3HL6A

Staphylococcus aureus pathogenicity island 3 orf9 protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
213
structure length
189
Chain Sequence
DIETIVNEFETRAGTLLRYYTGLLERSKVQPCCFKLYNDPFDMVYVMMNSKLFSHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKQLSISDMMASQLFEDEYFMYGLQTYQSSNTDVIANIEMLYQLATGINEPVPELVEGLKLVTEFVQDENATQEDYKALERKLNDLKASYYSLSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pathogenicity island protein
publication title Structural and functional studies of a pathogenicity island protein from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Unknown function
total genus 58
structure length 189
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16560 SAPI Putative mobile pathogenicity island
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.700 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3hl6A02
3.30.1300.50 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3hl6A01
3HL6A
chains in the Genus database with same CATH superfamily
4QKNA 3I9WA 1QSDA 1LVKA 3OVUA 5GONE 2NR4A 3PJAA 3KV4A 1W09A 4JEHB 1B7TA 4IDNA 3PURA 4PJMA 3AAEB 1FMVA 2UXCT 5FNVE 5IUXA 4GK5E 5FY1A 4C91A 3ANWA 1NWMX 2J4GA 2XQ5A 2D2SA 3O4XE 4PNIA 4DR4T 3UQ7A 1IJ6A 3NZPA 3RGLA 2WU2A 3GN5A 4DDMA 3NZQA 4H9QC 3AEDA 3RPUA 2HHHT 3UTKA 3AG6A 5LG3A 4XBFB 2BDEA 4WW0A 4NPPA 4JI0T 3H3MA 4UXNB 2H3RA 2ZLYA 2X67A 4ZS2A 3TKLB 2W4XA 5HEOA 5LBQB 2XZEA 3ZCIA 4GOUA 1HX8A 2CLYB 2JQKA 4EZ4A 3W15B 3EHZA 3VKGA 3PUVF 1MMGA 5EXCA 4NXNT 5A1LA 2HN2A 2X66A 1MIWA 1Z0PA 5C8YE 5FXZA 5HAXA 4UELA 3Q10A 4GYSA 3AXJB 4HFDA 4HTEA 2ODVA 2X0LB 4IREA 4YTMA 5KXJA 4AKIA 3C98B 3UT5E 2BZBA 4H9NC 4YTNA 1ZKEA 3HR0A 2ZM6T 4UVAB 3OYXA 2CWOA 3CKDA 3B57A 1T8BA 3ONLC 3CK6A 3O1JA 1KK7A 2YINA 3P4PA 5L47A 3WI3A 3AE9A 3TLUA 4NXMT 2KWIB 4ZEYA 3EABA 4O4JE 4EF6A 3QK6A 3RIFA 4PK6A 1BR0A 2LT3A 1Y01A 3P7IA 2E9XB 4BJMA 2XQYA 3LK3B 2WDVA 3AE2A 2K5BB 3AEBA 3ZCJA 4DV1T 4DNDA 3C4WA 1I94T 2UUBT 4HWCA 1R8IA 2CMRA 4AKLA 3L09A 2A7XA 4EYUA 5L4HA 4B6XA 1BR2A 2XHEB 3COZA 2R6GF 4DIDB 4GKKT 1WR0A 2L3LA 4OYJA 4DV7T 3Q5XA 3B5MA 2OLTA 2UXBT 4LF7T 1WYCA 4KI0F 1FEWA 2D9DA 2J1DG 2A3DA 2JIWA 1OEDB 1JNRA 5LJNA 4YHHT 2UXNB 2LJLA 3NBXX 2E8IA 3PUZF 3COYA 3OTOT 3P8CD 4HWHA 2NOXA 3FZHB 5LCYA 3PV0F 2Y8DA 2YK0A 4O2AE 4QX8B 4EEBA 2VVNA 3A8YC 4HWDA 2L9QA 4JUYA 2XAHB 2YN6A 3QNUA 4Z91A 2LKGA 2V5DA 5FMNA 2NWBA 2VURA 5LGNB 3AEFA 2EJCA 2BVLA 4JV5T 2XQ3A 4X20E 4DUYT 2VQET 3SRZA 3IODA 2A52A 3EI0A 5LHIB 3BQLA 4OHFA 1N2OA 2H88A 4CXYA 4X65T 1N2BA 2WSSV 4G2AA 3TLWA 3LJCA 3N2OA 3CMLA 4U74A 4UR9A 3SFDA 2JMHA 4KHZF 5FL0A 4IIJE 1HNWT 3CQCB 4XZCA 4NUVA 4DR1T 1EZ3A 2LHRA 3KFWX 4ZI2D 2EHOB 3EDVA 4EEDA 2PG8A 5BW0B 3LF4A 4MFRA 2LSYA 4DR6T 2V7JA 5LP6E 3AAAB 5HWXA 2DHRA 4O4HE 4HWFA 3K8PC 3P50A 3IVCA 4DR2T 2XM2A 3RI5A 2LLYA 3AE3A 4L9IA 1YXRA 2DWKA 4TV9E 4IGUA 3ZSSA 5FKYA 3UU3A 2K3WA 2RA1A 2JRKA 3ZMUB 3N8HA 2G0UA 2XQ4A 2X3FA 3VRBA 4HKAA 1HFAA 2VKHA 4CQIA 3B13A 5JR9A 3IMGA 1LKXA 5L2LA 3P4SA 4ISTA 4CI1B 5AQKB 2W61A 4X1KE 1MNDA 4MBQA 3N9MA 4MUJA 4E7ZA 5FXWA 2MOZA 3R6NA 4DR3T 3N2GE 2W2UA 1YW0A 4TN7B 1X9BA 2DCFA 2KZ7B 4YT0A 4P09A 3C4XA 2JQ9A 3UUXB 4UV9B 1N2GA 5EK3A 2WU5A 3AE6A 2P9BA 4QH5A 2QRXA 2UU9T 2I6HA 4F6RC 1ZP0A 2WY2A 3VR8A 2X9WA 2CWYA 1WFDA 4DDKA 3QC9A 4HE8A 5JR9C 4AKGA 4PW8A 3FHNA 2Q9QA 4V1Av 3IOEA 5J2UE 5JH7E 2X0HA 4PFOA 4HEAA 2J47A 4JI3T 3NVOA 3PUSA 2A53A 2GR8A 2WQYA 5HXHA 1XNQT 5JREA 5JDFA 4QXCB 3RQUA 5HXRA 1GQEA 1VRBA 5L3CB 4LF8T 2CXDA 4DBRA 1UFVA 1N2JA 1HG2A 2G2SA 5C2TA 4B3MT 3N2KE 2YDRA 3RH3A 2A2FX 3KV6A 3Q5DA 2LSGA 2IIUA 2DNXA 3SFEA 4I43B 4TWDA 2Q9QC 3LE8A 2UXXB 4OK0A 4WZXA 2IUBA 2XQ7A 4H9RC 3ZT7A 3IA3A 5EK4A 1G8XA 5HEHA 5HEGA 2WZIA 2MPKA 4YSZA 2Y6XA 2BBHA 4QH4A 2XAJB 2MTQA 5JDQA 2VWAA 4OYKA 3U3IA 3MK7C 2XJ7A 3RQWA 3Q12A 4IXJA 4DVDA 5BMVE 1U5PA 3IUBA 5CA0E 4ILAA 4X1YE 3MXTA 5ABEA 4UF0A 3RRCA 3RKGA 4FJOA 2XQAA 2PJQA 2I59A 3LBXB 4IHJE 4AQFA 3AAIA 2NW8A 5TAOA 3D0TA 2IECA 3K3QC 1G73A 2BBJA 2ODUA 3OBVE 3EVYA 2L8KA 2BKOA 3FB2A 4DDHA 2W66A 5J1GA 3RYFE 3GWHA 4LMLA 3RYIE 1UURA 5LMNT 1SA0E 3ZMSB 4TWHA 1S35A 4J2CA 3TLTA 3Q9DA 2PFVA 2V8SV 4O8SA 3PUGA 5AQNB 5KDMC 1N33T 4ZHQE 3LK42 1UK5A 1VOMA 2G5ZA 1S94A 3RC3A 2VASA 2ZM2A 4ZZCA 4MUGA 2XTLA 3J7Yq 3QTTA 2KNDA 3RHWA 3OKQA 5ABHA 3DTOA 1KFYA 4JBWF 2CLYC 4AQFC 5HCMA 4A97A 2XQ8A 5L3EB 4EXTA 2E9XA 2A88A 4ZOLE 2W0GA 4H9SE 2BS3A 3MJXA 1XNRT 1QUUA 3VR9A 3AECA 1ZEEA 3C51A 3ZSTA 5AQRB 4GIWA 4ERRA 3CI0I 5JDHA 4I50E 1FMWA 2CPTA 5LG4A 4ILBA 3PJAJ 4K0UA 1WR6A 2I52A 3Q5EA 4JI1T 2M6IA 2UXDT 5ABFB 4KX6A 4YY3T 3F2EA 5LHHB 3PU3A 3A7MA 4TNWA 2LSJA 2CRBA 3PUWF 4LFBT 1WCRA 4JEUB 3K1SA 3RIAA 2D5UA 3VKHA 5JVDE 3O1IA 3CX8B 2VL0A 3E08A 4PK5A 5ETWA 3MACA 1US7B 1U4QA 2E9XC 5LB7B 5J2TE 3CI0K 4MULA 2GK9A 2W63A 3EUHA 3CX6B 2BG9B 5AQTB 4BHRA 3HI2A 4JLEA 4YHJA 4LF4T 3ZN0B 2GR7A 4MUIA 5EZYE 5HXEA 4AXPA 3E22E 5FYMA 4U3CA 3WAKA 2C5IT 3X1DA 2UUCT 1D0YA 3ZYMA 2A9UA 1HS7A 1IAPA 3ZKRA 4JI4T 1KF6A 5AQMB 5AQUB 4LF6T 1IJ5A 5KMGP 3RC8A 4NIQA 3IUEA 5AQLB 3AE7A 2RP4A 3OYZA 1BR1A 1KEYA 3C4ZA 3OPCA 2LMEA 2WS3A 3AE5A 2CCQA 4MUKA 1NENA 3UUBA 3ZN1B 3AE8A 1ZOYA 4EB6E 2LEHA 4YFSA 2EHOA 3FXDB 3ZC0A 4UVBB 3CQGB 5E0OA 3S4UA 4DBQA 1LVFA 1OEDE 1V8FA 3EMOA 4Z90A 2VKOA 4AKHA 5LOVE 2NW9A 1D0XA 3KBUA 3LFMA 1CHUA 1XMQT 3CFHL 5IWAT 4QHOA 4AIUA 1UX4A 1J5ET 4IDOA 4UIGA 3UFGA 2M67A 4IE5A 4G5FA 3NKZA 2AE9A 2N9DA 3PUAA 4YJ3E 3G06A 3JAEA 2EHOC 4H9OC 3Q2MA 1JNZA 2V7MA 2XUEA 1IHOA 1X79A 3UQ4A 2X51A 3T8OA 3ZPOA 2BS2A 3C50A 1HTJF 1N2IA 2QVAA 3AEGA 2B1EA 3FZLB 2KMFA 4KP3C 2IMLA 2ES0A 2JPFA 1D1AA 1HX1B 3GA8A 1ZHCA 4GKJT 4G63A 2UUAT 5LYJE 4IL9A 5EK2A 3LK2B 3VU7H 3E0ZA 4X62T 4PFPA 5H6RB 2KLQA 3GMIA 4U33A 4U7IA 2WZHA 3AVSA 3CPZA 3QB5K 4UEMA 4Z8XA 3ZT6A 4ZI7E 1T98A 3UU4A 5FY0A 5FVKA 5HG0A 4GYRA 4MUNA 1D1BA 2I0MA 3U78A 1MIVA 2H7VC 4IE6A 2DL1A 3HKCE 2CM0A 2J62A 2YU2A 4OX9T 3TLVA 1YD8G 2LOSA 1WYBA 1IZNB 3ZJ1A 3UY4A 1CUNA 4DV3T 3CQXC 2XAQB 4AQYT 5FY7A 3ZMVB 3PUQA 4LMKA 1IBKT 2NTYA 5M4YA 4U72A 2C0SA 1WLXA 3P4QA 3QB5A 5KWVA 5DJQC 4IDPA 4MUEA 2Y48B 3L39A 3V5UA 4HWIB 3ZJ2A 4I55E 1IBLT 4TNVA 4IT4A 5DQVA 5LNKA 5HEJA 4Q25A 1Z8UA 2XAGB 3L8RA 2LKHA 3AEEA 1YKEB 4COFA 2CBJA 2WDQA 4ZI3C 5KX5E 3UUMA 4JI8T 2BKPA 3LDQB 3ZC1A 4E7SA 4QXHB 3IVXA 1IBMT 4B3ST 2A84A 4O4IE 1J5WA 3ETUA 2B76A 4B3RT 4PJNA 4M1PA 3UA0A 4I0UA 3WAJA 3P4WA 3JC6C 2C5KT 2LSIA 4EGWA 4H63H 2CEAA 3LBXA 2V6YB 3DP7A 4GK0E 1FJGT 4HFEA 5AQSB 3IMEA 2N1GA 3IEEA 3C64A 4YJ2E 5L3GB 3AA1B 4ISSA 3PDYA 3NRXA 3O9XA 3COVA 4KUMB 5JDGA 2SPCA 3KINB 3ESLA 3KV5A 2NTXA 3RF1A 3FZMB 2H89A 4U7YA 2C5JA 3UK2A 5AQOB 2LSKA 2K9AA 3FZFB 3H37A 4KBMB 1MOPA 5LXTE 1UCUA 3MXZA 3N9LA 3MKDA 3UUNA 1E1HB 2V7IA 3JAFA 2WAUA 1XDOA 5JRCB 1MMNA 4WNKA 2LRKA 2XQ6A 3I0QA 3UU8A 3CVRA 4EYYR 3PTRB 1HG5A 5J0ZA 3ISJA 3FZKB 4MUHA 2HH7A 4X1IE 4TZ4C 2QA7A 1OWAA 3INNA 3RRWA 3LSVA 4JI7T 1V9DA 2XSAA 3J9X1 1UUSA 3ONJA 1W0BA 4ADZA 2FJDA 4O2BE 3LG7A 2W62A 5LMUT 4KMCA 5AQGB 2Q9QD 4JYAT 3JCFA 3KVBA 4DV4T 2YDQA 4ILUA 4U2ZA 5CJ5A 1ZV4X 2JMKA 2IAKA 1HF8A 3MZKB 4A98A 2HPJA 2AXDS 3A5XA 3AXJA 5ABFA 2X9YA 3NRYA 2MBGA 1E7PA 2YU1A 2KINB 3VHLA 1BR4A 3TLSA 1HNXT 4L0RA 2X9HA 3ZYKA 4YLHA 2Z6EA 5BR8T 2NW7A 4X64T 4P0AA 3I9YA 3ONXA 1E2AA 5FXVA 5F8PA 4IE4A 2BG9A 4PJJA 3R84B 1KNZA 2JJ9A 4PAGA 4MALA 1NEKA 2XSBA 5C3JA 1SUMB 5IYZE 2E5LT 4QWNB 4WBNE 5HXSA 2X9XA 1UX5A 3BK9A 4YSXA 5L4EA 3PUXF 3PE0A 2OV9A 1KNRA 4JI6T 4MUFA 2E2AA 3V5SA 3UU5A 3CFFL 1LRZA 2V6XA 2V7KA 3AE1A 3I1AA 3FBZA 4CI3B 1YQ4A 3ZLIA 4UF0B 4BA9A 2OA5A 2D0TA 4ZZBA 4EAHA 2A86A 3EAMA 2D0UA 3UU6A 2FBWA 4CXXA 2BG9C 4AISA 5FP3A 1OEDA 2W00A 4TWFA 4CZZB 2KXPB 5AQQB 3BQIA 4YXDA 2VK9A 1XWMA 3RYHE 5LHGB 3ANWB 4IDQA 2LM2A 3CIRA 1AJ3A 4BJNA 3MA9A 4DR7T 2KWHA 2YOEA 3N9PA 2FUPA 2BG9E 4XAXB 4TV8E 3GN5B 2DLRA 4QX7B 4DO0A 2OGFA 5JDMA 2VL8A 4C90A 2H7OA 2VB6A 2G16A 2XQ9A 3RIUA 4I4TE 1NAFA 4AKRB 4LF5T 4A5XA 2ZM8A 4TUYE 4ZXLA 5L3FB 3K3OA 5CA1E 3ETVA 2RPAA 3CX7B 1YQ3A 2G3DA 2V1DB 3FXEB 5LJMA 4QXBB 4P1NA 4CXWA 1OEDC 3FBLA 1HNZT 5AQFB 2FJEA 4ASKA 2BVMA 1N36T 5HEUA 3HKDE 2LM9A 2E9XD 3RKOA 4IDZA 4K0KT 4TX5A 4LF9T 3F31A 4CI2B 1XDPA 1MMDA 2IDOB 3KBTA 2XY8B 2VQFT 2BS4A 2CBIA 5F3JA 4DV6T 4HFBA 4DE5A 1MIYA 1W0AA 2XAFB 2HN1A 3ABVA 2IC6A 4H63V 5HWYA 5AQPB 3RIUC 1L0VA 2LOPA 4UV8B 5FXXA 2CA5A 3L3PA 4ZI2C 1T72A 2K48A 5CB4E 5CFBA 1DU2A 2WWVA 3RYCE 2WWUA 2NP9A 4L5GA 2HPLA 1Y64B 4CN4A 2V26A 5JDNA 3KV9A 4EFKA 2FJAA 4FI5A 1N2EA 5AQJB 2KT9A 2X68A 2F4VT 3ZMZB 3AA0B 3IVGA 2CXLA 3K3NA 3VRAA 5L3BB 2ACZA 4U2YA 4AI6A 4EOZB 3AEAA 3N5LA 2YEVC 3NWIA 5G2FA 4ANJA 3N9OA 4KHPT 3AB3B 3ZEFB 4HFIA 1OXZA 1VCSA 3H3AA 5IHYA 2CXFA 1XMOT 4JI5T 4HFCA 1QLBA 2CE7A 3EDUA 1YKHB 2XASB 1WRDA 2A54A 3AE4A 3IF8B 1SHZC 4B3TT 2VVSA 2KSRA 4EIWA 2W67A 4IL4A 4LFAT 1W9RA 2IW5B 2XPKA 4P0BA 2GW4A 2MAWA 3RLFF 2EHOD 1HCIA 3MUEA 4YTPA 2WP9A 2JQHA 3IMCA 2WCAA 5AQVB 4U31A 4DV0T 3HKBE 2PTFA 4MLKA 3IOBA 3CFAL 4JI2T 2K24A 4HFHA 5AFUL 4IE7A 2WMNA 4DMVA 4HN9A 5LGUB 5ABGA 5AQHB 4X5TA 3M3ZB 2FJBA 4DR5T 4DMWA 2IHR1 2V6YA 4LFCT 3HA4A 2VKJA 4AQGA 2LHNA 3CWZB 4DV5T 3OJAA 3UULA 3T1YT 2CHNA 3ZT5A 2WMOA 5FL1A 4MQ6A 3HKEE 3N9QA 1N2HA 4MHCA 3COWA 2N2NA 3PUYF 5HYAA 3HL6A 2PBIA 4HFVA 3IBPA 2MYSA 4X66T 4F8HA 2ACXA 2M6BA 2V5CA 4WBOA 2QGSA 3PU8A 4N78D 4UVCB 2E5VA 3UFEA 2LE8A 4BAYB 5JRCA 1HR0T 5ADXL 1SE7A 3RX6A 4CN6A 4HGAA 3DJBA 2QYWA 3KVAA 5F5WA 2BKNA 4PJLA 3I0OA 2LRLA 3Q5WA 5JQGE 3IHRA 1M62A 5JDLA 4DV2T 4A56A 1UGOA 2WDRA 3AG5A 2ZMAA 3SWHA 2WM9A 2A56A 1J1JA 1MNEA 3QUJA 4EV6A 1D0ZA 1FIOA 2ZM0A 5DQWA 2DWGA 5JR9B 4EZHA 4ZI3D 2YKSA 2X0YA 3JADA 4DUZT 4FZJA 4O4LE 3IOCA 5DABA 1I6ZA 2A50A 2DI4A 4QH1A 4LMJA 2IC9A 1N34T 2CHOA 2JQQA 3N9NA 5LA6E 2WBLA 4ILCA 5H6QB 3SS1A 3BQKA 3AA6B 3AA7B 1H7CA 2XM1A 4G5YA 3JC6D 5JTGA 4OFZA 3SOLA 3AVRA 4CN1A 3QOFA 1M7KA 3CFIA 5FVLA 1KNPA 4PK4A 4IE0A 4ZS3A 2A72A 2VKDA 5HXCA 3ZYLA 5LGTB 3P4RA 1MMAA 5AQIB 3ZMTB 1XZYA 1O3XA 2WB5A 3M65A 4WYVA 4NUUA 3O1HA 2YDSA 3F57A 3KDSE 4YSYA 5CGMA 2Q9QB 1T7SA 1N32T 1VCTA 2V7LA 1D1CA 4H9PC 5HCJA 3T1HT 5LBMA 5L3DB 2RETA
chains in the Genus database with same CATH topology
4QKNA 3I9WA 4F6RC 3Q2MA 2V7MA 1AJ3A 1QSDA 4BJNA 2XUEA 1IHOA 1LVKA 1X79A 2X9WA 2CWYA 2X51A 4DDKA 3T8OA 3QC9A 5GONE 3MA9A 4HE8A 2KWHA 3N9PA 3ZPOA 4XAXB 3C50A 3KV4A 1HTJF 5JR9C 4AKGA 4PW8A 4TV8E 3GN5B 3FHNA 1N2IA 2Q9QA 2DLRA 4JEHB 1B7TA 4QX7B 4V1Av 4DO0A 3IOEA 2B1EA 2KMFA 3PURA 4KP3C 4PJMA 3AAEB 2JPFA 2ES0A 1FMVA 5J2UE 5JDMA 2VL8A 4C90A 2H7OA 1D1AA 2VB6A 2G16A 5JH7E 3GA8A 4I4TE 1NAFA 1ZHCA 5FNVE 4G63A 4PFOA 4AKRB 4GK5E 5LYJE 5FY1A 4HEAA 2ZM8A 4TUYE 4C91A 3ANWA 5L3FB 5EK2A 3LK2B 3VU7H 3K3OA 5CA1E 1NWMX 3CX7B 3ETVA 3E0ZA 3PUSA 4PFPA 2A53A 5H6RB 2G3DA 2V1DB 3FXEB 5HXHA 5LJMA 5JREA 4QXBB 4PNIA 2D2SA 2KLQA 3O4XE 4QXCB 5JDFA 4CXWA 3GMIA 3FBLA 5HXRA 1IJ6A 4ASKA 2BVMA 3AVSA 1VRBA 5L3CB 3CPZA 3HKDE 2CXDA 4UEMA 2LM9A 4DBRA 1UFVA 4Z8XA 2E9XD 3RKOA 1N2JA 1HG2A 4IDZA 3NZPA 4ZI7E 2G2SA 4TX5A 1T98A 3GN5A 4DDMA 3NZQA 3F31A 4CI2B 4H9QC 3N2KE 5FY0A 5HG0A 3RH3A 4GYRA 1MMDA 4MUNA 1D1BA 3RPUA 1MIVA 2H7VC 4IE6A 3U78A 3HKCE 2A2FX 2CM0A 3KBTA 3KV6A 3UTKA 2YU2A 3AG6A 4XBFB 5F3JA 2BDEA 2LSGA 1YD8G 2LOSA 4DE5A 1WYBA 2DNXA 4WW0A 1MIYA 1IZNB 3ZJ1A 3UY4A 2XAFB 4I43B 1CUNA 3CQXC 2Q9QC 4UXNB 2IC6A 3LE8A 2UXXB 4H63V 2H3RA 4OK0A 5HWYA 2XAQB 5FY7A 4H9RC 3ZMVB 2ZLYA 5EK4A 2X67A 4ZS2A 3TKLB 1G8XA 3PUQA 5LBQB 2NTYA 5M4YA 4U72A 2LOPA 3ZCIA 2C0SA 4UV8B 5FXXA 1WLXA 4GOUA 1HX8A 2Y6XA 2CLYB 2CA5A 4EZ4A 3W15B 3L3PA 2XAJB 3VKGA 5KWVA 1MMGA 5EXCA 5DJQC 4MUEA 2Y48B 3V5UA 2MTQA 5A1LA 4ZI2C 2X66A 5JDQA 1MIWA 2K48A 1Z0PA 2VWAA 5CB4E 5C8YE 3ZJ2A 4I55E 4OYKA 3U3IA 5FXZA 3RYCE 5HAXA 4UELA 2WWUA 3Q10A 3MK7C 4GYSA 5DQVA 5LNKA 4HTEA 2ODVA 2NP9A 3Q12A 2X0LB 4IXJA 4L5GA 2HPLA 1Y64B 2V26A 2XAGB 4DVDA 5JDNA 3KV9A 4AKIA 4EFKA 3C98B 1U5PA 5BMVE 3IUBA 3UT5E 2BZBA 4H9NC 5CA0E 4X1YE 1YKEB 4FI5A 3MXTA 1N2EA 4UF0A 2KT9A 4ZI3C 3RRCA 5KX5E 2X68A 3UUMA 1ZKEA 3HR0A 4UVAB 4FJOA 3OYXA 2PJQA 3ZC1A 2CWOA 3AA0B 2CXLA 2I59A 3K3NA 3ZMZB 4E7SA 5L3BB 3IVGA 3CKDA 3B57A 3LBXB 4AI6A 4QXHB 4IHJE 4EOZB 4AQFA 3N5LA 3IVXA 3AAIA 2YEVC 5G2FA 3O1JA 1KK7A 2NW8A 2YINA 4ANJA 3N9OA 5TAOA 3WI3A 3D0TA 3K3QC 1G73A 2ODUA 3OBVE 2A84A 4O4IE 3EVYA 2L8KA 3FB2A 4DDHA 5J1GA 3AB3B 3ZEFB 3ETUA 3RYFE 1OXZA 3GWHA 2KWIB 4O4JE 3RYIE 4PJNA 4EF6A 3QK6A 4M1PA 3H3AA 3UA0A 1SA0E 3ZMSB 3WAJA 1S35A 4PK6A 5IHYA 4J2CA 2CXFA 3JC6C 1BR0A 3Q9DA 2LT3A 2CE7A 2PFVA 2C5KT 2LSIA 3EDUA 1YKHB 2XASB 3P7IA 4O8SA 2E9XB 1WRDA 2A54A 3PUGA 4BJMA 2XQYA 4H63H 3IF8B 5KDMC 1SHZC 3LK3B 4ZHQE 3LK42 2CEAA 1VOMA 4EIWA 2K5BB 2G5ZA 1S94A 3ZCJA 3LBXA 3RC3A 3DP7A 4GK0E 2VASA 2IW5B 2ZM2A 4DNDA 4MUGA 2XTLA 4P0BA 3J7Yq 3C4WA 2GW4A 3IMEA 2N1GA 2CMRA 4AKLA 3L09A 2EHOD 1HCIA 3IEEA 3C64A 2A7XA 4EYUA 3QTTA 3MUEA 2KNDA 4YJ2E 5L3GB 3AA1B 4ISSA 3OKQA 4B6XA 1BR2A 2XHEB 3PDYA 3NRXA 3DTOA 3COZA 3IMCA 2L3LA 3O9XA 3COVA 4OYJA 4KUMB 3HKBE 3Q5XA 2SPCA 5JDGA 4MLKA 3IOBA 2CLYC 4AQFC 3KINB 2K24A 3ESLA 3CFAL 5AFUL 3KV5A 2NTXA 5L3EB 4IE7A 4EXTA 2E9XA 2A88A 2WMNA 4DMVA 4ZOLE 2W0GA 4H9SE 3MJXA 4HN9A 5LGUB 2C5JA 3UK2A 2LSKA 2K9AA 1WYCA 3H37A 4KBMB 1QUUA 1FEWA 1MOPA 5LXTE 4DMWA 2J1DG 1UCUA 2A3DA 3MXZA 1ZEEA 3C51A 3HA4A 3N9LA 5LJNA 2UXNB 2LJLA 2VKJA 3NBXX 2E8IA 4AQGA 3COYA 3MKDA 4GIWA 3UUNA 2LHNA 1E1HB 2V7IA 2WAUA 3CWZB 3P8CD 5JRCB 2NOXA 5LCYA 1MMNA 2Y8DA 2YK0A 4WNKA 4ERRA 3OJAA 4O2AE 3UULA 3I0QA 5JDHA 4QX8B 4I50E 1FMWA 2WMOA 5LG4A 3CVRA 4EYYR 2L9QA 3PTRB 1HG5A 4JUYA 1WR6A 3HKEE 4K0UA 4MQ6A 3N9QA 1N2HA 4MHCA 3COWA 2XAHB 3ISJA 3F2EA 2N2NA 5FMNA 2NWBA 3HL6A 5HYAA 5LHHB 2PBIA 4HFVA 3PU3A 4MUHA 2LSJA 5LGNB 2HH7A 4X1IE 2EJCA 4JEUB 3IBPA 4TZ4C 2MYSA 2D5UA 2QA7A 1OWAA 3INNA 3VKHA 2BVLA 2ACXA 3RRWA 4WBOA 4X20E 2QGSA 3PU8A 4N78D 5JVDE 3IODA 3SRZA 4UVCB 3O1IA 1V9DA 3J9X1 3CX8B 2A52A 3E08A 3BQLA 4OHFA 4PK5A 3UFEA 4ADZA 5LHIB 1N2OA 5ETWA 2LE8A 3MACA 1US7B 4O2BE 4BAYB 3LG7A 1U4QA 2W62A 2E9XC 4CXYA 5ADXL 5JRCA 4KMCA 5J2TE 1N2BA 3RX6A 2Q9QD 4HGAA 4MULA 2GK9A 2WSSV 3DJBA 3KVBA 3KVAA 2W63A 3EUHA 4ILUA 3CX6B 4G2AA 1ZV4X 2JMKA 2IAKA 3LJCA 3N2OA 4PJLA 3CMLA 3I0OA 1HF8A 4BHRA 3MZKB 3HI2A 3Q5WA 4U74A 5JQGE 2HPJA 2JMHA 3A5XA 4JLEA 3IHRA 4YHJA 2X9YA 3NRYA 2MBGA 3ZN0B 2YU1A 2KINB 3VHLA 1BR4A 5JDLA 4MUIA 4IIJE 5EZYE 4L0RA 4A56A 4AXPA 5HXEA 3E22E 2X9HA 5FYMA 3WAKA 2C5IT 3CQCB 4YLHA 2Z6EA 3ZYKA 4XZCA 3AG5A 4NUVA 2ZMAA 1EZ3A 1D0YA 2LHRA 3KFWX 2NW7A 3SWHA 2WM9A 3ZYMA 4ZI2D 2A56A 2EHOB 1HS7A 1IAPA 4P0AA 3EDVA 3I9YA 1MNEA 2PG8A 3ONXA 3LF4A 5FXVA 4MFRA 2LSYA 3QUJA 2V7JA 1D0ZA 1FIOA 5LP6E 2ZM0A 1IJ5A 3AAAB 5KMGP 5F8PA 3RC8A 5HWXA 2DHRA 5DQWA 4IE4A 4O4HE 3IUEA 2DWGA 5JR9B 3K8PC 4EZHA 4PJJA 3R84B 1KNZA 4ZI3D 3IVCA 2RP4A 2JJ9A 3OYZA 1BR1A 4PAGA 3C4ZA 4MALA 4FZJA 4O4LE 3IOCA 5IYZE 5DABA 2A50A 2DI4A 2CCQA 4L9IA 4QWNB 2DWKA 4MUKA 2IC9A 4WBNE 2JQQA 3ZN1B 4TV9E 4EB6E 2LEHA 3N9NA 4YFSA 5LA6E 5HXSA 2X9XA 4IGUA 2EHOA 3FXDB 1UX5A 3BK9A 2WBLA 3ZC0A 5H6QB 3PE0A 2RA1A 3SS1A 3BQKA 2JRKA 3AA6B 4UVBB 3ZMUB 3AA7B 1H7CA 4G5YA 3N8HA 2G0UA 2X3FA 3JC6D 3CQGB 4MUFA 5E0OA 3V5SA 4HKAA 4OFZA 1HFAA 2VKHA 3S4UA 3SOLA 3CFFL 4CQIA 3B13A 1LRZA 3AVRA 2V7KA 5JR9A 3IMGA 4DBQA 3I1AA 3FBZA 1LVFA 4CI3B 1LKXA 1V8FA 4PK4A 3ZLIA 4IE0A 5L2LA 4ISTA 4ZS3A 2A72A 2VKDA 4UF0B 5HXCA 3ZYLA 4BA9A 4CI1B 2OA5A 5LGTB 2VKOA 2W61A 4X1KE 1MMAA 2D0TA 1MNDA 4MBQA 4AKHA 4EAHA 2A86A 5LOVE 3ZMTB 3N9MA 2NW9A 1D0XA 1O3XA 3M65A 2D0UA 3KBUA 4MUJA 3LFMA 4E7ZA 4NUUA 5FXWA 2MOZA 3R6NA 3O1HA 3F57A 3KDSE 3CFHL 4CXXA 3N2GE 1YW0A 4QHOA 5FP3A 2Q9QB 1UX4A 4TN7B 2V7LA 2W00A 1D1CA 2DCFA 2KZ7B 2KXPB 4CZZB 4UIGA 4P09A 3BQIA 2VK9A 4H9PC 3C4XA 2M67A 3UUXB 4IE5A 4G5FA 2N9DA 4UV9B 3RYHE 1N2GA 5EK3A 5LHGB 3PUAA 2P9BA 3ANWB 4YJ3E 5LBMA 5L3DB 2EHOC 4H9OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HL6 A; 
#chains in the Genus database with same CATH topology
 4QKN A;  3I9W A;  1QSD A;  1LVK A;  3OVU A;  5GON E;  2NR4 A;  3PJA A;  3KV4 A;  1W09 A;  4JEH B;  1B7T A;  4IDN A;  3PUR A;  4PJM A;  3AAE B;  1FMV A;  2UXC T;  5FNV E;  5IUX A;  4GK5 E;  5FY1 A;  4C91 A;  3ANW A;  1NWM X;  2J4G A;  2XQ5 A;  2D2S A;  3O4X E;  4PNI A;  4DR4 T;  3UQ7 A;  1IJ6 A;  3NZP A;  3RGL A;  2WU2 A;  3GN5 A;  4DDM A;  3NZQ A;  4H9Q C;  3AED A;  3RPU A;  2HHH T;  3UTK A;  3AG6 A;  5LG3 A;  4XBF B;  2BDE A;  4WW0 A;  4NPP A;  4JI0 T;  3H3M A;  4UXN B;  2H3R A;  2ZLY A;  2X67 A;  4ZS2 A;  3TKL B;  2W4X A;  5HEO A;  5LBQ B;  2XZE A;  3ZCI A;  4GOU A;  1HX8 A;  2CLY B;  2JQK A;  4EZ4 A;  3W15 B;  3EHZ A;  3VKG A;  3PUV F;  1MMG A;  5EXC A;  4NXN T;  5A1L A;  2HN2 A;  2X66 A;  1MIW A;  1Z0P A;  5C8Y E;  5FXZ A;  5HAX A;  4UEL A;  3Q10 A;  4GYS A;  3AXJ B;  4HFD A;  4HTE A;  2ODV A;  2X0L B;  4IRE A;  4YTM A;  5KXJ A;  4AKI A;  3C98 B;  3UT5 E;  2BZB A;  4H9N C;  4YTN A;  1ZKE A;  3HR0 A;  2ZM6 T;  4UVA B;  3OYX A;  2CWO A;  3CKD A;  3B57 A;  1T8B A;  3ONL C;  3CK6 A;  3O1J A;  1KK7 A;  2YIN A;  3P4P A;  5L47 A;  3WI3 A;  3AE9 A;  3TLU A;  4NXM T;  2KWI B;  4ZEY A;  3EAB A;  4O4J E;  4EF6 A;  3QK6 A;  3RIF A;  4PK6 A;  1BR0 A;  2LT3 A;  1Y01 A;  3P7I A;  2E9X B;  4BJM A;  2XQY A;  3LK3 B;  2WDV A;  3AE2 A;  2K5B B;  3AEB A;  3ZCJ A;  4DV1 T;  4DND A;  3C4W A;  1I94 T;  2UUB T;  4HWC A;  1R8I A;  2CMR A;  4AKL A;  3L09 A;  2A7X A;  4EYU A;  5L4H A;  4B6X A;  1BR2 A;  2XHE B;  3COZ A;  2R6G F;  4DID B;  4GKK T;  1WR0 A;  2L3L A;  4OYJ A;  4DV7 T;  3Q5X A;  3B5M A;  2OLT A;  2UXB T;  4LF7 T;  1WYC A;  4KI0 F;  1FEW A;  2D9D A;  2J1D G;  2A3D A;  2JIW A;  1OED B;  1JNR A;  5LJN A;  4YHH T;  2UXN B;  2LJL A;  3NBX X;  2E8I A;  3PUZ F;  3COY A;  3OTO T;  3P8C D;  4HWH A;  2NOX A;  3FZH B;  5LCY A;  3PV0 F;  2Y8D A;  2YK0 A;  4O2A E;  4QX8 B;  4EEB A;  2VVN A;  3A8Y C;  4HWD A;  2L9Q A;  4JUY A;  2XAH B;  2YN6 A;  3QNU A;  4Z91 A;  2LKG A;  2V5D A;  5FMN A;  2NWB A;  2VUR A;  5LGN B;  3AEF A;  2EJC A;  2BVL A;  4JV5 T;  2XQ3 A;  4X20 E;  4DUY T;  2VQE T;  3SRZ A;  3IOD A;  2A52 A;  3EI0 A;  5LHI B;  3BQL A;  4OHF A;  1N2O A;  2H88 A;  4CXY A;  4X65 T;  1N2B A;  2WSS V;  4G2A A;  3TLW A;  3LJC A;  3N2O A;  3CML A;  4U74 A;  4UR9 A;  3SFD A;  2JMH A;  4KHZ F;  5FL0 A;  4IIJ E;  1HNW T;  3CQC B;  4XZC A;  4NUV A;  4DR1 T;  1EZ3 A;  2LHR A;  3KFW X;  4ZI2 D;  2EHO B;  3EDV A;  4EED A;  2PG8 A;  5BW0 B;  3LF4 A;  4MFR A;  2LSY A;  4DR6 T;  2V7J A;  5LP6 E;  3AAA B;  5HWX A;  2DHR A;  4O4H E;  4HWF A;  3K8P C;  3P50 A;  3IVC A;  4DR2 T;  2XM2 A;  3RI5 A;  2LLY A;  3AE3 A;  4L9I A;  1YXR A;  2DWK A;  4TV9 E;  4IGU A;  3ZSS A;  5FKY A;  3UU3 A;  2K3W A;  2RA1 A;  2JRK A;  3ZMU B;  3N8H A;  2G0U A;  2XQ4 A;  2X3F A;  3VRB A;  4HKA A;  1HFA A;  2VKH A;  4CQI A;  3B13 A;  5JR9 A;  3IMG A;  1LKX A;  5L2L A;  3P4S A;  4IST A;  4CI1 B;  5AQK B;  2W61 A;  4X1K E;  1MND A;  4MBQ A;  3N9M A;  4MUJ A;  4E7Z A;  5FXW A;  2MOZ A;  3R6N A;  4DR3 T;  3N2G E;  2W2U A;  1YW0 A;  4TN7 B;  1X9B A;  2DCF A;  2KZ7 B;  4YT0 A;  4P09 A;  3C4X A;  2JQ9 A;  3UUX B;  4UV9 B;  1N2G A;  5EK3 A;  2WU5 A;  3AE6 A;  2P9B A;  4QH5 A;  2QRX A;  2UU9 T;  2I6H A;  4F6R C;  1ZP0 A;  2WY2 A;  3VR8 A;  2X9W A;  2CWY A;  1WFD A;  4DDK A;  3QC9 A;  4HE8 A;  5JR9 C;  4AKG A;  4PW8 A;  3FHN A;  2Q9Q A;  4V1A v;  3IOE A;  5J2U E;  5JH7 E;  2X0H A;  4PFO A;  4HEA A;  2J47 A;  4JI3 T;  3NVO A;  3PUS A;  2A53 A;  2GR8 A;  2WQY A;  5HXH A;  1XNQ T;  5JRE A;  5JDF A;  4QXC B;  3RQU A;  5HXR A;  1GQE A;  1VRB A;  5L3C B;  4LF8 T;  2CXD A;  4DBR A;  1UFV A;  1N2J A;  1HG2 A;  2G2S A;  5C2T A;  4B3M T;  3N2K E;  2YDR A;  3RH3 A;  2A2F X;  3KV6 A;  3Q5D A;  2LSG A;  2IIU A;  2DNX A;  3SFE A;  4I43 B;  4TWD A;  2Q9Q C;  3LE8 A;  2UXX B;  4OK0 A;  4WZX A;  2IUB A;  2XQ7 A;  4H9R C;  3ZT7 A;  3IA3 A;  5EK4 A;  1G8X A;  5HEH A;  5HEG A;  2WZI A;  2MPK A;  4YSZ A;  2Y6X A;  2BBH A;  4QH4 A;  2XAJ B;  2MTQ A;  5JDQ A;  2VWA A;  4OYK A;  3U3I A;  3MK7 C;  2XJ7 A;  3RQW A;  3Q12 A;  4IXJ A;  4DVD A;  5BMV E;  1U5P A;  3IUB A;  5CA0 E;  4ILA A;  4X1Y E;  3MXT A;  5ABE A;  4UF0 A;  3RRC A;  3RKG A;  4FJO A;  2XQA A;  2PJQ A;  2I59 A;  3LBX B;  4IHJ E;  4AQF A;  3AAI A;  2NW8 A;  5TAO A;  3D0T A;  2IEC A;  3K3Q C;  1G73 A;  2BBJ A;  2ODU A;  3OBV E;  3EVY A;  2L8K A;  2BKO A;  3FB2 A;  4DDH A;  2W66 A;  5J1G A;  3RYF E;  3GWH A;  4LML A;  3RYI E;  1UUR A;  5LMN T;  1SA0 E;  3ZMS B;  4TWH A;  1S35 A;  4J2C A;  3TLT A;  3Q9D A;  2PFV A;  2V8S V;  4O8S A;  3PUG A;  5AQN B;  5KDM C;  1N33 T;  4ZHQ E;  3LK4 2;  1UK5 A;  1VOM A;  2G5Z A;  1S94 A;  3RC3 A;  2VAS A;  2ZM2 A;  4ZZC A;  4MUG A;  2XTL A;  3J7Y q;  3QTT A;  2KND A;  3RHW A;  3OKQ A;  5ABH A;  3DTO A;  1KFY A;  4JBW F;  2CLY C;  4AQF C;  5HCM A;  4A97 A;  2XQ8 A;  5L3E B;  4EXT A;  2E9X A;  2A88 A;  4ZOL E;  2W0G A;  4H9S E;  2BS3 A;  3MJX A;  1XNR T;  1QUU A;  3VR9 A;  3AEC A;  1ZEE A;  3C51 A;  3ZST A;  5AQR B;  4GIW A;  4ERR A;  3CI0 I;  5JDH A;  4I50 E;  1FMW A;  2CPT A;  5LG4 A;  4ILB A;  3PJA J;  4K0U A;  1WR6 A;  2I52 A;  3Q5E A;  4JI1 T;  2M6I A;  2UXD T;  5ABF B;  4KX6 A;  4YY3 T;  3F2E A;  5LHH B;  3PU3 A;  3A7M A;  4TNW A;  2LSJ A;  2CRB A;  3PUW F;  4LFB T;  1WCR A;  4JEU B;  3K1S A;  3RIA A;  2D5U A;  3VKH A;  5JVD E;  3O1I A;  3CX8 B;  2VL0 A;  3E08 A;  4PK5 A;  5ETW A;  3MAC A;  1US7 B;  1U4Q A;  2E9X C;  5LB7 B;  5J2T E;  3CI0 K;  4MUL A;  2GK9 A;  2W63 A;  3EUH A;  3CX6 B;  2BG9 B;  5AQT B;  4BHR A;  3HI2 A;  4JLE A;  4YHJ A;  4LF4 T;  3ZN0 B;  2GR7 A;  4MUI A;  5EZY E;  5HXE A;  4AXP A;  3E22 E;  5FYM A;  4U3C A;  3WAK A;  2C5I T;  3X1D A;  2UUC T;  1D0Y A;  3ZYM A;  2A9U A;  1HS7 A;  1IAP A;  3ZKR A;  4JI4 T;  1KF6 A;  5AQM B;  5AQU B;  4LF6 T;  1IJ5 A;  5KMG P;  3RC8 A;  4NIQ A;  3IUE A;  5AQL B;  3AE7 A;  2RP4 A;  3OYZ A;  1BR1 A;  1KEY A;  3C4Z A;  3OPC A;  2LME A;  2WS3 A;  3AE5 A;  2CCQ A;  4MUK A;  1NEN A;  3UUB A;  3ZN1 B;  3AE8 A;  1ZOY A;  4EB6 E;  2LEH A;  4YFS A;  2EHO A;  3FXD B;  3ZC0 A;  4UVB B;  3CQG B;  5E0O A;  3S4U A;  4DBQ A;  1LVF A;  1OED E;  1V8F A;  3EMO A;  4Z90 A;  2VKO A;  4AKH A;  5LOV E;  2NW9 A;  1D0X A;  3KBU A;  3LFM A;  1CHU A;  1XMQ T;  3CFH L;  5IWA T;  4QHO A;  4AIU A;  1UX4 A;  1J5E T;  4IDO A;  4UIG A;  3UFG A;  2M67 A;  4IE5 A;  4G5F A;  3NKZ A;  2AE9 A;  2N9D A;  3PUA A;  4YJ3 E;  3G06 A;  3JAE A;  2EHO C;  4H9O C;  3Q2M A;  1JNZ A;  2V7M A;  2XUE A;  1IHO A;  1X79 A;  3UQ4 A;  2X51 A;  3T8O A;  3ZPO A;  2BS2 A;  3C50 A;  1HTJ F;  1N2I A;  2QVA A;  3AEG A;  2B1E A;  3FZL B;  2KMF A;  4KP3 C;  2IML A;  2ES0 A;  2JPF A;  1D1A A;  1HX1 B;  3GA8 A;  1ZHC A;  4GKJ T;  4G63 A;  2UUA T;  5LYJ E;  4IL9 A;  5EK2 A;  3LK2 B;  3VU7 H;  3E0Z A;  4X62 T;  4PFP A;  5H6R B;  2KLQ A;  3GMI A;  4U33 A;  4U7I A;  2WZH A;  3AVS A;  3CPZ A;  3QB5 K;  4UEM A;  4Z8X A;  3ZT6 A;  4ZI7 E;  1T98 A;  3UU4 A;  5FY0 A;  5FVK A;  5HG0 A;  4GYR A;  4MUN A;  1D1B A;  2I0M A;  3U78 A;  1MIV A;  2H7V C;  4IE6 A;  2DL1 A;  3HKC E;  2CM0 A;  2J62 A;  2YU2 A;  4OX9 T;  3TLV A;  1YD8 G;  2LOS A;  1WYB A;  1IZN B;  3ZJ1 A;  3UY4 A;  1CUN A;  4DV3 T;  3CQX C;  2XAQ B;  4AQY T;  5FY7 A;  3ZMV B;  3PUQ A;  4LMK A;  1IBK T;  2NTY A;  5M4Y A;  4U72 A;  2C0S A;  1WLX A;  3P4Q A;  3QB5 A;  5KWV A;  5DJQ C;  4IDP A;  4MUE A;  2Y48 B;  3L39 A;  3V5U A;  4HWI B;  3ZJ2 A;  4I55 E;  1IBL T;  4TNV A;  4IT4 A;  5DQV A;  5LNK A;  5HEJ A;  4Q25 A;  1Z8U A;  2XAG B;  3L8R A;  2LKH A;  3AEE A;  1YKE B;  4COF A;  2CBJ A;  2WDQ A;  4ZI3 C;  5KX5 E;  3UUM A;  4JI8 T;  2BKP A;  3LDQ B;  3ZC1 A;  4E7S A;  4QXH B;  3IVX A;  1IBM T;  4B3S T;  2A84 A;  4O4I E;  1J5W A;  3ETU A;  2B76 A;  4B3R T;  4PJN A;  4M1P A;  3UA0 A;  4I0U A;  3WAJ A;  3P4W A;  3JC6 C;  2C5K T;  2LSI A;  4EGW A;  4H63 H;  2CEA A;  3LBX A;  2V6Y B;  3DP7 A;  4GK0 E;  1FJG T;  4HFE A;  5AQS B;  3IME A;  2N1G A;  3IEE A;  3C64 A;  4YJ2 E;  5L3G B;  3AA1 B;  4ISS A;  3PDY A;  3NRX A;  3O9X A;  3COV A;  4KUM B;  5JDG A;  2SPC A;  3KIN B;  3ESL A;  3KV5 A;  2NTX A;  3RF1 A;  3FZM B;  2H89 A;  4U7Y A;  2C5J A;  3UK2 A;  5AQO B;  2LSK A;  2K9A A;  3FZF B;  3H37 A;  4KBM B;  1MOP A;  5LXT E;  1UCU A;  3MXZ A;  3N9L A;  3MKD A;  3UUN A;  1E1H B;  2V7I A;  3JAF A;  2WAU A;  1XDO A;  5JRC B;  1MMN A;  4WNK A;  2LRK A;  2XQ6 A;  3I0Q A;  3UU8 A;  3CVR A;  4EYY R;  3PTR B;  1HG5 A;  5J0Z A;  3ISJ A;  3FZK B;  4MUH A;  2HH7 A;  4X1I E;  4TZ4 C;  2QA7 A;  1OWA A;  3INN A;  3RRW A;  3LSV A;  4JI7 T;  1V9D A;  2XSA A;  3J9X 1;  1UUS A;  3ONJ A;  1W0B A;  4ADZ A;  2FJD A;  4O2B E;  3LG7 A;  2W62 A;  5LMU T;  4KMC A;  5AQG B;  2Q9Q D;  4JYA T;  3JCF A;  3KVB A;  4DV4 T;  2YDQ A;  4ILU A;  4U2Z A;  5CJ5 A;  1ZV4 X;  2JMK A;  2IAK A;  1HF8 A;  3MZK B;  4A98 A;  2HPJ A;  2AXD S;  3A5X A;  3AXJ A;  5ABF A;  2X9Y A;  3NRY A;  2MBG A;  1E7P A;  2YU1 A;  2KIN B;  3VHL A;  1BR4 A;  3TLS A;  1HNX T;  4L0R A;  2X9H A;  3ZYK A;  4YLH A;  2Z6E A;  5BR8 T;  2NW7 A;  4X64 T;  4P0A A;  3I9Y A;  3ONX A;  1E2A A;  5FXV A;  5F8P A;  4IE4 A;  2BG9 A;  4PJJ A;  3R84 B;  1KNZ A;  2JJ9 A;  4PAG A;  4MAL A;  1NEK A;  2XSB A;  5C3J A;  1SUM B;  5IYZ E;  2E5L T;  4QWN B;  4WBN E;  5HXS A;  2X9X A;  1UX5 A;  3BK9 A;  4YSX A;  5L4E A;  3PUX F;  3PE0 A;  2OV9 A;  1KNR A;  4JI6 T;  4MUF A;  2E2A A;  3V5S A;  3UU5 A;  3CFF L;  1LRZ A;  2V6X A;  2V7K A;  3AE1 A;  3I1A A;  3FBZ A;  4CI3 B;  1YQ4 A;  3ZLI A;  4UF0 B;  4BA9 A;  2OA5 A;  2D0T A;  4ZZB A;  4EAH A;  2A86 A;  3EAM A;  2D0U A;  3UU6 A;  2FBW A;  4CXX A;  2BG9 C;  4AIS A;  5FP3 A;  1OED A;  2W00 A;  4TWF A;  4CZZ B;  2KXP B;  5AQQ B;  3BQI A;  4YXD A;  2VK9 A;  1XWM A;  3RYH E;  5LHG B;  3ANW B;  4IDQ A;  2LM2 A;  3CIR A;  1AJ3 A;  4BJN A;  3MA9 A;  4DR7 T;  2KWH A;  2YOE A;  3N9P A;  2FUP A;  2BG9 E;  4XAX B;  4TV8 E;  3GN5 B;  2DLR A;  4QX7 B;  4DO0 A;  2OGF A;  5JDM A;  2VL8 A;  4C90 A;  2H7O A;  2VB6 A;  2G16 A;  2XQ9 A;  3RIU A;  4I4T E;  1NAF A;  4AKR B;  4LF5 T;  4A5X A;  2ZM8 A;  4TUY E;  4ZXL A;  5L3F B;  3K3O A;  5CA1 E;  3ETV A;  2RPA A;  3CX7 B;  1YQ3 A;  2G3D A;  2V1D B;  3FXE B;  5LJM A;  4QXB B;  4P1N A;  4CXW A;  1OED C;  3FBL A;  1HNZ T;  5AQF B;  2FJE A;  4ASK A;  2BVM A;  1N36 T;  5HEU A;  3HKD E;  2LM9 A;  2E9X D;  3RKO A;  4IDZ A;  4K0K T;  4TX5 A;  4LF9 T;  3F31 A;  4CI2 B;  1XDP A;  1MMD A;  2IDO B;  3KBT A;  2XY8 B;  2VQF T;  2BS4 A;  2CBI A;  5F3J A;  4DV6 T;  4HFB A;  4DE5 A;  1MIY A;  1W0A A;  2XAF B;  2HN1 A;  3ABV A;  2IC6 A;  4H63 V;  5HWY A;  5AQP B;  3RIU C;  1L0V A;  2LOP A;  4UV8 B;  5FXX A;  2CA5 A;  3L3P A;  4ZI2 C;  1T72 A;  2K48 A;  5CB4 E;  5CFB A;  1DU2 A;  2WWV A;  3RYC E;  2WWU A;  2NP9 A;  4L5G A;  2HPL A;  1Y64 B;  4CN4 A;  2V26 A;  5JDN A;  3KV9 A;  4EFK A;  2FJA A;  4FI5 A;  1N2E A;  5AQJ B;  2KT9 A;  2X68 A;  2F4V T;  3ZMZ B;  3AA0 B;  3IVG A;  2CXL A;  3K3N A;  3VRA A;  5L3B B;  2ACZ A;  4U2Y A;  4AI6 A;  4EOZ B;  3AEA A;  3N5L A;  2YEV C;  3NWI A;  5G2F A;  4ANJ A;  3N9O A;  4KHP T;  3AB3 B;  3ZEF B;  4HFI A;  1OXZ A;  1VCS A;  3H3A A;  5IHY A;  2CXF A;  1XMO T;  4JI5 T;  4HFC A;  1QLB A;  2CE7 A;  3EDU A;  1YKH B;  2XAS B;  1WRD A;  2A54 A;  3AE4 A;  3IF8 B;  1SHZ C;  4B3T T;  2VVS A;  2KSR A;  4EIW A;  2W67 A;  4IL4 A;  4LFA T;  1W9R A;  2IW5 B;  2XPK A;  4P0B A;  2GW4 A;  2MAW A;  3RLF F;  2EHO D;  1HCI A;  3MUE A;  4YTP A;  2WP9 A;  2JQH A;  3IMC A;  2WCA A;  5AQV B;  4U31 A;  4DV0 T;  3HKB E;  2PTF A;  4MLK A;  3IOB A;  3CFA L;  4JI2 T;  2K24 A;  4HFH A;  5AFU L;  4IE7 A;  2WMN A;  4DMV A;  4HN9 A;  5LGU B;  5ABG A;  5AQH B;  4X5T A;  3M3Z B;  2FJB A;  4DR5 T;  4DMW A;  2IHR 1;  2V6Y A;  4LFC T;  3HA4 A;  2VKJ A;  4AQG A;  2LHN A;  3CWZ B;  4DV5 T;  3OJA A;  3UUL A;  3T1Y T;  2CHN A;  3ZT5 A;  2WMO A;  5FL1 A;  4MQ6 A;  3HKE E;  3N9Q A;  1N2H A;  4MHC A;  3COW A;  2N2N A;  3PUY F;  5HYA A;  3HL6 A;  2PBI A;  4HFV A;  3IBP A;  2MYS A;  4X66 T;  4F8H A;  2ACX A;  2M6B A;  2V5C A;  4WBO A;  2QGS A;  3PU8 A;  4N78 D;  4UVC B;  2E5V A;  3UFE A;  2LE8 A;  4BAY B;  5JRC A;  1HR0 T;  5ADX L;  1SE7 A;  3RX6 A;  4CN6 A;  4HGA A;  3DJB A;  2QYW A;  3KVA A;  5F5W A;  2BKN A;  4PJL A;  3I0O A;  2LRL A;  3Q5W A;  5JQG E;  3IHR A;  1M62 A;  5JDL A;  4DV2 T;  4A56 A;  1UGO A;  2WDR A;  3AG5 A;  2ZMA A;  3SWH A;  2WM9 A;  2A56 A;  1J1J A;  1MNE A;  3QUJ A;  4EV6 A;  1D0Z A;  1FIO A;  2ZM0 A;  5DQW A;  2DWG A;  5JR9 B;  4EZH A;  4ZI3 D;  2YKS A;  2X0Y A;  3JAD A;  4DUZ T;  4FZJ A;  4O4L E;  3IOC A;  5DAB A;  1I6Z A;  2A50 A;  2DI4 A;  4QH1 A;  4LMJ A;  2IC9 A;  1N34 T;  2CHO A;  2JQQ A;  3N9N A;  5LA6 E;  2WBL A;  4ILC A;  5H6Q B;  3SS1 A;  3BQK A;  3AA6 B;  3AA7 B;  1H7C A;  2XM1 A;  4G5Y A;  3JC6 D;  5JTG A;  4OFZ A;  3SOL A;  3AVR A;  4CN1 A;  3QOF A;  1M7K A;  3CFI A;  5FVL A;  1KNP A;  4PK4 A;  4IE0 A;  4ZS3 A;  2A72 A;  2VKD A;  5HXC A;  3ZYL A;  5LGT B;  3P4R A;  1MMA A;  5AQI B;  3ZMT B;  1XZY A;  1O3X A;  2WB5 A;  3M65 A;  4WYV A;  4NUU A;  3O1H A;  2YDS A;  3F57 A;  3KDS E;  4YSY A;  5CGM A;  2Q9Q B;  1T7S A;  1N32 T;  1VCT A;  2V7L A;  1D1C A;  4H9P C;  5HCJ A;  3T1H T;  5LBM A;  5L3D B;  2RET A; 
#chains in the Genus database with same CATH homology
 4QKN A;  3I9W A;  4F6R C;  3Q2M A;  2V7M A;  1AJ3 A;  1QSD A;  4BJN A;  2XUE A;  1IHO A;  1LVK A;  1X79 A;  2X9W A;  2CWY A;  2X51 A;  4DDK A;  3T8O A;  3QC9 A;  5GON E;  3MA9 A;  4HE8 A;  2KWH A;  3N9P A;  3ZPO A;  4XAX B;  3C50 A;  3KV4 A;  1HTJ F;  5JR9 C;  4AKG A;  4PW8 A;  4TV8 E;  3GN5 B;  3FHN A;  1N2I A;  2Q9Q A;  2DLR A;  4JEH B;  1B7T A;  4QX7 B;  4V1A v;  4DO0 A;  3IOE A;  2B1E A;  2KMF A;  3PUR A;  4KP3 C;  4PJM A;  3AAE B;  2JPF A;  2ES0 A;  1FMV A;  5J2U E;  5JDM A;  2VL8 A;  4C90 A;  2H7O A;  1D1A A;  2VB6 A;  2G16 A;  5JH7 E;  3GA8 A;  4I4T E;  1NAF A;  1ZHC A;  5FNV E;  4G63 A;  4PFO A;  4AKR B;  4GK5 E;  5LYJ E;  5FY1 A;  4HEA A;  2ZM8 A;  4TUY E;  4C91 A;  3ANW A;  5L3F B;  5EK2 A;  3LK2 B;  3VU7 H;  3K3O A;  5CA1 E;  1NWM X;  3CX7 B;  3ETV A;  3E0Z A;  3PUS A;  4PFP A;  2A53 A;  5H6R B;  2G3D A;  2V1D B;  3FXE B;  5HXH A;  5LJM A;  5JRE A;  4QXB B;  4PNI A;  2D2S A;  2KLQ A;  3O4X E;  4QXC B;  5JDF A;  4CXW A;  3GMI A;  3FBL A;  5HXR A;  1IJ6 A;  4ASK A;  2BVM A;  3AVS A;  1VRB A;  5L3C B;  3CPZ A;  3HKD E;  2CXD A;  4UEM A;  2LM9 A;  4DBR A;  1UFV A;  4Z8X A;  2E9X D;  3RKO A;  1N2J A;  1HG2 A;  4IDZ A;  3NZP A;  4ZI7 E;  2G2S A;  4TX5 A;  1T98 A;  3GN5 A;  4DDM A;  3NZQ A;  3F31 A;  4CI2 B;  4H9Q C;  3N2K E;  5FY0 A;  5HG0 A;  3RH3 A;  4GYR A;  1MMD A;  4MUN A;  1D1B A;  3RPU A;  1MIV A;  2H7V C;  4IE6 A;  3U78 A;  3HKC E;  2A2F X;  2CM0 A;  3KBT A;  3KV6 A;  3UTK A;  2YU2 A;  3AG6 A;  4XBF B;  5F3J A;  2BDE A;  2LSG A;  1YD8 G;  2LOS A;  4DE5 A;  1WYB A;  2DNX A;  4WW0 A;  1MIY A;  1IZN B;  3ZJ1 A;  3UY4 A;  2XAF B;  4I43 B;  1CUN A;  3CQX C;  2Q9Q C;  4UXN B;  2IC6 A;  3LE8 A;  2UXX B;  4H63 V;  2H3R A;  4OK0 A;  5HWY A;  2XAQ B;  5FY7 A;  4H9R C;  3ZMV B;  2ZLY A;  5EK4 A;  2X67 A;  4ZS2 A;  3TKL B;  1G8X A;  3PUQ A;  5LBQ B;  2NTY A;  5M4Y A;  4U72 A;  2LOP A;  3ZCI A;  2C0S A;  4UV8 B;  5FXX A;  1WLX A;  4GOU A;  1HX8 A;  2Y6X A;  2CLY B;  2CA5 A;  4EZ4 A;  3W15 B;  3L3P A;  2XAJ B;  3VKG A;  5KWV A;  1MMG A;  5EXC A;  5DJQ C;  4MUE A;  2Y48 B;  3V5U A;  2MTQ A;  5A1L A;  4ZI2 C;  2X66 A;  5JDQ A;  1MIW A;  2K48 A;  1Z0P A;  2VWA A;  5CB4 E;  5C8Y E;  3ZJ2 A;  4I55 E;  4OYK A;  3U3I A;  5FXZ A;  3RYC E;  5HAX A;  4UEL A;  2WWU A;  3Q10 A;  3MK7 C;  4GYS A;  5DQV A;  5LNK A;  4HTE A;  2ODV A;  2NP9 A;  3Q12 A;  2X0L B;  4IXJ A;  4L5G A;  2HPL A;  1Y64 B;  2V26 A;  2XAG B;  4DVD A;  5JDN A;  3KV9 A;  4AKI A;  4EFK A;  3C98 B;  1U5P A;  5BMV E;  3IUB A;  3UT5 E;  2BZB A;  4H9N C;  5CA0 E;  4X1Y E;  1YKE B;  4FI5 A;  3MXT A;  1N2E A;  4UF0 A;  2KT9 A;  4ZI3 C;  3RRC A;  5KX5 E;  2X68 A;  3UUM A;  1ZKE A;  3HR0 A;  4UVA B;  4FJO A;  3OYX A;  2PJQ A;  3ZC1 A;  2CWO A;  3AA0 B;  2CXL A;  2I59 A;  3K3N A;  3ZMZ B;  4E7S A;  5L3B B;  3IVG A;  3CKD A;  3B57 A;  3LBX B;  4AI6 A;  4QXH B;  4IHJ E;  4EOZ B;  4AQF A;  3N5L A;  3IVX A;  3AAI A;  2YEV C;  5G2F A;  3O1J A;  1KK7 A;  2NW8 A;  2YIN A;  4ANJ A;  3N9O A;  5TAO A;  3WI3 A;  3D0T A;  3K3Q C;  1G73 A;  2ODU A;  3OBV E;  2A84 A;  4O4I E;  3EVY A;  2L8K A;  3FB2 A;  4DDH A;  5J1G A;  3AB3 B;  3ZEF B;  3ETU A;  3RYF E;  1OXZ A;  3GWH A;  2KWI B;  4O4J E;  3RYI E;  4PJN A;  4EF6 A;  3QK6 A;  4M1P A;  3H3A A;  3UA0 A;  1SA0 E;  3ZMS B;  3WAJ A;  1S35 A;  4PK6 A;  5IHY A;  4J2C A;  2CXF A;  3JC6 C;  1BR0 A;  3Q9D A;  2LT3 A;  2CE7 A;  2PFV A;  2C5K T;  2LSI A;  3EDU A;  1YKH B;  2XAS B;  3P7I A;  4O8S A;  2E9X B;  1WRD A;  2A54 A;  3PUG A;  4BJM A;  2XQY A;  4H63 H;  3IF8 B;  5KDM C;  1SHZ C;  3LK3 B;  4ZHQ E;  3LK4 2;  2CEA A;  1VOM A;  4EIW A;  2K5B B;  2G5Z A;  1S94 A;  3ZCJ A;  3LBX A;  3RC3 A;  3DP7 A;  4GK0 E;  2VAS A;  2IW5 B;  2ZM2 A;  4DND A;  4MUG A;  2XTL A;  4P0B A;  3J7Y q;  3C4W A;  2GW4 A;  3IME A;  2N1G A;  2CMR A;  4AKL A;  3L09 A;  2EHO D;  1HCI A;  3IEE A;  3C64 A;  2A7X A;  4EYU A;  3QTT A;  3MUE A;  2KND A;  4YJ2 E;  5L3G B;  3AA1 B;  4ISS A;  3OKQ A;  4B6X A;  1BR2 A;  2XHE B;  3PDY A;  3NRX A;  3DTO A;  3COZ A;  3IMC A;  2L3L A;  3O9X A;  3COV A;  4OYJ A;  4KUM B;  3HKB E;  3Q5X A;  2SPC A;  5JDG A;  4MLK A;  3IOB A;  2CLY C;  4AQF C;  3KIN B;  2K24 A;  3ESL A;  3CFA L;  5AFU L;  3KV5 A;  2NTX A;  5L3E B;  4IE7 A;  4EXT A;  2E9X A;  2A88 A;  2WMN A;  4DMV A;  4ZOL E;  2W0G A;  4H9S E;  3MJX A;  4HN9 A;  5LGU B;  2C5J A;  3UK2 A;  2LSK A;  2K9A A;  1WYC A;  3H37 A;  4KBM B;  1QUU A;  1FEW A;  1MOP A;  5LXT E;  4DMW A;  2J1D G;  1UCU A;  2A3D A;  3MXZ A;  1ZEE A;  3C51 A;  3HA4 A;  3N9L A;  5LJN A;  2UXN B;  2LJL A;  2VKJ A;  3NBX X;  2E8I A;  4AQG A;  3COY A;  3MKD A;  4GIW A;  3UUN A;  2LHN A;  1E1H B;  2V7I A;  2WAU A;  3CWZ B;  3P8C D;  5JRC B;  2NOX A;  5LCY A;  1MMN A;  2Y8D A;  2YK0 A;  4WNK A;  4ERR A;  3OJA A;  4O2A E;  3UUL A;  3I0Q A;  5JDH A;  4QX8 B;  4I50 E;  1FMW A;  2WMO A;  5LG4 A;  3CVR A;  4EYY R;  2L9Q A;  3PTR B;  1HG5 A;  4JUY A;  1WR6 A;  3HKE E;  4K0U A;  4MQ6 A;  3N9Q A;  1N2H A;  4MHC A;  3COW A;  2XAH B;  3ISJ A;  3F2E A;  2N2N A;  5FMN A;  2NWB A;  3HL6 A;  5HYA A;  5LHH B;  2PBI A;  4HFV A;  3PU3 A;  4MUH A;  2LSJ A;  5LGN B;  2HH7 A;  4X1I E;  2EJC A;  4JEU B;  3IBP A;  4TZ4 C;  2MYS A;  2D5U A;  2QA7 A;  1OWA A;  3INN A;  3VKH A;  2BVL A;  2ACX A;  3RRW A;  4WBO A;  4X20 E;  2QGS A;  3PU8 A;  4N78 D;  5JVD E;  3IOD A;  3SRZ A;  4UVC B;  3O1I A;  1V9D A;  3J9X 1;  3CX8 B;  2A52 A;  3E08 A;  3BQL A;  4OHF A;  4PK5 A;  3UFE A;  4ADZ A;  5LHI B;  1N2O A;  5ETW A;  2LE8 A;  3MAC A;  1US7 B;  4O2B E;  4BAY B;  3LG7 A;  1U4Q A;  2W62 A;  2E9X C;  4CXY A;  5ADX L;  5JRC A;  4KMC A;  5J2T E;  1N2B A;  3RX6 A;  2Q9Q D;  4HGA A;  4MUL A;  2GK9 A;  2WSS V;  3DJB A;  3KVB A;  3KVA A;  2W63 A;  3EUH A;  4ILU A;  3CX6 B;  4G2A A;  1ZV4 X;  2JMK A;  2IAK A;  3LJC A;  3N2O A;  4PJL A;  3CML A;  3I0O A;  1HF8 A;  4BHR A;  3MZK B;  3HI2 A;  3Q5W A;  4U74 A;  5JQG E;  2HPJ A;  2JMH A;  3A5X A;  4JLE A;  3IHR A;  4YHJ A;  2X9Y A;  3NRY A;  2MBG A;  3ZN0 B;  2YU1 A;  2KIN B;  3VHL A;  1BR4 A;  5JDL A;  4MUI A;  4IIJ E;  5EZY E;  4L0R A;  4A56 A;  4AXP A;  5HXE A;  3E22 E;  2X9H A;  5FYM A;  3WAK A;  2C5I T;  3CQC B;  4YLH A;  2Z6E A;  3ZYK A;  4XZC A;  3AG5 A;  4NUV A;  2ZMA A;  1EZ3 A;  1D0Y A;  2LHR A;  3KFW X;  2NW7 A;  3SWH A;  2WM9 A;  3ZYM A;  4ZI2 D;  2A56 A;  2EHO B;  1HS7 A;  1IAP A;  4P0A A;  3EDV A;  3I9Y A;  1MNE A;  2PG8 A;  3ONX A;  3LF4 A;  5FXV A;  4MFR A;  2LSY A;  3QUJ A;  2V7J A;  1D0Z A;  1FIO A;  5LP6 E;  2ZM0 A;  1IJ5 A;  3AAA B;  5KMG P;  5F8P A;  3RC8 A;  5HWX A;  2DHR A;  5DQW A;  4IE4 A;  4O4H E;  3IUE A;  2DWG A;  5JR9 B;  3K8P C;  4EZH A;  4PJJ A;  3R84 B;  1KNZ A;  4ZI3 D;  3IVC A;  2RP4 A;  2JJ9 A;  3OYZ A;  1BR1 A;  4PAG A;  3C4Z A;  4MAL A;  4FZJ A;  4O4L E;  3IOC A;  5IYZ E;  5DAB A;  2A50 A;  2DI4 A;  2CCQ A;  4L9I A;  4QWN B;  2DWK A;  4MUK A;  2IC9 A;  4WBN E;  2JQQ A;  3ZN1 B;  4TV9 E;  4EB6 E;  2LEH A;  3N9N A;  4YFS A;  5LA6 E;  5HXS A;  2X9X A;  4IGU A;  2EHO A;  3FXD B;  1UX5 A;  3BK9 A;  2WBL A;  3ZC0 A;  5H6Q B;  3PE0 A;  2RA1 A;  3SS1 A;  3BQK A;  2JRK A;  3AA6 B;  4UVB B;  3ZMU B;  3AA7 B;  1H7C A;  4G5Y A;  3N8H A;  2G0U A;  2X3F A;  3JC6 D;  3CQG B;  4MUF A;  5E0O A;  3V5S A;  4HKA A;  4OFZ A;  1HFA A;  2VKH A;  3S4U A;  3SOL A;  3CFF L;  4CQI A;  3B13 A;  1LRZ A;  3AVR A;  2V7K A;  5JR9 A;  3IMG A;  4DBQ A;  3I1A A;  3FBZ A;  1LVF A;  4CI3 B;  1LKX A;  1V8F A;  4PK4 A;  3ZLI A;  4IE0 A;  5L2L A;  4IST A;  4ZS3 A;  2A72 A;  2VKD A;  4UF0 B;  5HXC A;  3ZYL A;  4BA9 A;  4CI1 B;  2OA5 A;  5LGT B;  2VKO A;  2W61 A;  4X1K E;  1MMA A;  2D0T A;  1MND A;  4MBQ A;  4AKH A;  4EAH A;  2A86 A;  5LOV E;  3ZMT B;  3N9M A;  2NW9 A;  1D0X A;  1O3X A;  3M65 A;  2D0U A;  3KBU A;  4MUJ A;  3LFM A;  4E7Z A;  4NUU A;  5FXW A;  2MOZ A;  3R6N A;  3O1H A;  3F57 A;  3KDS E;  3CFH L;  4CXX A;  3N2G E;  1YW0 A;  4QHO A;  5FP3 A;  2Q9Q B;  1UX4 A;  4TN7 B;  2V7L A;  2W00 A;  1D1C A;  2DCF A;  2KZ7 B;  2KXP B;  4CZZ B;  4UIG A;  4P09 A;  3BQI A;  2VK9 A;  4H9P C;  3C4X A;  2M67 A;  3UUX B;  4IE5 A;  4G5F A;  2N9D A;  4UV9 B;  3RYH E;  1N2G A;  5EK3 A;  5LHG B;  3PUA A;  2P9B A;  3ANW B;  4YJ3 E;  5LBM A;  5L3D B;  2EHO C;  4H9O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...