3HL6A

Staphylococcus aureus pathogenicity island 3 orf9 protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
213
structure length
189
Chain Sequence
DIETIVNEFETRAGTLLRYYTGLLERSKVQPCCFKLYNDPFDMVYVMMNSKLFSHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKQLSISDMMASQLFEDEYFMYGLQTYQSSNTDVIANIEMLYQLATGINEPVPELVEGLKLVTEFVQDENATQEDYKALERKLNDLKASYYSLSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of a pathogenicity island protein from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Unknown function
molecule keywords Pathogenicity island protein
total genus 58
structure length 189
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16560 SAPI Putative mobile pathogenicity island
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.700 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3hl6A02
3.30.1300.50 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3hl6A01
3HL6A
chains in the Genus database with same CATH superfamily
4HE8A 4MUEA 4WZXA 4AKRB 4QX7B 1HG5A 2P9BA 3AA6B 3G06A 4ZXLA 3K3OA 4TNVA 3LF4A 4QX8B 2A56A 4J2CA 2J4GA 3CI0I 4JLEA 1N2HA 5AFUL 5FXXA 5LCYA 5LNKA 4DNDA 3KV6A 2W00A 3AAIA 2CCQA 3Q5EA 3F31A 2LEHA 3O1HA 4MQ6A 5L3FB 3M3ZB 2CXDA 2IMLA 2WCAA 4U31A 2H88A 4UVCB 4EEBA 4UR9A 3LJCA 2CBJA 3R6NA 5LHIB 2NTXA 4UF0A 1I6ZA 4F6RC 3K3NA 3N9QA 3Q5DA 3RHWA 5JDQA 5FKYA 1Z8UA 2VASA 4TUYE 5FY7A 2W61A 4YHHT 2CRBA 2XQYA 2WMNA 4CXXA 2A9UA 2W66A 3ZN1B 2BS4A 3KINB 4H9SE 2V7MA 2RPAA 1LKXA 4OX9T 1BR1A 2H89A 1HTJF 3AAEB 3ZPOA 5DABA 4CN4A 2CBIA 4HWFA 3KFWX 3D0TA 2M6BA 1W0BA 3I1AA 4YJ3E 4YLHA 3AE6A 3VKGA 4AQYT 2IC9A 1N32T 4CN1A 3QTTA 2GR8A 1N2IA 5BR8T 3TLTA 3MZKB 4IREA 4ILUA 2OLTA 2XJ7A 2BVLA 2QRXA 4PK4A 1WCRA 2J62A 4HN9A 3C4WA 2K5BB 2W2UA 4JI5T 5E0OA 4XAXB 3RRCA 4LFAT 5AQGB 3I0QA 2IHR1 4Z8XA 1HG2A 5L3BB 2L3LA 5LHHB 4MUJA 5HEJA 2H7VC 3W15B 2ES0A 2XSAA 2DWGA 3ZMZB 5J1GA 2ODVA 4EF6A 3RLFF 3PJAJ 4U33A 2LJLA 1KF6A 4PW8A 2ODUA 3FXEB 2ZM6T 4JI3T 3KBUA 5HXEA 5AQMB 4BA9A 2CA5A 4ILBA 2W4XA 4DV6T 1WLXA 1VOMA 2DHRA 3PUQA 1B7TA 2Q9QC 3FZKB 3ZMUB 4XBFB 4DDMA 4QXBB 3AE4A 4JV5T 3CK6A 3CFHL 4HFCA 3N9LA 2KSRA 2CPTA 3DP7A 5L3GB 5FP3A 4EAHA 4TN7B 2QA7A 3PUXF 2A50A 2C0SA 5L3DB 2VKHA 2UXDT 5J2TE 4X64T 4HFIA 1HX1B 4U2YA 2Y48B 2B1EA 1YKHB 1SHZC 4ILCA 4WYVA 3VR8A 5IYZE 1Z0PA 3LSVA 3P8CD 1D1BA 3J9X1 5LA6E 2W0GA 3C4ZA 4TV8E 3PV0F 2Y6XA 2X9WA 3AE2A 2V7LA 5A1LA 2FBWA 4F8HA 2ZM8A 2YU1A 4HWCA 5FYMA 4JYAT 3GWHA 1N2OA 3L39A 5EZYE 4UV8B 2HN1A 1UX4A 2D2SA 2CHNA 2EJCA 4CXWA 2WZHA 5EK3A 1IBMT 2Q9QB 5CGMA 2WU2A 2YINA 3ZJ2A 2VKDA 2PFVA 4IE5A 2RETA 3AE5A 4DR3T 4DUYT 2FJDA 3RKGA 2HPJA 5JRCA 2X9XA 2H3RA 3N9MA 1OXZA 3IODA 4YTPA 2MOZA 3AVSA 3H3AA 4K0UA 3ZCJA 4K0KT 1QSDA 4H9OC 1IJ6A 1FMWA 3PUGA 4UELA 1U4QA 1HS7A 3DTOA 2DNXA 2QVAA 3AXJA 5JDFA 2IC6A 4AQGA 4AISA 3P4SA 4GKKT 5C3JA 2BG9C 4PFPA 1NEKA 2BDEA 4UXNB 4IDPA 3COWA 4DBRA 1OWAA 2UXXB 1D0XA 4JI1T 3A7MA 2CWOA 4PK6A 3FBZA 5CB4E 2X3FA 4FZJA 4EIWA 4Z91A 1T7SA 3UUMA 4AXPA 4C90A 2C5IT 4ISTA 3EVYA 3B13A 4UVBB 5GONE 2JJ9A 4IGUA 2IDOB 3N8HA 2F4VT 2FUPA 2JRKA 2LRLA 2XAFB 5HCMA 4LF4T 3AE9A 3N9PA 3AEEA 2J47A 3RYFE 4IL9A 3QNUA 4JUYA 4AKGA 3MXTA 4G5FA 1MIVA 4H63V 2LSYA 5AQNB 1UX5A 3QUJA 4X20E 4X66T 3HKDE 5JDHA 1YQ3A 2X9YA 5C2TA 4O4IE 4E7ZA 2JQKA 4U72A 5AQIB 1N34T 5AQPB 4LF7T 5L4EA 3SFDA 3T1HT 2FJAA 4MALA 1W9RA 2VB6A 2LOSA 4AKLA 3UU8A 3FZMB 3GN5B 1N36T 2LSIA 3KVBA 1MMDA 2WS3A 2YDQA 3TLSA 3GN5A 2IECA 1OEDC 4JEUB 2ZMAA 2XQ8A 2G2SA 3OKQA 3UFGA 3ONLC 4QKNA 4MUNA 2NW7A 3EI0A 2K24A 4PNIA 3VRBA 4YXDA 1N2BA 4PJMA 1WRDA 1MNDA 4NIQA 2NTYA 4ASKA 1ZHCA 4LF9T 3RIFA 4ZI3D 4X62T 5AQQB 4AKHA 4DV2T 5FY0A 4BJMA 5LG4A 5LYJE 4QXHB 4EGWA 3CFFL 3NRXA 3AE1A 1LVKA 4DO0A 3Q9DA 2W63A 1S94A 2KLQA 2K9AA 3AB3B 5AQLB 2BG9B 3IVXA 3P7IA 3I9YA 1D0YA 2W67A 4EV6A 1G8XA 4JEHB 2KT9A 3AEBA 2OA5A 1UFVA 3IHRA 3AG6A 4AKIA 4IT4A 2OV9A 1BR0A 2VK9A 3EDUA 2A54A 2XQ3A 5ABEA 3IOCA 1N33T 2DCFA 3HI2A 3N5LA 3O1JA 3B57A 2WZIA 4YTMA 1U5PA 1XZYA 5LOVE 3N2GE 5LJNA 5CJ5A 2WMOA 2D9DA 1HNZT 1UURA 3S4UA 4CI1B 3P4PA 3O1IA 2LOPA 3PUZF 3Q5XA 2DLRA 4DR1T 4ZS2A 1J1JA 4B3TT 4ZEYA 3UUNA 3TLUA 3AEFA 4UVAB 4GKJT 4YY3T 2YDSA 1Y01A 3HKEE 2I6HA 4WBOA 3AECA 4KX6A 4DDHA 1MIYA 2WDRA 3IOBA 2XSBA 2BBHA 4H9NC 4IIJE 4NUVA 4O4LE 5FL1A 2HN2A 4ADZA 5CFBA 4E7SA 3KV9A 2MPKA 2XM2A 1IBLT 3R84B 2E9XC 4OYKA 3OYZA 3CKDA 4YSXA 3FB2A 4MUHA 2NP9A 2VL8A 4ILAA 5LHGB 5IHYA 3CX8B 1XWMA 1HFAA 4B3RT 2X0YA 1J5ET 2XY8B 3KV4A 5JTGA 2XQ6A 3NZQA 5EK2A 4LFBT 4HEAA 1MNEA 4ZI3C 3B5MA 2XPKA 4ZZBA 2IAKA 3RF1A 3ZT5A 5JH7E 4CI3B 3X1DA 2CM0A 3JADA 3MUEA 4TZ4C 2CXFA 3ZC1A 3O4XE 3MACA 1XDPA 3IVGA 4KHZF 2D0UA 3RGLA 2WY2A 3RPUA 2I52A 1WYCA 3BQKA 3IF8B 2M67A 4DR4T 1GQEA 1NWMX 5HEHA 3F2EA 4GK0E 4MBQA 4X5TA 3NVOA 2XAQB 5LB7B 3ZMSB 1KK7A 3CPZA 5BW0B 1J5WA 5AQUB 4ZI7E 4DBQA 4G2AA 3TLVA 3SWHA 3FZFB 3TKLB 2HPLA 4YJ2E 3U3IA 4IL4A 5KWVA 2LKHA 1WR6A 3RH3A 2V6YB 5JR9A 3P50A 3PTRB 2JIWA 3U78A 2XHEB 3EMOA 3LG7A 1XMQT 4AIUA 2L9QA 1FJGT 4C91A 5LG3A 3UQ4A 5TAOA 4UIGA 5C8YE 2E5LT 2JMHA 4IDZA 4QH4A 5JVDE 3COVA 2A2FX 3CVRA 2QGSA 4ISSA 3NWIA 3ZMVB 1Y64B 2WWUA 4LF8T 4DV5T 2G3DA 3ABVA 3EUHA 1XDOA 3UT5E 3PUWF 3CQCB 4G5YA 3O9XA 2CWYA 3N9NA 4XZCA 4UF0B 2JQHA 3MJXA 4DUZT 2PJQA 3CMLA 4ANJA 2KMFA 3EAMA 5FVKA 1HNXT 5HEUA 2CHOA 2E9XA 2C5KT 2JPFA 3IMEA 2XZEA 2ZM2A 3ANWA 4IDQA 2WDVA 2VKOA 4PJNA 2WQYA 3HA4A 2K3WA 4IE7A 1ZOYA 3H37A 2BS3A 3N9OA 5L3EB 4G63A 3OPCA 2HHHT 3AEDA 4GOUA 2H7OA 2X66A 4CZZB 1VCSA 3MKDA 2MYSA 2UUAT 2Z6EA 4FJOA 5LGNB 1V9DA 4U7YA 4DR7T 4IDOA 3VKHA 4MHCA 4I4TE 4MULA 5JR9C 1G73A 3LBXB 1D0ZA 1DU2A 3K1SA 3NZPA 1UCUA 1SA0E 5LMNT 4OHFA 5KDMC 3UU5A 2WU5A 4YSZA 2YK0A 4OYJA 2CE7A 2WWVA 5ABHA 2N2NA 3CWZB 5FVLA 3AA1B 3ZJ1A 4NPPA 5DQVA 3JCFA 2NW9A 4IXJA 3ISJA 3V5UA 4IHJE 1FIOA 2XM1A 2WAUA 4L5GA 5AQVB 3RQUA 5AQKB 4COFA 2GK9A 3QB5A 4HGAA 5JRCB 3T1YT 2KWHA 4B6XA 3SOLA 2EHOA 3KDSE 4DDKA 5HWYA 1YXRA 1E1HB 1AJ3A 2JQQA 1IBKT 2WDQA 1HNWT 3AA0B 1N2EA 2K48A 3C4XA 4YT0A 2V7KA 1UK5A 1O3XA 3RQWA 5HEGA 5HAXA 3IEEA 3JC6C 4LFCT 2A86A 2OGFA 4MUGA 2LHNA 2Y8DA 5DJQC 2ZLYA 3RIUA 4GYRA 3ZKRA 4GK5E 2G16A 3C98B 4EFKA 4MUIA 5L47A 3N2KE 4KMCA 4LF6T 3AAAB 3PURA 5FY1A 2Q9QD 1MMGA 1KEYA 1V8FA 1IZNB 3RIUC 3COZA 5IWAT 3RIAA 4TWDA 2X67A 4DMVA 3GA8A 4IDNA 1MIWA 2HH7A 3NKZA 1XMOT 4NXNT 5G2FA 3UU6A 4O2AE 3OYXA 3EHZA 1QLBA 2LSGA 2I0MA 3AEAA 3LFMA 3CIRA 3RC3A 3HL6A 4HWIB 4WBNE 3UULA 4A56A 5HYAA 2BZBA 5LBQB 5AQOB 3E22E 2VWAA 4YHJA 4P0AA 2NR4A 2WP9A 1X79A 5EXCA 2A88A 4LF5T 3QC9A 1CUNA 2B76A 5J0ZA 1M62A 3COYA 3ZSSA 3NRYA 4GIWA 3CFIA 4KUMB 4DIDB 2BS2A 4PJJA 2D5UA 4A98A 3MXZA 2XQ4A 4EOZB 4AI6A 3ZEFB 2UUCT 2DWKA 5FXZA 2XUEA 2FJEA 2VURA 2V7IA 3ZN0B 1T8BA 3BK9A 2E2AA 3AA7B 1FMVA 3PUVF 2XAJB 3ZYLA 4LMKA 4X1IE 5LMUT 2IIUA 3OJAA 3C51A 4P1NA 4DV0T 2WSSV 3PJAA 1ZEEA 1I94T 3A8YC 3C64A 3LK3B 2LRKA 2BKPA 1OEDE 2J1DG 1YQ4A 2UU9T 3CFAL 2BG9E 2VVNA 1BR2A 1KNPA 5AQSB 2LT3A 3AXJB 2DI4A 2I59A 3I0OA 2EHOB 3HKBE 2D0TA 1JNZA 2A7XA 2WM9A 3JC6D 1E7PA 3AE8A 2GW4A 2A84A 3KVAA 3L3PA 4DVDA 3IVCA 5FMNA 2LM2A 5H6RB 4JI8T 3ZLIA 2MAWA 2A3DA 5JDGA 2LMEA 1BR4A 1X9BA 3ANWB 1HX8A 4EYUA 4A5XA 2KINB 4IE4A 1R8IA 2YOEA 4QXCB 2VQFT 4YSYA 1ZKEA 4QH5A 3LDQB 3PU8A 3P4QA 4DR2T 2ZM0A 3MA9A 5LBMA 4QHOA 3ZC0A 2X68A 3Q5WA 2A53A 2X0HA 2KWIB 4U3CA 3UTKA 4JI7T 1YD8G 2CLYC 4ZHQE 1H7CA 3RX6A 2NW8A 5LXTE 2PBIA 2PG8A 2KNDA 3FHNA 1KNRA 4IE0A 3ETVA 2UXCT 1IJ5A 5ABGA 3LK42 3PE0A 3UU4A 3PU3A 2VVSA 4UV9B 2ACZA 4LMLA 1KNZA 3A5XA 3RYHE 4Q25A 4L0RA 1KFYA 3Q12A 4DE5A 4AQFC 2E9XB 5ETWA 1E2AA 5JDLA 4H9QC 3PUAA 3IUBA 5AQJB 3LK2B 3ZT7A 3K8PC 3L8RA 3INNA 2E8IA 4I50E 3RYIE 2R6GF 1ZP0A 2EHOC 3ETUA 3OTOT 1VCTA 4BAYB 4CI2B 1N2GA 2WBLA 2IW5B 3ZYMA 1MOPA 2A72A 1NAFA 2YDRA 5LJMA 3ZSTA 5AQHB 4DMWA 2KZ7B 2LKGA 4B3MT 3C50A 4B3ST 2XAHB 4ERRA 2ACXA 3QB5K 4N78D 2XQ7A 4ZOLE 3HR0A 5HXCA 3IOEA 4HFEA 2LM9A 1D1CA 3IA3A 4Z90A 3N2OA 1LVFA 2V1DB 3FZHB 3Q2MA 1SUMB 3TLWA 1XNQT 2GR7A 3PDYA 4HFHA 1QUUA 3RC8A 4ZZCA 2V7JA 5ABFA 2WB5A 1UUSA 3FBLA 5KXJA 4M1PA 3VHLA 5F8PA 2E9XD 2M6IA 4YTNA 5CA1E 1HCIA 4U7IA 3L09A 3J7Yq 4A97A 1N2JA 2CEAA 4ZS3A 3VRAA 4L9IA 3ZT6A 5HEOA 3M65A 2G0UA 5LGTB 3UQ7A 4ZI2C 4TV9E 5HXSA 4CN6A 4MFRA 2W62A 3I9WA 4EB6E 4HTEA 4I55E 5JDMA 1IHOA 2JQ9A 2BKOA 5HCJA 4DR5T 3H3MA 4TWHA 3PUSA 3RI5A 4MUFA 2XQ5A 5HG0A 2XAGB 1US7B 3E08A 3NBXX 2XTLA 3CX6B 5JDNA 1D1AA 4H63H 4PK5A 2LLYA 3KBTA 5F5WA 5ABFB 4KP3C 3UK2A 5FL0A 2X9HA 4CQIA 5HXRA 5JR9B 5JREA 3AVRA 5ADXL 4V1Av 4OK0A 1VRBA 4PAGA 2VQET 3ESLA 1HF8A 4JBWF 3IMCA 2EHOD 2FJBA 4I43B 2L8KA 4CXYA 4MLKA 2XQAA 2MTQA 1T98A 4KI0F 3WAJA 4O4JE 3F57A 2RA1A 4UEMA 2VL0A 2XQ9A 3CQGB 2A52A 2NWBA 3SS1A 3OBVE 2UXBT 4U74A 1L0VA 4O8SA 4QWNB 4O4HE 2BKNA 4HFDA 2N9DA 3K3QC 4HFVA 5DQWA 4PFOA 4HFBA 1EZ3A 5L4HA 1WR0A 3IUEA 3CX7B 3BQLA 2V6YA 5H6QB 1WYBA 2QYWA 3AE3A 4X1YE 3CI0K 4DV3T 3UY4A 4O2BE 4PJLA 1SE7A 1LRZA 2AXDS 2UXNB 2LSKA 4FI5A 3WI3A 3UU3A 5LGUB 3GMIA 4ZI2D 4YFSA 5EK4A 3FZLB 2MBGA 3QOFA 4HWDA 2X51A 4HKAA 3UFEA 5LP6E 4H9PC 2CLYB 2JMKA 2YKSA 2UUBT 4IE6A 3ONJA 1XNRT 4X1KE 1W09A 3AE7A 4TX5A 4JI0T 1T72A 1CHUA 3AG5A 3ZYKA 4JI6T 3V5SA 3PUYF 4P09A 4EXTA 4WNKA 4KHPT 4NXMT 1MMAA 4JI2T 4DV1T 4EZHA 3VU7H 5FNVE 3IBPA 3RRWA 4I0UA 3VR9A 2V6XA 3EABA 2V5CA 5BMVE 1YW0A 4EEDA 2N1GA 4NUUA 3JAEA 5CA0E 1ZV4X 3ONXA 3KV5A 2AE9A 5AQTB 2V5DA 5IUXA 5J2UE 2YN6A 3MK7C 3RYCE 2C5JA 4GYSA 3LBXA 4P0BA 3T8OA 5M4YA 4TWFA 2LE8A 3BQIA 3DJBA 3OVUA 3FXDB 3SRZA 2YU2A 2BG9A 3HKCE 3Q10A 5FXVA 2VKJA 1M7KA 3RKOA 4EYYR 2G5ZA 2NOXA 5AQFB 5FXWA 2V26A 4OFZA 3QK6A 1NENA 2X0LB 5L3CB 3UUXB 1HR0T 2CMRA 3AEGA 3CQXC 3UUBA 2BVMA 5F3JA 5HWXA 1OEDA 5KMGP 2DL1A 4KBMB 3SFEA 1IAPA 1YKEB 5JQGE 3ZCIA 2SPCA 3ZMTB 4H9RC 4EZ4A 2IUBA 2RP4A 4DV7T 3IMGA 3EDVA 3UA0A 3P4RA 2CXLA 2KXPB 4WW0A 2Q9QA 5KX5E 1S35A 4QH1A 1W0AA 2BBJA 5AQRB 2PTFA 3JAFA 4HWHA 2LSJA 4MUKA 5L2LA 3P4WA 4DR6T 2E5VA 2XASB 4TNWA 1JNRA 2YEVC 4BHRA 1FEWA 5HXHA 3WAKA 4LMJA 3E0ZA 4JI4T 2LHRA 1OEDB 4U2ZA 3LE8A 4BJNA 1MMNA 1UGOA 4DV4T 4AQFA 1WFDA 2V8SV 4X65T
chains in the Genus database with same CATH topology
2XAHB 4HE8A 4O4IE 4E7ZA 4ERRA 3NZPA 2ACXA 1UCUA 1SA0E 4MUEA 4N78D 4U72A 4OHFA 4ZOLE 3HR0A 5KDMC 4AKRB 4QX7B 5HXCA 3IOEA 1HG5A 2P9BA 2LM9A 3AA6B 1D1CA 2YK0A 3N2OA 1LVFA 4OYJA 2CE7A 2V1DB 3K3OA 3Q2MA 2N2NA 3CWZB 3LF4A 4QX8B 2A56A 4J2CA 4JLEA 3AA1B 4MALA 5AFUL 2VB6A 3PDYA 1N2HA 3ZJ1A 2LOSA 1QUUA 5DQVA 2NW9A 4AKLA 5FXXA 5LCYA 3RC8A 5LNKA 3ISJA 4IXJA 4DNDA 3V5UA 4IHJE 1FIOA 2V7JA 3GN5B 2WAUA 4L5GA 3FBLA 2LSIA 2W00A 3KVBA 3KV6A 2GK9A 3AAIA 1MMDA 2CCQA 4M1PA 3VHLA 5F8PA 2E9XD 4HGAA 3F31A 2LEHA 3GN5A 3O1HA 4MQ6A 5JRCB 5L3FB 4JEUB 2KWHA 4B6XA 5CA1E 2ZMAA 1HCIA 3SOLA 2G2SA 3OKQA 2CXDA 3L09A 2EHOA 4QKNA 3J7Yq 3KDSE 2CEAA 1N2JA 4ZS3A 5HWYA 4MUNA 4DDKA 4L9IA 2NW7A 1E1HB 2K24A 3M65A 4PNIA 4UVCB 1AJ3A 2G0UA 3LJCA 5LGTB 2JQQA 3R6NA 5LHIB 4ZI2C 2NTXA 1N2BA 4PJMA 4TV9E 1WRDA 1MNDA 4UF0A 5HXSA 3AA0B 4F6RC 1N2EA 3K3NA 4MFRA 3N9QA 2K48A 3C4XA 5JDQA 2NTYA 2V7KA 1G73A 4TUYE 2VASA 1O3XA 5FY7A 2W61A 4ASKA 2W62A 1ZHCA 2XQYA 3I9WA 4ZI3D 2WMNA 5HAXA 4EB6E 4CXXA 3ZN1B 3IEEA 4HTEA 4I55E 4AKHA 3JC6C 5JDMA 3KINB 5FY0A 4H9SE 2A86A 1IHOA 2LHNA 4MUGA 2Y8DA 4BJMA 2V7MA 5DJQC 1LKXA 5LG4A 5LYJE 2ZLYA 4QXHB 1BR1A 3CFFL 1HTJF 3AAEB 3NRXA 5DABA 3ZPOA 1LVKA 4DO0A 3Q9DA 3PUSA 4MUFA 2W63A 5HG0A 2XAGB 3KFWX 4GYRA 1S94A 1US7B 4GK5E 3D0TA 3E08A 3NBXX 2G16A 2XTLA 3C98B 3I1AA 4YJ3E 4EFKA 3CX6B 4YLHA 1D1AA 4H63H 4PK5A 5JDNA 3VKGA 4MUIA 2IC9A 3KBTA 3QTTA 2KLQA 2K9AA 3AB3B 4KP3C 1N2IA 3UK2A 3IVXA 3N2KE 4KMCA 3MZKB 3P7IA 2X9HA 3AAAB 3I9YA 4ILUA 3PURA 1D0YA 2Q9QD 5FY1A 4CQIA 5HXRA 1G8XA 2BVLA 3AVRA 4JEHB 2KT9A 5ADXL 5JR9B 5JREA 4V1Av 2OA5A 1UFVA 3IHRA 1MMGA 4OK0A 1V8FA 3AG6A 1IZNB 4AKIA 3COZA 1BR0A 1VRBA 2VK9A 4PK4A 3EDUA 2A54A 4PAGA 3IOCA 4HN9A 2X67A 3ESLA 1HF8A 2DCFA 3C4WA 2K5BB 3GA8A 3HI2A 4DMVA 3IMCA 3N5LA 3O1JA 3B57A 1U5PA 1MIWA 2HH7A 5LOVE 3N2GE 4XAXB 5E0OA 3RRCA 5LJNA 2WMOA 2EHOD 4I43B 3S4UA 5G2FA 2L8KA 4CI1B 4MLKA 4CXYA 3O1IA 2LOPA 4O2AE 3OYXA 3Q5XA 2MTQA 3I0QA 1T98A 3WAJA 2DLRA 2LSGA 4Z8XA 4ZS2A 1HG2A 4O4JE 5L3BB 2L3LA 3LFMA 5LHHB 3F57A 2RA1A 4UEMA 3RC3A 3HL6A 4WBNE 3UULA 3UUNA 4MUJA 4A56A 5HYAA 2H7VC 3W15B 2BZBA 2ES0A 5LBQB 2DWGA 4UVAB 3ZMZB 5J1GA 2ODVA 4EF6A 3E22E 3CQGB 2VWAA 2A52A 3HKEE 2NWBA 3SS1A 4YHJA 4P0AA 4WBOA 3OBVE 4U74A 2LJLA 4DDHA 4PW8A 2ODUA 3FXEB 4O8SA 1MIYA 3KBUA 4QWNB 4O4HE 1X79A 5HXEA 3IOBA 5EXCA 4BA9A 2A88A 3QC9A 1CUNA 2N9DA 3K3QC 4HFVA 5DQWA 4H9NC 2CA5A 4IIJE 4NUVA 4PFOA 3COYA 1WLXA 1VOMA 4O4LE 1EZ3A 2DHRA 3PUQA 1B7TA 3NRYA 4GIWA 2Q9QC 3ZMUB 4XBFB 4DDMA 4ADZA 4QXBB 4KUMB 4E7SA 3KV9A 3IUEA 3CX7B 3CFHL 3BQLA 5H6QB 1WYBA 4PJJA 4X1YE 3R84B 2D5UA 2E9XC 4OYKA 3MXZA 3UY4A 3OYZA 3N9LA 4O2BE 4PJLA 3CKDA 4EOZB 4AI6A 3FB2A 3DP7A 1LRZA 3ZEFB 4MUHA 2DWKA 5FXZA 2UXNB 5L3GB 2XUEA 2NP9A 2VL8A 5FP3A 4EAHA 4TN7B 5M4YA 5LHGB 2LSKA 2QA7A 2A50A 5IHYA 2V7IA 2C0SA 4FI5A 5L3DB 3ZN0B 3BK9A 3WI3A 3CX8B 2VKHA 1HFAA 5LGUB 3GMIA 5J2TE 4ZI2D 4YFSA 5EK4A 3AA7B 2Y48B 2B1EA 2MBGA 1FMVA 2X51A 4HKAA 1YKHB 2XAJB 1SHZC 3KV4A 3UFEA 5LP6E 5IYZE 4H9PC 3ZYLA 1Z0PA 3NZQA 2CLYB 2JMKA 4X1IE 5EK2A 3P8CD 4HEAA 1MNEA 4IE6A 4X1KE 3OJAA 4ZI3C 3C51A 4TX5A 2WSSV 1ZEEA 1D1BA 3J9X1 5LA6E 2W0GA 3C64A 3LK3B 3C4ZA 2IAKA 2J1DG 4TV8E 3AG5A 3CFAL 3ZYKA 2Y6XA 5JH7E 2X9WA 3V5SA 4CI3B 1BR2A 2V7LA 5A1LA 4P09A 2LT3A 2CM0A 2ZM8A 4EXTA 2YU1A 2DI4A 2I59A 3I0OA 3MUEA 4WNKA 2EHOB 3HKBE 5FYMA 2D0TA 4TZ4C 2CXFA 3ZC1A 2A7XA 2WM9A 1MMAA 3GWHA 3O4XE 1N2OA 3JC6D 4EZHA 3VU7H 5FNVE 2GW4A 3IBPA 4UV8B 5EZYE 3RRWA 3KVAA 2A84A 3MACA 3L3PA 4DVDA 1UX4A 2D2SA 2EJCA 3IVGA 3IVCA 4CXWA 5FMNA 5H6RB 2D0UA 5BMVE 3ZLIA 3RPUA 5EK3A 2A3DA 1WYCA 2Q9QB 5JDGA 1YW0A 2N1GA 1BR4A 2YINA 3BQKA 3IF8B 2M67A 2VKDA 4NUUA 3ZJ2A 5CA0E 1NWMX 3ANWB 1HX8A 1ZV4X 3ONXA 3KV5A 4EYUA 2PFVA 4IE5A 3F2EA 2KINB 4GK0E 4MBQA 4IE4A 4QXCB 5J2UE 1ZKEA 2XAQB 3MK7C 2HPJA 3ZMSB 5JRCA 2X9XA 3PU8A 3RYCE 2H3RA 3N9MA 1KK7A 1OXZA 2C5JA 3IODA 2MOZA 3CPZA 2ZM0A 3MA9A 3AVSA 4GYSA 5LBMA 3H3AA 4K0UA 3ZCJA 4QHOA 4ZI7E 3ZC0A 4DBQA 4G2AA 2X68A 3Q5WA 3LBXA 3SWHA 3TKLB 2HPLA 2KWIB 4YJ2E 2A53A 4P0BA 3T8OA 3UTKA 1QSDA 4H9OC 3U3IA 5KWVA 1IJ6A 1WR6A 2LE8A 3BQIA 3DJBA 1FMWA 1YD8G 5JR9A 2CLYC 3PUGA 3PTRB 4UELA 3RH3A 4ZHQE 1U4QA 3U78A 1HS7A 3FXDB 3DTOA 2DNXA 1H7CA 2XHEB 2YU2A 3SRZA 3LG7A 3RX6A 3HKCE 2L9QA 3Q10A 2NW8A 5FXVA 5LXTE 5JDFA 2IC6A 2PBIA 2VKJA 4AQGA 2PG8A 2KNDA 4C91A 3FHNA 4IE0A 3RKOA 4PFPA 3ETVA 4EYYR 1IJ5A 2BDEA 2G5ZA 4UXNB 5TAOA 3COWA 4DBRA 4UIGA 2NOXA 1OWAA 2UXXB 5C8YE 3LK42 3PE0A 1D0XA 5FXWA 3PU3A 2JMHA 2V26A 4OFZA 4IDZA 3QK6A 2X0LB 2CWOA 4UV9B 5L3CB 5JVDE 2A2FX 3A5XA 4PK6A 1KNZA 3CVRA 3RYHE 3COVA 3UUXB 3FBZA 5CB4E 4L0RA 2QGSA 4ISSA 2X3FA 4FZJA 4EIWA 2CMRA 3ZMVB 3CQXC 1Y64B 2WWUA 4DE5A 2BVMA 3UUMA 4AQFC 5F3JA 4AXPA 5HWXA 2G3DA 3Q12A 2E9XB 5KMGP 4C90A 3EUHA 5ETWA 3UT5E 2C5IT 4KBMB 1IAPA 3CQCB 1YKEB 4G5YA 5JDLA 4H9QC 3PUAA 4ISTA 3O9XA 3IUBA 3LK2B 2CWYA 3N9NA 3EVYA 4XZCA 5JQGE 3ZCIA 2SPCA 3ZMTB 3K8PC 4UF0B 3B13A 4UVBB 4H9RC 3MJXA 5GONE 4EZ4A 2JJ9A 4IGUA 2PJQA 3CMLA 4ANJA 2KMFA 3INNA 3N8HA 2RP4A 2E8IA 2E9XA 2C5KT 4I50E 2JPFA 3IMEA 3RYIE 2JRKA 3IMGA 2ZM2A 3ANWA 3EDVA 3UA0A 2VKOA 2XAFB 2CXLA 2KXPB 4PJNA 4WW0A 2EHOC 3ETUA 2Q9QA 3HA4A 5KX5E 1S35A 3N9PA 4IE7A 4BAYB 4CI2B 3H37A 1N2GA 3N9OA 5L3EB 2WBLA 2IW5B 3RYFE 2LSJA 4G63A 4MUKA 4JUYA 5L2LA 3ZYMA 4AKGA 2XASB 3MXTA 2YEVC 4GOUA 4BHRA 1FEWA 2H7OA 5HXHA 2X66A 1MOPA 2A72A 4CZZB 1NAFA 1MIVA 3WAKA 3E0ZA 4G5FA 3MKDA 2MYSA 4H63V 2LHRA 2Z6EA 4FJOA 5LGNB 5LJMA 1V9DA 4DMWA 2LSYA 2KZ7B 3LE8A 1UX5A 4BJNA 3QUJA 4X20E 3VKHA 4MHCA 1MMNA 3HKDE 5JDHA 4I4TE 4AQFA 4MULA 5JR9C 2X9YA 3C50A 3LBXB 1D0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HL6 A; 
#chains in the Genus database with same CATH topology
 4HE8 A;  4MUE A;  4WZX A;  4AKR B;  4QX7 B;  1HG5 A;  2P9B A;  3AA6 B;  3G06 A;  4ZXL A;  3K3O A;  4TNV A;  3LF4 A;  4QX8 B;  2A56 A;  4J2C A;  2J4G A;  3CI0 I;  4JLE A;  1N2H A;  5AFU L;  5FXX A;  5LCY A;  5LNK A;  4DND A;  3KV6 A;  2W00 A;  3AAI A;  2CCQ A;  3Q5E A;  3F31 A;  2LEH A;  3O1H A;  4MQ6 A;  5L3F B;  3M3Z B;  2CXD A;  2IML A;  2WCA A;  4U31 A;  2H88 A;  4UVC B;  4EEB A;  4UR9 A;  3LJC A;  2CBJ A;  3R6N A;  5LHI B;  2NTX A;  4UF0 A;  1I6Z A;  4F6R C;  3K3N A;  3N9Q A;  3Q5D A;  3RHW A;  5JDQ A;  5FKY A;  1Z8U A;  2VAS A;  4TUY E;  5FY7 A;  2W61 A;  4YHH T;  2CRB A;  2XQY A;  2WMN A;  4CXX A;  2A9U A;  2W66 A;  3ZN1 B;  2BS4 A;  3KIN B;  4H9S E;  2V7M A;  2RPA A;  1LKX A;  4OX9 T;  1BR1 A;  2H89 A;  1HTJ F;  3AAE B;  3ZPO A;  5DAB A;  4CN4 A;  2CBI A;  4HWF A;  3KFW X;  3D0T A;  2M6B A;  1W0B A;  3I1A A;  4YJ3 E;  4YLH A;  3AE6 A;  3VKG A;  4AQY T;  2IC9 A;  1N32 T;  4CN1 A;  3QTT A;  2GR8 A;  1N2I A;  5BR8 T;  3TLT A;  3MZK B;  4IRE A;  4ILU A;  2OLT A;  2XJ7 A;  2BVL A;  2QRX A;  4PK4 A;  1WCR A;  2J62 A;  4HN9 A;  3C4W A;  2K5B B;  2W2U A;  4JI5 T;  5E0O A;  4XAX B;  3RRC A;  4LFA T;  5AQG B;  3I0Q A;  2IHR 1;  4Z8X A;  1HG2 A;  5L3B B;  2L3L A;  5LHH B;  4MUJ A;  5HEJ A;  2H7V C;  3W15 B;  2ES0 A;  2XSA A;  2DWG A;  3ZMZ B;  5J1G A;  2ODV A;  4EF6 A;  3RLF F;  3PJA J;  4U33 A;  2LJL A;  1KF6 A;  4PW8 A;  2ODU A;  3FXE B;  2ZM6 T;  4JI3 T;  3KBU A;  5HXE A;  5AQM B;  4BA9 A;  2CA5 A;  4ILB A;  2W4X A;  4DV6 T;  1WLX A;  1VOM A;  2DHR A;  3PUQ A;  1B7T A;  2Q9Q C;  3FZK B;  3ZMU B;  4XBF B;  4DDM A;  4QXB B;  3AE4 A;  4JV5 T;  3CK6 A;  3CFH L;  4HFC A;  3N9L A;  2KSR A;  2CPT A;  3DP7 A;  5L3G B;  5FP3 A;  4EAH A;  4TN7 B;  2QA7 A;  3PUX F;  2A50 A;  2C0S A;  5L3D B;  2VKH A;  2UXD T;  5J2T E;  4X64 T;  4HFI A;  1HX1 B;  4U2Y A;  2Y48 B;  2B1E A;  1YKH B;  1SHZ C;  4ILC A;  4WYV A;  3VR8 A;  5IYZ E;  1Z0P A;  3LSV A;  3P8C D;  1D1B A;  3J9X 1;  5LA6 E;  2W0G A;  3C4Z A;  4TV8 E;  3PV0 F;  2Y6X A;  2X9W A;  3AE2 A;  2V7L A;  5A1L A;  2FBW A;  4F8H A;  2ZM8 A;  2YU1 A;  4HWC A;  5FYM A;  4JYA T;  3GWH A;  1N2O A;  3L39 A;  5EZY E;  4UV8 B;  2HN1 A;  1UX4 A;  2D2S A;  2CHN A;  2EJC A;  4CXW A;  2WZH A;  5EK3 A;  1IBM T;  2Q9Q B;  5CGM A;  2WU2 A;  2YIN A;  3ZJ2 A;  2VKD A;  2PFV A;  4IE5 A;  2RET A;  3AE5 A;  4DR3 T;  4DUY T;  2FJD A;  3RKG A;  2HPJ A;  5JRC A;  2X9X A;  2H3R A;  3N9M A;  1OXZ A;  3IOD A;  4YTP A;  2MOZ A;  3AVS A;  3H3A A;  4K0U A;  3ZCJ A;  4K0K T;  1QSD A;  4H9O C;  1IJ6 A;  1FMW A;  3PUG A;  4UEL A;  1U4Q A;  1HS7 A;  3DTO A;  2DNX A;  2QVA A;  3AXJ A;  5JDF A;  2IC6 A;  4AQG A;  4AIS A;  3P4S A;  4GKK T;  5C3J A;  2BG9 C;  4PFP A;  1NEK A;  2BDE A;  4UXN B;  4IDP A;  3COW A;  4DBR A;  1OWA A;  2UXX B;  1D0X A;  4JI1 T;  3A7M A;  2CWO A;  4PK6 A;  3FBZ A;  5CB4 E;  2X3F A;  4FZJ A;  4EIW A;  4Z91 A;  1T7S A;  3UUM A;  4AXP A;  4C90 A;  2C5I T;  4IST A;  3EVY A;  3B13 A;  4UVB B;  5GON E;  2JJ9 A;  4IGU A;  2IDO B;  3N8H A;  2F4V T;  2FUP A;  2JRK A;  2LRL A;  2XAF B;  5HCM A;  4LF4 T;  3AE9 A;  3N9P A;  3AEE A;  2J47 A;  3RYF E;  4IL9 A;  3QNU A;  4JUY A;  4AKG A;  3MXT A;  4G5F A;  1MIV A;  4H63 V;  2LSY A;  5AQN B;  1UX5 A;  3QUJ A;  4X20 E;  4X66 T;  3HKD E;  5JDH A;  1YQ3 A;  2X9Y A;  5C2T A;  4O4I E;  4E7Z A;  2JQK A;  4U72 A;  5AQI B;  1N34 T;  5AQP B;  4LF7 T;  5L4E A;  3SFD A;  3T1H T;  2FJA A;  4MAL A;  1W9R A;  2VB6 A;  2LOS A;  4AKL A;  3UU8 A;  3FZM B;  3GN5 B;  1N36 T;  2LSI A;  3KVB A;  1MMD A;  2WS3 A;  2YDQ A;  3TLS A;  3GN5 A;  2IEC A;  1OED C;  4JEU B;  2ZMA A;  2XQ8 A;  2G2S A;  3OKQ A;  3UFG A;  3ONL C;  4QKN A;  4MUN A;  2NW7 A;  3EI0 A;  2K24 A;  4PNI A;  3VRB A;  4YXD A;  1N2B A;  4PJM A;  1WRD A;  1MND A;  4NIQ A;  2NTY A;  4ASK A;  1ZHC A;  4LF9 T;  3RIF A;  4ZI3 D;  4X62 T;  5AQQ B;  4AKH A;  4DV2 T;  5FY0 A;  4BJM A;  5LG4 A;  5LYJ E;  4QXH B;  4EGW A;  3CFF L;  3NRX A;  3AE1 A;  1LVK A;  4DO0 A;  3Q9D A;  2W63 A;  1S94 A;  2KLQ A;  2K9A A;  3AB3 B;  5AQL B;  2BG9 B;  3IVX A;  3P7I A;  3I9Y A;  1D0Y A;  2W67 A;  4EV6 A;  1G8X A;  4JEH B;  2KT9 A;  3AEB A;  2OA5 A;  1UFV A;  3IHR A;  3AG6 A;  4AKI A;  4IT4 A;  2OV9 A;  1BR0 A;  2VK9 A;  3EDU A;  2A54 A;  2XQ3 A;  5ABE A;  3IOC A;  1N33 T;  2DCF A;  3HI2 A;  3N5L A;  3O1J A;  3B57 A;  2WZI A;  4YTM A;  1U5P A;  1XZY A;  5LOV E;  3N2G E;  5LJN A;  5CJ5 A;  2WMO A;  2D9D A;  1HNZ T;  1UUR A;  3S4U A;  4CI1 B;  3P4P A;  3O1I A;  2LOP A;  3PUZ F;  3Q5X A;  2DLR A;  4DR1 T;  4ZS2 A;  1J1J A;  4B3T T;  4ZEY A;  3UUN A;  3TLU A;  3AEF A;  4UVA B;  4GKJ T;  4YY3 T;  2YDS A;  1Y01 A;  3HKE E;  2I6H A;  4WBO A;  3AEC A;  4KX6 A;  4DDH A;  1MIY A;  2WDR A;  3IOB A;  2XSB A;  2BBH A;  4H9N C;  4IIJ E;  4NUV A;  4O4L E;  5FL1 A;  2HN2 A;  4ADZ A;  5CFB A;  4E7S A;  3KV9 A;  2MPK A;  2XM2 A;  1IBL T;  3R84 B;  2E9X C;  4OYK A;  3OYZ A;  3CKD A;  4YSX A;  3FB2 A;  4MUH A;  2NP9 A;  2VL8 A;  4ILA A;  5LHG B;  5IHY A;  3CX8 B;  1XWM A;  1HFA A;  4B3R T;  2X0Y A;  1J5E T;  2XY8 B;  3KV4 A;  5JTG A;  2XQ6 A;  3NZQ A;  5EK2 A;  4LFB T;  4HEA A;  1MNE A;  4ZI3 C;  3B5M A;  2XPK A;  4ZZB A;  2IAK A;  3RF1 A;  3ZT5 A;  5JH7 E;  4CI3 B;  3X1D A;  2CM0 A;  3JAD A;  3MUE A;  4TZ4 C;  2CXF A;  3ZC1 A;  3O4X E;  3MAC A;  1XDP A;  3IVG A;  4KHZ F;  2D0U A;  3RGL A;  2WY2 A;  3RPU A;  2I52 A;  1WYC A;  3BQK A;  3IF8 B;  2M67 A;  4DR4 T;  1GQE A;  1NWM X;  5HEH A;  3F2E A;  4GK0 E;  4MBQ A;  4X5T A;  3NVO A;  2XAQ B;  5LB7 B;  3ZMS B;  1KK7 A;  3CPZ A;  5BW0 B;  1J5W A;  5AQU B;  4ZI7 E;  4DBQ A;  4G2A A;  3TLV A;  3SWH A;  3FZF B;  3TKL B;  2HPL A;  4YJ2 E;  3U3I A;  4IL4 A;  5KWV A;  2LKH A;  1WR6 A;  3RH3 A;  2V6Y B;  5JR9 A;  3P50 A;  3PTR B;  2JIW A;  3U78 A;  2XHE B;  3EMO A;  3LG7 A;  1XMQ T;  4AIU A;  2L9Q A;  1FJG T;  4C91 A;  5LG3 A;  3UQ4 A;  5TAO A;  4UIG A;  5C8Y E;  2E5L T;  2JMH A;  4IDZ A;  4QH4 A;  5JVD E;  3COV A;  2A2F X;  3CVR A;  2QGS A;  4ISS A;  3NWI A;  3ZMV B;  1Y64 B;  2WWU A;  4LF8 T;  4DV5 T;  2G3D A;  3ABV A;  3EUH A;  1XDO A;  3UT5 E;  3PUW F;  3CQC B;  4G5Y A;  3O9X A;  2CWY A;  3N9N A;  4XZC A;  4UF0 B;  2JQH A;  3MJX A;  4DUZ T;  2PJQ A;  3CML A;  4ANJ A;  2KMF A;  3EAM A;  5FVK A;  1HNX T;  5HEU A;  2CHO A;  2E9X A;  2C5K T;  2JPF A;  3IME A;  2XZE A;  2ZM2 A;  3ANW A;  4IDQ A;  2WDV A;  2VKO A;  4PJN A;  2WQY A;  3HA4 A;  2K3W A;  4IE7 A;  1ZOY A;  3H37 A;  2BS3 A;  3N9O A;  5L3E B;  4G63 A;  3OPC A;  2HHH T;  3AED A;  4GOU A;  2H7O A;  2X66 A;  4CZZ B;  1VCS A;  3MKD A;  2MYS A;  2UUA T;  2Z6E A;  4FJO A;  5LGN B;  1V9D A;  4U7Y A;  4DR7 T;  4IDO A;  3VKH A;  4MHC A;  4I4T E;  4MUL A;  5JR9 C;  1G73 A;  3LBX B;  1D0Z A;  1DU2 A;  3K1S A;  3NZP A;  1UCU A;  1SA0 E;  5LMN T;  4OHF A;  5KDM C;  3UU5 A;  2WU5 A;  4YSZ A;  2YK0 A;  4OYJ A;  2CE7 A;  2WWV A;  5ABH A;  2N2N A;  3CWZ B;  5FVL A;  3AA1 B;  3ZJ1 A;  4NPP A;  5DQV A;  3JCF A;  2NW9 A;  4IXJ A;  3ISJ A;  3V5U A;  4IHJ E;  1FIO A;  2XM1 A;  2WAU A;  4L5G A;  5AQV B;  3RQU A;  5AQK B;  4COF A;  2GK9 A;  3QB5 A;  4HGA A;  5JRC B;  3T1Y T;  2KWH A;  4B6X A;  3SOL A;  2EHO A;  3KDS E;  4DDK A;  5HWY A;  1YXR A;  1E1H B;  1AJ3 A;  2JQQ A;  1IBK T;  2WDQ A;  1HNW T;  3AA0 B;  1N2E A;  2K48 A;  3C4X A;  4YT0 A;  2V7K A;  1UK5 A;  1O3X A;  3RQW A;  5HEG A;  5HAX A;  3IEE A;  3JC6 C;  4LFC T;  2A86 A;  2OGF A;  4MUG A;  2LHN A;  2Y8D A;  5DJQ C;  2ZLY A;  3RIU A;  4GYR A;  3ZKR A;  4GK5 E;  2G16 A;  3C98 B;  4EFK A;  4MUI A;  5L47 A;  3N2K E;  4KMC A;  4LF6 T;  3AAA B;  3PUR A;  5FY1 A;  2Q9Q D;  1MMG A;  1KEY A;  1V8F A;  1IZN B;  3RIU C;  3COZ A;  5IWA T;  3RIA A;  4TWD A;  2X67 A;  4DMV A;  3GA8 A;  4IDN A;  1MIW A;  2HH7 A;  3NKZ A;  1XMO T;  4NXN T;  5G2F A;  3UU6 A;  4O2A E;  3OYX A;  3EHZ A;  1QLB A;  2LSG A;  2I0M A;  3AEA A;  3LFM A;  3CIR A;  3RC3 A;  3HL6 A;  4HWI B;  4WBN E;  3UUL A;  4A56 A;  5HYA A;  2BZB A;  5LBQ B;  5AQO B;  3E22 E;  2VWA A;  4YHJ A;  4P0A A;  2NR4 A;  2WP9 A;  1X79 A;  5EXC A;  2A88 A;  4LF5 T;  3QC9 A;  1CUN A;  2B76 A;  5J0Z A;  1M62 A;  3COY A;  3ZSS A;  3NRY A;  4GIW A;  3CFI A;  4KUM B;  4DID B;  2BS2 A;  4PJJ A;  2D5U A;  4A98 A;  3MXZ A;  2XQ4 A;  4EOZ B;  4AI6 A;  3ZEF B;  2UUC T;  2DWK A;  5FXZ A;  2XUE A;  2FJE A;  2VUR A;  2V7I A;  3ZN0 B;  1T8B A;  3BK9 A;  2E2A A;  3AA7 B;  1FMV A;  3PUV F;  2XAJ B;  3ZYL A;  4LMK A;  4X1I E;  5LMU T;  2IIU A;  3OJA A;  3C51 A;  4P1N A;  4DV0 T;  2WSS V;  3PJA A;  1ZEE A;  1I94 T;  3A8Y C;  3C64 A;  3LK3 B;  2LRK A;  2BKP A;  1OED E;  2J1D G;  1YQ4 A;  2UU9 T;  3CFA L;  2BG9 E;  2VVN A;  1BR2 A;  1KNP A;  5AQS B;  2LT3 A;  3AXJ B;  2DI4 A;  2I59 A;  3I0O A;  2EHO B;  3HKB E;  2D0T A;  1JNZ A;  2A7X A;  2WM9 A;  3JC6 D;  1E7P A;  3AE8 A;  2GW4 A;  2A84 A;  3KVA A;  3L3P A;  4DVD A;  3IVC A;  5FMN A;  2LM2 A;  5H6R B;  4JI8 T;  3ZLI A;  2MAW A;  2A3D A;  5JDG A;  2LME A;  1BR4 A;  1X9B A;  3ANW B;  1HX8 A;  4EYU A;  4A5X A;  2KIN B;  4IE4 A;  1R8I A;  2YOE A;  4QXC B;  2VQF T;  4YSY A;  1ZKE A;  4QH5 A;  3LDQ B;  3PU8 A;  3P4Q A;  4DR2 T;  2ZM0 A;  3MA9 A;  5LBM A;  4QHO A;  3ZC0 A;  2X68 A;  3Q5W A;  2A53 A;  2X0H A;  2KWI B;  4U3C A;  3UTK A;  4JI7 T;  1YD8 G;  2CLY C;  4ZHQ E;  1H7C A;  3RX6 A;  2NW8 A;  5LXT E;  2PBI A;  2PG8 A;  2KND A;  3FHN A;  1KNR A;  4IE0 A;  3ETV A;  2UXC T;  1IJ5 A;  5ABG A;  3LK4 2;  3PE0 A;  3UU4 A;  3PU3 A;  2VVS A;  4UV9 B;  2ACZ A;  4LML A;  1KNZ A;  3A5X A;  3RYH E;  4Q25 A;  4L0R A;  1KFY A;  3Q12 A;  4DE5 A;  4AQF C;  2E9X B;  5ETW A;  1E2A A;  5JDL A;  4H9Q C;  3PUA A;  3IUB A;  5AQJ B;  3LK2 B;  3ZT7 A;  3K8P C;  3L8R A;  3INN A;  2E8I A;  4I50 E;  3RYI E;  2R6G F;  1ZP0 A;  2EHO C;  3ETU A;  3OTO T;  1VCT A;  4BAY B;  4CI2 B;  1N2G A;  2WBL A;  2IW5 B;  3ZYM A;  1MOP A;  2A72 A;  1NAF A;  2YDR A;  5LJM A;  3ZST A;  5AQH B;  4DMW A;  2KZ7 B;  2LKG A;  4B3M T;  3C50 A;  4B3S T;  2XAH B;  4ERR A;  2ACX A;  3QB5 K;  4N78 D;  2XQ7 A;  4ZOL E;  3HR0 A;  5HXC A;  3IOE A;  4HFE A;  2LM9 A;  1D1C A;  3IA3 A;  4Z90 A;  3N2O A;  1LVF A;  2V1D B;  3FZH B;  3Q2M A;  1SUM B;  3TLW A;  1XNQ T;  2GR7 A;  3PDY A;  4HFH A;  1QUU A;  3RC8 A;  4ZZC A;  2V7J A;  5ABF A;  2WB5 A;  1UUS A;  3FBL A;  5KXJ A;  4M1P A;  3VHL A;  5F8P A;  2E9X D;  2M6I A;  4YTN A;  5CA1 E;  1HCI A;  4U7I A;  3L09 A;  3J7Y q;  4A97 A;  1N2J A;  2CEA A;  4ZS3 A;  3VRA A;  4L9I A;  3ZT6 A;  5HEO A;  3M65 A;  2G0U A;  5LGT B;  3UQ7 A;  4ZI2 C;  4TV9 E;  5HXS A;  4CN6 A;  4MFR A;  2W62 A;  3I9W A;  4EB6 E;  4HTE A;  4I55 E;  5JDM A;  1IHO A;  2JQ9 A;  2BKO A;  5HCJ A;  4DR5 T;  3H3M A;  4TWH A;  3PUS A;  3RI5 A;  4MUF A;  2XQ5 A;  5HG0 A;  2XAG B;  1US7 B;  3E08 A;  3NBX X;  2XTL A;  3CX6 B;  5JDN A;  1D1A A;  4H63 H;  4PK5 A;  2LLY A;  3KBT A;  5F5W A;  5ABF B;  4KP3 C;  3UK2 A;  5FL0 A;  2X9H A;  4CQI A;  5HXR A;  5JR9 B;  5JRE A;  3AVR A;  5ADX L;  4V1A v;  4OK0 A;  1VRB A;  4PAG A;  2VQE T;  3ESL A;  1HF8 A;  4JBW F;  3IMC A;  2EHO D;  2FJB A;  4I43 B;  2L8K A;  4CXY A;  4MLK A;  2XQA A;  2MTQ A;  1T98 A;  4KI0 F;  3WAJ A;  4O4J E;  3F57 A;  2RA1 A;  4UEM A;  2VL0 A;  2XQ9 A;  3CQG B;  2A52 A;  2NWB A;  3SS1 A;  3OBV E;  2UXB T;  4U74 A;  1L0V A;  4O8S A;  4QWN B;  4O4H E;  2BKN A;  4HFD A;  2N9D A;  3K3Q C;  4HFV A;  5DQW A;  4PFO A;  4HFB A;  1EZ3 A;  5L4H A;  1WR0 A;  3IUE A;  3CX7 B;  3BQL A;  2V6Y A;  5H6Q B;  1WYB A;  2QYW A;  3AE3 A;  4X1Y E;  3CI0 K;  4DV3 T;  3UY4 A;  4O2B E;  4PJL A;  1SE7 A;  1LRZ A;  2AXD S;  2UXN B;  2LSK A;  4FI5 A;  3WI3 A;  3UU3 A;  5LGU B;  3GMI A;  4ZI2 D;  4YFS A;  5EK4 A;  3FZL B;  2MBG A;  3QOF A;  4HWD A;  2X51 A;  4HKA A;  3UFE A;  5LP6 E;  4H9P C;  2CLY B;  2JMK A;  2YKS A;  2UUB T;  4IE6 A;  3ONJ A;  1XNR T;  4X1K E;  1W09 A;  3AE7 A;  4TX5 A;  4JI0 T;  1T72 A;  1CHU A;  3AG5 A;  3ZYK A;  4JI6 T;  3V5S A;  3PUY F;  4P09 A;  4EXT A;  4WNK A;  4KHP T;  4NXM T;  1MMA A;  4JI2 T;  4DV1 T;  4EZH A;  3VU7 H;  5FNV E;  3IBP A;  3RRW A;  4I0U A;  3VR9 A;  2V6X A;  3EAB A;  2V5C A;  5BMV E;  1YW0 A;  4EED A;  2N1G A;  4NUU A;  3JAE A;  5CA0 E;  1ZV4 X;  3ONX A;  3KV5 A;  2AE9 A;  5AQT B;  2V5D A;  5IUX A;  5J2U E;  2YN6 A;  3MK7 C;  3RYC E;  2C5J A;  4GYS A;  3LBX A;  4P0B A;  3T8O A;  5M4Y A;  4TWF A;  2LE8 A;  3BQI A;  3DJB A;  3OVU A;  3FXD B;  3SRZ A;  2YU2 A;  2BG9 A;  3HKC E;  3Q10 A;  5FXV A;  2VKJ A;  1M7K A;  3RKO A;  4EYY R;  2G5Z A;  2NOX A;  5AQF B;  5FXW A;  2V26 A;  4OFZ A;  3QK6 A;  1NEN A;  2X0L B;  5L3C B;  3UUX B;  1HR0 T;  2CMR A;  3AEG A;  3CQX C;  3UUB A;  2BVM A;  5F3J A;  5HWX A;  1OED A;  5KMG P;  2DL1 A;  4KBM B;  3SFE A;  1IAP A;  1YKE B;  5JQG E;  3ZCI A;  2SPC A;  3ZMT B;  4H9R C;  4EZ4 A;  2IUB A;  2RP4 A;  4DV7 T;  3IMG A;  3EDV A;  3UA0 A;  3P4R A;  2CXL A;  2KXP B;  4WW0 A;  2Q9Q A;  5KX5 E;  1S35 A;  4QH1 A;  1W0A A;  2BBJ A;  5AQR B;  2PTF A;  3JAF A;  4HWH A;  2LSJ A;  4MUK A;  5L2L A;  3P4W A;  4DR6 T;  2E5V A;  2XAS B;  4TNW A;  1JNR A;  2YEV C;  4BHR A;  1FEW A;  5HXH A;  3WAK A;  4LMJ A;  3E0Z A;  4JI4 T;  2LHR A;  1OED B;  4U2Z A;  3LE8 A;  4BJN A;  1MMN A;  1UGO A;  4DV4 T;  4AQF A;  1WFD A;  2V8S V;  4X65 T; 
#chains in the Genus database with same CATH homology
 2XAH B;  4HE8 A;  4O4I E;  4E7Z A;  4ERR A;  3NZP A;  2ACX A;  1UCU A;  1SA0 E;  4MUE A;  4N78 D;  4U72 A;  4OHF A;  4ZOL E;  3HR0 A;  5KDM C;  4AKR B;  4QX7 B;  5HXC A;  3IOE A;  1HG5 A;  2P9B A;  2LM9 A;  3AA6 B;  1D1C A;  2YK0 A;  3N2O A;  1LVF A;  4OYJ A;  2CE7 A;  2V1D B;  3K3O A;  3Q2M A;  2N2N A;  3CWZ B;  3LF4 A;  4QX8 B;  2A56 A;  4J2C A;  4JLE A;  3AA1 B;  4MAL A;  5AFU L;  2VB6 A;  3PDY A;  1N2H A;  3ZJ1 A;  2LOS A;  1QUU A;  5DQV A;  2NW9 A;  4AKL A;  5FXX A;  5LCY A;  3RC8 A;  5LNK A;  3ISJ A;  4IXJ A;  4DND A;  3V5U A;  4IHJ E;  1FIO A;  2V7J A;  3GN5 B;  2WAU A;  4L5G A;  3FBL A;  2LSI A;  2W00 A;  3KVB A;  3KV6 A;  2GK9 A;  3AAI A;  1MMD A;  2CCQ A;  4M1P A;  3VHL A;  5F8P A;  2E9X D;  4HGA A;  3F31 A;  2LEH A;  3GN5 A;  3O1H A;  4MQ6 A;  5JRC B;  5L3F B;  4JEU B;  2KWH A;  4B6X A;  5CA1 E;  2ZMA A;  1HCI A;  3SOL A;  2G2S A;  3OKQ A;  2CXD A;  3L09 A;  2EHO A;  4QKN A;  3J7Y q;  3KDS E;  2CEA A;  1N2J A;  4ZS3 A;  5HWY A;  4MUN A;  4DDK A;  4L9I A;  2NW7 A;  1E1H B;  2K24 A;  3M65 A;  4PNI A;  4UVC B;  1AJ3 A;  2G0U A;  3LJC A;  5LGT B;  2JQQ A;  3R6N A;  5LHI B;  4ZI2 C;  2NTX A;  1N2B A;  4PJM A;  4TV9 E;  1WRD A;  1MND A;  4UF0 A;  5HXS A;  3AA0 B;  4F6R C;  1N2E A;  3K3N A;  4MFR A;  3N9Q A;  2K48 A;  3C4X A;  5JDQ A;  2NTY A;  2V7K A;  1G73 A;  4TUY E;  2VAS A;  1O3X A;  5FY7 A;  2W61 A;  4ASK A;  2W62 A;  1ZHC A;  2XQY A;  3I9W A;  4ZI3 D;  2WMN A;  5HAX A;  4EB6 E;  4CXX A;  3ZN1 B;  3IEE A;  4HTE A;  4I55 E;  4AKH A;  3JC6 C;  5JDM A;  3KIN B;  5FY0 A;  4H9S E;  2A86 A;  1IHO A;  2LHN A;  4MUG A;  2Y8D A;  4BJM A;  2V7M A;  5DJQ C;  1LKX A;  5LG4 A;  5LYJ E;  2ZLY A;  4QXH B;  1BR1 A;  3CFF L;  1HTJ F;  3AAE B;  3NRX A;  5DAB A;  3ZPO A;  1LVK A;  4DO0 A;  3Q9D A;  3PUS A;  4MUF A;  2W63 A;  5HG0 A;  2XAG B;  3KFW X;  4GYR A;  1S94 A;  1US7 B;  4GK5 E;  3D0T A;  3E08 A;  3NBX X;  2G16 A;  2XTL A;  3C98 B;  3I1A A;  4YJ3 E;  4EFK A;  3CX6 B;  4YLH A;  1D1A A;  4H63 H;  4PK5 A;  5JDN A;  3VKG A;  4MUI A;  2IC9 A;  3KBT A;  3QTT A;  2KLQ A;  2K9A A;  3AB3 B;  4KP3 C;  1N2I A;  3UK2 A;  3IVX A;  3N2K E;  4KMC A;  3MZK B;  3P7I A;  2X9H A;  3AAA B;  3I9Y A;  4ILU A;  3PUR A;  1D0Y A;  2Q9Q D;  5FY1 A;  4CQI A;  5HXR A;  1G8X A;  2BVL A;  3AVR A;  4JEH B;  2KT9 A;  5ADX L;  5JR9 B;  5JRE A;  4V1A v;  2OA5 A;  1UFV A;  3IHR A;  1MMG A;  4OK0 A;  1V8F A;  3AG6 A;  1IZN B;  4AKI A;  3COZ A;  1BR0 A;  1VRB A;  2VK9 A;  4PK4 A;  3EDU A;  2A54 A;  4PAG A;  3IOC A;  4HN9 A;  2X67 A;  3ESL A;  1HF8 A;  2DCF A;  3C4W A;  2K5B B;  3GA8 A;  3HI2 A;  4DMV A;  3IMC A;  3N5L A;  3O1J A;  3B57 A;  1U5P A;  1MIW A;  2HH7 A;  5LOV E;  3N2G E;  4XAX B;  5E0O A;  3RRC A;  5LJN A;  2WMO A;  2EHO D;  4I43 B;  3S4U A;  5G2F A;  2L8K A;  4CI1 B;  4MLK A;  4CXY A;  3O1I A;  2LOP A;  4O2A E;  3OYX A;  3Q5X A;  2MTQ A;  3I0Q A;  1T98 A;  3WAJ A;  2DLR A;  2LSG A;  4Z8X A;  4ZS2 A;  1HG2 A;  4O4J E;  5L3B B;  2L3L A;  3LFM A;  5LHH B;  3F57 A;  2RA1 A;  4UEM A;  3RC3 A;  3HL6 A;  4WBN E;  3UUL A;  3UUN A;  4MUJ A;  4A56 A;  5HYA A;  2H7V C;  3W15 B;  2BZB A;  2ES0 A;  5LBQ B;  2DWG A;  4UVA B;  3ZMZ B;  5J1G A;  2ODV A;  4EF6 A;  3E22 E;  3CQG B;  2VWA A;  2A52 A;  3HKE E;  2NWB A;  3SS1 A;  4YHJ A;  4P0A A;  4WBO A;  3OBV E;  4U74 A;  2LJL A;  4DDH A;  4PW8 A;  2ODU A;  3FXE B;  4O8S A;  1MIY A;  3KBU A;  4QWN B;  4O4H E;  1X79 A;  5HXE A;  3IOB A;  5EXC A;  4BA9 A;  2A88 A;  3QC9 A;  1CUN A;  2N9D A;  3K3Q C;  4HFV A;  5DQW A;  4H9N C;  2CA5 A;  4IIJ E;  4NUV A;  4PFO A;  3COY A;  1WLX A;  1VOM A;  4O4L E;  1EZ3 A;  2DHR A;  3PUQ A;  1B7T A;  3NRY A;  4GIW A;  2Q9Q C;  3ZMU B;  4XBF B;  4DDM A;  4ADZ A;  4QXB B;  4KUM B;  4E7S A;  3KV9 A;  3IUE A;  3CX7 B;  3CFH L;  3BQL A;  5H6Q B;  1WYB A;  4PJJ A;  4X1Y E;  3R84 B;  2D5U A;  2E9X C;  4OYK A;  3MXZ A;  3UY4 A;  3OYZ A;  3N9L A;  4O2B E;  4PJL A;  3CKD A;  4EOZ B;  4AI6 A;  3FB2 A;  3DP7 A;  1LRZ A;  3ZEF B;  4MUH A;  2DWK A;  5FXZ A;  2UXN B;  5L3G B;  2XUE A;  2NP9 A;  2VL8 A;  5FP3 A;  4EAH A;  4TN7 B;  5M4Y A;  5LHG B;  2LSK A;  2QA7 A;  2A50 A;  5IHY A;  2V7I A;  2C0S A;  4FI5 A;  5L3D B;  3ZN0 B;  3BK9 A;  3WI3 A;  3CX8 B;  2VKH A;  1HFA A;  5LGU B;  3GMI A;  5J2T E;  4ZI2 D;  4YFS A;  5EK4 A;  3AA7 B;  2Y48 B;  2B1E A;  2MBG A;  1FMV A;  2X51 A;  4HKA A;  1YKH B;  2XAJ B;  1SHZ C;  3KV4 A;  3UFE A;  5LP6 E;  5IYZ E;  4H9P C;  3ZYL A;  1Z0P A;  3NZQ A;  2CLY B;  2JMK A;  4X1I E;  5EK2 A;  3P8C D;  4HEA A;  1MNE A;  4IE6 A;  4X1K E;  3OJA A;  4ZI3 C;  3C51 A;  4TX5 A;  2WSS V;  1ZEE A;  1D1B A;  3J9X 1;  5LA6 E;  2W0G A;  3C64 A;  3LK3 B;  3C4Z A;  2IAK A;  2J1D G;  4TV8 E;  3AG5 A;  3CFA L;  3ZYK A;  2Y6X A;  5JH7 E;  2X9W A;  3V5S A;  4CI3 B;  1BR2 A;  2V7L A;  5A1L A;  4P09 A;  2LT3 A;  2CM0 A;  2ZM8 A;  4EXT A;  2YU1 A;  2DI4 A;  2I59 A;  3I0O A;  3MUE A;  4WNK A;  2EHO B;  3HKB E;  5FYM A;  2D0T A;  4TZ4 C;  2CXF A;  3ZC1 A;  2A7X A;  2WM9 A;  1MMA A;  3GWH A;  3O4X E;  1N2O A;  3JC6 D;  4EZH A;  3VU7 H;  5FNV E;  2GW4 A;  3IBP A;  4UV8 B;  5EZY E;  3RRW A;  3KVA A;  2A84 A;  3MAC A;  3L3P A;  4DVD A;  1UX4 A;  2D2S A;  2EJC A;  3IVG A;  3IVC A;  4CXW A;  5FMN A;  5H6R B;  2D0U A;  5BMV E;  3ZLI A;  3RPU A;  5EK3 A;  2A3D A;  1WYC A;  2Q9Q B;  5JDG A;  1YW0 A;  2N1G A;  1BR4 A;  2YIN A;  3BQK A;  3IF8 B;  2M67 A;  2VKD A;  4NUU A;  3ZJ2 A;  5CA0 E;  1NWM X;  3ANW B;  1HX8 A;  1ZV4 X;  3ONX A;  3KV5 A;  4EYU A;  2PFV A;  4IE5 A;  3F2E A;  2KIN B;  4GK0 E;  4MBQ A;  4IE4 A;  4QXC B;  5J2U E;  1ZKE A;  2XAQ B;  3MK7 C;  2HPJ A;  3ZMS B;  5JRC A;  2X9X A;  3PU8 A;  3RYC E;  2H3R A;  3N9M A;  1KK7 A;  1OXZ A;  2C5J A;  3IOD A;  2MOZ A;  3CPZ A;  2ZM0 A;  3MA9 A;  3AVS A;  4GYS A;  5LBM A;  3H3A A;  4K0U A;  3ZCJ A;  4QHO A;  4ZI7 E;  3ZC0 A;  4DBQ A;  4G2A A;  2X68 A;  3Q5W A;  3LBX A;  3SWH A;  3TKL B;  2HPL A;  2KWI B;  4YJ2 E;  2A53 A;  4P0B A;  3T8O A;  3UTK A;  1QSD A;  4H9O C;  3U3I A;  5KWV A;  1IJ6 A;  1WR6 A;  2LE8 A;  3BQI A;  3DJB A;  1FMW A;  1YD8 G;  5JR9 A;  2CLY C;  3PUG A;  3PTR B;  4UEL A;  3RH3 A;  4ZHQ E;  1U4Q A;  3U78 A;  1HS7 A;  3FXD B;  3DTO A;  2DNX A;  1H7C A;  2XHE B;  2YU2 A;  3SRZ A;  3LG7 A;  3RX6 A;  3HKC E;  2L9Q A;  3Q10 A;  2NW8 A;  5FXV A;  5LXT E;  5JDF A;  2IC6 A;  2PBI A;  2VKJ A;  4AQG A;  2PG8 A;  2KND A;  4C91 A;  3FHN A;  4IE0 A;  3RKO A;  4PFP A;  3ETV A;  4EYY R;  1IJ5 A;  2BDE A;  2G5Z A;  4UXN B;  5TAO A;  3COW A;  4DBR A;  4UIG A;  2NOX A;  1OWA A;  2UXX B;  5C8Y E;  3LK4 2;  3PE0 A;  1D0X A;  5FXW A;  3PU3 A;  2JMH A;  2V26 A;  4OFZ A;  4IDZ A;  3QK6 A;  2X0L B;  2CWO A;  4UV9 B;  5L3C B;  5JVD E;  2A2F X;  3A5X A;  4PK6 A;  1KNZ A;  3CVR A;  3RYH E;  3COV A;  3UUX B;  3FBZ A;  5CB4 E;  4L0R A;  2QGS A;  4ISS A;  2X3F A;  4FZJ A;  4EIW A;  2CMR A;  3ZMV B;  3CQX C;  1Y64 B;  2WWU A;  4DE5 A;  2BVM A;  3UUM A;  4AQF C;  5F3J A;  4AXP A;  5HWX A;  2G3D A;  3Q12 A;  2E9X B;  5KMG P;  4C90 A;  3EUH A;  5ETW A;  3UT5 E;  2C5I T;  4KBM B;  1IAP A;  3CQC B;  1YKE B;  4G5Y A;  5JDL A;  4H9Q C;  3PUA A;  4IST A;  3O9X A;  3IUB A;  3LK2 B;  2CWY A;  3N9N A;  3EVY A;  4XZC A;  5JQG E;  3ZCI A;  2SPC A;  3ZMT B;  3K8P C;  4UF0 B;  3B13 A;  4UVB B;  4H9R C;  3MJX A;  5GON E;  4EZ4 A;  2JJ9 A;  4IGU A;  2PJQ A;  3CML A;  4ANJ A;  2KMF A;  3INN A;  3N8H A;  2RP4 A;  2E8I A;  2E9X A;  2C5K T;  4I50 E;  2JPF A;  3IME A;  3RYI E;  2JRK A;  3IMG A;  2ZM2 A;  3ANW A;  3EDV A;  3UA0 A;  2VKO A;  2XAF B;  2CXL A;  2KXP B;  4PJN A;  4WW0 A;  2EHO C;  3ETU A;  2Q9Q A;  3HA4 A;  5KX5 E;  1S35 A;  3N9P A;  4IE7 A;  4BAY B;  4CI2 B;  3H37 A;  1N2G A;  3N9O A;  5L3E B;  2WBL A;  2IW5 B;  3RYF E;  2LSJ A;  4G63 A;  4MUK A;  4JUY A;  5L2L A;  3ZYM A;  4AKG A;  2XAS B;  3MXT A;  2YEV C;  4GOU A;  4BHR A;  1FEW A;  2H7O A;  5HXH A;  2X66 A;  1MOP A;  2A72 A;  4CZZ B;  1NAF A;  1MIV A;  3WAK A;  3E0Z A;  4G5F A;  3MKD A;  2MYS A;  4H63 V;  2LHR A;  2Z6E A;  4FJO A;  5LGN B;  5LJM A;  1V9D A;  4DMW A;  2LSY A;  2KZ7 B;  3LE8 A;  1UX5 A;  4BJN A;  3QUJ A;  4X20 E;  3VKH A;  4MHC A;  1MMN A;  3HKD E;  5JDH A;  4I4T E;  4AQF A;  4MUL A;  5JR9 C;  2X9Y A;  3C50 A;  3LBX B;  1D0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...