3HL6A

Staphylococcus aureus pathogenicity island 3 orf9 protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
213
structure length
189
Chain Sequence
DIETIVNEFETRAGTLLRYYTGLLERSKVQPCCFKLYNDPFDMVYVMMNSKLFSHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKQLSISDMMASQLFEDEYFMYGLQTYQSSNTDVIANIEMLYQLATGINEPVPELVEGLKLVTEFVQDENATQEDYKALERKLNDLKASYYSLSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pathogenicity island protein
publication title Structural and functional studies of a pathogenicity island protein from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Unknown function
total genus 58
structure length 189
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16560 SAPI Putative mobile pathogenicity island
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.700 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3hl6A02
3.30.1300.50 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3hl6A01
3HL6A
chains in the Genus database with same CATH superfamily
1HNXT 5DABA 3IVXA 4ANJA 3GA8A 4FI5A 4H9SE 3PURA 5ABHA 4G63A 4YHHT 4H9NC 3I1AA 3MK7C 1WFDA 4H9RC 3O1IA 3IMEA 3ONXA 2YU1A 2M6BA 4MBQA 3NWIA 4DV0T 3COWA 2Y8DA 3QC9A 1Z0PA 4GOUA 3Q5WA 3UY4A 2IIUA 4OYJA 4HFDA 3HA4A 4LF9T 2ODUA 3EHZA 2EHOA 2LOSA 3S4UA 2NR4A 4JI3T 5IHYA 3RKGA 3ZMSB 3FZKB 4BJMA 3LE8A 2ZM2A 3PDYA 5KXJA 1JNRA 1NEKA 4MUIA 4DV3T 4I4TE 1N36T 2XQ9A 1N2JA 5JR9A 2W0GA 2ZM6T 1BR0A 2ES0A 3JAFA 4JLEA 4CN1A 2FBWA 4ZS2A 4ERRA 1HR0T 3C4WA 2WAUA 3HKCE 5CA1E 3ZN0B 4IIJE 3MA9A 5LG3A 4AKLA 4IDNA 2MTQA 3T1YT 1M62A 4BAYB 1UCUA 3PV0F 1D0ZA 4PJMA 3RGLA 2XQAA 2E2AA 3TKLB 5LMUT 5ADXL 3AAEB 5CB4E 5FY1A 5LGTB 3IVGA 4XZCA 4IL4A 2V7LA 4YJ2E 4PNIA 2LLYA 4P09A 3OPCA 3M3ZB 4DV2T 3P50A 2V6YB 2I6HA 1YD8G 2Z6EA 2IDOB 1KEYA 5HEHA 1R8IA 1MNEA 1NWMX 4JI4T 4JI7T 4PK4A 2QVAA 1GQEA 2D0UA 3LBXB 4TX5A 1ZP0A 1L0VA 3TLVA 2LEHA 2G3DA 2LKHA 2BKOA 2VQFT 4E7SA 2MYSA 2D5UA 1N2IA 4G5FA 3FBLA 1W0AA 2LSKA 1T98A 3Q10A 2M67A 2HPLA 1HS7A 2CWYA 2W00A 4IE7A 3HKDE 1U4QA 4AKGA 3RYFE 2A54A 3AE6A 4HFVA 3O9XA 5AQRB 3JCFA 4PFPA 5LJNA 3RYHE 2WDVA 5BR8T 3VU7H 2A7XA 2IC9A 2BS3A 2WCAA 5H6QB 4ISTA 2HPJA 4TV8E 5JRCB 3COZA 3FXDB 2XAGB 3N9NA 3I0QA 5AQOB 4DR2T 4OYKA 3VHLA 4QX8B 4DR4T 3Q5DA 2FJDA 2H7OA 5DQVA 4EIWA 3CFIA 5L47A 3N9MA 5HXEA 3AVSA 2VL8A 5CGMA 2E9XD 3V5SA 3LSVA 2XSAA 3AG5A 2LMEA 4HKAA 3K3QC 3EI0A 4X1YE 3KFWX 2DCFA 4MHCA 2V1DB 1J1JA 2X3FA 4DVDA 4DBQA 5FP3A 2X9WA 4MALA 4TWHA 2WB5A 2WWVA 2WWUA 3RIFA 2XHEB 3P4WA 3N2OA 2FJBA 3UUBA 2IW5B 3C4ZA 2YDSA 3F2EA 4AI6A 2XPKA 4LFBT 3IMCA 2B76A 2BVMA 2C5KT 2WZIA 4M1PA 2WMNA 2IC6A 5EK4A 3AA7B 4O2BE 3KV9A 3H3AA 4DO0A 4DR6T 3IF8B 5FVLA 3LK3B 2KXPB 2WMOA 5FVKA 4NIQA 4QH1A 3ZMVB 5KX5E 2C0SA 4WYVA 5J0ZA 1M7KA 4CI2B 3RYIE 4EOZB 2VASA 5FXVA 4NXNT 4B6XA 2CLYC 5FXWA 3A5XA 5ETWA 3EDUA 1AJ3A 4B3MT 3CX7B 3ZYLA 3FB2A 2N9DA 3ONLC 3AE8A 3UU5A 4B3RT 4TV9E 2H89A 4PAGA 2A52A 4HFIA 4X62T 2KLQA 3VRAA 4JV5T 5LCYA 5JREA 4LF8T 3MUEA 1KF6A 4XBFB 3GN5A 3UFGA 3ANWA 1SA0E 2WDQA 2IUBA 1SE7A 3IBPA 4LMKA 3ZC1A 3FBZA 5ABEA 2JQ9A 1UK5A 4X66T 3CI0I 2UXDT 2VKDA 3CQCB 2XJ7A 5FL1A 1VOMA 1V9DA 2VWAA 4FZJA 4QXCB 2CLYB 4WW0A 3MKDA 4KHZF 1VCTA 4ISSA 4U2YA 3IEEA 2IAKA 1Z8UA 4JEHB 3E0ZA 4U31A 5AQUB 3HKBE 5LNKA 3OYXA 4LMLA 1US7B 1OEDC 1MMGA 1IBLT 3SRZA 4YY3T 2XAJB 1OXZA 1N2EA 3FZLB 5JVDE 4E7ZA 4C90A 5LP6E 1QLBA 2W2UA 2L3LA 2XQYA 2VKOA 3CVRA 4L0RA 2LSIA 3UA0A 3AA0B 5AQNB 3E22E 4TN7B 1W9RA 1V8FA 5FY7A 4YLHA 1ZHCA 3UQ4A 3ZT6A 5AQMB 3P8CD 3RRCA 4LFCT 3KINB 2X0YA 4L5GA 4ILBA 4GK5E 2V5DA 1UUSA 1ZOYA 2DLRA 4JI5T 1G8XA 2A53A 2LRLA 5AQJB 2Q9QC 2CM0A 2DL1A 3RH3A 4KBMB 1HX1B 2G5ZA 5FL0A 4U72A 4DV1T 2JIWA 3COYA 2H88A 2CXDA 1MNDA 1HG5A 4J2CA 3AEEA 3SFEA 2KSRA 5FXZA 3RHWA 4UV8B 4DDMA 4ILCA 3UULA 3LK42 4MUFA 3IOEA 4IE6A 4CXWA 1HFAA 4WBNE 3RYCE 2YOEA 3ZMUB 3AB3B 3HR0A 2LM9A 3UUNA 4A98A 1HG2A 2JJ9A 2XSBA 3K8PC 5GONE 3PUXF 2K9AA 4GK0E 4DV6T 4JUYA 5AQGB 4JEUB 3SOLA 3TLWA 4CI3B 5HEOA 3KV4A 4I50E 3N2KE 4U33A 5JH7E 5LHIB 4GKKT 4CN6A 1FEWA 4LMJA 3PU3A 4MUEA 1UX4A 2V5CA 3P4PA 4AKRB 4AKHA 2CA5A 3QNUA 4P1NA 2X9YA 4P0AA 3O1HA 2WSSV 3P4QA 4G5YA 1MMNA 2Q9QB 2GR7A 3LG7A 5FXXA 4YXDA 4EGWA 3Q5XA 4AQFA 3KBUA 1QUUA 4K0UA 3RX6A 2PBIA 5JR9C 3C4XA 4TNVA 2KWHA 2XM2A 3EUHA 5HG0A 5AQSB 2XY8B 3RIUC 2H3RA 3MJXA 1KK7A 1O3XA 4BA9A 2JRKA 2VVNA 3AEGA 3AEBA 3P7IA 4DUZT 3P4RA 4U74A 4TUYE 5M4YA 2EHOB 3FXEB 5J2TE 4IHJE 2C5IT 3KVBA 3B13A 1XWMA 5L4EA 3CWZB 3DTOA 3UUXB 5DQWA 1XDOA 4OHFA 4YSXA 2WY2A 1IBKT 2MPKA 3INNA 4DR3T 2RPAA 2X68A 1IJ6A 4YT0A 3V5UA 1QSDA 2CWOA 2W67A 5JR9B 2B1EA 3ETUA 3IMGA 1WCRA 4IDZA 2XAQB 3JADA 4JYAT 1N2BA 3ZT5A 4TWDA 4HWHA 3HI2A 3AECA 1N33T 1D1CA 2JMKA 2PTFA 5HCMA 3U3IA 4EYUA 3JAEA 2HN2A 5LA6E 2BG9E 2AE9A 2W62A 4H9PC 4OFZA 2A84A 3CI0K 2CXLA 1I6ZA 3NRYA 5AQTB 4TWFA 1J5ET 5JQGE 5IWAT 2BKNA 3ISJA 4N78D 4HWIB 3O1JA 3AE2A 2BS4A 2BDEA 2DWKA 4QXBB 2YK0A 4KUMB 3AE5A 1W09A 3F31A 4UR9A 3N5LA 3AAAB 3AXJA 2DNXA 3UU6A 2G16A 3GMIA 2NP9A 3N9LA 4LF7T 2YU2A 2OV9A 2W4XA 4H9OC 4IDPA 1H7CA 3QK6A 2LSJA 4PK6A 5EK3A 3M65A 2JQQA 4EEBA 1ZKEA 4UVCB 4EZ4A 2J1DG 4TZ4C 4AXPA 1KNPA 5LG4A 2D9DA 2AXDS 3SFDA 4CXXA 3MXZA 3CX6B 1MIWA 2XM1A 1WRDA 2RA1A 2IHR1 2J4GA 1UFVA 3AAIA 3P4SA 4TNWA 2J47A 2CEAA 3VRBA 2OLTA 3ABVA 4WZXA 1NENA 3EVYA 2A9UA 2XUEA 3N2GE 5JDQA 2ACZA 3Q12A 3KV6A 4X5TA 3E08A 3RPUA 2LSGA 4ADZA 3LJCA 2LM2A 3PUVF 4K0KT 2WZHA 2I0MA 4I55E 4O4HE 4IREA 5C2TA 5ABGA 3UT5E 2X9XA 4BJNA 2UXNB 3C98B 2UXXB 2BS2A 2DI4A 1D1BA 3DJBA 3RC3A 1BR1A 2UXBT 2YN6A 5LMNT 5ABFA 1WYBA 4DV7T 5AQHB 4GKJT 3LK2B 3L39A 4GYRA 1N2HA 2UUBT 4XAXB 4IDQA 1LVFA 1FMWA 4PJJA 2K3WA 4HWCA 4MUNA 4OK0A 1FMVA 5CJ5A 3L3PA 1XDPA 3UU8A 1LVKA 3NZQA 4YTNA 3NZPA 3C64A 2KZ7B 4CQIA 1OEDE 3R84B 2WM9A 1E1HB 5J2UE 3I9YA 5FYMA 3PUSA 1FIOA 2LOPA 2BG9A 3AA1B 2IECA 3OTOT 5HYAA 2UUCT 1WLXA 5HEUA 4O2AE 3CPZA 5AQVB 3H37A 2Y48B 4EAHA 2CMRA 1S35A 4QXHB 5AQQB 2WDRA 3B57A 4HWFA 4QX7B 2X9HA 2EJCA 4LF5T 4HEAA 3UFEA 4IE4A 2CHNA 3FHNA 2F4VT 2KMFA 4Z91A 4H63V 4H63H 1T72A 1J5WA 1N32T 3N9OA 5AQFB 4WBOA 4UVAB 3U78A 2D0TA 2ODVA 5AQPB 2BBHA 1IJ5A 4NPPA 3GN5B 5L2LA 3VR9A 3ANWB 2XASB 4UEMA 2XQ5A 2A72A 1CUNA 1XNQT 1FJGT 4EZHA 2PFVA 2KINB 3LDQB 4YSZA 4MUHA 1D0YA 4DV4T 3N9PA 2V7JA 3ZJ1A 3QOFA 4H9QC 4Q25A 4HGAA 3BQKA 2YDRA 3VKGA 4UF0A 4NUVA 2X51A 3QUJA 3AVRA 4A97A 2WBLA 2X0HA 4QWNB 2E9XA 3Q5EA 3K1SA 2LHNA 2V7MA 2YEVC 3CFHL 4ZHQE 2A3DA 2NTYA 1IZNB 4ZI3D 3L09A 2ACXA 3PJAA 4IE0A 4EEDA 3ZCJA 4JI6T 4HE8A 2E5VA 2V6XA 3AEAA 2RP4A 2SPCA 1XNRT 2HN1A 3UUMA 2KT9A 2WU5A 3ZC0A 2WU2A 3CQXC 5J1GA 3COVA 1N2GA 5L3EB 2BBJA 4EXTA 1MIVA 4AISA 3FZHB 5KMGP 5LHGB 2W66A 5JDHA 3JC6C 4JI2T 3RIAA 1OEDA 2CHOA 1UURA 4PJLA 3CKDA 1XMQT 2ZMAA 4O4IE 4YSYA 1YW0A 4ILAA 3H3MA 3CK6A 3TLSA 4LFAT 4A56A 3T8OA 5HWYA 5HEGA 4IXJA 3BQLA 4ZXLA 3WI3A 4ZZCA 4A5XA 2A50A 5IYZE 2EHOC 3RLFF 4PK5A 5C3JA 4GYSA 3ZKRA 3G06A 1WYCA 3I0OA 5HXRA 1MIYA 3FZFB 4IE5A 1D0XA 2CPTA 1N2OA 3IOBA 4DR1T 5HCJA 1YQ4A 3ZSTA 1LRZA 4B3ST 2CE7A 3ZLIA 3UK2A 2E5LT 4JI8T 4LF6T 3AE7A 5JDFA 5LJMA 4HWDA 2GR8A 4O4JE 3VKHA 3N9QA 3D0TA 4MQ6A 2CXFA 4F6RC 2N2NA 5L4HA 4PW8A 2CCQA 3ZJ2A 4X20E 3CQGB 3KV5A 3PUQA 4L9IA 3QB5A 2VQET 4OX9T 3NVOA 5FKYA 5AQKB 2JQKA 3RQWA 3IVCA 2ZM8A 2QYWA 1U5PA 4CXYA 3LF4A 4I0UA 2DWGA 2VURA 2KNDA 3ZCIA 2LKGA 3PJAJ 4LF4T 2VB6A 2VKHA 3IUEA 1HX8A 4HFEA 3WAKA 1YQ3A 3ETVA 4EF6A 3PUYF 3J9X1 3RKOA 5LOVE 2XQ8A 2K48A 2VVSA 2A2FX 4QH4A 5L3FB 4X1KE 5TAOA 4PFOA 5AQLB 4BHRA 5KWVA 3CIRA 4QH5A 4YHJA 5A1LA 2GW4A 2R6GF 4AQYT 2NOXA 3A7MA 1D1AA 3UU4A 1I94T 2G2SA 3AEFA 3MZKB 2P9BA 4HTEA 1WR6A 3O4XE 5JTGA 3NBXX 1MOPA 5FMNA 3RIUA 2J62A 3J7Yq 1BR4A 2LE8A 3OJAA 4UELA 1VRBA 4U3CA 2X66A 1HNZT 4YFSA 4ZI2C 5F5WA 1HF8A 4COFA 2V6YA 2W63A 3PUWF 1UX5A 2VL0A 2XZEA 2UXCT 5CFBA 3ZYKA 4KMCA 5FY0A 2LHRA 3T1HT 4EB6E 3LBXA 3RRWA 2L8KA 5BMVE 4U7IA 2V7IA 3AE4A 2MOZA 4ZS3A 5EZYE 1Y01A 5CA0E 4C91A 2FJAA 4UIGA 3W15B 4P0BA 3KDSE 5LXTE 4IGUA 4ZEYA 3AA6B 5HXCA 1IBMT 3A8YC 1EZ3A 1CHUA 2PG8A 4IT4A 5C8YE 2XQ3A 3AXJB 3EMOA 4DMWA 2HH7A 5L3CB 2V8SV 3AG6A 3BK9A 1X9BA 3IHRA 4O8SA 5JRCA 4MFRA 4UVBB 3DP7A 1XMOT 2NW8A 4UV9B 2VK9A 1YXRA 5LGUB 1SHZC 5LBQB 4PJNA 2K5BB 3SS1A 3ZPOA 5F3JA 3CX8B 3ZEFB 2XQ4A 3SWHA 2BZBA 2I52A 3RQUA 3QB5K 1T7SA 5F8PA 3CMLA 4DE5A 5HEJA 2LT3A 4X65T 3F57A 3KVAA 2CRBA 3PUZF 3HL6A 3QTTA 2A56A 1SUMB 3OBVE 2BG9C 5BW0B 4DV5T 4HFBA 5G2FA 3L8RA 2XAFB 4FJOA 4KP3C 4Z8XA 2KWIB 4ASKA 3PTRB 4DNDA 1VCSA 1KNRA 3I9WA 2YKSA 2C5JA 3OYZA 1HCIA 1DU2A 2QA7A 5H6RB 4JI0T 3EABA 4EFKA 3ESLA 3K3OA 5ABFB 5HXHA 2ZM0A 3MACA 3AE3A 2Y6XA 2K24A 1B7TA 2V7KA 2BKPA 5L3BB 2IMLA 5E0OA 1KFYA 1S94A 4QKNA 4DR5T 4DBRA 2BVLA 2ZLYA 3NKZA 2OGFA 2BG9B 4MUKA 3C51A 5EK2A 3AE1A 4HFCA 1YKHB 4F8HA 2QGSA 4ZI7E 1NAFA 2A88A 2NW7A 4DUYT 1XZYA 2RETA 1T8BA 4JBWF 5JDNA 2M6IA 2LRKA 3TLUA 5IUXA 3VR8A 3TLTA 4JI1T 1BR2A 1N34T 3FZMB 2E9XC 1LKXA 2WS3A 3HKEE 3BQIA 2YDQA 2Q9QD 3ZYMA 2L9QA 3Q2MA 5LB7B 4UXNB 4YTPA 4DR7T 2MAWA 5JDMA 4CN4A 2XQ6A 1X79A 4YJ3E 4AIUA 4QHOA 4DIDB 4U2ZA 3IUBA 2N1GA 3JC6D 4ZOLE 1UGOA 3AE9A 3CFAL 1MMDA 2NW9A 2LSYA 3EDVA 2WP9A 3RF1A 2FJEA 1E7PA 2JQHA 3OVUA 4MLKA 2FUPA 3B5MA 4IDOA 3AEDA 3LFMA 5HWXA 5HXSA 3UTKA 2EHOD 4UF0B 2QRXA 3ZT7A 1JNZA 4MUGA 1ZV4X 4Z90A 2E9XB 1Y64B 5KDMC 2UU9T 3CFFL 2UUAT 2E8IA 4U7YA 5JDLA 4NUUA 4NXMT 4CI1B 5LBMA 1HTJF 3GWHA 4KHPT 2NTXA 4V1Av 2NWBA 4YTMA 2CBIA 2V26A 3PE0A 2X67A 5FNVE 3MXTA 4X64T 4I43B 3RI5A 2XQ7A 5LHHB 5L3GB 5L3DB 5LGNB 1KNZA 1YKEB 1OWAA 4B3TT 3R6NA 3WAJA 4MUJA 4DDKA 4DMVA 3N8HA 4AQGA 2JPFA 1HNWT 2HHHT 4KI0F 4KX6A 4HFHA 2LJLA 5AQIB 4G2AA 2W61A 4O4LE 3NRXA 3ZMTB 3Q9DA 2H7VC 2XTLA 4CZZB 5DJQC 5AFUL 5LYJE 4AQFC 1IAPA 3ZMZB 1G73A 1E2AA 3OKQA 3PUAA 2I59A 2JMHA 2G0UA 2DHRA 4WNKA 3KBTA 1W0BA 1OEDB 3IOCA 3PUGA 1WR0A 3EAMA 2OA5A 4EV6A 4HN9A 3C50A 1IHOA 3RC8A 4MULA 2XAHB 3UQ7A 3UU3A 3PU8A 4IL9A 2MBGA 3IA3A 4ZZBA 2A86A 5JDGA 5EXCA 3X1DA 2PJQA 4X1IE 2CBJA 2GK9A 4ILUA 4AKIA 2D2SA 2WQYA 1ZEEA 3ONJA 2YINA 3IODA 2Q9QA 2VKJA 4EYYR 3ZN1B 5HAXA 3ZSSA 4ZI2D 1MMAA 4ZI3C 3K3NA 4DDHA 4GIWA 2X0LB
chains in the Genus database with same CATH topology
2V7IA 5DABA 3IVXA 4ANJA 2MOZA 3GA8A 4FI5A 1MMGA 4ZS3A 4H9SE 4XAXB 5EZYE 3SRZA 3PURA 5CA0E 1LVFA 4C91A 4G63A 2XAJB 1OXZA 1N2EA 1FMWA 4H9NC 4PJJA 3I1AA 4UIGA 4MUNA 3W15B 4OK0A 4P0BA 1FMVA 5JVDE 3KDSE 4E7ZA 3MK7C 3L3PA 4C90A 5LP6E 4H9RC 2L3LA 3O1IA 2XQYA 1LVKA 2VKOA 3CVRA 3NZQA 4L0RA 2LSIA 5LXTE 3IMEA 3UA0A 3AA0B 3NZPA 3ONXA 3C64A 2KZ7B 4IGUA 4CQIA 3AA6B 2YU1A 3R84B 2WM9A 1E1HB 5J2UE 3I9YA 4MBQA 5FYMA 5HXCA 3E22E 4TN7B 3PUSA 1V8FA 5FY7A 1EZ3A 1FIOA 2LOPA 3RRWA 3AA1B 4YLHA 2PG8A 3COWA 2Y8DA 1ZHCA 3QC9A 5C8YE 1Z0PA 4GOUA 4DMWA 3Q5WA 2HH7A 3UY4A 4OYJA 5L3CB 3P8CD 5HYAA 3RRCA 3HA4A 3AG6A 3BK9A 1WLXA 2ODUA 3IHRA 4O8SA 3KINB 2EHOA 4O2AE 3CPZA 4L5GA 5JRCA 3H37A 4MFRA 4UVBB 2LOSA 2Y48B 3DP7A 4GK5E 4EAHA 3S4UA 2NW8A 2CMRA 2DLRA 1G8XA 1S35A 4UV9B 2A53A 2VK9A 4QXHB 5IHYA 3B57A 3ZMSB 4BJMA 3LE8A 4QX7B 2X9HA 2Q9QC 2CM0A 2ZM2A 5LGUB 2EJCA 1SHZC 5LBQB 4PJNA 3RH3A 3PDYA 4KBMB 2K5BB 3SS1A 3ZPOA 4MUIA 5F3JA 4HEAA 3UFEA 3CX8B 3ZEFB 2G5ZA 4IE4A 4U72A 4I4TE 3FHNA 3COYA 1N2JA 3SWHA 2BZBA 2CXDA 1MNDA 2KMFA 4H63V 1HG5A 4J2CA 4H63H 5JR9A 2W0GA 1BR0A 5FXZA 2ES0A 3N9OA 4UV8B 5F8PA 4DDMA 3UULA 3LK42 4JLEA 3CMLA 4WBOA 4MUFA 4DE5A 3IOEA 4IE6A 4CXWA 4UVAB 3U78A 1HFAA 2D0TA 2LT3A 3F57A 4WBNE 4ZS2A 3KVAA 2ODVA 3RYCE 4ERRA 1IJ5A 3C4WA 2WAUA 3HKCE 3GN5B 3ZMUB 5CA1E 5L2LA 3AB3B 3HR0A 3ZN0B 3ANWB 4IIJE 3MA9A 4AKLA 2LM9A 2XASB 4UEMA 2MTQA 3UUNA 1HG2A 3HL6A 2JJ9A 3K8PC 5GONE 2A72A 3QTTA 2A56A 1CUNA 3OBVE 4BAYB 1UCUA 2K9AA 4GK0E 4EZHA 4JUYA 2PFVA 2KINB 1D0ZA 4JEUB 4PJMA 3SOLA 4CI3B 5G2FA 4MUHA 1D0YA 3KV4A 3TKLB 4I50E 3N9PA 5ADXL 3N2KE 2XAFB 2V7JA 5JH7E 5LHIB 3AAEB 1FEWA 4FJOA 5CB4E 3ZJ1A 5FY1A 3PU3A 4MUEA 5LGTB 1UX4A 4H9QC 4KP3C 4HGAA 3BQKA 4XZCA 4Z8XA 2KWIB 4ASKA 3VKGA 3IVGA 2V7LA 3PTRB 4UF0A 4YJ2E 4PNIA 4DNDA 3I9WA 4AKRB 4NUVA 4P09A 2X51A 4AKHA 2CA5A 2X9YA 3AVRA 3QUJA 2C5JA 4P0AA 3O1HA 3OYZA 1HCIA 2WSSV 1YD8G 2QA7A 4G5YA 2Z6EA 2WBLA 5H6RB 4QWNB 2E9XA 1MMNA 2Q9QB 4EFKA 3LG7A 2LHNA 1MNEA 2V7MA 1NWMX 3ESLA 5FXXA 3K3OA 3Q5XA 4AQFA 2YEVC 3CFHL 3KBUA 4PK4A 5HXHA 1QUUA 2ZM0A 3MACA 4ZHQE 2A3DA 4K0UA 2D0UA 3RX6A 2NTYA 2PBIA 3LBXB 4TX5A 1IZNB 4ZI3D 2Y6XA 3L09A 2ACXA 5JR9C 2K24A 3C4XA 4IE0A 1B7TA 2LEHA 2V7KA 2G3DA 5L3BB 5E0OA 3ZCJA 4HE8A 4E7SA 2MYSA 2KWHA 2D5UA 1N2IA 4G5FA 3FBLA 1S94A 4QKNA 2LSKA 3EUHA 5HG0A 1T98A 3Q10A 2M67A 2HPLA 1HS7A 4DBRA 2BVLA 2RP4A 2CWYA 2W00A 4IE7A 3HKDE 1U4QA 2ZLYA 4AKGA 2H3RA 3RYFE 3MJXA 2SPCA 2A54A 1KK7A 1O3XA 4BA9A 4HFVA 2JRKA 3O9XA 4MUKA 3C51A 3UUMA 5EK2A 4PFPA 2KT9A 5LJNA 3RYHE 3ZYLA 1YKHB 2QGSA 3P7IA 3ZC0A 3CQXC 3VU7H 5J1GA 4ZI7E 2A7XA 2IC9A 1NAFA 4U74A 4TUYE 5H6QB 5M4YA 2A88A 3COVA 2EHOB 3FXEB 4ISTA 2NW7A 5J2TE 1N2GA 5L3EB 2HPJA 4TV8E 5JRCB 4EXTA 3COZA 3FXDB 4IHJE 2C5IT 3KVBA 2XAGB 3B13A 1MIVA 5JDNA 3N9NA 3CWZB 3DTOA 3I0QA 3UUXB 5DQWA 4OYKA 4OHFA 3K3NA 3VHLA 1BR2A 4QX8B 5KMGP 5LHGB 2E9XC 1LKXA 3HKEE 3BQIA 5JDHA 3JC6C 2Q9QD 3ZYMA 2L9QA 3Q2MA 3INNA 4UXNB 2H7OA 5DQVA 4EIWA 2X68A 1IJ6A 3N9MA 5JDMA 5HXEA 3AVSA 1X79A 4YJ3E 4QHOA 3V5UA 2VL8A 1QSDA 2E9XD 2CWOA 3IMGA 5JR9B 2B1EA 3ETUA 2N1GA 4PJLA 3CKDA 3V5SA 3IUBA 2ZMAA 3JC6D 4ZOLE 3AG5A 4IDZA 4O4IE 2XAQB 4HKAA 1YW0A 3CFAL 1MMDA 2NW9A 2LSYA 1N2BA 3EDVA 3K3QC 4A56A 3HI2A 3T8OA 4X1YE 5HWYA 3KFWX 4IXJA 1D1CA 2DCFA 2JMKA 3BQLA 4MHCA 2V1DB 3WI3A 2A50A 3U3IA 5IYZE 2X3FA 4EYUA 4DVDA 2EHOC 4DBQA 5FP3A 4PK5A 2X9WA 5LA6E 4MLKA 4MALA 4GYSA 2WWUA 2XHEB 2W62A 1WYCA 3I0OA 4H9PC 4OFZA 3N2OA 2A84A 3LFMA 5HWXA 5HXRA 5HXSA 1MIYA 3UTKA 4IE5A 2EHOD 2IW5B 4UF0B 1D0XA 3C4ZA 2CXLA 3F2EA 4AI6A 1N2OA 3NRYA 3IOBA 3IMCA 5JQGE 3ISJA 1LRZA 2BVMA 2C5KT 4N78D 2CE7A 4MUGA 4M1PA 3ZLIA 3O1JA 3UK2A 1ZV4X 2E9XB 2WMNA 1Y64B 2IC6A 5EK4A 3AA7B 4O2BE 5KDMC 2BDEA 3CFFL 5JDFA 5LJMA 2DWKA 2E8IA 3KV9A 5JDLA 3H3AA 4O4JE 3VKHA 4DO0A 4NUUA 3N9QA 3D0TA 4QXBB 4MQ6A 4CI1B 2CXFA 2YK0A 4F6RC 5LBMA 2N2NA 3IF8B 1HTJF 4KUMB 3GWHA 4PW8A 2CCQA 3ZJ2A 2NTXA 4V1Av 3LK3B 2KXPB 2WMOA 3CQGB 2NWBA 3F31A 4X20E 3KV5A 3PUQA 4L9IA 2V26A 3PE0A 2X67A 5FNVE 3N5LA 3AAAB 3MXTA 3ZMVB 4I43B 5KX5E 2DNXA 2G16A 2C0SA 5LHHB 3GMIA 5L3GB 5L3DB 2NP9A 5LGNB 3IVCA 1KNZA 3N9LA 2ZM8A 4CI2B 1YKEB 3RYIE 4EOZB 2YU2A 1OWAA 3R6NA 1U5PA 3WAJA 4MUJA 4CXYA 3LF4A 4DMVA 4DDKA 2VASA 2DWGA 4H9OC 3N8HA 4AQGA 1H7CA 5FXVA 4B6XA 3QK6A 2CLYC 2JPFA 5FXWA 3A5XA 5ETWA 2LSJA 4PK6A 2KNDA 5EK3A 3ZCIA 3M65A 2JQQA 3EDUA 2LJLA 2VB6A 2VKHA 1AJ3A 1HX8A 3IUEA 4G2AA 2W61A 3ETVA 3WAKA 3CX7B 4EF6A 4O4LE 3NRXA 3ZMTB 1ZKEA 4UVCB 3J9X1 3RKOA 2J1DG 3Q9DA 2H7VC 2XTLA 4TZ4C 5DJQC 5LOVE 4CZZB 5AFUL 3FB2A 4AXPA 5LYJE 2N9DA 2K48A 4AQFC 1IAPA 5LG4A 2A2FX 5L3FB 3ZMZB 4X1KE 5TAOA 1G73A 4PFOA 4PAGA 4TV9E 2A52A 3OKQA 3PUAA 2I59A 4BHRA 5KWVA 2KLQA 4CXXA 4EZ4A 3MXZA 4YHJA 3CX6B 1MIWA 2JMHA 1WRDA 2RA1A 5A1LA 2GW4A 2G0UA 5LCYA 2DHRA 1UFVA 3AAIA 4WNKA 5JREA 3MUEA 3KBTA 4XBFB 4DDHA 2NOXA 3GN5A 1D1AA 2CEAA 2G2SA 3IOCA 3ANWA 3PUGA 1SA0E 3MZKB 3EVYA 3IBPA 2P9BA 2XUEA 4HTEA 2OA5A 3N2GE 3ZC1A 3FBZA 4HN9A 1WR6A 3O4XE 5JDQA 3NBXX 3C50A 1MOPA 3Q12A 3KV6A 5FMNA 3E08A 3J7Yq 1IHOA 3RPUA 2LSGA 1BR4A 2XAHB 3RC8A 4ADZA 3PU8A 4MULA 2MBGA 3LJCA 2VKDA 2LE8A 3OJAA 4UELA 2A86A 5JDGA 5EXCA 1VRBA 3CQCB 2PJQA 4I55E 4O4HE 4X1IE 2X66A 1VOMA 1V9DA 3UT5E 2VWAA 2GK9A 4ILUA 4QXCB 2X9XA 4BJNA 4FZJA 2UXNB 3C98B 4YFSA 4ZI2C 4AKIA 2D2SA 2CLYB 2UXXB 1HF8A 4WW0A 1ZEEA 2W63A 2YINA 2DI4A 1D1BA 3DJBA 1UX5A 3MKDA 3IODA 3RC3A 4ISSA 1BR1A 2Q9QA 2VKJA 3ZYKA 4EYYR 3IEEA 4KMCA 5FY0A 3ZN1B 2IAKA 5HAXA 4JEHB 2LHRA 1WYBA 3E0ZA 4ZI2D 1MMAA 3HKBE 4EB6E 3LK2B 4ZI3C 3LBXA 3OYXA 4GYRA 5LNKA 1US7B 2L8KA 5BMVE 4GIWA 2X0LB 1N2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HL6 A; 
#chains in the Genus database with same CATH topology
 1HNX T;  5DAB A;  3IVX A;  4ANJ A;  3GA8 A;  4FI5 A;  4H9S E;  3PUR A;  5ABH A;  4G63 A;  4YHH T;  4H9N C;  3I1A A;  3MK7 C;  1WFD A;  4H9R C;  3O1I A;  3IME A;  3ONX A;  2YU1 A;  2M6B A;  4MBQ A;  3NWI A;  4DV0 T;  3COW A;  2Y8D A;  3QC9 A;  1Z0P A;  4GOU A;  3Q5W A;  3UY4 A;  2IIU A;  4OYJ A;  4HFD A;  3HA4 A;  4LF9 T;  2ODU A;  3EHZ A;  2EHO A;  2LOS A;  3S4U A;  2NR4 A;  4JI3 T;  5IHY A;  3RKG A;  3ZMS B;  3FZK B;  4BJM A;  3LE8 A;  2ZM2 A;  3PDY A;  5KXJ A;  1JNR A;  1NEK A;  4MUI A;  4DV3 T;  4I4T E;  1N36 T;  2XQ9 A;  1N2J A;  5JR9 A;  2W0G A;  2ZM6 T;  1BR0 A;  2ES0 A;  3JAF A;  4JLE A;  4CN1 A;  2FBW A;  4ZS2 A;  4ERR A;  1HR0 T;  3C4W A;  2WAU A;  3HKC E;  5CA1 E;  3ZN0 B;  4IIJ E;  3MA9 A;  5LG3 A;  4AKL A;  4IDN A;  2MTQ A;  3T1Y T;  1M62 A;  4BAY B;  1UCU A;  3PV0 F;  1D0Z A;  4PJM A;  3RGL A;  2XQA A;  2E2A A;  3TKL B;  5LMU T;  5ADX L;  3AAE B;  5CB4 E;  5FY1 A;  5LGT B;  3IVG A;  4XZC A;  4IL4 A;  2V7L A;  4YJ2 E;  4PNI A;  2LLY A;  4P09 A;  3OPC A;  3M3Z B;  4DV2 T;  3P50 A;  2V6Y B;  2I6H A;  1YD8 G;  2Z6E A;  2IDO B;  1KEY A;  5HEH A;  1R8I A;  1MNE A;  1NWM X;  4JI4 T;  4JI7 T;  4PK4 A;  2QVA A;  1GQE A;  2D0U A;  3LBX B;  4TX5 A;  1ZP0 A;  1L0V A;  3TLV A;  2LEH A;  2G3D A;  2LKH A;  2BKO A;  2VQF T;  4E7S A;  2MYS A;  2D5U A;  1N2I A;  4G5F A;  3FBL A;  1W0A A;  2LSK A;  1T98 A;  3Q10 A;  2M67 A;  2HPL A;  1HS7 A;  2CWY A;  2W00 A;  4IE7 A;  3HKD E;  1U4Q A;  4AKG A;  3RYF E;  2A54 A;  3AE6 A;  4HFV A;  3O9X A;  5AQR B;  3JCF A;  4PFP A;  5LJN A;  3RYH E;  2WDV A;  5BR8 T;  3VU7 H;  2A7X A;  2IC9 A;  2BS3 A;  2WCA A;  5H6Q B;  4IST A;  2HPJ A;  4TV8 E;  5JRC B;  3COZ A;  3FXD B;  2XAG B;  3N9N A;  3I0Q A;  5AQO B;  4DR2 T;  4OYK A;  3VHL A;  4QX8 B;  4DR4 T;  3Q5D A;  2FJD A;  2H7O A;  5DQV A;  4EIW A;  3CFI A;  5L47 A;  3N9M A;  5HXE A;  3AVS A;  2VL8 A;  5CGM A;  2E9X D;  3V5S A;  3LSV A;  2XSA A;  3AG5 A;  2LME A;  4HKA A;  3K3Q C;  3EI0 A;  4X1Y E;  3KFW X;  2DCF A;  4MHC A;  2V1D B;  1J1J A;  2X3F A;  4DVD A;  4DBQ A;  5FP3 A;  2X9W A;  4MAL A;  4TWH A;  2WB5 A;  2WWV A;  2WWU A;  3RIF A;  2XHE B;  3P4W A;  3N2O A;  2FJB A;  3UUB A;  2IW5 B;  3C4Z A;  2YDS A;  3F2E A;  4AI6 A;  2XPK A;  4LFB T;  3IMC A;  2B76 A;  2BVM A;  2C5K T;  2WZI A;  4M1P A;  2WMN A;  2IC6 A;  5EK4 A;  3AA7 B;  4O2B E;  3KV9 A;  3H3A A;  4DO0 A;  4DR6 T;  3IF8 B;  5FVL A;  3LK3 B;  2KXP B;  2WMO A;  5FVK A;  4NIQ A;  4QH1 A;  3ZMV B;  5KX5 E;  2C0S A;  4WYV A;  5J0Z A;  1M7K A;  4CI2 B;  3RYI E;  4EOZ B;  2VAS A;  5FXV A;  4NXN T;  4B6X A;  2CLY C;  5FXW A;  3A5X A;  5ETW A;  3EDU A;  1AJ3 A;  4B3M T;  3CX7 B;  3ZYL A;  3FB2 A;  2N9D A;  3ONL C;  3AE8 A;  3UU5 A;  4B3R T;  4TV9 E;  2H89 A;  4PAG A;  2A52 A;  4HFI A;  4X62 T;  2KLQ A;  3VRA A;  4JV5 T;  5LCY A;  5JRE A;  4LF8 T;  3MUE A;  1KF6 A;  4XBF B;  3GN5 A;  3UFG A;  3ANW A;  1SA0 E;  2WDQ A;  2IUB A;  1SE7 A;  3IBP A;  4LMK A;  3ZC1 A;  3FBZ A;  5ABE A;  2JQ9 A;  1UK5 A;  4X66 T;  3CI0 I;  2UXD T;  2VKD A;  3CQC B;  2XJ7 A;  5FL1 A;  1VOM A;  1V9D A;  2VWA A;  4FZJ A;  4QXC B;  2CLY B;  4WW0 A;  3MKD A;  4KHZ F;  1VCT A;  4ISS A;  4U2Y A;  3IEE A;  2IAK A;  1Z8U A;  4JEH B;  3E0Z A;  4U31 A;  5AQU B;  3HKB E;  5LNK A;  3OYX A;  4LML A;  1US7 B;  1OED C;  1MMG A;  1IBL T;  3SRZ A;  4YY3 T;  2XAJ B;  1OXZ A;  1N2E A;  3FZL B;  5JVD E;  4E7Z A;  4C90 A;  5LP6 E;  1QLB A;  2W2U A;  2L3L A;  2XQY A;  2VKO A;  3CVR A;  4L0R A;  2LSI A;  3UA0 A;  3AA0 B;  5AQN B;  3E22 E;  4TN7 B;  1W9R A;  1V8F A;  5FY7 A;  4YLH A;  1ZHC A;  3UQ4 A;  3ZT6 A;  5AQM B;  3P8C D;  3RRC A;  4LFC T;  3KIN B;  2X0Y A;  4L5G A;  4ILB A;  4GK5 E;  2V5D A;  1UUS A;  1ZOY A;  2DLR A;  4JI5 T;  1G8X A;  2A53 A;  2LRL A;  5AQJ B;  2Q9Q C;  2CM0 A;  2DL1 A;  3RH3 A;  4KBM B;  1HX1 B;  2G5Z A;  5FL0 A;  4U72 A;  4DV1 T;  2JIW A;  3COY A;  2H88 A;  2CXD A;  1MND A;  1HG5 A;  4J2C A;  3AEE A;  3SFE A;  2KSR A;  5FXZ A;  3RHW A;  4UV8 B;  4DDM A;  4ILC A;  3UUL A;  3LK4 2;  4MUF A;  3IOE A;  4IE6 A;  4CXW A;  1HFA A;  4WBN E;  3RYC E;  2YOE A;  3ZMU B;  3AB3 B;  3HR0 A;  2LM9 A;  3UUN A;  4A98 A;  1HG2 A;  2JJ9 A;  2XSB A;  3K8P C;  5GON E;  3PUX F;  2K9A A;  4GK0 E;  4DV6 T;  4JUY A;  5AQG B;  4JEU B;  3SOL A;  3TLW A;  4CI3 B;  5HEO A;  3KV4 A;  4I50 E;  3N2K E;  4U33 A;  5JH7 E;  5LHI B;  4GKK T;  4CN6 A;  1FEW A;  4LMJ A;  3PU3 A;  4MUE A;  1UX4 A;  2V5C A;  3P4P A;  4AKR B;  4AKH A;  2CA5 A;  3QNU A;  4P1N A;  2X9Y A;  4P0A A;  3O1H A;  2WSS V;  3P4Q A;  4G5Y A;  1MMN A;  2Q9Q B;  2GR7 A;  3LG7 A;  5FXX A;  4YXD A;  4EGW A;  3Q5X A;  4AQF A;  3KBU A;  1QUU A;  4K0U A;  3RX6 A;  2PBI A;  5JR9 C;  3C4X A;  4TNV A;  2KWH A;  2XM2 A;  3EUH A;  5HG0 A;  5AQS B;  2XY8 B;  3RIU C;  2H3R A;  3MJX A;  1KK7 A;  1O3X A;  4BA9 A;  2JRK A;  2VVN A;  3AEG A;  3AEB A;  3P7I A;  4DUZ T;  3P4R A;  4U74 A;  4TUY E;  5M4Y A;  2EHO B;  3FXE B;  5J2T E;  4IHJ E;  2C5I T;  3KVB A;  3B13 A;  1XWM A;  5L4E A;  3CWZ B;  3DTO A;  3UUX B;  5DQW A;  1XDO A;  4OHF A;  4YSX A;  2WY2 A;  1IBK T;  2MPK A;  3INN A;  4DR3 T;  2RPA A;  2X68 A;  1IJ6 A;  4YT0 A;  3V5U A;  1QSD A;  2CWO A;  2W67 A;  5JR9 B;  2B1E A;  3ETU A;  3IMG A;  1WCR A;  4IDZ A;  2XAQ B;  3JAD A;  4JYA T;  1N2B A;  3ZT5 A;  4TWD A;  4HWH A;  3HI2 A;  3AEC A;  1N33 T;  1D1C A;  2JMK A;  2PTF A;  5HCM A;  3U3I A;  4EYU A;  3JAE A;  2HN2 A;  5LA6 E;  2BG9 E;  2AE9 A;  2W62 A;  4H9P C;  4OFZ A;  2A84 A;  3CI0 K;  2CXL A;  1I6Z A;  3NRY A;  5AQT B;  4TWF A;  1J5E T;  5JQG E;  5IWA T;  2BKN A;  3ISJ A;  4N78 D;  4HWI B;  3O1J A;  3AE2 A;  2BS4 A;  2BDE A;  2DWK A;  4QXB B;  2YK0 A;  4KUM B;  3AE5 A;  1W09 A;  3F31 A;  4UR9 A;  3N5L A;  3AAA B;  3AXJ A;  2DNX A;  3UU6 A;  2G16 A;  3GMI A;  2NP9 A;  3N9L A;  4LF7 T;  2YU2 A;  2OV9 A;  2W4X A;  4H9O C;  4IDP A;  1H7C A;  3QK6 A;  2LSJ A;  4PK6 A;  5EK3 A;  3M65 A;  2JQQ A;  4EEB A;  1ZKE A;  4UVC B;  4EZ4 A;  2J1D G;  4TZ4 C;  4AXP A;  1KNP A;  5LG4 A;  2D9D A;  2AXD S;  3SFD A;  4CXX A;  3MXZ A;  3CX6 B;  1MIW A;  2XM1 A;  1WRD A;  2RA1 A;  2IHR 1;  2J4G A;  1UFV A;  3AAI A;  3P4S A;  4TNW A;  2J47 A;  2CEA A;  3VRB A;  2OLT A;  3ABV A;  4WZX A;  1NEN A;  3EVY A;  2A9U A;  2XUE A;  3N2G E;  5JDQ A;  2ACZ A;  3Q12 A;  3KV6 A;  4X5T A;  3E08 A;  3RPU A;  2LSG A;  4ADZ A;  3LJC A;  2LM2 A;  3PUV F;  4K0K T;  2WZH A;  2I0M A;  4I55 E;  4O4H E;  4IRE A;  5C2T A;  5ABG A;  3UT5 E;  2X9X A;  4BJN A;  2UXN B;  3C98 B;  2UXX B;  2BS2 A;  2DI4 A;  1D1B A;  3DJB A;  3RC3 A;  1BR1 A;  2UXB T;  2YN6 A;  5LMN T;  5ABF A;  1WYB A;  4DV7 T;  5AQH B;  4GKJ T;  3LK2 B;  3L39 A;  4GYR A;  1N2H A;  2UUB T;  4XAX B;  4IDQ A;  1LVF A;  1FMW A;  4PJJ A;  2K3W A;  4HWC A;  4MUN A;  4OK0 A;  1FMV A;  5CJ5 A;  3L3P A;  1XDP A;  3UU8 A;  1LVK A;  3NZQ A;  4YTN A;  3NZP A;  3C64 A;  2KZ7 B;  4CQI A;  1OED E;  3R84 B;  2WM9 A;  1E1H B;  5J2U E;  3I9Y A;  5FYM A;  3PUS A;  1FIO A;  2LOP A;  2BG9 A;  3AA1 B;  2IEC A;  3OTO T;  5HYA A;  2UUC T;  1WLX A;  5HEU A;  4O2A E;  3CPZ A;  5AQV B;  3H37 A;  2Y48 B;  4EAH A;  2CMR A;  1S35 A;  4QXH B;  5AQQ B;  2WDR A;  3B57 A;  4HWF A;  4QX7 B;  2X9H A;  2EJC A;  4LF5 T;  4HEA A;  3UFE A;  4IE4 A;  2CHN A;  3FHN A;  2F4V T;  2KMF A;  4Z91 A;  4H63 V;  4H63 H;  1T72 A;  1J5W A;  1N32 T;  3N9O A;  5AQF B;  4WBO A;  4UVA B;  3U78 A;  2D0T A;  2ODV A;  5AQP B;  2BBH A;  1IJ5 A;  4NPP A;  3GN5 B;  5L2L A;  3VR9 A;  3ANW B;  2XAS B;  4UEM A;  2XQ5 A;  2A72 A;  1CUN A;  1XNQ T;  1FJG T;  4EZH A;  2PFV A;  2KIN B;  3LDQ B;  4YSZ A;  4MUH A;  1D0Y A;  4DV4 T;  3N9P A;  2V7J A;  3ZJ1 A;  3QOF A;  4H9Q C;  4Q25 A;  4HGA A;  3BQK A;  2YDR A;  3VKG A;  4UF0 A;  4NUV A;  2X51 A;  3QUJ A;  3AVR A;  4A97 A;  2WBL A;  2X0H A;  4QWN B;  2E9X A;  3Q5E A;  3K1S A;  2LHN A;  2V7M A;  2YEV C;  3CFH L;  4ZHQ E;  2A3D A;  2NTY A;  1IZN B;  4ZI3 D;  3L09 A;  2ACX A;  3PJA A;  4IE0 A;  4EED A;  3ZCJ A;  4JI6 T;  4HE8 A;  2E5V A;  2V6X A;  3AEA A;  2RP4 A;  2SPC A;  1XNR T;  2HN1 A;  3UUM A;  2KT9 A;  2WU5 A;  3ZC0 A;  2WU2 A;  3CQX C;  5J1G A;  3COV A;  1N2G A;  5L3E B;  2BBJ A;  4EXT A;  1MIV A;  4AIS A;  3FZH B;  5KMG P;  5LHG B;  2W66 A;  5JDH A;  3JC6 C;  4JI2 T;  3RIA A;  1OED A;  2CHO A;  1UUR A;  4PJL A;  3CKD A;  1XMQ T;  2ZMA A;  4O4I E;  4YSY A;  1YW0 A;  4ILA A;  3H3M A;  3CK6 A;  3TLS A;  4LFA T;  4A56 A;  3T8O A;  5HWY A;  5HEG A;  4IXJ A;  3BQL A;  4ZXL A;  3WI3 A;  4ZZC A;  4A5X A;  2A50 A;  5IYZ E;  2EHO C;  3RLF F;  4PK5 A;  5C3J A;  4GYS A;  3ZKR A;  3G06 A;  1WYC A;  3I0O A;  5HXR A;  1MIY A;  3FZF B;  4IE5 A;  1D0X A;  2CPT A;  1N2O A;  3IOB A;  4DR1 T;  5HCJ A;  1YQ4 A;  3ZST A;  1LRZ A;  4B3S T;  2CE7 A;  3ZLI A;  3UK2 A;  2E5L T;  4JI8 T;  4LF6 T;  3AE7 A;  5JDF A;  5LJM A;  4HWD A;  2GR8 A;  4O4J E;  3VKH A;  3N9Q A;  3D0T A;  4MQ6 A;  2CXF A;  4F6R C;  2N2N A;  5L4H A;  4PW8 A;  2CCQ A;  3ZJ2 A;  4X20 E;  3CQG B;  3KV5 A;  3PUQ A;  4L9I A;  3QB5 A;  2VQE T;  4OX9 T;  3NVO A;  5FKY A;  5AQK B;  2JQK A;  3RQW A;  3IVC A;  2ZM8 A;  2QYW A;  1U5P A;  4CXY A;  3LF4 A;  4I0U A;  2DWG A;  2VUR A;  2KND A;  3ZCI A;  2LKG A;  3PJA J;  4LF4 T;  2VB6 A;  2VKH A;  3IUE A;  1HX8 A;  4HFE A;  3WAK A;  1YQ3 A;  3ETV A;  4EF6 A;  3PUY F;  3J9X 1;  3RKO A;  5LOV E;  2XQ8 A;  2K48 A;  2VVS A;  2A2F X;  4QH4 A;  5L3F B;  4X1K E;  5TAO A;  4PFO A;  5AQL B;  4BHR A;  5KWV A;  3CIR A;  4QH5 A;  4YHJ A;  5A1L A;  2GW4 A;  2R6G F;  4AQY T;  2NOX A;  3A7M A;  1D1A A;  3UU4 A;  1I94 T;  2G2S A;  3AEF A;  3MZK B;  2P9B A;  4HTE A;  1WR6 A;  3O4X E;  5JTG A;  3NBX X;  1MOP A;  5FMN A;  3RIU A;  2J62 A;  3J7Y q;  1BR4 A;  2LE8 A;  3OJA A;  4UEL A;  1VRB A;  4U3C A;  2X66 A;  1HNZ T;  4YFS A;  4ZI2 C;  5F5W A;  1HF8 A;  4COF A;  2V6Y A;  2W63 A;  3PUW F;  1UX5 A;  2VL0 A;  2XZE A;  2UXC T;  5CFB A;  3ZYK A;  4KMC A;  5FY0 A;  2LHR A;  3T1H T;  4EB6 E;  3LBX A;  3RRW A;  2L8K A;  5BMV E;  4U7I A;  2V7I A;  3AE4 A;  2MOZ A;  4ZS3 A;  5EZY E;  1Y01 A;  5CA0 E;  4C91 A;  2FJA A;  4UIG A;  3W15 B;  4P0B A;  3KDS E;  5LXT E;  4IGU A;  4ZEY A;  3AA6 B;  5HXC A;  1IBM T;  3A8Y C;  1EZ3 A;  1CHU A;  2PG8 A;  4IT4 A;  5C8Y E;  2XQ3 A;  3AXJ B;  3EMO A;  4DMW A;  2HH7 A;  5L3C B;  2V8S V;  3AG6 A;  3BK9 A;  1X9B A;  3IHR A;  4O8S A;  5JRC A;  4MFR A;  4UVB B;  3DP7 A;  1XMO T;  2NW8 A;  4UV9 B;  2VK9 A;  1YXR A;  5LGU B;  1SHZ C;  5LBQ B;  4PJN A;  2K5B B;  3SS1 A;  3ZPO A;  5F3J A;  3CX8 B;  3ZEF B;  2XQ4 A;  3SWH A;  2BZB A;  2I52 A;  3RQU A;  3QB5 K;  1T7S A;  5F8P A;  3CML A;  4DE5 A;  5HEJ A;  2LT3 A;  4X65 T;  3F57 A;  3KVA A;  2CRB A;  3PUZ F;  3HL6 A;  3QTT A;  2A56 A;  1SUM B;  3OBV E;  2BG9 C;  5BW0 B;  4DV5 T;  4HFB A;  5G2F A;  3L8R A;  2XAF B;  4FJO A;  4KP3 C;  4Z8X A;  2KWI B;  4ASK A;  3PTR B;  4DND A;  1VCS A;  1KNR A;  3I9W A;  2YKS A;  2C5J A;  3OYZ A;  1HCI A;  1DU2 A;  2QA7 A;  5H6R B;  4JI0 T;  3EAB A;  4EFK A;  3ESL A;  3K3O A;  5ABF B;  5HXH A;  2ZM0 A;  3MAC A;  3AE3 A;  2Y6X A;  2K24 A;  1B7T A;  2V7K A;  2BKP A;  5L3B B;  2IML A;  5E0O A;  1KFY A;  1S94 A;  4QKN A;  4DR5 T;  4DBR A;  2BVL A;  2ZLY A;  3NKZ A;  2OGF A;  2BG9 B;  4MUK A;  3C51 A;  5EK2 A;  3AE1 A;  4HFC A;  1YKH B;  4F8H A;  2QGS A;  4ZI7 E;  1NAF A;  2A88 A;  2NW7 A;  4DUY T;  1XZY A;  2RET A;  1T8B A;  4JBW F;  5JDN A;  2M6I A;  2LRK A;  3TLU A;  5IUX A;  3VR8 A;  3TLT A;  4JI1 T;  1BR2 A;  1N34 T;  3FZM B;  2E9X C;  1LKX A;  2WS3 A;  3HKE E;  3BQI A;  2YDQ A;  2Q9Q D;  3ZYM A;  2L9Q A;  3Q2M A;  5LB7 B;  4UXN B;  4YTP A;  4DR7 T;  2MAW A;  5JDM A;  4CN4 A;  2XQ6 A;  1X79 A;  4YJ3 E;  4AIU A;  4QHO A;  4DID B;  4U2Z A;  3IUB A;  2N1G A;  3JC6 D;  4ZOL E;  1UGO A;  3AE9 A;  3CFA L;  1MMD A;  2NW9 A;  2LSY A;  3EDV A;  2WP9 A;  3RF1 A;  2FJE A;  1E7P A;  2JQH A;  3OVU A;  4MLK A;  2FUP A;  3B5M A;  4IDO A;  3AED A;  3LFM A;  5HWX A;  5HXS A;  3UTK A;  2EHO D;  4UF0 B;  2QRX A;  3ZT7 A;  1JNZ A;  4MUG A;  1ZV4 X;  4Z90 A;  2E9X B;  1Y64 B;  5KDM C;  2UU9 T;  3CFF L;  2UUA T;  2E8I A;  4U7Y A;  5JDL A;  4NUU A;  4NXM T;  4CI1 B;  5LBM A;  1HTJ F;  3GWH A;  4KHP T;  2NTX A;  4V1A v;  2NWB A;  4YTM A;  2CBI A;  2V26 A;  3PE0 A;  2X67 A;  5FNV E;  3MXT A;  4X64 T;  4I43 B;  3RI5 A;  2XQ7 A;  5LHH B;  5L3G B;  5L3D B;  5LGN B;  1KNZ A;  1YKE B;  1OWA A;  4B3T T;  3R6N A;  3WAJ A;  4MUJ A;  4DDK A;  4DMV A;  3N8H A;  4AQG A;  2JPF A;  1HNW T;  2HHH T;  4KI0 F;  4KX6 A;  4HFH A;  2LJL A;  5AQI B;  4G2A A;  2W61 A;  4O4L E;  3NRX A;  3ZMT B;  3Q9D A;  2H7V C;  2XTL A;  4CZZ B;  5DJQ C;  5AFU L;  5LYJ E;  4AQF C;  1IAP A;  3ZMZ B;  1G73 A;  1E2A A;  3OKQ A;  3PUA A;  2I59 A;  2JMH A;  2G0U A;  2DHR A;  4WNK A;  3KBT A;  1W0B A;  1OED B;  3IOC A;  3PUG A;  1WR0 A;  3EAM A;  2OA5 A;  4EV6 A;  4HN9 A;  3C50 A;  1IHO A;  3RC8 A;  4MUL A;  2XAH B;  3UQ7 A;  3UU3 A;  3PU8 A;  4IL9 A;  2MBG A;  3IA3 A;  4ZZB A;  2A86 A;  5JDG A;  5EXC A;  3X1D A;  2PJQ A;  4X1I E;  2CBJ A;  2GK9 A;  4ILU A;  4AKI A;  2D2S A;  2WQY A;  1ZEE A;  3ONJ A;  2YIN A;  3IOD A;  2Q9Q A;  2VKJ A;  4EYY R;  3ZN1 B;  5HAX A;  3ZSS A;  4ZI2 D;  1MMA A;  4ZI3 C;  3K3N A;  4DDH A;  4GIW A;  2X0L B; 
#chains in the Genus database with same CATH homology
 2V7I A;  5DAB A;  3IVX A;  4ANJ A;  2MOZ A;  3GA8 A;  4FI5 A;  1MMG A;  4ZS3 A;  4H9S E;  4XAX B;  5EZY E;  3SRZ A;  3PUR A;  5CA0 E;  1LVF A;  4C91 A;  4G63 A;  2XAJ B;  1OXZ A;  1N2E A;  1FMW A;  4H9N C;  4PJJ A;  3I1A A;  4UIG A;  4MUN A;  3W15 B;  4OK0 A;  4P0B A;  1FMV A;  5JVD E;  3KDS E;  4E7Z A;  3MK7 C;  3L3P A;  4C90 A;  5LP6 E;  4H9R C;  2L3L A;  3O1I A;  2XQY A;  1LVK A;  2VKO A;  3CVR A;  3NZQ A;  4L0R A;  2LSI A;  5LXT E;  3IME A;  3UA0 A;  3AA0 B;  3NZP A;  3ONX A;  3C64 A;  2KZ7 B;  4IGU A;  4CQI A;  3AA6 B;  2YU1 A;  3R84 B;  2WM9 A;  1E1H B;  5J2U E;  3I9Y A;  4MBQ A;  5FYM A;  5HXC A;  3E22 E;  4TN7 B;  3PUS A;  1V8F A;  5FY7 A;  1EZ3 A;  1FIO A;  2LOP A;  3RRW A;  3AA1 B;  4YLH A;  2PG8 A;  3COW A;  2Y8D A;  1ZHC A;  3QC9 A;  5C8Y E;  1Z0P A;  4GOU A;  4DMW A;  3Q5W A;  2HH7 A;  3UY4 A;  4OYJ A;  5L3C B;  3P8C D;  5HYA A;  3RRC A;  3HA4 A;  3AG6 A;  3BK9 A;  1WLX A;  2ODU A;  3IHR A;  4O8S A;  3KIN B;  2EHO A;  4O2A E;  3CPZ A;  4L5G A;  5JRC A;  3H37 A;  4MFR A;  4UVB B;  2LOS A;  2Y48 B;  3DP7 A;  4GK5 E;  4EAH A;  3S4U A;  2NW8 A;  2CMR A;  2DLR A;  1G8X A;  1S35 A;  4UV9 B;  2A53 A;  2VK9 A;  4QXH B;  5IHY A;  3B57 A;  3ZMS B;  4BJM A;  3LE8 A;  4QX7 B;  2X9H A;  2Q9Q C;  2CM0 A;  2ZM2 A;  5LGU B;  2EJC A;  1SHZ C;  5LBQ B;  4PJN A;  3RH3 A;  3PDY A;  4KBM B;  2K5B B;  3SS1 A;  3ZPO A;  4MUI A;  5F3J A;  4HEA A;  3UFE A;  3CX8 B;  3ZEF B;  2G5Z A;  4IE4 A;  4U72 A;  4I4T E;  3FHN A;  3COY A;  1N2J A;  3SWH A;  2BZB A;  2CXD A;  1MND A;  2KMF A;  4H63 V;  1HG5 A;  4J2C A;  4H63 H;  5JR9 A;  2W0G A;  1BR0 A;  5FXZ A;  2ES0 A;  3N9O A;  4UV8 B;  5F8P A;  4DDM A;  3UUL A;  3LK4 2;  4JLE A;  3CML A;  4WBO A;  4MUF A;  4DE5 A;  3IOE A;  4IE6 A;  4CXW A;  4UVA B;  3U78 A;  1HFA A;  2D0T A;  2LT3 A;  3F57 A;  4WBN E;  4ZS2 A;  3KVA A;  2ODV A;  3RYC E;  4ERR A;  1IJ5 A;  3C4W A;  2WAU A;  3HKC E;  3GN5 B;  3ZMU B;  5CA1 E;  5L2L A;  3AB3 B;  3HR0 A;  3ZN0 B;  3ANW B;  4IIJ E;  3MA9 A;  4AKL A;  2LM9 A;  2XAS B;  4UEM A;  2MTQ A;  3UUN A;  1HG2 A;  3HL6 A;  2JJ9 A;  3K8P C;  5GON E;  2A72 A;  3QTT A;  2A56 A;  1CUN A;  3OBV E;  4BAY B;  1UCU A;  2K9A A;  4GK0 E;  4EZH A;  4JUY A;  2PFV A;  2KIN B;  1D0Z A;  4JEU B;  4PJM A;  3SOL A;  4CI3 B;  5G2F A;  4MUH A;  1D0Y A;  3KV4 A;  3TKL B;  4I50 E;  3N9P A;  5ADX L;  3N2K E;  2XAF B;  2V7J A;  5JH7 E;  5LHI B;  3AAE B;  1FEW A;  4FJO A;  5CB4 E;  3ZJ1 A;  5FY1 A;  3PU3 A;  4MUE A;  5LGT B;  1UX4 A;  4H9Q C;  4KP3 C;  4HGA A;  3BQK A;  4XZC A;  4Z8X A;  2KWI B;  4ASK A;  3VKG A;  3IVG A;  2V7L A;  3PTR B;  4UF0 A;  4YJ2 E;  4PNI A;  4DND A;  3I9W A;  4AKR B;  4NUV A;  4P09 A;  2X51 A;  4AKH A;  2CA5 A;  2X9Y A;  3AVR A;  3QUJ A;  2C5J A;  4P0A A;  3O1H A;  3OYZ A;  1HCI A;  2WSS V;  1YD8 G;  2QA7 A;  4G5Y A;  2Z6E A;  2WBL A;  5H6R B;  4QWN B;  2E9X A;  1MMN A;  2Q9Q B;  4EFK A;  3LG7 A;  2LHN A;  1MNE A;  2V7M A;  1NWM X;  3ESL A;  5FXX A;  3K3O A;  3Q5X A;  4AQF A;  2YEV C;  3CFH L;  3KBU A;  4PK4 A;  5HXH A;  1QUU A;  2ZM0 A;  3MAC A;  4ZHQ E;  2A3D A;  4K0U A;  2D0U A;  3RX6 A;  2NTY A;  2PBI A;  3LBX B;  4TX5 A;  1IZN B;  4ZI3 D;  2Y6X A;  3L09 A;  2ACX A;  5JR9 C;  2K24 A;  3C4X A;  4IE0 A;  1B7T A;  2LEH A;  2V7K A;  2G3D A;  5L3B B;  5E0O A;  3ZCJ A;  4HE8 A;  4E7S A;  2MYS A;  2KWH A;  2D5U A;  1N2I A;  4G5F A;  3FBL A;  1S94 A;  4QKN A;  2LSK A;  3EUH A;  5HG0 A;  1T98 A;  3Q10 A;  2M67 A;  2HPL A;  1HS7 A;  4DBR A;  2BVL A;  2RP4 A;  2CWY A;  2W00 A;  4IE7 A;  3HKD E;  1U4Q A;  2ZLY A;  4AKG A;  2H3R A;  3RYF E;  3MJX A;  2SPC A;  2A54 A;  1KK7 A;  1O3X A;  4BA9 A;  4HFV A;  2JRK A;  3O9X A;  4MUK A;  3C51 A;  3UUM A;  5EK2 A;  4PFP A;  2KT9 A;  5LJN A;  3RYH E;  3ZYL A;  1YKH B;  2QGS A;  3P7I A;  3ZC0 A;  3CQX C;  3VU7 H;  5J1G A;  4ZI7 E;  2A7X A;  2IC9 A;  1NAF A;  4U74 A;  4TUY E;  5H6Q B;  5M4Y A;  2A88 A;  3COV A;  2EHO B;  3FXE B;  4IST A;  2NW7 A;  5J2T E;  1N2G A;  5L3E B;  2HPJ A;  4TV8 E;  5JRC B;  4EXT A;  3COZ A;  3FXD B;  4IHJ E;  2C5I T;  3KVB A;  2XAG B;  3B13 A;  1MIV A;  5JDN A;  3N9N A;  3CWZ B;  3DTO A;  3I0Q A;  3UUX B;  5DQW A;  4OYK A;  4OHF A;  3K3N A;  3VHL A;  1BR2 A;  4QX8 B;  5KMG P;  5LHG B;  2E9X C;  1LKX A;  3HKE E;  3BQI A;  5JDH A;  3JC6 C;  2Q9Q D;  3ZYM A;  2L9Q A;  3Q2M A;  3INN A;  4UXN B;  2H7O A;  5DQV A;  4EIW A;  2X68 A;  1IJ6 A;  3N9M A;  5JDM A;  5HXE A;  3AVS A;  1X79 A;  4YJ3 E;  4QHO A;  3V5U A;  2VL8 A;  1QSD A;  2E9X D;  2CWO A;  3IMG A;  5JR9 B;  2B1E A;  3ETU A;  2N1G A;  4PJL A;  3CKD A;  3V5S A;  3IUB A;  2ZMA A;  3JC6 D;  4ZOL E;  3AG5 A;  4IDZ A;  4O4I E;  2XAQ B;  4HKA A;  1YW0 A;  3CFA L;  1MMD A;  2NW9 A;  2LSY A;  1N2B A;  3EDV A;  3K3Q C;  4A56 A;  3HI2 A;  3T8O A;  4X1Y E;  5HWY A;  3KFW X;  4IXJ A;  1D1C A;  2DCF A;  2JMK A;  3BQL A;  4MHC A;  2V1D B;  3WI3 A;  2A50 A;  3U3I A;  5IYZ E;  2X3F A;  4EYU A;  4DVD A;  2EHO C;  4DBQ A;  5FP3 A;  4PK5 A;  2X9W A;  5LA6 E;  4MLK A;  4MAL A;  4GYS A;  2WWU A;  2XHE B;  2W62 A;  1WYC A;  3I0O A;  4H9P C;  4OFZ A;  3N2O A;  2A84 A;  3LFM A;  5HWX A;  5HXR A;  5HXS A;  1MIY A;  3UTK A;  4IE5 A;  2EHO D;  2IW5 B;  4UF0 B;  1D0X A;  3C4Z A;  2CXL A;  3F2E A;  4AI6 A;  1N2O A;  3NRY A;  3IOB A;  3IMC A;  5JQG E;  3ISJ A;  1LRZ A;  2BVM A;  2C5K T;  4N78 D;  2CE7 A;  4MUG A;  4M1P A;  3ZLI A;  3O1J A;  3UK2 A;  1ZV4 X;  2E9X B;  2WMN A;  1Y64 B;  2IC6 A;  5EK4 A;  3AA7 B;  4O2B E;  5KDM C;  2BDE A;  3CFF L;  5JDF A;  5LJM A;  2DWK A;  2E8I A;  3KV9 A;  5JDL A;  3H3A A;  4O4J E;  3VKH A;  4DO0 A;  4NUU A;  3N9Q A;  3D0T A;  4QXB B;  4MQ6 A;  4CI1 B;  2CXF A;  2YK0 A;  4F6R C;  5LBM A;  2N2N A;  3IF8 B;  1HTJ F;  4KUM B;  3GWH A;  4PW8 A;  2CCQ A;  3ZJ2 A;  2NTX A;  4V1A v;  3LK3 B;  2KXP B;  2WMO A;  3CQG B;  2NWB A;  3F31 A;  4X20 E;  3KV5 A;  3PUQ A;  4L9I A;  2V26 A;  3PE0 A;  2X67 A;  5FNV E;  3N5L A;  3AAA B;  3MXT A;  3ZMV B;  4I43 B;  5KX5 E;  2DNX A;  2G16 A;  2C0S A;  5LHH B;  3GMI A;  5L3G B;  5L3D B;  2NP9 A;  5LGN B;  3IVC A;  1KNZ A;  3N9L A;  2ZM8 A;  4CI2 B;  1YKE B;  3RYI E;  4EOZ B;  2YU2 A;  1OWA A;  3R6N A;  1U5P A;  3WAJ A;  4MUJ A;  4CXY A;  3LF4 A;  4DMV A;  4DDK A;  2VAS A;  2DWG A;  4H9O C;  3N8H A;  4AQG A;  1H7C A;  5FXV A;  4B6X A;  3QK6 A;  2CLY C;  2JPF A;  5FXW A;  3A5X A;  5ETW A;  2LSJ A;  4PK6 A;  2KND A;  5EK3 A;  3ZCI A;  3M65 A;  2JQQ A;  3EDU A;  2LJL A;  2VB6 A;  2VKH A;  1AJ3 A;  1HX8 A;  3IUE A;  4G2A A;  2W61 A;  3ETV A;  3WAK A;  3CX7 B;  4EF6 A;  4O4L E;  3NRX A;  3ZMT B;  1ZKE A;  4UVC B;  3J9X 1;  3RKO A;  2J1D G;  3Q9D A;  2H7V C;  2XTL A;  4TZ4 C;  5DJQ C;  5LOV E;  4CZZ B;  5AFU L;  3FB2 A;  4AXP A;  5LYJ E;  2N9D A;  2K48 A;  4AQF C;  1IAP A;  5LG4 A;  2A2F X;  5L3F B;  3ZMZ B;  4X1K E;  5TAO A;  1G73 A;  4PFO A;  4PAG A;  4TV9 E;  2A52 A;  3OKQ A;  3PUA A;  2I59 A;  4BHR A;  5KWV A;  2KLQ A;  4CXX A;  4EZ4 A;  3MXZ A;  4YHJ A;  3CX6 B;  1MIW A;  2JMH A;  1WRD A;  2RA1 A;  5A1L A;  2GW4 A;  2G0U A;  5LCY A;  2DHR A;  1UFV A;  3AAI A;  4WNK A;  5JRE A;  3MUE A;  3KBT A;  4XBF B;  4DDH A;  2NOX A;  3GN5 A;  1D1A A;  2CEA A;  2G2S A;  3IOC A;  3ANW A;  3PUG A;  1SA0 E;  3MZK B;  3EVY A;  3IBP A;  2P9B A;  2XUE A;  4HTE A;  2OA5 A;  3N2G E;  3ZC1 A;  3FBZ A;  4HN9 A;  1WR6 A;  3O4X E;  5JDQ A;  3NBX X;  3C50 A;  1MOP A;  3Q12 A;  3KV6 A;  5FMN A;  3E08 A;  3J7Y q;  1IHO A;  3RPU A;  2LSG A;  1BR4 A;  2XAH B;  3RC8 A;  4ADZ A;  3PU8 A;  4MUL A;  2MBG A;  3LJC A;  2VKD A;  2LE8 A;  3OJA A;  4UEL A;  2A86 A;  5JDG A;  5EXC A;  1VRB A;  3CQC B;  2PJQ A;  4I55 E;  4O4H E;  4X1I E;  2X66 A;  1VOM A;  1V9D A;  3UT5 E;  2VWA A;  2GK9 A;  4ILU A;  4QXC B;  2X9X A;  4BJN A;  4FZJ A;  2UXN B;  3C98 B;  4YFS A;  4ZI2 C;  4AKI A;  2D2S A;  2CLY B;  2UXX B;  1HF8 A;  4WW0 A;  1ZEE A;  2W63 A;  2YIN A;  2DI4 A;  1D1B A;  3DJB A;  1UX5 A;  3MKD A;  3IOD A;  3RC3 A;  4ISS A;  1BR1 A;  2Q9Q A;  2VKJ A;  3ZYK A;  4EYY R;  3IEE A;  4KMC A;  5FY0 A;  3ZN1 B;  2IAK A;  5HAX A;  4JEH B;  2LHR A;  1WYB A;  3E0Z A;  4ZI2 D;  1MMA A;  3HKB E;  4EB6 E;  3LK2 B;  4ZI3 C;  3LBX A;  3OYX A;  4GYR A;  5LNK A;  1US7 B;  2L8K A;  5BMV E;  4GIW A;  2X0L B;  1N2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...