1N2JA

Crystal structure of a pantothenate synthetase from m. tuberculosis in complex with pantoate
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
287
structure length
287
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords pantothenate synthetase
publication title Crystal structures of a pantothenate synthetase from M. tuberculosis and its complexes with substrates and a reaction intermediate
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 93
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2002-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 1n2jA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1n2jA01
1KP3A 5AHWA 4KKVA 2XRYA 3DLAA 4I6JA 4UZFA 3ZXSA 3COVA 1XNGA 2QJFA 3IDFA 4DJAA 1F4LA 1J09A 1JEEA 3ZIUA 1WQ4A 3ZJTA 2E18A 5J58A 2QJOA 1OWNA 4MWBA 2CSXA 3HGMA 3G5AA 3CR8A 1QU2A 2DERA 1N2OA 4KPUB 1JMVA 3KFLA 2PFSA 3HFJA 4EG5A 3CVXA 2QUHA 2CUZA 2TS1A 1MBZA 5TGTA 4TS1A 1R6XA 5K0TA 4MQ6A 1TYAE 1KAMA 4JZYA 1CT9A 3RJZA 2DEUA 3S3TA 3CLSD 1K4MA 2J5BA 4MVYA 4G5FA 4OUDA 2PIDA 2A7XA 4CT0A 3K9WA 3H9CA 1WKBA 3E27A 3VRHA 1T9GS 2YWBA 5IJXA 3Q12A 3FOCA 1N2BA 2E0IA 4F3RA 2A1UA 1S4MA 1MJHA 1M8PA 3FG9A 2J4DA 1T6YA 1G8GA 5DEOA 3HL4A 1GTSA 1O95D 3N2YA 4MLPA 4MWEA 3P0IA 3ZGZA 1JILA 1IQRA 1U7DA 1O0CA 2E21A 3PNYA 1O6BA 2EJCA 3GLVA 4EG1A 3U1VA 3AG6A 2PZ8A 1PFUA 3UY4A 1EFPA 4DDMA 2A1TR 3P0HA 4ZT5A 3A4IA 1I6LA 3IMGA 1MOPA 4XSVA 1IFXA 1ZH0A 2D5BA 1OBCA 2JA2A 4YBRA 1QJCA 3D6UA 1MAUA 1WXEA 1YI8A 4ZT6A 3CVUA 1O0BA 4EF6A 4J76A 1KQOA 4L2IB 3P52A 1MC1A 2JAXA 3SZGA 3TQIA 4WNYA 2QTMA 4P2BA 3CLUC 1ZJWA 1I6MA 1M8FA 2HGZA 1MAWA 1QRUA 1K97A 3IOEA 1N78A 3UK2A 3IVXA 1YIAA 4KPUA 1N3LA 1P7PA 3FI0A 5TEVA 3RBAA 5F23A 4EG8A 5HUJA 2GM3A 3DPIA 1KR2A 4ZT2A 1PFVA 4MUFA 2X1LA 2CV1A 5KWVA 3CLRC 4HJXA 4YP6A 4KR9A 3CVVA 3N05A 4ND7A 2YY5A 3FH0A 4MW9A 4KR6A 2R5WA 2BYTA 4MUJA 1IQ0A 2V0GA 4JYZA 2J09A 3SP1A 4CDMA 3SEQA 1GPMA 4G6ZA 3KT3A 3DV2A 3CLTC 1MB2A 2IJGX 2ZUEA 3FETA 3LCJA 3CA8A 1YIDA 1WJGA 4PBTA 1N2EA 2CFOA 2VXOA 3H99A 3QE4A 1IH8A 1NUSA 3SZ3A 4CQNA 1T6XA 1VBMA 4MULA 2EL7A 3ND5A 4RPIA 1KKUA 1MB9A 4YP7A 4NATA 1LI5A 2GKSA 3SYTA 4R2LA 1QTQA 2X1MA 4NDAA 1JZSA 2H2AA 1KQPA 2WB2A 3QTTA 1MRZA 4MUGA 1EJ2A 1UFVA 2X3FA 4ARIA 4UZEA 1H1TA 3MLBA 4NAUA 1XJQA 2A86A 3DO8A 4XFJA 2CT8A 1KH1A 3RFFA 2CV2A 3ISJA 2XRZA 3IMEA 3PNVA 5J59A 1NSYA 3JXEA 4HK4A 3AIIA 1QU3A 2NZ2A 3L92A 1OWPA 2Z09A 4L2IA 3UOWA 2X0KA 1A8HA 1WXHA 3HZRA 3MXTA 2AKEA 2A84A 1WOYA 5HG0A 4JXXA 1PG0A 1H3EA 1V47A 5LM3A 1N2IA 4EG6A 2OV4A 1LI7A 3H9BA 5KHAA 4MUNA 4XFDA 3VGJA 3L93A 2CV0A 4ZCPA 3IOBA 4MUIA 3A2KA 1D2RA 4MW4A 1TYCA 3P0JA 1TFUA 1COZA 4NAHA 2DLCX 3H05A 1FYDA 3NBAA 3Q10A 3D6VA 5KCMA 1WY5A 4JXZA 3CVWA 2YWCA 4ZCRA 2ZUFA 1IRXA 4PBSA 3N8HA 1KH2A 2VTBA 4CDNA 3CVYA 1YULA 1I6KA 1ULHA 3KT6A 2HZ7A 4EG7A 3OTWA 2A1TS 4ZCSA 3TZLA 3VU8A 3IUBA 3F3MA 3ZJVA 3IH5A 4MAFA 1J20A 3C8ZA 1EXDA 2V0CA 4MVWA 1O97C 1IVSA 1JIIA 1O5TA 3AFHA 3MLAA 1N2JA 4FZJA 1GAXA 1IQUA 1Y42X 4AQ7A 4MVXA 1U3DA 1NURA 1JIJA 1QRSA 2A4MA 3ND6A 4NZPA 1WQ3A 1QRTA 2WSIA 4J75A 2ZP1A 1TEZA 2O5RA 4PBRA 4WSOA 1Q15A 4DDKA 3NBKA 3ELBA 4QREA 4AS1A 1N1DA 4BWVA 2PXHA 4QBTA 2J08A 3K32A 1GN8A 4PY2A 4Q93A 1Q11A 3FNRA 4EG3A 5IHXA 5LFAA 3NV7A 1TYDE 3TQOA 2IP1A 4X0EA 3X1KA 5DASA 3QTBA 4GRIA 3COWA 1J1UA 1ZUNA 5FO1A 1O94D 4OUDB 2CYCA 4JFAA 4EFKA 1JECA 1VBNA 2QTRA 4MVCA 1M8KA 1M8GA 4ZCQA 2PG3A 3LOQA 2J07A 3HV0A 3UMVA 1NUTA 1K92A 2WQ7A 1WZ2A 4MWCA 1NUQA 3FDXA 1F9AA 5DK4A 3FY4A 2D13A 1N77A 3MMXA 4E1AA 2DPLA 1J70A 3OP1A 4MW1A 1QQTA 2C5SA 3CLUD 2G36A 1N2GA 3BL5A 1FFYA 3KT0A 1KORA 3N9IA 4S1OA 4U8HA 2D54A 3PNBA 3HMQA 5HUHA 3CLSC 3ILVA 1VLHA 1LW7A 1O96B 4R0NA 3SDBA 1PFWA 3CLRD 3PXUA 5H16A 1H3NA 1TQ8A 4DLPA 3G59A 3A05A 1B6TA 4I6EA 4EG4A 4ZT4A 1I2DA 1WXFA 4U7JA 2QUJA 1KAQA 1M1ZA 2I1LA 1VL2A 3SEZA 2IELA 4EGAA 3CLTD 1N2HA 3MUEA 1EFVB 2Z3VA 4ND6A 3TZEA 2AZXA 1R6TA 3H97A 3ND7A 3ZUGA 1GLNA 1O95C 1X8XA 2CYBA 3COYA 4ZT3A 4ARCA 2NSYA 3LE8A 3FIUA 3RK1A 3TNJA 5BNZA 3UC5A 4G5YA 1XNJA 1VBKA 3A04A 3FWKA 3G6KA 5K0SA 3KT8A 4MW0A 5TEWA 1RQGA 4NX2A 1M83A 4GU5A 4I6GA 1KP2A 1OD6A 4DDHA 3RHSA 3ZXIA 1EUQA 2DR2A 1U3CA 1OWLA 4MW5A 3IOCA 1OWOA 5JBNA 1IHOA 1Q19A 1GZUA 1JIKA 3GUZA 1F7VA 3IODA 1JGTA 1SURA 1T9GR 2QUIA 1G59A 2YXNA 1XNHA 3IMCA 4MUEA 3FHJA 1N75A 4K0RA 2GOYA 3AG5A 1Q77A 4OJMX 2H29A 4MW2A 3AL0C 2AG6A 2QTNA 2A88A 1JZQA 3X1MA 1NP7A 1NYLA 1G8FA 4KR7A 3COZA 4HPWA 1R6UA 2QUKA 4Q16A 5DB4A 1O96A 2PZBA 1ILEA 1U7XA 1O94C 2WQ6A 5TS2A 4K03A 1BS2A 5FNZA 1K4KA 4F4HA 1WXIA 1PG2A 1DNPA 2RD2A 3INNA 4HJRA 4RUKA 1NZJA 2CYAA 1YUNA 4MWDA 1EFVA 2DETA 3X1JA 2PZAA 5FO0A 1U0BB 2QJTA 2OQ2A 1J21A 3TS1A 4MUKA 1H3FA 4DNXA 1TYBE 1O97D 1JHDA 4YMIA 2RE8A 1T6ZA 3IVGA 2E89A 4DE5A 1NI5A 1EUYA 1HYBA 4U63A 1ZH6A 2A1UB 5LLTA 3M5WA 2BTEA 4A91A 4MW7A 5J5AA 4H3SA 1EE1A 2B7LA 4MW6A 1KQNA 5H7XA 1GTRA 3PRHA 4ZCTA 1OWMA 4QRDA 1X6VA 2HMAA 2O8VA 3I05A 4R2MA 1J1ZA 3IUEA 2DXIA 1G8HA 1NUPA 1V8FA 1PFYA 2VTBB 1F7UA 3IVCA 1QNFA 2Z08A 4ZT7A 1WXGA 1NUUA 5EKDA 3AKZA 1KH3A 1M8JA 1YUMA 4YP5A 1EFPB 4MUHA 3ZJUA 3RK0A 1JEDA 3GMIA 3Q4GA 2DUMA 1OBHA 2JANA
chains in the Genus database with same CATH superfamily
4TS4A 1AKTA 1VHWA 2DAPA 3UKJA 4B6GA 1I94B 2JFFA 3OPYB 1K5GA 2GDZA 2BGUA 1B8NA 5DSZA 3A1EA 4M0DA 4I7EA 3D0KA 3GOQA 3MN1A 3JALA 5B1HA 4DJAA 5LKAA 4OGKA 2FX3A 2ZANA 1GPAA 1L4GA 1P1BA 3H1FA 3QBJA 3UCEA 2OLJA 3ZBPA 3ZW8A 3ZJTA 5HIIA 1Q20A 2JCVA 1M2JA 4ZQIA 1YKSA 2PSEA 1RZ3A 1ESDA 4LFBB 5ALJA 1DRJA 1XTIA 3I83A 5K4GA 4U00A 1XIVA 2YW9A 3HKCA 3DTVA 1S2DA 4AUMA 2QQEA 3SS9X 4UAJA 5ALPA 3WDLA 4EHFA 4DV3B 4Q82A 4Q3OA 2QTVA 4Q5IA 5DHFA 3DV0A 5M04A 4TS1A 4WN9B 3TIIA 3FBWA 2EZ4A 1KDTA 2H1VA 2XMGA 3GGCA 2NU7B 3W1EA 1ENZA 1GO2A 1ML4A 3DZDA 3JD1A 3UV6A 4V0MA 2VJAA 5JPDA 3V46A 2VUTA 5C7OO 1IN7A 4EJFA 3LKBA 3K9WA 4I2VA 4E2XA 5K20A 2C2ZA 2BF7A 3C6QA 3CNOA 1LC0A 2CLEB 3W04A 5KKNB 3QEMB 1UT8A 4X3CA 1GLGA 3NATA 4CKEA 3AF2A 1D1PA 1ZCFA 3PC4A 3NETA 3BMOA 3PENA 4YO8A 5L3QB 3C6KA 1L5MA 2HFKA 2NO1A 2YMQA 1QIDA 1XB2A 2QPAA 3H3JA 3CF2A 1EFRD 3PPVA 2RGGA 3DVQX 1LDYA 4ALNA 2QLMA 5CURA 4F3CA 5TNXA 1SVIA 3INYA 3S2IA 1GGJA 4MLPA 2I3GA 3FGNA 4GFDA 2X4IA 4FT2A 3IFSA 4WLVA 1FDIA 1IUPA 5FTWA 1RRVA 2BW0A 4J9UE 1XZGA 1R8JA 2YJ5A 3F71A 3PNYA 4BGEA 3HCOA 4TZKA 2PZGA 3C16C 3GLVA 3ZUPA 2X8LA 3SIRA 4GBJA 4OQPA 5JY1A 2RGWA 3PC7A 5TMBA 4ESVA 4PFSA 1PFUA 1BKYA 4XD7A 5EJEA 5JMOA 1EK1A 2X76A 4DDMA 1CYEA 1EG2A 4GI7A 3NX4A 4BFCA 3B1FA 1W46A 4P2GA 3T3MB 4DLKA 3HB7A 3KUUA 2WYUA 4UM5A 1G2PA 2G4CA 1HZZA 1QQ7A 3RRZA 4N8DA 1NJ1A 4NONA 2F4VB 1W30A 2R1TA 5FYQA 3TNFA 1POWA 2B92A 5HVNA 3NOQA 2I33A 1NZDA 1Z4KA 3KSAC 2XE6A 3WDKA 5HRAA 1N2CB 1R7RA 1U3WA 1SU6A 1ZVQA 4BGIA 3WV4A 1TGYA 2ZU6A 5KHLB 4HWRA 1P3JA 2A6PA 4HNUA 1NE7A 2ZE5A 2OLEA 2WZCA 1II0A 4BRUA 4XI9A 4E12A 4QJ4A 4F4CA 1G5PA 5D6OA 5IXYA 4QTXA 1I6MA 3IKTA 3PD7A 2HDNB 1CUZA 4D9JA 3IGFA 1NAIA 2VF8A 4HWKA 3UYKA 1K97A 2OBNA 1N78A 2C2YA 3QFCA 1NSFA 4Y2PA 2ZM5A 3ZWQA 1DTWA 3PPIA 2FH5B 2ZIFA 4M0MA 1JEQB 4IJUA 4BNWA 2X1HA 3NHSA 4G5OA 2XWQA 1KFBB 1X7XB 4NFYA 4XRRA 4FVTA 1ZBDA 1ZD3A 1JQ5A 3FDIA 2VF7A 1Z2NX 1ZWLA 2DG2A 3PFFA 3RF6A 4ND4A 1ZUWA 1E96A 3HXQA 3ZI7A 2H0QA 1IUKA 2PX6A 1B3BA 3N05A 3MCAA 4CCWA 1CUFA 4W7HA 1M1NA 1NMYA 1F1JA 3FFBA 1OH7A 4ERXA 3NYQA 4FQ5A 2PH5A 4B84A 2QB5A 3G02A 4BLTA 3DP7A 1I01A 1GPMA 1O9HA 2P40A 3MWEB 2EX0A 3PHJA 4EL5A 3E6AA 2ABWA 4RK6A 1ZOPA 3C45A 2HCFA 3VH1A 2JCYA 5JVDB 4Q3NA 1B93A 1NQTA 2SICE 2YVKA 1M0WA 4MICA 4UHFA 5K51A 1JBEA 5HK8A 3TW0A 3LCJA 1V26A 3CA8A 4I81A 4X63A 2UUBB 4KN9S 1K68A 2ZTLA 4B3CA 4M1KA 1B41A 2V45A 4FQ8A 5BWBA 5J4HA 1RYEA 1KSJA 2DBYA 2QF7A 3L8FA 1WF3A 4YRQA 4E5KA 2Z2KA 5EPOA 3NWPA 3T1NA 4UHKA 5JVDF 4JL5A 4TMYA 4BP8A 3AHCA 5A02A 4OHOA 4RQAA 2HQBA 3MT7A 1QPGA 3OCZA 4X71A 4OHWA 4I4IA 3SC2A 1XG5A 2C5AA 4KN8A 5AXCA 1YTLA 4Q9LA 1U80A 1B3RA 1PT5A 3IB6A 4TKUB 4CMKA 3U61B 1JPJA 5DP2A 1EJ2A 1UFVA 1W47A 2AFIB 2WKQA 3AEZA 3HLTA 1PS9A 4YRSA 1HYGA 3OQ1A 3W7AA 1AY0A 3BXZA 4G4IA 4BRWA 2C3UA 5M3BA 3TG8A 3ZGYA 3MFYA 3MTBA 2ORVA 1HT0A 2Z8YA 1RJFA 1XZFA 2A78A 4OI2A 3JXEA 4HK4A 4CF7A 2W43A 1DIAA 3COPA 3DB2A 3IDAA 3CZ9A 3P9QA 4MTLA 3AQIA 2PGNA 2X0KA 1WXHA 4RABA 4EFNA 5ITSA 4IQ8A 3B3FA 3G1TA 2GAFA 4M9UA 2ZYIA 2BMDA 1QNLA 4HDSA 4N49A 4WEQA 5LZ7A 2WJAA 3TM4A 1Q6ZA 3TFOA 3D6NB 2H2WA 3FWZA 4DV1B 1N2IA 3OJFA 5LBIA 1SC6A 2JK1A 3G82C 3KLPX 2IYRA 1ZISA 3R5TA 5KHAA 3H9BA 3ZYCA 1KHHA 2C2WA 4LOKA 1GTL1 3DL0A 1EFKA 1BXRA 1KK3A 1D04A 2ECQA 2ZRDA 3GEIA 4K9DA 2JFOA 4LMAA 1TK3A 5HYVA 1FB5A 2FP4A 2FN3A 2JFVA 1E2UA 2MTBA 3GVHA 3G1WA 4PSDA 4RO0A 4K9MA 1USUA 4IV5A 5BR8B 2PY6A 3UB3A 1U8UA 2Q3HA 2Q27A 1RXEA 2BHTA 3F5DA 3FPEA 2C5GA 4H4CA 3ZY6A 3R5KA 1EFAA 4B35A 5HF8A 1GZSA 3OEHA 1W0JD 3RFUA 4AIIA 1CB0A 2HLNA 2XIQA 4FJ2A 4L0CA 3ZNOA 2BIFA 4UUNA 4B3HA 3VR6H 2FW9A 3G5MA 3S2FA 2OGUA 1WEKA 5D3KA 3GJQA 2IGTA 1HL3A 3SQMA 1QO0A 3CISA 2HPZA 1IPHA 3MNFA 3AJDA 4PFQA 4Y6GB 4CHTA 2NSHA 4KPEC 4FHDA 1CUIA 3UEOA 1GG5A 1DUSA 2KLHA 2R751 4K9PA 2PX5A 2CXHA 4QUEA 3OTHA 2ZT7A 5ER9A 1ONPA 1ETHA 3B3AA 3VU8A 1RLJA 1XZ8A 2AI3A 1LTKA 4QUDA 2C4TA 3FFXA 1UWLA 1E3EA 1JS1X 3P20A 3I23A 4E11A 1SKMA 1FSPA 4TRMA 3C3KA 4FFBB 4QU0A 5K9ZA 1ODIA 2A14A 3GJ3A 5HKBA 2CL6X 3OZTA 1L7OA 2F43B 3FCYA 1RRCA 1Q1ZA 2JI6A 5FPSA 1G6KA 1S6YA 3LQRA 3NS7A 4WADA 4CF3A 3DKVA 3NTQA 1BQ3A 1JDTA 3KYIB 2KX7A 5B6JA 1V3QE 1L4EA 1L4MA 1MR3F 2Y4NA 3QU7A 2IDMA 4ZAVA 1LXCA 3V4SA 4TS3A 3NGMA 2Q1YA 2IIPA 2E4WA 5J4VA 1CUHA 4GM0A 1YRWA 3JALB 1GPNA 1VIMA 1G9SA 3NAQA 3ELUA 4ND5A 4YRAA 2RK3A 2FWRA 2BUBA 3DEFA 3NVKI 4P5PA 3TRJA 1VE3A 5CP8A 3RROA 3TOZA 4DDTA 5KVSA 4K9RA 3G13A 3K0KA 2GF9A 3RH0A 1OYWA 1RI2A 3RSHA 5TV2A 3K32A 4Q7KA 2UZ1A 5HS6A 3TSCA 5CA0F 1Z5ZA 3DTVB 5CG2A 1QYCA 4EJMA 3QV2A 2FK7A 2OZEA 4UVDA 1XPRA 3FCXA 1JHPA 4GSLA 1YRAA 5I9BA 3S7ZA 4DBLE 2OXFA 1PK9A 1L1FA 1GG2A 1XTQA 1XPUA 5ADWA 1D0VA 4PTZA 1AHIA 4J0CA 2XGOA 2JLAA 3DAHA 1T29A 4MLDA 2GMWA 5KNDD 4M1OA 4RVHA 1QHIA 3VDQA 4YAIA 2JH8A 1M8GA 1PLLA 3DFZA 1A8PA 3LVFO 5CB6A 5CA0A 4XDZA 4QLBA 3FYTA 3DGEC 4I4NA 5FTKA 4WPGA 4CI0B 2C2HA 2G9QA 1QGAA 1FLVA 1Z75A 3LDAA 3SLKA 1XALA 1JH8A 1JYEA 2A5DA 2O7RA 2PSJA 4RTQA 4ZO9A 4B6RA 2HO4A 4CKEB 3BSWA 2BGKA 1RRMA 2ZB3A 2VAPA 2IYPA 1NM5A 1SMKA 2PO7A 1KY5A 2MYTA 3IULA 3O2JA 4ROSA 1L5KA 3P32A 3TPFA 4ZYTA 4LSWA 1WBDA 2HBZA 1MW9X 4XCQA 3EXFA 1TC1A 2LP4Y 3R2JA 3TWOA 3QYAA 3VZCA 2X9NA 4C0WA 5LWHA 4F2DA 1FFDA 1FFYA 1Q7EA 1HDYA 1MG0A 1RRFA 2AXQA 4Y2HA 1FW6A 2D54A 3A6DA 5FAKA 4YI3A 5LYJB 5JISA 1DRWA 5DM4A 2JHGA 1JJ7A 1ZINA 3CPEA 1B1CA 3DOUA 1IXYA 1JXQA 3HN7A 3ILVA 4LJYA 2BKAA 2PE5A 5IZ4A 1FEZA 4LCJA 1Q1GA 4J9VA 4DVGA 3CLRD 1SBZA 3EZ6A 2OORC 2O57A 4QUBA 5KNCH 2ACKA 5LYJF 1YASA 1IAVA 4ZT4A 1RYHA 1WXFA 1L4LA 2F4NA 1MB0A 2AOVA 2FSVA 1P9NA 4J3JA 7ABPA 1XZJA 3U4QB 2R1TB 1Q14A 2OESA 4XWKA 2IELA 4B76A 2GEVA 2XY4A 3ICCA 3GVIA 2HWXA 2ZWVA 3H97A 1ZC4A 3L0PA 2AWOA 1ZIPA 5F1PA 2VWPA 3IT1A 4IBOA 1ONSA 3AUXA 3DGFC 4MJ3A 3INGA 4F9TA 1BXKA 1HE2A 2Q07A 5CU7A 1XZCA 1W4AA 3TNJA 2IDJA 1V7PC 3RGWS 4Z4IA 5CJPA 6YASA 1KFCB 1RPJA 3MFQA 3T7SA 3ZHRA 1YIOA 3PF8A 2FTKE 2W9XA 2VA8A 3AR5A 1KHTA 1KXZA 1DFGA 4L15A 3AJ9A 3UUGA 3PEVA 4CYMA 3AP1A 5TQ2B 3Q3JB 2P91A 3E2IA 4LV6A 3A1VA 3UK6A 2UYGA 3EJ6A 2DM6A 4BNHA 2ZJ1A 3P8ZA 2JNWA 4JJ8A 5CVVA 4QUIA 2PKRA 3WBFA 4E3ZA 3JZDA 1V3TA 4RKEA 4L8FA 4ZV4A 2I4LA 3ZEAA 5BUQA 1KIFA 1B43A 3D8BA 1Y4UA 4F2HA 3ZDZB 2I87A 3IPRA 2WMNB 1KJNA 4KXFB 4YJGA 5FA5A 2VCYA 3JRNA 4BLQA 1N5KA 2WNSA 4LQ4A 2P6MA 3EH1A 1OR8A 2H1LA 4H0NA 3ZV4A 4A27A 4D6YA 5B7GA 1BGXT 2JF0A 2CMDA 4B4OA 5AJXA 2ZZNA 2A58A 2WD7B 3ZY2A 4PNHA 2B8WA 1B0ZA 3ADOA 4RK5A 2IW3A 2PD6A 5DMXA 4MB0A 1CERA 3P4YA 4Q7EA 1GQQA 4RMNA 1U1IA 1XEAA 4GVLA 4FOSA 4XGQA 3WGLA 4BE4A 4F4FA 3D64A 1AZTA 2QUKA 4LVNA 4WL0A 4Q3LA 1X1AA 4R8MA 2X9VA 5CFNA 2VG8A 5D2CA 2PZBA 5KDDA 4HP8A 4A9AA 2ONKA 2W0MA 1WV0A 2JGDB 4LF4B 3H3FA 1C3LA 5CIWA 4M0UA 5AVTA 5JAHA 3JTMA 4YGXB 3Q3EA 5JO9A 1FMLA 2MDTA 3FX2A 3D43A 2QG9A 4ILKA 5BYKA 3HBJA 4P1ZA 4DC0A 1GN9A 3Q2OA 2WU8A 3INNA 4RK1A 4RVNA 3RO7A 4UOEA 2W2LD 3RI3A 1EVLA 3Q7TA 5KS2A 1RHRA 3U26A 1Q95A 4DIKA 5JC1A 2GFQA 2PMDA 5KTTA 1ZGHA 3E48A 3AKCA 2KMLA 3DM9B 2ZSBA 4MH0R 1GPLA 1DWPA 2BRUA 1IZYA 2ZB8A 3OQJA 4XLZA 5K3CA 1CJTC 4HDSB 5CTAA 3O8QB 3U9TA 3OA2A 2HMWA 3TINA 1C3OA 4PRKA 1SR8A 3OM1A 4Y9TA 1BXGA 4BPBA 5AKZA 4M38A 4OQZA 2E89A 4UUAA 4KIJA 1P1IA 5TRTA 1DRUA 3PWZA 4DA0A 4HQOA 5BNWA 4B79A 2UAGA 1ZH6A 1EMDA 3QX9A 1AD2A 4GVXA 3ZW7A 3GRZA 1VJDA 1RLOA 4ZGGA 3REQA 4YS6A 5IKMA 1DQSA 3RC2A 3GG9A 1YT5A 2G08A 4G07A 4FKMA 3KOWA 1OXVA 4DMUB 3L6CA 4HOYA 3FRJA 4PG6A 4BFYA 1JPNA 4AKEA 5LZ5A 2MT9A 2VP4A 4ZO6A 3JQBA 3IUPA 3M81A 2JGJA 3W2EA 4P4SA 3IUMA 5JXHA 2PGDA 4KWTA 1A7AA 3R41A 5AUPB 1UF9A 2UUCB 2HI0A 3OTOB 1D9XA 3NHWA 4GPBA 4NHEA 5HDQA 1NVKA 1FC0A 1H2ZA 3MCVA 4IIYA 1MOSA 2ECFA 4DBLC 3K2QA 1I4WA 2TSYB 4HAZA 1A4IA 2F9FA 5KUTA 2FFHA 4MPPA 3E9DA 3Q2KA 3Q8XB 4RSHA 5HA5A 2PUEA 2SNIE 2C2GA 3OZDA 3R7LA 2A3RA 2G9RA 4TQAA 4QWMA 5LXTA 3MSCA 4C0XA 4BATA 5FLKA 3PRYA 3L0ZA 3TTXA 3M89A 2XYGA 1LRLA 4KWCA 4DCCA 3LXMA 2C20A 2Q3FA 3IR7A 3PE4A 2A8YA 3C87A 3EHDA 3KCNA 2VHUA 3ITDA 1VSBA 3ZXUB 1Z0IA 3JSAA 1DEXA 3BD9A 2YWGA 4A73A 1ZOSA 1NR5A 1F2DA 2EFJA 5AOCA 4JBIA 1BC5A 2AG5A 3H2HA 5KNLA 2HPHA 2Q1WA 1R18A 2J5RA 3GFOA 4P9NA 3ABIA 3TDMA 4P53A 2VWQA 1GHTA 3PR2B 4JZKA 1Q57A 5IP5A 2I3ZA 3TDKA 3HH8A 2R4QA 2R6HA 5H4GA 4MQ6A 5HNKA 2DFNA 2EKQA 2AA3A 1YJQA 2F1JA 4Q01A 1FQOA 5DOZA 5AXBA 3RV3A 4C0BA 2BONA 2DFDA 3CH4B 4G5SA 3CEHA 3S68A 3C1UA 2A7XA 4XVQA 2WSYB 3H2GA 4TWIA 4KWIA 2F6RA 2WU1A 2Y2UA 3KE8A 1V3UA 3EC7A 4I0WB 5JECA 1MQAA 3NH9A 3OTIA 5EHGA 4JT9A 1FDWA 4E33A 3ANTA 4F3RA 1D1TA 2PL9A 2ZXUA 4NCBA 4P58A 3BXXA 3LQYA 3T9CA 5L7TA 4LNHA 1ZA1A 2FFRA 3QVGB 2ATXA 4FUQA 1M1UA 4NYIQ 4PYIA 2ECOA 3UG6A 3QHPA 4LZZA 2OCLA 3GD5A 1JA1A 2X0DA 1XZBA 4JJ7A 1G8PA 2VDVE 5DEOA 4X94A 3IAXA 1TCVA 3C8DA 5FP0A 3M82A 1GTSA 3I0MA 4X20B 5A6VA 4LF9B 3VV2A 2HIAA 3ZGZA 1J4AA 1QH9A 1V4BA 4H7EA 5C81A 4OHZA 2L18A 4MWSA 2XSZD 4WX2B 1C7RA 1LK0A 4G1EB 1XTUA 4DMRA 3QJYA 1RWVA 2C57A 4EB8A 1DIRA 1G7CA 2IEBA 4X6YA 2R0QC 1EDZA 2GPYA 5BV0A 3D4OA 4YRLA 5ALIA 2FSPA 3W6UA 5KQGA 1WCWA 4ZAXA 3ZV5A 3QM1A 1W36C 3CNLA 3IMGA 2ORIA 2SKCA 4URFA 5LZ4A 1KPIA 3BXFA 3O75A 4FJ1A 4B6QA 2GXAA 5HKKA 3LIPA 1HURA 1XLUA 2I2WA 3IBFA 5E3IA 4ZI3A 3HS3A 1B0AA 3E22B 1I10A 3CNEA 3W5UA 2YYAA 5EMNA 2JAXA 3HI4A 8ATCA 1G4UR 2PZFA 1KEVA 2OHOA 2IZZA 2AWNA 2FUEA 5FBHA 3UW3A 4OUKX 2H11A 3HJAA 4PSCA 3QLVA 3HN2A 4LJRA 4CLHA 3P5SA 1QHSA 1KAOA 1G3RA 3SOZA 1M7BA 5FT9A 3FI0A 2G76A 1ZXLA 1AQYA 4MUXA 621PA 1RE0A 2PRZA 2Y1XA 4XB1A 3FOFC 4Z4QA 5CLJA 4EYGA 4R81A 3AV0B 1F8UA 1OGYA 1PFVA 4DGSA 2CV1A 4KDFA 3MYRA 2CJFA 4ER3A 1JTEA 3NTXA 4TSFA 4HNGA 1GKIA 2PMKA 4MW9A 1R10A 1Z7EA 4Z8XA 4E5PA 1IQ0A 2J59A 2WF8A 3HCAA 4ZMBA 1PQ4A 4PZZA 3SEQA 4AULA 5JCJA 2YYZA 5ICGA 1EINA 3ISTA 4LJSA 1DBRA 3B6ZA 4X95A 2A9QA 3UVEA 1QV7A 3L1JA 1PZXA 2QZZA 3JW8A 1Z56C 4RD4A 4TVBA 2MYPA 1MQSA 1PZHA 1RLUA 2TMGA 1BU8A 4IXDA 4M22A 4EX6A 1Q92A 5JZVA 2FZKA 5ICMA 4ZJUA 1DRVA 4H7KA 2AUNA 4BMOB 1QK3A 2VL7A 3EXEA 3FJYA 5CYFA 4MULA 4AU1A 1AHNA 4QBHA 3ER6A 1KA9H 1VG8A 1WKVA 4PZDA 3GW8A 4RPIA 5F7JA 1H2HA 3OZGA 2MJLA 4IXMA 1EHYA 4J7CA 3GGDA 2D8MA 3VYRB 4B6EA 5HR5A 3NEPX 1ZDMA 1LRJA 3HVKA 1W5TA 1AXGA 3JX9A 2F1KA 2JPDA 5FKJA 1E0SA 1ULSA 4PN3A 4LYGA 6NULA 2Z9BA 4ZYVA 2IHVA 3D2LA 4Y2QA 4E21A 4L5AA 3QTTA 1LS6A 1KOJA 3FVVA 4MUGA 2C7GA 1GR0A 4BVAA 3R7NA 3HJRA 4BV2A 4UZEA 3OJXA 4X90A 1E98A 4NAUA 1RQPA 2WG0A 3U7RA 4GQBA 4JV5B 2JLBA 2H4JA 3OZWA 3PZRA 4GQIA 4GWKA 1FX0A 1FU8A 3CTMA 4XH9B 3PXGA 2W2XA 2B1IA 1FFXB 4CUJA 1H8HD 3QYJA 1SOVA 3VSEA 1Z39A 1V5WA 1PWXA 2NZ2A 3HZOA 1QU3A 3G8YA 5BN3A 4N7BA 5AP9A 5B7PA 5JDIC 1T3TA 1KR5A 4DYDA 1T34A 2EVWX 1XKQA 2F9LA 2Z4SA 4IJ6A 1VPDA 3K09C 3WGOA 5B7QA 1JDZA 3A1CA 5M34A 4PLYA 1JXAA 1KZ1A 2H07A 3KTAA 4ZVQA 1XQVA 4KMRA 4HDRA 4UVHA 3WADA 1Z5VA 1KGDA 1JDVA 1MOZA 1T6BY 4AD8A 3SD7A 3ZWAA 2E3JA 2V59A 2OV4A 4PXSA 3V2GA 4MVJM 4BHRA 4X64B 1NBIA 2DH5A 3AFNA 4MZXA 5F4BA 1TK2A 3K8ZA 4CQJA 4ZVPA 4MUNA 1RWNA 2FE1A 1NP6A 3DEZA 4XFDA 3VGJA 1Y82A 3IT3A 3JU3A 3HJNA 4JJKA 2YQ4A 5E6SA 2WNHA 2EEZA 5T6MA 3QU9A 4P3PA 1TFUA 4QYTA 1XNRB 3MD9A 2ZPAA 3FKSA 4D9FA 1D4FA 1COZA 1VTKA 3C2QA 4I19A 3LDGA 6GPBA 2I22A 4FFNA 4JY7A 2XYRA 1E4VA 5EIAA 3FFTA 2LV8A 2IYYA 5LDDC 4A0QA 3K8YA 4LC0A 5HJEA 5EOVA 1W4LA 5H02A 2GRUA 3H4MA 3QUQA 5JNUA 1U2DA 2GCOB 2O4CA 2P69A 2FPIA 4OHUA 5D1HA 4MMXB 1QMGA 1R8XA 1TIKA 4C20A 1W6RA 4EHKA 4IOKA 4YAOA 1GFSA 4BVHA 3Q0TA 3TIXB 1IG3A 1LDGA 4EHLA 1A9RA 4HSGA 4TOIA 3ZTTA 1JIIA 4YJHA 1GAXA 4NCIA 2F8SA 1NW6A 1VKNA 2G1PA 1IJBA 4UUPA 2JIDA 2K7ZA 4C7OA 1IBRA 2QRGA 3R40A 3O74A 3PE3A 2PRYA 3O3OB 3BHMA 4B80A 4E5YA 1GZ4A 4MQUA 4RZIA 2RCYA 1VBFA 4IYJA 2FPRA 3F6RA 4JHLA 4C4ZA 1UDRA 5BMOA 1T9DA 3DMYA 4MVJH 5BR1A 5DT2A 1E9AA 1SG0A 3PICA 2WWYA 2J7PA 4KH0A 2ZRLA 2J3LA 2HB6A 4MYSA 4KRXA 3PVZA 5D3ZA 1GQFA 1WHSB 4A92A 4BJ5A 3WQHA 2H57A 1DC8A 4U0KA 5L3VA 1BOFA 3CNBA 4U6NA 2I8LA 1RLIA 4XVRA 4QBTA 2B61A 4ZPXA 4HAXA 3D4BA 1TJNA 2V7BA 4YXWA 2DT8A 4V38A 3KQHA 5DBIA 1VPWA 2G1UA 4RW0A 4OQDA 4O59O 3CF0A 1C4KA 1JTVA 4QQRA 3U7FB 1B14A 2UYYA 4C2TA 3BA1A 1N8KA 2HPVA 4DLUA 4JQOA 1VB3A 1SUWA 2PD4A 3EODA 5BVGA 2A5GA 4R9RA 3AESB 3ROZA 3U5TA 1UJCA 2UZAA 1LSJA 3KEQA 1P81A 3U16A 2AKYA 4G0ZA 3CZPA 3KZNA 3QZUA 3B70A 2GEKA 2JAHA 2WJGA 5AVJA 4HMPA 2V6FA 3CX6A 4CHGA 1DHTA 5K4AA 3FDXA 4FN5A 2DQSA 1YJXA 4BFZA 1Z29A 1EQ2A 4BNMA 4Z6KA 3NTUA 4YC7A 2X2PA 2OCAA 1U31A 1LJ8A 3I6MA 4G0XA 5F12A 4D43A 3E23A 2QGNA 3P71T 2C5EA 4KEAA 2GB4A 3P19A 3RWBA 3FDZA 3A9RA 3ZX5A 3ROTA 1TF5A 4IVQA 4R7GA 3KSUA 2F1HA 1S0UA 4KQ1A 4AJKA 3IEMA 5EC8A 1MXFA 4TROA 5EKUA 1XPJA 1SWVA 1Z5PA 2AL7A 4KOEC 2BEVA 4LXGA 2Q99A 3RVBA 4B17A 4DWJA 3CLSC 5CYOA 3LYLA 4AJ9A 2QN2A 5ENDA 2VOEA 2G70A 3P5BA 3AUFA 2KHZA 1GP2A 3K5PA 4YJDA 5F2OA 3WHLA 3PHIA 4AECA 4CLDA 4JP8A 4WZZA 4ZIRA 2AOTB 2LKCA 2XVAA 4PC2A 3HYCA 1EDOA 3D6JA 1LFAA 1C0KA 2CK3D 3BN3A 4AURA 1SXPA 3A4YA 4R9SA 3ZY4A 1YZUA 4L8LA 3B6EA 2OBBA 4ROTA 2QUJA 5EQJB 3GDFA 4EA6A 3N0TA 3I2GA 1P60A 4HH1A 1N2HA 3M6FA 4I9HA 4NBLA 3PZBA 1ODKA 1ZICA 2QX8A 3FNEA 1GLNA 3L18A 2HJ9A 1T2EA 2QNBA 1ULZA 3MBKA 3SF8A 2HHAA 1CTQA 2Q1XA 3PUXA 3TX6A 4LHXA 5JI3E 2QAIA 3FMVA 4Q3BA 1WUTA 4MI9A 2YASA 3H04A 3GI1A 3V1TC 5E3HA 2I4TA 5CMLA 1E1KA 2ZJ8A 1RJ9A 1MAVA 4NU5A 4PE5B 1KO5A 1UC8A 4MMYB 4HZGA 5GIOE 1NW7A 1UOOA 1RQGA 4MW0A 2VHJA 2A5JA 1XROA 3ABZA 4TKVA 4LZOA 1JX6A 1DCKA 2PR7A 4L4UA 1C9KA 1D0SA 1EUQA 5ICEA 4N3CA 5BWLA 1KVSA 1PT6A 2WSLA 1VG1A 1WDLA 3FXAA 3HZZA 4L22A 4TKZA 2G0TA 3IOCA 3WB9A 1UDCA 1P0IA 4NL4H 3N6RA 4KLCA 3HYLA 3KTFA 3RWMB 4AWBA 1IHOA 2QL5A 2VDUE 4LNUB 4QTZA 2AB0A 1YZLA 4PC3A 3RREA 2ZYWX 1KVUA 2RHCA 1JGTA 1SURA 3AY0A 3E61A 3F98A 5FH9A 1KOGA 3T3EA 3EA4A 1KAHA 3RSCA 3FHJA 4C05A 3F6BX 1WVIA 2ZSJA 2XVZA 3PE6A 1OBOA 3BHIA 3WRXC 5IBQA 4FBGA 3EXEB 4C01A 4HFNA 4MS3B 1AKRA 2ROQA 4QDUA 3U7EB 1WU7A 5A5EA 1GCUA 4I3HA 1JJVA 4RGVA 2HNAA 5KAPA 3HKDB 2O52A 1PJ8A 4LJ9A 4GP7A 4NFSA 4EWLA 1RAEA 4G5HA 1YL7A 3SFTA 2FPWA 2WFZA 2Y27A 4YJ2A 5HQ3A 4BQOA 2E55A 4YT8A 1QPBA 1RS0A 1TEVA 2PRIA 5BRAA 4MHTA 5IT0A 1KETA 3CRW1 1F4PA 2FG7C 3L05A 3K6SA 5T5QA 3X1ZA 4GPD1 4R2IA 3TQCA 1XOIA 3BGOS 3IEKA 2QLTA 4ND2A 3W34A 1P8AA 3L6EA 4UMVA 1E6EA 4NPAA 2FUG6 1IU9A 4XSHA 2HDHA 3X0DA 4DB4A 3ZEIA 3VPFA 1OU4A 5CVTA 1QUEA 1J0CA 1W76A 4PYLA 1GSHA 4ZOLB 2PUGA 3IXLA 2FW7A 3MYYA 5A0VA 2FRXA 3LHKA 2OZLA 2O8CB 3I04M 3UMRA 5DCLA 2O3JA 1XD2B 5BN3B 2I66A 3O9VA 2RHTA 4DLTA 3TCXB 1IWBB 3LPNA 4KPFC 2XV1A 3JSXA 3AHDA 2QD4A 3IRVA 4RSRA 4ZOLF 2FEMA 4S1NA 3DMRA 3KJQA 2PNFA 4HADA 3UJCA 2C92A 1FDVA 4X62B 4DNXA 2YJGA 521PA 1YZYA 3NBUA 1UK7A 4YMIA 5DEIA 1XCOA 1NMSA 4XWGA 1TM7E 3VUFA 2BBOA 3GT0A 1KP9A 3ZG6A 4P98A 4FJ0A 1T0IA 2HLPA 3VNQA 3KOMA 3VH4A 1DC7A 2BMJA 1KK2A 1LH0A 3VR5H 1YDWA 4LVOA 1P1FA 3KSMA 5JJLA 5BSVA 4PM4A 1MTOA 3PRHA 2EJVA 4ZCTA 2EQAA 3W8FA 1NOIA 5FB3A 5I5GA 3THOA 5BNIA 2COKA 4ZQFA 4QXMA 1CUUA 3KE9A 1BA2A 1V8FA 3OPYI 4Y1RA 2REQA 4GX1A 1KO7A 1QNFA 2AJLI 2NAPA 3ZBQA 5EKDA 2ZR9A 2VN8A 3M6XA 2NNLD 4TUYA 4HDNA 5CFQA 4MVJE 1HFEL 5THXA 3P0FA 1T2UA 4WJLA 4YP5A 1NWCA 1V8ZA 3RARA 2WW8A 4WEOA 3RD5A 3U4AA 5J2TA 2BGMA 2QMOA 4YJHB 1P6XA 2RETA 1PJLA 4E08A 1C3JA 3HKEA 1PHPA 3QFHA 1XK7A 3ES9A 2FOLA 5BO5A 1YQXA 3S44A 5LKRA 4KFCA 1IXSB 2UDPA 1Y1RA 2J4FA 3ZE9A 4C7OB 1YSCA 3MW8A 4X5OA 4C7MA 3R3UA 1L3IA 4IJVA 3DAOA 4IDNA 4L4RA 1H9AA 2BEUB 4EJ6A 5F2NA 4N6OA 2PM8A 4RVUA 3DOJA 3OPQA 4J0FA 2MSDB 4LNAA 1C1XB 1B0PA 3N28A 3VKFA 2E7ZA 2E18A 1PJSA 2O8FA 2D0IA 3OZ7A 2ZI6A 3HCPA 4MO9A 2ZREA 3AR7A 3LHIA 1GNQA 3AR3A 1Q5PA 2DERA 1KDYA 3HJUA 1UZNA 1W96A 1E2HA 5I9NA 1DBQA 2G04A 2CL7X 1YQTA 1UEXC 3JARA 3JPWA 4FZ5A 1UJNA 4PO1A 1CY2A 3QOWA 4QPPA 2QBYB 1U5BA 2HD4A 2W2KA 1P2SA 2X8AA 5TGTA 2P4SA 5F51A 3OLCX 1M67A 1TM4E 2V7WA 1Z17A 3BHNA 1DL5A 3BM5A 2B21A 1TYAE 3CS3A 3N8NA 4I9UA 4MIEA 2R8OA 1KVQA 4MDHA 4AJOA 2JG3A 4OUDA 2VQDA 3AZPA 1AU9A 3IJEB 4RNCA 4XYEA 3EUAA 2H17A 3H16A 5BVGB 1FFEA 1QVAA 2XD9A 1VL1A 1CULC 3ZDEA 5T3YA 4GSKA 2AYXA 3NXKA 4US2R 2Y1GA 2AN4A 3D8TA 1J2YA 4MKFA 1XWWA 3QBVA 5HQJA 2DFVA 4IDOA 1TMKA 3F6SA 4PGAA 4H1HA 4P8RA 3DMHA 3VBEA 4S35A 2F3QA 4BO5A 2VPWA 4ZVMA 3I9JA 2QY6A 1GGEA 3NORA 4LGMA 1V71A 5HE9A 5DULA 5JFGA 1BX0A 5TLSA 3R0VA 2Q2NA 3N2ZB 4MWEA 3P0IA 4GWLA 3FDZB 4GOLD 1L7VC 4EY4A 3UICA 1O0CA 4P7JA 2WUGA 3EQ2A 3O84A 4WOKA 1TMYA 1XRLA 3PI7A 1O0SA 2IY7A 1YVPA 4N76A 3EULA 5JH7A 4KDCA 2V7GA 2BEVB 1OLUB 3A2NA 2H2FA 1NQUA 2VDJA 2CLOB 4IDEA 1EK5A 4JLPA 4RIGA 4ZVLA 1ZSVA 3SSMA 4DRYA 2OBXA 5IANA 2Q0SA 1HRKA 5B4UA 4C29A 2GYWA 2PGXA 2V03A 4CDGA 2XQIA 2X9GA 3WMFA 4ZIRB 4K3UA 2QVLA 4I1SA 4BP3A 1CFJA 5GVRA 1GPUA 1FYXA 1MAUA 2V6JA 3KYJB 1CC1S 3SYKA 2MSCB 3VR6A 1VSQA 1Z15A 3HWSA 4RS4A 4EATA 1JSLA 3Q7PA 3EPHA 3EF3A 1OXMA 5C8DA 3V8NA 1SPBS 1FIUA 5BN5B 3V4OA 1ZRMA 3W6OA 2VXYA 1O57A 4NARA 4ZODA 4YWJA 5ITZB 3WNQA 3PX7A 2BKUA 3HCCA 2GTIA 1Y4ZA 4LHWA 2OUIA 2PYDA 2HF9A 2WIKA 2DB3A 4GKJB 4NOJA 5DWVA 2X4GA 5KJFA 4KR6A 5CFRA 4HNVA 1ZNQO 4H18A 3SC6A 2AJ8A 2B6HA 1P7PA 1HG1A 5AKJA 2J9GA 4X66B 1IN4A 2OAGA 5F23A 2DVMA 4BV9A 2EWWA 2H2GA 4A6DA 1EGVB 1OREA 1RJ9B 1SCUB 1XX6A 2WC1A 3NDPA 4MUFA 1SJ9A 4HFRA 5KWVA 1WNFA 2OCXA 2JFHA 4J7AA 2XUQA 4YT5A 4Y2VA 2IHUA 1Z4OA 4KH1A 4TKVB 3ZQ4A 2ZEJA 1GPYA 2F3TA 2F59A 1VKOA 2O2ZA 3EC2A 3KOXA 4IIXA 2WI8A 2V0GA 1S96A 1I24A 1MENA 4HDMB 4UM7A 4N9WA 5EJ2A 2YC2C 1TE2A 3QF4B 3SP1A 3WA7A 4HEHA 3QWFA 5KNDH 1SQ0A 2H3HA 3D2CA 4OLFA 3FNBA 1KRHA 1N6LA 2H1RA 2ZSIA 1PJRA 3GLTA 3NHUA 4HRVA 5JROA 1CF4A 3AJ8A 3HCDA 1T9KA 3Q3IA 5DT9A 1MJ5A 3WRVA 4MV7A 5SY4A 2A3NA 3OZSA 2DJIA 1BOOA 3H5IA 4GI5A 1R0WA 3ZHVA 3ESXA 1E2EA 2IKSA 5IASA 1F0KA 1IY8A 5FTNA 4YRMA 4AX8A 4YP7A 1OZFA 2M1ZA 1W75A 1E0KA 2EBWA 1DDGA 2N47A 2O07A 4RQTA 4DPKA 5AUOB 2B4KA 3IHKA 1XA0A 4EZBA 1TT5A 3KUKA 1JZSA 2PA0A 2PH3A 4HH3C 2EIHA 4TTIA 1E2IA 2CNKA 5I7RA 4LRTB 4F45A 1U2RA 3DHEA 3LFTA 2CB9A 5ERYA 4XVCA 1X7GA 5DIFA 4ARUA 5HQ3B 1ELOA 3ILSA 1DIOB 1SKBA 1B15A 3CJRA 3E9NA 3R0XA 2YHAA 4DIEA 3PUWA 2QP4A 2IFTA 4GH5A 3U3DA 1GTG1 2HCTA 2JLCA 1N2XA 2RMKA 2ZIWB 2ZULA 3MPUA 5FJJA 3SHWA 5F1KA 1BEZA 4HI0E 4IS3A 2N3ZA 2HA3A 2R4UA 3KCQA 4FMDF 2BEWA 4G5XA 3P9PA 4RWEA 4D44A 4RM2A 4EPWA 2MSLA 3V8BA 2Z09A 3AVVA 1PEYA 1DMRA 4E2WA 2OZLB 1HNZB 1OTYA 3NT2A 3ADBA 4PSAA 2RBEA 5F9HA 2J6IA 3GRVA 3G0DA 4J2TA 1L7AA 2QTTA 5COQA 5DM60 1BSVA 4H7DA 4BVJA 2P9JA 4IV0A 3TLXA 3DYVA 4JQYA 3TW8A 3GO4A 2FUKA 4U2EA 3MGCA 4RFLA 3VX3A 3DKIA 1TLTA 5JSKA 1R27A 1XRMA 2PRJA 1JAZA 1FJXA 2JKZA 1TYCA 3BKXA 3WLTA 1X1TA 5C7LO 1YJBA 1YTUA 1X3SA 1JMKC 4GOOD 1P17A 2C77A 4JQSA 4M1YA 4CIDA 4F6RA 3M6WA 1QG6A 3O31A 3TZKA 4H59A 3KXKA 4E1BA 1JEOA 3WNCA 4NQRA 3RYIA 1GPKA 4ZCRA 4BQQA 4PANA 2Y77A 4PBSA 2ZQYA 3N8HA 3CZCA 3S6JA 4GT1A 1SCDA 1IN6A 4BBPA 4DWWA 4L9RA 1ML3A 5F5LA 5JTUA 1RPZA 2QM0A 2QMUA 5A3SA 1FJGB 3L46A 5L3SB 3F3MA 1C3VA 3GFFA 4MAFA 3ZCQA 3HNPA 2PBFA 4CM7A 1YR9A 1TZCA 3ETLA 3KXDA 3PGA1 4FCCA 4KXQA 5DVZA 1EXDA 1SIUA 4V3CA 5AVVA 2HA0A 3LUDA 3MLAA 3RC7A 4FZJA 3S29A 1S5PA 3SICE 3OY2A 4DIOA 3K15A 5EWMA 3DFKA 3TNYA 3HKEB 2I6SA 3V7UA 1J8QA 2FR8C 3VNUA 3F73A 1FTGA 4I4CA 3UBMA 1S89A 2H9IA 1U3GA 3RAPR 4Z5XA 1PDOA 1F5NA 2PBZA 4IXWA 3M9WA 2AGVA 3V7NA 2W6NA 5DU2A 4RORA 4I5GA 3NU1A 1E2KA 1E60A 1L6IA 2AYZA 3GJZA 3EZ7A 3S99A 1E1QA 2V54A 3NUGA 4C03A 1OI2A 1YS4A 4EJ2A 2JBAA 3A7EA 2FZEA 2IIVA 3E5NA 3QLJA 4NY1A 3V80A 2FSGA 5KNBH 5KZMB 3C6YA 3GVXA 5D51S 4PY2A 1QE5A 2P1DA 4RVOA 2EFHB 4LHVA 2G5TA 4AYWA 1IN8A 3RUPA 1TYDE 4F93B 3THRA 1UM8A 2W8BB 1OZGA 5B3JC 1W88A 1G1AA 2RHJA 2W2KB 1YMUA 5HFAA 2YOGA 2VSOA 4J43A 5JAOA 2C58A 2GBLA 3IEIA 2GZSA 2QTGA 4P4UA 1F3LA 1H2YA 1GQOA 3AR4A 5I9SA 2O2JA 2QVZX 4OUDB 4P7FA 1Z4MA 2QV0A 8AT1A 2MWMA 1JHOA 3MWYW 4IQGA 1J9EA 1EA5A 3AUYA 5AHRA 1NUTA 1DT5A 1UAGA 2RH9B 4YECA 3UCFA 2P90A 4BFUA 3DB1A 5BUSA 3LQ1A 2UZ3A 1IJKA 2IYFA 3PB3A 1RYFA 2FAXA 3QPDA 3ZDBA 3E9QA 2IS1A 2I1QA 4WBNA 3WLFA 4OHYA 2D13A 2HC9A 4X9XA 4CKCB 1U28C 1HO3A 2FXIA 3MGAA 4YA6A 2ZKIA 4UTRA 3ORRA 5A2QA 1MO5A 2ASEA 1ZRSA 2GZAA 2E1PA 4GXTA 1FBTA 3RHTA 5GQSA 1MEJA 1TAHA 3RKSA 1RBZA 4COKA 4UFOA 1QOZA 2YTZA 2BGTA 3RVQA 2JFWA 4MS1B 5EL0A 4YBZA 1ZJZA 2JCBA 2KB0A 2WT8A 4JGIA 4DA9A 5FV7A 1KORA 2C4NA 3OZAA 2CE2X 4BUCA 3K4QA 4S1OA 4RHFA 3WKDA 1UC4B 1OASA 1CETA 4DCVA 1XTRA 3HMQA 3HWRA 4WCFC 1KVTA 5HWSA 2ZRCA 4KMOA 4AF8A 3PGXA 4Z4EA 3UXEA 2YH2A 3TLZA 1EWRA 2PVPA 4KXUA 4D6XA 4OLHA 3GCZA 4R51A 1HV8A 3AKYA 3LQQA 2OP0A 4MPRA 3S4YA 3E9ZA 3FOBA 3RSLA 1BW9A 3TD2A 1SUDA 2GLXA 5H16A 3WJ1A 4ALMA 4QXAA 4MI1A 2AX4A 1YB7A 2G1AA 3BXPA 1L5HA 2QN3A 5EE5B 2VFAA 3IHTA 1DEKA 4FGZA 3PNSA 3UZUA 5C4MA 4MWZA 1PEDA 2ID4A 1T4CB 3JPYA 3TZEA 3IP6A 3KM0A 1E3WA 1QDUA 1YR8A 4Y2JA 4LY6A 5MN6A 1T43A 4RNDB 5LP6C 1GFZA 5IUNC 2I62A 3CPHA 3IVRA 3WIUA 4ALJA 3UB2A 1GPJA 3F4LA 3ZQUA 4B31A 5TPZA 2CKDA 1WLYA 1U3UA 4HX9A 4F06A 4H6WA 3HJFA 1EP9A 1I1QB 5ADVA 2F48A 1KFKB 4KXLA 1Z0JA 3O1JC 3O73A 5C8XA 2H2DA 3N7UA 4S2UA 3JD2A 4B4DA 1E77A 2GVDC 3QVSA 2B99A 1FY2A 1RQNA 2JRCA 2FQ1A 2VT2A 3W0LB 2EAUA 2RJOA 2BZ0A 1OD6A 4KXVA 1FFAA 1RCUA 3KX2A 3V1UA 3C85A 2LCIA 4L50A 4QYIA 2H1IA 2OK8A 4RZUA 3BICA 3HHEA 4RGYA 5CLGA 1I2AA 1QJ4A 5DTQA 3WE7A 2C8VA 4EB6A 2EW8A 4R1LA 4RE5A 4XYGA 2AXPA 4HRAA 1OYYA 1XAHA 4MJ7A 2OV1A 5A9TA 4AY4A 5KMGB 3CKYA 1ADBA 3IODA 1C9DB 2ZQ5A 2YIDA 3FFWA 1QBGA 1UC9A 3M5DA 5IWAB 5KSZA 1QYWA 1R00A 4OREX 4HYEA 2C7VA 3IMCA 4MUEA 1HE1C 1OXBB 1M5TA 3CZMA 1QGDA 3L4EA 4NYJR 1QQBA 4PZPA 3Q72A 4GOXA 1Q0LA 3PA6A 2VHXA 1GA4A 4DG5A 2Q49A 1S2NA 3UIEA 1WCV1 3AXSA 4GR5A 1IE3A 1HBJA 4Q21A 1XXHA 3ICWA 3T7DA 2QBYA 3HYSA 1SWWA 3HLKA 4Z2AA 4P4NA 1M1YE 2AHRA 2DKNA 2XX3A 4PX2A 5CX4A 4ETMA 3BGWA 3ILXA 2IYSA 5GVSA 4AZ3A 4R7TA 3M6VA 4C0HA 1N0HA 4M21A 2FDCA 3EHEA 3FTNA 1E94E 1JDJA 3NKVA 1UCFA 1XRQA 3DUWA 3PITA 5AM3A 2H7CA 1QLHA 4JLOA 4GZ3A 4DQDA 1PVVA 1HOTA 5AI9A 4UXIA 4HD8A 5EIFA 1XHEA 5FLEX 3WGHA 3FYUB 2QJRA 4Z7QB 5FNZA 2W71A 3OX4A 1VYUA 1G5HA 3A4VA 1NXPA 2PLAA 1Z45A 2QDXA 1U0SY 2R48A 2W6OA 5LQCA 1E1CB 2OKCA 1K89A 2YVLA 1KO1A 3HXKA 3EMKA 5BQ3A 1RXSA 5KCZA 1XN4A 2QQ0A 4WNAB 3QXXA 5JLJA 2P2YA 1BN7A 2I91A 5C3UA 4OHRA 1E1DA 1QKJA 1YO6A 4CIBA 4ITVA 4BGUA 5FO0A 3LPMA 5B36A 1NG1A 5JPIA 3T3NA 5KREA 3B1WA 3EIXA 2IXEA 4MAAA 3UJ6A 2HSEA 4R8KA 3ROFA 2IUTA 3KB1A 2I8AA 3TLCA 1VKZA 5HF9A 3TW8B 3ZE1B 4CUKA 2QXTA 1E2GA 3C3JA 3L1UA 4CFZA 5L6MB 3T7EA 4F9FA 4DJFC 1KYQA 3A6KA 1L3BA 3G17A 3HWX1 3LMKA 3OUTA 3RANA 3RSOA 2QYHA 2PXXA 5E4TA 3T1YB 4HCJA 2C2KA 1JE0A 2HJSA 2RGEA 1VSUA 3GJYA 1NYRA 4CBVA 1RWQA 2VYVD 4WJKB 4HG2A 5T3UA 4EA8A 1DKMA 1ZIOA 2G4VA 3AINA 4AMVA 3B3QA 1C3EA 5C8YF 4L72A 3ZCUA 2ADMA 2NO5A 4E70A 1SCIA 1BJKA 1ZM9A 3E8MA 4S0ZA 3V6MA 4Z4HA 1U0JA 1FL9A 5GZ6A 4FHCA 1R2QA 2IL1A 1OC4A 4EH1A 4JR2A 4PR0A 1T5DX 3SQDA 4GI1A 5C35A 2UV8A 3TBKA 1WG8A 3P0RA 1WSWA 5HTOA 2VPYA 4RSGA 5HZKA 3G2KA 4RY9A 3ZIAA 5F5NA 3VSAA 4NDZA 1TJPB 4C4SA 4JSYA 1Y9AA 3Q41A 1DBWA 1QH8A 2QX4A 3HY3A 4H2DA 3PXXA 4P86A 4DNFA 2WF5A 1C0PA 1NAHA 2G5GX 2J0UA 2PXAA 5EIBC 5FOVA 3L1KA 3U39A 4B73A 2J9FA 1XYYA 1NN5A 1YQUA 1BWQA 3CNNA 3Q7SA 1WQ1R 1ZM3A 2V5AA 3WLQA 2G16A 1Z0KA 1PLKA 1PW5A 1JHUA 1Q7RA 5FUQA 5KVCA 5EWMB 1NMQA 5DGXA 4HV4A 1VB5A 5F2EA 1CW2B 4BRSA 4DREA 1SG9A 3A37A 3AEUA 3H0EA 1GT91 1XMXA 2YMLA 2HA2A 4IF6A 4Q3KA 2DFLA 5I45A 4RJTA 2BELA 4IHAA 3PD1A 1UXIA 1TQHA 4D56A 1Z06A 2NUAA 3C4JA 4C08A 4EM6A 4MS4A 2QJOA 5H83A 4JVMA 3DFFA 4JLNA 5ITWA 4HH4A 3LQFA 5I48A 1P5FA 4KWEA 2E4YA 2FWNA 4TTSA 4YACA 2OXTA 4IZHA 2ZRJA 5IHPA 5BSEA 4HDKB 1ZGZA 3F9RA 5I7WA 3RS9A 1CQIA 2FEAA 2BDEA 4IV8A 5KO2A 3ORYA 4KSCA 4R8RA 3VR4D 2PSHA 4P0PB 4H1TA 3R3JA 4AKHA 4JH0A 721PA 2PSDA 2OL4A 1DU4A 3URKA 3THXB 1Z88A 2EWMA 4ZK6A 1FS4A 2ZYAA 4IM7A 5BW6B 1P72A 1YF3A 1P2FA 1MEOA 1RW4A 1SBHA 4TMXA 4Z9BA 1YCDA 3CH6A 1JWBB 2C94A 2GJKA 2NSDA 3EXHC 3HHPA 4B6FA 1U2QA 2AMYA 1U8XX 2FWPA 2YWBA 4Q3EA 5EQFA 3LYUA 1IBMB 5CAEA 2CZCA 3PDIB 4MV1A 4XD2A 1M8PA 2BF4A 5DLPA 4B8ZA 1TIBA 4WBNB 2DHCA 5A2GA 3K1TA 3OZIA 1W85B 3KKPA 1OXTA 1O95D 1KSFX 3BXEA 1VSTA 2LZ0A 3IALA 1SUEA 4Y1FA 3T94A 4EA9A 5CDTA 2IY9A 4FKZA 5ANRB 3KVYA 3L0OA 2Z57A 3EG9B 2AUTA 4JITA 2B2NA 3F97A 4JP1A 5LCXA 3RYHA 3LBFA 3T06B 4IRUB 3UWSA 4WBNF 1GTMA 3IE2A 4L27A 1NNUA 3AOEA 3VC2A 1V1MB 2JFYA 1CVIA 2HRQA 3V97A 3UMFA 2BUAA 3S7TA 3W5JA 5BMVB 4LXHA 1GOTA 5F73A 3BRCA 3IMFA 1Z6ZA 4LKOA 1OY1A 3ZQ6A 1V45E 2WFLA 4HX5A 4N82A 3W2HA 3NWOA 1ZH0A 3E81A 3OE5A 1WXEA 1Z0FA 2WSMA 1L5HB 2BSAA 4JB2A 3ZX4A 3TUIC 5BMVF 1RR6A 2FQWA 2VDKB 4C6HA 1KZYC 1UBLS 3QXGA 2A9KA 1G8SA 3H4TA 4K8OA 4MQMA 3T1HB 1KGSA 4UE3S 5A04A 4WNYA 1FFWA 4L1KA 2QTMA 3V1KA 4MA4A 3WDMA 1SZJG 1N1MA 2Z1NA 3L7NA 4P54A 3ESYA 4JKOA 2EV9A 1NJ2A 4AP9A 3W3ZB 4FR5A 2ZTHA 5DBGA 1Y9JA 2NG1A 2UVQA 3OTGA 2C95A 3QH4A 4P81A 2JJ8A 4Y2XA 5TEVA 1XCJA 3OIWA 5GJWC 1HLGA 2GN6A 3QGMA 3VBCA 5KYUB 4BNLA 4PQGA 2X1LA 1DC4A 2PAAA 3CLRC 3HA3A 2NYAA 3I09A 1Y8CA 3AF4A 3HDHA 3VZRA 1NRXA 1P2GA 4HUQA 4GS5A 4MV3A 5ECGC 1Z9BA 3ZNNA 2YJZA 3FH0A 3F3SA 3KLBA 3KPWA 2YKGA 3CEJA 1TTHA 2P4EA 4MVJA 2XJ9A 4E88A 4JYZA 5B2EA 3KWLA 4KUGA 1AHHA 3BXHA 4I46A 4NV3A 1UBJS 2WHEA 1KK0A 3IIMA 5FTJA 1NXTA 5JSYA 4C76A 4JIGA 4K2AA 2G7MC 3K20A 3ONFA 3VSBA 1BAPA 2CHGA 2Z8ZA 4Q4HA 1QS0A 1OX4A 3FETA 4NSNA 3DTVD 3WIBA 2UZ4A 2JLWA 2H51A 2ZSUA 3Q7EA 1U8AA 1Q1AA 2JHAA 2OGWA 5GZ3A 3DBOB 3WLOA 1L5ZA 3K94A 3QPWA 5F9MA 3QP9A 4PC1A 5CGZA 2H5IA 1ZZEA 4BN4A 1S3SA 3DAPA 1IN1A 3QWIA 1XXHB 1JEYB 2R6DA 3WNBA 1NY6A 2C8JA 3MRTA 3ER9A 3G8BA 3GRKA 1EIWA 3K53A 3WMGA 4FKBA 2QY9A 2WKWA 5BV1A 5IFKA 3GJ8A 4V0QA 4DCPA 5F35A 2C1XA 2QTFA 4A2WA 2EX4A 3IV7A 1F4VA 2ETXA 2ORYA 1A7UA 4DJTA 1WY7A 3MCUA 4IGKA 4UUBA 1UBNA 4K8RB 1KAGA 1VE9A 1WP9A 4KLNA 5DLEA 3WV5A 5IYZA 3G2QA 4KG7A 3PLRA 1BDHA 2BHLA 3DDCA 3G2MA 1O9GA 2DRIA 4IFTA 1PR1A 1V1JA 4QYSA 2X0EA 4EJ0A 2Q28A 4ABTA 3A0UA 3F1KA 4WVFA 4PNEA 5AD1A 1QBKC 3SS8A 4O0LA 3FSJX 3FZNA 1U2SA 2VDQB 3MXTA 1TCBA 4RJIA 4E4TA 4YCSA 2JFBA 1J8VA 1PJCA 4NZ9A 3WTBA 3N8GA 1Z83A 4REQB 5CNMA 3AC0A 5IVHA 2OV6A 1WEHA 4QUHA 4XD7D 2K2WA 1N6KA 3B6MA 3OE4A 4GM4A 1BN6A 1US8B 4HTAA 4AMUA 2XZLA 1N33B 5KEIA 1CWUA 1R3DA 1UBMS 3E8XA 3T38A 3NTRA 4PHCA 4G8CA 1X74A 1JAIA 1FFSA 1NL3A 2OQIA 2OD2A 2WUDA 3O92A 5FR2A 1A88A 2GFIA 3BD8A 1RKBA 3OM8A 1VRWA 1O1YA 4LCEA 3NONA 5I7UA 4YUYA 2YMPA 2HU5A 3CKKA 3L1HA 4K6HA 4Q9HA 4DJDC 1L1EA 1FTNA 3LY5A 1T4MA 1UFKA 1P6UA 4EPVA 2ZUFA 1EHCA 2PZEA 3R5XA 4KO8A 5K09A 1AVTA 4YQYA 1KYIA 3Q87B 3CVYA 3B6JA 4OU4A 4L5YA 1SKYB 2DPXA 1I6KA 3VSDA 2FEOA 4UAVA 1M34B 4WZAE 2EG9A 5HF6A 3DCJA 3ZWXA 3WK8A 4H0CA 4JJAA 3H5NA 3GLKA 1YB1A 2MOKA 2KLBA 1YRBA 4E2YA 4XWOA 2AI2A 2NVWA 4FOPA 4U7GA 1SU8A 2DY1A 4JMLA 2XCLA 3WKCA 4PS1A 3TJRA 1ENYA 3K1AB 4XWYA 3JQ6A 4I5FA 3AW9A 3DDZX 3C3EA 3QFTA 3OY7A 5DYIA 2JLXA 3L4SO 3ROGA 2HCRA 4FZVA 5D5HA 4A10A 2VNJA 1NNSA 2YXEA 4LPSA 3AEUB 1YK1A 1Z4IA 2O3TA 3G89A 5AK4A 3I76A 1XZPA 4KU4A 4RTPA 3KB6A 1PTKA 3N2GA 1EZ1A 2J32A 4J4BA 4OAPA 2BGRA 5J2UF 1CQPA 1C30A 5K45A 1AH2A 4G67A 2W2PA 4MS4B 2XA2A 5IS2A 3RS2A 4Q4JB 2PGLA 4DR3B 4KI7A 5IH7A 5JG7A 3ND8A 5E6UA 2XADA 4X97A 3OIYA 3O83A 1E3DA 1FZTA 1BE8A 7MHTA 5DCYA 3A3OA 2I6GA 1KAEA 3DLTA 4MYUA 2OEPA 5J5VA 2QAGA 2QTBA 1CQIB 2HW8A 3VM6A 2B6NA 4YRBA 4MTCA 2WUWE 5EN4A 4CTJA 5K03A 3LD9A 5A5GA 5FUYA 1J8FA 3MRVA 1N0WA 3ZDDA 3KAPA 1U0NA 4U5QA 1UMCA 3GAMA 1DKUA 2B37A 1OB5A 1WZIA 1E3JA 1JB9A 1Z13A 2DUWA 1WB9A 1GU0A 4RADA 1OVGA 4TKLA 3I5MA 1YVEI 4JB8A 2PJDA 3RS3A 1VDMA 1W0KA 4M1TA 3KQSA 3O1HB 1N36B 2VK2A 2W6JA 2ZVQX 1E2QA 4ZMSA 4RDCA 4R5MA 3LWDA 3OAAA 4C6SA 4CG3A 4E32A 1JLSA 5EPEA 5FUMA 1RXCA 3LQ4A 2G83A 3KQKA 4MW1A 4X3OA 1CZRA 3ZVNA 3U13A 2AN3A 3QY9A 4AWXA 2JIBA 2WU4A 1JXOA 1P62B 1P7WA 1PR5A 1WD7A 2X2EA 2XXJA 1C7IA 1FBNA 4HTFA 3KT0A 5FPHA 2H7VA 3RUEA 1RPAA 5EJ7A 4C14A 5L45A 2N46A 2Q4TA 3AHFA 4NFHA 4B9AA 1UPTA 4S1PA 1TX4B 1EVQA 4BNDA 1VLHA 3COJA 3U37A 1I3LA 4YCMA 2P1ZA 5JCOA 3T3OA 3KD2A 5EVCA 5JQGB 1TUBA 2IH5A 5BQ5A 5KPJA 1PFWA 4QICA 3QPUA 3GAZA 4W63A 4XJXA 1GCOA 2QUBA 3GZNA 3OEHD 3TLGB 3OF2A 4A82A 1P5HA 2P4HX 4HQLA 3VR5A 1QG2A 3E7FA 2PX4A 3TGLA 4LRQA 4PHGA 2AMFA 5JQGF 1QO0D 1GNPA 1K9SA 1P2BA 4EBFA 3WWCA 4BNYA 3JR7A 1PU2A 3M1IA 3BEDA 2OO3A 4M55A 1G0OA 1V0JA 4IIFA 3WS7A 1TQ6A 4C06A 1NP3A 3BF8A 4EPYA 2ZFUA 2VJLA 2R6R1 5D6NA 5HS4A 1ZD2P 1Z36A 2Z98A 3LLUA 1QHHB 4JP5A 1OGIA 5G2OA 5KVVA 3E5RA 1YBMA 3M70A 1CEXA 1MD9A 3L8YA 4JYCA 2Q62A 4NMLA 3LUKA 3CN9A 4QFCA 4Z99A 1GARA 3VNRA 2P6PA 3OPNA 1T8UA 2IHJA 1ORDA 4NBNA 3NM4A 1Y9EA 3RYHB 3TLBA 3I04A 4O8ZA 3HU1A 3ZHUA 4E5SA 1JQLB 3MMPA 2A0WA 2C0QA 3QA9A 3LX8A 1MEEA 3KT8A 2QSUA 1CUYA 4LJ5A 3CXRA 2WU3A 1SCNE 2WIAA 1GIAA 3B1ZA 3FMIA 3WYDA 4W5NA 1BCSA 3KQWA 1UMDB 3BWYA 4ON9A 1A97A 2PD3A 3HFSA 1X7DA 2EW1A 2FZLA 2RH8A 3LCMA 3ZK8A 4UMFA 2C2MA 1Q19A 1G21E 4JP2A 1VKJA 3QEOA 5AKYA 1MIHA 2WG2A 2Y6UA 3FPJA 4WOBA 1DRKA 4XJTA 2Q5OA 4MCAA 2D3WA 3VFDA 5AVRA 1ENPA 1WB4A 1QS0B 2G72A 2W2QA 3CF4G 3LW7A 2GR8A 1GADO 1KZ6A 4ZRMA 3RRMA 4YJFB 3WYCA 1DXOA 1IZ7A 4KN6A 3KQVA 2XMSA 2J85A 4BL5A 3E84A 2A88A 3BREA 1LWNA 1AS2A 1LPSA 1UJ5A 1WOMA 4HC4A 4LWPA 1P4SA 3X1MA 2OAP1 1R4MA 1NFRA 3IHWA 5ECWA 2D6FA 4A2QA 4KSYA 4ZI2A 2X7XA 3AJRA 2HK8A 4W9RA 4BAZA 4CN8A 3LL4A 4NOMA 4TWJA 1Q0PA 1T8YA 2ZBPA 3RU9A 3E58A 2EYQA 2QS9A 1RJDA 1PT7A 1TZBA 2FB9A 4BO2A 5JS1A 3H3XA 1JFTA 2UXCB 5LN1A 2XHEA 2R7NA 1M0TA 3O8LA 4E7OA 5AW8A 4RD3A 5IYZB 1L5SA 4LC9A 1Y6RA 2O3UA 2YVAA 4J3NA 4IF4A 5DTEA 1ZM7A 3NHJA 2P9QA 2PT9A 1TF7A 2OO7A 2R5FA 3LC2O 4I9GA 1RRGA 4QOSA 3L7KA 4QPZA 1DKLA 3EH2A 1EFVA 2CL5A 4IO0A 3U3OA 2OV3A 2H1HA 3KLOA 5F1YA 4MQFA 1SN7A 5IYZF 4C88A 3EGDA 4LMBA 4W8GA 3RAEC 1TVKB 3DMDA 1PL6A 5IF9A 1RQRA 1H3FA 4YCLA 1O87A 1I30A 1JHDA 2LXNA 4IJQA 2DUJA 5K3SA 4LTMA 4BEWA 2W8ZA 3HY4A 5CGQB 3GPLA 2X7JA 1YZTA 3B5IA 4N39A 4TXLA 3PQ2A 3ZWYA 3STUA 5TQJA 2AE1A 4KC0A 5AOAA 1GNVA 1LBSA 1LDMA 1KWGA 1D2AA 3PT5A 4HLUA 2RHRA 1AGRA 1X9IA 2CBZA 3EBOA 2GCIA 3Q3VA 4W5JA 4II7A 4DRXA 2QX9A 2IBTA 1MC8A 1GL3A 1T2FA 3CONA 1X8LA 2CW5A 2ZSDA 3DMTC 3F1LA 2DTDA 4HZIA 1WPRA 1P2TA 3WLSA 5FWNA 1A9XA 2GJSA 3ED5A 4L3VA 4NYMR 5L53A 4IMPA 2E5LB 4BXOB 1NN1A 3MWKA 3SU8A 2HMAA 5EJAA 1APBA 2O8VA 1IIBA 4K6CA 4ER0A 3UYLA 5CCXA 2AQHA 4H1WA 3A6EA 1Q0TA 4LN1A 3UAWA 4WUVA 1E8NA 1KH3A 3KVOA 4NXNB 1QYXA 3W2IA 2I4RA 3SK0A 1KJJA 1VXOA 4QNNA 1QGED 3ETHA 2GO1A 5CG1A 2I7CA 3UBTA 2FW6A 1NVTA 2A1IA 1KERA 2IYLD 3DDSA 4XPIA 3HP1A 1EA7A 1TMGE 2R97A 2XF8A 2JGKA 3V2HA 1WX1A 4GAEA 4Y2TA 3BXOA 1THTA 2Y1WA 4IEIA 2M6SA 1XZEA 3V8EA 4DMGA 5EJ8A 4XYBA 1GDHA 1M6EX 2FZ5A 1NR1A 2YZKA 3A2MA 1GQSA 3G2JA 1R4NA 3CN7A 1SXHA 4P4LA 4X1KB 4EFLA 3FZEA 5BXYA 5KJ6A 4U7WA 1EIZA 2ZPUA 5KOIA 2ZUWA 3C8MA 3N76A 2CHQA 4IHJB 1KYXA 1EE2A 1Z0AA 2PJUA 4FHZA 3T12A 5LZ2A 2EZUA 3FFAA 3N2GB 1IAQA 3W6PA 4AUNA 1SC4A 3TB4A 5AVWA 1GPWB 1XA3A 1AKYA 4M87A 3T5BA 1V7QA 3IYLW 2JZOA 3RYFA 5J43A 4D42A 2UVPA 4M76B 1E3IA 3OO1A 3TE6A 4KODA 1NJFA 1E2NA 4IHJF 5H5JA 3V3KA 4BKUA 4DEYA 1IUNA 2JFPA 1LQTA 1XQ1A 3QPVA 3MJRA 4D82A 4EQ6A 3CEPB 4RAQA 5IXJA 5TARA 5BSRA 1KKLA 1J5XA 4PHFA 4G0OA 5LD2B 3RJZA 2GM4A 2WILA 2ZXFA 2QAGB 5TIIA 3CH7A 1O6FA 3F74A 3KWJA 3GMTA 4ARVA 1IZ0A 3QHQA 1ANKA 5CYPA 3GQVA 1CB7A 3K9FC 2XWSA 1A95A 3N3AC 2B3TA 3E27A 4JB3A 1VFNA 2IZ0A 1DPGA 1PDVA 2VP6A 2DUNA 2PX3A 2GARA 1ILWA 1GQYA 2OHXA 3OKAA 4IQ0A 4JI1B 2AC7A 1MJHA 1MOQA 4GM1A 4NC9A 3OU2A 2FV8A 3SJUA 3GJ7A 3B5EA 3RG2A 5BURA 3KTOA 3SZOA 5D3QA 1HDZA 3FG9A 4NESA 1VG0B 1VJ0A 2H31A 3HCBA 2WUVA 1Q1QA 1SRRA 5CDYA 3QYPA 4R68A 3ZZNA 4QPDA 4TZ0A 1Q16A 4U1RA 3Q7IA 4F4IA 1E32A 1L8OA 5C5IA 3V8QA 5EHZA 2ZAIA 1CUVA 4Q7QA 3CFFL 4DNOA 2OMEA 4ZVUA 4KRFA 2PZKA 3ANYB 4EG1A 1BGWA 1UZUA 1ZOIA 1R0SA 4H7FA 3FNGA 4W9NC 1S1MA 1SCJA 4QGFA 4FDMA 3MOGA 2G7ZA 4U6SA 3H86A 2O8NA 2FW8A 4GKBA 3OQHA 5A7HA 2VSYA 1YS9A 2JRLA 1NJ6A 3ZGOA 4JXKA 1M33A 4BRZA 4CLOB 1YNOA 5A4JA 1E3LA 3TH5A 3W5DA 2CD7A 3P0EA 4U7PB 2V4ZA 5F77A 4XDHA 1OF1A 3D6UA 3K0AA 2P2NA 2P8JA 5ESDA 3BB3A 4IHQA 4F5DA 4AUKA 2J3QA 1GQRA 2Z2XA 1BHQ1 3FF1A 4CIVA 2DQZA 2NU6B 3C15C 1AGNA 3OFNA 3R23A 4KBYA 4OQEA 5BV7A 3IQWA 5L95A 3HYTA 4EECA 1SEVA 1OA0A 1EVZA 1RHJA 3AWIA 3KEOA 5T67A 4WA7A 1JR4A 4F2GA 2OLKA 2XE7A 2HIGA 3PNQA 4AZVA 3Q3HA 3H42B 6CHYA 5ILQA 4AXBA 1P9WA 5JH7B 5K8IA 1DGQA 1M8FA 4HVLA 1CZHA 3L40A 2O5CA 4K0KB 3QVTA 4PPYA 1L8QA 1H1LB 1I51A 4KPUA 5JY6A 8LDHA 1T26A 3RBAA 2GM3A 3OQIA 3DE2X 1U2PA 1D7AA 4DM3A 1DUIA 3TIFA 4KITB 4GEGA 1GRRA 2NQ8A 4KTTE 3PVSA 4MV4A 2BCJQ 4L78A 5T4EA 4IICA 1ZIYA 1E0JA 3LLSA 1F6WA 1ZITA 1Z08A 1EX7A 1BCSB 4RF5A 4R31A 6AT1A 2ERCA 1XP5A 3IELA 1OH5A 4K9LA 4Y67A 4RTOA 4LYFA 3H7IA 2FGKA 2XUIA 4QXQA 3BFXA 1VPLA 2IJGX 2YHIB 1PFGA 3I6YA 3GCDA 3RSSA 5KNBA 3PUHA 5CJJA 3MG9A 4J1NA 3SZ3A 1IH8A 1NUSA 4WLUA 2AX3A 5TVKA 2ZBQA 1GVHA 3I9V6 2A0UA 3OUZA 4LHEA 1HOXA 1ECPA 1MGOA 4ZDJA 3G6WA 4P3OA 4RGBA 3LHFA 1SO8A 1DJNA 1OKKA 4KNWA 1M2WA 3BJIC 4YUZA 2HCBA 1K6JA 1QG4A 4TMVA 2VT3A 1Q2UA 1MNQA 5A3VA 4UPDA 1R4MB 2WM3A 3CJTA 1VHTA 3U7QB 2WJHA 9LDTA 3C3AA 4XUDA 1W4RA 4WESB 1NJ8A 3LZCA 5DJ5A 4U8GA 1N0IA 1LB1B 2I1VB 3HNRA 2XNHA 4UEKA 3SFZA 4B82A 4YPVA 2MYNA 1Z33A 4R1PA 3OWXA 1TTQB 3HGQA 3Q1KA 4ZAZA 3RFFA 5JDCA 3IE1A 3DCYA 4I55A 4QDZA 1UH5A 3U09A 2ADFA 3WP1B 2WYVA 3ISVA 3LZ6A 1VJGA 5KYWA 5JCZA 1CF2O 1NHGA 1YU9A 2ZROA 3L92A 2QK4A 3OC0A 4MP8A 2JARA 2KS6A 2NO7A 1JA9A 4CUZA 4DMHA 3BQ9A 4KQEA 4RPHA 1TKRA 4D9EA 2YHBA 3HBNA 1KMHA 2FPMA 1XVUA 5DNCA 5FWYB 5IKXA 1SAYA 1JIXA 1WOYA 1XEXB 1NU8A 1Z28A 2D5IA 3K6KA 4P82A 2AXNA 3L8MA 4IDHA 1DSSG 4R6XA 1PD0A 1QHYA 2E6KA 3CT6A 4XA8A 1QGOA 3BFJA 1YL6A 1ZM4A 5FUBA 4ETWA 1XVTA 3PG5A 5FXMA 3O8NA 3VTKA 4R9NA 2FU5C 5IRCD 3AXTA 1OLXA 2X23A 2G3DA 2YRFA 5CT5A 5AKLA 3TX2A 4ARZA 1E18A 1PT9A 5HKOA 3P9NA 1VIDA 2PMBA 1O77A 3PTAA 2C82A 1MPXA 1JP7A 2XT6A 4ZVNA 1VI5A 2BP7B 2RKOA 1VZ2A 4NAHA 3NWEA 3TTUA 3QV1A 3VC3A 3EFBA 3WWPA 4NWIA 1PQUA 4H9GA 5HKKD 1H1DA 5IKPA 4J3FA 5KBYA 5KCMA 4HX2A 3PEYA 2DU8A 4FT4A 4B2PA 1UXGA 4K86A 1A9XB 1LX7A 1G98A 3MS2A 4F84A 3V1NA 4UU1A 5I47A 2PANA 3QW2A 2R7MA 4I8XA 2G1KA 1ZA2A 1PR3A 3BMCA 3E8SA 3AF0A 3GLGE 4F5YA 4G41A 4TYWA 5CLLA 4YCCA 3AP2A 3CKLA 3DYIA 3GK3A 3EQ6A 3H6HA 3MJVA 3T7AA 3GRPA 2R8BA 4QODA 3DEYX 4B4KA 1P3Y1 2J87A 1GSAA 4ARBA 4ZCIA 3HXPA 4CQLB 1OXKB 1N2JA 2J7KA 2YXLA 5U4XA 4K26A 4XAQA 4B0OA 4N7JA 3MQ4A 3O7WA 1IONA 3C14C 3ONWA 4YJ3A 3TD9A 4TSFD 3Q8WA 4MWTA 4C89A 4DJJA 2XOXA 2ZAMA 4YVFA 4XPIB 3W9YA 1U94A 4JENA 1ODJA 3QRWA 2ZYVX 1XQ9A 1OYVA 1PT8A 3I8SA 2FSSA 4FSDA 3ZXYA 2A4MA 4J4HA 2RB5A 4FQ7A 4JJ4A 4F3NA 4CV1A 5ES3A 5JCJD 4LYYA 1MA3A 1JQEA 1JU3A 3RFVA 4E30A 3SMVA 3NDBB 2FSHA 2QMYA 3CBQA 4L9AA 2YZ7A 1X14A 2IUEA 4EITA 4PYRA 5KQLA 2EJBA 4W5OA 3G0BA 5K01A 1WR8A 3I6QA 1IM8A 2PXHA 4BO6A 2ID7A 4P80A 5IDQA 1SC9A 4WCVA 1D9ZA 1XKTA 1JQAA 1OH6A 3RYFB 1IK6A 2UVPB 3WI7A 4XQCA 4RVGA 5I7HA 1ISPA 2R2AA 4X0EA 2Q7XA 4CT4B 3MMNA 4P31A 4H1UA 5FV4A 4EQ6B 2V6BA 4RVFA 1XL1A 1HFWA 2QVGA 1XMSA 2H18A 5IBCA 3CU5A 3F96A 3NDJA 4MCIA 4LY9A 3REOA 4RVSA 2QRVA 3LPDA 1KEZA 3REGA 2Q4RA 2IGBA 2ZBFA 1EWVA 1RTTA 4GX0A 4Q9DA 2Z6QA 1U7HA 1M8KA 5DNWA 4EHAA 4PHHA 2HKIA 2XMZA 2FMIA 3K0CA 3H7AA 1E4EA 2DBVO 3AVTA 1ZMTA 1K4YA 1CHNA 3RS8A 3ZGXA 3T3PB 2HWUA 2FRDA 4PZCA 3ROQA 2SBTA 1WABA 3V34A 2GDJA 3MMXA 1RI5A 2QQGA 4N5NA 1ZMXA 2NUPA 3I2FA 3E5MA 3OP1A 4LBVA 1F3OA 1FYVA 2E9SA 3LS2A 3PGMA 5DM1A 1FJHA 3A27A 3JQRA 2VI5A 3D6MA 2CFIA 3GEDA 2JD2A 3KHSA 2FMTA 2FPUA 3C1OA 2FFBA 5I9IA 2IQIA 3PYXA 1AO3A 3NJ4A 3Q3GE 4R2WA 1C9JA 1GEEA 2Q3MA 4QDKA 2P5TB 3LOUA 5JTTA 1OW3B 5HF5A 3HTXA 2FPPB 4IKOA 3MT9A 4RF2A 4LDZA 3BGDA 1NNEA 1PE0A 1JDSA 1LW7A 1QWSA 4U02A 5F3RA 3KOZA 2OILA 1WW8A 3EZNA 4L76A 3D1VA 4Q66C 3TEFA 1C3XA 2HADA 3GLFE 1GFIA 3FKSD 6LDHA 4Q12A 1EHIA 2P77A 4FX2A 4E2FA 1T0BA 4YUWA 1BQEA 1G5IA 1YR1A 2XUDA 1K2WA 2BM9A 5JD4A 4A0SA 4DQXA 2XBUA 2I9KA 3GV0A 2ZYTX 5KTNA 5KWJA 1VLMA 3CG0A 2XMPA 3PEWA 3SNHA 4EGAA 3W5IA 1NG9A 2RK4A 3G7UA 2PN1A 2C96A 1LQ2A 2O7VA 3WOHA 1PZGA 2GN0A 4YAEA 3SIWA 4OQYA 4LVUA 3UFXA 3UC5A 3RRYA 5C80A 2WYIA 4G5YA 1IB0A 2O7QA 4PG8A 2ZDQA 4LX8A 4L7QA 1I9GA 5DHSA 3OD1A 1QZXA 2DHRA 2XEDA 2YN0A 3DDUA 4EY8A 3NEAA 4BEBA 4DDWA 2DTEA 3A1TA 2NXCA 5CVUA 2HT6A 4OJTA 2FUNB 5P8WA 5KIAA 3TSYA 4WZAA 1DS6A 1TKAA 2J6CA 3VR4H 3V7YA 2QRMA 4EABA 4ZZ3A 5J4LA 4KE6A 1HQDA 4Q4DA 2J7PD 3GVCA 4YK7A 3I3OA 1KI1A 5LZ8A 4FWIB 3WP0A 3L7YA