3HL6A

Staphylococcus aureus pathogenicity island 3 orf9 protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
213
structure length
189
Chain Sequence
DIETIVNEFETRAGTLLRYYTGLLERSKVQPCCFKLYNDPFDMVYVMMNSKLFSHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKQLSISDMMASQLFEDEYFMYGLQTYQSSNTDVIANIEMLYQLATGINEPVPELVEGLKLVTEFVQDENATQEDYKALERKLNDLKASYYSLSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Pathogenicity island protein
publication title Structural and functional studies of a pathogenicity island protein from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 58
structure length 189
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16560 SAPI Putative mobile pathogenicity island
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.700 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3hl6A02
3.30.1300.50 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3hl6A01
3HL6A
chains in the Genus database with same CATH superfamily
4ILBA 4L9IA 2A84A 2CBJA 2MTQA 1XNQT 3EMOA 3AE9A 4U74A 4GKKT 2HN1A 3AA1B 3RYIE 3KVBA 4B3RT 3ZC0A 4DUZT 2UUAT 5IHYA 4AKLA 5HEGA 3K1SA 2EHOB 3HI2A 4DDHA 5AQGB 4YHHT 2OA5A 4I55E 3V5UA 3KV5A 3CFFL 5CA0E 2WDVA 2IAKA 4IE4A 2QYWA 3CQCB 2UUBT 2E5VA 3FZFB 2X67A 3A5XA 2LE8A 1FEWA 2ODUA 1XWMA 1T72A 4IT4A 2XASB 4HFCA 2LSIA 3ABVA 2A86A 4YJ3E 2D0UA 2UU9T 2N1GA 2XQ6A 2H7OA 4UELA 4E7ZA 4H63V 4PJNA 2BG9B 4I0UA 4NIQA 4IDPA 3ZYLA 4EZ4A 5HXRA 3UUXB 3BQLA 4WNKA 5F5WA 3N9PA 2JPFA 5AQJB 2RPAA 3IF8B 5L3CB 3UU3A 4JI2T 2I52A 2YDSA 5JDMA 4JI1T 5ABFA 2E9XC 4QX7B 2LSYA 1YKHB 1KNPA 2JRKA 4CXXA 1N2JA 1QUUA 3C64A 5ABGA 1QSDA 3SWHA 2A56A 2MBGA 2JIWA 3FZMB 5FXWA 4EFKA 4LF5T 2ACZA 2H7VC 2W67A 2NP9A 3NZQA 5AQLB 2DCFA 3OPCA 2DLRA 4YY3T 2HH7A 2BG9A 3AA0B 4H63H 4ZI7E 2LM9A 4DNDA 3P4QA 3AE7A 3UFEA 4TV8E 3AE3A 2D9DA 4MUFA 3FB2A 5TAOA 3Q9DA 2Q9QD 3ZSTA 3KDSE 3ZSSA 3PUYF 4U7YA 4LF9T 4ADZA 1IJ5A 1N33T 5AQIB 4B6XA 4AIUA 5C3JA 2XQAA 3SS1A 3FZLB 1LKXA 5AQOB 2X66A 1SE7A 2FJAA 2CRBA 1KEYA 1O3XA 4I43B 4UEMA 5L3GB 1G8XA 3UUNA 3ZT5A 4U72A 4EIWA 2N2NA 2EJCA 3PUZF 2NW7A 3CX8B 4DV7T 4MUIA 5JDQA 4YLHA 5FXXA 4QH5A 2SPCA 1Y01A 3AE4A 2JMHA 2UXDT 4AKIA 1UGOA 3ZLIA 5HCJA 5LGUB 4IIJE 3D0TA 4MULA 4H9RC 2DWKA 3Q5DA 4LF8T 2X9YA 3QK6A 4BJMA 4TV9E 2DWGA 5J1GA 5G2FA 3O9XA 2V7MA 2A53A 3PURA 3N9OA 3N2GE 3FXEB 2B76A 1WCRA 5HAXA 5LHHB 3RIFA 3T1HT 4MUKA 5FVLA 3RLFF 4P09A 4BA9A 5FVKA 2AE9A 2LSKA 3GN5B 5JQGE 3IVCA 3F31A 2BBHA 2PBIA 3EDVA 3PJAA 2CLYC 4CZZB 4HEAA 3K8PC 3PUGA 3FZHB 4IGUA 2MYSA 2PJQA 4KBMB 1JNRA 2WU2A 1W0AA 1MIWA 3EHZA 1XMQT 1HCIA 4O4LE 2HPLA 4OFZA 5C8YE 1BR1A 4JI7T 2W4XA 3UK2A 3WAKA 4DBRA 1MNDA 4J2CA 2G2SA 5ABEA 4DV6T 4O4IE 5AQMB 3MKDA 4UVCB 4XBFB 2K9AA 4PK4A 5FL1A 3CMLA 1IBKT 4QWNB 4QXBB 3JAEA 5DQWA 2PFVA 4OYKA 3GN5A 2Y8DA 5FY0A 2X51A 3AG6A 3S4UA 3AG5A 2H89A 3MA9A 3N2OA 4ZXLA 2FJEA 3TLWA 3LE8A 4X1IE 3L09A 1J5ET 3JAFA 4NPPA 4AQYT 1NAFA 1D0YA 3B5MA 3RI5A 4LF4T 4QHOA 2NTXA 4DVDA 5L2LA 2ZMAA 3EVYA 4AQFA 3VR9A 1VCTA 3CFHL 1BR0A 3RYFE 3UTKA 4WZXA 3CX6B 3RIAA 2IMLA 1KNRA 2A7XA 4HFVA 5GONE 5AQKB 2IHR1 1D1CA 5JR9C 2B1EA 3ZCJA 4DR1T 4PJJA 4L5GA 3CFAL 2XAGB 2L8KA 1QLBA 5CGMA 1BR4A 2XQ8A 3IBPA 2CBIA 2CMRA 4AKHA 2XJ7A 2KNDA 2BS2A 5L3FB 2C0SA 4HWCA 2E8IA 3L39A 4U3CA 3COVA 3LJCA 2X68A 2XSAA 3A8YC 5LBQB 2KT9A 2GR8A 4DR5T 4V1Av 4FZJA 4OK0A 3UFGA 2LRLA 3L3PA 4DR2T 4G2AA 1HTJF 4LF6T 3KFWX 3ZN1B 4DR7T 3SFEA 3AE6A 3IMCA 4CXWA 4FJOA 3AE5A 2P9BA 3ZT7A 5J2UE 3INNA 3UULA 3RQWA 3ZMZB 2WZHA 2V5CA 3UU4A 2OGFA 5HEOA 5AQUB 3C50A 2LMEA 5J0ZA 3PTRB 4WW0A 2WDQA 4ERRA 1OEDA 5F3JA 4UVAB 3IUEA 3IOEA 4EYYR 4NXMT 4KI0F 3HKBE 4Z8XA 5J2TE 1WYCA 4JI6T 1IHOA 5EK3A 4A56A 1E7PA 2YINA 1W9RA 5AQHB 2I6HA 4DR3T 4PNIA 3C51A 1XDOA 3M65A 3MK7C 2K24A 4MUJA 5AQSB 4I50E 3FBLA 2C5IT 4MUGA 1YD8G 4H9OC 3PJAJ 2GW4A 3R6NA 1HNXT 3RC8A 2WWVA 1T7SA 3B57A 1D1AA 1D0ZA 4LMJA 4ZS3A 5JRCA 5FNVE 1N36T 3F57A 2RP4A 1XZYA 3P7IA 1KFYA 2R6GF 3ESLA 3PUSA 3KBUA 1I6ZA 2XAQB 4A97A 2UXNB 4PJLA 3T8OA 4DV5T 1ZOYA 2RETA 3E0ZA 5AQPB 4DUYT 3C4ZA 3QUJA 3UU8A 4G5FA 4ASKA 3HR0A 2V6XA 1CUNA 1W0BA 4HWHA 5HYAA 2CHOA 3ZJ1A 3ZYKA 4DE5A 3CIRA 4Q25A 5AFUL 5AQNB 5LHIB 5LB7B 2V8SV 2OV9A 4CI3B 5KWVA 1VOMA 2XAHB 2W66A 2D2SA 4ZZBA 4KHPT 3MJXA 2EHOA 2Q9QC 5LA6E 3FZKB 3PV0F 3PUWF 2JQHA 3NRYA 4M1PA 4JEHB 4X1YE 4DV4T 5FKYA 5KMGP 2HN2A 4HWIB 4AKGA 4PK5A 4GIWA 5L3BB 2WDRA 3AXJB 4HWDA 1NWMX 3P4RA 3J9X1 2CLYB 3NVOA 2IC9A 3SFDA 3IA3A 3F2EA 4QH1A 3QOFA 4U2YA 3LDQB 4EF6A 2PG8A 3AE1A 3Q5WA 1J5WA 3KV6A 3AA6B 5IYZE 4EZHA 1LRZA 4CI2B 3VRBA 4ZI2D 3DTOA 5FL0A 5HWYA 5JH7E 4CQIA 3AEAA 4O8SA 2CE7A 3NWIA 4GYSA 5BMVE 4EEBA 4IXJA 2A3DA 3TLTA 4AISA 2V6YB 2M6BA 2W00A 2MOZA 3QC9A 2VQFT 3NZPA 2LLYA 3TLSA 4QKNA 3RX6A 3PE0A 2CWYA 4TZ4C 2K48A 3AXJA 2BDEA 3AEDA 2BS4A 1FMWA 2YU1A 4DV0T 3QNUA 3RYHE 2XAFB 1KK7A 5FY7A 2CCQA 1E1HB 2KINB 3Q5XA 5LJNA 4WBNE 1IBMT 1WR0A 2Z6EA 4HGAA 2ZM8A 4MBQA 5AQVB 3LG7A 3P4SA 5JDLA 1VCSA 2C5JA 3MACA 3ZN0B 1LVKA 1HR0T 3Q2MA 4H9QC 3E22E 3LFMA 3O4XE 2IC6A 4IREA 2E2AA 2HPJA 4KUMB 4YXDA 4IDOA 2YDRA 1N34T 1YKEB 4U7IA 5LMNT 3Q10A 4BJNA 3KINB 2NW9A 1UUSA 4JBWF 3OTOT 3LK2B 3IODA 4IE0A 3ONLC 3HL6A 3ETVA 4GK0E 4O2AE 2X0LB 1ZEEA 4TX5A 4BAYB 3JC6D 3N8HA 4CN4A 5FMNA 3AEBA 4WYVA 3U3IA 2BG9C 1UX5A 1R8IA 2DNXA 3IVXA 4MALA 2WSSV 3ZJ2A 3KVAA 4EOZB 3ZT6A 4COFA 4PFOA 3NKZA 2VKHA 5LG3A 5LYJE 2V7IA 3P4WA 2EHOD 2LT3A 4DMWA 2DL1A 2NTYA 3GMIA 5HEUA 3VKHA 2A52A 5ABHA 3C4XA 5JVDE 3CWZB 5LNKA 3RIUA 5CA1E 4X65T 2QA7A 3LBXB 4N78D 4UF0B 3N9LA 1EZ3A 1G73A 2KMFA 4ISSA 4KMCA 5LJMA 5KXJA 3L8RA 3RYCE 2W0GA 4DMVA 4HWFA 3RC3A 2NW8A 4ISTA 2CXLA 1HX8A 4X5TA 5L3DB 5LG4A 4NUUA 3Q5EA 3X1DA 2J47A 2ZM2A 4H9SE 4HE8A 1XMOT 2LHNA 3A7MA 4LFBT 2X0YA 4QH4A 4GKJT 5F8PA 2CA5A 1WFDA 3RGLA 5L3EB 2LKGA 4ZI3D 4IL4A 2VURA 4TUYE 3K3NA 1X79A 1YXRA 4X20E 3Q12A 5E0OA 4JI4T 3N5LA 3O1HA 4AKRB 2VWAA 2CPTA 5JDFA 3IVGA 4UF0A 4MLKA 2ODVA 1D1BA 2D0TA 2FBWA 2LSGA 3MXTA 5IUXA 3CPZA 2LM2A 5JDGA 1OXZA 2BKPA 2JMKA 1M7KA 1MNEA 4NUVA 2BG9E 4YTMA 3COWA 2PTFA 3RRCA 1YW0A 2W63A 1WLXA 3OYZA 3UQ4A 4U31A 2WZIA 3GA8A 3KV9A 2RA1A 5HCMA 4ZOLE 1Z8UA 2BKNA 3RIUC 4UXNB 3WI3A 4JYAT 4KX6A 2ZLYA 2V7KA 2XZEA 2K5BB 3I1AA 2HHHT 2WP9A 1T8BA 4OX9T 2G0UA 2ACXA 2LEHA 2J1DG 4CN1A 4YT0A 5CB4E 4F6RC 3P4PA 3PUQA 1VRBA 4WBOA 2YN6A 3PDYA 4ZS2A 5HWXA 3IOBA 3VRAA 2IW5B 4YSZA 2XY8B 4PK6A 4IDNA 4GOUA 3HKDE 3VHLA 4A98A 4QXCB 3H3AA 4UIGA 4F8HA 4EV6A 5KDMC 4GK5E 2Q9QB 3QB5A 2UXCT 1HNWT 3PUVF 3COZA 1BR2A 2WMOA 2NOXA 1MIVA 4XZCA 3N9QA 3TLUA 2E9XB 3CFIA 3ZKRA 2WQYA 2G16A 4AQFC 1SHZC 4CI1B 2F4VT 5LP6E 5L4HA 4EYUA 4L0RA 2NWBA 1HS7A 3RRWA 3COYA 3R84B 5FXZA 4QXHB 3T1YT 4P1NA 3BQIA 2WM9A 3MZKB 3V5SA 2UUCT 4JV5T 3PU3A 1LVFA 2XQ3A 3JCFA 3ZPOA 3CVRA 2LOSA 3JADA 2A2FX 2I0MA 1M62A 3AECA 2VB6A 4UVBB 3QB5K 4O4JE 3PUAA 2ZM6T 2YOEA 2E9XA 1N2EA 1NENA 4O2BE 4JI0T 4CXYA 4JI5T 4XAXB 2FJBA 3LF4A 5H6RB 2E5LT 2X0HA 3CX7B 2D5UA 3OKQA 2GK9A 1GQEA 2WWUA 2WBLA 4EGWA 4ZEYA 3M3ZB 2VL0A 4JUYA 2VKDA 2CHNA 5JDHA 4K0UA 3AVRA 4IDZA 5DQVA 3AAEB 4MUEA 3AEEA 3IOCA 4X64T 4HN9A 4LFAT 4YHJA 2XUEA 3O1JA 2JQ9A 2C5KT 4TNVA 2NR4A 3UU6A 3UA0A 4TWDA 5FP3A 4OYJA 5FY1A 2KXPB 2XHEB 1D0XA 3CK6A 3OVUA 3AEGA 5BR8T 4EEDA 5L4EA 2A50A 3EUHA 2KWIB 2M67A 5ABFB 3CQGB 3I9YA 3UUMA 1AJ3A 4YSYA 3GWHA 4BHRA 1S94A 4AI6A 1OEDC 2LRKA 4IE6A 4ZI2C 1XNRT 1MOPA 1HFAA 4ANJA 2A9UA 2IECA 4UR9A 4MHCA 1T98A 5LMUT 1FMVA 1JNZA 3AA7B 1MMGA 4IE7A 4YFSA 3RKOA 5EXCA 5AQTB 2X9WA 3SOLA 3W15B 3K3QC 4JI3T 4X62T 3RHWA 4LMKA 2XSBA 2KLQA 2LJLA 2LKHA 3B13A 5AQQB 2CM0A 2X9XA 3ANWB 2WMNA 3FXDB 4UV9B 2WS3A 2AXDS 1L0VA 4IDQA 4TN7B 4YSXA 5LGTB 4ZZCA 3DP7A 5JTGA 3DJBA 4IHJE 2V1DB 2MPKA 3ZYMA 4ILUA 4AXPA 3UUBA 3QTTA 3UQ7A 4KP3C 1NEKA 2QVAA 3VR8A 3LK3B 3HKCE 2V7JA 3MXZA 1CHUA 4DR4T 3ZCIA 4PJMA 5ETWA 2J62A 5CJ5A 5L47A 3BK9A 4DV3T 3IHRA 2W61A 1FIOA 1HX1B 5AQRB 2FJDA 4O4HE 3JC6C 4NXNT 3ANWA 3N9NA 4MFRA 2BVLA 3HA4A 2E9XD 3G06A 2VKOA 3H37A 1Z0PA 1XDPA 2GR7A 1OEDE 2XTLA 4AQGA 2EHOC 2L9QA 4OHFA 5IWAT 4EXTA 4JEUB 3RPUA 4DR6T 3J7Yq 3P50A 3H3MA 2VL8A 2CXFA 4LFCT 3C4WA 4HFIA 2XPKA 2VVNA 2V6YA 4G63A 2Y48B 4TNWA 4DV2T 3LK42 1MMNA 3AAIA 4DIDB 2UXXB 2G3DA 5FYMA 3ZMTB 2DI4A 1ZKEA 5LGNB 3ZMUB 1OWAA 5LXTE 5KX5E 1MMDA 2YKSA 4DO0A 1MIYA 2VKJA 3RQUA 1WRDA 1MMAA 3E08A 5JR9B 3IMEA 4P0BA 3RF1A 4YTPA 1H7CA 2YK0A 1UCUA 3N9MA 5A1LA 1YQ3A 5FXVA 5HG0A 1SA0E 4ILCA 4YJ2E 2X3FA 4H9PC 3CI0K 3EI0A 2CEAA 1U5PA 4PFPA 1UURA 3CQXC 4ZI3C 1S35A 3OJAA 2XQYA 1I94T 1KNZA 4Z91A 2LHRA 2CXDA 4JI8T 3NBXX 1J1JA 2H88A 2W2UA 3AE2A 2WCAA 3CKDA 3CI0I 5BW0B 1N2OA 2LOPA 2XQ7A 4ZHQE 2BS3A 2ZM0A 2YU2A 3TLVA 2QRXA 2YDQA 4EB6E 4G5YA 5JR9A 4U33A 5H6QB 1WR6A 4A5XA 2V7LA 2VVSA 1IBLT 3PU8A 3VKGA 3OBVE 4DV1T 1B7TA 1DU2A 4ILAA 3VU7H 4P0AA 4JLEA 3ONJA 3HKEE 3PUXF 2N9DA 4TWFA 1YQ4A 4B3MT 1SUMB 2H3RA 3ONXA 2IDOB 3SRZA 4PAGA 4E7SA 3EAMA 5ADXL 5LOVE 2KSRA 5EK4A 2XAJB 4LF7T 2A54A 2KWHA 3LBXA 5EK2A 5LBMA 5HXCA 2VQET 1IZNB 3UY4A 4HFDA 3IMGA 2KZ7B 3AAAB 5DABA 5JREA 2WAUA 3ZMSB 5DJQC 2XQ5A 4YTNA 3BQKA 4K0KT 1FJGT 4IL9A 2LSJA 1N2BA 4PW8A 2IUBA 4QX8B 3OYXA 1HF8A 2WY2A 4DBQA 3I0OA 5HEHA 4UV8B 4X66T 3C98B 3MUEA 3LSVA 4CN6A 4LMLA 5EZYE 1HNZT 1U4QA 5LHGB 4HFEA 4I4TE 2YEVC 4B3TT 4C91A 3P8CD 1KF6A 3AVSA 2FUPA 3RH3A 2IIUA 2VASA 5HXEA 4DDMA 4IE5A 2XQ4A 1HG2A 2A72A 4B3ST 1ZP0A 3ZEFB 3ISJA 1X9BA 1N2GA 1HG5A 1UX4A 2K3WA 4DDKA 2J4GA 3TKLB 2L3LA 2JQQA 2Y6XA 1V9DA 2XM1A 3WAJA 1N32T 1E2AA 1US7B 1OEDB 5M4YA 2OLTA 3I9WA 4GYRA 4TWHA 4X1KE 4MUHA 3AE8A 4HFBA 3KBTA 4Z90A 2M6IA 2DHRA 3ZC1A 2XM2A 2JJ9A 5LCYA 2W62A 2QGSA 2BZBA 1ZV4X 4HTEA 3N2KE 3EABA 1IAPA 3UU5A 1N2IA 1WYBA 4MQ6A 3KV4A 2WB5A 5HXHA 5AQFB 2I59A 2X9HA 5HEJA 5JDNA 1UFVA 1N2HA 3AB3B 4H9NC 5CFBA 2ES0A 3ETUA 2WU5A 3I0QA 2V5DA 3O1IA 5HXSA 3U78A 3ZMVB 5JRCB 4MUNA 4U2ZA 2A88A 2VK9A 2BVMA 3IUBA 4EAHA 1UK5A 2G5ZA 4FI5A 4HFHA 1ZHCA 2Q9QA 2BBJA 2XQ9A 4HKAA 3FBZA 1IJ6A 2MAWA 3FHNA 3NRXA 2JQKA 3AEFA 4C90A 5C2TA 2BKOA 3EDUA 2UXBT 3K3OA 3RKGA 4KHZF 3IEEA 1W09A 1Y64B 2V26A 3UT5E 2CWOA 1V8FA
chains in the Genus database with same CATH topology
4ILUA 2B1EA 3GMIA 3ZCJA 4AXPA 3VKHA 2A52A 3QTTA 4L9IA 3C4XA 5JVDE 2A84A 4KP3C 3CWZB 2MTQA 5LNKA 4PJJA 3LK3B 3HKCE 4L5GA 2V7JA 3MXZA 3CFAL 3ZCIA 5CA1E 2XAGB 2L8KA 1BR4A 3IBPA 4PJMA 5ETWA 2QA7A 2CMRA 3LBXB 4U74A 4AKHA 4N78D 4UF0B 3N9LA 1EZ3A 2KNDA 1G73A 3AA1B 3RYIE 3KVBA 2KMFA 5L3FB 3ZC0A 3BK9A 4ISSA 2C0SA 3IHRA 4KMCA 5IHYA 5LJMA 2E8IA 4AKLA 2W61A 3RYCE 2W0GA 1FIOA 2EHOB 4DMVA 3HI2A 4DDHA 3COVA 3LJCA 4O4HE 3RC3A 2NW8A 3JC6C 2X68A 3ANWA 3N9NA 2OA5A 4I55E 4MFRA 3V5UA 4ISTA 3KV5A 2CXLA 2BVLA 5CA0E 3HA4A 3CFFL 1HX8A 5LBQB 2IAKA 4IE4A 5L3DB 5LG4A 2KT9A 4NUUA 2E9XD 3CQCB 2ZM2A 4H9SE 4HE8A 2VKOA 4V1Av 2X67A 3H37A 2LHNA 4FZJA 4OK0A 3A5XA 2LE8A 5F8PA 1Z0PA 1FEWA 2ODUA 3L3PA 2CA5A 2XTLA 4AQGA 4G2AA 2XASB 2EHOC 2L9QA 5L3EB 1HTJF 4ZI3D 4OHFA 3KFWX 4JEUB 3RPUA 4EXTA 3ZN1B 2LSIA 3J7Yq 2A86A 4YJ3E 2D0UA 4TUYE 3K3NA 3IMCA 4CXWA 1X79A 2VL8A 4X20E 4FJOA 5E0OA 3Q12A 2CXFA 2N1GA 2P9BA 2H7OA 4UELA 4E7ZA 3C4WA 3N5LA 5J2UE 3O1HA 4AKRB 4H63V 3INNA 4PJNA 2VWAA 4G63A 2Y48B 3UULA 5JDFA 3IVGA 3LK42 4UF0A 3ZMZB 1MMNA 4MLKA 3AAIA 2ODVA 1D1BA 2UXXB 2D0TA 2G3DA 5FYMA 3ZYLA 4EZ4A 3ZMTB 2DI4A 3C50A 5HXRA 3UUXB 3BQLA 1ZKEA 4WNKA 5LGNB 3ZMUB 1OWAA 5LXTE 5KX5E 1MMDA 4DO0A 3N9PA 2JPFA 3PTRB 4WW0A 4ERRA 2LSGA 5F3JA 3MXTA 3CPZA 1MIYA 2VKJA 3IF8B 1OXZA 5JDGA 5L3CB 1WRDA 1MMAA 4UVAB 3IUEA 3E08A 2JMKA 3IOEA 4EYYR 1MNEA 4NUVA 5JR9B 3HKBE 4Z8XA 3IMEA 5J2TE 4P0BA 5JDMA 3COWA 1WYCA 1IHOA 3RRCA 1H7CA 2YK0A 2E9XC 4QX7B 5EK3A 1UCUA 1YW0A 4A56A 3N9MA 2LSYA 5A1LA 2YINA 1YKHB 5FXVA 5HG0A 1SA0E 2W63A 2JRKA 4CXXA 4YJ2E 1N2JA 3C64A 1QUUA 4PNIA 2X3FA 1QSDA 3C51A 4H9PC 3SWHA 2A56A 2CEAA 1U5PA 1WLXA 3OYZA 2MBGA 5FXWA 4PFPA 3CQXC 3GA8A 3M65A 4ZI3C 3KV9A 1S35A 4EFKA 2RA1A 3MK7C 4ZOLE 2K24A 4MUJA 3OJAA 4I50E 3FBLA 2H7VC 4UXNB 3WI3A 2C5IT 4MUGA 2XQYA 2NP9A 3NZQA 1YD8G 2DCFA 2ZLYA 1KNZA 2DLRA 2LHRA 4H9OC 2HH7A 2CXDA 2GW4A 3AA0B 3NBXX 4H63H 2V7KA 3R6NA 4ZI7E 3RC8A 2LM9A 2K5BB 4DNDA 3I1AA 3B57A 1D1AA 3UFEA 1D0ZA 3CKDA 4TV8E 2G0UA 2ACXA 4ZS3A 2LEHA 5JRCA 5FNVE 2LOPA 1N2OA 2J1DG 4MUFA 3FB2A 5TAOA 3F57A 2Q9QD 3Q9DA 2RP4A 4ZHQE 3KDSE 2ZM0A 3P7IA 4F6RC 5CB4E 2YU2A 4G5YA 4EB6E 5JR9A 4ADZA 5H6QB 1IJ5A 1WR6A 3PUQA 3ESLA 1VRBA 4WBOA 2V7LA 3PDYA 3KBUA 3PUSA 4ZS2A 5HWXA 3PU8A 3IOBA 2XAQB 2UXNB 2IW5B 3VKGA 3OBVE 4PK6A 4PJLA 4B6XA 1B7TA 3T8OA 4GOUA 3E0ZA 3HKDE 3C4ZA 3QUJA 3VHLA 3VU7H 3SS1A 4P0AA 4JLEA 3HKEE 4G5FA 1LKXA 4QXCB 4ASKA 2N9DA 3H3AA 3HR0A 4UIGA 2X66A 1CUNA 5KDMC 2H3RA 3ONXA 4GK5E 2Q9QB 5HYAA 3SRZA 4PAGA 1O3XA 4E7SA 4I43B 3ZJ1A 1BR2A 3ZYKA 3COZA 4UEMA 4DE5A 5L3GB 2WMOA 5AFUL 5ADXL 2NOXA 5LOVE 1G8XA 1MIVA 4XZCA 5EK4A 5LHIB 3UUNA 2XAJB 4U72A 4EIWA 2A54A 2N2NA 3N9QA 2EJCA 2KWHA 2NW7A 2E9XB 3LBXA 3CX8B 4CI3B 5EK2A 5KWVA 5LBMA 5HXCA 1VOMA 2XAHB 2G16A 4MUIA 2D2SA 5JDQA 1IZNB 4YLHA 4AQFC 3UY4A 5FXXA 1SHZC 3IMGA 2KZ7B 4CI1B 3AAAB 5DABA 5JREA 2SPCA 2WAUA 3MJXA 2JMHA 3ZMSB 5LP6E 4EYUA 5DJQC 2EHOA 2NWBA 2Q9QC 4L0RA 1HS7A 5LA6E 4AKIA 3ZLIA 3BQKA 3NRYA 3RRWA 2LSJA 3COYA 3R84B 4M1PA 5FXZA 4JEHB 4PW8A 5LGUB 4X1YE 1N2BA 4QX8B 4IIJE 3OYXA 5KMGP 3D0TA 4MULA 1HF8A 4QXHB 4DBQA 4AKGA 4H9RC 3BQIA 2DWKA 2WM9A 3I0OA 3MZKB 2X9YA 3V5SA 3QK6A 4PK5A 4BJMA 4GIWA 3PU3A 4UV8B 4TV9E 3C98B 5L3BB 1LVFA 3MUEA 3ZPOA 2DWGA 1NWMX 3CVRA 5J1GA 2LOSA 5G2FA 3J9X1 2CLYB 3O9XA 5EZYE 2V7MA 2A53A 2IC9A 3PURA 1U4QA 2A2FX 5LHGB 3N9OA 3F2EA 4I4TE 3N2GE 2YEVC 3FXEB 2VB6A 5HAXA 4UVBB 5LHHB 4C91A 3P8CD 4EF6A 4MUKA 4O4JE 2PG8A 3PUAA 3AVSA 4P09A 4BA9A 2E9XA 3Q5WA 3RH3A 5HXEA 2VASA 3KV6A 1N2EA 4DDMA 3AA6B 2LSKA 4O2BE 5IYZE 4EZHA 3GN5B 5JQGE 3IVCA 1LRZA 3F31A 4CXYA 4XAXB 4CI2B 2PBIA 3EDVA 3LF4A 5H6RB 4ZI2D 2CLYC 4IE5A 3DTOA 4CZZB 5HWYA 5JH7E 4HEAA 3K8PC 4CQIA 3CX7B 4O8SA 2D5UA 3OKQA 3PUGA 2GK9A 2WWUA 2CE7A 1HG2A 2A72A 4IGUA 4GYSA 3ZEFB 5BMVE 2MYSA 3ISJA 1N2GA 2WBLA 1HG5A 1UX4A 4IXJA 2PJQA 4JUYA 4KBMB 4DDKA 2VKDA 2A3DA 5JDHA 4K0UA 1MIWA 3AVRA 1HCIA 2W00A 2MOZA 3QC9A 4IDZA 3AAEB 4O4LE 2HPLA 5DQVA 3TKLB 4MUEA 3IOCA 3NZPA 4OFZA 2JQQA 2L3LA 5C8YE 4HN9A 1BR1A 4QKNA 2Y6XA 1V9DA 3RX6A 3PE0A 3UK2A 4YHJA 3WAKA 2CWYA 2XUEA 3O1JA 4TZ4C 3WAJA 2K48A 2BDEA 1MNDA 1US7B 2C5KT 4DBRA 1FMWA 5M4YA 4J2CA 3UA0A 2G2SA 2YU1A 3I9WA 4GYRA 3RYHE 5FP3A 4OYJA 4X1KE 5FY1A 2XAFB 4O4IE 4MUHA 1KK7A 2KXPB 5FY7A 2XHEB 2CCQA 1E1HB 1D0XA 3MKDA 3KBTA 2KINB 4UVCB 3Q5XA 4WBNE 5LJNA 3EUHA 2DHRA 2KWIB 2A50A 2M67A 2Z6EA 2K9AA 4PK4A 3ZC1A 4XBFB 3CQGB 4HGAA 2JJ9A 3I9YA 5LCYA 3UUMA 2W62A 2ZM8A 2QGSA 1AJ3A 2BZBA 3CMLA 1ZV4X 4MBQA 4HTEA 4QWNB 3N2KE 3LG7A 4QXBB 3GWHA 1IAPA 5DQWA 2PFVA 4OYKA 5JDLA 1N2IA 3MACA 2C5JA 3ZN0B 1LVKA 3Q2MA 3GN5A 4H9QC 2Y8DA 4BHRA 3E22E 1S94A 1WYBA 3LFMA 4MQ6A 3O4XE 4AI6A 2IC6A 3KV4A 5FY0A 4IE6A 4ZI2C 1MOPA 2X51A 1HFAA 3S4UA 3AG6A 2HPJA 3AG5A 4KUMB 4ANJA 5HXHA 3MA9A 2I59A 2X9HA 3N2OA 4MHCA 3LE8A 5JDNA 1YKEB 1UFVA 1T98A 1N2HA 3AB3B 4H9NC 4X1IE 3L09A 3Q10A 4BJNA 3KINB 2ES0A 2NW9A 1FMVA 3AA7B 3ETUA 1MMGA 1NAFA 3IODA 3LK2B 4IE7A 1D0YA 4YFSA 4IE0A 3RKOA 5EXCA 3HL6A 3I0QA 3ETVA 3O1IA 5HXSA 3U78A 2X9WA 3ZMVB 3SOLA 3W15B 3K3QC 5JRCB 4QHOA 4GK0E 4O2AE 2X0LB 2NTXA 4DVDA 4MUNA 2A88A 1ZEEA 5L2LA 2VK9A 2BVMA 4TX5A 2KLQA 2ZMAA 3EVYA 4AQFA 4BAYB 4EAHA 2LJLA 3IUBA 3JC6D 2G5ZA 3B13A 3N8HA 2CM0A 2X9XA 4FI5A 3ANWB 1ZHCA 2Q9QA 2WMNA 3FXDB 4UV9B 5FMNA 3U3IA 4HKAA 3FBZA 3CFHL 1BR0A 1IJ6A 1UX5A 3RYFE 3UTKA 3FHNA 3NRXA 4TN7B 2DNXA 4C90A 3IVXA 4MALA 5LGTB 2WSSV 3ZJ2A 3DP7A 3KVAA 3EDUA 4EOZB 3CX6B 3K3OA 4PFOA 2VKHA 3DJBA 3IEEA 5LYJE 2V7IA 4IHJE 2EHOD 2LT3A 2A7XA 4HFVA 5GONE 4DMWA 1Y64B 2V26A 2V1DB 2NTYA 1D1CA 3UT5E 5JR9C 2CWOA 1V8FA 3ZYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HL6 A; 
#chains in the Genus database with same CATH topology
 4ILB A;  4L9I A;  2A84 A;  2CBJ A;  2MTQ A;  1XNQ T;  3EMO A;  3AE9 A;  4U74 A;  4GKK T;  2HN1 A;  3AA1 B;  3RYI E;  3KVB A;  4B3R T;  3ZC0 A;  4DUZ T;  2UUA T;  5IHY A;  4AKL A;  5HEG A;  3K1S A;  2EHO B;  3HI2 A;  4DDH A;  5AQG B;  4YHH T;  2OA5 A;  4I55 E;  3V5U A;  3KV5 A;  3CFF L;  5CA0 E;  2WDV A;  2IAK A;  4IE4 A;  2QYW A;  3CQC B;  2UUB T;  2E5V A;  3FZF B;  2X67 A;  3A5X A;  2LE8 A;  1FEW A;  2ODU A;  1XWM A;  1T72 A;  4IT4 A;  2XAS B;  4HFC A;  2LSI A;  3ABV A;  2A86 A;  4YJ3 E;  2D0U A;  2UU9 T;  2N1G A;  2XQ6 A;  2H7O A;  4UEL A;  4E7Z A;  4H63 V;  4PJN A;  2BG9 B;  4I0U A;  4NIQ A;  4IDP A;  3ZYL A;  4EZ4 A;  5HXR A;  3UUX B;  3BQL A;  4WNK A;  5F5W A;  3N9P A;  2JPF A;  5AQJ B;  2RPA A;  3IF8 B;  5L3C B;  3UU3 A;  4JI2 T;  2I52 A;  2YDS A;  5JDM A;  4JI1 T;  5ABF A;  2E9X C;  4QX7 B;  2LSY A;  1YKH B;  1KNP A;  2JRK A;  4CXX A;  1N2J A;  1QUU A;  3C64 A;  5ABG A;  1QSD A;  3SWH A;  2A56 A;  2MBG A;  2JIW A;  3FZM B;  5FXW A;  4EFK A;  4LF5 T;  2ACZ A;  2H7V C;  2W67 A;  2NP9 A;  3NZQ A;  5AQL B;  2DCF A;  3OPC A;  2DLR A;  4YY3 T;  2HH7 A;  2BG9 A;  3AA0 B;  4H63 H;  4ZI7 E;  2LM9 A;  4DND A;  3P4Q A;  3AE7 A;  3UFE A;  4TV8 E;  3AE3 A;  2D9D A;  4MUF A;  3FB2 A;  5TAO A;  3Q9D A;  2Q9Q D;  3ZST A;  3KDS E;  3ZSS A;  3PUY F;  4U7Y A;  4LF9 T;  4ADZ A;  1IJ5 A;  1N33 T;  5AQI B;  4B6X A;  4AIU A;  5C3J A;  2XQA A;  3SS1 A;  3FZL B;  1LKX A;  5AQO B;  2X66 A;  1SE7 A;  2FJA A;  2CRB A;  1KEY A;  1O3X A;  4I43 B;  4UEM A;  5L3G B;  1G8X A;  3UUN A;  3ZT5 A;  4U72 A;  4EIW A;  2N2N A;  2EJC A;  3PUZ F;  2NW7 A;  3CX8 B;  4DV7 T;  4MUI A;  5JDQ A;  4YLH A;  5FXX A;  4QH5 A;  2SPC A;  1Y01 A;  3AE4 A;  2JMH A;  2UXD T;  4AKI A;  1UGO A;  3ZLI A;  5HCJ A;  5LGU B;  4IIJ E;  3D0T A;  4MUL A;  4H9R C;  2DWK A;  3Q5D A;  4LF8 T;  2X9Y A;  3QK6 A;  4BJM A;  4TV9 E;  2DWG A;  5J1G A;  5G2F A;  3O9X A;  2V7M A;  2A53 A;  3PUR A;  3N9O A;  3N2G E;  3FXE B;  2B76 A;  1WCR A;  5HAX A;  5LHH B;  3RIF A;  3T1H T;  4MUK A;  5FVL A;  3RLF F;  4P09 A;  4BA9 A;  5FVK A;  2AE9 A;  2LSK A;  3GN5 B;  5JQG E;  3IVC A;  3F31 A;  2BBH A;  2PBI A;  3EDV A;  3PJA A;  2CLY C;  4CZZ B;  4HEA A;  3K8P C;  3PUG A;  3FZH B;  4IGU A;  2MYS A;  2PJQ A;  4KBM B;  1JNR A;  2WU2 A;  1W0A A;  1MIW A;  3EHZ A;  1XMQ T;  1HCI A;  4O4L E;  2HPL A;  4OFZ A;  5C8Y E;  1BR1 A;  4JI7 T;  2W4X A;  3UK2 A;  3WAK A;  4DBR A;  1MND A;  4J2C A;  2G2S A;  5ABE A;  4DV6 T;  4O4I E;  5AQM B;  3MKD A;  4UVC B;  4XBF B;  2K9A A;  4PK4 A;  5FL1 A;  3CML A;  1IBK T;  4QWN B;  4QXB B;  3JAE A;  5DQW A;  2PFV A;  4OYK A;  3GN5 A;  2Y8D A;  5FY0 A;  2X51 A;  3AG6 A;  3S4U A;  3AG5 A;  2H89 A;  3MA9 A;  3N2O A;  4ZXL A;  2FJE A;  3TLW A;  3LE8 A;  4X1I E;  3L09 A;  1J5E T;  3JAF A;  4NPP A;  4AQY T;  1NAF A;  1D0Y A;  3B5M A;  3RI5 A;  4LF4 T;  4QHO A;  2NTX A;  4DVD A;  5L2L A;  2ZMA A;  3EVY A;  4AQF A;  3VR9 A;  1VCT A;  3CFH L;  1BR0 A;  3RYF E;  3UTK A;  4WZX A;  3CX6 B;  3RIA A;  2IML A;  1KNR A;  2A7X A;  4HFV A;  5GON E;  5AQK B;  2IHR 1;  1D1C A;  5JR9 C;  2B1E A;  3ZCJ A;  4DR1 T;  4PJJ A;  4L5G A;  3CFA L;  2XAG B;  2L8K A;  1QLB A;  5CGM A;  1BR4 A;  2XQ8 A;  3IBP A;  2CBI A;  2CMR A;  4AKH A;  2XJ7 A;  2KND A;  2BS2 A;  5L3F B;  2C0S A;  4HWC A;  2E8I A;  3L39 A;  4U3C A;  3COV A;  3LJC A;  2X68 A;  2XSA A;  3A8Y C;  5LBQ B;  2KT9 A;  2GR8 A;  4DR5 T;  4V1A v;  4FZJ A;  4OK0 A;  3UFG A;  2LRL A;  3L3P A;  4DR2 T;  4G2A A;  1HTJ F;  4LF6 T;  3KFW X;  3ZN1 B;  4DR7 T;  3SFE A;  3AE6 A;  3IMC A;  4CXW A;  4FJO A;  3AE5 A;  2P9B A;  3ZT7 A;  5J2U E;  3INN A;  3UUL A;  3RQW A;  3ZMZ B;  2WZH A;  2V5C A;  3UU4 A;  2OGF A;  5HEO A;  5AQU B;  3C50 A;  2LME A;  5J0Z A;  3PTR B;  4WW0 A;  2WDQ A;  4ERR A;  1OED A;  5F3J A;  4UVA B;  3IUE A;  3IOE A;  4EYY R;  4NXM T;  4KI0 F;  3HKB E;  4Z8X A;  5J2T E;  1WYC A;  4JI6 T;  1IHO A;  5EK3 A;  4A56 A;  1E7P A;  2YIN A;  1W9R A;  5AQH B;  2I6H A;  4DR3 T;  4PNI A;  3C51 A;  1XDO A;  3M65 A;  3MK7 C;  2K24 A;  4MUJ A;  5AQS B;  4I50 E;  3FBL A;  2C5I T;  4MUG A;  1YD8 G;  4H9O C;  3PJA J;  2GW4 A;  3R6N A;  1HNX T;  3RC8 A;  2WWV A;  1T7S A;  3B57 A;  1D1A A;  1D0Z A;  4LMJ A;  4ZS3 A;  5JRC A;  5FNV E;  1N36 T;  3F57 A;  2RP4 A;  1XZY A;  3P7I A;  1KFY A;  2R6G F;  3ESL A;  3PUS A;  3KBU A;  1I6Z A;  2XAQ B;  4A97 A;  2UXN B;  4PJL A;  3T8O A;  4DV5 T;  1ZOY A;  2RET A;  3E0Z A;  5AQP B;  4DUY T;  3C4Z A;  3QUJ A;  3UU8 A;  4G5F A;  4ASK A;  3HR0 A;  2V6X A;  1CUN A;  1W0B A;  4HWH A;  5HYA A;  2CHO A;  3ZJ1 A;  3ZYK A;  4DE5 A;  3CIR A;  4Q25 A;  5AFU L;  5AQN B;  5LHI B;  5LB7 B;  2V8S V;  2OV9 A;  4CI3 B;  5KWV A;  1VOM A;  2XAH B;  2W66 A;  2D2S A;  4ZZB A;  4KHP T;  3MJX A;  2EHO A;  2Q9Q C;  5LA6 E;  3FZK B;  3PV0 F;  3PUW F;  2JQH A;  3NRY A;  4M1P A;  4JEH B;  4X1Y E;  4DV4 T;  5FKY A;  5KMG P;  2HN2 A;  4HWI B;  4AKG A;  4PK5 A;  4GIW A;  5L3B B;  2WDR A;  3AXJ B;  4HWD A;  1NWM X;  3P4R A;  3J9X 1;  2CLY B;  3NVO A;  2IC9 A;  3SFD A;  3IA3 A;  3F2E A;  4QH1 A;  3QOF A;  4U2Y A;  3LDQ B;  4EF6 A;  2PG8 A;  3AE1 A;  3Q5W A;  1J5W A;  3KV6 A;  3AA6 B;  5IYZ E;  4EZH A;  1LRZ A;  4CI2 B;  3VRB A;  4ZI2 D;  3DTO A;  5FL0 A;  5HWY A;  5JH7 E;  4CQI A;  3AEA A;  4O8S A;  2CE7 A;  3NWI A;  4GYS A;  5BMV E;  4EEB A;  4IXJ A;  2A3D A;  3TLT A;  4AIS A;  2V6Y B;  2M6B A;  2W00 A;  2MOZ A;  3QC9 A;  2VQF T;  3NZP A;  2LLY A;  3TLS A;  4QKN A;  3RX6 A;  3PE0 A;  2CWY A;  4TZ4 C;  2K48 A;  3AXJ A;  2BDE A;  3AED A;  2BS4 A;  1FMW A;  2YU1 A;  4DV0 T;  3QNU A;  3RYH E;  2XAF B;  1KK7 A;  5FY7 A;  2CCQ A;  1E1H B;  2KIN B;  3Q5X A;  5LJN A;  4WBN E;  1IBM T;  1WR0 A;  2Z6E A;  4HGA A;  2ZM8 A;  4MBQ A;  5AQV B;  3LG7 A;  3P4S A;  5JDL A;  1VCS A;  2C5J A;  3MAC A;  3ZN0 B;  1LVK A;  1HR0 T;  3Q2M A;  4H9Q C;  3E22 E;  3LFM A;  3O4X E;  2IC6 A;  4IRE A;  2E2A A;  2HPJ A;  4KUM B;  4YXD A;  4IDO A;  2YDR A;  1N34 T;  1YKE B;  4U7I A;  5LMN T;  3Q10 A;  4BJN A;  3KIN B;  2NW9 A;  1UUS A;  4JBW F;  3OTO T;  3LK2 B;  3IOD A;  4IE0 A;  3ONL C;  3HL6 A;  3ETV A;  4GK0 E;  4O2A E;  2X0L B;  1ZEE A;  4TX5 A;  4BAY B;  3JC6 D;  3N8H A;  4CN4 A;  5FMN A;  3AEB A;  4WYV A;  3U3I A;  2BG9 C;  1UX5 A;  1R8I A;  2DNX A;  3IVX A;  4MAL A;  2WSS V;  3ZJ2 A;  3KVA A;  4EOZ B;  3ZT6 A;  4COF A;  4PFO A;  3NKZ A;  2VKH A;  5LG3 A;  5LYJ E;  2V7I A;  3P4W A;  2EHO D;  2LT3 A;  4DMW A;  2DL1 A;  2NTY A;  3GMI A;  5HEU A;  3VKH A;  2A52 A;  5ABH A;  3C4X A;  5JVD E;  3CWZ B;  5LNK A;  3RIU A;  5CA1 E;  4X65 T;  2QA7 A;  3LBX B;  4N78 D;  4UF0 B;  3N9L A;  1EZ3 A;  1G73 A;  2KMF A;  4ISS A;  4KMC A;  5LJM A;  5KXJ A;  3L8R A;  3RYC E;  2W0G A;  4DMV A;  4HWF A;  3RC3 A;  2NW8 A;  4IST A;  2CXL A;  1HX8 A;  4X5T A;  5L3D B;  5LG4 A;  4NUU A;  3Q5E A;  3X1D A;  2J47 A;  2ZM2 A;  4H9S E;  4HE8 A;  1XMO T;  2LHN A;  3A7M A;  4LFB T;  2X0Y A;  4QH4 A;  4GKJ T;  5F8P A;  2CA5 A;  1WFD A;  3RGL A;  5L3E B;  2LKG A;  4ZI3 D;  4IL4 A;  2VUR A;  4TUY E;  3K3N A;  1X79 A;  1YXR A;  4X20 E;  3Q12 A;  5E0O A;  4JI4 T;  3N5L A;  3O1H A;  4AKR B;  2VWA A;  2CPT A;  5JDF A;  3IVG A;  4UF0 A;  4MLK A;  2ODV A;  1D1B A;  2D0T A;  2FBW A;  2LSG A;  3MXT A;  5IUX A;  3CPZ A;  2LM2 A;  5JDG A;  1OXZ A;  2BKP A;  2JMK A;  1M7K A;  1MNE A;  4NUV A;  2BG9 E;  4YTM A;  3COW A;  2PTF A;  3RRC A;  1YW0 A;  2W63 A;  1WLX A;  3OYZ A;  3UQ4 A;  4U31 A;  2WZI A;  3GA8 A;  3KV9 A;  2RA1 A;  5HCM A;  4ZOL E;  1Z8U A;  2BKN A;  3RIU C;  4UXN B;  3WI3 A;  4JYA T;  4KX6 A;  2ZLY A;  2V7K A;  2XZE A;  2K5B B;  3I1A A;  2HHH T;  2WP9 A;  1T8B A;  4OX9 T;  2G0U A;  2ACX A;  2LEH A;  2J1D G;  4CN1 A;  4YT0 A;  5CB4 E;  4F6R C;  3P4P A;  3PUQ A;  1VRB A;  4WBO A;  2YN6 A;  3PDY A;  4ZS2 A;  5HWX A;  3IOB A;  3VRA A;  2IW5 B;  4YSZ A;  2XY8 B;  4PK6 A;  4IDN A;  4GOU A;  3HKD E;  3VHL A;  4A98 A;  4QXC B;  3H3A A;  4UIG A;  4F8H A;  4EV6 A;  5KDM C;  4GK5 E;  2Q9Q B;  3QB5 A;  2UXC T;  1HNW T;  3PUV F;  3COZ A;  1BR2 A;  2WMO A;  2NOX A;  1MIV A;  4XZC A;  3N9Q A;  3TLU A;  2E9X B;  3CFI A;  3ZKR A;  2WQY A;  2G16 A;  4AQF C;  1SHZ C;  4CI1 B;  2F4V T;  5LP6 E;  5L4H A;  4EYU A;  4L0R A;  2NWB A;  1HS7 A;  3RRW A;  3COY A;  3R84 B;  5FXZ A;  4QXH B;  3T1Y T;  4P1N A;  3BQI A;  2WM9 A;  3MZK B;  3V5S A;  2UUC T;  4JV5 T;  3PU3 A;  1LVF A;  2XQ3 A;  3JCF A;  3ZPO A;  3CVR A;  2LOS A;  3JAD A;  2A2F X;  2I0M A;  1M62 A;  3AEC A;  2VB6 A;  4UVB B;  3QB5 K;  4O4J E;  3PUA A;  2ZM6 T;  2YOE A;  2E9X A;  1N2E A;  1NEN A;  4O2B E;  4JI0 T;  4CXY A;  4JI5 T;  4XAX B;  2FJB A;  3LF4 A;  5H6R B;  2E5L T;  2X0H A;  3CX7 B;  2D5U A;  3OKQ A;  2GK9 A;  1GQE A;  2WWU A;  2WBL A;  4EGW A;  4ZEY A;  3M3Z B;  2VL0 A;  4JUY A;  2VKD A;  2CHN A;  5JDH A;  4K0U A;  3AVR A;  4IDZ A;  5DQV A;  3AAE B;  4MUE A;  3AEE A;  3IOC A;  4X64 T;  4HN9 A;  4LFA T;  4YHJ A;  2XUE A;  3O1J A;  2JQ9 A;  2C5K T;  4TNV A;  2NR4 A;  3UU6 A;  3UA0 A;  4TWD A;  5FP3 A;  4OYJ A;  5FY1 A;  2KXP B;  2XHE B;  1D0X A;  3CK6 A;  3OVU A;  3AEG A;  5BR8 T;  4EED A;  5L4E A;  2A50 A;  3EUH A;  2KWI B;  2M67 A;  5ABF B;  3CQG B;  3I9Y A;  3UUM A;  1AJ3 A;  4YSY A;  3GWH A;  4BHR A;  1S94 A;  4AI6 A;  1OED C;  2LRK A;  4IE6 A;  4ZI2 C;  1XNR T;  1MOP A;  1HFA A;  4ANJ A;  2A9U A;  2IEC A;  4UR9 A;  4MHC A;  1T98 A;  5LMU T;  1FMV A;  1JNZ A;  3AA7 B;  1MMG A;  4IE7 A;  4YFS A;  3RKO A;  5EXC A;  5AQT B;  2X9W A;  3SOL A;  3W15 B;  3K3Q C;  4JI3 T;  4X62 T;  3RHW A;  4LMK A;  2XSB A;  2KLQ A;  2LJL A;  2LKH A;  3B13 A;  5AQQ B;  2CM0 A;  2X9X A;  3ANW B;  2WMN A;  3FXD B;  4UV9 B;  2WS3 A;  2AXD S;  1L0V A;  4IDQ A;  4TN7 B;  4YSX A;  5LGT B;  4ZZC A;  3DP7 A;  5JTG A;  3DJB A;  4IHJ E;  2V1D B;  2MPK A;  3ZYM A;  4ILU A;  4AXP A;  3UUB A;  3QTT A;  3UQ7 A;  4KP3 C;  1NEK A;  2QVA A;  3VR8 A;  3LK3 B;  3HKC E;  2V7J A;  3MXZ A;  1CHU A;  4DR4 T;  3ZCI A;  4PJM A;  5ETW A;  2J62 A;  5CJ5 A;  5L47 A;  3BK9 A;  4DV3 T;  3IHR A;  2W61 A;  1FIO A;  1HX1 B;  5AQR B;  2FJD A;  4O4H E;  3JC6 C;  4NXN T;  3ANW A;  3N9N A;  4MFR A;  2BVL A;  3HA4 A;  2E9X D;  3G06 A;  2VKO A;  3H37 A;  1Z0P A;  1XDP A;  2GR7 A;  1OED E;  2XTL A;  4AQG A;  2EHO C;  2L9Q A;  4OHF A;  5IWA T;  4EXT A;  4JEU B;  3RPU A;  4DR6 T;  3J7Y q;  3P50 A;  3H3M A;  2VL8 A;  2CXF A;  4LFC T;  3C4W A;  4HFI A;  2XPK A;  2VVN A;  2V6Y A;  4G63 A;  2Y48 B;  4TNW A;  4DV2 T;  3LK4 2;  1MMN A;  3AAI A;  4DID B;  2UXX B;  2G3D A;  5FYM A;  3ZMT B;  2DI4 A;  1ZKE A;  5LGN B;  3ZMU B;  1OWA A;  5LXT E;  5KX5 E;  1MMD A;  2YKS A;  4DO0 A;  1MIY A;  2VKJ A;  3RQU A;  1WRD A;  1MMA A;  3E08 A;  5JR9 B;  3IME A;  4P0B A;  3RF1 A;  4YTP A;  1H7C A;  2YK0 A;  1UCU A;  3N9M A;  5A1L A;  1YQ3 A;  5FXV A;  5HG0 A;  1SA0 E;  4ILC A;  4YJ2 E;  2X3F A;  4H9P C;  3CI0 K;  3EI0 A;  2CEA A;  1U5P A;  4PFP A;  1UUR A;  3CQX C;  4ZI3 C;  1S35 A;  3OJA A;  2XQY A;  1I94 T;  1KNZ A;  4Z91 A;  2LHR A;  2CXD A;  4JI8 T;  3NBX X;  1J1J A;  2H88 A;  2W2U A;  3AE2 A;  2WCA A;  3CKD A;  3CI0 I;  5BW0 B;  1N2O A;  2LOP A;  2XQ7 A;  4ZHQ E;  2BS3 A;  2ZM0 A;  2YU2 A;  3TLV A;  2QRX A;  2YDQ A;  4EB6 E;  4G5Y A;  5JR9 A;  4U33 A;  5H6Q B;  1WR6 A;  4A5X A;  2V7L A;  2VVS A;  1IBL T;  3PU8 A;  3VKG A;  3OBV E;  4DV1 T;  1B7T A;  1DU2 A;  4ILA A;  3VU7 H;  4P0A A;  4JLE A;  3ONJ A;  3HKE E;  3PUX F;  2N9D A;  4TWF A;  1YQ4 A;  4B3M T;  1SUM B;  2H3R A;  3ONX A;  2IDO B;  3SRZ A;  4PAG A;  4E7S A;  3EAM A;  5ADX L;  5LOV E;  2KSR A;  5EK4 A;  2XAJ B;  4LF7 T;  2A54 A;  2KWH A;  3LBX A;  5EK2 A;  5LBM A;  5HXC A;  2VQE T;  1IZN B;  3UY4 A;  4HFD A;  3IMG A;  2KZ7 B;  3AAA B;  5DAB A;  5JRE A;  2WAU A;  3ZMS B;  5DJQ C;  2XQ5 A;  4YTN A;  3BQK A;  4K0K T;  1FJG T;  4IL9 A;  2LSJ A;  1N2B A;  4PW8 A;  2IUB A;  4QX8 B;  3OYX A;  1HF8 A;  2WY2 A;  4DBQ A;  3I0O A;  5HEH A;  4UV8 B;  4X66 T;  3C98 B;  3MUE A;  3LSV A;  4CN6 A;  4LML A;  5EZY E;  1HNZ T;  1U4Q A;  5LHG B;  4HFE A;  4I4T E;  2YEV C;  4B3T T;  4C91 A;  3P8C D;  1KF6 A;  3AVS A;  2FUP A;  3RH3 A;  2IIU A;  2VAS A;  5HXE A;  4DDM A;  4IE5 A;  2XQ4 A;  1HG2 A;  2A72 A;  4B3S T;  1ZP0 A;  3ZEF B;  3ISJ A;  1X9B A;  1N2G A;  1HG5 A;  1UX4 A;  2K3W A;  4DDK A;  2J4G A;  3TKL B;  2L3L A;  2JQQ A;  2Y6X A;  1V9D A;  2XM1 A;  3WAJ A;  1N32 T;  1E2A A;  1US7 B;  1OED B;  5M4Y A;  2OLT A;  3I9W A;  4GYR A;  4TWH A;  4X1K E;  4MUH A;  3AE8 A;  4HFB A;  3KBT A;  4Z90 A;  2M6I A;  2DHR A;  3ZC1 A;  2XM2 A;  2JJ9 A;  5LCY A;  2W62 A;  2QGS A;  2BZB A;  1ZV4 X;  4HTE A;  3N2K E;  3EAB A;  1IAP A;  3UU5 A;  1N2I A;  1WYB A;  4MQ6 A;  3KV4 A;  2WB5 A;  5HXH A;  5AQF B;  2I59 A;  2X9H A;  5HEJ A;  5JDN A;  1UFV A;  1N2H A;  3AB3 B;  4H9N C;  5CFB A;  2ES0 A;  3ETU A;  2WU5 A;  3I0Q A;  2V5D A;  3O1I A;  5HXS A;  3U78 A;  3ZMV B;  5JRC B;  4MUN A;  4U2Z A;  2A88 A;  2VK9 A;  2BVM A;  3IUB A;  4EAH A;  1UK5 A;  2G5Z A;  4FI5 A;  4HFH A;  1ZHC A;  2Q9Q A;  2BBJ A;  2XQ9 A;  4HKA A;  3FBZ A;  1IJ6 A;  2MAW A;  3FHN A;  3NRX A;  2JQK A;  3AEF A;  4C90 A;  5C2T A;  2BKO A;  3EDU A;  2UXB T;  3K3O A;  3RKG A;  4KHZ F;  3IEE A;  1W09 A;  1Y64 B;  2V26 A;  3UT5 E;  2CWO A;  1V8F A; 
#chains in the Genus database with same CATH homology
 4ILU A;  2B1E A;  3GMI A;  3ZCJ A;  4AXP A;  3VKH A;  2A52 A;  3QTT A;  4L9I A;  3C4X A;  5JVD E;  2A84 A;  4KP3 C;  3CWZ B;  2MTQ A;  5LNK A;  4PJJ A;  3LK3 B;  3HKC E;  4L5G A;  2V7J A;  3MXZ A;  3CFA L;  3ZCI A;  5CA1 E;  2XAG B;  2L8K A;  1BR4 A;  3IBP A;  4PJM A;  5ETW A;  2QA7 A;  2CMR A;  3LBX B;  4U74 A;  4AKH A;  4N78 D;  4UF0 B;  3N9L A;  1EZ3 A;  2KND A;  1G73 A;  3AA1 B;  3RYI E;  3KVB A;  2KMF A;  5L3F B;  3ZC0 A;  3BK9 A;  4ISS A;  2C0S A;  3IHR A;  4KMC A;  5IHY A;  5LJM A;  2E8I A;  4AKL A;  2W61 A;  3RYC E;  2W0G A;  1FIO A;  2EHO B;  4DMV A;  3HI2 A;  4DDH A;  3COV A;  3LJC A;  4O4H E;  3RC3 A;  2NW8 A;  3JC6 C;  2X68 A;  3ANW A;  3N9N A;  2OA5 A;  4I55 E;  4MFR A;  3V5U A;  4IST A;  3KV5 A;  2CXL A;  2BVL A;  5CA0 E;  3HA4 A;  3CFF L;  1HX8 A;  5LBQ B;  2IAK A;  4IE4 A;  5L3D B;  5LG4 A;  2KT9 A;  4NUU A;  2E9X D;  3CQC B;  2ZM2 A;  4H9S E;  4HE8 A;  2VKO A;  4V1A v;  2X67 A;  3H37 A;  2LHN A;  4FZJ A;  4OK0 A;  3A5X A;  2LE8 A;  5F8P A;  1Z0P A;  1FEW A;  2ODU A;  3L3P A;  2CA5 A;  2XTL A;  4AQG A;  4G2A A;  2XAS B;  2EHO C;  2L9Q A;  5L3E B;  1HTJ F;  4ZI3 D;  4OHF A;  3KFW X;  4JEU B;  3RPU A;  4EXT A;  3ZN1 B;  2LSI A;  3J7Y q;  2A86 A;  4YJ3 E;  2D0U A;  4TUY E;  3K3N A;  3IMC A;  4CXW A;  1X79 A;  2VL8 A;  4X20 E;  4FJO A;  5E0O A;  3Q12 A;  2CXF A;  2N1G A;  2P9B A;  2H7O A;  4UEL A;  4E7Z A;  3C4W A;  3N5L A;  5J2U E;  3O1H A;  4AKR B;  4H63 V;  3INN A;  4PJN A;  2VWA A;  4G63 A;  2Y48 B;  3UUL A;  5JDF A;  3IVG A;  3LK4 2;  4UF0 A;  3ZMZ B;  1MMN A;  4MLK A;  3AAI A;  2ODV A;  1D1B A;  2UXX B;  2D0T A;  2G3D A;  5FYM A;  3ZYL A;  4EZ4 A;  3ZMT B;  2DI4 A;  3C50 A;  5HXR A;  3UUX B;  3BQL A;  1ZKE A;  4WNK A;  5LGN B;  3ZMU B;  1OWA A;  5LXT E;  5KX5 E;  1MMD A;  4DO0 A;  3N9P A;  2JPF A;  3PTR B;  4WW0 A;  4ERR A;  2LSG A;  5F3J A;  3MXT A;  3CPZ A;  1MIY A;  2VKJ A;  3IF8 B;  1OXZ A;  5JDG A;  5L3C B;  1WRD A;  1MMA A;  4UVA B;  3IUE A;  3E08 A;  2JMK A;  3IOE A;  4EYY R;  1MNE A;  4NUV A;  5JR9 B;  3HKB E;  4Z8X A;  3IME A;  5J2T E;  4P0B A;  5JDM A;  3COW A;  1WYC A;  1IHO A;  3RRC A;  1H7C A;  2YK0 A;  2E9X C;  4QX7 B;  5EK3 A;  1UCU A;  1YW0 A;  4A56 A;  3N9M A;  2LSY A;  5A1L A;  2YIN A;  1YKH B;  5FXV A;  5HG0 A;  1SA0 E;  2W63 A;  2JRK A;  4CXX A;  4YJ2 E;  1N2J A;  3C64 A;  1QUU A;  4PNI A;  2X3F A;  1QSD A;  3C51 A;  4H9P C;  3SWH A;  2A56 A;  2CEA A;  1U5P A;  1WLX A;  3OYZ A;  2MBG A;  5FXW A;  4PFP A;  3CQX C;  3GA8 A;  3M65 A;  4ZI3 C;  3KV9 A;  1S35 A;  4EFK A;  2RA1 A;  3MK7 C;  4ZOL E;  2K24 A;  4MUJ A;  3OJA A;  4I50 E;  3FBL A;  2H7V C;  4UXN B;  3WI3 A;  2C5I T;  4MUG A;  2XQY A;  2NP9 A;  3NZQ A;  1YD8 G;  2DCF A;  2ZLY A;  1KNZ A;  2DLR A;  2LHR A;  4H9O C;  2HH7 A;  2CXD A;  2GW4 A;  3AA0 B;  3NBX X;  4H63 H;  2V7K A;  3R6N A;  4ZI7 E;  3RC8 A;  2LM9 A;  2K5B B;  4DND A;  3I1A A;  3B57 A;  1D1A A;  3UFE A;  1D0Z A;  3CKD A;  4TV8 E;  2G0U A;  2ACX A;  4ZS3 A;  2LEH A;  5JRC A;  5FNV E;  2LOP A;  1N2O A;  2J1D G;  4MUF A;  3FB2 A;  5TAO A;  3F57 A;  2Q9Q D;  3Q9D A;  2RP4 A;  4ZHQ E;  3KDS E;  2ZM0 A;  3P7I A;  4F6R C;  5CB4 E;  2YU2 A;  4G5Y A;  4EB6 E;  5JR9 A;  4ADZ A;  5H6Q B;  1IJ5 A;  1WR6 A;  3PUQ A;  3ESL A;  1VRB A;  4WBO A;  2V7L A;  3PDY A;  3KBU A;  3PUS A;  4ZS2 A;  5HWX A;  3PU8 A;  3IOB A;  2XAQ B;  2UXN B;  2IW5 B;  3VKG A;  3OBV E;  4PK6 A;  4PJL A;  4B6X A;  1B7T A;  3T8O A;  4GOU A;  3E0Z A;  3HKD E;  3C4Z A;  3QUJ A;  3VHL A;  3VU7 H;  3SS1 A;  4P0A A;  4JLE A;  3HKE E;  4G5F A;  1LKX A;  4QXC B;  4ASK A;  2N9D A;  3H3A A;  3HR0 A;  4UIG A;  2X66 A;  1CUN A;  5KDM C;  2H3R A;  3ONX A;  4GK5 E;  2Q9Q B;  5HYA A;  3SRZ A;  4PAG A;  1O3X A;  4E7S A;  4I43 B;  3ZJ1 A;  1BR2 A;  3ZYK A;  3COZ A;  4UEM A;  4DE5 A;  5L3G B;  2WMO A;  5AFU L;  5ADX L;  2NOX A;  5LOV E;  1G8X A;  1MIV A;  4XZC A;  5EK4 A;  5LHI B;  3UUN A;  2XAJ B;  4U72 A;  4EIW A;  2A54 A;  2N2N A;  3N9Q A;  2EJC A;  2KWH A;  2NW7 A;  2E9X B;  3LBX A;  3CX8 B;  4CI3 B;  5EK2 A;  5KWV A;  5LBM A;  5HXC A;  1VOM A;  2XAH B;  2G16 A;  4MUI A;  2D2S A;  5JDQ A;  1IZN B;  4YLH A;  4AQF C;  3UY4 A;  5FXX A;  1SHZ C;  3IMG A;  2KZ7 B;  4CI1 B;  3AAA B;  5DAB A;  5JRE A;  2SPC A;  2WAU A;  3MJX A;  2JMH A;  3ZMS B;  5LP6 E;  4EYU A;  5DJQ C;  2EHO A;  2NWB A;  2Q9Q C;  4L0R A;  1HS7 A;  5LA6 E;  4AKI A;  3ZLI A;  3BQK A;  3NRY A;  3RRW A;  2LSJ A;  3COY A;  3R84 B;  4M1P A;  5FXZ A;  4JEH B;  4PW8 A;  5LGU B;  4X1Y E;  1N2B A;  4QX8 B;  4IIJ E;  3OYX A;  5KMG P;  3D0T A;  4MUL A;  1HF8 A;  4QXH B;  4DBQ A;  4AKG A;  4H9R C;  3BQI A;  2DWK A;  2WM9 A;  3I0O A;  3MZK B;  2X9Y A;  3V5S A;  3QK6 A;  4PK5 A;  4BJM A;  4GIW A;  3PU3 A;  4UV8 B;  4TV9 E;  3C98 B;  5L3B B;  1LVF A;  3MUE A;  3ZPO A;  2DWG A;  1NWM X;  3CVR A;  5J1G A;  2LOS A;  5G2F A;  3J9X 1;  2CLY B;  3O9X A;  5EZY E;  2V7M A;  2A53 A;  2IC9 A;  3PUR A;  1U4Q A;  2A2F X;  5LHG B;  3N9O A;  3F2E A;  4I4T E;  3N2G E;  2YEV C;  3FXE B;  2VB6 A;  5HAX A;  4UVB B;  5LHH B;  4C91 A;  3P8C D;  4EF6 A;  4MUK A;  4O4J E;  2PG8 A;  3PUA A;  3AVS A;  4P09 A;  4BA9 A;  2E9X A;  3Q5W A;  3RH3 A;  5HXE A;  2VAS A;  3KV6 A;  1N2E A;  4DDM A;  3AA6 B;  2LSK A;  4O2B E;  5IYZ E;  4EZH A;  3GN5 B;  5JQG E;  3IVC A;  1LRZ A;  3F31 A;  4CXY A;  4XAX B;  4CI2 B;  2PBI A;  3EDV A;  3LF4 A;  5H6R B;  4ZI2 D;  2CLY C;  4IE5 A;  3DTO A;  4CZZ B;  5HWY A;  5JH7 E;  4HEA A;  3K8P C;  4CQI A;  3CX7 B;  4O8S A;  2D5U A;  3OKQ A;  3PUG A;  2GK9 A;  2WWU A;  2CE7 A;  1HG2 A;  2A72 A;  4IGU A;  4GYS A;  3ZEF B;  5BMV E;  2MYS A;  3ISJ A;  1N2G A;  2WBL A;  1HG5 A;  1UX4 A;  4IXJ A;  2PJQ A;  4JUY A;  4KBM B;  4DDK A;  2VKD A;  2A3D A;  5JDH A;  4K0U A;  1MIW A;  3AVR A;  1HCI A;  2W00 A;  2MOZ A;  3QC9 A;  4IDZ A;  3AAE B;  4O4L E;  2HPL A;  5DQV A;  3TKL B;  4MUE A;  3IOC A;  3NZP A;  4OFZ A;  2JQQ A;  2L3L A;  5C8Y E;  4HN9 A;  1BR1 A;  4QKN A;  2Y6X A;  1V9D A;  3RX6 A;  3PE0 A;  3UK2 A;  4YHJ A;  3WAK A;  2CWY A;  2XUE A;  3O1J A;  4TZ4 C;  3WAJ A;  2K48 A;  2BDE A;  1MND A;  1US7 B;  2C5K T;  4DBR A;  1FMW A;  5M4Y A;  4J2C A;  3UA0 A;  2G2S A;  2YU1 A;  3I9W A;  4GYR A;  3RYH E;  5FP3 A;  4OYJ A;  4X1K E;  5FY1 A;  2XAF B;  4O4I E;  4MUH A;  1KK7 A;  2KXP B;  5FY7 A;  2XHE B;  2CCQ A;  1E1H B;  1D0X A;  3MKD A;  3KBT A;  2KIN B;  4UVC B;  3Q5X A;  4WBN E;  5LJN A;  3EUH A;  2DHR A;  2KWI B;  2A50 A;  2M67 A;  2Z6E A;  2K9A A;  4PK4 A;  3ZC1 A;  4XBF B;  3CQG B;  4HGA A;  2JJ9 A;  3I9Y A;  5LCY A;  3UUM A;  2W62 A;  2ZM8 A;  2QGS A;  1AJ3 A;  2BZB A;  3CML A;  1ZV4 X;  4MBQ A;  4HTE A;  4QWN B;  3N2K E;  3LG7 A;  4QXB B;  3GWH A;  1IAP A;  5DQW A;  2PFV A;  4OYK A;  5JDL A;  1N2I A;  3MAC A;  2C5J A;  3ZN0 B;  1LVK A;  3Q2M A;  3GN5 A;  4H9Q C;  2Y8D A;  4BHR A;  3E22 E;  1S94 A;  1WYB A;  3LFM A;  4MQ6 A;  3O4X E;  4AI6 A;  2IC6 A;  3KV4 A;  5FY0 A;  4IE6 A;  4ZI2 C;  1MOP A;  2X51 A;  1HFA A;  3S4U A;  3AG6 A;  2HPJ A;  3AG5 A;  4KUM B;  4ANJ A;  5HXH A;  3MA9 A;  2I59 A;  2X9H A;  3N2O A;  4MHC A;  3LE8 A;  5JDN A;  1YKE B;  1UFV A;  1T98 A;  1N2H A;  3AB3 B;  4H9N C;  4X1I E;  3L09 A;  3Q10 A;  4BJN A;  3KIN B;  2ES0 A;  2NW9 A;  1FMV A;  3AA7 B;  3ETU A;  1MMG A;  1NAF A;  3IOD A;  3LK2 B;  4IE7 A;  1D0Y A;  4YFS A;  4IE0 A;  3RKO A;  5EXC A;  3HL6 A;  3I0Q A;  3ETV A;  3O1I A;  5HXS A;  3U78 A;  2X9W A;  3ZMV B;  3SOL A;  3W15 B;  3K3Q C;  5JRC B;  4QHO A;  4GK0 E;  4O2A E;  2X0L B;  2NTX A;  4DVD A;  4MUN A;  2A88 A;  1ZEE A;  5L2L A;  2VK9 A;  2BVM A;  4TX5 A;  2KLQ A;  2ZMA A;  3EVY A;  4AQF A;  4BAY B;  4EAH A;  2LJL A;  3IUB A;  3JC6 D;  2G5Z A;  3B13 A;  3N8H A;  2CM0 A;  2X9X A;  4FI5 A;  3ANW B;  1ZHC A;  2Q9Q A;  2WMN A;  3FXD B;  4UV9 B;  5FMN A;  3U3I A;  4HKA A;  3FBZ A;  3CFH L;  1BR0 A;  1IJ6 A;  1UX5 A;  3RYF E;  3UTK A;  3FHN A;  3NRX A;  4TN7 B;  2DNX A;  4C90 A;  3IVX A;  4MAL A;  5LGT B;  2WSS V;  3ZJ2 A;  3DP7 A;  3KVA A;  3EDU A;  4EOZ B;  3CX6 B;  3K3O A;  4PFO A;  2VKH A;  3DJB A;  3IEE A;  5LYJ E;  2V7I A;  4IHJ E;  2EHO D;  2LT3 A;  2A7X A;  4HFV A;  5GON E;  4DMW A;  1Y64 B;  2V26 A;  2V1D B;  2NTY A;  1D1C A;  3UT5 E;  5JR9 C;  2CWO A;  1V8F A;  3ZYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...