3HL6A

Staphylococcus aureus pathogenicity island 3 orf9 protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
213
structure length
189
Chain Sequence
DIETIVNEFETRAGTLLRYYTGLLERSKVQPCCFKLYNDPFDMVYVMMNSKLFSHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKQLSISDMMASQLFEDEYFMYGLQTYQSSNTDVIANIEMLYQLATGINEPVPELVEGLKLVTEFVQDENATQEDYKALERKLNDLKASYYSLSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of a pathogenicity island protein from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Unknown function
molecule keywords Pathogenicity island protein
total genus 58
structure length 189
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16560 SAPI Putative mobile pathogenicity island
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.700 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3hl6A02
3.30.1300.50 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3hl6A01
3HL6A
chains in the Genus database with same CATH superfamily
2JQKA 3UA0A 2E9XC 1SA0E 4MQ6A 3Q5EA 4ZI7E 3OYXA 3NVOA 3CQCB 1B7TA 4HFIA 2A53A 5FVLA 4TNWA 4EZHA 3QTTA 4PJLA 3O1HA 3KV9A 5HEJA 4DO0A 4QXBB 2XSAA 4JBWF 4G5YA 4WBNE 1KEYA 3AEDA 3RKGA 3HR0A 2Q9QA 3VR9A 3RIAA 3N9QA 3RKOA 4DDKA 3AEAA 3HKEE 3CPZA 4U31A 5JRCB 3AE4A 2VURA 2BKOA 1ZHCA 2BBHA 2VL8A 4H9QC 2NW9A 3KVAA 4ILUA 2W4XA 5AFUL 3OPCA 5JH7E 4PK6A 2V8SV 2GR8A 3FZLB 2E2AA 5LG3A 4HFHA 4O4JE 2UUCT 2E9XB 2VK9A 4DV6T 2XZEA 5LXTE 4YHHT 4LF4T 2XPKA 4AQGA 2QVAA 2Y8DA 1I94T 2BVLA 2DNXA 2F4VT 3V5UA 5CB4E 2EHOC 1BR2A 3ZT6A 2RP4A 3FXDB 1N2HA 3AAEB 5HYAA 4I4TE 4BA9A 4LMJA 1ZOYA 3MACA 4JI6T 4AIUA 3FZMB 1G8XA 3GN5A 3CQGB 5ABHA 4GIWA 4DV4T 5AQVB 4QXHB 2H7OA 3C51A 3Q12A 4GOUA 1JNZA 2WAUA 2HH7A 3DTOA 3RGLA 5LHIB 5KMGP 4PK4A 4HE8A 1FMVA 3ZN1B 5AQMB 1EZ3A 2E5VA 4LF8T 3RX6A 3ZMZB 4AQFA 5CJ5A 2JQ9A 3P4PA 4PAGA 2WWVA 4QXCB 2OV9A 1N34T 5ABEA 4CZZB 2XASB 3RI5A 2EHOA 2WBLA 4QH4A 1HTJF 2CE7A 2P9BA 3UK2A 3RC3A 2FJBA 2I6HA 2LE8A 4KUMB 2C0SA 4X64T 3N9LA 3RYCE 1GQEA 1D1BA 3COVA 2D2SA 4TWHA 3VHLA 2YU1A 5ABGA 5AQTB 2WDVA 5LGUB 2G16A 1HNWT 2YU2A 2NW7A 2A56A 4IDOA 2EJCA 2NOXA 5LJMA 2VKOA 2KZ7B 2WB5A 4ADZA 3RC8A 1MNEA 5FY7A 2JIWA 2RA1A 2X68A 2HN1A 1CHUA 3AA1B 4HWDA 4TN7B 1BR0A 2DWKA 5J2UE 5FXWA 4L9IA 2CWOA 2ODUA 4IHJE 2CRBA 2FJEA 1NEKA 1UUSA 2W66A 1IJ5A 3ZMSB 4BJNA 3IVGA 4O4IE 2BG9A 1NAFA 2LT3A 1M62A 3PJAA 2JPFA 4KP3C 5AQKB 3KV5A 2VKJA 4YHJA 2E9XD 5HXRA 3MXZA 3OKQA 3F31A 4O4LE 5AQFB 1HF8A 4IT4A 5GONE 2MOZA 4WBOA 2C5IT 2LLYA 2PFVA 4YY3T 3CFFL 4ZXLA 3UT5E 5C2TA 3JAFA 1XWMA 2C5KT 4HWFA 4Z91A 4TX5A 3QB5K 4UXNB 4FZJA 1VRBA 3INNA 1MMGA 4U2YA 2HPLA 2A72A 2JRKA 1N2GA 2BZBA 2I59A 4AKRB 4YTPA 3CMLA 3I1AA 4DV1T 4TV8E 3AAAB 1MMNA 3TLUA 5LBQB 2YK0A 4PJJA 4I55E 3C64A 3ZEFB 3AAIA 3RYFE 2XQAA 1E7PA 5L3DB 2H7VC 4BHRA 3AA7B 3UUMA 2RETA 4YJ2E 3BK9A 3LFMA 2LJLA 4AKHA 4PJNA 3AE9A 3E0ZA 3PU8A 3PUZF 2L9QA 4CN1A 4HFVA 1US7B 1QSDA 3A7MA 2UUAT 3BQLA 4EYYR 4XAXB 4X62T 2W2UA 2LSJA 1N32T 5L3FB 2G5ZA 2ZM6T 5LP6E 2LM9A 3CK6A 2A3DA 4X1IE 3I9WA 3ZSSA 5LG4A 3TKLB 3C4XA 4GYRA 1Y01A 1W0BA 1XNRT 3PE0A 3CFIA 2CXLA 3N9NA 4H9PC 4IE5A 3T1YT 4QHOA 5L47A 3N8HA 2BVMA 4DV2T 5LGNB 4DIDB 4OFZA 2QYWA 2ZM8A 1OEDC 3KBTA 4DMVA 2V6XA 1J5WA 1YD8G 3OBVE 2IECA 3UUBA 3AE8A 3NZPA 2MPKA 5JREA 2VQET 3Q5DA 5EZYE 1J1JA 4ANJA 4MBQA 2QA7A 2N2NA 3IMGA 5TAOA 2AXDS 5AQRB 5CA1E 2G3DA 4I50E 2KSRA 3IUBA 5IUXA 4ZS2A 1MMAA 4EAHA 4EV6A 5JR9A 4OYKA 4OK0A 4JUYA 4LF9T 3AG6A 1LVFA 3BQIA 4H9RC 4EF6A 3TLWA 2XAFB 3JAEA 4YSXA 1VOMA 4ZI2D 4JV5T 3RYHE 2UUBT 2MAWA 3SRZA 2IAKA 4EXTA 2UXCT 2JQQA 2WDQA 5J1GA 4IDQA 2KT9A 2PBIA 5JDQA 5IHYA 3H37A 4DR1T 2IIUA 5HAXA 4CXWA 1IHOA 2H88A 4C90A 2UXNB 3CIRA 4PFOA 2YDQA 4HWHA 2EHOB 3AEGA 2MYSA 3PDYA 3ZC1A 3IOEA 3IHRA 4EB6E 5G2FA 5LMUT 3EUHA 4YLHA 1OXZA 2DCFA 5F3JA 5FXXA 4CI2B 2OGFA 4N78D 1XMOT 2W62A 4AKIA 3QNUA 2PJQA 4M1PA 2I0MA 5AQQB 1YKHB 4CN4A 3IF8B 1U5PA 3IUEA 1HS7A 3T1HT 4ZI3C 3RQUA 4B3TT 1HCIA 2Y48B 4ZHQE 5LB7B 3RIUA 2J1DG 1FMWA 3PUYF 3UQ4A 1HX8A 2X3FA 3D0TA 3E22E 4UVAB 1KNPA 5HEHA 4IE4A 1IAPA 2Z6EA 2GR7A 1KFYA 4TUYE 4O8SA 3TLVA 3AE5A 4K0UA 3LBXB 4AXPA 2A54A 2PG8A 2XQ6A 3F57A 4JI5T 5LYJE 4P1NA 4ZZBA 2M6IA 2X0LB 1KF6A 3DP7A 2V7MA 2YDSA 3L39A 3AVSA 1N2EA 1YXRA 5JTGA 3KFWX 4DBRA 3L3PA 1YW0A 3PUGA 1ZV4X 5KDMC 3TLTA 4H63H 4HWIB 3B57A 5JQGE 3N2OA 2V7JA 3AXJA 2V1DB 3ZJ2A 4PK5A 2ACZA 5DJQC 3RIUC 5HXHA 4YFSA 3CX6B 1D1CA 2KWHA 2OA5A 2BKNA 1WLXA 3P8CD 4EFKA 2WZIA 4YJ3E 1XNQT 3V5SA 5JR9C 4X20E 1VCTA 2H89A 2M6BA 3AE3A 3N2KE 3UULA 3RIFA 5HXSA 3SOLA 2FJDA 4B3MT 2XSBA 3AE1A 1T7SA 5LNKA 4H9OC 4G63A 2WY2A 5HCMA 3OJAA 3UFEA 2A9UA 3QOFA 4P0BA 2A88A 3E08A 3SS1A 1Y64B 5AQUB 2NTYA 4DR3T 3DJBA 4CQIA 4A97A 5C8YE 2X9XA 4G5FA 4IDNA 2LSKA 4TNVA 1U4QA 1N2IA 5ETWA 3OYZA 4UVCB 2XAJB 2X51A 4U2ZA 3A5XA 4MFRA 2JMKA 4MUEA 2V7IA 3IODA 2Q9QB 5IYZE 4JI4T 4B6XA 3COYA 3HL6A 2XQ3A 5M4YA 5LGTB 4JEUB 5A1LA 3UU6A 2BG9E 4IGUA 4NPPA 4XBFB 2KWIB 4OYJA 1YKEB 4ZI2C 5FYMA 2VASA 4GK0E 5AQJB 1LRZA 1SUMB 4ILAA 3AEFA 5EK4A 4HFCA 2H3RA 3LK3B 4A5XA 2A86A 5AQLB 3JADA 2LHNA 4DUYT 4HFBA 5BR8T 3ZJ1A 4CXYA 2DL1A 2XQ5A 4O2AE 1HG2A 4WYVA 2LOPA 4JI3T 1MOPA 4EIWA 4A98A 4P0AA 5FP3A 3FB2A 3CX7B 2V7LA 4LMKA 4UR9A 2ZMAA 3FXEB 3ZT5A 4EGWA 3CKDA 2VVNA 3AA0B 3C50A 5L4HA 1IBLT 5HWYA 5AQOB 2LHRA 3PTRB 3AB3B 2GW4A 2WZHA 2CXDA 3L09A 3KVBA 3RH3A 4AQYT 3GMIA 1DU2A 3TLSA 3FBLA 3AG5A 1ZEEA 2ES0A 4JI7T 2W61A 2NWBA 4XZCA 4B3RT 1NENA 4NUUA 1BR4A 4X5TA 1V9DA 3K3OA 3VKHA 2CWYA 2V6YB 3I0OA 1CUNA 4GYSA 4JI2T 5J2TE 2BG9B 2JMHA 2WU5A 4KHZF 3ZMVB 4IE7A 3ZCIA 2CBIA 3FZKB 5F8PA 5EK2A 3ZYLA 1FEWA 3PUSA 1S35A 3QB5A 3N9MA 1BR1A 4U7IA 4ISTA 3EI0A 2W67A 3EABA 5ADXL 2CEAA 3ZYKA 3NRXA 5C3JA 4NIQA 2A84A 3LK42 2KNDA 4QX7B 3ETVA 2NTXA 2HN2A 2YINA 2M67A 2D5UA 5LOVE 2JJ9A 1N2BA 2E9XA 2WWUA 3NKZA 5LA6E 3OVUA 3P4SA 2XAQB 2CA5A 2HPJA 4KI0F 1X9BA 2XQ4A 3NZQA 3ZN0B 4O2BE 2W0GA 4JYAT 2BDEA 3PUWF 2KINB 2I52A 3AE7A 3HKDE 5HXCA 2E8IA 1FIOA 5IWAT 2CLYB 3ABVA 2CHOA 3KBUA 2L8KA 3C4WA 4PNIA 4ISSA 4G2AA 1NWMX 4WZXA 2LSYA 4LMLA 4HWCA 1OEDA 3ONXA 2CPTA 4JI8T 4DR7T 1KNRA 2K9AA 3AXJB 5HG0A 5HEUA 1N36T 1Z8UA 1WR0A 4IE0A 4DR2T 4WW0A 3R6NA 2X9YA 3JCFA 3UY4A 4HFDA 2BS3A 4AISA 5HCJA 4MALA 3Q5WA 4GK5E 3EDUA 1MIYA 4MUKA 2BBJA 2UU9T 4TWFA 3AVRA 4IE6A 2HHHT 2JQHA 3ZT7A 4YSZA 5JDMA 2B76A 2YOEA 2J4GA 2J47A 5J0ZA 3IVXA 4QKNA 5AQIB 4YXDA 2V5CA 5ABFB 2B1EA 4DV7T 2CLYC 2XAGB 3ANWB 2X0YA 2LKHA 3JC6C 3O1IA 1T8BA 2ZM0A 1MIVA 3K8PC 1HNZT 4KBMB 2XQ8A 3UUXB 4EEDA 3IMCA 3IVCA 5LCYA 4ILBA 4X1KE 3QK6A 3GWHA 1HX1B 3PUAA 3C98B 3O9XA 1N33T 1YQ4A 4C91A 1IBMT 3LDQB 5F5WA 3ONJA 1HFAA 3J7Yq 4UV8B 1HG5A 5AQGB 5HEGA 3VU7H 2A7XA 3ESLA 4FI5A 3ANWA 3LE8A 1WRDA 4LF7T 5H6QB 5CGMA 2CMRA 3VRBA 1XDPA 4NUVA 5FKYA 4ZEYA 4H63V 2X0HA 2BKPA 2A52A 4IDZA 5AQSB 5FMNA 4MULA 1XDOA 4PFPA 4DV0T 3LBXA 4MHCA 4A56A 3UTKA 4F8HA 3GN5B 2QRXA 3N9OA 1E2AA 4AKLA 2SPCA 2VVSA 3FZHB 2XJ7A 3ETUA 4HKAA 2WMOA 4NXMT 3ZMUB 4FJOA 3MJXA 4ZZCA 2LOSA 1H7CA 1D1AA 4KMCA 2GK9A 5LBMA 4KX6A 3CVRA 4QH1A 3ISJA 2WM9A 3K1SA 2IC6A 3VRAA 4DNDA 2WU2A 4IL9A 1V8FA 1QLBA 3UUNA 4DMWA 4X66T 3PU3A 2CHNA 3N2GE 1LVKA 4EYUA 2XM2A 5FL1A 2X66A 1XMQT 4H9SE 2K24A 4DR5T 2IC9A 2DWGA 2W00A 3ZPOA 1LKXA 4DUZT 1Z0PA 3S4UA 1SE7A 2LMEA 2LKGA 4LF5T 3PUXF 3AECA 4L5GA 2N1GA 2IMLA 1XZYA 3SFEA 2VB6A 3LF4A 1JNRA 4COFA 3MZKB 3RRWA 5BW0B 2X67A 3COWA 2XY8B 2ZM2A 2ODVA 2D9DA 4ZOLE 5HXEA 2RPAA 3LSVA 4LFBT 4DV3T 3AE2A 5AQNB 2MTQA 2DHRA 1UCUA 3IEEA 4O4HE 1YQ3A 3KDSE 3ONLC 4TV9E 3ZSTA 3EAMA 3Q5XA 3ZKRA 4I43B 4DVDA 4GKJT 3ZLIA 2V26A 2XHEB 3N5LA 2NW8A 3UU3A 5H6RB 3IBPA 2WQYA 3CI0K 1G73A 1N2OA 3LK2B 2XAHB 4U7YA 4P09A 3WAKA 2NP9A 4KHPT 4V1Av 1L0VA 3COZA 4ILCA 1UX4A 2ZLYA 3MKDA 3CFHL 5FXZA 5L4EA 5JDHA 3P4WA 4HTEA 5LHHB 4X1YE 5DQVA 2MBGA 3EHZA 3HKBE 5ABFA 4YTNA 2A50A 3I0QA 4U74A 3PJAJ 3RQWA 2CBJA 3KV6A 3JC6D 3BQKA 4U3CA 1UGOA 3CWZB 5JVDE 3KV4A 1IJ6A 1OEDB 1KK7A 3RLFF 2WS3A 3C4ZA 1HR0T 3W15B 3UU4A 2DLRA 3UQ7A 2BS2A 4AKGA 3ZYMA 1VCSA 2YEVC 2VQFT 3ZMTB 2W63A 2VL0A 4MLKA 2LSIA 4UF0A 2AE9A 4AQFC 2X9HA 3R84B 4U33A 3LJCA 3UU8A 5L3BB 3WAJA 2VKDA 4DDHA 3UU5A 4ASKA 2KLQA 1KNZA 3T8OA 4I0UA 4J2CA 2V6YA 3I9YA 3PV0F 3FBZA 4EEBA 2EHOD 3MA9A 4ZI3D 2ACXA 2QGSA 2CXFA 1SHZC 3H3MA 4Z8XA 4HGAA 4AI6A 2IUBA 4MUHA 3P7IA 1ZKEA 4GKKT 3NWIA 4YTMA 1UURA 2FBWA 3WI3A 5FNVE 3J9X1 4JI1T 3PURA 4DDMA 3O1JA 2CM0A 4HN9A 5CA0E 2LRLA 2YDRA 1QUUA 4QWNB 3CQXC 4DBQA 4E7ZA 2LEHA 4TWDA 3EMOA 4ZS3A 4OX9T 2VKHA 4DV5T 5KX5E 4BJMA 1UK5A 3Q10A 2Y6XA 5JDFA 2FUPA 3HI2A 4WNKA 2D0TA 3B5MA 2BG9C 3B13A 5L2LA 3ZCJA 1W0AA 2D0UA 3P4QA 5DABA 2IDOB 3Q2MA 4UELA 1UX5A 3G06A 3QC9A 4Z90A 2K48A 2OLTA 4UIGA 2PTFA 1AJ3A 2C5JA 2WMNA 4E7SA 5LJNA 1WFDA 3ZC0A 4PJMA 1WCRA 2VWAA 3VR8A 2A2FX 5CFBA 1HNXT 3RPUA 3MUEA 3LG7A 2IW5B 2UXDT 1J5ET 4YT0A 2IHR1 1T98A 3NBXX 1IBKT 2XTLA 3KINB 2L3LA 5E0OA 4OHFA 2WDRA 2LRKA 4F6RC 4LFCT 3IOCA 1R8IA 1D0ZA 2Q9QD 2X9WA 4X65T 5L3GB 3RYIE 1D0YA 1O3XA 3VKGA 5KWVA 3GA8A 2V5DA 3MK7C 3AEBA 4H9NC 2KXPB 2V7KA 4IIJE 5JDGA 4MUGA 3SWHA 1ZP0A 5JDLA 5KXJA 2FJAA 2UXBT 3CFAL 4LFAT 4BAYB 4CI3B 2XQ7A 3M65A 1N2JA 3CX8B 3IA3A 3NRYA 1UFVA 3RRCA 1OEDE 2WCAA 3IMEA 2E5LT 4ERRA 4DR6T 1D0XA 1T72A 4JLEA 4B3ST 5JR9B 2R6GF 5AQHB 2G0UA 4UF0B 4HEAA 4U72A 1IZNB 3SFDA 4HFEA 4UEMA 3L8RA 1E1HB 2YN6A 2K5BB 2UXXB 4TZ4C 4IREA 5AQPB 3F2EA 1FJGT 3CI0I 4UVBB 5EK3A 3X1DA 3U3IA 2LSGA 1X79A 3HA4A 3AE6A 4K0KT 2XQ9A 4JEHB 5L3EB 4YSYA 2KMFA 3PUQA 2J62A 5L3CB 1MMDA 4CXXA 5JDNA 4L0RA 1I6ZA 3MXTA 1W9RA 4QH5A 4Q25A 1WYBA 5FVKA 3EVYA 5HWXA 4MUIA 3K3QC 2LM2A 2WSSV 1MNDA 4IDPA 5JRCA 5FY1A 2Q9QC 1W09A 3M3ZB 2YKSA 3QUJA 3U78A 1M7KA 5EXCA 1OWAA 3EDVA 2XM1A 1WYCA 4CI1B 2XUEA 4MUNA 3K3NA 3IOBA 5LHGB 5LMNT 4LF6T 4DR4T 2BS4A 2DI4A 4CN6A 3OTOT 5DQWA 3P50A 3UFGA 2XQYA 4MUJA 4IXJA 3FHNA 3RF1A 3H3AA 4JI0T 2NR4A 4QX8B 3AEEA 3FZFB 4IL4A 2G2SA 2N9DA 5BMVE 3PUVF 1WR6A 4EOZB 5FY0A 2CCQA 5FL0A 4NXNT 2WP9A 4MUFA 4DE5A 5HEOA 3O4XE 3P4RA 3Q9DA 4EZ4A 1S94A 4PW8A 3N9PA 5FXVA 2K3WA 3HKCE 3RHWA 1MIWA 3AA6B 4UV9B 3A8YC
chains in the Genus database with same CATH topology
4XZCA 3KBTA 1UX4A 2ZLYA 3MKDA 3CFHL 3UA0A 5FXZA 4DMVA 5JDHA 4NUUA 1BR4A 2E9XC 4HTEA 5LHHB 1YD8G 3OBVE 4X1YE 5DQVA 2MBGA 3NZPA 1V9DA 3K3OA 5JREA 5EZYE 3VKHA 1SA0E 3HKBE 4MQ6A 4ANJA 2CWYA 4MBQA 4ZI7E 3OYXA 2QA7A 3I0OA 1CUNA 4GYSA 2N2NA 3CQCB 3IMGA 5J2TE 2JMHA 2A50A 1B7TA 5TAOA 3ZMVB 4IE7A 3I0QA 2A53A 4U74A 5CA1E 4EZHA 3QTTA 2G3DA 4PJLA 3O1HA 3ZCIA 3KV9A 3KV6A 4I50E 3JC6D 5F8PA 3BQKA 3IUBA 4DO0A 4ZS2A 1MMAA 4EAHA 5EK2A 3ZYLA 1FEWA 3CWZB 3PUSA 4QXBB 5JVDE 1S35A 4OYKA 5JR9A 3N9MA 4OK0A 1BR1A 3KV4A 4JUYA 1IJ6A 4G5YA 4ISTA 3AG6A 1LVFA 1KK7A 5ADXL 2CEAA 3BQIA 4H9RC 4EF6A 3C4ZA 3ZYKA 3NRXA 2XAFB 4WBNE 3W15B 1VOMA 2DLRA 4AKGA 4ZI2D 3HR0A 2Q9QA 3RYHE 2A84A 3ZYMA 3SRZA 2IAKA 3LK42 2KNDA 4EXTA 2YEVC 3N9QA 4QX7B 3ETVA 3ZMTB 3RKOA 2NTXA 2JQQA 2W63A 4DDKA 2YINA 2M67A 2D5UA 3HKEE 4MLKA 5LOVE 2JJ9A 1N2BA 2E9XA 2WWUA 2LSIA 3CPZA 5J1GA 4UF0A 5LA6E 5JRCB 2KT9A 4AQFC 2PBIA 2X9HA 3R84B 5JDQA 2XAQB 1ZHCA 2CA5A 2HPJA 2VL8A 4H9QC 3NZQA 2NW9A 5IHYA 3H37A 3LJCA 3KVAA 4ILUA 5L3BB 3WAJA 5AFUL 3ZN0B 2VKDA 5HAXA 4O2BE 4CXWA 4DDHA 1IHOA 2W0GA 5JH7E 4ASKA 4PK6A 4C90A 2BDEA 2UXNB 4PFOA 2KLQA 2KINB 4O4JE 1KNZA 2EHOB 3HKDE 2E9XB 3T8OA 2MYSA 5HXCA 3PDYA 2E8IA 1FIOA 2VK9A 4J2CA 3ZC1A 3IOEA 3IHRA 4EB6E 5G2FA 2CLYB 3I9YA 5LXTE 3KBUA 2L8KA 3C4WA 3EUHA 3FBZA 4YLHA 4PNIA 4AQGA 1OXZA 2EHOD 2Y8DA 4ISSA 2DCFA 3MA9A 5F3JA 4G2AA 1NWMX 2ACXA 2BVLA 2DNXA 2QGSA 4ZI3D 3V5UA 2LSYA 5CB4E 2EHOC 1BR2A 3ONXA 2CXFA 1SHZC 5FXXA 4CI2B 4Z8XA 4HGAA 2K9AA 4AI6A 2RP4A 4N78D 4MUHA 3P7IA 5HG0A 1ZKEA 3FXDB 4IE0A 1N2HA 3AAEB 2W62A 4WW0A 3R6NA 2X9YA 4I4TE 5HYAA 4BA9A 4AKIA 3UY4A 3WI3A 5FNVE 2PJQA 3J9X1 4M1PA 3MACA 4MALA 1YKHB 3Q5WA 3IF8B 1U5PA 1G8XA 3PURA 3EDUA 4GK5E 1MIYA 3IUEA 3GN5A 4DDMA 1HS7A 3CQGB 3N8HA 4MUKA 3O1JA 4GIWA 2CM0A 4HN9A 5CA0E 4ZI3C 4QXHB 2H7OA 3AVRA 4IE6A 1QUUA 4QWNB 3C51A 3CQXC 3Q12A 1HCIA 4GOUA 4DBQA 2WAUA 2Y48B 4E7ZA 2LEHA 2HH7A 3DTOA 5JDMA 5LHIB 4ZS3A 4ZHQE 5KMGP 4PK4A 4HE8A 2VKHA 1FMVA 2J1DG 3ZN1B 1FMWA 5KX5E 4BJMA 3Q10A 2Y6XA 5JDFA 1EZ3A 1HX8A 2X3FA 3D0TA 3E22E 3HI2A 4UVAB 4WNKA 2D0TA 4IE4A 3IVXA 3RX6A 3ZMZB 4AQFA 1IAPA 4QKNA 2Z6EA 4PAGA 4QXCB 4TUYE 3B13A 5L2LA 4O8SA 3ZCJA 4CZZB 2B1EA 4K0UA 3LBXB 4AXPA 2XASB 2A54A 2PG8A 2D0UA 5DABA 2EHOA 3F57A 2CLYC 2WBLA 2XAGB 3ANWB 1HTJF 2CE7A 3JC6C 3O1IA 3Q2MA 5LYJE 4UELA 2P9BA 2X0LB 2ZM0A 3DP7A 1MIVA 1UX5A 3QC9A 3K8PC 2K48A 2V7MA 4UIGA 1AJ3A 4KBMB 3AVSA 2C5JA 1N2EA 2WMNA 4E7SA 5LJNA 3UUXB 3UK2A 3RC3A 3KFWX 2LE8A 4DBRA 3L3PA 1YW0A 4KUMB 3ZC0A 4PJMA 2C0SA 2VWAA 3IMCA 3PUGA 1ZV4X 2A2FX 5KDMC 3N9LA 4H63H 3B57A 5JQGE 3IVCA 3RYCE 3N2OA 1D1BA 2V7JA 5LCYA 3RPUA 4X1KE 3COVA 2V1DB 3MUEA 2D2SA 3QK6A 3LG7A 2IW5B 3GWHA 3ZJ2A 3VHLA 4PK5A 2YU1A 1T98A 3NBXX 3PUAA 3C98B 3O9XA 5DJQC 2XTLA 5LGUB 2G16A 2YU2A 5HXHA 4YFSA 4C91A 3KINB 3CX6B 2NW7A 2L3LA 5E0OA 3J7Yq 1HFAA 4OHFA 1D1CA 2KWHA 4UV8B 2OA5A 1HG5A 2A56A 2EJCA 4F6RC 2NOXA 3VU7H 3IOCA 5LJMA 2VKOA 1D0ZA 2Q9QD 2X9WA 2A7XA 2KZ7B 5L3GB 4ADZA 3RC8A 3ESLA 1WLXA 3P8CD 1MNEA 4EFKA 4FI5A 2NWBA 3RYIE 3ANWA 4YJ3E 3LE8A 5FY7A 1D0YA 1WRDA 2RA1A 3V5SA 5H6QB 5JR9C 2CMRA 4X20E 1O3XA 2X68A 3VKGA 5KWVA 3GA8A 4NUVA 3N2KE 3UULA 3MK7C 5HXSA 3AA1B 4H63V 4H9NC 2KXPB 4TN7B 3SOLA 1BR0A 2A52A 2DWKA 4IDZA 2V7KA 5J2UE 4IIJE 5JDGA 4MUGA 5FXWA 3SWHA 5JDLA 4L9IA 2CWOA 5LNKA 2ODUA 4IHJE 5FMNA 4MULA 3CFAL 4BAYB 4H9OC 4CI3B 1IJ5A 3ZMSB 4BJNA 4G63A 4PFPA 3IVGA 4O4IE 3M65A 1N2JA 3OJAA 3UFEA 1NAFA 3CX8B 2LT3A 3NRYA 1UFVA 3RRCA 3LBXA 4MHCA 4A56A 4P0BA 3UTKA 2A88A 3GN5B 2JPFA 3E08A 3SS1A 1Y64B 4KP3C 3IMEA 3KV5A 2VKJA 3N9OA 4YHJA 2E9XD 4ERRA 4AKLA 2NTYA 5HXRA 2SPCA 3DJBA 1D0XA 3MXZA 3OKQA 4CQIA 3F31A 3ETUA 5C8YE 2X9XA 4O4LE 4JLEA 5JR9B 2G0UA 4HKAA 4G5FA 4UF0B 1HF8A 5GONE 4HEAA 4U72A 1IZNB 2WMOA 3ZMUB 2LSKA 2MOZA 1U4QA 4FJOA 1N2IA 5ETWA 3OYZA 4UEMA 4UVCB 4WBOA 2XAJB 2X51A 1E1HB 2C5IT 3MJXA 2PFVA 2K5BB 2UXXB 3A5XA 4MFRA 2JMKA 2LOSA 4TZ4C 2V7IA 3CFFL 4MUEA 3F2EA 3IODA 2Q9QB 5IYZE 1H7CA 4UVBB 3UT5E 1D1AA 4KMCA 4B6XA 3COYA 5EK3A 2GK9A 5LBMA 3HA4A 2LSGA 1X79A 3U3IA 3CVRA 3HL6A 3ISJA 2C5KT 5M4YA 4JEHB 5LGTB 4JEUB 5A1LA 2WM9A 5L3EB 4TX5A 2IC6A 2KMFA 3PUQA 4UXNB 4DNDA 5L3CB 4IGUA 1MMDA 4FZJA 1VRBA 4XBFB 2KWIB 4OYJA 4CXXA 1V8FA 3INNA 3UUNA 5JDNA 1YKEB 4L0RA 1MMGA 4DMWA 4ZI2C 3MXTA 5FYMA 2VASA 3PU3A 2HPLA 2A72A 2JRKA 1N2GA 2BZBA 2I59A 1WYBA 4GK0E 4AKRB 3EVYA 3N2GE 5HWXA 1LVKA 3CMLA 4EYUA 4MUIA 3I1AA 3K3QC 4TV8E 2X66A 1LRZA 3AAAB 2WSSV 4H9SE 1MNDA 2K24A 5JRCA 5FY1A 1MMNA 5EK4A 2H3RA 5LBQB 3LK3B 2Q9QC 2YK0A 2A86A 4PJJA 2IC9A 2DWGA 2W00A 4I55E 3C64A 3ZPOA 1LKXA 3ZEFB 2LHNA 3QUJA 3AAIA 3RYFE 1Z0PA 3U78A 5EXCA 5L3DB 2H7VC 1OWAA 3EDVA 3S4UA 3ZJ1A 4BHRA 3AA7B 4CXYA 3UUMA 1WYCA 4CI1B 4YJ2E 3BK9A 2XUEA 3LFMA 3K3NA 4O2AE 4MUNA 2LJLA 1HG2A 3IOBA 4AKHA 5LHGB 2LOPA 4PJNA 2DI4A 3E0ZA 3PU8A 5DQWA 2L9QA 2XQYA 1MOPA 4L5GA 4MUJA 2N1GA 4HFVA 1US7B 4EIWA 4IXJA 1QSDA 3FHNA 2VB6A 4P0AA 3LF4A 3H3AA 3BQLA 5FP3A 3FB2A 3MZKB 4QX8B 3RRWA 4EYYR 3CX7B 2V7LA 2N9DA 2X67A 2ZM2A 2ODVA 2G2SA 3COWA 5BMVE 2ZMAA 3FXEB 4XAXB 4ZOLE 1WR6A 4EOZB 5HXEA 5FY0A 2LSJA 2CCQA 3CKDA 5L3FB 2G5ZA 5LP6E 2LM9A 2A3DA 3AA0B 3C50A 2MTQA 2DHRA 1UCUA 4X1IE 4MUFA 4DE5A 3IEEA 4O4HE 3O4XE 3I9WA 5HWYA 3KDSE 4TV9E 2LHRA 3PTRB 3Q9DA 3Q5XA 5LG4A 3TKLB 3C4XA 4GYRA 4I43B 3AB3B 2GW4A 4DVDA 4EZ4A 3ZLIA 2CXDA 3L09A 3KVBA 3PE0A 1S94A 3RH3A 3GMIA 4PW8A 2CXLA 2V26A 2XHEB 3N5LA 3N9NA 3N9PA 2NW8A 5FXVA 5H6RB 3IBPA 4H9PC 4IE5A 3FBLA 1G73A 4QHOA 3AG5A 1N2OA 3HKCE 1ZEEA 2BVMA 2ES0A 3LK2B 5LGNB 4OFZA 2XAHB 1MIWA 3AA6B 4P09A 4UV9B 2NP9A 3WAKA 2W61A 4V1Av 3COZA 2ZM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HL6 A; 
#chains in the Genus database with same CATH topology
 2JQK A;  3UA0 A;  2E9X C;  1SA0 E;  4MQ6 A;  3Q5E A;  4ZI7 E;  3OYX A;  3NVO A;  3CQC B;  1B7T A;  4HFI A;  2A53 A;  5FVL A;  4TNW A;  4EZH A;  3QTT A;  4PJL A;  3O1H A;  3KV9 A;  5HEJ A;  4DO0 A;  4QXB B;  2XSA A;  4JBW F;  4G5Y A;  4WBN E;  1KEY A;  3AED A;  3RKG A;  3HR0 A;  2Q9Q A;  3VR9 A;  3RIA A;  3N9Q A;  3RKO A;  4DDK A;  3AEA A;  3HKE E;  3CPZ A;  4U31 A;  5JRC B;  3AE4 A;  2VUR A;  2BKO A;  1ZHC A;  2BBH A;  2VL8 A;  4H9Q C;  2NW9 A;  3KVA A;  4ILU A;  2W4X A;  5AFU L;  3OPC A;  5JH7 E;  4PK6 A;  2V8S V;  2GR8 A;  3FZL B;  2E2A A;  5LG3 A;  4HFH A;  4O4J E;  2UUC T;  2E9X B;  2VK9 A;  4DV6 T;  2XZE A;  5LXT E;  4YHH T;  4LF4 T;  2XPK A;  4AQG A;  2QVA A;  2Y8D A;  1I94 T;  2BVL A;  2DNX A;  2F4V T;  3V5U A;  5CB4 E;  2EHO C;  1BR2 A;  3ZT6 A;  2RP4 A;  3FXD B;  1N2H A;  3AAE B;  5HYA A;  4I4T E;  4BA9 A;  4LMJ A;  1ZOY A;  3MAC A;  4JI6 T;  4AIU A;  3FZM B;  1G8X A;  3GN5 A;  3CQG B;  5ABH A;  4GIW A;  4DV4 T;  5AQV B;  4QXH B;  2H7O A;  3C51 A;  3Q12 A;  4GOU A;  1JNZ A;  2WAU A;  2HH7 A;  3DTO A;  3RGL A;  5LHI B;  5KMG P;  4PK4 A;  4HE8 A;  1FMV A;  3ZN1 B;  5AQM B;  1EZ3 A;  2E5V A;  4LF8 T;  3RX6 A;  3ZMZ B;  4AQF A;  5CJ5 A;  2JQ9 A;  3P4P A;  4PAG A;  2WWV A;  4QXC B;  2OV9 A;  1N34 T;  5ABE A;  4CZZ B;  2XAS B;  3RI5 A;  2EHO A;  2WBL A;  4QH4 A;  1HTJ F;  2CE7 A;  2P9B A;  3UK2 A;  3RC3 A;  2FJB A;  2I6H A;  2LE8 A;  4KUM B;  2C0S A;  4X64 T;  3N9L A;  3RYC E;  1GQE A;  1D1B A;  3COV A;  2D2S A;  4TWH A;  3VHL A;  2YU1 A;  5ABG A;  5AQT B;  2WDV A;  5LGU B;  2G16 A;  1HNW T;  2YU2 A;  2NW7 A;  2A56 A;  4IDO A;  2EJC A;  2NOX A;  5LJM A;  2VKO A;  2KZ7 B;  2WB5 A;  4ADZ A;  3RC8 A;  1MNE A;  5FY7 A;  2JIW A;  2RA1 A;  2X68 A;  2HN1 A;  1CHU A;  3AA1 B;  4HWD A;  4TN7 B;  1BR0 A;  2DWK A;  5J2U E;  5FXW A;  4L9I A;  2CWO A;  2ODU A;  4IHJ E;  2CRB A;  2FJE A;  1NEK A;  1UUS A;  2W66 A;  1IJ5 A;  3ZMS B;  4BJN A;  3IVG A;  4O4I E;  2BG9 A;  1NAF A;  2LT3 A;  1M62 A;  3PJA A;  2JPF A;  4KP3 C;  5AQK B;  3KV5 A;  2VKJ A;  4YHJ A;  2E9X D;  5HXR A;  3MXZ A;  3OKQ A;  3F31 A;  4O4L E;  5AQF B;  1HF8 A;  4IT4 A;  5GON E;  2MOZ A;  4WBO A;  2C5I T;  2LLY A;  2PFV A;  4YY3 T;  3CFF L;  4ZXL A;  3UT5 E;  5C2T A;  3JAF A;  1XWM A;  2C5K T;  4HWF A;  4Z91 A;  4TX5 A;  3QB5 K;  4UXN B;  4FZJ A;  1VRB A;  3INN A;  1MMG A;  4U2Y A;  2HPL A;  2A72 A;  2JRK A;  1N2G A;  2BZB A;  2I59 A;  4AKR B;  4YTP A;  3CML A;  3I1A A;  4DV1 T;  4TV8 E;  3AAA B;  1MMN A;  3TLU A;  5LBQ B;  2YK0 A;  4PJJ A;  4I55 E;  3C64 A;  3ZEF B;  3AAI A;  3RYF E;  2XQA A;  1E7P A;  5L3D B;  2H7V C;  4BHR A;  3AA7 B;  3UUM A;  2RET A;  4YJ2 E;  3BK9 A;  3LFM A;  2LJL A;  4AKH A;  4PJN A;  3AE9 A;  3E0Z A;  3PU8 A;  3PUZ F;  2L9Q A;  4CN1 A;  4HFV A;  1US7 B;  1QSD A;  3A7M A;  2UUA T;  3BQL A;  4EYY R;  4XAX B;  4X62 T;  2W2U A;  2LSJ A;  1N32 T;  5L3F B;  2G5Z A;  2ZM6 T;  5LP6 E;  2LM9 A;  3CK6 A;  2A3D A;  4X1I E;  3I9W A;  3ZSS A;  5LG4 A;  3TKL B;  3C4X A;  4GYR A;  1Y01 A;  1W0B A;  1XNR T;  3PE0 A;  3CFI A;  2CXL A;  3N9N A;  4H9P C;  4IE5 A;  3T1Y T;  4QHO A;  5L47 A;  3N8H A;  2BVM A;  4DV2 T;  5LGN B;  4DID B;  4OFZ A;  2QYW A;  2ZM8 A;  1OED C;  3KBT A;  4DMV A;  2V6X A;  1J5W A;  1YD8 G;  3OBV E;  2IEC A;  3UUB A;  3AE8 A;  3NZP A;  2MPK A;  5JRE A;  2VQE T;  3Q5D A;  5EZY E;  1J1J A;  4ANJ A;  4MBQ A;  2QA7 A;  2N2N A;  3IMG A;  5TAO A;  2AXD S;  5AQR B;  5CA1 E;  2G3D A;  4I50 E;  2KSR A;  3IUB A;  5IUX A;  4ZS2 A;  1MMA A;  4EAH A;  4EV6 A;  5JR9 A;  4OYK A;  4OK0 A;  4JUY A;  4LF9 T;  3AG6 A;  1LVF A;  3BQI A;  4H9R C;  4EF6 A;  3TLW A;  2XAF B;  3JAE A;  4YSX A;  1VOM A;  4ZI2 D;  4JV5 T;  3RYH E;  2UUB T;  2MAW A;  3SRZ A;  2IAK A;  4EXT A;  2UXC T;  2JQQ A;  2WDQ A;  5J1G A;  4IDQ A;  2KT9 A;  2PBI A;  5JDQ A;  5IHY A;  3H37 A;  4DR1 T;  2IIU A;  5HAX A;  4CXW A;  1IHO A;  2H88 A;  4C90 A;  2UXN B;  3CIR A;  4PFO A;  2YDQ A;  4HWH A;  2EHO B;  3AEG A;  2MYS A;  3PDY A;  3ZC1 A;  3IOE A;  3IHR A;  4EB6 E;  5G2F A;  5LMU T;  3EUH A;  4YLH A;  1OXZ A;  2DCF A;  5F3J A;  5FXX A;  4CI2 B;  2OGF A;  4N78 D;  1XMO T;  2W62 A;  4AKI A;  3QNU A;  2PJQ A;  4M1P A;  2I0M A;  5AQQ B;  1YKH B;  4CN4 A;  3IF8 B;  1U5P A;  3IUE A;  1HS7 A;  3T1H T;  4ZI3 C;  3RQU A;  4B3T T;  1HCI A;  2Y48 B;  4ZHQ E;  5LB7 B;  3RIU A;  2J1D G;  1FMW A;  3PUY F;  3UQ4 A;  1HX8 A;  2X3F A;  3D0T A;  3E22 E;  4UVA B;  1KNP A;  5HEH A;  4IE4 A;  1IAP A;  2Z6E A;  2GR7 A;  1KFY A;  4TUY E;  4O8S A;  3TLV A;  3AE5 A;  4K0U A;  3LBX B;  4AXP A;  2A54 A;  2PG8 A;  2XQ6 A;  3F57 A;  4JI5 T;  5LYJ E;  4P1N A;  4ZZB A;  2M6I A;  2X0L B;  1KF6 A;  3DP7 A;  2V7M A;  2YDS A;  3L39 A;  3AVS A;  1N2E A;  1YXR A;  5JTG A;  3KFW X;  4DBR A;  3L3P A;  1YW0 A;  3PUG A;  1ZV4 X;  5KDM C;  3TLT A;  4H63 H;  4HWI B;  3B57 A;  5JQG E;  3N2O A;  2V7J A;  3AXJ A;  2V1D B;  3ZJ2 A;  4PK5 A;  2ACZ A;  5DJQ C;  3RIU C;  5HXH A;  4YFS A;  3CX6 B;  1D1C A;  2KWH A;  2OA5 A;  2BKN A;  1WLX A;  3P8C D;  4EFK A;  2WZI A;  4YJ3 E;  1XNQ T;  3V5S A;  5JR9 C;  4X20 E;  1VCT A;  2H89 A;  2M6B A;  3AE3 A;  3N2K E;  3UUL A;  3RIF A;  5HXS A;  3SOL A;  2FJD A;  4B3M T;  2XSB A;  3AE1 A;  1T7S A;  5LNK A;  4H9O C;  4G63 A;  2WY2 A;  5HCM A;  3OJA A;  3UFE A;  2A9U A;  3QOF A;  4P0B A;  2A88 A;  3E08 A;  3SS1 A;  1Y64 B;  5AQU B;  2NTY A;  4DR3 T;  3DJB A;  4CQI A;  4A97 A;  5C8Y E;  2X9X A;  4G5F A;  4IDN A;  2LSK A;  4TNV A;  1U4Q A;  1N2I A;  5ETW A;  3OYZ A;  4UVC B;  2XAJ B;  2X51 A;  4U2Z A;  3A5X A;  4MFR A;  2JMK A;  4MUE A;  2V7I A;  3IOD A;  2Q9Q B;  5IYZ E;  4JI4 T;  4B6X A;  3COY A;  3HL6 A;  2XQ3 A;  5M4Y A;  5LGT B;  4JEU B;  5A1L A;  3UU6 A;  2BG9 E;  4IGU A;  4NPP A;  4XBF B;  2KWI B;  4OYJ A;  1YKE B;  4ZI2 C;  5FYM A;  2VAS A;  4GK0 E;  5AQJ B;  1LRZ A;  1SUM B;  4ILA A;  3AEF A;  5EK4 A;  4HFC A;  2H3R A;  3LK3 B;  4A5X A;  2A86 A;  5AQL B;  3JAD A;  2LHN A;  4DUY T;  4HFB A;  5BR8 T;  3ZJ1 A;  4CXY A;  2DL1 A;  2XQ5 A;  4O2A E;  1HG2 A;  4WYV A;  2LOP A;  4JI3 T;  1MOP A;  4EIW A;  4A98 A;  4P0A A;  5FP3 A;  3FB2 A;  3CX7 B;  2V7L A;  4LMK A;  4UR9 A;  2ZMA A;  3FXE B;  3ZT5 A;  4EGW A;  3CKD A;  2VVN A;  3AA0 B;  3C50 A;  5L4H A;  1IBL T;  5HWY A;  5AQO B;  2LHR A;  3PTR B;  3AB3 B;  2GW4 A;  2WZH A;  2CXD A;  3L09 A;  3KVB A;  3RH3 A;  4AQY T;  3GMI A;  1DU2 A;  3TLS A;  3FBL A;  3AG5 A;  1ZEE A;  2ES0 A;  4JI7 T;  2W61 A;  2NWB A;  4XZC A;  4B3R T;  1NEN A;  4NUU A;  1BR4 A;  4X5T A;  1V9D A;  3K3O A;  3VKH A;  2CWY A;  2V6Y B;  3I0O A;  1CUN A;  4GYS A;  4JI2 T;  5J2T E;  2BG9 B;  2JMH A;  2WU5 A;  4KHZ F;  3ZMV B;  4IE7 A;  3ZCI A;  2CBI A;  3FZK B;  5F8P A;  5EK2 A;  3ZYL A;  1FEW A;  3PUS A;  1S35 A;  3QB5 A;  3N9M A;  1BR1 A;  4U7I A;  4IST A;  3EI0 A;  2W67 A;  3EAB A;  5ADX L;  2CEA A;  3ZYK A;  3NRX A;  5C3J A;  4NIQ A;  2A84 A;  3LK4 2;  2KND A;  4QX7 B;  3ETV A;  2NTX A;  2HN2 A;  2YIN A;  2M67 A;  2D5U A;  5LOV E;  2JJ9 A;  1N2B A;  2E9X A;  2WWU A;  3NKZ A;  5LA6 E;  3OVU A;  3P4S A;  2XAQ B;  2CA5 A;  2HPJ A;  4KI0 F;  1X9B A;  2XQ4 A;  3NZQ A;  3ZN0 B;  4O2B E;  2W0G A;  4JYA T;  2BDE A;  3PUW F;  2KIN B;  2I52 A;  3AE7 A;  3HKD E;  5HXC A;  2E8I A;  1FIO A;  5IWA T;  2CLY B;  3ABV A;  2CHO A;  3KBU A;  2L8K A;  3C4W A;  4PNI A;  4ISS A;  4G2A A;  1NWM X;  4WZX A;  2LSY A;  4LML A;  4HWC A;  1OED A;  3ONX A;  2CPT A;  4JI8 T;  4DR7 T;  1KNR A;  2K9A A;  3AXJ B;  5HG0 A;  5HEU A;  1N36 T;  1Z8U A;  1WR0 A;  4IE0 A;  4DR2 T;  4WW0 A;  3R6N A;  2X9Y A;  3JCF A;  3UY4 A;  4HFD A;  2BS3 A;  4AIS A;  5HCJ A;  4MAL A;  3Q5W A;  4GK5 E;  3EDU A;  1MIY A;  4MUK A;  2BBJ A;  2UU9 T;  4TWF A;  3AVR A;  4IE6 A;  2HHH T;  2JQH A;  3ZT7 A;  4YSZ A;  5JDM A;  2B76 A;  2YOE A;  2J4G A;  2J47 A;  5J0Z A;  3IVX A;  4QKN A;  5AQI B;  4YXD A;  2V5C A;  5ABF B;  2B1E A;  4DV7 T;  2CLY C;  2XAG B;  3ANW B;  2X0Y A;  2LKH A;  3JC6 C;  3O1I A;  1T8B A;  2ZM0 A;  1MIV A;  3K8P C;  1HNZ T;  4KBM B;  2XQ8 A;  3UUX B;  4EED A;  3IMC A;  3IVC A;  5LCY A;  4ILB A;  4X1K E;  3QK6 A;  3GWH A;  1HX1 B;  3PUA A;  3C98 B;  3O9X A;  1N33 T;  1YQ4 A;  4C91 A;  1IBM T;  3LDQ B;  5F5W A;  3ONJ A;  1HFA A;  3J7Y q;  4UV8 B;  1HG5 A;  5AQG B;  5HEG A;  3VU7 H;  2A7X A;  3ESL A;  4FI5 A;  3ANW A;  3LE8 A;  1WRD A;  4LF7 T;  5H6Q B;  5CGM A;  2CMR A;  3VRB A;  1XDP A;  4NUV A;  5FKY A;  4ZEY A;  4H63 V;  2X0H A;  2BKP A;  2A52 A;  4IDZ A;  5AQS B;  5FMN A;  4MUL A;  1XDO A;  4PFP A;  4DV0 T;  3LBX A;  4MHC A;  4A56 A;  3UTK A;  4F8H A;  3GN5 B;  2QRX A;  3N9O A;  1E2A A;  4AKL A;  2SPC A;  2VVS A;  3FZH B;  2XJ7 A;  3ETU A;  4HKA A;  2WMO A;  4NXM T;  3ZMU B;  4FJO A;  3MJX A;  4ZZC A;  2LOS A;  1H7C A;  1D1A A;  4KMC A;  2GK9 A;  5LBM A;  4KX6 A;  3CVR A;  4QH1 A;  3ISJ A;  2WM9 A;  3K1S A;  2IC6 A;  3VRA A;  4DND A;  2WU2 A;  4IL9 A;  1V8F A;  1QLB A;  3UUN A;  4DMW A;  4X66 T;  3PU3 A;  2CHN A;  3N2G E;  1LVK A;  4EYU A;  2XM2 A;  5FL1 A;  2X66 A;  1XMQ T;  4H9S E;  2K24 A;  4DR5 T;  2IC9 A;  2DWG A;  2W00 A;  3ZPO A;  1LKX A;  4DUZ T;  1Z0P A;  3S4U A;  1SE7 A;  2LME A;  2LKG A;  4LF5 T;  3PUX F;  3AEC A;  4L5G A;  2N1G A;  2IML A;  1XZY A;  3SFE A;  2VB6 A;  3LF4 A;  1JNR A;  4COF A;  3MZK B;  3RRW A;  5BW0 B;  2X67 A;  3COW A;  2XY8 B;  2ZM2 A;  2ODV A;  2D9D A;  4ZOL E;  5HXE A;  2RPA A;  3LSV A;  4LFB T;  4DV3 T;  3AE2 A;  5AQN B;  2MTQ A;  2DHR A;  1UCU A;  3IEE A;  4O4H E;  1YQ3 A;  3KDS E;  3ONL C;  4TV9 E;  3ZST A;  3EAM A;  3Q5X A;  3ZKR A;  4I43 B;  4DVD A;  4GKJ T;  3ZLI A;  2V26 A;  2XHE B;  3N5L A;  2NW8 A;  3UU3 A;  5H6R B;  3IBP A;  2WQY A;  3CI0 K;  1G73 A;  1N2O A;  3LK2 B;  2XAH B;  4U7Y A;  4P09 A;  3WAK A;  2NP9 A;  4KHP T;  4V1A v;  1L0V A;  3COZ A;  4ILC A;  1UX4 A;  2ZLY A;  3MKD A;  3CFH L;  5FXZ A;  5L4E A;  5JDH A;  3P4W A;  4HTE A;  5LHH B;  4X1Y E;  5DQV A;  2MBG A;  3EHZ A;  3HKB E;  5ABF A;  4YTN A;  2A50 A;  3I0Q A;  4U74 A;  3PJA J;  3RQW A;  2CBJ A;  3KV6 A;  3JC6 D;  3BQK A;  4U3C A;  1UGO A;  3CWZ B;  5JVD E;  3KV4 A;  1IJ6 A;  1OED B;  1KK7 A;  3RLF F;  2WS3 A;  3C4Z A;  1HR0 T;  3W15 B;  3UU4 A;  2DLR A;  3UQ7 A;  2BS2 A;  4AKG A;  3ZYM A;  1VCS A;  2YEV C;  2VQF T;  3ZMT B;  2W63 A;  2VL0 A;  4MLK A;  2LSI A;  4UF0 A;  2AE9 A;  4AQF C;  2X9H A;  3R84 B;  4U33 A;  3LJC A;  3UU8 A;  5L3B B;  3WAJ A;  2VKD A;  4DDH A;  3UU5 A;  4ASK A;  2KLQ A;  1KNZ A;  3T8O A;  4I0U A;  4J2C A;  2V6Y A;  3I9Y A;  3PV0 F;  3FBZ A;  4EEB A;  2EHO D;  3MA9 A;  4ZI3 D;  2ACX A;  2QGS A;  2CXF A;  1SHZ C;  3H3M A;  4Z8X A;  4HGA A;  4AI6 A;  2IUB A;  4MUH A;  3P7I A;  1ZKE A;  4GKK T;  3NWI A;  4YTM A;  1UUR A;  2FBW A;  3WI3 A;  5FNV E;  3J9X 1;  4JI1 T;  3PUR A;  4DDM A;  3O1J A;  2CM0 A;  4HN9 A;  5CA0 E;  2LRL A;  2YDR A;  1QUU A;  4QWN B;  3CQX C;  4DBQ A;  4E7Z A;  2LEH A;  4TWD A;  3EMO A;  4ZS3 A;  4OX9 T;  2VKH A;  4DV5 T;  5KX5 E;  4BJM A;  1UK5 A;  3Q10 A;  2Y6X A;  5JDF A;  2FUP A;  3HI2 A;  4WNK A;  2D0T A;  3B5M A;  2BG9 C;  3B13 A;  5L2L A;  3ZCJ A;  1W0A A;  2D0U A;  3P4Q A;  5DAB A;  2IDO B;  3Q2M A;  4UEL A;  1UX5 A;  3G06 A;  3QC9 A;  4Z90 A;  2K48 A;  2OLT A;  4UIG A;  2PTF A;  1AJ3 A;  2C5J A;  2WMN A;  4E7S A;  5LJN A;  1WFD A;  3ZC0 A;  4PJM A;  1WCR A;  2VWA A;  3VR8 A;  2A2F X;  5CFB A;  1HNX T;  3RPU A;  3MUE A;  3LG7 A;  2IW5 B;  2UXD T;  1J5E T;  4YT0 A;  2IHR 1;  1T98 A;  3NBX X;  1IBK T;  2XTL A;  3KIN B;  2L3L A;  5E0O A;  4OHF A;  2WDR A;  2LRK A;  4F6R C;  4LFC T;  3IOC A;  1R8I A;  1D0Z A;  2Q9Q D;  2X9W A;  4X65 T;  5L3G B;  3RYI E;  1D0Y A;  1O3X A;  3VKG A;  5KWV A;  3GA8 A;  2V5D A;  3MK7 C;  3AEB A;  4H9N C;  2KXP B;  2V7K A;  4IIJ E;  5JDG A;  4MUG A;  3SWH A;  1ZP0 A;  5JDL A;  5KXJ A;  2FJA A;  2UXB T;  3CFA L;  4LFA T;  4BAY B;  4CI3 B;  2XQ7 A;  3M65 A;  1N2J A;  3CX8 B;  3IA3 A;  3NRY A;  1UFV A;  3RRC A;  1OED E;  2WCA A;  3IME A;  2E5L T;  4ERR A;  4DR6 T;  1D0X A;  1T72 A;  4JLE A;  4B3S T;  5JR9 B;  2R6G F;  5AQH B;  2G0U A;  4UF0 B;  4HEA A;  4U72 A;  1IZN B;  3SFD A;  4HFE A;  4UEM A;  3L8R A;  1E1H B;  2YN6 A;  2K5B B;  2UXX B;  4TZ4 C;  4IRE A;  5AQP B;  3F2E A;  1FJG T;  3CI0 I;  4UVB B;  5EK3 A;  3X1D A;  3U3I A;  2LSG A;  1X79 A;  3HA4 A;  3AE6 A;  4K0K T;  2XQ9 A;  4JEH B;  5L3E B;  4YSY A;  2KMF A;  3PUQ A;  2J62 A;  5L3C B;  1MMD A;  4CXX A;  5JDN A;  4L0R A;  1I6Z A;  3MXT A;  1W9R A;  4QH5 A;  4Q25 A;  1WYB A;  5FVK A;  3EVY A;  5HWX A;  4MUI A;  3K3Q C;  2LM2 A;  2WSS V;  1MND A;  4IDP A;  5JRC A;  5FY1 A;  2Q9Q C;  1W09 A;  3M3Z B;  2YKS A;  3QUJ A;  3U78 A;  1M7K A;  5EXC A;  1OWA A;  3EDV A;  2XM1 A;  1WYC A;  4CI1 B;  2XUE A;  4MUN A;  3K3N A;  3IOB A;  5LHG B;  5LMN T;  4LF6 T;  4DR4 T;  2BS4 A;  2DI4 A;  4CN6 A;  3OTO T;  5DQW A;  3P50 A;  3UFG A;  2XQY A;  4MUJ A;  4IXJ A;  3FHN A;  3RF1 A;  3H3A A;  4JI0 T;  2NR4 A;  4QX8 B;  3AEE A;  3FZF B;  4IL4 A;  2G2S A;  2N9D A;  5BMV E;  3PUV F;  1WR6 A;  4EOZ B;  5FY0 A;  2CCQ A;  5FL0 A;  4NXN T;  2WP9 A;  4MUF A;  4DE5 A;  5HEO A;  3O4X E;  3P4R A;  3Q9D A;  4EZ4 A;  1S94 A;  4PW8 A;  3N9P A;  5FXV A;  2K3W A;  3HKC E;  3RHW A;  1MIW A;  3AA6 B;  4UV9 B;  3A8Y C; 
#chains in the Genus database with same CATH homology
 4XZC A;  3KBT A;  1UX4 A;  2ZLY A;  3MKD A;  3CFH L;  3UA0 A;  5FXZ A;  4DMV A;  5JDH A;  4NUU A;  1BR4 A;  2E9X C;  4HTE A;  5LHH B;  1YD8 G;  3OBV E;  4X1Y E;  5DQV A;  2MBG A;  3NZP A;  1V9D A;  3K3O A;  5JRE A;  5EZY E;  3VKH A;  1SA0 E;  3HKB E;  4MQ6 A;  4ANJ A;  2CWY A;  4MBQ A;  4ZI7 E;  3OYX A;  2QA7 A;  3I0O A;  1CUN A;  4GYS A;  2N2N A;  3CQC B;  3IMG A;  5J2T E;  2JMH A;  2A50 A;  1B7T A;  5TAO A;  3ZMV B;  4IE7 A;  3I0Q A;  2A53 A;  4U74 A;  5CA1 E;  4EZH A;  3QTT A;  2G3D A;  4PJL A;  3O1H A;  3ZCI A;  3KV9 A;  3KV6 A;  4I50 E;  3JC6 D;  5F8P A;  3BQK A;  3IUB A;  4DO0 A;  4ZS2 A;  1MMA A;  4EAH A;  5EK2 A;  3ZYL A;  1FEW A;  3CWZ B;  3PUS A;  4QXB B;  5JVD E;  1S35 A;  4OYK A;  5JR9 A;  3N9M A;  4OK0 A;  1BR1 A;  3KV4 A;  4JUY A;  1IJ6 A;  4G5Y A;  4IST A;  3AG6 A;  1LVF A;  1KK7 A;  5ADX L;  2CEA A;  3BQI A;  4H9R C;  4EF6 A;  3C4Z A;  3ZYK A;  3NRX A;  2XAF B;  4WBN E;  3W15 B;  1VOM A;  2DLR A;  4AKG A;  4ZI2 D;  3HR0 A;  2Q9Q A;  3RYH E;  2A84 A;  3ZYM A;  3SRZ A;  2IAK A;  3LK4 2;  2KND A;  4EXT A;  2YEV C;  3N9Q A;  4QX7 B;  3ETV A;  3ZMT B;  3RKO A;  2NTX A;  2JQQ A;  2W63 A;  4DDK A;  2YIN A;  2M67 A;  2D5U A;  3HKE E;  4MLK A;  5LOV E;  2JJ9 A;  1N2B A;  2E9X A;  2WWU A;  2LSI A;  3CPZ A;  5J1G A;  4UF0 A;  5LA6 E;  5JRC B;  2KT9 A;  4AQF C;  2PBI A;  2X9H A;  3R84 B;  5JDQ A;  2XAQ B;  1ZHC A;  2CA5 A;  2HPJ A;  2VL8 A;  4H9Q C;  3NZQ A;  2NW9 A;  5IHY A;  3H37 A;  3LJC A;  3KVA A;  4ILU A;  5L3B B;  3WAJ A;  5AFU L;  3ZN0 B;  2VKD A;  5HAX A;  4O2B E;  4CXW A;  4DDH A;  1IHO A;  2W0G A;  5JH7 E;  4ASK A;  4PK6 A;  4C90 A;  2BDE A;  2UXN B;  4PFO A;  2KLQ A;  2KIN B;  4O4J E;  1KNZ A;  2EHO B;  3HKD E;  2E9X B;  3T8O A;  2MYS A;  5HXC A;  3PDY A;  2E8I A;  1FIO A;  2VK9 A;  4J2C A;  3ZC1 A;  3IOE A;  3IHR A;  4EB6 E;  5G2F A;  2CLY B;  3I9Y A;  5LXT E;  3KBU A;  2L8K A;  3C4W A;  3EUH A;  3FBZ A;  4YLH A;  4PNI A;  4AQG A;  1OXZ A;  2EHO D;  2Y8D A;  4ISS A;  2DCF A;  3MA9 A;  5F3J A;  4G2A A;  1NWM X;  2ACX A;  2BVL A;  2DNX A;  2QGS A;  4ZI3 D;  3V5U A;  2LSY A;  5CB4 E;  2EHO C;  1BR2 A;  3ONX A;  2CXF A;  1SHZ C;  5FXX A;  4CI2 B;  4Z8X A;  4HGA A;  2K9A A;  4AI6 A;  2RP4 A;  4N78 D;  4MUH A;  3P7I A;  5HG0 A;  1ZKE A;  3FXD B;  4IE0 A;  1N2H A;  3AAE B;  2W62 A;  4WW0 A;  3R6N A;  2X9Y A;  4I4T E;  5HYA A;  4BA9 A;  4AKI A;  3UY4 A;  3WI3 A;  5FNV E;  2PJQ A;  3J9X 1;  4M1P A;  3MAC A;  4MAL A;  1YKH B;  3Q5W A;  3IF8 B;  1U5P A;  1G8X A;  3PUR A;  3EDU A;  4GK5 E;  1MIY A;  3IUE A;  3GN5 A;  4DDM A;  1HS7 A;  3CQG B;  3N8H A;  4MUK A;  3O1J A;  4GIW A;  2CM0 A;  4HN9 A;  5CA0 E;  4ZI3 C;  4QXH B;  2H7O A;  3AVR A;  4IE6 A;  1QUU A;  4QWN B;  3C51 A;  3CQX C;  3Q12 A;  1HCI A;  4GOU A;  4DBQ A;  2WAU A;  2Y48 B;  4E7Z A;  2LEH A;  2HH7 A;  3DTO A;  5JDM A;  5LHI B;  4ZS3 A;  4ZHQ E;  5KMG P;  4PK4 A;  4HE8 A;  2VKH A;  1FMV A;  2J1D G;  3ZN1 B;  1FMW A;  5KX5 E;  4BJM A;  3Q10 A;  2Y6X A;  5JDF A;  1EZ3 A;  1HX8 A;  2X3F A;  3D0T A;  3E22 E;  3HI2 A;  4UVA B;  4WNK A;  2D0T A;  4IE4 A;  3IVX A;  3RX6 A;  3ZMZ B;  4AQF A;  1IAP A;  4QKN A;  2Z6E A;  4PAG A;  4QXC B;  4TUY E;  3B13 A;  5L2L A;  4O8S A;  3ZCJ A;  4CZZ B;  2B1E A;  4K0U A;  3LBX B;  4AXP A;  2XAS B;  2A54 A;  2PG8 A;  2D0U A;  5DAB A;  2EHO A;  3F57 A;  2CLY C;  2WBL A;  2XAG B;  3ANW B;  1HTJ F;  2CE7 A;  3JC6 C;  3O1I A;  3Q2M A;  5LYJ E;  4UEL A;  2P9B A;  2X0L B;  2ZM0 A;  3DP7 A;  1MIV A;  1UX5 A;  3QC9 A;  3K8P C;  2K48 A;  2V7M A;  4UIG A;  1AJ3 A;  4KBM B;  3AVS A;  2C5J A;  1N2E A;  2WMN A;  4E7S A;  5LJN A;  3UUX B;  3UK2 A;  3RC3 A;  3KFW X;  2LE8 A;  4DBR A;  3L3P A;  1YW0 A;  4KUM B;  3ZC0 A;  4PJM A;  2C0S A;  2VWA A;  3IMC A;  3PUG A;  1ZV4 X;  2A2F X;  5KDM C;  3N9L A;  4H63 H;  3B57 A;  5JQG E;  3IVC A;  3RYC E;  3N2O A;  1D1B A;  2V7J A;  5LCY A;  3RPU A;  4X1K E;  3COV A;  2V1D B;  3MUE A;  2D2S A;  3QK6 A;  3LG7 A;  2IW5 B;  3GWH A;  3ZJ2 A;  3VHL A;  4PK5 A;  2YU1 A;  1T98 A;  3NBX X;  3PUA A;  3C98 B;  3O9X A;  5DJQ C;  2XTL A;  5LGU B;  2G16 A;  2YU2 A;  5HXH A;  4YFS A;  4C91 A;  3KIN B;  3CX6 B;  2NW7 A;  2L3L A;  5E0O A;  3J7Y q;  1HFA A;  4OHF A;  1D1C A;  2KWH A;  4UV8 B;  2OA5 A;  1HG5 A;  2A56 A;  2EJC A;  4F6R C;  2NOX A;  3VU7 H;  3IOC A;  5LJM A;  2VKO A;  1D0Z A;  2Q9Q D;  2X9W A;  2A7X A;  2KZ7 B;  5L3G B;  4ADZ A;  3RC8 A;  3ESL A;  1WLX A;  3P8C D;  1MNE A;  4EFK A;  4FI5 A;  2NWB A;  3RYI E;  3ANW A;  4YJ3 E;  3LE8 A;  5FY7 A;  1D0Y A;  1WRD A;  2RA1 A;  3V5S A;  5H6Q B;  5JR9 C;  2CMR A;  4X20 E;  1O3X A;  2X68 A;  3VKG A;  5KWV A;  3GA8 A;  4NUV A;  3N2K E;  3UUL A;  3MK7 C;  5HXS A;  3AA1 B;  4H63 V;  4H9N C;  2KXP B;  4TN7 B;  3SOL A;  1BR0 A;  2A52 A;  2DWK A;  4IDZ A;  2V7K A;  5J2U E;  4IIJ E;  5JDG A;  4MUG A;  5FXW A;  3SWH A;  5JDL A;  4L9I A;  2CWO A;  5LNK A;  2ODU A;  4IHJ E;  5FMN A;  4MUL A;  3CFA L;  4BAY B;  4H9O C;  4CI3 B;  1IJ5 A;  3ZMS B;  4BJN A;  4G63 A;  4PFP A;  3IVG A;  4O4I E;  3M65 A;  1N2J A;  3OJA A;  3UFE A;  1NAF A;  3CX8 B;  2LT3 A;  3NRY A;  1UFV A;  3RRC A;  3LBX A;  4MHC A;  4A56 A;  4P0B A;  3UTK A;  2A88 A;  3GN5 B;  2JPF A;  3E08 A;  3SS1 A;  1Y64 B;  4KP3 C;  3IME A;  3KV5 A;  2VKJ A;  3N9O A;  4YHJ A;  2E9X D;  4ERR A;  4AKL A;  2NTY A;  5HXR A;  2SPC A;  3DJB A;  1D0X A;  3MXZ A;  3OKQ A;  4CQI A;  3F31 A;  3ETU A;  5C8Y E;  2X9X A;  4O4L E;  4JLE A;  5JR9 B;  2G0U A;  4HKA A;  4G5F A;  4UF0 B;  1HF8 A;  5GON E;  4HEA A;  4U72 A;  1IZN B;  2WMO A;  3ZMU B;  2LSK A;  2MOZ A;  1U4Q A;  4FJO A;  1N2I A;  5ETW A;  3OYZ A;  4UEM A;  4UVC B;  4WBO A;  2XAJ B;  2X51 A;  1E1H B;  2C5I T;  3MJX A;  2PFV A;  2K5B B;  2UXX B;  3A5X A;  4MFR A;  2JMK A;  2LOS A;  4TZ4 C;  2V7I A;  3CFF L;  4MUE A;  3F2E A;  3IOD A;  2Q9Q B;  5IYZ E;  1H7C A;  4UVB B;  3UT5 E;  1D1A A;  4KMC A;  4B6X A;  3COY A;  5EK3 A;  2GK9 A;  5LBM A;  3HA4 A;  2LSG A;  1X79 A;  3U3I A;  3CVR A;  3HL6 A;  3ISJ A;  2C5K T;  5M4Y A;  4JEH B;  5LGT B;  4JEU B;  5A1L A;  2WM9 A;  5L3E B;  4TX5 A;  2IC6 A;  2KMF A;  3PUQ A;  4UXN B;  4DND A;  5L3C B;  4IGU A;  1MMD A;  4FZJ A;  1VRB A;  4XBF B;  2KWI B;  4OYJ A;  4CXX A;  1V8F A;  3INN A;  3UUN A;  5JDN A;  1YKE B;  4L0R A;  1MMG A;  4DMW A;  4ZI2 C;  3MXT A;  5FYM A;  2VAS A;  3PU3 A;  2HPL A;  2A72 A;  2JRK A;  1N2G A;  2BZB A;  2I59 A;  1WYB A;  4GK0 E;  4AKR B;  3EVY A;  3N2G E;  5HWX A;  1LVK A;  3CML A;  4EYU A;  4MUI A;  3I1A A;  3K3Q C;  4TV8 E;  2X66 A;  1LRZ A;  3AAA B;  2WSS V;  4H9S E;  1MND A;  2K24 A;  5JRC A;  5FY1 A;  1MMN A;  5EK4 A;  2H3R A;  5LBQ B;  3LK3 B;  2Q9Q C;  2YK0 A;  2A86 A;  4PJJ A;  2IC9 A;  2DWG A;  2W00 A;  4I55 E;  3C64 A;  3ZPO A;  1LKX A;  3ZEF B;  2LHN A;  3QUJ A;  3AAI A;  3RYF E;  1Z0P A;  3U78 A;  5EXC A;  5L3D B;  2H7V C;  1OWA A;  3EDV A;  3S4U A;  3ZJ1 A;  4BHR A;  3AA7 B;  4CXY A;  3UUM A;  1WYC A;  4CI1 B;  4YJ2 E;  3BK9 A;  2XUE A;  3LFM A;  3K3N A;  4O2A E;  4MUN A;  2LJL A;  1HG2 A;  3IOB A;  4AKH A;  5LHG B;  2LOP A;  4PJN A;  2DI4 A;  3E0Z A;  3PU8 A;  5DQW A;  2L9Q A;  2XQY A;  1MOP A;  4L5G A;  4MUJ A;  2N1G A;  4HFV A;  1US7 B;  4EIW A;  4IXJ A;  1QSD A;  3FHN A;  2VB6 A;  4P0A A;  3LF4 A;  3H3A A;  3BQL A;  5FP3 A;  3FB2 A;  3MZK B;  4QX8 B;  3RRW A;  4EYY R;  3CX7 B;  2V7L A;  2N9D A;  2X67 A;  2ZM2 A;  2ODV A;  2G2S A;  3COW A;  5BMV E;  2ZMA A;  3FXE B;  4XAX B;  4ZOL E;  1WR6 A;  4EOZ B;  5HXE A;  5FY0 A;  2LSJ A;  2CCQ A;  3CKD A;  5L3F B;  2G5Z A;  5LP6 E;  2LM9 A;  2A3D A;  3AA0 B;  3C50 A;  2MTQ A;  2DHR A;  1UCU A;  4X1I E;  4MUF A;  4DE5 A;  3IEE A;  4O4H E;  3O4X E;  3I9W A;  5HWY A;  3KDS E;  4TV9 E;  2LHR A;  3PTR B;  3Q9D A;  3Q5X A;  5LG4 A;  3TKL B;  3C4X A;  4GYR A;  4I43 B;  3AB3 B;  2GW4 A;  4DVD A;  4EZ4 A;  3ZLI A;  2CXD A;  3L09 A;  3KVB A;  3PE0 A;  1S94 A;  3RH3 A;  3GMI A;  4PW8 A;  2CXL A;  2V26 A;  2XHE B;  3N5L A;  3N9N A;  3N9P A;  2NW8 A;  5FXV A;  5H6R B;  3IBP A;  4H9P C;  4IE5 A;  3FBL A;  1G73 A;  4QHO A;  3AG5 A;  1N2O A;  3HKC E;  1ZEE A;  2BVM A;  2ES0 A;  3LK2 B;  5LGN B;  4OFZ A;  2XAH B;  1MIW A;  3AA6 B;  4P09 A;  4UV9 B;  2NP9 A;  3WAK A;  2W61 A;  4V1A v;  3COZ A;  2ZM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...