3HL6A

Staphylococcus aureus pathogenicity island 3 orf9 protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
213
structure length
189
Chain Sequence
b'DIETIVNEFETRAGTLLRYYTGLLERSKVQPCCFKLYNDPFDMVYVMMNSKLFSHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKQLSISDMMASQLFEDEYFMYGLQTYQSSNTDVIANIEMLYQLATGINEPVPELVEGLKLVTEFVQDENATQEDYKALERKLNDLKASYYSLSKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pathogenicity island protein
publication title Structural and functional studies of a pathogenicity island protein from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Unknown function
total genus 58
structure length 189
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16560 SAPI Putative mobile pathogenicity island
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.700 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3hl6A02
3.30.1300.50 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3hl6A01
3HL6A
chains in the Genus database with same CATH superfamily
1T98A 3RYFE 2CLYC 3JADA 4X1KE 4E7SA 5L4EA 3CKDA 4X62T 4Z8XA 2VURA 4LMJA 3EVYA 2D5UA 2XQ6A 1KNZA 3CFHL 3CPZA 3AE3A 2VL0A 4ZS3A 3RI5A 3UUBA 4EZ4A 1NWMX 4TZ4C 3Q5WA 2Z6EA 1DU2A 3PU8A 3RQWA 1NAFA 5AQOB 3H3MA 4DV1T 4MBQA 2XM2A 1Z0PA 2W63A 3RYHE 3N9NA 5J2TE 3ZT5A 3NKZA 3K3OA 2E5LT 2WDQA 3AVRA 1KK7A 3AE8A 4MHCA 3PUGA 4G5FA 2PBIA 5CFBA 2G16A 2W2UA 3IMCA 4ILAA 2CM0A 2CBJA 4HFCA 5EXCA 3JC6D 2LEHA 4DR5T 3INNA 1X9BA 1UK5A 2IMLA 3OPCA 5FMNA 1I94T 5DABA 4JYAT 5IWAT 2BKNA 2X9YA 3FB2A 2WBLA 2ACXA 2V7JA 4JI6T 2X66A 2I6HA 5LJNA 5LA6E 2YU2A 4G5YA 4UR9A 2RPAA 1FIOA 5JREA 4U31A 4X1IE 3SRZA 1HX8A 4XBFB 2NWBA 2D0TA 2WZIA 5HXEA 1N34T 2F4VT 4YTNA 2KWIB 1YKHB 3OKQA 4AQGA 2X67A 2LMEA 1SHZC 3FXEB 5FY0A 1IAPA 1IBKT 2B76A 5ABFA 5HEUA 4JI0T 2BZBA 3AE7A 2I59A 2V26A 5AQJB 2BDEA 4IE4A 2CRBA 2J1DG 2CLYB 5LMUT 1VRBA 4PAGA 4MUKA 4LF6T 4HGAA 2BG9A 3X1DA 5AQPB 3I0OA 1NENA 4MALA 4PK4A 2IAKA 1IBLT 3RKGA 2LRKA 5LMNT 2KXPB 2BS4A 4ZEYA 2XQ7A 5ABFB 3TLTA 2JQQA 5L3GB 1Y64B 3O1IA 5LG4A 2JQHA 2K24A 2X51A 4YSXA 3IVCA 1E2AA 2BG9B 3RH3A 3HKCE 2CXDA 3Q2MA 3COWA 3UK2A 4NUVA 5JR9A 2XAGB 2VL8A 1G73A 4Q25A 4WW0A 3UTKA 3LK42 1MOPA 3CQGB 3OTOT 3SWHA 5FXVA 4TNWA 1HNXT 2JQKA 4I0UA 1HTJF 4OYJA 4C91A 5HEOA 1UUSA 3C4ZA 3HKDE 1N33T 5FXWA 4CI3B 3LJCA 5JR9B 3MJXA 2X9WA 2C5JA 4EB6E 5LCYA 3TLUA 3MACA 2X68A 1S94A 4QX7B 3COYA 5LJMA 3K3QC 2VQET 3QK6A 3AE1A 2ODUA 4LFAT 2LOPA 4ILCA 4EEDA 2LM2A 4Z90A 1ZV4X 1ZOYA 2OGFA 3RLFF 4I4TE 4I43B 4JV5T 2CE7A 3RYIE 2M6IA 3OYZA 2AXDS 3HI2A 5KWVA 3N9OA 2LT3A 3CVRA 1D0XA 3QOFA 2DWGA 3KBUA 1MIYA 3CK6A 4JEUB 2V5CA 3HR0A 2DLRA 3N9PA 3CX8B 3GMIA 2V7MA 2D2SA 3IOBA 1LVFA 3OYXA 2XPKA 2M6BA 4ERRA 5EK4A 4ZZCA 2YDSA 1WLXA 3UU4A 4CN1A 3N9QA 3AG5A 5JTGA 2VVNA 4KHZF 3LFMA 3I9WA 2WB5A 4HWDA 4JI2T 3AE5A 3GN5A 5HYAA 1WYCA 1QUUA 5L3FB 2ES0A 4HFIA 3VKGA 1WCRA 2JJ9A 4MUEA 2NOXA 4YHJA 5L3DB 1LVKA 3C4XA 3ONLC 3UA0A 4OK0A 5JDNA 2BBHA 3E0ZA 2XASB 5AQIB 3GN5B 3IMGA 3BQIA 2XAHB 4IREA 1UCUA 4ADZA 2UXDT 4IIJE 3EHZA 4E7ZA 5AQRB 1FEWA 1KNRA 2FJBA 5JDGA 3CMLA 3K8PC 4TN7B 2LM9A 3Q5DA 2UXNB 2V8SV 3S4UA 4I55E 3ZYLA 4V1Av 4ANJA 1E1HB 3RC8A 1IBMT 2X3FA 4QXHB 1O3XA 2XAJB 3VR8A 3AECA 1YD8G 2A84A 2I0MA 3UUNA 3L39A 5ETWA 3H3AA 4H9NC 5LYJE 2K5BB 2KSRA 3FBLA 3RKOA 4IE6A 3BQLA 3RX6A 3E22E 4ASKA 4B6XA 1KFYA 4MULA 2A56A 1IHOA 4UV9B 5DQVA 3U78A 5H6QB 4EIWA 2OA5A 4L0RA 4PJNA 4HFEA 4TWFA 2LSJA 3VU7H 4ISSA 4EFKA 5HAXA 4BAYB 4DUZT 2WWVA 3GA8A 2FBWA 4O4IE 3SS1A 5ABHA 3I9YA 4G63A 2VQFT 1XZYA 4P0BA 4IT4A 4GIWA 1HX1B 5C3JA 1OXZA 5JQGE 2KINB 4QHOA 4U33A 4YY3T 5AQFB 4HN9A 1D0ZA 4PK5A 4PW8A 2FJAA 2BKPA 3C64A 3F2EA 2JMKA 5AQNB 1CUNA 1W9RA 4DR7T 2CMRA 2G5ZA 5FXZA 3P50A 4ZHQE 5LB7B 3VRAA 3ZN1B 4CZZB 1J5WA 2SPCA 3UU3A 4H9QC 3MXTA 4IDOA 5JRCA 3KV6A 2YOEA 3PV0F 3KINB 3NZQA 4AKGA 3R84B 1XMOT 3TKLB 2G0UA 4NPPA 5CGMA 2E2AA 4L5GA 2XUEA 1JNRA 4U7IA 3P8CD 5AQSB 4X65T 3N2GE 5KX5E 1WR6A 2MPKA 3D0TA 3K1SA 3P4SA 3H37A 2D0UA 5ABEA 3AB3B 2WWUA 4DDMA 1EZ3A 3N9MA 2A3DA 4MUHA 4AQFA 3ZJ2A 5JRCB 1HCIA 2X9XA 2CHOA 3UFEA 2JMHA 2ZMAA 5L4HA 5AQVB 4EV6A 4IE7A 3EMOA 1SA0E 5GONE 2VVSA 1U4QA 3RC3A 1BR4A 3O1HA 3IOCA 4AKIA 2KLQA 4AIUA 4EYYR 2LSGA 4EYUA 4AKLA 2LSYA 4DV7T 5FYMA 2E9XC 5AQHB 3EDUA 4P0AA 3C4WA 2XTLA 3LDQB 3UFGA 3ZSTA 3LE8A 2BG9C 3A7MA 5HG0A 4ZXLA 3AA6B 3L09A 4WBNE 1ZKEA 2IUBA 2MAWA 4BHRA 4GYRA 5LGNB 3EUHA 5LBQB 2ODVA 3FBZA 4TWDA 2MOZA 3HL6A 3O1JA 2A86A 3L8RA 4X20E 3SOLA 4YJ2E 2N2NA 2YINA 3CIRA 4DV6T 2WU2A 1OWAA 3ZMZB 3RIUC 2CEAA 4AI6A 2GK9A 5JR9C 3ZT6A 4EOZB 3EDVA 3AA1B 2Q9QD 3EAMA 4HWCA 1SE7A 4IXJA 1V8FA 4GYSA 2DWKA 5AFUL 1N2HA 4HEAA 5JDQA 2IC9A 4MUGA 4MQ6A 2CPTA 2EHOD 5BW0B 3LG7A 3AEDA 2B1EA 4KMCA 3N2KE 3PUWF 2C5IT 3AEGA 5BR8T 1N2GA 3CX6B 3PE0A 4IE0A 4HKAA 3JC6C 2A52A 3IF8B 2HN2A 1ZHCA 2XAQB 3OJAA 3CQXC 4F6RC 3AE4A 5DJQC 4IHJE 1H7CA 4X5TA 4A98A 3RQUA 5F3JA 5HWYA 1MIVA 2E9XA 2K48A 2QRXA 4B3RT 3PJAJ 4NXMT 3ZMUB 3ZLIA 3ZMVB 2V7KA 3RRWA 4EF6A 1W09A 3RIAA 3AEBA 1MMAA 2VWAA 4QH1A 2CCQA 4CXWA 3OBVE 2UXBT 2MYSA 2HN1A 2KMFA 2QVAA 2W61A 4PFPA 3IUEA 2E9XB 4H9PC 3RPUA 2BS3A 5FY1A 5AQKB 3UU5A 2JPFA 3PUXF 5AQGB 4ZI2D 1J5ET 1J1JA 4H9OC 1T72A 4U7YA 4MUIA 4CXYA 2V5DA 4C90A 4MUNA 3GWHA 3RIUA 4DE5A 2JRKA 3COZA 1ZP0A 3UU6A 5BMVE 1W0BA 2WM9A 3UU8A 4H9SE 4LFCT 3U3IA 2UUCT 3ZJ1A 4IDNA 4YXDA 1BR0A 4K0UA 3L3PA 4O4JE 4PK6A 1N32T 4YSZA 5JDFA 4EXTA 3EABA 3KVAA 3RGLA 3MK7C 2QYWA 2BKOA 3PUYF 4YSYA 2DNXA 1S35A 2N1GA 3NRYA 3O9XA 3ISJA 2Q9QA 4U2YA 4U2ZA 4JI7T 2XSBA 2JQ9A 3T8OA 2RA1A 1XNQT 2NP9A 1R8IA 3KFWX 4MUJA 5F5WA 1D1BA 4KP3C 2LOSA 2VB6A 4UXNB 4AQYT 4KHPT 1YKEB 1LKXA 3ZT7A 2D9DA 2EHOA 5LOVE 2XJ7A 2BBJA 5AQMB 2Q9QB 3KDSE 3AAAB 4FI5A 4UVCB 1YQ3A 2WCAA 4CQIA 4H63H 2P9BA 4UELA 4ZI3D 4LF8T 3AE2A 4X64T 2LKHA 4U3CA 2WZHA 2KNDA 3Q5EA 1KNPA 4WBOA 3T1YT 5LGTB 4QXCB 2CHNA 4ZZBA 3TLWA 1N36T 1UFVA 2LKGA 2EHOB 1I6ZA 3IOEA 2WMOA 2E8IA 5HCMA 4OX9T 4YTMA 2XQ9A 3ZC1A 2A7XA 1UGOA 2LHNA 2UXCT 3T1HT 4LF5T 2E5VA 2XZEA 3Q9DA 4DR4T 3V5SA 4O4LE 4DIDB 3KV5A 5JDMA 5M4YA 3ZYMA 2YKSA 5JVDE 3AAIA 3AG6A 4LF9T 2IW5B 4QX8B 5L47A 4EEBA 3Q12A 3ZEFB 4HFHA 1IJ5A 4QH5A 5L3CB 2WDRA 2FJEA 3RHWA 4FJOA 2M67A 5E0OA 3PTRB 5HXHA 2CWOA 5AQTB 2RP4A 5KXJA 2WP9A 3QNUA 4A97A 3I1AA 4A5XA 3PUVF 3ETUA 2YU1A 3IHRA 3PJAA 2XQAA 1YQ4A 2UUBT 2BG9E 4JI8T 2IIUA 3FZHB 4AQFC 5CB4E 4O2AE 3IUBA 5FP3A 2C0SA 1HS7A 4NXNT 4IDPA 3V5UA 4DV2T 1T7SA 3BK9A 2WDVA 5AQUB 2XM1A 4HFBA 4ZOLE 4X66T 2A53A 3QUJA 1N2BA 2CA5A 3MUEA 3CWZB 2WSSV 4JBWF 3DP7A 2Y8DA 5FL0A 4U74A 4UVAB 4N78D 4CN6A 2JIWA 3O4XE 2W4XA 4B3MT 1US7B 3AVSA 3NRXA 2R6GF 2BS2A 3KV4A 4H63V 1Y01A 4AXPA 5DQWA 3WI3A 1Z8UA 4YFSA 4LFBT 4M1PA 5JH7E 2WU5A 4FZJA 2I52A 2VKHA 2J4GA 2C5KT 3ZYKA 1M62A 4PNIA 2A72A 3UUMA 2VKOA 5IUXA 2V6XA 2BVLA 5JDLA 4YTPA 2ACZA 4P1NA 4HFDA 3VR9A 5KDMC 3IMEA 3HKBE 3N8HA 3C51A 3JCFA 4DR6T 4IL9A 3UQ4A 5HXRA 1WFDA 1BR1A 1D1CA 1HNWT 1KF6A 2VASA 5CJ5A 5LNKA 4IGUA 2YK0A 1VCSA 1XMQT 1VCTA 3Q5XA 4DV0T 5LP6E 4YT0A 2PFVA 1IJ6A 2DL1A 5FXXA 3TLVA 5LXTE 5EZYE 4EZHA 2MBGA 4ZI7E 4PJLA 4MFRA 3A8YC 2LSKA 2OLTA 1B7TA 3NVOA 4COFA 1SUMB 2CXFA 2XQ3A 2ZLYA 3I0QA 2XSAA 3MKDA 3RIFA 3PUQA 2Y48B 3P4QA 2XQ8A 2J62A 1N2IA 2H7OA 3PDYA 2UU9T 3FHNA 3QTTA 2PG8A 5L3EB 5HCJA 4AISA 3IEEA 1KEYA 2FUPA 2W00A 1UX4A 3ZMSB 1MMDA 4B3TT 2CXLA 2WQYA 3KVBA 4KBMB 2Y6XA 2HHHT 2L8KA 2NTXA 2X9HA 2UXXB 1OEDC 3FZLB 3K3NA 3HA4A 4WZXA 4IL4A 3PUSA 3AAEB 3OVUA 3LK3B 4ISTA 4JI1T 4H9RC 2UUAT 3IVXA 5HXCA 3CFIA 2KWHA 1HF8A 1M7KA 3A5XA 4TWHA 2A54A 2VKJA 4DBQA 5HEGA 4DV5T 5C8YE 3LK2B 3DTOA 2IECA 1N2EA 3AE6A 1FJGT 2DI4A 2IC6A 4MLKA 2LE8A 1WYBA 5LHIB 5ABGA 1JNZA 4UEMA 3AEAA 4F8HA 3CX7B 1HG5A 4X1YE 5FKYA 4JLEA 2KZ7B 3N5LA 5HEHA 5TAOA 4QH4A 3J9X1 2N9DA 3BQKA 4GKJT 4DDHA 3LBXA 5C2TA 1MMNA 3ZPOA 4LF7T 4PJMA 2Q9QC 4YJ3E 3ZCJA 4JUYA 2PJQA 5KMGP 4HWHA 3ONXA 1D0YA 3AEEA 3ZKRA 3UUXB 3P4WA 4TV9E 5L3BB 5LGUB 3AE9A 2W66A 2YDRA 4PFOA 4OHFA 3SFDA 2EHOC 2QA7A 4HWFA 3LBXB 1V9DA 3IODA 3N2OA 3RYCE 1UX5A 1FMWA 2LSIA 3QB5K 3VKHA 3ONJA 2WS3A 3KBTA 2CWYA 3P4RA 2KT9A 4TX5A 3C98B 1W0AA 4JEHB 4CXXA 2IDOB 1OEDA 1LRZA 1U5PA 4DBRA 4OYKA 5IHYA 3P7IA 3CQCB 3AA0B 2X0YA 3IVGA 1HR0T 5J0ZA 4B3ST 5A1LA 3Q10A 1AJ3A 2MTQA 2HPLA 4NUUA 3VHLA 2EJCA 5CA0E 4BJNA 2XY8B 1N2JA 3CFAL 2W0GA 1X79A 3MA9A 1NEKA 3F31A 3JAFA 4DV4T 3WAKA 5LBMA 2A9UA 1OEDB 4QXBB 5EK2A 5JDHA 3UQ7A 3M3ZB 4HFVA 3ZMTB 3B57A 4ZI2C 2H7VC 3JAEA 2YDQA 4CI2B 3AA7B 2V7LA 2BVMA 1MNDA 5IYZE 4I50E 2A88A 4LMLA 2NR4A 4ILBA 4Z91A 2WY2A 5FVLA 3IBPA 3ANWA 1FMVA 4JI5T 4UVBB 3ZCIA 4DDKA 4HWIB 2XAFB 3PU3A 2PTFA 3PURA 3CI0K 5H6RB 4GOUA 3TLSA 5G2FA 2ZM8A 4XZCA 3ANWB 4GK5E 4WYVA 4BJMA 4WNKA 3NZPA 4L9IA 2NTYA 3IA3A 2VK9A 2VKDA 2H88A 2L3LA 2DHRA 3DJBA 3MXZA 3N9LA 4TV8E 2W62A 5L2LA 3ZC0A 2LJLA 4HE8A 5F8PA 5FL1A 3AEFA 3B5MA 2YEVC 3M65A 5HEJA 2A2FX 2V6YA 3UY4A 4ZI3C 2QGSA 3C50A 2H3RA 1VOMA 4LF4T 5AQLB 5LG3A 3QC9A 4DR1T 3LSVA 4A56A 3ETVA 1E7PA 5AQQB 5FVKA 5HXSA 2G2SA 5FY7A 4IDZA 3FZFB 3AXJA 3UULA 3UT5E 3CFFL 2L9QA 4PJJA 2AE9A 2V6YB 2FJDA 4DO0A 2LHRA 1D1AA 4AKRB 4UV8B 1G8XA 4K0KT 4ILUA 2ZM2A 2DCFA 2J47A 4G2AA 1MMGA 2K9AA 1XWMA 2XHEB 4AKHA 3FXDB 2XQ5A 2OV9A 4QWNB 2WMNA 1BR2A 3WAJA 3AXJB 4JI3T 1IZNB 1MNEA 3QB5A 5EK3A 4DMWA 4TNVA 4TUYE 2G3DA 3COVA 3B13A 2X0HA 2NW8A 4UF0A 5J2UE 3NBXX 4DVDA 1WR0A 4J2CA 4IDQA 2XQYA 2X0LB 1CHUA 1OEDE 1XDPA 3PUAA 4JI4T 4O2BE 4YHHT 4EAHA 3ESLA 2HH7A 4LMKA 5ADXL 2WAUA 3F57A 1GQEA 4KI0F 3RF1A 2GR8A 1ZEEA 5CA1E 2GW4A 4UF0B 3R6NA 3ABVA 3EI0A 2K3WA 3ZN0B 4DNDA 2HPJA 4QKNA 4DR3T 4O4HE 2H89A 3J7Yq 4HTEA 4P09A 1HG2A 4O8SA 2IHR1 4DMVA 4IE5A 3LF4A 3SFEA 2V7IA 4KX6A 2NW7A 3KV9A 2V1DB 4CN4A 5LHHB 1N2OA 3PUZF 2CBIA 2RETA 3E08A 3ZSSA 4DV3T 4YLHA 4NIQA 3G06A 4OFZA 2YN6A 1YW0A 2XQ4A 5HWXA 3P4PA 4U72A 3CI0I 1QSDA 4CI1B 2NW9A 4UIGA 3VRBA 1YXRA 2A50A 3NWIA 4GKKT 4ZS2A 5FNVE 4DUYT 4MUFA 2ZM0A 2LLYA 4EGWA 3W15B 1XNRT 3HKEE 2W67A 1QLBA 3MZKB 4BA9A 1T8BA 1WRDA 2LRLA 4KUMB 1UURA 3RRCA 5LHGB 5J1GA 2GR7A 2E9XD 2ZM6T 1L0VA 1HFAA 3FZMB 4GK0E 1HNZT 1MIWA 4XAXB 3FZKB 1XDOA 4DR2T
chains in the Genus database with same CATH topology
2K5BB 3FBLA 5LOVE 3RKOA 3UUXB 4IE6A 1T98A 3RYFE 4TV9E 5L3BB 5LGUB 2CLYC 2Q9QB 3BQLA 3RX6A 3E22E 4ASKA 3KDSE 4PFOA 3AAAB 4FI5A 4OHFA 4B6XA 4UVCB 4CQIA 2EHOC 2QA7A 4H63H 4MULA 2A56A 4X1KE 1IHOA 2P9BA 4UV9B 3LBXB 4E7SA 5DQVA 3CKDA 1V9DA 3U78A 4UELA 3N2OA 4Z8XA 5H6QB 3RYCE 4EIWA 1UX5A 2OA5A 4ZI3D 3IODA 1FMWA 4L0RA 4PJNA 3EVYA 2D5UA 2LSIA 2LSJA 2KNDA 3VU7H 3VKHA 4ISSA 4EFKA 4WBOA 5HAXA 1KNZA 3KBTA 2CWYA 5LGTB 2KT9A 4TX5A 4QXCB 3CFHL 3CPZA 3C98B 4BAYB 1UFVA 4JEHB 4CXXA 2EHOB 3GA8A 4ZS3A 4O4IE 3SS1A 1LRZA 1U5PA 3IOEA 3I9YA 4G63A 4DBRA 4OYKA 5IHYA 4EZ4A 3P7IA 1NWMX 3CQCB 3AA0B 3Q5WA 4TZ4C 2Z6EA 3PU8A 4P0BA 3IVGA 2WMOA 2E8IA 4GIWA 3ZC1A 1OXZA 5JQGE 2A7XA 2KINB 4QHOA 5A1LA 3Q10A 1NAFA 1AJ3A 2MTQA 2HPLA 4NUUA 3VHLA 2LHNA 4MBQA 2EJCA 1Z0PA 2W63A 3RYHE 4HN9A 5CA0E 4BJNA 3N9NA 3Q9DA 5J2TE 1N2JA 1D0ZA 2W0GA 3CFAL 1X79A 3V5SA 3MA9A 3F31A 4PK5A 3K3OA 4PW8A 3WAKA 3AVRA 3C64A 4O4LE 5LBMA 3KV5A 3F2EA 2JMKA 4QXBB 5JDMA 5M4YA 5EK2A 5JDHA 1CUNA 3ZYMA 2CMRA 2G5ZA 1KK7A 4MHCA 5FXZA 4ZHQE 3PUGA 4G5FA 2PBIA 5JVDE 4HFVA 2G16A 3ZN1B 3IMCA 3ZMTB 3AAIA 4CZZB 3B57A 4ZI2C 3AG6A 2H7VC 2SPCA 2CM0A 2IW5B 4H9QC 3MXTA 4QX8B 5JRCA 5EXCA 3JC6D 3KV6A 2LEHA 3Q12A 3ZEFB 3INNA 4CI2B 3KINB 1IJ5A 3AA7B 3NZQA 4AKGA 3R84B 2V7LA 5L3CB 2BVMA 3TKLB 2G0UA 5FMNA 4L5GA 2XUEA 1MNDA 5IYZE 4I50E 2A88A 3P8CD 5DABA 4FJOA 2M67A 5E0OA 3PTRB 3N2GE 5HXHA 2CWOA 5KX5E 1WR6A 3D0TA 2X9YA 3H37A 2RP4A 3FB2A 2WBLA 2D0UA 2ACXA 2V7JA 2WWUA 3AB3B 2X66A 3IBPA 5LJNA 1EZ3A 4DDMA 5LA6E 3I1AA 3ANWA 3N9MA 1FMVA 2A3DA 2YU2A 4G5YA 4MUHA 4AQFA 3ZJ2A 5JRCB 3ETUA 2YU1A 1HCIA 3IHRA 1FIOA 4UVBB 5JREA 4X1IE 3SRZA 2X9XA 3ZCIA 3UFEA 2JMHA 1HX8A 2ZMAA 4XBFB 4DDKA 4AQFC 2NWBA 2D0TA 5CB4E 4IE7A 5HXEA 4O2AE 2XAFB 3PU3A 3IUBA 2KWIB 3PURA 5FP3A 1SA0E 1YKHB 2C0SA 5GONE 1U4QA 3OKQA 4AQGA 1HS7A 2X67A 5H6RB 3RC3A 3V5UA 1BR4A 3O1HA 1SHZC 4GOUA 3FXEB 5G2FA 5FY0A 2ZM8A 4XZCA 1IAPA 3ANWB 3BK9A 4GK5E 4AKIA 3IOCA 2KLQA 4ZOLE 4BJMA 4WNKA 2BZBA 4EYYR 2LSGA 2I59A 2V26A 4AKLA 4EYUA 3NZPA 2BDEA 4IE4A 4L9IA 2A53A 2NTYA 3QUJA 2J1DG 2VK9A 2VKDA 2CLYB 1N2BA 1VRBA 2CA5A 4PAGA 2L3LA 3MUEA 4MUKA 2LSYA 4HGAA 5FYMA 2E9XC 2DHRA 3DJBA 3I0OA 3MXZA 3N9LA 4TV8E 2W62A 3CWZB 2WSSV 3DP7A 5L2LA 3EDUA 4P0AA 3ZC0A 2LJLA 2Y8DA 3C4WA 4HE8A 2XTLA 4U74A 4MALA 4PK4A 3LE8A 4UVAB 2IAKA 5HG0A 4N78D 5F8PA 2KXPB 3AA6B 3L09A 4WBNE 1ZKEA 2JQQA 3O4XE 1US7B 5L3GB 3AVSA 1Y64B 3O1IA 3NRXA 4BHRA 5LG4A 3KV4A 4H63V 3M65A 2YEVC 4GYRA 4AXPA 5DQWA 5LGNB 2K24A 2X51A 3EUHA 5LBQB 3IVCA 2ODVA 2A2FX 3FBZA 2MOZA 3UY4A 3HL6A 3O1JA 2A86A 3WI3A 4ZI3C 3RH3A 2QGSA 4X20E 3HKCE 3SOLA 2CXDA 4YJ2E 3C50A 3Q2MA 2H3RA 2N2NA 1VOMA 4YFSA 4M1PA 5JH7E 2YINA 4FZJA 3COWA 3UK2A 4NUVA 5JR9A 2VKHA 3QC9A 2XAGB 2VL8A 1G73A 2C5KT 3ZYKA 1OWAA 4WW0A 3UTKA 3LK42 1MOPA 3CQGB 4A56A 4PNIA 2A72A 3UUMA 2VKOA 3ETVA 3ZMZB 3SWHA 5HXSA 2G2SA 5FXVA 2CEAA 5FY7A 4AI6A 4IDZA 2GK9A 2BVLA 5JR9C 5JDLA 4EOZB 3EDVA 3UULA 1HTJF 5KDMC 3AA1B 4OYJA 3UT5E 3IMEA 3HKBE 3N8HA 3CFFL 2L9QA 3C51A 4PJJA 2Q9QD 4C91A 4IXJA 4DO0A 1V8FA 2LHRA 1D1AA 3C4ZA 3HKDE 4GYSA 4AKRB 4UV8B 1G8XA 5FXWA 5HXRA 1BR1A 2DWKA 1D1CA 4CI3B 3LJCA 4ILUA 5AFUL 5JR9B 1N2HA 4HEAA 2VASA 2ZM2A 3MJXA 2DCFA 2X9WA 2C5JA 4IGUA 5LNKA 4G2AA 4EB6E 5LCYA 2YK0A 1MMGA 5JDQA 2IC9A 4MUGA 3MACA 2K9AA 4MQ6A 2X68A 1S94A 2XHEB 4AKHA 3FXDB 4QX7B 3COYA 4QWNB 5LJMA 2EHOD 2WMNA 1BR2A 3K3QC 3LG7A 3Q5XA 3QK6A 3WAJA 5LP6E 2PFVA 2B1EA 4KMCA 1IJ6A 1IZNB 1MNEA 2ODUA 2C5IT 3N2KE 5EK3A 2LOPA 1N2GA 4DMWA 4TUYE 2G3DA 3CX6B 3PE0A 5FXXA 3COVA 4IE0A 4HKAA 5EZYE 4EZHA 5LXTE 2MBGA 3JC6C 2A52A 3B13A 4ZI7E 3IF8B 4PJLA 1ZV4X 1ZHCA 2XAQB 3OJAA 4MFRA 2NW8A 3CQXC 2LSKA 4UF0A 4F6RC 5J2UE 3NBXX 1B7TA 4DVDA 5DJQC 4IHJE 4J2CA 1H7CA 2XQYA 2X0LB 4I4TE 5F3JA 4I43B 5HWYA 1MIVA 2CXFA 2E9XA 2K48A 2CE7A 3RYIE 3PUAA 2ZLYA 3OYZA 4O2BE 3HI2A 3I0QA 5KWVA 4EAHA 3N9OA 3MKDA 2LT3A 3CVRA 3ZMUB 1D0XA 3PUQA 3ESLA 2Y48B 2HH7A 5ADXL 1N2IA 2H7OA 2WAUA 3PDYA 2DWGA 3KBUA 3ZLIA 3ZMVB 2V7KA 3F57A 1MIYA 3RRWA 4EF6A 4JEUB 1ZEEA 3HR0A 3FHNA 5CA1E 2GW4A 3QTTA 2PG8A 1MMAA 2VWAA 2DLRA 4UF0B 5L3EB 2CCQA 3R6NA 3IEEA 3N9PA 4CXWA 3CX8B 2W00A 3OBVE 3ZN0B 4DNDA 2MYSA 1UX4A 3GMIA 2KMFA 2HPJA 4QKNA 3ZMSB 2W61A 4PFPA 2V7MA 4O4HE 3IUEA 2E9XB 1MMDA 4H9PC 5FY1A 2D2SA 3RPUA 3J7Yq 3IOBA 2CXLA 4HTEA 1LVFA 2JPFA 3OYXA 4P09A 4ZI2D 3KVBA 4H9OC 4ERRA 4KBMB 2Y6XA 5EK4A 1WLXA 2L8KA 1HG2A 2NTXA 4O8SA 4MUIA 2X9HA 4DMVA 4CXYA 4C90A 4MUNA 4IE5A 2UXXB 3LF4A 3N9QA 2V7IA 3GWHA 3AG5A 2NW7A 4DE5A 2JRKA 3KV9A 3COZA 3LFMA 3I9WA 3K3NA 2V1DB 3GN5A 3HA4A 5BMVE 5LHHB 1N2OA 2WM9A 5HYAA 1WYCA 1QUUA 3E08A 3PUSA 5L3FB 3AAEB 4YLHA 4OFZA 3LK3B 2ES0A 4H9SE 4ISTA 4H9RC 3VKGA 3U3IA 3ZJ1A 1YW0A 2JJ9A 3IVXA 5HXCA 4MUEA 2KWHA 2NOXA 4YHJA 5HWXA 1HF8A 4U72A 5L3DB 3A5XA 1BR0A 1LVKA 1QSDA 4K0UA 3C4XA 3L3PA 2A54A 2VKJA 3UA0A 4O4JE 4OK0A 4CI1B 4PK6A 5JDNA 4DBQA 2NW9A 4UIGA 3E0ZA 5JDFA 4EXTA 3KVAA 2A50A 2XASB 4ZS2A 5FNVE 5C8YE 3GN5B 3LK2B 3DTOA 3MK7C 3IMGA 1N2EA 3BQIA 2XAHB 4MUFA 2DI4A 2ZM0A 2IC6A 4MLKA 2LE8A 1WYBA 1UCUA 5LHIB 4UEMA 3W15B 4ADZA 4IIJE 3HKEE 2DNXA 1S35A 3MZKB 2N1GA 4E7ZA 3CX7B 1FEWA 1HG5A 4X1YE 5JDGA 4BA9A 3CMLA 3K8PC 3NRYA 4TN7B 3O9XA 2LM9A 4JLEA 3ISJA 2Q9QA 2UXNB 2KZ7B 3N5LA 3S4UA 1WRDA 5TAOA 4I55E 3ZYLA 4V1Av 4KUMB 3J9X1 4ANJA 2N9DA 3BQKA 3RRCA 5LHGB 4DDHA 5J1GA 2RA1A 1E1HB 3T8OA 3RC8A 3LBXA 4QXHB 2X3FA 1MMNA 2NP9A 3ZPOA 2E9XD 3KFWX 4PJMA 1O3XA 2XAJB 2Q9QC 4MUJA 4YJ3E 1D1BA 4KP3C 1HFAA 3ZCJA 1YD8G 2A84A 2LOSA 3UUNA 4GK0E 2VB6A 4JUYA 2PJQA 4UXNB 5ETWA 5KMGP 1MIWA 4XAXB 1YKEB 1LKXA 3ONXA 1D0YA 3H3AA 4H9NC 2EHOA 5LYJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HL6 A; 
#chains in the Genus database with same CATH topology
 1T98 A;  3RYF E;  2CLY C;  3JAD A;  4X1K E;  4E7S A;  5L4E A;  3CKD A;  4X62 T;  4Z8X A;  2VUR A;  4LMJ A;  3EVY A;  2D5U A;  2XQ6 A;  1KNZ A;  3CFH L;  3CPZ A;  3AE3 A;  2VL0 A;  4ZS3 A;  3RI5 A;  3UUB A;  4EZ4 A;  1NWM X;  4TZ4 C;  3Q5W A;  2Z6E A;  1DU2 A;  3PU8 A;  3RQW A;  1NAF A;  5AQO B;  3H3M A;  4DV1 T;  4MBQ A;  2XM2 A;  1Z0P A;  2W63 A;  3RYH E;  3N9N A;  5J2T E;  3ZT5 A;  3NKZ A;  3K3O A;  2E5L T;  2WDQ A;  3AVR A;  1KK7 A;  3AE8 A;  4MHC A;  3PUG A;  4G5F A;  2PBI A;  5CFB A;  2G16 A;  2W2U A;  3IMC A;  4ILA A;  2CM0 A;  2CBJ A;  4HFC A;  5EXC A;  3JC6 D;  2LEH A;  4DR5 T;  3INN A;  1X9B A;  1UK5 A;  2IML A;  3OPC A;  5FMN A;  1I94 T;  5DAB A;  4JYA T;  5IWA T;  2BKN A;  2X9Y A;  3FB2 A;  2WBL A;  2ACX A;  2V7J A;  4JI6 T;  2X66 A;  2I6H A;  5LJN A;  5LA6 E;  2YU2 A;  4G5Y A;  4UR9 A;  2RPA A;  1FIO A;  5JRE A;  4U31 A;  4X1I E;  3SRZ A;  1HX8 A;  4XBF B;  2NWB A;  2D0T A;  2WZI A;  5HXE A;  1N34 T;  2F4V T;  4YTN A;  2KWI B;  1YKH B;  3OKQ A;  4AQG A;  2X67 A;  2LME A;  1SHZ C;  3FXE B;  5FY0 A;  1IAP A;  1IBK T;  2B76 A;  5ABF A;  5HEU A;  4JI0 T;  2BZB A;  3AE7 A;  2I59 A;  2V26 A;  5AQJ B;  2BDE A;  4IE4 A;  2CRB A;  2J1D G;  2CLY B;  5LMU T;  1VRB A;  4PAG A;  4MUK A;  4LF6 T;  4HGA A;  2BG9 A;  3X1D A;  5AQP B;  3I0O A;  1NEN A;  4MAL A;  4PK4 A;  2IAK A;  1IBL T;  3RKG A;  2LRK A;  5LMN T;  2KXP B;  2BS4 A;  4ZEY A;  2XQ7 A;  5ABF B;  3TLT A;  2JQQ A;  5L3G B;  1Y64 B;  3O1I A;  5LG4 A;  2JQH A;  2K24 A;  2X51 A;  4YSX A;  3IVC A;  1E2A A;  2BG9 B;  3RH3 A;  3HKC E;  2CXD A;  3Q2M A;  3COW A;  3UK2 A;  4NUV A;  5JR9 A;  2XAG B;  2VL8 A;  1G73 A;  4Q25 A;  4WW0 A;  3UTK A;  3LK4 2;  1MOP A;  3CQG B;  3OTO T;  3SWH A;  5FXV A;  4TNW A;  1HNX T;  2JQK A;  4I0U A;  1HTJ F;  4OYJ A;  4C91 A;  5HEO A;  1UUS A;  3C4Z A;  3HKD E;  1N33 T;  5FXW A;  4CI3 B;  3LJC A;  5JR9 B;  3MJX A;  2X9W A;  2C5J A;  4EB6 E;  5LCY A;  3TLU A;  3MAC A;  2X68 A;  1S94 A;  4QX7 B;  3COY A;  5LJM A;  3K3Q C;  2VQE T;  3QK6 A;  3AE1 A;  2ODU A;  4LFA T;  2LOP A;  4ILC A;  4EED A;  2LM2 A;  4Z90 A;  1ZV4 X;  1ZOY A;  2OGF A;  3RLF F;  4I4T E;  4I43 B;  4JV5 T;  2CE7 A;  3RYI E;  2M6I A;  3OYZ A;  2AXD S;  3HI2 A;  5KWV A;  3N9O A;  2LT3 A;  3CVR A;  1D0X A;  3QOF A;  2DWG A;  3KBU A;  1MIY A;  3CK6 A;  4JEU B;  2V5C A;  3HR0 A;  2DLR A;  3N9P A;  3CX8 B;  3GMI A;  2V7M A;  2D2S A;  3IOB A;  1LVF A;  3OYX A;  2XPK A;  2M6B A;  4ERR A;  5EK4 A;  4ZZC A;  2YDS A;  1WLX A;  3UU4 A;  4CN1 A;  3N9Q A;  3AG5 A;  5JTG A;  2VVN A;  4KHZ F;  3LFM A;  3I9W A;  2WB5 A;  4HWD A;  4JI2 T;  3AE5 A;  3GN5 A;  5HYA A;  1WYC A;  1QUU A;  5L3F B;  2ES0 A;  4HFI A;  3VKG A;  1WCR A;  2JJ9 A;  4MUE A;  2NOX A;  4YHJ A;  5L3D B;  1LVK A;  3C4X A;  3ONL C;  3UA0 A;  4OK0 A;  5JDN A;  2BBH A;  3E0Z A;  2XAS B;  5AQI B;  3GN5 B;  3IMG A;  3BQI A;  2XAH B;  4IRE A;  1UCU A;  4ADZ A;  2UXD T;  4IIJ E;  3EHZ A;  4E7Z A;  5AQR B;  1FEW A;  1KNR A;  2FJB A;  5JDG A;  3CML A;  3K8P C;  4TN7 B;  2LM9 A;  3Q5D A;  2UXN B;  2V8S V;  3S4U A;  4I55 E;  3ZYL A;  4V1A v;  4ANJ A;  1E1H B;  3RC8 A;  1IBM T;  2X3F A;  4QXH B;  1O3X A;  2XAJ B;  3VR8 A;  3AEC A;  1YD8 G;  2A84 A;  2I0M A;  3UUN A;  3L39 A;  5ETW A;  3H3A A;  4H9N C;  5LYJ E;  2K5B B;  2KSR A;  3FBL A;  3RKO A;  4IE6 A;  3BQL A;  3RX6 A;  3E22 E;  4ASK A;  4B6X A;  1KFY A;  4MUL A;  2A56 A;  1IHO A;  4UV9 B;  5DQV A;  3U78 A;  5H6Q B;  4EIW A;  2OA5 A;  4L0R A;  4PJN A;  4HFE A;  4TWF A;  2LSJ A;  3VU7 H;  4ISS A;  4EFK A;  5HAX A;  4BAY B;  4DUZ T;  2WWV A;  3GA8 A;  2FBW A;  4O4I E;  3SS1 A;  5ABH A;  3I9Y A;  4G63 A;  2VQF T;  1XZY A;  4P0B A;  4IT4 A;  4GIW A;  1HX1 B;  5C3J A;  1OXZ A;  5JQG E;  2KIN B;  4QHO A;  4U33 A;  4YY3 T;  5AQF B;  4HN9 A;  1D0Z A;  4PK5 A;  4PW8 A;  2FJA A;  2BKP A;  3C64 A;  3F2E A;  2JMK A;  5AQN B;  1CUN A;  1W9R A;  4DR7 T;  2CMR A;  2G5Z A;  5FXZ A;  3P50 A;  4ZHQ E;  5LB7 B;  3VRA A;  3ZN1 B;  4CZZ B;  1J5W A;  2SPC A;  3UU3 A;  4H9Q C;  3MXT A;  4IDO A;  5JRC A;  3KV6 A;  2YOE A;  3PV0 F;  3KIN B;  3NZQ A;  4AKG A;  3R84 B;  1XMO T;  3TKL B;  2G0U A;  4NPP A;  5CGM A;  2E2A A;  4L5G A;  2XUE A;  1JNR A;  4U7I A;  3P8C D;  5AQS B;  4X65 T;  3N2G E;  5KX5 E;  1WR6 A;  2MPK A;  3D0T A;  3K1S A;  3P4S A;  3H37 A;  2D0U A;  5ABE A;  3AB3 B;  2WWU A;  4DDM A;  1EZ3 A;  3N9M A;  2A3D A;  4MUH A;  4AQF A;  3ZJ2 A;  5JRC B;  1HCI A;  2X9X A;  2CHO A;  3UFE A;  2JMH A;  2ZMA A;  5L4H A;  5AQV B;  4EV6 A;  4IE7 A;  3EMO A;  1SA0 E;  5GON E;  2VVS A;  1U4Q A;  3RC3 A;  1BR4 A;  3O1H A;  3IOC A;  4AKI A;  2KLQ A;  4AIU A;  4EYY R;  2LSG A;  4EYU A;  4AKL A;  2LSY A;  4DV7 T;  5FYM A;  2E9X C;  5AQH B;  3EDU A;  4P0A A;  3C4W A;  2XTL A;  3LDQ B;  3UFG A;  3ZST A;  3LE8 A;  2BG9 C;  3A7M A;  5HG0 A;  4ZXL A;  3AA6 B;  3L09 A;  4WBN E;  1ZKE A;  2IUB A;  2MAW A;  4BHR A;  4GYR A;  5LGN B;  3EUH A;  5LBQ B;  2ODV A;  3FBZ A;  4TWD A;  2MOZ A;  3HL6 A;  3O1J A;  2A86 A;  3L8R A;  4X20 E;  3SOL A;  4YJ2 E;  2N2N A;  2YIN A;  3CIR A;  4DV6 T;  2WU2 A;  1OWA A;  3ZMZ B;  3RIU C;  2CEA A;  4AI6 A;  2GK9 A;  5JR9 C;  3ZT6 A;  4EOZ B;  3EDV A;  3AA1 B;  2Q9Q D;  3EAM A;  4HWC A;  1SE7 A;  4IXJ A;  1V8F A;  4GYS A;  2DWK A;  5AFU L;  1N2H A;  4HEA A;  5JDQ A;  2IC9 A;  4MUG A;  4MQ6 A;  2CPT A;  2EHO D;  5BW0 B;  3LG7 A;  3AED A;  2B1E A;  4KMC A;  3N2K E;  3PUW F;  2C5I T;  3AEG A;  5BR8 T;  1N2G A;  3CX6 B;  3PE0 A;  4IE0 A;  4HKA A;  3JC6 C;  2A52 A;  3IF8 B;  2HN2 A;  1ZHC A;  2XAQ B;  3OJA A;  3CQX C;  4F6R C;  3AE4 A;  5DJQ C;  4IHJ E;  1H7C A;  4X5T A;  4A98 A;  3RQU A;  5F3J A;  5HWY A;  1MIV A;  2E9X A;  2K48 A;  2QRX A;  4B3R T;  3PJA J;  4NXM T;  3ZMU B;  3ZLI A;  3ZMV B;  2V7K A;  3RRW A;  4EF6 A;  1W09 A;  3RIA A;  3AEB A;  1MMA A;  2VWA A;  4QH1 A;  2CCQ A;  4CXW A;  3OBV E;  2UXB T;  2MYS A;  2HN1 A;  2KMF A;  2QVA A;  2W61 A;  4PFP A;  3IUE A;  2E9X B;  4H9P C;  3RPU A;  2BS3 A;  5FY1 A;  5AQK B;  3UU5 A;  2JPF A;  3PUX F;  5AQG B;  4ZI2 D;  1J5E T;  1J1J A;  4H9O C;  1T72 A;  4U7Y A;  4MUI A;  4CXY A;  2V5D A;  4C90 A;  4MUN A;  3GWH A;  3RIU A;  4DE5 A;  2JRK A;  3COZ A;  1ZP0 A;  3UU6 A;  5BMV E;  1W0B A;  2WM9 A;  3UU8 A;  4H9S E;  4LFC T;  3U3I A;  2UUC T;  3ZJ1 A;  4IDN A;  4YXD A;  1BR0 A;  4K0U A;  3L3P A;  4O4J E;  4PK6 A;  1N32 T;  4YSZ A;  5JDF A;  4EXT A;  3EAB A;  3KVA A;  3RGL A;  3MK7 C;  2QYW A;  2BKO A;  3PUY F;  4YSY A;  2DNX A;  1S35 A;  2N1G A;  3NRY A;  3O9X A;  3ISJ A;  2Q9Q A;  4U2Y A;  4U2Z A;  4JI7 T;  2XSB A;  2JQ9 A;  3T8O A;  2RA1 A;  1XNQ T;  2NP9 A;  1R8I A;  3KFW X;  4MUJ A;  5F5W A;  1D1B A;  4KP3 C;  2LOS A;  2VB6 A;  4UXN B;  4AQY T;  4KHP T;  1YKE B;  1LKX A;  3ZT7 A;  2D9D A;  2EHO A;  5LOV E;  2XJ7 A;  2BBJ A;  5AQM B;  2Q9Q B;  3KDS E;  3AAA B;  4FI5 A;  4UVC B;  1YQ3 A;  2WCA A;  4CQI A;  4H63 H;  2P9B A;  4UEL A;  4ZI3 D;  4LF8 T;  3AE2 A;  4X64 T;  2LKH A;  4U3C A;  2WZH A;  2KND A;  3Q5E A;  1KNP A;  4WBO A;  3T1Y T;  5LGT B;  4QXC B;  2CHN A;  4ZZB A;  3TLW A;  1N36 T;  1UFV A;  2LKG A;  2EHO B;  1I6Z A;  3IOE A;  2WMO A;  2E8I A;  5HCM A;  4OX9 T;  4YTM A;  2XQ9 A;  3ZC1 A;  2A7X A;  1UGO A;  2LHN A;  2UXC T;  3T1H T;  4LF5 T;  2E5V A;  2XZE A;  3Q9D A;  4DR4 T;  3V5S A;  4O4L E;  4DID B;  3KV5 A;  5JDM A;  5M4Y A;  3ZYM A;  2YKS A;  5JVD E;  3AAI A;  3AG6 A;  4LF9 T;  2IW5 B;  4QX8 B;  5L47 A;  4EEB A;  3Q12 A;  3ZEF B;  4HFH A;  1IJ5 A;  4QH5 A;  5L3C B;  2WDR A;  2FJE A;  3RHW A;  4FJO A;  2M67 A;  5E0O A;  3PTR B;  5HXH A;  2CWO A;  5AQT B;  2RP4 A;  5KXJ A;  2WP9 A;  3QNU A;  4A97 A;  3I1A A;  4A5X A;  3PUV F;  3ETU A;  2YU1 A;  3IHR A;  3PJA A;  2XQA A;  1YQ4 A;  2UUB T;  2BG9 E;  4JI8 T;  2IIU A;  3FZH B;  4AQF C;  5CB4 E;  4O2A E;  3IUB A;  5FP3 A;  2C0S A;  1HS7 A;  4NXN T;  4IDP A;  3V5U A;  4DV2 T;  1T7S A;  3BK9 A;  2WDV A;  5AQU B;  2XM1 A;  4HFB A;  4ZOL E;  4X66 T;  2A53 A;  3QUJ A;  1N2B A;  2CA5 A;  3MUE A;  3CWZ B;  2WSS V;  4JBW F;  3DP7 A;  2Y8D A;  5FL0 A;  4U74 A;  4UVA B;  4N78 D;  4CN6 A;  2JIW A;  3O4X E;  2W4X A;  4B3M T;  1US7 B;  3AVS A;  3NRX A;  2R6G F;  2BS2 A;  3KV4 A;  4H63 V;  1Y01 A;  4AXP A;  5DQW A;  3WI3 A;  1Z8U A;  4YFS A;  4LFB T;  4M1P A;  5JH7 E;  2WU5 A;  4FZJ A;  2I52 A;  2VKH A;  2J4G A;  2C5K T;  3ZYK A;  1M62 A;  4PNI A;  2A72 A;  3UUM A;  2VKO A;  5IUX A;  2V6X A;  2BVL A;  5JDL A;  4YTP A;  2ACZ A;  4P1N A;  4HFD A;  3VR9 A;  5KDM C;  3IME A;  3HKB E;  3N8H A;  3C51 A;  3JCF A;  4DR6 T;  4IL9 A;  3UQ4 A;  5HXR A;  1WFD A;  1BR1 A;  1D1C A;  1HNW T;  1KF6 A;  2VAS A;  5CJ5 A;  5LNK A;  4IGU A;  2YK0 A;  1VCS A;  1XMQ T;  1VCT A;  3Q5X A;  4DV0 T;  5LP6 E;  4YT0 A;  2PFV A;  1IJ6 A;  2DL1 A;  5FXX A;  3TLV A;  5LXT E;  5EZY E;  4EZH A;  2MBG A;  4ZI7 E;  4PJL A;  4MFR A;  3A8Y C;  2LSK A;  2OLT A;  1B7T A;  3NVO A;  4COF A;  1SUM B;  2CXF A;  2XQ3 A;  2ZLY A;  3I0Q A;  2XSA A;  3MKD A;  3RIF A;  3PUQ A;  2Y48 B;  3P4Q A;  2XQ8 A;  2J62 A;  1N2I A;  2H7O A;  3PDY A;  2UU9 T;  3FHN A;  3QTT A;  2PG8 A;  5L3E B;  5HCJ A;  4AIS A;  3IEE A;  1KEY A;  2FUP A;  2W00 A;  1UX4 A;  3ZMS B;  1MMD A;  4B3T T;  2CXL A;  2WQY A;  3KVB A;  4KBM B;  2Y6X A;  2HHH T;  2L8K A;  2NTX A;  2X9H A;  2UXX B;  1OED C;  3FZL B;  3K3N A;  3HA4 A;  4WZX A;  4IL4 A;  3PUS A;  3AAE B;  3OVU A;  3LK3 B;  4IST A;  4JI1 T;  4H9R C;  2UUA T;  3IVX A;  5HXC A;  3CFI A;  2KWH A;  1HF8 A;  1M7K A;  3A5X A;  4TWH A;  2A54 A;  2VKJ A;  4DBQ A;  5HEG A;  4DV5 T;  5C8Y E;  3LK2 B;  3DTO A;  2IEC A;  1N2E A;  3AE6 A;  1FJG T;  2DI4 A;  2IC6 A;  4MLK A;  2LE8 A;  1WYB A;  5LHI B;  5ABG A;  1JNZ A;  4UEM A;  3AEA A;  4F8H A;  3CX7 B;  1HG5 A;  4X1Y E;  5FKY A;  4JLE A;  2KZ7 B;  3N5L A;  5HEH A;  5TAO A;  4QH4 A;  3J9X 1;  2N9D A;  3BQK A;  4GKJ T;  4DDH A;  3LBX A;  5C2T A;  1MMN A;  3ZPO A;  4LF7 T;  4PJM A;  2Q9Q C;  4YJ3 E;  3ZCJ A;  4JUY A;  2PJQ A;  5KMG P;  4HWH A;  3ONX A;  1D0Y A;  3AEE A;  3ZKR A;  3UUX B;  3P4W A;  4TV9 E;  5L3B B;  5LGU B;  3AE9 A;  2W66 A;  2YDR A;  4PFO A;  4OHF A;  3SFD A;  2EHO C;  2QA7 A;  4HWF A;  3LBX B;  1V9D A;  3IOD A;  3N2O A;  3RYC E;  1UX5 A;  1FMW A;  2LSI A;  3QB5 K;  3VKH A;  3ONJ A;  2WS3 A;  3KBT A;  2CWY A;  3P4R A;  2KT9 A;  4TX5 A;  3C98 B;  1W0A A;  4JEH B;  4CXX A;  2IDO B;  1OED A;  1LRZ A;  1U5P A;  4DBR A;  4OYK A;  5IHY A;  3P7I A;  3CQC B;  3AA0 B;  2X0Y A;  3IVG A;  1HR0 T;  5J0Z A;  4B3S T;  5A1L A;  3Q10 A;  1AJ3 A;  2MTQ A;  2HPL A;  4NUU A;  3VHL A;  2EJC A;  5CA0 E;  4BJN A;  2XY8 B;  1N2J A;  3CFA L;  2W0G A;  1X79 A;  3MA9 A;  1NEK A;  3F31 A;  3JAF A;  4DV4 T;  3WAK A;  5LBM A;  2A9U A;  1OED B;  4QXB B;  5EK2 A;  5JDH A;  3UQ7 A;  3M3Z B;  4HFV A;  3ZMT B;  3B57 A;  4ZI2 C;  2H7V C;  3JAE A;  2YDQ A;  4CI2 B;  3AA7 B;  2V7L A;  2BVM A;  1MND A;  5IYZ E;  4I50 E;  2A88 A;  4LML A;  2NR4 A;  4ILB A;  4Z91 A;  2WY2 A;  5FVL A;  3IBP A;  3ANW A;  1FMV A;  4JI5 T;  4UVB B;  3ZCI A;  4DDK A;  4HWI B;  2XAF B;  3PU3 A;  2PTF A;  3PUR A;  3CI0 K;  5H6R B;  4GOU A;  3TLS A;  5G2F A;  2ZM8 A;  4XZC A;  3ANW B;  4GK5 E;  4WYV A;  4BJM A;  4WNK A;  3NZP A;  4L9I A;  2NTY A;  3IA3 A;  2VK9 A;  2VKD A;  2H88 A;  2L3L A;  2DHR A;  3DJB A;  3MXZ A;  3N9L A;  4TV8 E;  2W62 A;  5L2L A;  3ZC0 A;  2LJL A;  4HE8 A;  5F8P A;  5FL1 A;  3AEF A;  3B5M A;  2YEV C;  3M65 A;  5HEJ A;  2A2F X;  2V6Y A;  3UY4 A;  4ZI3 C;  2QGS A;  3C50 A;  2H3R A;  1VOM A;  4LF4 T;  5AQL B;  5LG3 A;  3QC9 A;  4DR1 T;  3LSV A;  4A56 A;  3ETV A;  1E7P A;  5AQQ B;  5FVK A;  5HXS A;  2G2S A;  5FY7 A;  4IDZ A;  3FZF B;  3AXJ A;  3UUL A;  3UT5 E;  3CFF L;  2L9Q A;  4PJJ A;  2AE9 A;  2V6Y B;  2FJD A;  4DO0 A;  2LHR A;  1D1A A;  4AKR B;  4UV8 B;  1G8X A;  4K0K T;  4ILU A;  2ZM2 A;  2DCF A;  2J47 A;  4G2A A;  1MMG A;  2K9A A;  1XWM A;  2XHE B;  4AKH A;  3FXD B;  2XQ5 A;  2OV9 A;  4QWN B;  2WMN A;  1BR2 A;  3WAJ A;  3AXJ B;  4JI3 T;  1IZN B;  1MNE A;  3QB5 A;  5EK3 A;  4DMW A;  4TNV A;  4TUY E;  2G3D A;  3COV A;  3B13 A;  2X0H A;  2NW8 A;  4UF0 A;  5J2U E;  3NBX X;  4DVD A;  1WR0 A;  4J2C A;  4IDQ A;  2XQY A;  2X0L B;  1CHU A;  1OED E;  1XDP A;  3PUA A;  4JI4 T;  4O2B E;  4YHH T;  4EAH A;  3ESL A;  2HH7 A;  4LMK A;  5ADX L;  2WAU A;  3F57 A;  1GQE A;  4KI0 F;  3RF1 A;  2GR8 A;  1ZEE A;  5CA1 E;  2GW4 A;  4UF0 B;  3R6N A;  3ABV A;  3EI0 A;  2K3W A;  3ZN0 B;  4DND A;  2HPJ A;  4QKN A;  4DR3 T;  4O4H E;  2H89 A;  3J7Y q;  4HTE A;  4P09 A;  1HG2 A;  4O8S A;  2IHR 1;  4DMV A;  4IE5 A;  3LF4 A;  3SFE A;  2V7I A;  4KX6 A;  2NW7 A;  3KV9 A;  2V1D B;  4CN4 A;  5LHH B;  1N2O A;  3PUZ F;  2CBI A;  2RET A;  3E08 A;  3ZSS A;  4DV3 T;  4YLH A;  4NIQ A;  3G06 A;  4OFZ A;  2YN6 A;  1YW0 A;  2XQ4 A;  5HWX A;  3P4P A;  4U72 A;  3CI0 I;  1QSD A;  4CI1 B;  2NW9 A;  4UIG A;  3VRB A;  1YXR A;  2A50 A;  3NWI A;  4GKK T;  4ZS2 A;  5FNV E;  4DUY T;  4MUF A;  2ZM0 A;  2LLY A;  4EGW A;  3W15 B;  1XNR T;  3HKE E;  2W67 A;  1QLB A;  3MZK B;  4BA9 A;  1T8B A;  1WRD A;  2LRL A;  4KUM B;  1UUR A;  3RRC A;  5LHG B;  5J1G A;  2GR7 A;  2E9X D;  2ZM6 T;  1L0V A;  1HFA A;  3FZM B;  4GK0 E;  1HNZ T;  1MIW A;  4XAX B;  3FZK B;  1XDO A;  4DR2 T; 
#chains in the Genus database with same CATH homology
 2K5B B;  3FBL A;  5LOV E;  3RKO A;  3UUX B;  4IE6 A;  1T98 A;  3RYF E;  4TV9 E;  5L3B B;  5LGU B;  2CLY C;  2Q9Q B;  3BQL A;  3RX6 A;  3E22 E;  4ASK A;  3KDS E;  4PFO A;  3AAA B;  4FI5 A;  4OHF A;  4B6X A;  4UVC B;  4CQI A;  2EHO C;  2QA7 A;  4H63 H;  4MUL A;  2A56 A;  4X1K E;  1IHO A;  2P9B A;  4UV9 B;  3LBX B;  4E7S A;  5DQV A;  3CKD A;  1V9D A;  3U78 A;  4UEL A;  3N2O A;  4Z8X A;  5H6Q B;  3RYC E;  4EIW A;  1UX5 A;  2OA5 A;  4ZI3 D;  3IOD A;  1FMW A;  4L0R A;  4PJN A;  3EVY A;  2D5U A;  2LSI A;  2LSJ A;  2KND A;  3VU7 H;  3VKH A;  4ISS A;  4EFK A;  4WBO A;  5HAX A;  1KNZ A;  3KBT A;  2CWY A;  5LGT B;  2KT9 A;  4TX5 A;  4QXC B;  3CFH L;  3CPZ A;  3C98 B;  4BAY B;  1UFV A;  4JEH B;  4CXX A;  2EHO B;  3GA8 A;  4ZS3 A;  4O4I E;  3SS1 A;  1LRZ A;  1U5P A;  3IOE A;  3I9Y A;  4G63 A;  4DBR A;  4OYK A;  5IHY A;  4EZ4 A;  3P7I A;  1NWM X;  3CQC B;  3AA0 B;  3Q5W A;  4TZ4 C;  2Z6E A;  3PU8 A;  4P0B A;  3IVG A;  2WMO A;  2E8I A;  4GIW A;  3ZC1 A;  1OXZ A;  5JQG E;  2A7X A;  2KIN B;  4QHO A;  5A1L A;  3Q10 A;  1NAF A;  1AJ3 A;  2MTQ A;  2HPL A;  4NUU A;  3VHL A;  2LHN A;  4MBQ A;  2EJC A;  1Z0P A;  2W63 A;  3RYH E;  4HN9 A;  5CA0 E;  4BJN A;  3N9N A;  3Q9D A;  5J2T E;  1N2J A;  1D0Z A;  2W0G A;  3CFA L;  1X79 A;  3V5S A;  3MA9 A;  3F31 A;  4PK5 A;  3K3O A;  4PW8 A;  3WAK A;  3AVR A;  3C64 A;  4O4L E;  5LBM A;  3KV5 A;  3F2E A;  2JMK A;  4QXB B;  5JDM A;  5M4Y A;  5EK2 A;  5JDH A;  1CUN A;  3ZYM A;  2CMR A;  2G5Z A;  1KK7 A;  4MHC A;  5FXZ A;  4ZHQ E;  3PUG A;  4G5F A;  2PBI A;  5JVD E;  4HFV A;  2G16 A;  3ZN1 B;  3IMC A;  3ZMT B;  3AAI A;  4CZZ B;  3B57 A;  4ZI2 C;  3AG6 A;  2H7V C;  2SPC A;  2CM0 A;  2IW5 B;  4H9Q C;  3MXT A;  4QX8 B;  5JRC A;  5EXC A;  3JC6 D;  3KV6 A;  2LEH A;  3Q12 A;  3ZEF B;  3INN A;  4CI2 B;  3KIN B;  1IJ5 A;  3AA7 B;  3NZQ A;  4AKG A;  3R84 B;  2V7L A;  5L3C B;  2BVM A;  3TKL B;  2G0U A;  5FMN A;  4L5G A;  2XUE A;  1MND A;  5IYZ E;  4I50 E;  2A88 A;  3P8C D;  5DAB A;  4FJO A;  2M67 A;  5E0O A;  3PTR B;  3N2G E;  5HXH A;  2CWO A;  5KX5 E;  1WR6 A;  3D0T A;  2X9Y A;  3H37 A;  2RP4 A;  3FB2 A;  2WBL A;  2D0U A;  2ACX A;  2V7J A;  2WWU A;  3AB3 B;  2X66 A;  3IBP A;  5LJN A;  1EZ3 A;  4DDM A;  5LA6 E;  3I1A A;  3ANW A;  3N9M A;  1FMV A;  2A3D A;  2YU2 A;  4G5Y A;  4MUH A;  4AQF A;  3ZJ2 A;  5JRC B;  3ETU A;  2YU1 A;  1HCI A;  3IHR A;  1FIO A;  4UVB B;  5JRE A;  4X1I E;  3SRZ A;  2X9X A;  3ZCI A;  3UFE A;  2JMH A;  1HX8 A;  2ZMA A;  4XBF B;  4DDK A;  4AQF C;  2NWB A;  2D0T A;  5CB4 E;  4IE7 A;  5HXE A;  4O2A E;  2XAF B;  3PU3 A;  3IUB A;  2KWI B;  3PUR A;  5FP3 A;  1SA0 E;  1YKH B;  2C0S A;  5GON E;  1U4Q A;  3OKQ A;  4AQG A;  1HS7 A;  2X67 A;  5H6R B;  3RC3 A;  3V5U A;  1BR4 A;  3O1H A;  1SHZ C;  4GOU A;  3FXE B;  5G2F A;  5FY0 A;  2ZM8 A;  4XZC A;  1IAP A;  3ANW B;  3BK9 A;  4GK5 E;  4AKI A;  3IOC A;  2KLQ A;  4ZOL E;  4BJM A;  4WNK A;  2BZB A;  4EYY R;  2LSG A;  2I59 A;  2V26 A;  4AKL A;  4EYU A;  3NZP A;  2BDE A;  4IE4 A;  4L9I A;  2A53 A;  2NTY A;  3QUJ A;  2J1D G;  2VK9 A;  2VKD A;  2CLY B;  1N2B A;  1VRB A;  2CA5 A;  4PAG A;  2L3L A;  3MUE A;  4MUK A;  2LSY A;  4HGA A;  5FYM A;  2E9X C;  2DHR A;  3DJB A;  3I0O A;  3MXZ A;  3N9L A;  4TV8 E;  2W62 A;  3CWZ B;  2WSS V;  3DP7 A;  5L2L A;  3EDU A;  4P0A A;  3ZC0 A;  2LJL A;  2Y8D A;  3C4W A;  4HE8 A;  2XTL A;  4U74 A;  4MAL A;  4PK4 A;  3LE8 A;  4UVA B;  2IAK A;  5HG0 A;  4N78 D;  5F8P A;  2KXP B;  3AA6 B;  3L09 A;  4WBN E;  1ZKE A;  2JQQ A;  3O4X E;  1US7 B;  5L3G B;  3AVS A;  1Y64 B;  3O1I A;  3NRX A;  4BHR A;  5LG4 A;  3KV4 A;  4H63 V;  3M65 A;  2YEV C;  4GYR A;  4AXP A;  5DQW A;  5LGN B;  2K24 A;  2X51 A;  3EUH A;  5LBQ B;  3IVC A;  2ODV A;  2A2F X;  3FBZ A;  2MOZ A;  3UY4 A;  3HL6 A;  3O1J A;  2A86 A;  3WI3 A;  4ZI3 C;  3RH3 A;  2QGS A;  4X20 E;  3HKC E;  3SOL A;  2CXD A;  4YJ2 E;  3C50 A;  3Q2M A;  2H3R A;  2N2N A;  1VOM A;  4YFS A;  4M1P A;  5JH7 E;  2YIN A;  4FZJ A;  3COW A;  3UK2 A;  4NUV A;  5JR9 A;  2VKH A;  3QC9 A;  2XAG B;  2VL8 A;  1G73 A;  2C5K T;  3ZYK A;  1OWA A;  4WW0 A;  3UTK A;  3LK4 2;  1MOP A;  3CQG B;  4A56 A;  4PNI A;  2A72 A;  3UUM A;  2VKO A;  3ETV A;  3ZMZ B;  3SWH A;  5HXS A;  2G2S A;  5FXV A;  2CEA A;  5FY7 A;  4AI6 A;  4IDZ A;  2GK9 A;  2BVL A;  5JR9 C;  5JDL A;  4EOZ B;  3EDV A;  3UUL A;  1HTJ F;  5KDM C;  3AA1 B;  4OYJ A;  3UT5 E;  3IME A;  3HKB E;  3N8H A;  3CFF L;  2L9Q A;  3C51 A;  4PJJ A;  2Q9Q D;  4C91 A;  4IXJ A;  4DO0 A;  1V8F A;  2LHR A;  1D1A A;  3C4Z A;  3HKD E;  4GYS A;  4AKR B;  4UV8 B;  1G8X A;  5FXW A;  5HXR A;  1BR1 A;  2DWK A;  1D1C A;  4CI3 B;  3LJC A;  4ILU A;  5AFU L;  5JR9 B;  1N2H A;  4HEA A;  2VAS A;  2ZM2 A;  3MJX A;  2DCF A;  2X9W A;  2C5J A;  4IGU A;  5LNK A;  4G2A A;  4EB6 E;  5LCY A;  2YK0 A;  1MMG A;  5JDQ A;  2IC9 A;  4MUG A;  3MAC A;  2K9A A;  4MQ6 A;  2X68 A;  1S94 A;  2XHE B;  4AKH A;  3FXD B;  4QX7 B;  3COY A;  4QWN B;  5LJM A;  2EHO D;  2WMN A;  1BR2 A;  3K3Q C;  3LG7 A;  3Q5X A;  3QK6 A;  3WAJ A;  5LP6 E;  2PFV A;  2B1E A;  4KMC A;  1IJ6 A;  1IZN B;  1MNE A;  2ODU A;  2C5I T;  3N2K E;  5EK3 A;  2LOP A;  1N2G A;  4DMW A;  4TUY E;  2G3D A;  3CX6 B;  3PE0 A;  5FXX A;  3COV A;  4IE0 A;  4HKA A;  5EZY E;  4EZH A;  5LXT E;  2MBG A;  3JC6 C;  2A52 A;  3B13 A;  4ZI7 E;  3IF8 B;  4PJL A;  1ZV4 X;  1ZHC A;  2XAQ B;  3OJA A;  4MFR A;  2NW8 A;  3CQX C;  2LSK A;  4UF0 A;  4F6R C;  5J2U E;  3NBX X;  1B7T A;  4DVD A;  5DJQ C;  4IHJ E;  4J2C A;  1H7C A;  2XQY A;  2X0L B;  4I4T E;  5F3J A;  4I43 B;  5HWY A;  1MIV A;  2CXF A;  2E9X A;  2K48 A;  2CE7 A;  3RYI E;  3PUA A;  2ZLY A;  3OYZ A;  4O2B E;  3HI2 A;  3I0Q A;  5KWV A;  4EAH A;  3N9O A;  3MKD A;  2LT3 A;  3CVR A;  3ZMU B;  1D0X A;  3PUQ A;  3ESL A;  2Y48 B;  2HH7 A;  5ADX L;  1N2I A;  2H7O A;  2WAU A;  3PDY A;  2DWG A;  3KBU A;  3ZLI A;  3ZMV B;  2V7K A;  3F57 A;  1MIY A;  3RRW A;  4EF6 A;  4JEU B;  1ZEE A;  3HR0 A;  3FHN A;  5CA1 E;  2GW4 A;  3QTT A;  2PG8 A;  1MMA A;  2VWA A;  2DLR A;  4UF0 B;  5L3E B;  2CCQ A;  3R6N A;  3IEE A;  3N9P A;  4CXW A;  3CX8 B;  2W00 A;  3OBV E;  3ZN0 B;  4DND A;  2MYS A;  1UX4 A;  3GMI A;  2KMF A;  2HPJ A;  4QKN A;  3ZMS B;  2W61 A;  4PFP A;  2V7M A;  4O4H E;  3IUE A;  2E9X B;  1MMD A;  4H9P C;  5FY1 A;  2D2S A;  3RPU A;  3J7Y q;  3IOB A;  2CXL A;  4HTE A;  1LVF A;  2JPF A;  3OYX A;  4P09 A;  4ZI2 D;  3KVB A;  4H9O C;  4ERR A;  4KBM B;  2Y6X A;  5EK4 A;  1WLX A;  2L8K A;  1HG2 A;  2NTX A;  4O8S A;  4MUI A;  2X9H A;  4DMV A;  4CXY A;  4C90 A;  4MUN A;  4IE5 A;  2UXX B;  3LF4 A;  3N9Q A;  2V7I A;  3GWH A;  3AG5 A;  2NW7 A;  4DE5 A;  2JRK A;  3KV9 A;  3COZ A;  3LFM A;  3I9W A;  3K3N A;  2V1D B;  3GN5 A;  3HA4 A;  5BMV E;  5LHH B;  1N2O A;  2WM9 A;  5HYA A;  1WYC A;  1QUU A;  3E08 A;  3PUS A;  5L3F B;  3AAE B;  4YLH A;  4OFZ A;  3LK3 B;  2ES0 A;  4H9S E;  4IST A;  4H9R C;  3VKG A;  3U3I A;  3ZJ1 A;  1YW0 A;  2JJ9 A;  3IVX A;  5HXC A;  4MUE A;  2KWH A;  2NOX A;  4YHJ A;  5HWX A;  1HF8 A;  4U72 A;  5L3D B;  3A5X A;  1BR0 A;  1LVK A;  1QSD A;  4K0U A;  3C4X A;  3L3P A;  2A54 A;  2VKJ A;  3UA0 A;  4O4J E;  4OK0 A;  4CI1 B;  4PK6 A;  5JDN A;  4DBQ A;  2NW9 A;  4UIG A;  3E0Z A;  5JDF A;  4EXT A;  3KVA A;  2A50 A;  2XAS B;  4ZS2 A;  5FNV E;  5C8Y E;  3GN5 B;  3LK2 B;  3DTO A;  3MK7 C;  3IMG A;  1N2E A;  3BQI A;  2XAH B;  4MUF A;  2DI4 A;  2ZM0 A;  2IC6 A;  4MLK A;  2LE8 A;  1WYB A;  1UCU A;  5LHI B;  4UEM A;  3W15 B;  4ADZ A;  4IIJ E;  3HKE E;  2DNX A;  1S35 A;  3MZK B;  2N1G A;  4E7Z A;  3CX7 B;  1FEW A;  1HG5 A;  4X1Y E;  5JDG A;  4BA9 A;  3CML A;  3K8P C;  3NRY A;  4TN7 B;  3O9X A;  2LM9 A;  4JLE A;  3ISJ A;  2Q9Q A;  2UXN B;  2KZ7 B;  3N5L A;  3S4U A;  1WRD A;  5TAO A;  4I55 E;  3ZYL A;  4V1A v;  4KUM B;  3J9X 1;  4ANJ A;  2N9D A;  3BQK A;  3RRC A;  5LHG B;  4DDH A;  5J1G A;  2RA1 A;  1E1H B;  3T8O A;  3RC8 A;  3LBX A;  4QXH B;  2X3F A;  1MMN A;  2NP9 A;  3ZPO A;  2E9X D;  3KFW X;  4PJM A;  1O3X A;  2XAJ B;  2Q9Q C;  4MUJ A;  4YJ3 E;  1D1B A;  4KP3 C;  1HFA A;  3ZCJ A;  1YD8 G;  2A84 A;  2LOS A;  3UUN A;  4GK0 E;  2VB6 A;  4JUY A;  2PJQ A;  4UXN B;  5ETW A;  5KMG P;  1MIW A;  4XAX B;  1YKE B;  1LKX A;  3ONX A;  1D0Y A;  3H3A A;  4H9N C;  2EHO A;  5LYJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...