1N2JA

Crystal structure of a pantothenate synthetase from m. tuberculosis in complex with pantoate
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
287
structure length
287
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pantothenate synthetase
publication title Crystal structures of a pantothenate synthetase from M. tuberculosis and its complexes with substrates and a reaction intermediate
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 93
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2002-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 1n2jA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1n2jA01
3CVUA 4MW7A 1MBZA 1KP2A 4CDMA 3QE4A 3F3MA 4DNXA 1FYDA 3N2YA 2X1LA 3FI0A 4UZFA 1VLHA 5KCMA 1OWMA 3K32A 1KR2A 3SP1A 1JHDA 1XJQA 2ZUFA 2CV0A 1N78A 1O0CA 1GTRA 4ZT5A 3RBAA 1NZJA 2A1UB 3S3TA 2WSIA 3Q10A 1H1TA 1N2JA 5J5AA 3FDXA 2HZ7A 3SEZA 2A88A 1Q19A 1VBNA 3H99A 4MWEA 1ZUNA 4YP5A 1J21A 3HFJA 4JXXA 1K97A 2VTBA 1TFUA 1WZ2A 4KPUA 1IFXA 4EF6A 3UK2A 4NAUA 4MW6A 1XNHA 5AHWA 4GRIA 4K03A 4RUKA 2WQ7A 3MLAA 1U3DA 4DDKA 1TEZA 1WJGA 1NUUA 3COYA 1J70A 2X3FA 1OBHA 1I2DA 1R6TA 3RK1A 2GOYA 3IUEA 4G5FA 4PY2A 2HGZA 1QTQA 1JILA 1GAXA 1YI8A 2DR2A 3ZIUA 1JZQA 3COZA 2CYCA 4Q16A 1TYAE 4NDAA 4DE5A 2NSYA 1PG0A 2CT8A 5K0TA 2J08A 2YY5A 3VU8A 5TGTA 3FY4A 3TNJA 4EFKA 1IQRA 2IJGX 4ND6A 1M8GA 3FNRA 3NV7A 4EG5A 3GMIA 1I6MA 1K4KA 4ZCQA 2CV1A 3SDBA 2G36A 4XSVA 3RJZA 5HG0A 5DEOA 4MQ6A 2A1TS 1KH1A 4F4HA 1FFYA 1NUPA 2PZ8A 2HMAA 2DXIA 3CVYA 3MMXA 1Q15A 4XFDA 4XFJA 4MUIA 1ULHA 1G8HA 1VBKA 4J75A 3IDFA 3G59A 3FWKA 4YMIA 2B7LA 4HJRA 1TYCA 4L2IA 1X8XA 3PRHA 3UMVA 4JXZA 1JGTA 2R5WA 1F4LA 2A7XA 2X1MA 3MXTA 1EUYA 3HV0A 1NURA 3LE8A 1MB2A 2PIDA 4WNYA 3HGMA 4MUGA 1I6LA 3AIIA 2X0KA 3ZXSA 1K4MA 1B6TA 3ND5A 4MW5A 2Z08A 3ND6A 1NSYA 1T6XA 3LOQA 2O5RA 1LW7A 4HJXA 2Z09A 3UY4A 3IMGA 1T6YA 5FNZA 3X1MA 3HZRA 3CLTC 1K92A 5IJXA 1WXIA 1IRXA 4DDHA 2QJFA 4DLPA 1QJCA 1O6BA 1EFPB 1OD6A 2CFOA 1JECA 1O95D 1YUNA 1MAWA 1GTSA 4MUKA 2PXHA 3DV2A 4DDMA 4ZCTA 1WXFA 1SURA 4MVCA 4PBRA 5JBNA 3SZGA 4YP6A 1J09A 1H3NA 1O97C 4AS1A 2QUJA 1OWPA 4ZCRA 2TS1A 1J20A 1N2HA 3DPIA 2JANA 3BL5A 1MOPA 1WKBA 2E0IA 3PNVA 3LCJA 3X1KA 1J1ZA 3ILVA 1ILEA 4MVXA 3IVCA 5DASA 1GLNA 1QNFA 3NBKA 3MUEA 1TQ8A 5HUJA 4U63A 4EGAA 2C5SA 3IOCA 3IOEA 4JYZA 4NX2A 2QTMA 4MAFA 1RQGA 3VGJA 1U7DA 3L93A 1LI5A 4GU5A 2NZ2A 4EG6A 2A1UA 4A91A 3IUBA 1NYLA 1EFVB 3PNBA 3CLUD 4MW1A 1A8HA 3IOBA 3ISJA 1WQ4A 4F3RA 3G5AA 2OV4A 1COZA 4ZCPA 3KFLA 1N77A 4YP7A 3SYTA 3L92A 1PFUA 4EG4A 1IQUA 1G59A 3RFFA 5DB4A 4ZT2A 3KT0A 3FIUA 3N8HA 1XNGA 4ARCA 2DERA 2QTNA 3PNYA 1TYBE 3ELBA 2A4MA 1ZJWA 4G6ZA 4KKVA 3SEQA 1IH8A 1KAMA 3IVGA 1KORA 3P52A 2QTRA 4KR6A 2A86A 3DLAA 1O0BA 4EG8A 4JFAA 1M8FA 3N05A 3AL0C 2JA2A 2YWBA 3CVWA 2QUHA 3TS1A 4HK4A 4ZT3A 2DETA 1CT9A 4ZT6A 4ND7A 2E18A 3PXUA 1EE1A 1YIDA 4U7JA 3GLVA 4ZT4A 1S4MA 1NP7A 2Z3VA 3CVXA 3TQIA 4EG3A 1JZSA 1TYDE 1YIAA 3C8ZA 1NUTA 1N2EA 2V0CA 3DO8A 3INNA 1YUMA 3K9WA 2GKSA 1M8KA 3H05A 3FETA 3UC5A 3AKZA 2CYBA 1KP3A 4QREA 4MULA 1N75A 3FH0A 5FO0A 4OUDB 3H9BA 2DLCX 4KR9A 3CLRC 1DNPA 1VL2A 1O94C 4RPIA 1QRUA 4CDNA 1U7XA 5H16A 4WSOA 4R0NA 3E27A 1KH2A 3X1JA 1PG2A 1N2BA 1IQ0A 2QUIA 1R6XA 5LM3A 1M1ZA 3HMQA 4YBRA 1IHOA 3QTTA 4X0EA 1N3LA 4E1AA 1KH3A 1QQTA 2XRYA 2WQ6A 1Y42X 4AQ7A 2D13A 2YXNA 4HPWA 4ZCSA 3VRHA 4TS1A 4G5YA 2YWCA 1PFYA 1WY5A 2OQ2A 5IHXA 1T6ZA 2IELA 3MLBA 1P7PA 1U0BB 1EXDA 4MUJA 3CVVA 5H7XA 1OBCA 1PFWA 1OWNA 4H3SA 3I05A 1O5TA 4MWBA 5K0SA 3FOCA 1OWLA 3RHSA 4UZEA 1EFPA 1KQPA 3CLSC 4QRDA 3TZEA 4BWVA 2V0GA 1QRSA 4NAHA 2D5BA 2QJTA 4MW4A 3ZJUA 4J76A 1O96B 2RD2A 3TZLA 1JEEA 1Q11A 2DPLA 1N2IA 2IP1A 3COWA 2GM3A 3P0HA 3TQOA 2PZBA 1ZH6A 4FZJA 4NZPA 1M83A 1WQ3A 3IMEA 4MVWA 1PFVA 3HL4A 1MRZA 3ZJTA 3U1VA 1JIJA 3Q4GA 1M8PA 3CR8A 2ZP1A 3OP1A 2J5BA 3FG9A 5HUHA 5BNZA 1N2GA 1QU3A 4ZT7A 2WB2A 1KAQA 1KQOA 3GUZA 5TEVA 5TEWA 4NATA 1QRTA 2PFSA 1EFVA 4KR7A 3CA8A 1YULA 3ZUGA 3A04A 3CLTD 1F9AA 3ZGZA 1D2RA 1BS2A 5LLTA 4MUFA 4R2LA 2O8VA 3IVXA 2A1TR 1EUQA 3CLSD 4MW2A 2J09A 2VXOA 2PZAA 4K0RA 1H3FA 3D6VA 3ZXIA 4MUEA 2PG3A 4MWCA 1O97D 2BTEA 2VTBB 3ZJVA 4KPUB 5TS2A 5DK4A 1WXHA 5F23A 1NUSA 1KQNA 3JXEA 1G8GA 4MLPA 1J1UA 2H29A 1X6VA 3QTBA 4OJMX 1HYBA 2I1LA 3UOWA 1Q77A 2A84A 1R6UA 3A2KA 5J58A 4MVYA 1JEDA 2H2AA 4CT0A 1WOYA 3SZ3A 3IODA 1JIKA 3N9IA 4I6GA 3A05A 4I6JA 1UFVA 3IMCA 3Q12A 4EG1A 5EKDA 5J59A 2AG6A 3RK0A 1V8FA 1MJHA 1NUQA 1IVSA 2XRZA 2BYTA 4Q93A 1ZH0A 2J4DA 1H3EA 3AG5A 1VBMA 1U3CA 3COVA 2EJCA 4OUDA 4PBTA 1N1DA 3FHJA 3OTWA 1JIIA 1MAUA 1KKUA 1T9GR 1GPMA 4JZYA 3P0JA 2RE8A 4EG7A 3A4IA 4R2MA 4MUHA 1O95C 1I6KA 4S1OA 1WXGA 4I6EA 3ND7A 1LI7A 2CUZA 3AFHA 2CV2A 1MB9A 1EJ2A 2AKEA 3H9CA 1F7VA 1F7UA 3P0IA 1M8JA 2E21A 2EL7A 2DUMA 4CQNA 4L2IB 3AG6A 1QU2A 3G6KA 1JMVA 2CYAA 4ARIA 1MC1A 2E89A 2DEUA 4DJAA 1V47A 2QJOA 3D6UA 4MWDA 5LFAA 1XNJA 1N2OA 1GN8A 3KT6A 4MW0A 3H97A 3KT8A 4U8HA 3CLRD 1O94D 1G8FA 3KT3A 5FO1A 3NBAA 5KWVA 2J07A 3CLUC 1OWOA 1O96A 2QUKA 4P2BA 2AZXA 4QBTA 2CSXA 4PBSA 4MW9A 1GZUA 2ZUEA 2D54A 3M5WA 3IH5A 1T9GS 1WXEA 2JAXA 5KHAA 4MUNA 1NI5A
chains in the Genus database with same CATH superfamily
4DV7B 3GFFA 1HE3A 1W0CA 4RTRA 1LVGA 4RVNA 2HXGA 3DBLA 5I7WA 1OFUA 2BBSA 2VDOB 3P2MA 4YI5A 1EHCA 1FUIA 3DTNA 1LVHA 5BMVA 2PX4A 4JLVA 1C7ZA 3S2EA 3EN0A 3LPNA 3G7SA 4Z2YA 2XXAB 3AO0B 4IUDS 4UHCA 5D8DA 1HLDA 1XX6A 5DULA 5DMXA 5ICFA 3KB8A 4BGDA 2CV0A 1UF9A 3D3JA 1N78A 2MDTA 2WOJA 1O6ZA 3ZDEA 1DRVA 1PW5A 4DCJA 5ULLA 2YRXA 3R77A 1M1YA 3E58A 4IKEA 5EMJA 5H3HA 4DEXA 3T1HB 2GD0A 5J5AA 4I4CA 3UFXB 5B6JA 1PYOA 3IQHX 4H0CA 1IG3A 2WSLA 1FNCA 5ALNA 1BFKA 3DMGA 5F1PA 2KBEA 1I7LA 2H17A 3MWYW 2VDWA 4OQLA 2I3BA 1YB2A 1NI4A 1ZD3A 2WD7B 3K9HA 3QPDA 5JV5A 1Z4PX 3PHLA 4UE2A 1GTMA 2NZUG 3OECA 3IB6A 3QNWA 1S3SA 4QFCA 4BNYA 5KS2A 1M66A 1QCDA 1YXMA 3DO5A 3KTAA 1OXUA 1UZMA 2JCBA 1ZNWA 3MLAA 3PCXA 5H3CA 4BYGA 2B1RA 1M1NB 1YBHA 3UG6A 5IZ4A 3COYA 1K8RA 2BR3A 1FFDA 3CZQA 4ARAA 4OQ4A 4YWHA 4HN4B 5I6DA 3X44A 1RLIA 2K87A 4E32A 3ZV5A 1ABFA 4J6EA 3K9NA 4CTOA 3ET5A 4EVRA 5B58C 3DA8A 5CD9A 3FDFA 1DAIA 2AN3A 2JLWA 2I1QA 2DBZA 1L5QA 4KAXA 3GD5A 4GI7A 1L5NA 3UWPA 3F6PA 4OMUA 1H93A 3ELUA 2C83A 2V59A 3HXKA 4QOJA 1X1DA 4KFUA 1K7XB 5EUCA 3R7WA 3FY4A 2JKVA 2WWXA 4G2NA 3T0GA 3PRKE 4JCOA 1GCOA 2QA5A 1GSAA 3M70A 2E87A 3GMIA 3O0DA 1B2LA 4OX9B 4Y6OA 2P9FA 4KLAA 2LCFA 2GS9A 2B2XA 5HG0A 1ISPA 2VR1A 1QHSA 3J7TA 1RYMA 1T6BY 2ZWIA 4V0ME 2FI1A 4F3KA 1X2BA 4NY1A 5BV1A 2WWYA 4FYHA 3B38A 4L6CA 1G5TA 4P83A 3CZPA 3JWGA 1CRZA 2PE5A 4WASA 1AS2A 3MMXA 3AF4A 3WHLA 2C2HA 1QFMA 1VBKA 2IHYA 1MXHA 2JAHA 1RYHA 2R6JA 3LKZA 4OVKA 3JRXA 3TGPA 1CF2O 4YS6A 4YMIA 3SDZA 1WD5A 2VRCD 1HL7A 4HJRA 4MINA 4OIFA 4BJ1A 4L95C 4CG0A 4ZAWA 1N6HA 2ODTX 1KK2A 1T5TA 2PL9A 1DSSG 4G1EB 3P45A 1WCIB 4IVPA 1X15A 1ULSA 3FMGA 3HPRA 1RBZA 5A7HA 2FPPA 3WI7A 3TM4A 3WL6A 4C4AA 2I7VA 1N9KA 1CDDA 1JV2B 2HHJA 3LE8A 2J3EA 1O2DA 4KIGA 2AJCA 1SJ9A 4ZEWA 3HA7A 1Z6AA 1UL1X 3AIIA 3AWDA 3X1DA 5LN1A 2OZKA 1AGNA 3EY9A 1A2OA 2LNDA 3EEYA 2VT3A 2SCUB 1NSYA 3QVJA 4B34A 4D9HA 3L06A 4BQSA 2O5RA 4X00A 1GEGA 2X4IA 1GFIA 2VTKA 4EARA 3I4FA 1EBBA 3CZ9A 5FTKA 3NEYA 3KV1A 4FEGA 4TSKA 4WJZA 3DYIA 4DCVA 4N5LA 1PLKA 3PJFA 4LHSA 4S1VA 5I7SA 2GW4A 3CYFA 1FDWA 2P3SA 1J0AA 1ITZA 2JDIA 4AY5A 4GSLA 3VVLA 2XGSA 1ZL2A 1T4CB 4GVPA 4QU8A 4HI0E 4OIMA 3BIXA 5DTJA 4C2BA 4CMIB 4Z7NB 4H17A 1P6UA 2CWDA 5T6BA 1F1JA 3Q3JB 4E4TA 2AYZA 4MVCA 3UJPA 3I9MA 2QENA 3QUBA 2I03A 4E3WA 5LSAA 2NACA 4K28A 1DHTA 2PSSA 1JZTA 4JLKA 2A0UA 5TY0A 2H2FA 2JIQA 4BASA 3CEAA 5FAKA 4X85A 1Q44A 16PKA 4YPVA 1EXWA 2VJDA 4HB3A 4BLTA 3IUNA 5HIIA 4EEKA 3IIKA 3X1KA 1C0IA 3L7DA 4NCNA 3AR5A 4NONA 2AZDA 2F1HA 1UBFA 2FGKA 2EQBA 3A8TA 3QPBA 4TLAA 5TVGA 5DASA 3UUFA 4CHTA 1A04A 3ND8A 4IS2A 2WINI 4MI9A 2RKBA 5CH8A 3DUFA 2C5SA 3UT5A 3OPVA 1J23A 3P96A 3KZ1E 1ABEA 2P9GA 1ECJA 3E70C 3ISTA 4CCAA 4CQMA 1PK8A 4S05A 3ONWA 4Y1FA 4AMYA 3RIEA 4A91A 3JVDA 2JA1A 3W7BA 1K6MA 1CVIA 2QSJA 1EFVB 1NUHA 2IKSA 4MUXA 3W2GA 4LGYA 1A5SB 2RHHA 4YV7A 1QG6A 3M6WA 1YFJA 1JR6A 2BV3A 1QQ6A 3H2YA 2JKZA 3CG4A 2VDRB 3VV3A 2QLMA 2WFLA 3AEQA 2DY0A 2G7ZA 4QU5A 3VDNB 1RDFA 3AETA 1ULUA 2QTWB 1C0LA 3K9LA 3QUQA 1JTVA 4HNRA 3COPA 4I1UA 1XNGA 1NNEA 1KHTA 2GN6A 2YXPX 4PO8A 3BMQA 4B84A 5EP4A 2I5PO 3LLUA 1E1LA 4XB2A 2Z3ZA 4G4GA 1M34A 3GLGA 2GUGA 3IEIA 1KAHA 4W9NA 3TE6A 1G98A 3LI2A 4HBGA 4BLWA 1C7FA 5FUYA 4CCWA 4EI2A 1N36B 3VPAA 4EPVA 3MAAC 1F0YA 3OD5A 2H48A 5KYKA 4G86A 4Q82A 4ERXA 4I8DA 2JA2A 1N8TA 3W5IA 4EFMA 2I6SA 2ZITA 2OBBA 1GKKA 4BB0A 2QG6A 2V4ZA 5HM6A 2BCJQ 4REQA 5T67A 4DVGA 5M34A 3PEUA 1SR8A 1L1QA 3EDQA 3MOSA 4W7IA 2XD9A 1SBHA 4YIKA 1TU0A 2E7ZA 2ZWPA 4KMOA 3U3ZA 4YJ3F 2YWRA 4KTVE 1BKDR 1JSCA 4XRRA 3KD3A 3ZBTA 5KX5A 3CN7A 1YQDA 4HAVA 4UHFA 3VOTA 1YIAA 1YJQA 3GPBA 2H52A 3C8ZA 4YA6A 1NSTA 3RWMB 3WYEA 4AF8A 1N2EA 2B4YA 5C37A 4DLRA 4W1SA 1EUCA 5FDFA 1XG5A 2C2WA 2W2XA 4Z4CA 3Q9SA 1X1TA 4LECA 4A6XA 2GD1O 1L4MA 4Q15A 5K51A 1DJQA 4JBWA 2JGIA 5JS8A 3UMSA 4QREA 1C8VB 1W2WB 4Q1VA 2UYYA 5G1NA 2OR3A 4OUDB 5KKNB 4XVHA 4KR9A 5IFKA 1ORTA 1YH3A 1BU5A 3CLRC 3OJWA 5IBPA 1XCPA 2VHWA 3MJVA 1ZISA 1Z7YA 2CVFA 3C6QA 2CVPA 4R0NA 3OTOB 3Q88A 5DBEX 3LZCA 2IY7A 3V2IA 3D3QA 3D5TA 1JG6A 3GNSA 4B3CA 5JISA 5AK4A 4EBBA 1PGQA 2BEVA 4N49A 5BSKA 1FJXA 4Y6LA 3VTKA 5L7TA 3TF5A 3CSDA 1U98A 5BUSA 3H0KA 2LCIA 4Z1OA 3KOYA 1XZHA 3JPWA 3OQOA 3AR7A 2WTBA 4UXHA 1V1JA 4MDFA 1XELA 3ZE8A 1KY2A 1H4TA 1JPUA 3CX3A 3WWOA 2PA0A 4P82A 1G5PA 2A3RA 4OG2A 1QGUB 4Q4HB 5B1DA 5HRCA 1JFFA 1CUWA 2UYOA 1GGVA 5IJAA 1NP3A 4Q7EA 4R7TA 5ITZB 2BFAA 4JGGA 4BBZA 4EHJA 2IBTA 4CJXA 3HFGA 2DJ5A 2A9RA 2JLSA 4KTTE 3OPNA 5H9WA 4TV8F 4DBVO 1M2WA 3O0TA 4DG5A 5HGJA 1R9JA 1CUYA 2OCAA 2QR3A 3EFOA 1KI6A 2Q1UA 3AHFA 4R51A 3F5SA 5E0OA 2WSSA 3EUFA 2GK7A 3KELA 4C0BA 2QK4A 1VG1A 3ZC3A 1IAQA 1NBWB 3FLAA 3BCRA 1L1RA 2PBLA 1ZGHA 3SC2A 1G3RA 1TIKA 1FDTA 2AV6A 2YWGA 5JAHA 1XZEA 1P1JA 4LMPA 4OQZA 2QJTA 3CEHA 4PFKA 3HCBA 3FVRA 4MW4A 3KPYA 1OX4B 2LPMA 4JR1A 2QLNA 4I3GA 3SU8A 1Y3CE 2BTQA 4ARUA 4X44A 4UUAA 3SQXA 1CRWG 2X5JO 1DCTA 4M0LA 2IZ6A 5EIHA 1TCAA 4B3TB 5EQDA 3KQKA 3VHXB 3CZ5A 5AHXA 2JLZA 3MBIA 5K8UA 4ZDWA 1JMYA 4IIJA 2YJZA 2FR8A 4FSHA 1QP8A 5GY7A 4UKDA 4KN6A 4UM9D 3V8MA 1U9IA 5FWXB 4AP5A 4DWOA 1IWOA 3LWDA 3N59A 4B6QA 2ET6A 2VP2A 3O94A 3NHSA 4TQ9A 3BUSA 4KKXB 3MTGA 2AKYA 3OEED 5J23A 4C2TA 5HUHA 3FW1A 1BFUA 1YR9A 3H19A 1AGPA 1TQDA 5BNZA 3H2GA 1YKFA 1VI6A 1YR2A 3A4LA 3CRNA 4QYTA 5IAEA 2AI3A 3TNLA 2AUTA 2W71A 5HZGA 3VU3A 4QOSA 3K6SA 3S2ZA 3AF1A 3G17A 1T13A 1TT5B 4OXQA 4BNWA 4FFBA 4E08A 4R1PA 4QZVA 1QK3A 1YTUA 3NWBA 3SICE 5J4KA 3WQBA 5I7EA 4XCXA 4LZOA 3DTVD 1F6WA 2C8KA 3EBPA 1LK0A 2AMLA 1ZGBA 1Q2XA 1C8LA 1WO8A 2AFIA 2VWPA 2O8BB 3JVEA 2PKCA 1DG9A 1AK9A 4DJDC 2EIHA 3DE7X 2OYRA 3OZGA 3IE2A 1EFTA 3ON5A 4DIOA 2O3TA 4BMDA 1ZUHA 5CM8B 3C7TA 4FYMA 1XAJA 4EGJA 4PQRA 2RHBA 3IA2A 4D7AA 4MLPA 3ZVKA 1WY7A 3O92A 2H29A 3U16A 2ZAGA 3LVRE 3ODGA 3OUUA 4OJMX 1ETUA 2HQRA 5HF6A 4C4RA 1XLTA 3SLKA 3ZXYA 2R84A 4GWLA 5D3ZA 1L7VC 1OCEA 4C01A 1ZI8A 2G0AA 3T12A 2WF6A 4EPXA 4S0ZA 5J4HA 2J6BA 3Q12A 5DKFA 4CU2A 4DSZA 4EG1A 4UOZA 2GZ2A 3RANA 2F9LA 3DHNA 3OO1A 1PJ8A 5KAMA 4JLSA 4RVCA 5FXMA 2I7CA 2ZIFA 421PA 4CNQA 3AI3A 3FPJA 4AY6A 2PRZA 3H04A 3R23A 4J1NA 1KZYC 2YVKA 3KAJA 3KOMA 3E3MA 5FPHA 4BNLA 5FI0B 1CF4A 4IDHA 3N5KA 4KXXA 4RL4A 3WJAA 3ZUPA 1U81A 4LW8A 4BCCA 2ZZNA 4LJLA 1VRWA 5LP6B 1W2GA 3MJEA 1C1XA 4LNUB 4U2FA 4PAWA 4BRUA 4LF6B 1DELA 5DMHA 1GNRA 4YAOA 3LUAA 2QZ4A 1E9SA 1E66A 1T9GR 2CNLA 3T4XA 2XE8A 5BUQA 2QORA 3P19A 4OUKX 4NJOA 2J1LA 3UVEA 3ROFA 3C5WP 3ZWYA 2GB4A 5EE0A 1WBDA 3V8NA 4DBLC 3R20A 3REQB 4D3SA 5GJBA 1WXGA 1XYGA 3ONEA 3W6UA 4IDBA 3AFHA 4RZHA 3RTCA 1YBVA 3ROMA 1BEUB 4YCBA 2WM8A 4PNPA 2F3SA 4FFOA 4QATA 4QU0A 3R9XB 2XCRB 2H8GA 2DWCA 1U2DA 1OFUX 1UT8A 4AWAA 1EH5A 1UR5A 1CR6A 1U8FO 3PGA1 4TYQA 5TPWA 2NU8B 4BC1A 1PEAA 4RAQA 2XUOA 2JBHA 3MC1A 5AT1A 1M7BA 4MGEA 3K2BA 2XWBF 4B3DA 2X23A 4RMNA 3CFHL 4IXNA 2WW8A 1JHMA 2NVUA 4V1CA 1ID8A 3K0HA 2O48X 3QXHA 1H0HA 1XD8A 1GVNB 4FGZA 4DJAA 4XYLA 5K45A 4BGIA 1Z73A 2BEKA 2CF6A 4NFSA 4Q9IA 3QVVA 1AY0A 2A30A 2X8WA 3EQ2A 4OHPA 4ZRMA 3SCZA 1UKYA 3HM9A 1TVCA 4BZQA 2OAEA 2MSEB 2G71A 4BTLA 1V16A 4RFLA 2R62A 1ZK3A 4DIUA 5HIKA 1ZJ6A 1ID1A 2Q0SA 1A95A 1Y3HA 2WP8J 1F8GA 3AESA 5EP1A 5A4MS 5JPDA 5ITSA 2C4KA 1R4MB 2XQKA 5JCJA 2R6FA 1GT91 4QVGA 2QUKA 5AJTA 4MUBA 3SIWA 4EMTA 5KTKA 2OKCA 1AV6A 2CEKA 4GLJA 2D1SA 1AUQA 2I71A 4QFDA 4ZOQI 4D0RA 3CBQA 3HJAA 4D0LB 1TXGA 3CLHA 2MR6A 2OP0A 2R6CA 3K72B 3BZUA 1CZOA 1E60A 3GCDA 3Q6NA 4RF4A 1WB9A 3OLWA 4C4SA 4GI3A 1GZ4A 1K5PA 1DLIA 1KMNA 2JGLA 2RGGA 2GD2A 3DOFA 1Z83A 1WR8A 1M33A 3MMZA 4I3FA 5FPPA 4ZXFA 4BO9A 3CVUA 1LA2A 5CFPA 2ZSDA 4GOJA 1F06A 1LPAB 2PM8A 3SNHA 4NE7A 1KO5A 2FZEA 2Z5LA 4D02A 2LE0A 4N3AA 3MJ4A 1K7EB 1YU6A 2ON6A 1RXWA 1U0EA 2ZYUX 1H2ZA 2HI0A 5HKKA 4PHFA 1QLWA 2H4ZA 1YVDA 4HGYA 3GEMA 1N2SA 1VLHA 4IMPA 2BMVA 1F3OA 2ZB2A 2YC2C 1E1QA 3MCUA 4K6HA 1M2OB 4LSMA 4V39A 2WJPA 3D2LA 4EKDA 1CJMA 1XJQA 5FUVA 5LZ2A 4BE9A 1F9EA 1S0UA 1GTRA 5ESRA 1DTWA 4C5BA 5IKXA 1FYXA 1B0AA 3MWEA 1YCDA 1KNQA 1JBQA 2C9CA 2OBLA 1F4PA 2CVHA 2WIAA 5K3FB 2AE1A 4EI9A 1FP7A 1NWHA 5JFGA 3OLQA 4S2EA 1OVMA 5DM0A 2OHGA 1JHRA 2X42A 4X1IB 2W6ZA 4K9LA 3JD2A 1IY2A 3EJWA 3MINB 1QYXA 4R83A 3R7DA 1KZ9A 2AXNA 2JLBA 1CUVA 1JJ7A 1CCWA 3C1TA 3N07A 4DR3B 3T7EA 4OOEA 4KPUA 3Q3CA 4N5NA 2PQ2A 4EF6A 2XDAA 3A0UA 4RGYA 2ZJAA 4CLRB 5G53C 2DT5A 4HAIA 1LDMA 1PLJA 4RYLA 2H18A 3HXTA 4YPOA 1KETA 3NWPA 3M7IA 4PONA 4W9RA 1X2EA 1SCIA 4ZV7A 5HKBA 2FKNA 5GVSA 3H4VA 3D4BA 3RRBA 1GLVA 2QMUA 4IHQA 4GD3Q 5E4YA 2GOYA 3TLXA 4G5FA 2XH8A 1J22A 3G9UA 4FKMA 1U28C 1W581 1XVIA 1XZGA 3L02A 2HSDA 3GJTA 4ZZ0A 5ALYA 2Y67A 1ZEMA 2Y1OA 1TYEB 4QUGA 1J4AA 1CRQA 2J3HA 4M36A 4I2NA 3PEWA 1CVRA 4UFNA 4E33A 4BBPA 3C45A 1UJMA 4EA6A 1DARA 3JASA 3UJCA 5K0TA 1L5RA 3HL6A 2DR3A 1A88A 2HA3A 3EVTA 2WTUA 2L42A 4UUOA 2IITA 3VU8A 4QBKA 4PC2A 4B4WA 1XMIA 2C9OA 2VOJA 3EW9A 1C2TA 3FHOA 3K6KA 3R7BA 2A57A 3VC2A 1BGXT 1MEJA 2CMFA 2PX6A 3P9IA 1M72A 1UZLA 4FILA 1RYBA 4MGKR 4N54A 3H1TA 4MYCA 4NCJA 3UMJA 4FR0A 1U7HA 3TINA 5ELXA 3AR2A 1VJ0A 3E1SA 3OAAA 1AXRA 5G4LA 1Z26A 5IAGA 4KQ1A 4AROA 5BWBA 4OFXA 4HRXA 1EU1A 1BXZA 1Y1KE 1Z75A 2YVQA 3TMKA 5KSOA 3HCOA 1W36B 2UXCB 3UV3A 1Y1QA 1TGVA 1YU9A 2C0PA 3PENA 1JH8A 3D54D 4CLEA 4CDRA 5E6RB 4GOMD 5BT8A 5JS1A 2B4QA 3W7AA 1BYIA 1V41E 5EXXA 2VP0A 1JYSA 1Q91A 1GPWB 1S2NA 2GBGA 521PA 2GM4A 2V6IA 3D2BA 3U1TA 2KPOA 3KKPA 3OLYA 4YAWA 3H75A 2ZT7A 5D5QA 2WG2A 5LOVF 2HWWA 1DBRA 2A7XA 4PGMA 3LP5A 4G41A 1WPRA 3SE7A 4WNAB 1KO8A 4PGGA 3UHAA 2BEWA 2NV2B 2IBMA 2QN3A 3VKWA 2JBWA 3YASA 4C7OB 2QL6A 3DE1X 2QUAA 3QYPA 4B4UA 1PCXA 5I9IA 1SO8A 4I8IA 3VO1A 3FKSA 1SQ6A 1KI3A 1ZCAA 2FN3A 1P19A 1EJ0A 4HDSA 3QELB 5ES4B 4JI4B 1R37A 4JT4A 3BH7A 4JSRA 5HK8A 3EH2A 4BMNA 1Q6ZA 2YUIA 1PYGA 5A04A 2CHVA 1LFAA 3D8BA 4OD0A 5IULC 1WXIA 4GQIA 5IAAA 1Y8QB 8ABPA 3ZKWA 2JIRA 1R6BX 5BXQC 2VBIA 2ZDGA 2ZUVA 2GUWA 4ZC1A 2RAPA 5IZCA 3ANMA 3R3ZA 5TNXA 4KX3A 2P4QA 3HJNA 4DDMA 4HDKB 1W29A 4H31A 2K7ZA 2BBTA 4D3FA 3N6RA 3LXXA 1OAOA 2MIIA 4RETA 3PLRA 5ER9A 1JLRA 1VA4A 1IB0A 2WMOB 3G68A 5ABPA 4XB1A 4UU0A 1C3OA 2IYNA 4JIGA 2BP7A 2V7VA 3PJGA 2TS1A 3QFTA 1XZIA 5LU9A 1WSDA 2WFAA 3GYGA 2VP9A 4PRLA 1DMSA 3WFIA 5TLSA 1H69A 4D4IA 3GFBA 4F96A 3GT7A 4Q9DA 1JDTA 3C1UA 1SXHA 3DGEC 4K40A 4MQMA 4R3WA 3RYFB 3ZCSA 3TQTA 3E61A 1T9HA 5TMBA 821PA 3KEQA 3MFYA 2OCGA 4OM8A 3BXXA 1XZQA 3H2ZA 4FN5A 5CK4A 3L0YA 4IICA 4RD1A 1RPJA 5JAPA 5KVVA 1CR1A 1LSOA 3SKXA 1PNOA 4TZ6A 3F98A 1RWMA 1U7DA 1V71A 2A7QA 3L93A 5KNCD 3K16A 4ZZ1A 3RU3A 4BNIA 3I52A 3TYXA 2B83A 5JBIA 4U0KA 1XRSB 1R27A 2AEFA 1UBEA 2WF8A 5L6LB 2R4UA 4O4HA 1Q2UA 1GQOA 3NORA 1N9GA 1V6AA 4UPDA 1MT0A 5LKAA 4FQ8A 3LPAA 1NBHA 5A5EA 3WDKA 1EM8A 4PHGA 5H0IA 4IJ5A 3P2EA 1N6LA 4K46A 3DDOA 2VT6A 1ML3A 1SHJA 2PYZA 2H4WA 4HDOB 3CEJA 4N5IX 3SEQA 3JQ8B 4D6XA 1J8MF 1LLFA 4IFEA 5LDGA 3BBPA 5A0TA 3PPWA 2FDRA 4MIYA 1QX3A 3GRKA 1LXCA 1QPBA 2LW7A 2O3UA 2J9FB 2QTRA 3P52A 1B73A 2GJ9A 2JD1A 1AC5A 3NDIA 1UADA 3GLFA 3L4BA 5AM3A 1U0JA 5BNFA 1KVQA 3ESXA 4HB0A 5JQWA 3GCZA 1I4EB 4WKCA 4F8JA 1J9GA 2GXUA 4NENA 4O2BA 3KR9A 3ZCVA 4P84A 1JTFA 1XA4A 3L04A 2VJNA 3I76A 3D31A 5C1PA 3LF2A 1YIDA 4TV9B 5G1PA 5H68A 1U4OA 3CT6A 3T34A 1LJUA 1ZJJA 1U5CA 1FLVA 1TYDE 4ZU1X 5DT9A 3CZRA 4MPJA 1XXHA 4YPFA 4KOEC 4H77A 5KTRA 1PEYA 4XZ3A 2GBLC 3GFSA 2G88A 2WJHA 3DMTC 3NYIA 3M0EA 1QQBA 2I2XB 3AOEC 1XD2B 2GKSA 4KOAA 3VNRA 3GRYA 2B21A 2QN8A 4DSNA 4GBED 5CX1A 4FHEA 2BGWA 2HQBA 2IYXA 3UFBA 3K1TA 2DETA 4X8HA 4B3RB 5BSTA 4F60A 3KX2A 1VE5A 3BDIA 4FE4A 2CMGA 3LDAA 4CKBB 1F5NA 2KB0A 2WYOA 4C4OA 4Q02A 3PICA 4FIZA 1QRUA 2OVFA 2JFGA 3TLJA 3C3DA 3PDIA 4EB6A 4Z4HA 2EBFX 4F72A 1KH2A 4OQPA 1M10A 1JPVA 1N2BA 2RJ3A 1QANA 2EXXA 2QUIA 3BXPA 3JWPA 3PQ2A 4G9EA 2I1VB 2GPNA 1PJTA 2FMKA 4P08A 3ICOA 1LNSA 3ABOB 4Z3DA 1DGQA 1Z2CA 2VYVD 1UFOA 5EKUA 2XRMA 4ZFNA 2H3EA 4YRDA 1DJPA 3EQ7A 1P0MA 1SD2A 2ZJOA 2ZR0A 4US1R 1G8KA 3FFXA 4W1PA 1A82A 1GGMA 4MQFA 4QJ4A 5CURA 1RAFA 5FQOA 4EX6A 3KBBA 2WTNA 4GYYA 1PWXA 3OU7A 1BXGB 3SQDA 1N1GA 2ZWOA 3IAHA 4YH1A 2IV3A 2VHEA 2XA1A 3RUFA 3VH2A 2W7TA 1MQ8B 1TKRA 3B12A 4IIXA 4GPEA 2ROQA 4ZQHA 3SF0A 1BD4A 1BW9A 1PR9A 5HP4A 2GFQA 2BKVA 1XF1A 2XLCA 2A78A 2FPPB 4CMCA 4TMYA 4F3CA 3WJ7A 5G4KA 4PNEA 3UWKA 1E4EB 3FPFA 4ITVA 1VCHA 1T1SA 1UINA 5P21A 4B79A 4NU5A 1C8BA 3CLSC 4CUZA 3DXXA 2RHGB 3QUSA 1KYVA 2RI0A 2GJSA 1OH5A 3H2IA 1C1DB 4J4TA 4QM6A 2O0MA 3LKVA 2ZIXA 3JQDA 3WIDA 1ZD1A 3NIWA 4BWVA 2XYPA 4UD2A 4LZPA 4B81A 4C20A 4CN8A 1ISIA 1WSBA 2VP4A 4P0PB 4RLHA 2Z0MA 5MN5A 4QPCA 3IDOA 3WSTA 3RS3A 1XHLA 2MWMA 3KP1A 5BYBA 4C3ZA 1MDBA 2NG1A 1Z22A 2AFHA 4Q3AA 3E3AA 5DISB 5A9SB 3DW3X 5GZ1A 2BRUC 1C4XA 3F9IA 3KUDA 3A9RA 2HA7A 2UUCB 3IV7A 2BFPA 3JD4A 4FW8A 4B2LA 5LA6A 1SA0B 1W94A 1XLWA 3CF4G 4J8PA 5DDIP 1GNVA 1Z08A 3QYAA 5F3WB 3IEUA 3NVAA 3IQWA 5K0CA 2Q27A 1E89A 2BKLA 3BJRA 4A10A 3RVPA 3V4LA 5CIQA 1T0IA 3L8GA 4HFMA 5CLQA 1TQ2A 4DN6A 1UAGA 5DGDA 4PEVA 3WKBA 1EGAA 1MW9X 3WZ2A 2X40A 3L0DA 4RK7A 3P9XA 3EGVA 3DL0A 5CYPA 3KZNA 2CFTA 1N2XA 2GBFA 3DEHA 1E1MA 3GJ8A 4HP8A 4X93A 5FFFA 1MFPA 5B3AA 1O8CA 4B7ZA 1DWUA 2DHCA 2YINC 3D43A 3QXGA 3VR4D 3SWWA 4N48A 2C61A 3WNBA 4ZANA 1C3XA 1GTZA 1N0WA 1Q0SA 2GEDA 2OILA 5EE1A 2XUDA 3OETA 2PKEA 3GAZA 1JT9A 1TJYA 5FFNA 2ZKLA 1W93A 2QQEA 2WJ3A 5I7AA 3O6VA 4JK3A 4LY3A 3TDMA 1VKNA 1P2GA 2AD5A 3B9PA 4N3NA 2WVGA 1VCIA 2HPVA 3LL4A 2PZAA 3N3BC 4IDAA 3ELWA 4K0RA 1U7PA 2NV0A 4LCBA 5DWDA 1JA0A 4H1WA 5B4VA 5FNVA 1CF9A 5L3QB 5EIEA 3O8QA 3ORFA 4GG1A 4AD8A 5A06A 5T57A 4GC5A 4KZPA 3WTCA 5TS2A 2J0EA 5KOHB 2NP6A 1GPNA 1BXKA 4NHOA 2O2SA 2ZUBA 1AS3A 1ESNA 5I51A 4RVFA 2YUTA 3IEMA 1H5UA 2VNAA 4R8KA 3C3CA 2WF7A 4FDAA 1KRHA 5IWAB 5IASA 1VSBA 3GZNB 3KQSA 1T0PA 4FSDA 1EAYA 1BQ3A 1VB5A 2BGUA 4RY0A 3S8MA 3U49A 4A27A 4CEJA 1PEDA 3VNVA 4BUZA 1DI0A 1G60A 4YCDA 3ZLVA 2OGZA 1NI3A 5G2FA 1ECLA 2DWPA 5EKSA 4MIOA 3IP1A 4B2PA 4DLWA 1C0KA 1WTCA 4I55B 2JZOA 3T7IA 3HNRA 4LHWA 5CLFA 3FPSA 2G4CA 1NUQA 3WYBA 6YASA 3PFFA 4F84A 2XRZA 3TR5A 4H7KA 1IXRC 3RU9A 5IK2A 2CFSA 1QF6A 3G0CA 1BDBA 3HS3A 2F8MA 2EJCA 1NXXA 3T7DA 5BSGA 3KYIB 2GN4A 1UPAA 2X4GA 3GJXC 3EPHA 5JBQA 4Q3CA 3KZVA 3ZWVA 4AJ2A 3IRVA 1MXFA 4RFSA 3QX8A 2RJNA 1EGVB 1CRLA 2VJMA 1JH9A 2IF2A 2VAXA 1XZNA 2C54A 5ILGA 1FPMA 4I5DA 4HOYA 3I01A 1PV1A 1ZH2A 1B8NA 1SXJE 2GWRA 2VEOA 3KU4A 3FNQA 4FKZA 4ID9A 4CYMA 5B30A 5CEFA 1TUEA 2J33A 4GI5A 3TLYA 5IPFA 1MHTA 1R0WA 4J4HA 4O2AA 1Q21A 3T3GA 4YRTA 1IOWA 2B35A 2FETA 3DS8A 4EG0A 4Z3KA 3HXLA 4U9HS 3TOCA 3EMKA 2Y99A 1OLSB 1ECPA 2CCKA 4ILEA 4I4TB 4JYAB 1GN9A 2BKUA 3FD8A 3IAEA 1ZYUA 2NVOA 5FOVA 1V5GA 3MGAA 3FSGA 4ZMRA 5F9HA 1H9CA 5I4CA 1Q17A 2A0KA 4R54A 3RHZA 2VPWA 4IOMA 1V3TA 4BAZA 2C96A 3GT4A 2LMEA 2ZR8A 2PPVA 2ZT6A 5JSFA 2DPGA 2HBRA 5CT8A 3SM9A 1OXTA 4K88A 2B4RO 4M1QA 1J90A 4GSKA 2XUIA 4AZ0B 2V7XA 4D92A 4M76B 3H5OA 2XAUA 2GSDA 3S6JA 1YDMA 2COEA 1CUJA 4Q18A 2HPAA 2AR9A 1LBTA 4BHTA 3B1VA 4Q21A 2PH5A 3BKWA 1DX4A 3KKZA 4OLHA 3HJGA 4TYPA 3EVAA 3HLTA 4RAOA 2R5NA 1G8FA 1W30A 1KEUA 3KT3A 3T3DA 3H11A 3IMFA 4U7DA 1SXJB 3TW4A 4BRWA 3EGXA 3VM6A 4MRVA 4P2BA 1QHHB 1SHZA 3OF2A 1U3FA 1B8PA 5EZYF 2BDUA 2WP0A 5HF8A 3MVEA 4B44A 1ILWA 1GSHA 1CY2A 1YO6A 2I4NA 3ZCRA 1JMKC 4EHFA 1WDLA 2YMLA 4G2TA 4Y6RA 2AQKA 4CIAA 4CKWB 3GFTA 2Y4NA 4D9IA 3NANA 4N8EA 2XZTA 1F3LA 4G5HA 5E8JA 1US8A 1XE3A 2W2LA 3AERA 4K3VA 1H2WA 1ZICA 4LC1A 1EBFA 1YA8A 4FE3A 1VE9A 4RADA 2RHMA 4FBGA 4CM4A 4ROTA 2J85A 2RCNA 4JI3B 2C99A 2DHQA 2IOQA 2WV9A 3ZWBA 3QF4A 5BN3B 4EJFA 1JRLA 4EZBA 1DPFA 3WLSA 5AVUA 1KJZA 1MVNA 4RZQA 4R2WA 1LGYA 2YJNA 3MTBA 2YDXA 1ULAA 1D7OA 1C9YA 1WHSB 2HBQA 4WJKB 5COAA 3DBIA 1A5ZA 5DCWA 3WMRA 3N2YA 1Y6QA 3HZHA 6Q21A 2X1LA 1LI4A 1VHLA 5DGIA 1KU6A 4UXJA 5TXGA 1AQUA 4JEUA 1OWMA 4QX6A 2JFUA 5M2QA 4NOMA 3ZIAA 2ZUFA 2FX5A 1TCUA 2C98A 3STUA 1CS4C 2VDKB 1UH5A 2C4MA 3EWIA 1PTJA 3GRAA 4QPPA 1L5SA 4QTTB 1BMFD 4TKZA 4UE3S 2NUTA 3VYVA 3OMWA 3CS3A 3TZKA 3C0KA 4OXKA 4GOND 1UBCA 4R8SA 4B46A 4JLJA 2JJ1A 3A14A 1RHQA 2B5WA 4FGSA 1R18A 4HQLA 3FR7A 3GUUA 3L1HA 5A0VA 4KREA 3FFTA 3K3PA 4HUQB 3LC2O 1X1CA 3EULA 1AKMA 4N0QA 5AKZA 3IIMA 5DTQA 1MAHA 1YQQA 1PFGA 4UBOA 5DBHX 3B2EA 3OQ6A 3VC3A 1RABA 2Y6UA 5FIUA 3NP9A 5CW1A 2ECFA 2G3YA 1AKRA 4B6FA 1TEZA 3WSWA 4LF4B 1YT5A 3WGOA 4P4GA 2HRZA 5HX7A 3I6ZA 4QEKA 3KQYA 1PQYA 1J70A 1OBOA 1SWWA 1YVUA 3EIEA 3RTGA 4M46A 1E6EA 1QP7A 3ZVLA 2J7PD 3SZMA 3X43A 2P68A 4TXHA 1LDYA 4V0NA 5K3BA 3V8PA 3LUBA 3NMUF 1U2EA 4C3UA 1JILA 4R4JA 3MPUA 4M54A 1IBSA 2IZ5A 1P77A 1BMTA 3C16C 3QGMA 1GYPA 3W5HA 2FPOA 4I8XA 4M1ZA 1I2BA 2OGFA 3RV4A 4TL8A 2POCA 3MBKA 5IDQA 1NJ6A 1DCKA 2G67A 3PS9A 4U7FA 3W2FA 1DKRA 3B3GA 1SMKA 2Y0EA 3AF2A 1HE2A 5A05A 1GSOA 4C4PA 4DMRA 1ANKA 3LSYA 4ND6A 5J43A 3TUZC 3AHDA 2ZR7A 2D8MA 4K3UA 4FCVA 1RS0A 4Y9UA 4E21A 1KVSA 4AMUA 2C9DA 5KTPA 2OFXA 4KH0A 2N46A 5KNLA 1ADCA 3DJYA 1NXQA 3S27A 2JIZD 3D4IA 4MQ6A 1E9EA 2YL2A 2D7CA 3V8BA 1QZZA 3LX8A 1MD9A 2B6HA 4CM8A 2GXAA 1S9DA 2ZJ8A 2W8BA 4YNBA 1UK6A 3UW3A 3PDCA 2CXQA 2QPAA 1FFYA 1HSOA 2I2WA 2AYXA 3B6IA 1NA5A 2DUNA 3ACCA 2RH5A 1R8SA 2EATA 2M1ZA 1G20B 2X1VA 3QLVC 1DKLA 1KSFX 5E9JA 3DEYX 5AVJA 1L8QA 3QBEA 5KPJA 2O8DB 3VU1A 4UW9A 2AH5A 3DP7A 4C4TA 3IESA 4E2FA 1OYWA 2CFRA 2OM6A 3FPGA 4GHWA 3HDQA 1JGTA 1P4SA 2AMVA 2VSYA 4I9NA 2IYRA 2VPXA 4JA2A 3T9AA 3VBEA 2BKAA 5ALIA 4BLQA 3NHJA 4IVQA 4PCLA 3EXIB 3CJRA 1XZMA 4RDIA 4UD6A 5DNEA 3IELA 3HGMA 1T8WA 3TRJA 2WNSA 4NABA 1Z5NA 5EPUA 2WUWE 2XAAA 3WL7A 1FP4A 5DOVA 1VGQA 2PXCA 3HR4A 1THZA 4GECA 4X92A 5COBA 1JA9A 4KGVA 3VC1A 1OIWA 1LW7A 1XQWA 2EFYA 3BXOA 2GETA 4HGRA 5FYQA 4BLVA 5CCXA 1A7KA 1UQRA 2FMFA 1J6UA 3ZGXA 3RIXA 2FDCA 3CX7A 1WTAA 2FF5A 1U1IA 3T1OA 1X8KA 4K9RA 2CGEA 2NOAA 1Z45A 3BF8A 2PRIA 3COSA 1XCOA 2FUKA 2W6CX 4II3A 2X4DA 4JAVC 4PLYA 5CDHA 2QNRA 3M6VA 2ZBQA 3UCFA 1VL0A 5KJ1A 1G6HA 2A52A 2I2FA 1K7SN 2Q4TA 4YMSA 2GWHA 4DJTA 1F5SA 2FR0A 2QYHA 4OHXA 4YIHA 3WHKA 5ERGB 5L3RA 1JIUA 4ZTUB 4IXDA 1I13A 2ZRKA 5IWCA 3DFMA 3NT2A 4J16C 5MN4A 2JFXA 3FLBA 4CQLA 2GNAA 5E6UB 2QUJA 4QGSA 4UMVA 3MWDA 3GLIE 1WZIA 2GJKA 3E9MA 5KYTA 2BFCA 2Z6VA 1DAHA 4GEGA 1XZDA 1EFUA 2XUHA 2E0IA 2NW6A 1VDZA 3QWAA 4LJSA 2R00C 1QFXA 4NNJA 2PUJA 4RWEA 1K88A 1O1YA 3IP9A 4XD7D 3RYIA 3NTOA 3NBKA 2A35A 4Y2GA 4PAGA 5HW0A 4YQYA 5K3OA 4MQ4A 4U63A 3GLHA 2RGYA 1QE3A 2CZCA 2N1BA 3HG7A 4RCYA 1NRIA 4RJJA 5CNJA 3WS7A 4C7VA 3X1WA 1XWWA 5IVPA 4GX5A 1EMDA 2R8RA 2A1IA 4MMZB 5CYOA 1EDDA 5LP6C 2REXB 3C3KA 5F7OA 4YXWD 2CFIA 4AY4A 3IUBA 2JGRA 3VVCA 2H1VA 4KR2A 2QRHA 3L6BA 4GICA 3L40A 1A8HA 4CLOA 1WQ4A 4HY3A 1P9RA 4MR7B 1G2IA 4WLUA 4CPDA 1HL3A 4NR0A 3SYTA 3OKPA 4N6OA 1WUKS 1JVSA 3JQRA 3O03A 5AM5A 3WLRA 2P9CA 5DB4A 4ZT2A 3NTRA 5F76A 3TQFA 3FOEC 1PR0A 1NW5A 4B7AA 5AFSA 2C97A 1ZCZA 2E49A 4PX3A 1X1RA 3HY6A 3T1VA 2VWGA 4KLNA 4QDUA 4OYRA 3GLIB 1NY6A 1EGQA 4D1YA 4MGHA 4PZCA 3A3NA 3OF5A 5I3ZA 1O0BA 3DBOB 3IEPA 2XXJA 2OVBA 4ZZ2A 1PS8A 4D6PA 1QBGA 4CM6A 1QXSA 3NAGA 4KO2S 3TS1A 3EMBA 4LXGA 1E7YA 1ZO8A 4NG4A 1I1NA 4QASA 3ETJA 1ISJA 4KGDA 4UHBA 4DA0A 2O4UX 4G1FA 3U60B 1YZ3A 1ZQ1A 2B36A 3HWX1 4GZ5A 5EJ2A 3KL4A 1K06A 1S7CA 4V3CA 1HDRA 4YT5A 1RZRA 4CG1A 1M6EX 3LCRA 5M29A 4LKRA 5GZ3A 1UMKA 1Y8CA 1ML4A 3DO8A 3G8DA 3Q98A 3NNDA 3VXKA 5EJMA 4A3SA 4YXFA 3J80A 3OZCA 2VP6A 4HWRA 3E1GA 3F5MA 2IP2A 1FDOA 3HBLA 1XV5A 3E84A 3EXAA 2YCBA 4TT3D 3IVMA 3Q7QA 4QUIA 5JANA 2OBFA 5EQTA 1YR7A 3K70D 3PUHA 1GG9A 1VL2A 4EKIA 5HNKA 1OBFO 3WRVA 4A2PA 4LISA 4JQZA 2C7PA 4AXBA 4UQLA 3E27A 2XTAA 3P9SA 3PVZA 4TYMA 3K9FC 5MN6A 1R0YA 1KIMA 1PKEA 1IQ0A 2X4LA 3O47A 3L84A 2C4TA 3ZX4A 4Q7QA 1SN7A 3A26A 2PUGA 4RKFA 2SKDA 3HMQA 3RHFA 3BD8A 1QQAA 3TSYA 1JE0A 1GCAA 1TC2A 4L78A 2YV3A 3UJ9A 4AUMA 2HRQA 1KH3A 3OZXA 3V34A 2VZ8A 4JOBA 4TMXA 3PPIA 1CJVC 2B1JA 4E1BA 5K2MA 3QPVA 3L9XA 1CQIB 3VVMA 1TQ4A 1LTQA 1QZXA 5CGQB 3I34X 1AB5A 1S8AA 1LTHR 4PR0A 1LDNA 1J97A 3EG5A 4CM5A 1JB9A 3K6RA 5FCDA 1KAOA 1PFYA 2JGDB 4Q19A 4LHXA 1MO5A 1XTZA 4RIHA 4WFQA 1L4UA 1P4AA 4P4SB 2CNWD 4LHYA 4N01A 2AMJA 4EJ0A 2P1RA 3CEMA 3UKOA 1FVXA 1ECGA 1HMPA 1M6HA 1Q57A 1SU8A 4I5IA 4D2IA 1ZAYA 1T15A 2YNMD 4P86A 1KC1A 4JVSB 5FAXA 2OFPA 2J0QA 1QRDA 2XHZA 4EHBA 2CUNA 2XYHA 4J2HA 4UZEA 1ZSVA 3WGLA 2GCPA 1UP6A 4Q3DA 4EZIA 1QVZA 4XKJA 1XTVA 2W4QA 1H8ED 4XPIA 3RVBA 1VKRA 2V0GA 2FN7A 2K6GA 2IDMA 4FHDA 2F1KA 4MLDA 2IU6A 1IEWA 4ALKA 1L1EA 4AO7A 4CKCB 2GT1A 4QFMA 2MINA 3COWA 2XECA 2BELA 1N0VC 5EJ9A 4Z8XA 1QLJA 3IKVA 4FZ3A 3LK6A 4LC0A 4NZPA 2GZMA 1Y5MA 1HOTA 4MVWA 1Z0FA 4GIBA 1IJKA 4P93A 3QUTA 4XDHA 1HUQA 1U2RA 4GGOA 4ZI7A 5A5FA 2D2IA 5LQMA 1DC7A 4DWVA 3RQSA 3UK1A 1SBTA 1TW3A 3K7EA 2R6ZA 1P45A 3G2OA 4JX8A 1IWBB 3CR8A 4KODA 2XYRA 3Q41A 5EMMA 1VFPA 3H1FA 5CLIA 4EMSA 5J2TB 3F3SA 3PZBA 4U5XA 2W8ZA 1HV8A 3AGPA 1PR1A 1QU3A 1T2EA 3EMDA 3U3RA 3S29A 4PCUA 2GMWA 3BIOA 1CZHA 3W0LB 5CFQA 2HNAA 2V7WA 3ESBA 4EWLA 1SXGA 4KR7A 2O7NA 3B8EA 8ATCA 4U9IS 4U2EA 2ZBPA 1YC2A 1B41A 3KVYA 1U6IA 3JSXA 3NHKA 4RM2A 1W5TA 1BS1A 1BE1A 2DULA 4MI1A 4UEJA 2GEUA 3A3KA 1DV1A 3C4VA 3TLEA 3R8FA 1BXRB 1UWCA 2ES4A 2JI9A 4XD2A 5DTRA 2ZTHA 3W8NA 2BHRA 1HEIA 4WD3A 2Q3HA 4DMHA 1Z17A 3KLPX 4DJ5X 4UJ3A 5REQA 4ZO4A 3N74A 4MUEA 4MWCA 4ZJZA 3ASYA 4WK0B 4IMIB 3OF3A 4Q4AA 1YL7A 4B80A 4QEZA 5JMWA 2Q4DA 1CG6A 1WDKA 1TVKB 3HQ4O 2HJVA 4Y1RB 4YJ3A 4ZDJA 5I9BA 1TL7C 2JIMA 1QFSA 2QRKA 3KLMX 2XQJA 5F23A 1IUNA 1Q0UA 1TLLA 1M1XB 3JXEA 5KYNA 3LA8A 4ZEXA 4O4IA 5I8ZA 3C8DA 4LJ8A 1K0FA 4AYTA 1QIMA 3OZAA 3OHMA 2ZANA 5KDDA 1PUJA 4M99A 2OYSA 2ZRNA 2ID7A 1NW8A 2H2GA 4IX1A 4TPKA 4B74A 5K6AC 3QBVA 1KZGB 4Q4JA 1ZM2A 1JLMA 2GZ3A 3HWSA 4KFTA 5EQJB 3UHJA 1TTTA 4KI0A 2VQSA 3DDZX 5CHEA 1KEEB 2UV8A 1KYTA 1KIFA 5CJPA 4ZOBA 4ZVTA 4BV8A 7REQB 5LWQA 1SGWA 1UT5A 4K9SA 3NBFA 4Q93A 5AM2A 3JD0A 2OB2A 1DUSA 4NICA 1EWQA 1A97A 2FTKE 1VBFA 4LVNA 4JC0A 1IZ9A 3ADOA 2IYLD 5BQXA 4AW9A 1OW3B 4Z0PA 1QGAA 3UJ7A 1N1DA 4CQJA 5BN4A 3ZHUA 3PXXA 2B4KA 3R5SA 4QYIB 1SXQA 1DB3A 2AFVA 1CUEA 1GPMA 2QZ9A 4S3MA 5BN5A 3CRW1 2Q45A 3RUIA 1MIOB 2XT0A 3ETGA 3LRXA 1C4WA 5LNK6 3H9JA 2YN2A 3BZBA 3H0EA 3ZX5A 1EB9A 5JAUA 4NMWA 3BS4A 4IZ6A 4GWKA 1YC5A 2X76A 1IXZA 3R4VA 1PNTA 1RTKA 1JKJB 1IIBA 2A5FA 2PSHA 3CE6A 3PB3A 2QGZA 3V1MA 3QZUA 3KYBA 3BE4A 4XE5A 3WLLA 2JFVA 1TTQB 2WVHA 3FOAA 5KZMB 3R7AA 3ENZA 2JFWA 2FMIA 1U3UA 3PJRA 5LBUA 2DUMA 4O1IA 5FFMA 3SYKA 5B4UA 5KVAA 4F8YA 4ZVKA 4RGVA 1GGHA 1U31A 4UVHA 1A9TA 2XT6A 2OFFA 1QU2A 4PC6A 2Z9CA 3TR0A 5A5GA 1WUHS 4EY5A 3H7IA 1SXJD 1XVVA 3CTPA 1CY6A 1R8JA 1VECA 4FT4A 4ER3A 1FMCA 2E82A 3HU3A 3STTA 4EATA 2H63A 1IBMB 2CXNA 3OM1A 3WLOA 2NZXA 1UDCA 3ILYA 2EZ8A 3R5HA 5EJFA 2XB2A 2AN4A 1GN8A 1D2MA 2I22A 2WYUA 4DM7A 1IY0A 5FWDA 2WKPA 5EZ6B 3EXHC 1T1EA 4COKA 3D6JA 1G4HA 1T4MA 1P7ZA 3H83A 1QS0B 3OX2A 5LQCA 5LUAA 1KZ6A 2P5YA 3QLEA 2Y71A 4M0KA 4NNPA 1XMSA 5IT0A 1E3LA 4U6QA 1OWOA 1JLHA 1C9DB 4XTRA 4ZHQB 3JQAA 4TXLA 1AGYA 1EP1B 1WVIA 3FOWA 1HYGA 4XWAA 1XTKA 3C5EA 3EE6A 1UM9B 1Z07A 3EVBA 4ENSA 3AVTA 4S1PA 3N53A 3U6KA 1JFVA 3GD7A 4MRRA 3RS4A 5D1HA 2YFKA 3V00A 3VDQA 4CW7A 1RZ3A 4I1RA 3WYGA 1MV8A 1ODFA 4FJ0A 4DMUB 1ZCJA 4AO6A 3UAZA 2C4UA 1QHFA 3HU2A 5IU6A 2H65A 3GP8A 5CA1B 2IHVA 4OSEA 3SE0A 1W0KD 4DV1B 1KGDA 4QICA 1IZ8A 1YHYA 5IH3A 3H4MA 1DEOA 3A36A 1F0PA 3C3MA 4KNWA 3D3WA 4XX0B 4YLGA 3RFTA 2ERYA 1TF5A 4O02B 4BLSA 4R69A 1D2NA 3K09C 2QSYA 1KY4A 3UBMA 3WDSA 4CBVA 3M2TA 4KYUA 2A50A 3T7AA 3PU6A 3OA2A 4A2CA 5JJLA 1WG8A 1JDVA 5BP7A 1I24A 4ZQBA 1Q0RA 3IQZA 5KQPA 2HSJA 2VK4A 1ZFNA 2NUPB 3FI0A 3EGWA 1XZLA 2C7QA 3HTXA 3LYUA 3CPSA 3NEPX 3N8DA 1JAIA 1KR2A 3RROA 1DO8A 3K0FB 1SXPA 4Q7KA 4RHXA 4UNPA 3EA0A 4JYCA 1NJ5A 4LRXA 1Q50A 4X41A 5BNIA 3EY4A 2A1UB 4R1UA 3GDHA 4WY8A 1ZK4A 4ODIA 4D8TA 4L5JA 3BWCA 3P4YA 2GEJA 4ED9A 4MHTA 5CK5A 3NR2A 5CA0A 1BCSB 1V5EA 4GR9A 4QO7A 4IDCA 3FDXA 4TQAA 1K4YA 3QVKA 1XU9A 4FI3C 1DTSA 3L9WA 1BGWA 1JDUA 2PMFA 3MWKA 3NNSA 2ILTA 4IGEA 1SUWA 4JL6A 2JZCA 4N5DA 5TF0A 1TFUA 4KXUA 3K70C 1XQ6A 3AFGA 4J43A 1E7MA 3IEVA 3MRXA 1PJZA 4Z53A 1CZLA 2BFWA 3DEZA 4GOLD 1XNHA 2BN4A 4H6VA 5JSYA 4YP1A 1YIOA 1ENOA 2QW1A 3P9KA 1E1RD 2JCYA 5KWEA 1L5MA 2IXBA 4EYOA 2VSFA 3JQ7A 1FW8A 1W85B 3JVIA 1U1CA 2HDOA 3AJ8A 3EB9A 4DA6A 3HYSA 1LS1A 4CIWA 1N2CB 2ZGVA 1ADYA 1OI7A 1IHXA 1X7ZA 1D1TA 3H1EA 4I66A 4N76A 4OHWA 2IQIA 4DZTA 1GAXA 4HN2A 3UOGA 3E8SA 1GGJA 2EFCB 2MSNA 3KAPA 3LH5A 2G06A 2ECPA 1UZNA 2UUOA 3O4JA 1LF0A 4FGKA 4PYRA 5FOXA 1KSGA 3THOA 4LZNA 4BQOA 4DLSA 1FMLA 5J47A 4GE0A 5EKXA 1BCRA 4DV6B 2GPWA 1TECE 1AQIA 4YRQA 3W3AH 4KCGA 4OQFA 4CEJB 3NRJA 5I7VA 2ZYIA 5KNDD 2J08A 4OU4A 1VLJA 3H8JA 5FBLB 2H59A 2CNOA 2IJGX 5KOIA 1DKNA 1PT8A 2YNMC 3BN3A 1CQXA 3LGSA 3LUPA 2VT7A 3I5MA 3PQEA 5DZSA 1ZOOA 2HA6A 1NQOA 1XAHA 2NU9B 3SDBA 3EEOA 2QTGA 1E2JA 4AUKA 2BSQA 5KTSA 1ZOSA 3BA6A 2RAUA 3WLNA 1HC7A 5AM0A 4WK6A 3TJZA 3A58B 5CAEB 1O54A 2QQGA 4FC7A 2ZT8A 5JDCA 4EHIA 3L0IB 1E92A 2PZ8A 4HTFA 1OX6A 4QOFA 1X92A 5A3RA 5AOAA 3BRWD 1FYEA 4IHJA 1GFSA 3TQQA 3PG5A 2B99A 4AQDA 5ED4A 3R3XA 3DQPA 1H8HA 3SYRA 2P69A 2NZJA 1P2DA 2A0YA 5JPIA 4RKWA 3NM4A 3EPLA 4DABA 2EKQA 2I66A 1SAYA 3ROGA 4AJJA 2H5JA 2FW9A 2KHZA 3GH3A 1E0DA 4M9RA 3H65A 4PXAA 3RSGA 2FG5A 5BV8A 2VTEA 4C76A 5JCZA 5F52A 2VJCA 2XNDD 4KDFA 3B1KA 3ZWPA 3PHCA 3HDJA 4RIFA 2EDAA 1H05A 4U2BA 5FR2A 2EGHA 1GR0A 1ZN2A 1T5LA 4FDMA 3ZG6A 2MSDB 5AI0A 4RKEA 1W46A 4D74A 2I4IA 1PGJA 5E7MA 2QN7A 4OGKA 2C03A 3T54A 5B2FA 5LYYA 3QH4A 4TS3A 3T0IA 3D8NA 4EFNA 4OK5A 1DG3A 1VG8A 4Q3NA 5LMZA 2CL5A 3FWNA 1NXVA 3MS4A 1WPQA 2I4LA 3RGWS 1WU7A 3VNBA 2FH5B 2XITA 2EKLA 3ICQB 4GBMA 4MUKA 3DV2A 1I5EA 1GO2A 1SURA 5KUTA 2WJ4A 2ENWA 1D1PA 4ENWA 2OORA 1WXDA 3LUJA 1B8UA 4KWIA 5C34B 2WFZA 2PGJA 3DZCA 3MAGA 1P0IA 1SBYA 2FLWA 1JDNA 1A4RA 1Z2OX 2J3LA 4LN1A 5DK6A 5ITVA 2Q2OA 4JWTA 1WQ1R 3W9BA 3NO4A 3ZK9A 4BNXA 4CF7A 4HADA 1W4CA 3ZWOA 3ER8A 5CVJA 4LTMA 2HR1A 4CEIB 1Z6YA 3EXFB 4IVNA 1N2HA 1GDHA 5G0TA 1VCNA 3I92A 4WNIA 5AI6A 2I87A 4YMWA 1ABBA 4XIGS 4ZWNA 1KK0A 2BR4A 1GLNA 2EYUA 4OGFA 4TTVA 3MT9A 1LV7A 4E5SA 1TF7A 2GEKA 1BOOA 3JZIA 1AK2A 3QXCA 4KHZA 3ADKA 3AF6A 1XNRB 1AKQA 2GEBA 4BX8A 1QH1B 1MZVA 1XRPA 4OH7A 3NIDB 4FFVA 2PNJA 3KIPA 2ZI3A 4GU5A 1LI5A 3CRQA 3I2FA 4NOKA 3USCS 3JAWB 1CC1S 1BEZA 4E4RA 5IJZA 2XCTB 2AMYA 1ZX1A 1NYLA 1U7OA 3KVRA 3LW7A 4JP2A 2Q29A 4OO3A 4QEDA 1FMJA 3AV0B 3B6JA 3QLUC 2JHCA 4PSCA 3O83A 1KMMA 4F3RA 2OV4A 5JZOA 2CMHA 1SQSA 4IIEA 3A9TA 1LBEA 3U48A 2P2ZA 4CLDA 4ERNA 2CLDX 3L0BA 4PLCA 2VYCA 4I9HA 1IQUA 4RIIA 1JEQB 4OX9Y 2FZCA 3IUQA 5SZHB 1Y9DA 3PFBA 3H87A 4F2PA 4YUYA 2CLEB 2A54A 4K8RB 1FYVA 5A5VA 5F33A 4D97A 4NH4A 2NO9A 5HF5A 4DMMA 4W63A 4BJ5A 5BSHA 5KOYA 3MOGA 2AHRA 1TUGA 2VHTA 4QGHA 3H3XA 3CKKA 1JE1A 1HRDA 4FYJA 4ENQA 4X66B 1IN4A 1SC6A 4PICA 4OH1A 5JI3E 1IY9A 2A86A 1L4NA 3OWOA 1XVLA 2WU1A 3JWIA 3W5DA 2HMTA 2HXYA 2K2WA 4DCMA 5TT0A 4OK3A 1WSWA 3KDAA 1T9ZA 1GJRA 2P6RA 2ZOSA 1D6JA 2X3UA 5GVRA 4MMXB 4ZT3A 3FSRA 3RSSA 4NIMA 1VJRA 1RE1A 3T5AA 2G9ZA 3CC8A 4MUMA 4RDCA 2QMEA 3A6ZA 4U7JA 1AUOA 3UIEA 1U2SA 2W6PA 3KKQA 5G02A 1XJ5A 3JX9A 5EUMA 2RKWA 5BWOA 5AW5A 4DVJA 1T9KA 2W2PA 3SZUA 4FHCA 1JR2A 1IHUA 4WLNA 5JH7B 4QQ8A 2UDPA 2O54A 2TMDA 2Q4RA 3D4OA 1SXJC 3U7EB 1J0XO 1QVAA 3B6ZA 4MOWA 4G84A 3SSNA 1X86B 3DFKA 4ONEA 4A7PA 2P2SA 3EZNA 2LZ0A 3DPUA 1NLFA 3E82A 4UE6A 3IT2A 4BHRA 4BAUA 2VYQA 1PD1A 1E2EA 1ECBA 3GUHA 4J0EA 3OPYA 4P5EA 2Q46A 4TRJA 4R98A 3SC6A 3OJLA 4KDEA 1XQVA 4AZ3B 5CFLA 1RC1A 3ENKA 1X7HA 1DNPA 2FJ0A 5BPFA 5BUCA 1GILA 1U7XA 4DRZA 1E8NA 3EXEB 1OT5A 1IXSB 3R1IA 2RONA 4H4EA 5C7YA 2IUUA 2G2SA 3SXUA 3KVNA 5LIRA 3PUVA 1T2CA 3HI6A 1SUBA 3AP2A 2QT0A 4M9XA 5HWSA 2OAGA 3A3PA 3HCPA 5FPSA 1P73A 2DTDA 2MT9A 2XZLA 2ZCJA 1II8B 1N6OA 1NW6A 1QYDA 3WADA 3WWCA 1UPBA 4G8BA 5E2IA 4QNRA 2JFZA 4U5QA 5JSZB 1MFZA 5KYVA 4N82A 1VYVA 1SHUX 2F3TA 4QUAA 3GRPA 1GU0A 2OOKA 4CF3A 3ZCPA 1EA7A 5DE3A 4IJ6A 3KR0A 1K6JA 2FP3A 3G2NA 4YAGA 5B7NA 2IX3A 1NBAA 2FQXA 3IUJA 1T5BA 2H1LA 4RU1A 5A62A 5ISMA 2QYSA 1G1AA 4LQLA 4LF7B 2XUZA 1MJNA 3NNNA 2V65A 5LJLA 1KDOA 3MJDA 1KOJA 3Q9LA 5JAZA 3GPLA 4F6LA 1E2KA 5FBVB 5HJ2A 3ZYZA 3HH8A 2FCRA 1TM4E 2DYKA 2Z4SA 1FA9A 3Q1KA 4BN5A 2FOLA 5JD4A 3FHCB 4B73A 4XQ9A 4ZA2A 3WLAA 4XRGA 1O96B 2ZB4A 2XUJA 3GAAA 1Y4DE 3NYQA 3Q85A 2F1OA 3EZ9A 4TUYB 1X14A 4MV0A 4BP8A 2X15A 4N7MA 3BORA 4YFVA 3D6FA 2IP1A 1LDGA 4N6GA 3PQ8A 4LDAA 2ARKA 2QRUA 4MH0R 3HO6A 4MA4A 2UZIR 4P92A 1L5LA 3SJ7A 2MSWA 2Q21A 3O8OA 3U7QA 4S04A 3G2IA 3PHGA 2ZJYA 4JC4A 3R6DA 2ZYSA 3CHYA 3V97A 2EX0A 4CHGA 1PFVA 3LUGA 2I8CA 2ZYTX 1MRZA 1J0CA 3PT5A 4CKEB 2W6JA 4GMGA 2DP4E 1DPGA 3LDGA 1H9AA 2ZM5A 4RVOA 2CHFA 2EKDA 5IFLA 2FRDC 4UNSA 4AIRA 1NYTA 1W5EA 5E7IA 5A02A 3PFKA 5LQSA 1NW9B 3DYVA 1JFTA 2I6XA 8AT1A 2O07A 2OCIA 3WK7A 2IOYA 4HS4A 2WAXA 1SELA 4CIBA 2RB5A 1N2GA 4MS3B 1OAKA 1I4OA 4R2JA 5B6PA 2V7QD 2WB2A 3H1GA 1PR3A 5JY6A 1QAQA 1T29A 2EQAA 2FXIA 3UXMA 1SD1A 2WYIA 2YZMA 3VZPA 3ZD9A 2X58A 1Z47A 1C3VA 4P7BA 2ETXA 4W7SA 5TT1A 3LFTA 4F38A 1V1RA 2PGNA 4FNMA 1H65A 3PUZA 1WUJS 2ONYA 2M1XA 2RG7A 4YUWA 4TZKA 3WQHA 2AJTA 1LJLA 3ZI4A 1IBLB 1K6XA 1MV5A 1DOZA 1NRJB 1E2HA 4HL6A 3FSEA 5F51A 4DAOA 1UXOA 1IUPA 2D0IA 4V0LA 1W4ZA 3V3KA 1RQPA 4OI0A 3GCXA 4U2CA 5HKAA 4WE3A 3W2TA 4BPBA 2VAWA 2OKGA 4UNIA 4I50B 5KREA 1IPHA 2UVPA 3VTAA 1O97D 4YRZA 2ATEA 3ZD8A 3FFAA 2XB8A 4IDEA 2JI6A 3CZAA 4DADA 1TFRA 3QNMA 1RRKA 2W6IA 2DCUA 1XCJA 2OLJA 3UQZA 4E11A 3PXBA 2VHCA 3Q87B 2J46A 2GVNA 1LZLA 3UOWA 2Q5HA 1RXSA 3OTGA 4M2LA 3S1LA 3QG5A 2ALJA 2EBHX 2H6EA 4RD2A 5HQ3A 2FEKA 2FZVA 1GA4A 2B8TA 2Y4OA 3K96A 1I33A 4WHMA 4JX9A 3PNMA 4B8ZA 4R71A 3TW8B 4ZDKA 1H0KA 1W73A 1Z74A 4I6GA 4FUQA 1UFVA 1W0JD 4HWOA 2B3TA 4ZO6A 2DQSA 5CFOA 3HUTA 2H5IA 4KLCA 4LWQA 5FX2A 4PYKA 4EGQA 1XWFA 1RI2A 3VU0A 3QXSA 2FSVC 2NNWB 4MKFA 5K0JA 2ZIZA 5IJ0A 1H3EA 1FTQA 1QB7A 2PXAA 4RANA 1K8XB 2O3JA 2XF8A 2HAEA 4NG5A 3VQTA 4JLMA 3ZV6A 2PL5A 4FKBA 1T3ZA 1AVTA 1Q1GA 2CJWA 2RK6A 2ZREA 4E5DA 2OZLA 3BZWA 5DTEA 4YYZA 1EINA 4MYSA 1E3EA 3IYLW 4FLFA 1R1DA 5H02A 3TIFA 4FB5A 1KMHA 4Y2VA 1RYEA 1AURA 4MI6A 4I9GA 1I1QB 3QE9Y 1UXHA 3IBTA 5K0NA 2HF9A 4INAA 1PZHA 3ESRA 4XIIA 4R2MA 4F5WA 3HVKA 3KR2A 4A8JC 5KSYA 1Y6FA 3KJZA 2ATVA 1MNAA 4B5KA 3H9CA 5EHGA 5KEIA 4RMHA 2QVLA 4MO9A 2VH2A 3OEYA 5JNLA 2EJWA 1CPYA 3B1FA 5K4AA 5AXBA 4NCAA 3GEIA 3B3JA 2XCQA 3IP5A 2QR5A 4CQNA 1XKXA 2C82A 5EYPB 4QXOA 3TK1A 3WKDA 5ADWA 2HUPA 1D4AA 1Q0HA 2R48A 2WA2A 4Q7MB 4UHHA 1Y80A 2IPMA 2F3QA 5DX8A 1IAVA 1ARZA 4ASUD 1RZUA 4WBNB 3OQHA 4I1SA 1AKTA 3EPPA 4EW3A 1BHO1 1TO2E 3MWFA 4PQEA 2YC4C 2ISQA 4BFSA 2H2WA 1FYFA 1GA6A 1Y9ZA 2QJOA 2Y0BA 3EGDB 2J48A 3AEKB 4NK5A 4B6SA 1FEZA 3QU7A 3ED5A 3NETA 3RAPR 1A9PA 3JQFC 3JZMA 2I54A 2BE9A 4QSHA 1IIRA 2Q7OE 1YAJA 2AOUB 5EJIA 1ZXXA 3UJ8A 3H97A 3FOBA 2HCBA 4N8SA 1R66A 3TPCA 4P7KA 4AVYA 1S5PA 1GQSA 3BSSA 2PUCA 3RAJA 5EQFA 1M1YE 4UTRA 3FHTA 1F12A 3GRUA 2YZGA 1X77A 1DP4A 1GZ3A 1NOKA 2WYWA 3GL9A 1SKUA 4ZU6X 2GF9A 4DUGD 1YR6A 3UK7A 5KHOC 1DAFA 4WACA 3VDMA 4AN1A 4R31A 4ZVSA 3MSCA 4IH4A 3NDBB 5JCOC 4U3JA 2Z04A 3TBHA 2XX3A 1KKMA 1Z6QA 2Q07A 4BFZA 1AXGA 1T9GS 4G0QA 4REMA 2PFGA 1CUCA 2A0WA 3ASZA 1NE7A 2AEJA 3ESYA 1NHWA 3KETA 3U31A 2YJ3A 1OXBB 1K3TA 3PSAA 3E5HA 1NJ2A 3GFPA 2QY6A 3CZCA 4E0BA 1HPLA 1VKHA 2ENUA 5KU7A 4NV3A 3AC0A 3R7FA 5JSKA 5K03A 5TB5A 4WXYB 3QE4A 1CB0A 2QD2A 1HM5A 2VRNA 2PUTA 2QW8A 2UYGA 4A26A 4IAOA 1CIJA 1H85A 4Y2XA 5FP0A 3CW2A 3ST7A 1TADA 2BFBA 5DEIA 3LFHA 3QE0A 4BNNA 2V7GA 4KNVA 5KCMA 5KCZA 4DCPA 4EDHA 4FMDB 3K9GA 1X42A 2J5XA 3SM3A 4D43A 1SUDA 2DFNA 2YHIB 3AFIA 3F47A 4YVFA 3UAYA 3WMWA 4EHLA 3DOEA 4WCFC 4NS1A 3KHSA 3X2EA 4D9BA 1Z25A 1CUIA 2F64A 2M32A 2PMCA 4D45A 2Y0CA 2J41A 3PIIA 2XVMA 4EQZA 1ESCA 4RQAA 4A23A 4O29A 2HYDA 3HKEB 4MLCA 5AIBA 5JQGF 1Z5PA 7ADHA 3P2OA 1J21A 4S1TA 3TI7A 1E9VA 2P9EA 4R5HA 3U3XA 4C0XA 4GP7A 5C81A 1WZ2A 1N32B 5E4JA 1Z82A 4UHDA 4F4DA 3KFXA 1W4AA 3QG1A 3QW4B 5IH7A 3V4OA 2Z2KA 3FN4A 1RLUA 5BY2A 4DDKA 1YUBA 4MV5A 3OBBA 3G0IA 4NMLA 3JVUA 5K3DA 2R97A 4WESB 1J8FA 3R44A 2GAOA 4GC9A 3FZQA 4ZU3A 4XIJA 1RIFA 4LRWA 1IOVA 3OQVA 2E4ZA 4N65A 5AK0A 1GD1O 2WZQA 5DYTA 2RIRA 3GX1A 3WHPA 2C00A 2HGZA 4A9AA 3F0TA 5FOTA 4BNKA 2Y1XA 4XWYA 5EE9A 5MHTA 2JATA 2ZRIA 4YJ2B 5BSMA 4NCXA 1RHUA 2BC9A 2DGDA 4KC0A 2QMHA 4PSKA 4KQCA 5NULA 2BZ0A 2QLFA 4LS3A 4PSAA 4BO8A 3ANYB 4H7PA 3KQNA 2YS7A 1TUBB 5AJZA 2RAFA 2QZPA 3R6LA 4KN9S 2G04A 1LRLA 1KO1A 1R16A 1Q7BA 2XMSA 5D86A 5AVKA 2QR2A 1LRJA 2WAAA 4FOOA 5HS6A 2YWDA 1KTVA 1OV4A 2ZRQA 3W34A 2EW1A 4OQMA 1ZR4A 3TKLA 4LOHA 4TLMB 3NUZA 2PUHA 4R1OA 3T5BA 2XQIA 3GLGE 2OQRA 3BL6A 3SF8B 4YRGA 2JAPA 4YQFA 3OMLA 4MR8A 1ZUD1 3IALA 4MWZA 2A1TS 3P9YA 2CL6X 1KJ9A 2WHPB 4X71A 2GAJA 3RIHA 1NQVA 4BVBA 4NDNE 6PFKA 1DRWA 1MOSA 3OVMA 4HUTA 2VAVA 2DUWA 4AKIA 3IP3A 1BFDA 4M38A 1FLNA 4MEJA 2GZ1A 1Q15A 1NU6A 1PZMA 4Z7QB 1F8XA 1LF5A 1YA6A 5INTA 2JJMA 2FOXA 5HRUA 4AG6A 1E0AA 2WHRA 1KEZA 1BDJA 2IV7A 2GD6A 4TOIA 1RYZA 3CUEF 4O1HA 1JHOA 2OV8A 3ZGLA 4F5ZA 1GL6A 4US2R 2VF8A 2WY2D 3UMVA 4ETWA 3PJEA 4M7OA 5CBPB 4UNNA 4BNTA 3NW9A 1CQZA 1BDMA 3V46A 1NATA 4LMRA 5ALPA 1ZLXA 5T5QA 3MXTA 1GPKA 4ND2A 3TX6A 3E18A 3SOZA 2A9FA 5B2EA 1N8NA 5I7FA 1N6RA 1NMEA 1T6NA 1N5KA 3AEXA 3L7AA 4ZV4A 1UEJA 1Z4KA 3AHIA 2PZEA 2P11A 4P4NA 1RM4A 2PL1A 2QTFA 3AHJA 3KXIA 3ND6A 5EZYA 1E5LA 2L69A 5FRDA 3A32A 3ZNOA 2QMZA 3OE5A 3K1AA 2PY6A 2OLKA 2FYTA 4YT2A 1G6Q1 3L01A 3QV2A 1BYUA 4JBXA 1U02A 2X8AA 4NOJA 4XFKA 5EUQB 3X1MA 1IG0A 5D01A 2FG7C 1QO0A 1U7ZA 3WKCA 4LTDA 3TJRA 1PL0A 2YFYA 1ORIA 2W5UA 1FFXB 4UCQA 1YVRA 4LY0A 5CMLA 2O2JA 1XHEA 3LBFA 4EOGA 2XEDA 1KFJB 5HEKA 3BX1A 1L0BA 3IP7A 4TTQA 3U3MA 1LV8A 2AVNA 4RIGA 4YV0A 2NXCA 2FMUA 3A1CA 1M34E 3C1OA 3H5TA 1MG0A 4H08A 1UMDB 3IQEA 2F67A 4J3NA 1E3WB 3FDJA 2HLDA 2PWBA 2Z5FA 1H3NA 1O97C 4P31A 4C3OB 4EJ6A 1IYZA 2H0AA 2J4CA 3DL2A 4Q3EA 5LD2B 1OWPA 1J25A 2PZJA 2TSYB 4QQFA 3OSUA 3WLFA 2HRRA 1Q22A 2M6SA 2V96A 4N3BA 4B17A 1E5TA 5JD3A 3UAXA 4D5GA 3MQFA 4L5IA 5FI5A 1BSVA 2Z8XA 3PNVA 3QJYA 3NC4A 4TQUS 1J1ZA 2BOVA 5THKA 4DT1A 1CJSA 5CG2A 4TZTA 1HDEA 1JIVA 1LPMA 3U44A 1X9GA 2EZUA 3TTYA 5CIYA 3N8KA 5FPQA 1EQAA 5HUJA 2AWOA 3SVLA 4LCEA 4EJSB 3QUCA 3F8TA 1B0PA 2C29D 3N0RA 1CUDA 5EIBD 2YIJA 3AZQA 5ALXA 3GJRA 3WQSB 3G0DA 4Q1AA 4J07A 5C2JB 3ZU6A 2RI1A 3TECE 1RVV1 4KWEA 1IRIA 3MUNA 1K2WA 4BNVA 2IS1A 2LV8A 1CEXA 3E9RA 2R79A 1HDGO 4EB8A 1YZGA 2VXYA 4IILA 5A5DA 2VSNA 3G2PA 2AS0A 3OY7A 5C8YB 4BMOB 2JPDA 5L53A 2UZAA 1UDWA 3BFVA 2E4XA 4R41A 3AI7A 5BMVF 3B1YA 4RHYA 1KVTA 5C8ZA 1R8XA 4ARCA 2EP8A 3KXPA 4D96A 4MO2A 4PLHA 5EIWA 1Q14A 1ZBDA 2O7SA 2FPSA 1E64A 2AOTB 1KORA 4IIVA 1GZDA 1R0BA 1G21B 4JENA 2B34A 1SVWA 1U4SA 2H5LA 2XF2A 1QJ4A 3EAGA 1BHSA 1ZGCA 1WUIS 2D1TA 2Y2VA 4K7JA 4NJEB 1RM5A 4RO0A 2NU6A 4TSFA 5AKYA 5HF9A 3R7SA 2IEDA 4PLTA 2G8NA 3H6KA 5I9MA 1H2AS 4WQMA 2XUPA 1V8OA 1SU7A 2KI5A 5C35A 2X0RA 3HFRA 3V80A 2B30A 4KFRA 2PIAA 4L4UA 5CT9A 4AJKA 5AW3A 1X1SA 2NO0A 3PUYA 4L8YA 2FP4A 4M60A 3PTLA 3CVXA 3R9WA 1ISRA 1D5CA 2D2EA 2GFIA 2VLBA 2W43A 5D2CA 2D3WA 2I99A 2FWJA 2EAUA 3FI9A 4G1MB 1YB6A 4Q34A 2ORIA 2GARA 4X60A 1F8YA 5DM4A 1DFIA 3RIGA 4AAYA 2Q6OA 5A1TA 2C2ZA 3VO2A 3WDLA 4LF5B 4EQ6A 1EESA 4R3NA 4Y9SA 2YXBA 4TV9F 2QU7A 2VZLA 4ZYTA 3E23A 3C7DB 5AI5A 3WGIA 3FZNA 1BH6A 1G3IA 2DFTA 2XXBA 4WW0A 1GAQA 1ZM4A 3ZE0B 4RA9B 1BCRB 4OP2A 3UGTA 1CK4A 1TMOA 3ZDRA 2L19A 2RH8A 2O3QA 1U2GA 2PXXA 3KG2A 4UREA 1WHTA 2AK3A 4C2UA 2JKYA 5EGSA 3K5WA 1ZD2P 3HXMA 1XKLA 1B3RA 1UP7A 2D3TA 4J1QA 2X0DA 5CTJA 4FYVA 4BEWA 4YRMA 1IHOA 1M7HA 1WETA 3R0QA 1U6KA 4R7GA 1KJQA 3C3EA 4KXNA 4E1AA 1EVIA 3ZHRA 4L74A 3C8MA 4RMIA 2OXTA 2ASVA 3ANLA 2PX8A 3AGQA 3I9LA 4E03A 2I80A 4EYKA 1RD4A 1Y42X 3TQHA 3T3NA 2KBFA 3V4ZA 2BI8A 2YV1A 1JQKA 3DG9A 1RYFA 1DT3A 2ZRBA 3DV0A 2QI9C 3PT9A 4ZCLA 1UXJA 2Y2UA 1E8DA 1RBQA 3MTQA 4A8HA 2HCRA 4DANA 4JJ7A 4F6RB 3OEWA 3NOVA 2CHGA 3AIOA 1NP6A 2Y1CA 4ZYXA 2VRCA 1GY8A 2DBRA 5IHXA 2DFKB 2F3RA 3Q5DA 4LSWA 3X0DA 3MLBA 1MO6A 1Q1BA 1CIVA 2Q1YA 1T5DX 1T9CA 4HLUA 4F45A 3BXZA 1YOVA 3NYRA 4AICA 1NVMB 4Z0HO 4KFSA 4G97A 1VMEA 3O3NB 2FEWB 5F5LA 2G6BA 1MEOA 1SIUA 3FOCA 5I9TA 1V96A 2ZIVB 1CFZA 1SVIA 2VCYA 2DQKA 3ROEA 3SK0A 5IHPA 1OZFA 5LXTB 3KQUA 2X8JB 3IT1A 5FKJA 4RMJA 2OXRA 3CNHA 3KYCA 4LKOA 4NJMA 4PQYA 3TZEA 5T4EA 3AF5A 1QF9A 1CZRA 4Q4DA 2AEMA 1LQUA 3RRXA 4DV4B 3TZLA 2AFIE 1GV1A 1PAUA 5DBOA 5CEJA 1ISMA 4QVIA