1MOPA

Crystal structure of a pantothenate synthetase from m. tuberculosis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
288
structure length
288
Chain Sequence
b'IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pantothenate synthetase
molecule tags Ligase
source organism Mycobacterium tuberculosis
publication title Crystal Structures of a Pantothenate Synthetase from M. tuberculosis and its Complexes with Substrates and a Reaction Intermediate
pubmed doi rcsb
total genus 95
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2002-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 1mopA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1mopA01
2IELA 4G5YA 3ND5A 2R5WA 4ZCRA 1NURA 2BTEA 3GUZA 1HYBA 3SEZA 4E1AA 1JIKA 3IMGA 2WQ7A 4MW6A 4QREA 1N2IA 3M5WA 1XNGA 1TEZA 1IVSA 1KH3A 1MC1A 1O96B 4YP7A 2CYAA 1MAUA 1KQPA 1WKBA 4EG6A 1M8JA 3PNYA 4NATA 1JZQA 5LFAA 3NBAA 1FYDA 2CV0A 5DASA 4ZT5A 2O5RA 3S3TA 2D54A 1P7PA 2Z09A 5F23A 3CVUA 5H16A 1OWOA 3RK0A 4I6GA 4ARIA 5IHXA 1MOPA 4KKVA 2J5BA 4PY2A 2A1TS 5K0SA 3K32A 1NP7A 2HGZA 2X1LA 4AQ7A 2DUMA 4NAUA 4ZCPA 1VL2A 1YIAA 1ZH0A 4ZCTA 3KT0A 1I6MA 3HL4A 2QJTA 1BS2A 4J76A 3A04A 1TYDE 3P0IA 1NUTA 3K9WA 2WQ6A 4KR6A 1Q11A 4PBTA 1VLHA 1MB2A 3FDXA 2CSXA 3IOBA 5H7XA 1J1ZA 3FNRA 1N2HA 3COVA 1JZSA 3SEQA 3CVYA 1WXGA 4PBSA 4NDAA 3TZLA 1KAQA 1O94D 1WXIA 1IQ0A 4NX2A 3IUEA 3SYTA 1VBMA 3P0HA 4I6EA 3G6KA 3QTTA 4YBRA 4MW2A 2VTBA 5FNZA 2V0GA 4EF6A 1IHOA 2OQ2A 1JGTA 1KH1A 3PRHA 1JIJA 3COWA 2PZ8A 2A88A 1JILA 1T9GR 2QJOA 5J58A 2D5BA 4I6JA 1YIDA 3H05A 3VGJA 2RE8A 4Q16A 1GZUA 4MUKA 3MUEA 4PBRA 1WQ3A 1J20A 2YWBA 3N9IA 4K03A 1PG2A 1YUNA 1TYCA 3A4IA 1ILEA 4GRIA 1IQRA 3AIIA 3PNBA 1S4MA 3ELBA 4HPWA 2H2AA 3IVCA 1NYLA 5TS2A 1Y42X 5AHWA 2DETA 1EFVA 1RQGA 2A4MA 3LOQA 1QJCA 3SZGA 5J5AA 1PFUA 4DE5A 3KT8A 4ZCSA 3FH0A 5BNZA 1PFYA 4EG5A 3FIUA 4HJXA 4MWCA 3KT3A 4MVXA 1B6TA 4WNYA 3RFFA 4YMIA 1YULA 2QTMA 2PZAA 1OWNA 4MW7A 3Q12A 1IH8A 2E18A 1R6TA 2OV4A 3IOEA 1KP3A 1N2BA 2X3FA 1G8GA 2WB2A 1IFXA 2NSYA 1O97C 3A05A 3HV0A 4MUGA 2QTNA 1V8FA 4EG7A 1N2OA 2PIDA 4K0RA 1WJGA 3MLAA 2IJGX 4DJAA 4MUJA 2CUZA 4HJRA 4A91A 3COYA 3ZIUA 4MW4A 4MWDA 4CDNA 3A2KA 1EUQA 5HUJA 4MUFA 3DLAA 1KQNA 2J09A 4MULA 1X6VA 1EFPA 1NSYA 2TS1A 1OWLA 2IP1A 1N75A 3X1MA 1LI7A 1M8FA 4MW5A 1KAMA 2A1UB 4ZT4A 1M1ZA 1MJHA 1QNFA 3IUBA 2QJFA 2X0KA 2WSIA 1KP2A 4DLPA 1O6BA 3G59A 4L2IB 4BWVA 4U63A 5K0TA 4WSOA 3AG6A 4EFKA 2CYCA 2XRZA 4DDHA 1J21A 4JYZA 4R0NA 3Q10A 1EJ2A 4ND6A 4KPUA 2ZP1A 3CLSC 3TS1A 4Q93A 4JZYA 4JFAA 1H1TA 3LE8A 1O94C 1J70A 2CYBA 2RD2A 3I05A 2O8VA 3IDFA 3P52A 4UZFA 1F9AA 2AG6A 5LLTA 3P0JA 1VBKA 1K97A 4R2MA 3FHJA 2H29A 2J08A 3ZGZA 3NBKA 1JEDA 2PZBA 1DNPA 3X1KA 2DR2A 1KORA 3G5AA 2HZ7A 4KR9A 4MVYA 1Q15A 3FY4A 4X0EA 2E89A 1J1UA 2CFOA 4ZT6A 4EG1A 2PG3A 3KFLA 5IJXA 1ZH6A 4EG8A 3FWKA 1I6KA 3FG9A 4ND7A 2GM3A 4OUDB 3UOWA 1H3FA 2QUKA 1O0BA 5LM3A 1O5TA 1EFPB 5TGTA 3RHSA 4MQ6A 5DEOA 1TFUA 2AZXA 3TQOA 2GKSA 3ND6A 2PFSA 5FO0A 2JA2A 3UK2A 1OWMA 3ZXIA 4F4HA 4JXXA 4MW9A 3Q4GA 1N77A 1QRSA 2C5SA 1TQ8A 2E21A 3RJZA 3F3MA 3IMCA 1KQOA 1SURA 4L2IA 1M8GA 5JBNA 4S1OA 3IMEA 2DXIA 1MAWA 1NUQA 1O96A 4MW0A 2YWCA 2JAXA 4CT0A 3ZJTA 4MWEA 1IRXA 5KHAA 1MBZA 3HGMA 2J07A 3PXUA 2AKEA 4FZJA 1M8PA 3HZRA 4NAHA 3ZXSA 3OTWA 3KT6A 1F7VA 3VRHA 4AS1A 1MB9A 1N2JA 1GN8A 3ILVA 4XSVA 1OBCA 1U3DA 3QTBA 4CDMA 3CVWA 2CV2A 4MW1A 4U8HA 2ZUEA 2VXOA 3CLTC 5TEVA 1JEEA 1I6LA 1OBHA 1FFYA 1O97D 1GTSA 1V47A 3UY4A 1WZ2A 3AG5A 1TYAE 3CR8A 4U7JA 3IVXA 3OP1A 5DK4A 1LI5A 4G5FA 1JMVA 1WXEA 3RBAA 1QRTA 2QTRA 1QTQA 1U3CA 1N2GA 3TNJA 2PXHA 1QQTA 1KH2A 4ARCA 1N2EA 4ZT2A 3IODA 1NZJA 4MVCA 2G36A 1KR2A 3H9BA 1WQ4A 3HMQA 3DO8A 1YI8A 4G6ZA 4P2BA 3N2YA 2Z3VA 1EXDA 2BYTA 2DEUA 4EG4A 1ZUNA 3ZJVA 1H3NA 1O95D 3CLUC 4ZT7A 2DERA 4MUNA 1D2RA 2A84A 1X8XA 2VTBB 3IVGA 3CLUD 1PG0A 4ZT3A 2QUIA 3COZA 3CLRD 3CLSD 4MLPA 3ZJUA 2J4DA 3INNA 1J09A 4KR7A 3L93A 5FO1A 3UC5A 2A7XA 4MWBA 3BL5A 1A8HA 4YP6A 4EG3A 4DDKA 3ZUGA 2CV1A 5HUHA 1CT9A 3MMXA 3VU8A 4RUKA 3X1JA 1T6YA 1U0BB 1F7UA 3ISJA 1WY5A 1N1DA 4QRDA 1NI5A 3SDBA 3E27A 4MUIA 1GPMA 2QUJA 2YXNA 3AKZA 3CVVA 1TYBE 1EFVB 3ND7A 3C8ZA 1PFWA 3CLRC 1K92A 3CVXA 2E0IA 3LCJA 4R2LA 1WOYA 5EKDA 2B7LA 3UMVA 4QBTA 5HG0A 2GOYA 3D6UA 3H99A 1I2DA 3GLVA 4MUEA 2A86A 2A1TR 4ZCQA 3RK1A 4EGAA 1QU3A 1KKUA 2EL7A 1QU2A 1R6UA 3IH5A 2HMAA 4H3SA 1ZJWA 5KCMA 1F4LA 2ZUFA 1OD6A 2DPLA 4YP5A 1GTRA 3H9CA 1U7DA 3NV7A 4UZEA 1WXFA 2V0CA 4OJMX 3DPIA 1T6ZA 3QE4A 4MAFA 2D13A 2JANA 1G8HA 3JXEA 4XFJA 1EUYA 4TS1A 2NZ2A 1COZA 4CQNA 5DB4A 3MXTA 3MLBA 1GAXA 1PFVA 1NUSA 3AFHA 3TQIA 4J75A 1GLNA 4GU5A 3D6VA 2XRYA 1U7XA 3CA8A 4NZPA 5KWVA 4JXZA 3N8HA 3PNVA 1R6XA 1JHDA 4XFDA 3U1VA 1N78A 1IQUA 5TEWA 1WXHA 1M8KA 1JECA 1NUUA 1XNJA 1G8FA 3CLTD 4RPIA 3DV2A 5J59A 1EE1A 1K4KA 2A1UA 1JIIA 2X1MA 1M83A 3L92A 2I1LA 3GMIA 1LW7A 1MRZA 1G59A 1K4MA 3HFJA 3N05A 1YUMA 3FOCA 3SZ3A 1N3LA 1H3EA 2YY5A 2QUHA 3H97A 3IOCA 4DDMA 3AL0C 1OWPA 2Z08A 2DLCX 1T9GS 1NUPA 4KPUB 4OUDA 1Q77A 2CT8A 1T6XA 4MVWA 4HK4A 3TZEA 1QRUA 1XJQA 4DNXA 2EJCA 3FI0A 4F3RA 1UFVA 1VBNA 4MUHA 1O0CA 3SP1A 1Q19A 3FETA 1ULHA 1XNHA 1O95C
chains in the Genus database with same CATH superfamily
3W6PA 3FLAA 1GQSA 4EMSA 2R5WA 1ZHFA 3H1BA 2B83A 1KVRA 1PWEA 1EWVA 1TJ3A 2RHDA 3OF3A 3OOHA 1QF7A 3QPWA 5ESWA 2WKSA 3KXLA 5AUNB 5KQPA 4V1CB 3ROPA 1R15A 2FOXA 2YQ4A 2GEBA 3BSFA 3IMGA 3AUXA 4X1KA 4E1AA 1JJFA 4LF7B 3ZHZA 3P8ZA 4AY3A 4YY3B 4Z7NB 1F2UA 1NI3A 3MF4A 3DP9A 4PLPA 4Q3KA 1L7BA 1UBMS 3LQ1A 2ZWOA 3WWOA 5KOJA 3I0MA 3UNXA 3ZDBA 3O73A 4QYSA 4IMPA 2CXNA 2AN4A 5BSWA 1NBOA 2ZANA 3SLGA 3ZXUB 4XCXA 4QXRA 1VKHA 2O19A 3D7NA 2GN9A 3DDUA 2OO3A 4I19A 3QYFA 1DOHA 2Z09A 1YGYA 1UBHS 2B0JA 1M1YE 3DOEA 4M38A 3RASA 4K2AA 3GLHA 1NQWA 2IZOA 3GL9A 3TFOA 4K88A 1YACA 2VAVA 4U6QA 4B2YA 1Q17A 1ZNZA 2J5BA 1SVKA 3EC2A 1S1CA 2ZQZA 2GVDC 1P3Y1 3ZE6A 1X1EA 4RYLA 3SF0A 5IVPA 1QDUA 2C2GA 1FTWA 3BS4A 3C5CA 4PU0A 2PFKA 4HPXB 3G8CA 3LBAA 4S2UA 3RW9A 3ZKWB 2C7RA 1T3LA 1H0SA 4IVPA 2B69A 1BDHA 5GOZA 1JJVA 1AX9A 3GRAA 3F74A 4B33A 1D2EA 1JXMA 1V9CA 2WQ6A 4JYAB 2ZB2A 3EQZA 2NXJA 1LA2A 3A4TA 3EASA 3FJYA 1JWAB 1QCDA 3H84A 1X3LA 1XTPA 2C5GA 4DYDA 5BYAA 1KYQA 2IIVA 1AXEA 4HEA1 2AYZA 1A97A 1XLVA 1EXMA 4KXYA 4UHJA 4WIAA 1Y89A 1VXRA 1JXAA 7YASA 4P22A 3HU3A 1PK8A 1UMKA 4HFJA 5BMVA 3E9YA 3CVYA 4Z4EA 5C18A 3S2IA 2BFDA 3E7WA 2QTGA 1TMOA 3UUEA 5F7OA 1EHIA 2XNDD 4C7XA 2J45A 3UZUA 3UXMA 5EYPB 4DIKA 1ZNYA 2A0WA 3HVUA 3K4QA 2ISQA 2E48A 4X94A 5EAIA 1M6YA 1HYGA 4GI7A 3ICQB 1RJDA 4MV5A 2QLTA 2LCFA 4ND4A 1MRNA 1WMDA 3N8GA 2A88A 1UKEA 2FLWA 2WIFA 3DSRA 4BZQA 5MGBA 4DXHA 2QY9A 7GPBA 2IKSA 5BNFA 2H0QA 2WYOA 1CY4A 2IYQA 4LOIA 4IJQA 4LTNA 2PJRA 3A1NA 3A6GA 3HLTA 4TXMA 3TMKA 1HT3A 2Y99A 3CEJA 4B7UA 1BS1A 3IQHX 3A36A 3OMXA 4DQ0A 3OT1B 3D0OA 2HDOA 3LOPA 4P7JA 2RG1A 1K5HA 2WWXA 4S1WA 4XDZA 1WZCA 4QLBA 5BXQC 2GZRA 3PUKA 5KVSA 3QFTA 3ICVA 5GOTA 4FDUA 4HPWA 4YCLA 3VOAA 5MHTA 2CJWB 2VH1A 4NBVA 1G21B 2R8RA 3W8EA 1HG1A 2B35A 5F21A 1ULZA 3E3LA 2NUBA 4ML3A 5J5AA 3FPBA 2H4YA 4M9ZA 1KQGA 1PHRA 3BKWA 5K0LA 1Y8QB 5H5JA 1DTSA 5TPWB 3CX3A 3S2EA 3CRMA 4EMBA 4Z0TA 1GCAA 1I5EA 3I39X 1I51A 1LBTA 1AHIA 2B4YA 3LT4A 3P20A 4ND1A 4QAJA 3RUFA 4UOEA 1A9OA 1DIOB 1BD3A 2ZXEA 2Z5LA 4WNYA 4JJAA 1O5IA 5C80A 4BAZA 2JS7A 4R9RA 1IH8A 1CETA 2ZRHA 3R6LA 2JFFA 1MEJA 3U44B 2NN3C 1AQLA 3HMKA 3M1YA 1YCFA 3F2IA 4KR0A 4Y98A 6REQA 1UMBA 3B2QA 5BR1A 1YUBA 3ADKA 4DLZA 2JLQA 1S1MA 2F64A 2FEWB 1ODLA 1O4VA 3HV0A 5DN9A 3DXFA 3W06A 3U7EB 4BHTA 1V2GA 1INLA 1GTG1 1QHNA 1YBHA 4FONA 4NVRA 2UZAA 1Q1AA 3ND9A 4W99A 5CYFA 3SXJA 5AVWA 5J23A 1GU0A 4O29A 4CIBA 2O1SA 2W2QA 1M34B 3ZWWA 4HQOA 3ZVNA 3GGJA 1J8MF 1GQ2A 4OD0A 1M2OA 3E9QA 1R0CA 3N5CA 3B3QA 5EXXA 1QWOA 1BDJA 5BQFA 1Q1QA 1UP6A 4QUKA 4S0XA 1VJCA 1KZ1A 3REQB 3KBOA 1Z7BA 1IJFA 2JKZA 4E5KA 3QENA 1JBQA 4L3OA 3G9XA 5K01A 1A88A 1SVLA 3QKUA 5EHGA 3SZMA 2C77A 2A94A 2HK8A 3OM1A 1AV7A 3KDSE 1SM4A 3RB8A 3WMRA 1VC2A 3U3XA 4M8KA 2PA3A 3AUAA 1CTQA 1HDYA 2O23A 1R37A 3O0TA 4RK4A 3UATA 1G16A 3E53A 1I1QB 5FHQA 2QG9A 2G9ZA 2V54A 1BEZA 1SXJE 2UUOA 1GA6A 3GWGA 2AYYA 4JBHA 4X97A 3TJZA 1ESEA 3LUBA 1DTWB 4NCJA 5CAEB 3ZQJA 4ZYWA 2IF0A 1IL0A 5AVVA 1VE7A 1SGWA 4HLQB 1R0XA 3WISA 3JD4A 3ZI0A 1OH6A 3D0KA 1R6DA 4GOXA 2XLBA 1Y6FA 4C87A 3ASYA 3A3YA 3S1AB 2XRZA 2R6GA 4O2AA 3CJQA 3F4KA 4F6LA 1YQEA 1V1JA 1EM8A 3WY9A 3QX8A 1YR3A 3FZGA 2VBIA 4MVJM 4WOKA 2BW0A 2P9HA 1IXYA 1Z33A 5HOEA 4Y2UA 2E2WA 3PNOA 4JFAA 4KC0A 4EPXA 4XM2A 1GFWA 3P97A 4QPNA 4WESB 5KYUA 1MOZA 1QGZA 5EGSA 2XI4A 3RF7A 4U6NA 3GIWA 3O8LA 4OP2A 1CUDA 4PPQA 2AWNA 1IK6A 3MS7A 2O6LA 2W37A 4UUNA 2EP5A 1JDBB 1QS0A 4MV8A 4P1ZA 3OLWA 2AZMA 1KBZA 4HQLA 3ECCA 3G79A 1IUNA 4WUTA 5T5QA 1Y4UA 3ITKA 2B2CA 4HWRA 4MR7A 1HZZA 4TV8F 5K2OA 2DR2A 2RBEA 5GAJA 1PUJA 1RZVA 3DNMA 3NNDA 2QJWA 3UWDA 3DF7A 4CMHA 1A8SA 5I7OA 4LC1A 3OWXA 5KYNA 3CRRA 1RQ2A 1LDMA 2C3OA 3AVYA 2QD3A 5FX2A 4LZWA 1T9DA 2RGWA 3LCUA 4D9KA 1JQJC 3AHJA 1HDEA 1SHZA 2VP0A 3QYAA 3W8DA 4RY8A 4YT5A 5A6SA 1XUOA 3ETCA 4TZKA 2NO7A 2OB1A 3DFKA 5IJXA 3BK7A 1XRLA 3PPYA 4X1YA 2EG9A 1O0BA 4UE2A 3KVRA 5I3CA 1VG9B 3DTYA 4C0BA 3A37A 3OQMA 2JIQA 4DDWA 4J16C 3PHBE 1IUKA 5L4LA 1DWOA 1GZ6A 3H2ZA 2BKUA 4WUVA 4F91B 2OMEA 3W4IA 3ZDZB 4GGMX 4PYJA 4CETA 1KDPA 4D8VA 3VA7A 1N9ZA 3WA7A 3RVLA 5IABA 1LTQA 4F4FA 1BXRB 2WFLB 4DNPA 1L9XA 5JAPA 2GTIA 2G1JA 1EFRD 2Y9MB 3AEKA 5EPOA 3EQ2A 3GT3A 3Q5DA 3RVPA 4DMKA 1R0ZA 3KDPA 2B36A 2JG3A 4W9NC 1S89A 2B20A 1UJNA 1B8OA 1ELOA 1TE2A 1LEHA 1BWQA 2G82A 2O7NA 2VZ8A 3LP5A 3KEGA 1DQNA 3Q11A 1O6CA 4TL6A 1Y3BE 2CXHA 2VQSA 1NJ5A 2AI3A 4FKBA 1WR8A 2L69A 2Q5QA 5FRDA 2K7FA 4CKEA 3GT0A 3FJ1A 4DKXA 1J49A 2IUEA 1U7PA 3BXEA 1G7CA 3WQBA 2R7AA 4V0ME 5FBVB 2V74B 4KO2S 1LNZA 3KUKA 4MMYB 3WDKA 4UUOA 3PX3A 2JGRA 3PTLA 5T8KA 1AZSC 4UBNA 5EWMA 4L75A 2VHYA 3GG2A 1HOXA 3ADOA 3FX2A 1JQ5A 2I1VB 5HE9A 4HFRA 3WLEA 3R7BA 4EGSA 2H2DA 1R3DA 3QGMA 4MQMA 4LXHA 2EWVA 4HWGA 4JS0A 1O97D 4G37A 3SICE 1E9RA 2GD2A 3AG5A 1MT0A 3LUJA 2OHHA 1CHDA 2E87A 3VO2A 4IV8A 5EY5B 3BBLA 1JTFA 3U5TA 4EKDA 4BMOB 1WS6A 3GQVA 4IIJF 3RTBA 4B3CA 3T3NA 3AERA 1YTLA 1Q2XA 3C1TA 3HCFA 1OHHD 2FSGA 5BVHA 5KTPA 2ZWVA 3A9UA 5E6SB 5IUNC 1A2BA 3WTCA 3HJUA 4XXHA 1KTVA 1JA1A 3C1UA 1OLOA 3RAEC 3PFKA 1E9BA 3T38A 3TIGA 3PQ5A 2QI9F 1SXQA 3IODA 5CCDA 4QUAA 4X95A 3EHEA 3W5AA 3KTAA 2HF2A 2WAYA 4WFQA 4ZZIA 2XEXA 2QR5A 2ZYIA 1QHHA 2I3GA 3DPUA 3ZE2B 4CM8B 5JRJA 3DZIA 4NBWA 1UWVA 4UEKA 1DAKA 1GKIA 1WZIA 2CE7A 1T8TA 1IWBB 3G2IA 2BD0A 4YAWA 3MTEA 5EXDA 4HB0A 4FBMA 2CJWA 3SQDA 4B3XA 2PYZA 4NE2A 1V4VA 1UBCA 1DBIA 3CLUC 3K31A 1VL8A 3N0TA 3BTVA 2V96A 1Y4AE 1M73E 3KJQA 1GO2A 3WSTA 1G3IA 1W88A 1E7MA 4WEOA 2XQFA 4DQXA 3EGCA 2QUIA 1KOLA 3S2YA 5KVAA 2MYNA 4UUQA 1FTGA 2FE4A 3HCDA 4A03A 1I8TA 1ZFNA 3GEGA 3IQZA 1XZQA 2QZZA 1PBTA 8ADHA 5A2QA 3AVUA 5LMUB 1FUIA 5FUXA 2DP4E 1X1CA 2ONZA 1OYYA 2A9OA 1G5QA 3EXHB 1ZLYA 4U0JA 3SHVA 2PWPA 4RZXA 4EHJA 5TLSA 3K09C 2QM7A 1HE2A 5BYBA 1C3OA 2CHGA 4M8SA 1E2KA 1E6KA 1G5RA 3GEDA 2BISA 3QVUA 4UBLA 2D59A 3OQPA 5LYYA 3AGQA 2TMKA 1L5QA 3QPCA 4MJXA 5K0CA 2EARA 5ICEA 4MAMA 2FWIA 5EJ9A 5K3AA 5JYEA 5K8LA 3MBOA 1D0IA 4MH0R 3R8FA 5E0OA 1PU2A 1SXJB 1CX9B 2GCIA 3R24A 3PKZA 4K6KA 4OOFA 1M6VB 1PQ4A 3PPVA 4GGOA 1TDJA 4BGVA 2GLUA 4UD2A 4B5KA 4UQOA 3MAAC 4BLVA 2YXPX 2I2DA 3ETJA 3H99A 1TU4A 4GO1A 5KKAA 2EIHA 3DM9B 2D4HA 3I9NA 4ZAYA 4EM6A 4JU9A 4PFQA 5DGIA 3ZWMA 2IL1A 2FGJA 5IH7A 4PG5A 4U2CA 4WXRA 1THGA 2VKQA 5CA0A 3K20A 3TKYA 3E7DA 4LDPA 3EXG1 4TLAA 1HX7A 5EJ6A 2W71A 1QU2A 4JC8A 4JL6A 3DEIA 1VHDA 4B7ZA 4YAIA 1GFIA 1LGYA 3E9EA 2XDYA 2WTMA 1RABA 3ENWA 1F4LA 1L3IA 2W2TA 1LDNA 3GCGA 3NC0C 3ZHQA 3BJIC 4DUGD 1P8JA 2ORED 2YFQA 5AI5A 2BFEA 2NT3A 1UAGA 1SCAA 4BFUA 3EOZA 1NVKA 2VFAA 1RRKA 1SKUA 5FBHA 4R2XA 4G0NA 2F3RA 1NKTA 1U2QA 5ECDA 2AH5A 2W6PA 4Q3LA 4DVJA 1OB5A 2XMBA 3GH1A 3TPFA 4GG1A 3CY6A 1EUZA 3KSRA 3OFJA 2FN4A 4NECA 3UFXB 3QA3E 4CM4B 1Y3CE 2IZ5A 3DR5A 3UXHA 3AFHA 2AKAB 3HBJA 3SNKA 3RR2A 4RHYA 2LGJA 4ZCMA 4OF4A 4EI7A 2KLBA 4IKEA 1U81A 4M9UA 4D3YA 1T9CA 1OFVA 3OQIB 3U1VA 1OXKB 1WSDA 2JARA 4R2IA 2EQBA 3DCJA 5AK0A 2RGUA 4EFLA 5JQWA 2YC4C 2VJDA 5BR8B 1L8XA 2I7TA 1J9ZA 4B3HA 3WKBA 1HRKA 4I8IA 2HJ9A 3L04A 1OTYA 4HNGA 3W6UA 1WUTA 3RFTA 2FU5C 5CDFA 5CDSA 4DABA 4ZTZB 1Q0QA 4JC0A 2PXXA 2H4XA 2V9CA 4CE6A 2OBMA 2NZYA 1ONSA 4HGPA 3LOUA 2NXNA 2UZ4A 1M2VB 2X1MA 1EFKA 1LRKA 4LYYA 3GMIA 4IG4A 3THXA 3RQSA 2G1UA 4BUCA 2FAXA 3FA2A 5D6OA 2YJTD 4IIJB 4M9CA 4BTEA 1FFXB 4GT1A 2WWFA 3D4LA 3H97A 3NGXA 1AS0A 2V5UA 3L0DA 4QATA 1N7HA 1ZJZA 4XPIA 3I9MA 2XE7A 1IMJA 1WD5A 2X13A 3DL0A 2R25B 4MMXB 4NMXB 4X6YA 3U7QB 4DA9A 5JZMA 2Z6AA 3T3OA 1JG1A 1N6PA 1UF9A 1Z2AA 2C29D 2Y05A 2QUBA 3LNCA 5DM2A 4HAWA 1K66A 2EKZA 4LBYA 1CIJA 2WIKA 3BHJA 1VBNA 1ZGZA 4POOA 4UMDA 1UBSB 4UPDA 1NBMA 3D8UA 4MVJD 1FSFA 4H7HA 3VR3D 2DTDA 4FFOA 2NV6A 5BP7A 3Q1KA 1SCJA 4N8DA 3TAXA 2JZCA 3KDAA 1TRKA 4GKBA 1U3VA 4BWYA 2NV2B 4ZAFA 2Z6UA 3B9PA 2DQYA 3H7IA 3N3BC 4A73A 1EFCA 1JIKA 2WQ7A 2NVUB 4E14A 3UANA 4LDZA 3RU9A 2QDKA 1ZVMA 1OC4A 6PFKA 2PQ0A 4E21A 4H0CA 1D4OA 3EVCA 2CYAA 1YB6A 1KQPA 3COJA 1YJ5A 2AV6A 5DBEX 1ZXBA 4EHHA 1FFDA 2VUHB 3CPHA 4NATA 2ODNA 3SDSA 2ZM6B 4R7TA 4XQGA 4E5DA 2FF5A 3GAAA 1XL1A 1R0BA 1PF7E 1V16B 4R9SA 5F23A 1E20A 1QIDA 1DQYA 4QQRA 3H9JA 2O7QA 4TMVA 4RM3A 2IHVA 1JDNA 1P39A 2ZUBA 3OESA 3KR2A 4OHPA 3O8CA 1X7HA 1A9XA 1HGXA 4FHDA 2F8TA 1UFOA 3WYEA 3AHGA 4OI1A 2PKWA 4KQ9A 4ENTA 1I13A 5JFOA 1GAJA 3VZDA 1NP7A 3IUQA 5KQGA 1YRYE 2DUMA 1Z88A 2YYYA 1C8KA 1L4GA 1VL2A 4ZAXA 1E6EA 4AF8A 1R9GA 1I7QB 1ZS9A 2P9TA 4AIRA 3ABIA 3H3XA 4BS9A 3PDIB 1FNMA 2H3EA 5H0IA 3GDHA 4PFSA 4LYHA 1QNLA 2W6OA 1YRHA 5T6MA 4KO8A 3IAEA 2XMZA 4RABA 3ZLJA 1BOOA 4IS2A 2F90A 5AIBA 2V55B 2FMXA 5IAEA 1Y5NA 3R3SA 4FXOA 5T41A 3EEYA 2G25A 5H9VA 1J8FA 1NRIA 2WD8A 1G64A 4TYMA 3FDZB 3QY9A 4X6XA 3RFVA 2C5BA 1W2HA 4YBZA 4DMFA 5CMLA 3DJFA 3R5SA 4TSFA 1CHNA 2HEGA 2JD1A 3NBUA 4OXYA 3TR5A 3I42A 3QU4A 3EEIA 3FDIA 2YWJA 4OK6A 1MJGM 1GG9A 4Y18A 2XVMA 1RMYA 1T6BY 3TQTA 2HFJA 1TKCA 5E6RB 3ABQB 3P4UA 4UREA 4H1HA 5F73A 1BWPA 5KYKA 1SBCA 1IN1A 4JUIA 1P0PA 2XB4A 5E4YA 4GP9A 5CIWA 3BDVA 5BSRA 1FLNA 1AA6A 4CGYA 5I4CA 1HPLA 1FMCA 1JIJA 1ICEA 1D8TA 5DNEA 3L43A 1GKLA 1JSZA 2DBQA 2PZ8A 3JQ7A 2QM0A 4RS3A 1ECCA 1V11A 2D5BA 2R3SA 2YVAA 1RAHA 4YRFA 5FWYB 3L05A 1SOUA 2RH4A 4NKRA 1JHMA 5EZ6B 1GPWB 1U5CA 3LDFA 1B3BA 3EXFA 3O82A 4HAXA 4OQXA 4NJOA 5AP9A 2CVZA 4MI9A 4M49A 4BKQA 5JVDA 1MF7A 4PBRA 1I7SB 5HFNA 1SVIA 2ZTMA 2FETA 1G20E 3C41J 1HLDA 3DVAA 5LB4A 4B4OA 3QVLA 1AXRA 4WASA 3D6FA 1LDGA 1O6FA 5EE1A 4ESHA 3EAGA 3F7MA 2MTBA 3O1HB 1IQRA 4I9FA 1GKKA 1S4MA 3O75A 4FFMA 3ZXYA 4FYYA 2QZ9A 4EA9A 1AGXA 4DA6A 4UCXA 2VDOB 2AFHE 3AHCA 1UDCA 3EX7C 1RI3A 3DWIA 3AJRA 4DE5A 4PHFA 1CKEA 2GM9A 1MN6A 2XD4A 3JWIA 3FR7A 3PD0A 2VAPA 3QLJA 4ZCSA 5T3YA 1L7MA 2AKYA 4WCFC 4CI9A 3N6RA 1UKZA 3AVXA 1U6IA 1W36C 4D0NA 5FHRA 1KDZA 1QPZA 3JALB 3E48A 2HEIA 5EGNA 1J9GA 1WRBA 4LI3X 4ZOLA 1GYPA 3TTXA 2VF5X 3W2TA 1B6TA 2WYHA 3QG5A 2OCYC 1V9LA 3GIDA 4FMPA 1AUXA 3PB3A 4BAGA 2CXXA 5C5IA 4FLFA 2ZXUA 1D2HA 1KP3A 4YGXB 1XPUA 4E08A 3ZV3A 3WB1A 2NUTB 2OBYA 2ZR9A 2XA1A 2NSYA 2JIZD 1MOSA 4IXTA 2GAOA 2I6UA 4QOGA 3CH5A 4KOEC 2KBEA 5AVQA 5FOQA 4DB4A 4UVGA 2I2AA 2R1UA 3G1WA 4MP8A 5D3QA 1AQNA 3M1LA 2OQRA 2QV7A 3LT0A 1VBFA 1KBQA 1KP9A 1ONNA 3L2OB 2XUZA 2Q0SA 1W1IA 2O0JA 4O4JA 4FD2A 5K8TA 1PR1A 5HX7A 5K8JB 2EW8A 4RSGA 2I3DA 2OFWA 2X0RA 3OQVA 1EZZA 1VSQA 2BAGA 3PEFA 3OBIA 4YRRA 5JPDA 5JSYA 5HOQA 3KHUA 3PF9A 5HFJA 1MAAA 1MB3A 1QGAA 4OEHA 4FJ1A 3J81k 2YJZA 2PUFA 1DEKA 1W44A 2B0CA 3RUPA 5HP4A 1QTQA 4ZAVA 1X1TA 2Q3LA 3ESAA 2I2FA 5BN4B 4GX5A 3I9JA 1X86B 3OE7A 2BBWA 3TVDA 2J67A 2YJ6A 4MULA 4J2HA 1E9CA 1UXHA 2FQQA 3JQ8A 1NSYA 2XW6A 5EEGA 3THYA 1XKTA 2BZGA 2J7PA 4ZI7B 5AOBA 3A1VA 4V2UA 5IKMA 1M8FA 1F60A 4MW5A 2ZB7A 5IDQA 2R84A 2W6MA 4NS1A 3N58A 4B7XA 2JIBA 2XHZA 4PQGA 4PTLA 3QHAA 4KDEA 1D09A 1XROA 2OHFA 4PIVA 4EA8A 4JL8A 5A9SB 3O03A 3CZPA 4UU7A 4W6ZA 3ZHTA 1V96A 4UCQA 2IWRA 2BMJA 1CJTC 1KU0A 2NXCA 1QV7A 3NIGB 3PZBA 5LZ7A 5K0TA 1ZINA 1PIWA 2P3SA 3PQ7A 4JUDX 2GNPA 4IL5A 4Y2RA 4FSDA 4RX1A 1E99A 3OICA 2WUFA 1W1WA 2GBLA 3TSWA 4TTQA 4BC1A 3B85A 3LBYA 2QE6A 4DTIA 1U7TA 1HM5A 1QQAA 1AV6A 5JE8A 4FK8A 4ENPA 3B9RA 2AQ8A 3C4QA 4TV8B 2LUOA 1SUPA 4DWOA 2BEWA 2GJ9A 1WKCA 2C54A 1NM5A 2BH9A 3NORA 1VOTA 5IVIA 2WPDA 1H1TA 1Z5UA 3BXOA 4HAUA 4RA9A 1W2WB 2IUYA 4LF4B 1L7QA 4GM4A 2VF4X 3HB0A 1KE1A 2B1IA 4DCPA 2PUCA 5TNXA 1J8VA 1K7SN 3NRJA 3V4OA 5B3LA 1L5VA 1Y6QA 4Q3NA 2OCIA 5M5BA 1GV1A 1OZFA 3D9QX 4FYVA 2OGSA 4B9AA 4X6LA 3NGMA 3EPJA 3BF8A 3OJFA 3WBFA 1ZQ1A 2LBPA 3VO1A 1Q20A 5LB2A 3IJEB 3I4CA 1MQAA 1T1RA 1VRWA 3HFRA 3KOYA 3UENA 3AVTA 5KREA 1EK5A 1TADA 2PCLA 3C85A 3FPFA 3L7IA 4FB5A 1AF7A 1M2GA 4R05A 3FWKA 2XEDA 5HCIA 1NNUA 1I6KA 2R4UA 4MYHA 1Z6YA 3OKPA 1ZUD1 3NAGA 1U3FA 1QV6A 2NTNA 3QLVC 1QBGA 2C98A 3HSSA 2BGTA 1FTSA 4UBKA 1T5TA 4ZGGA 3QPVA 1J2UA 1SU6A 3IP1A 3MJEA 4GF5A 3ZK8A 4C0HA 5IFKA 4RMNA 4UNRA 3KKNA 4DNFA 5KTRA 1RADA 2D5AA 1GXSB 1W5BA 4FYHA 1TYZA 4MW9A 2R6R1 5AXDA 3CNBA 4MB6A 3GPLA 3DGFC 2VPQA 4K46A 5IT0A 4QVIA 3ADBA 2LCIA 1FRQA 4G0PA 4GICA 1G8SA 3RS2A 2X76A 4Z0NA 3SQNA 2VHZA 3AEYA 3C3KA 2Q49A 1XKQA 1MDFA 2RKWA 3C97A 4OLAA 3EMKA 1F12A 1XALA 4W1QA 5D3ZA 4A15A 1Z2EA 2PJZA 1MAWA 2O8NA 3IUSA 2GVZC 2RGCA 2DF8A 2H06A 3VAAA 1UZNA 2P9JA 3CFAL 4MWEA 3OX3A 3VR6A 2Z3WA 4NMWA 3ELDA 2Q1TA 1BKYA 4E30A 3LL4A 3FUWA 4F4UA 4RESA 1A50B 2IYVA 3GPCA 1LPOA 2PZEA 2OZVA 2QX4A 2QX7A 2F2TA 4IZ6A 3FFAA 3GJ6A 3II6X 3O92A 2I6FA 4M60A 4BLQA 2QR3A 2UXCB 4QYIB 1Y3IA 1I4OA 3ONFA 4LRTB 3IALA 4A16A 1QKKA 3DQZA 3JQGA 3PPWA 3WGKA 2B8NA 2ACEA 1DBQA 1Z4PX 5DE3A 1C4KA 4BLWA 1QUEA 3LBNA 2VUUA 4TSKA 2ZT6A 3AF6A 1FFYA 5CEEA 1YZQA 3I9FA 4H77A 1K6XA 1TYAE 3BF7A 2NG1A 3GGSA 4F45A 2BMAA 5JCJA 2TECE 3C5VA 1KI3A 4D0RA 3Q5GA 3G8YA 3GELA 3MWFA 1GV0A 4RPHA 3DVRX 3WL7A 4EZBA 4TUYA 3WO0A 3EW7A 4AKGA 2XV1A 3UOGA 4F0JA 5AXAA 3VC1A 1YVPA 1KVSA 4CM9D 1FU4A 2VA9A 3FCCA 2PXHA 2X5JO 3IC5A 2FSUA 3C43A 3IE2A 2VDWA 3DBHB 4KXNA 2GNAA 4KXXA 2X2FA 4EPRA 5KOHB 5GIOE 1I7PA 2IKQA 4MX8A 4G6ZA 2FFRA 1NMSA 3JYQA 2FDRA 4NTZA 3K1YA 1JS1X 3H6GA 2FPIB 4Z2AA 1CUZA 2GESA 4FGLA 1J97A 2PGOA 1YU9A 1WABA 1Z6XA 1JDZA 4C4OA 3RYFA 4B4KA 1DADA 5ALSA 3KQYA 3EG5A 4P58A 1E96A 3NYQA 4J0KA 4KE7A 3DT6A 3E82A 4UUBA 4CCYB 5AVYA 2WU4A 2VTBB 4IOKA 4DV4B 4S0ZA 4BQSA 3K1AA 2NGRA 1DCFA 5AICA 6AT1A 2JLUA 4GKJB 4LV6A 3I6YA 3NCTA 2CFSA 3M4JA 3WV5A 4J7CA 3M1IA 3INNA 1W5EA 3BFXA 3MBKA 4R7GA 2Q6VA 5FUVA 3FPCA 4D81A 1NPTO 2OL4A 3GRPA 3LX6A 4JT9A 4AJHA 4JKIA 1RCUA 4JIGA 2QTVB 4LECA 3M83A 5DJ5A 3SJBA 1KPGA 3GUUA 3HHPA 1GLVA 5FBLB 1CQWA 2W6ID 2ESRA 1GPLA 1Z63A 3DOFA 3IGFA 4R2HA 3L5OA 3LK7A 2WVJA 3W90A 1PN3A 3GRVA 1KI2A 3TG2A 4HUJA 1XXLA 2I3BA 1VZ3A 2JJMA 4OJYA 4MKXA 4X9XA 1DC3A 1TYBE 1U0SY 3SCZA 3D4NA 4O4JB 4ZVOA 3TGLA 1M1UA 3N75A 2DQSA 5U1PA 2G6TA 1VYVA 1FP2A 1DU4A 2H92A 1WLSA 3ZLTA 2IA5A 5IZCA 3L0OA 4GXNA 2JI9A 3HDQA 5HG0A 4BMDA 1RRFA 1QO7A 1R5BA 1USGA 2FFAA 1GCIA 3GLVA 4OHXA 5E9QA 1JUDA 2GPAA 3D8BA 5BN4A 1KFEB 3HNRA 4HD8A 4R9VA 3PX7A 1K0UA 1IPEA 4B31A 1QYDA 3Q88A 4DV0B 1H4TA 4G89A 1QK4A 4RQAA 5AKLA 4D4JA 1SJ9A 2R1VB 2VHWA 2HA3A 2HV8A 1XPJA 2R7KA 4RZ2A 2CUTA 3A6KA 3KUUA 1JHAA 2PSJA 3X1ZA 3MJSA 4J6FA 4JJFA 4EY5A 1SQ6A 4BVGA 4GOLD 3F3SA 1F1BA 4L6AA 3BZWA 5IDYA 2DPLA 4P4GA 2GVNA 1E64A 3CF2A 4GXQA 3JARB 1DAPA 4IHJA 4PTYA 4BEBA 2Y1CA 1R1DA 4CTOA 1Z73A 4A8PA 1R8SA 3R5TA 2ZYHA 1JHVA 4QUGA 3UAYA 1J39A 3ZLBA 5L3QA 3R44A 3GDOA 2PZMA 1FJ2A 2PVPA 2Y0EA 1G8HA 4DOMA 1E2BA 2Z9CA 3ZCXA 1WHTB 1OC2A 3B8HA 5DB4A 3TLYA 3UT0A 3M6LA 1RHUA 2QD4A 5DTJA 1YF3A 1GAXA 3TQIA 2F17A 3JPWA 4QIHA 3H9UA 1PJAA 1OV4A 4YMSA 4HEQA 1GGJA 2VAWA 3CA8A 4UAUA 1X8KA 4D8WA 3T7IA 2D0DA 5I9BA 2PGXA 1ZSYA 4PWYA 2VHXA 1G8FA 1G291 4BQEA 3PJFA 3T6KA 3D64A 4LCBA 4NAVA 1JEAA 2I2WA 3DAYA 4LQLA 3CX8A 3FOFC 4IR7A 2ZRQA 2IYYA 1ABFA 1IG0A 3K6JA 1AY0A 4G09A 4NNJA 4QBIA 4QGSA 2YTZA 4JA2A 2ZPUA 3ASZA 3GPIA 4J7UA 1RJWA 3EB9A 1KJQA 1L4YA 5FBQB 5LP6B 1F8GA 3G8BA 4FQ8A 4G01B 3OQOA 1R8QA 3KK0A 4V3CA 1U94A 3LA6A 3KE8A 1N0VC 1XEWY 1VLZA 1H2FA 2I3AA 3O4RA 3FFWA 4OGKA 3AILA 3EDQA 2ZZNA 5C52B 2GCPA 3C8DA 1SCIA 1FJGB 2JCGA 3MD9A 2B1RA 1Y63A 4J0DA 3V3TA 3I2YX 1N5OX 1RYFA 3V8BA 1IHUA 3PC3A 4OHWA 5JO9A 4E07A 1QHXA 3TQFA 1Q77A 5JS1A 1XRMA 1AURA 2G3DA 3O47A 5BT9A 1SG6A 2R6HA 1OB2A 4G0XA 1OAOA 2HA4A 1NZFA 4C7OA 3KPWA 4WT7A 2FW8A 5L7YA 3GOHA 1KVTA 3NVMB 1PEYA 1U2ZA 2QRKA 3C70A 3LUDA 3MK31 1SIWA 2B9VA 4U2BA 2BFDB 3LWZA 4WTOA 1DJPA 4IDHA 3RYHB 1W6UA 1OV6A 1LY1A 1C7JA 1R9MA 1MR3F 3H5RA 1A7UA 4C0WA 4YRCA 3L7BA 2OECA 2C3YA 1HYBA 1Y9DA 2I91A 2QZ4A 1II9A 3WAJA 5JJBA 1N2IA 1TIPA 1WUIS 1FW6A 2MWMA 4MEJA 4WNAB 1G3UA 2YW2A 4OMUA 1YS2X 2L82A 1N9KA 2XUHA 4LNUB 3O21A 2D62A 4WZZA 2ZUUA 5ENVA 3DBOB 2HNBA 3CFHL 1K7EB 2HWKA 2XA2A 3S2FA 3K1TA 1GCUA 1U0OC 2AK3A 5EWLB 2X7HA 1BX3A 2NSLA 1J06A 2CFTA 3GCZA 1Q16A 1ZCAA 5DGTA 3UMYA 1MEEA 5EZQA 3FMGA 3ANXA 3ZH9B 3TX2A 4ARZA 1LJ8A 2CZGA 4GEKA 3SS9X 2EYUA 3KP1A 4JVLA 5C4GB 1MA0A 4PPNA 4DYVA 5CB4A 5IZ4A 2AEEA 2EGUA 2Z30A 1J42A 3HDHA 5AKGA 5AM0A 4A3SA 3F1LA 3OWOA 4JP3A 4F12A 3L6BA 3DE1X 3U4MA 1L7DA 3LUCA 4G5OA 2NZ8A 4OCZA 1G21A 3W6ZA 4YROA 3RDPA 1R88A 4RPKA 5EFOA 1V95A 4ITUA 3B3GA 5SYAA 3QUBA 3GV0A 5G0VA 3LQFA 1IRIA 4WZ6A 1E7QA 1BQEA 3RROA 1K2VN 1PLKA 3FLMA 1TLTA 1Z9BA 2JGAA 3DZKA 4ACBA 4W5RA 1TM2A 2W43A 4Q21A 2R0QC 2C8JA 5J5CA 1HRDA 2B92A 2LVBA 2MMCA 5EMHA 4C3UA 3BCRA 4EELA 3SMQA 1H0KA 4JKYA 2FW6A 4BNMA 2BFBA 4NJEA 4URVR 3DMYA 4K2HA 4LRSB 2O8EA 1FK8A 3P2JA 1UMBB 2OO5A 1FP4A 2YZKA 1DARA 2J5RA 2JFUA 3MEQA 1LVUA 3AFMA 3GQBB 4LXTA 5EI5A 2I22A 1FL9A 1TECE 1XIVA 2EJTA 2P91A 2Z1NA 3T1NA 1S8AA 4NCIA 3CNEA 4P3YA 1JG6A 2IP4A 4LE2A 1CPYA 1NXWA 3U6BA 2UVDA 4BNYA 4OVKA 1K9VF 3QJ5A 2FDXA 1PG5A 3W5JA 2QT1A 2V8BA 3A9RA 3K0BA 1Y7LA 1KMCA 2FSVA 2HLHA 3OURA 3OPYB 1JILA 2BZSA 3R0IA 3VXKA 3WKAA 1T9GR 3Q8KA 4TKUB 4L0DA 4OXXA 2SICE 3RT7A 3AJ9A 621PA 2AE2A 4KBYA 1MX3A 4M8IA 2CJXA 4OY3A 2Z5VA 3RE1A 3REQA 3HL0A 2XRFA 4HX2A 1A7JA 3QWHA 3QLUC 1C9NA 4LOJA 2HAEA 1QHEA 2VN8A 3LXUX 1PLJA 1Z7WA 2AF4C 2Q0HA 4F86A 4IQ8A 5HRUA 4W4TA 1SCDA 2BL4A 3D59A 3A1EA 5TPZA 3ZHYA 2EKQA 4UCWA 1DGQA 1RYEA 1OI4A 4DY6A 4ZMSA 4M9SA 3KUXA 3AIIA 1IDOA 3DEHA 2O1WA 1THTA 2QW1A 2Q7DA 3U26A 3ZGXA 4NBTA 4D0LB 7MDHA 4FDMA 2HA5A 4MR8B 3UJCA 3KKLA 3JASB 4LSGA 1RQGA 2A4MA 1YQXA 2QSUA 3A10A 2Q3JA 2YBDA 3V8RA 3A0UA 4FP9A 4HDRB 3WJ1A 5LVAA 1NLFA 3AZPA 3EIUA 3Q7EA 1H23A 5AVXA 3WGNA 1Q92A 1QVWA 1R6VA 2P1DA 2BHSA 5M2QA 1P60A 5FLYA 3AI3A 4G0ZA 4X85A 3UAXA 3AR8A 3SBXA 1FMTA 3TB4A 1HQYE 1N8NA 2O8BB 1PTJA 1YFZA 3VHLB 3WLPA 2G16A 5JJ5A 2FPOA 2AMJA 5KPDA 4MP6A 2VSFA 1KKMA 3RTDA 4EA6A 4A8HA 1YULA 2CNWD 2QTMA 3RVMA 1EBBA 3LS2A 4TKVA 5AHRA 1IC6A 5GTDA 4WESA 4P36A 3SG0A 4PC3A 3JQAB 5D84A 4TTPA 3U19A 2YRFA 3TLEA 1G0NA 3OPVA 5ARBA 4EUSA 1UUFA 4BO8A 4ZHQA 3C3DA 1IATA 3MT0A 4JEHA 3WQQA 7REQB 5HKAA 1QS0B 2CNBA 1YDEA 4WZAE 4PVDA 2WF8A 4RTOA 2WHXA 3H83A 3IERA 3L84A 1O9GA 1CJKC 1T5BA 2PH3A 2ZSKA 1IZYA 3FTCA 3P9SA 4UEQA 3SS8A 1FLDA 5D7BA 4PR0A 1UT8A 1VSTA 2C78A 4BX2A 1ODJA 1QZXA 4IRMA 5KKNB 4DV2B 2A52A 1S2NA 1N6RA 1ECJA 2XODA 3COPA 2I4NA 2ONYA 5HRCA 3CZ9A 4I55B 5KYYB 2H2GA 2R66A 4HWTA 4D9HA 4OB8A 2WD7B 2VK2A 3E9ZA 2AOVA 3I6IA 2CY0A 2IEDA 4MGKR 3WHPA 3IHTA 1GG2A 1Z39A 3QVJA 5F4BA 4AM8A 1SULA 4Q1BA 4MWDA 4XX0B 2E5LB 3CWQA 1EP1B 1UOPA 1WDWB 3H1EA 3H75A 1LFDB 1UBJS 2OY0A 1W9HA 1R5NA 3LCVB 4HQNA 4X7PA 4AX4A 3AVWA 1WDTA 1UMCA 2EZ9A 2FTKE 2WMYA 1E9AA 2BGIA 4QQNA 5K1ZA 3V34A 4YQYA 3QSGA 2C20A 3F9RA 5BN1A 1E1YA 2CBXA 1XMVA 2TS1A 4HAIA 3K0HA 4M9RA 2ZJZA 3E5RA 4MQEA 5AI0A 1KAMA 3R7NA 2FPGA 2O0LA 4Z3DA 3ZIDA 1RKBA 2AIRA 3O8DA 3JQAD 4G24A 2WSIA 2GYWA 1BEUB 1R6AA 1W48A 5F77A 3PHGA 4QOSA 3BIXA 5CT8A 2EKPA 4P4SA 4OXIA 4IWXA 3NDPA 2JEZA 5GWXA 3AG6A 2C9YA 5KU1A 2JH9A 1BFUA 1O94A 2ZJ6A 1OT5A 3HCOA 3PS9A 4HNRA 4XI9A 5FA5A 3GNQA 4R0NA 3RANA 3RUAA 1JU9A 2HJHA 4GW3A 3UJAA 2NW6A 5LKRA 3STVA 3UIEA 2FFQA 2ZBDA 4MIEA 1Y80A 3BH0A 4RQBA 1UCFA 3VH4A 4Q93A 1T8SA 2GPYA 5E7JA 2QNIA 4MITA 1E2PA 2ZB4A 1I9CA 1KVUA 3PLRA 4TKMA 1KSGA 4OBWA 3QKRA 1V8DA 1VMDA 3QKIA 3I05A 4PYNA 2QP4A 1UK9A 4EI8A 1NY6A 4YHBA 5DYWA 4B47A 2PRSA 1G7TA 4K6HA 5L7TA 3AF0A 5FPPA 2JJ8A 3T9AA 5K0NA 4DW8A 3K0KA 2R8YA 1KSHA 2BLNA 3X1KA 1WVIA 1X9GA 1Q7CA 3FSRA 3HKEA 3PXAA 4JYPA 5KAMA 5F1KA 4AULA 4D3XA 2AL7A 4QJ5A 4ERXA 1DLJA 1X1DA 3LCCA 3K0SA 4ZT6A 4GVPA 4N5LA 1F48A 2BEJA 4GWGA 4K3UA 4WNAA 3RGWS 1I7LA 5CIQA 4GNKA 3T7CA 3DV0A 1O3YA 5CU7A 1HDZA 4P84A 4OBBA 3ZCTA 3D5EA 2YZ2A 1KPIA 1YNSA 3FG9A 1PGPA 1UFQA 3LP6A 3P9QA 3GFGA 3MWEA 4FYPA 4PSCA 5LDGA 4DYHA 3C16C 4EW6A 1A9TA 1U98A 4PE5B 4PAWA 2CMHA 5SY9A 3RJMA 4DQDA 5DEOA 2LDXA 4CM8A 1UPAA 2JCSA 2PVCA 3NHFA 3KU4A 5HTOA 3UPTA 3IXMA 3P0EA 3OX2A 2OORA 3A4YA 4JJEA 4WLFA 4NMHA 3L6DA 3TLKA 2G76A 4FOSA 4OXQA 4NESA 2SKEA 4DIOA 2QTZA 2X6RA 3SQWA 4RVFA 4JJ8A 4ZYTA 2VK1A 3BMCA 4WBSA 3UK6A 3EXEA 3OLVA 4CM5A 5C5EA 3PRKE 3AM1A 3QVXA 5CDFE 4D4HA 4EMTA 5JBNA 4HUQA 3SJZA 1XVAA 2OENG 3SBOA 2RDMA 2PKQO 3BRQA 5HQTA 1DMSA 5DDIP 1KEUA 4AZ3B 1Y1KE 3B70A 5HIJA 3D7LA 5IAKA 1A04A 3F97A 4IVRA 4CI0B 3VNAA 4XWAA 1DXOA 4JUCA 2OHIA 4F3CA 1KYZA 2H4FA 3EXHA 1D2MA 3GJQA 3EBOA 4UVEA 2RHLA 3NNSA 3NR2A 3UCXA 4RF4A 2IHJA 4AP5A 1E4EB 2F9FA 1YZ3A 1QH1A 5HJEA 1E1LA 3WB0A 1OMOA 3FZQA 2VXOA 1NNI1 2GPSA 3L18A 3NBFA 3OE7D 2E6UX 4JKOA 4HNAB 2YYAA 4DQKA 1NBME 1E9VA 1KOFA 2RHWA 3FDJA 2AD1A 3CR8A 3PU6A 4TM7A 4I3HA 3ROFA 4BAUA 3SQOA 1KOGA 3IVXA 1L7EA 4EW1A 2C2YA 5EHNA 5G2FA 2B98A 5EIOA 3JS5A 5J9FA 3ZD7A 2OPBA 1X7GA 4HGNA 4M76B 3PWTA 6ABPA 3C74A 1YH3A 1Z4NA 2DH5A 5GV7A 1ZY2A 3N74A 1XTQA 4XEUA 4MR9A 5CLIA 1TU3A 1XDBA 3RBZA 1FB5A 1Z18A 2PS1A 4DA8A 2GEUA 3QWIA 2PA0A 3ORQA 2ZWMA 4YJHA 4N5NA 5DBFA 2VPTA 1YI8A 3ANYB 2NSHA 4Q18A 2POCA 2X1HA 2NSDA 3WS7A 2IV2X 1WBDA 2NO4A 1CEQA 3MRTA 3JVDA 4KAFA 2BHTA 1SOVA 5K6AA 3ZHBA 2XOEA 3F4BA 4KVFA 5JD3A 1AMNA 5C5CA 4LJRA 2BFEB 1GL9B 1H3NA 2BPOA 1RWOA 4V0SA 2Z4RA 3FYHA 1N3IA 3NTRA 3A1WA 1D2RA 2A84A 4FMCB 1GARA 4KI7A 4EB0A 1JFRA 1UXIA 4ZVUA 2H1WA 4CKYA 2DY0A 3COZA 1TB4A 1ISGA 2FPRA 4LRXA 5DWQA 3EWIA 3RWBA 4AY6A 3ORFA 3DZFA 3R5FA 4GYWA 1SD2A 1KO1A 2PSSA 4X60A 2ENWA 4IGIA 3UC5A 5ADVA 5E2BA 1P45A 1EGHA 2JRCA 4FWBA 4H16A 1KI6B 2O6HA 5K3FB 4DMLA 1NASA 1T9HA 2JC3A 4AO8A 4HWPA 5K3SA 2DH6A 5CBPB 1TEVA 5BVGB 3ZWXA 2ZTUA 3UHJA 4X90A 1ZK3A 3BPSA 2Q5EA 1AKUA 4JROA 3VU8A 3TLGB 5LN1A 1E7RA 1SA0B 1Y1PA 5HDQA 1XCBA 4Q1CA 1KRHA 1TQHA 2I9PA 4QPPA 5BW4A 4UTNA 3HJFA 2W2VA 1RW4A 2GILA 3CZCA 4ZVSA 3SDBA 5CGQB 3VH2A 2GERA 1L5HA 1P61B 1S01A 3VPGA 4YR7A 1M2VA 3KLPX 4CG1A 4OL9A 3IP6A 1W2GA 4EJMA 1K92A 3ND8A 3LCJA 4JI6B 3AETA 1M2HA 1BKSB 2Q5CA 2DFLA 3N28A 3C4VA 4KO3S 4P38A 2ECKA 4U7WA 2C2BA 4LV5B 3WADA 3V9PA 2HT1A 2ZRKA 3D4IA 3B1XA 2XXJA 1PX0A 3EVBA 2V65A 5KJEA 4N1AA 3EIEA 2P5YA 1UEXC 1USIA 2ZRPA 4Q7LA 3CHYA 1WCYA 5AKEA 5DI3A 4NYMR 3TOVA 4XPZA 1NJGA 1PS0A 3AUSA 4I2VA 2YVQA 2QLJA 2R87A 1E9FA 3CH6A 3LPNA 1I2BA 3EPPA 3TJRA 3NX4A 4GMFA 2CFCA 3BM5A 3E7XA 5LCXA 3DH0A 1H2XA 4IFEA 4INOA 4DLAA 3QIAA 4ER0A 4KSBA 3I12A 1GZSA 4IAOA 3ZHSA 2IUSA 2PKYX 1DKMA 2B3TA 2EW2A 2QQGA 2WNSA 1VSBA 2ZBGA 1RKXA 5DCWA 2NQ8A 1YZVA 5LIRA 4TVKA 4MRMA 3OEHA 3PIRA 2HLDA 1P19A 2D13A 4QEKA 2I6SA 1JXOA 1OI7A 2ZJ0A 2QORA 2FOLA 4IEIA 3AR7A 2XCQA 4RKWA 4U3JA 4UTXA 4TTTS 3IEKA 5E6UA 4Z4HA 2I8CA 3BGIA 2X0NA 3BOSA 5EKTA 3S2GA 4BE4A 2K6GA 3HVIA 1OZAA 3PE6A 1GGFA 4WX2B 4BNIA 4C0LA 1NYRA 4ZOAA 3RNLA 2D00A 3EVDA 2H7VA 3UT5B 4PLGA 1NUUA 2FUG1 2RC6A 3G1UA 3L8GA 4F85A 1ZICA 1H22A 4M98A 5CG1A 4RELA 2Q29A 1U90A 2VBGA 1K4KA 3FRIA 3HCNA 3O90A 4TL7A 2WMNB 2UVPA 3JD3A 2X23A 4KQEA 3STXA 3A2NA 1ZDMA 2IYAA 2B61A 4B4VA 1QQ6A 5IT4A 2P4HX 4MTCA 4AJIA 1M66A 1FS5A 3X2EA 2VBFA 2WILA 2R8XA 1M83A 3JZFA 4EOGA 2W7TA 2PS3A 3WX0A 2YN0A 2VO1A 4BNLA 2JBWA 4MZDA 4F6CA 4II2A 2VCHA 2Z6QA 1G21E 2QN1A 3WZ2A 4C9BA 2DQ4A 2PWZA 3R7FA 3DTVD 4BYMA 1IUPA 1OI3A 3FOBA 3Q0TA 1CRWG 1TQ6A 2FSFA 1E1MA 4KLCA 1T9GS 4RY0A 5ALOA 2QPOA 1NUPA 4O4IA 4ZIRA 3IR6A 4YJGB 5B3JC 1Z17A 3EGDA 1T36B 1RM5A 3B36A 2BEUB 3H2YA 4ETMA 3BFVA 1MKYA 4GX1A 2NU8B 1OIWA 1GY8A 4V1CA 4GM1A 1RYHA 1L6IA 1MTZA 3K6RA 3GMSA 4LJYA 3E5HA 1QE0A 4RHXA 2HRZA 3HYNA 4YQZA 5FOUA 3UFBA 1O0CA 4FD3A 1XL0A 4L0QA 1PSWA 1SQSA 1Y3FE 2QAIA 4PYQA 1KYVA 4JB0A 1YS6A 1TK2A 2BFWA 3EIFA 3L1VA 5B3AA 3ICWA 3BMCB 2JBHA 2P2LA 3E1SA 4WLNA 3CE9A 1AKTA 4LJAA 3HY3A 3AUUA 4FUTA 2EDCA 3H5LA 4XZ3A 1V43A 4DQLA 4Q9DA 3L7JA 2DWUA 2ZIXB 4XD7A 5CLGA 3ADCA 4HADA 4CEIB 3A31A 3QVOA 2DVMA 4ZICA 2OZKA 4RULA 3NUGA 3O3CA 1JEYB 3BEDA 3SHQA 3SSAA 3R3XA 3V00A 2Q8NA 3IJRA 3VDRA 3TR6A 5FWYA 4M7OA 1DCKA 4BPBA 4G4JA 1PR9A 3MRXA 3EXFB 5JC1A 1P74A 1QV9A 1NN5A 2WUDA 2W98A 2HSEA 3IX7A 4D8UA 4F21A 2ISSD 4JOSA 3AT1A 1QGOA 5H16A 5H3HA 3HBLA 5FF9A 5F3WB 4HLUA 3GDWA 4HDSA 5C32A 4FFNA 3I62A 1CUFA 1TGVA 4RDIA 2P30A 4R1TA 2M32A 5I47A 1JA0A 2AYXA 3CGGA 1DKPA 1L8AA 5DX0A 3ROKA 4BMPB 2BFFB 2HHAA 2R6DA 4EYGA 2X1LA 5BSMA 3P1JA 4W8HA 5F3DA 1EB9A 4M1KA 4QGHA 4CDRA 1GAEO 1YIAA 4HPJB 5AK3A 2I7CA 3K30A 1RYBA 1KXJA 2R8PA 1BKDR 1JB1A 1I6MA 1V48A 5I9MA 4DDVA 2WVAA 4A6XA 4MDEA 1YHYA 2IZ6A 4OHKA 1GILA 4TLEA 1IBSA 4ALIA 4FMBB 4ES6A 4JY7A 4BKRA 2XNSA 4BMSA 3NHWA 4L15A 4FIZA 4K6FA 1RJ9B 4FYIA 3IAM6 1BRTA 4DJFC 1R4AA 1GR0A 3F3YA 2DM6A 4QFBA 1P18A 2H1LA 5KNLA 2CF6A 2CJPA 2ZRMA 4KIJA 5BOSB 5ILOA 3TLCA 3IXQA 4G1BA 3FKQA 3BUSA 1DFGA 3S68A 4FNMA 2V7EA 3U4GA 3H5VA 2AS0A 3FMPB 1XF9A 4DLLA 2PBFA 2P5SA 1IEVA 3R9XA 2ZTHA 4C05A 2IYOA 4S1TA 1P1CA 1MC8A 3USZA 3CRVA 4KWCA 4QT0A 2ZJ3A 5I4IA 5DOVA 5FPQA 2PT5A 2PUTA 4Q02A 4I50A 3RGGA 3UWSA 4ZO8A 2C82A 5MN5A 4LDQA 3IIMA 1IZ7A 3VM6A 3Q2IA 4NFYA 1V35A 3QF4B 4QOJA 5K0EA 3UC9A 1XZNA 1YZUA 1UPBA 3PX2A 4B0PA 3E84A 1M1YA 4K8OA 3G0OA 4B74A 4JLUA 4JR0A 4PS1A 5KJ6A 2VP5A 4NCKA 4TSRA 1VPLA 2ZXFA 3KRTA 5EJAA 4P0PB 2F55A 1CRZA 5ALKA 4RVUA 3IFSA 3QE2A 3MIIA 2ZYAA 1C7IA 4RHEA 2EGGA 3UKJA 1D2GA 1Z36A 4G41A 4UFOA 2ILTA 2P2CA 2W6NA 2O50A 1QIHA 4DSUA 3QTLA 1P1KA 3CINA 4U6SA 4ZCLA 2GCGA 4KJXA 1NYLA 1XCMA 1Y42X 1Y1QA 3CZ5A 4IH1A 4QXMA 2FKAA 2GDJA 2REQA 3C3PA 3KYIB 4ZVNA 3C87A 1RZRD 3HP4A 2Q6KA 5AKYA 4LVNA 5EJMA 2KX7A 1ZUWA 2O2EA 4DIFA 3CJTA 4TRJA 3DMHA 1L7XA 2PT9A 1B73A 4MRSA 4NOLA 2IZ7A 4K9RA 4E11A 4QGBA 4P35A 3NUZA 4D4KA 2XWPA 4UNSA 3RFFA 1L1FA 3Q12A 4K0KB 4Q7QA 1M7GA 4E5YA 2YHSA 2DOKA 4N40A 4XWGA 3ORSA 1G55A 5KZMB 2G07A 3IP8A 5COBA 4RA9B 1ODTC 4DT1A 1M10A 4UBMA 1AKQA 3CYFA 4B73A 4US2R 1NYTA 5HBRA 1BJKA 2W4IA 3I3SR 2Q27A 4BGUA 3G9TA 3EN0A 3A05A 4OI4A 5IBCA 3PFFA 5LQNA 2ZGVA 4PZYA 2QL7A 3UAWA 4ENWA 4FILA 2J0QA 4CKWB 1WP9A 1XCOA 3PHHA 3V1MA 2HY7A 1N2OA 1GGEA 2QDXA 3WLLA 1HUQA 1TUGA 1ORDA 1H5UA 3KJZA 2CUZA 1TAHA 3GROA 3OFNA 1AO0A 2OGWA 2QG4A 4KGXA 2QQEA 1MQSA 4G2NA 4ASUA 2CLCX 4IDEA 4ZRNA 1CQJB 1AUVA 5KSZA 4NPCA 1W59A 1C1YA 1CUJA 1NBMD 1CB0A 1QGED 4S04A 4CXMA 1KI4A 4C6TB 4NONA 3GLGA 3TI7A 2VAXA 1HNNA 3QIVA 4BZWA 3B6ZA 3FCAA 4YUAA 5KX5B 4TS3A 2Y1EA 4JP5A 2Q5LA 5J2UB 2QMUA 1GXSA 3R09A 3GX1A 1T2UA 3WNCA 1BCRB 2XKAA 2ZIVB 2ZWIA 4IDNA 2AN1A 1K98A 3MUFA 4LOHA 4OA8A 5ETJA 1BFDA 1OHHA 2LCQA 4UM9B 1IY1A 2I65A 3M5DA 3U2QA 2GBIA 4GOJA 1G9XA 3CJRA 3L1UA 2DT5A 1S9DA 4F93B 2QL5A 1E5LA 2X5NA 1D3AA 3NTXA 4AP6A 1SU8A 4NCHA 5IF3A 3I2KA 1CDOA 3HJRA 1UM9A 4LWOA 2HBZA 3IESA 3GWZA 1M5TA 1A5BB 3SOPA 3EZNA 1AQ6A 1LBQA 4YMWA 1EJ2A 1X15A 4L16A 4I50F 3E9RA 1OX5A 2FCRA 4LX8A 4IJWA 1HY3A 1C3LA 5LD2B 4URUR 3OCYA 3TIXB 2MU1A 1A8PA 1QTRA 1R5OA 1L4UA 1W25A 3EFHA 4QTZA 4YUZA 4LXUA 3LE8A 2HPHA 1VKNA 1PS9A 4F38A 4JGBA 4ZTUB 3PR2B 5JH7F 2GETA 5I8WA 5GVSA 2PJDA 3ORHA 4D25A 3D8NA 1P1RA 2FN8A 3QBVA 3QKTA 4RFLA 3DCYA 3SC4A 1DKOA 2OXEA 3ZS8A 1I2MA 3ZGZA 1XCPA 1DNPA 4X84A 3NWJA 1TCAA 2V4MA 2Q2NA 3I9LA 2XB2A 4U2EA 3TQHA 4HMPA 3ODGA 1UL1X 3HQ4O 1N2XA 2ZIXA 4CEIA 3TEMA 3AO0B 1DXYA 5IS2A 2BONA 4NYMQ 1PS8A 2IW3A 5HKOA 3K8OE 4YAGA 4ZI3A 1U6JA 3PWZA 4OUDB 4U5QA 1NG1A 1JFLA 1Z5OA 2WG1A 5AKZA 4L78A 2XNJA 1S9HA 3JYHA 4O2BB 3DXXA 2CVOA 3AVPA 3DT8A 5KOHA 4FN4A 4Q4HB 3JQ9A 5C37A 2GKSA 3GEMA 3GMDA 2GYYA 3UPUA 3FRJA 1P7YA 3AUJB 4JOQA 4C88A 3W3AA 1NZDA 2BT4A 2FJ0A 3AM4A 3Q87B 2QXYA 3BXZA 1G4AE 3DWFA 5AJVB 5DT9A 1YVUA 2HMUA 1ENPA 1R0KA 4G1CA 1Y7HA 1Y0BA 2YXDA 2WZCA 3DW3X 1CU1A 3BORA 2JVJA 4ETNA 4Z3OA 1Y6JA 1RWBA 2RHRA 4R1PA 1ZRNA 4XYGA 1H8EA 2JLRA 2CMKA 3BTSA 3CKLA 1PE0A 1HETA 1V6SA 1Z5PA 2PEZA 4K7JA 4MQ5A 4QO8A 4CT5A 5BWBA 3IHLA 3NB0A 2D5IA 4KRFA 1JNYA 1WBBA 3PXUA 3HNPA 4ZVKA 3EFEA 2IY9A 3DW1X 3RKSA 3DWGA 2G5GX 4H15A 5BOSA 3FDFA 1JAZA 1PBNA 4KIGA 2HZBA 4O4JF 2FEMA 4MWOA 3OE4A 5BWCA 2EL9A 2HV9A 4XM1A 2D2FA 1R9NA 2ZJ5A 2BELA 4PGMA 5TF0A 5FTMA 4AVYA 4OHRA 2AUNA 1QDLB 3L8FA 3R6TA 1OKKA 2P4UA 2GW4A 4H7PA 4CDMA 4OAOA 2O9JA 5IDWA 3QV2A 3T4XA 1TA9A 4NP6A 4RPJA 4ZRDA 1JWLA 2VPPA 4LJ9A 1HT1E 3KTOA 4JD5A 1J2EA 1U9CA 2X14A 1E0KA 1EK2A 1R12A 2CXTA 3Q6MA 4PHHA 5C46F 1GTSA 2UXDB 3AWDA 5GM2A 1NQTA 5LUBA 4Z54A 2GA8A 3NHRA 4OAQA 5FYQA 2J3HA 3RVNA 1US8A 2R79A 1QUFA 1Z22A 1ID1A 2VDMB 4XGNA 3QHQA 2H18A 4TPKA 2JFXA 4LMRA 4MA4A 5TARA 1ZXLA 2KPOA 3IKJA 4Y2HA 1D4AA 3B6JA 2HMVA 3SU8A 3V7NA 4BUZA 4E7PA 4AI6A 3UV6A 3UCEA 2ZM5A 2JH3A 3MS2A 2BEVB 5FXMA 2UYYA 2DT8A 1AT1A 2X9LA 3BD6A 3W1EA 5EZYB 3SJ7A 1HC7A 4P4LA 2E1RA 3ZZ0A 3D2CA 3NOOA 4GUAA 1LC0A 4D8XA 3H0EA 2QMHA 3N8IA 1R16A 4JB3A 4CDGA 4X3PA 2W00A 1DTEA 4ZP1A 4MXDA 2E4YA 1Q1NA 2FEXA 4BRWA 4IDPA 2CCGA 3DLBA 5LBIA 2VDJA 2MYUA 4P7BA 3EXAA 4D0GA 4YDRA 5HZGA 1YCGA 2QLBA 3OFND 5EYPA 2JAOA 2P6UA 1RBQA 1VFNA 3EYAA 3JARA 4ZT7A 1KDVA 3ZY2A 4I7EA 4CG3A 5ALMA 1IQPA 2ZI5A 3TLZA 1SVOA 3PJDA 1CUXA 1JIQA 1N8TA 4RPCA 3QQPA 3Q7PA 4C5AA 2Q8QA 4C78A 4I9NA 1ISRA 1CYDA 2FF7A 2QT0A 5F3RA 5FH9A 1DMRA 3JZDA 1AN0A 2C04A 4ZQFA 5LYJF 5IUJC 2HJRA 4CEHA 1T2NA 3GN2A 3DJYA 4I14A 4C43A 3IOMA 3QZUA 1VG1A 1X7WA 2ZE7A 4IMJB 4H7KA 1GG5A 5FJJA 3I2IA 1GZVA 4CBVA 1HE4A 2VDLB 4FSXA 4RUKA 1IULA 1V1RA 1PEKE 5M04A 2QVZX 2R1TB 4UXIA 4QOHA 3N87A 3TW8A 1GQOA 3UJ8A 2Y71A 3RVDA 5EUCA 3SYMA 4F3YA 3ET5A 2H0RA 4DLBA 2YC2C 3OEEA 2QE7D 1PT9A 2XE4A 4HOYA 3AEUB 1ZZEA 4EKGA 3D6JA 4MQ4A 3CVVA 2JCBA 5EQFA 2PQMA 1EB8A 1C3XA 4BCBA 3UUWA 4Z4CA 5DI9A 2JRLA 1QZUA 3D7RA 1EVYA 2E0IA 5AK6A 5LQRA 1WOYA 1D6NA 3HKBB 4QSMA 2A50A 3L9WA 4RJKA 1P7VA 2DKOA 4WFIA 1P2VA 4CCWA 4KHPB 1U5AA 2DR0A 3TRHA 4BGDA 3WYGA 4BNTA 2GOYA 4B0OA 3NETA 5AKKA 2RCNA 1U8ZA 3FW1A 3R3ZA 4JEIA 1ZQ9A 3QK7A 1UJCA 3HCPA 2OWDA 4TXHA 3RLIA 1M76A 3GLGB 2BKLA 1YR8A 2WTXA 1JZTA 5ICCA 2PBRA 4MDYA 2XGSA 3LF2A 2X9QA 4PGHA 3UK1A 2HC9A 4WZBA 3R0XA 2IIPA 3E3MA 2F8MA 2J9FB 4DNOA 4PX3A 4CG0A 4IYRA 3DTVB 3IV6A 2VH2A 2C2MA 4BO0A 3EJ6A 2ZUFA 1DC6A 1FSSA 1P0MA 4YP5A 1P17A 1E1RA 2XCIA 5ALYA 4IHAA 3OIGA 1MAVA 4CMKA 1LLQA 3VU1A 4BFVA 4PCLA 3G9QA 4A2QA 2GEFA 1H1LA 3GJSA 5JXHA 3NWEA 4ANFA 1N33B 2GD1O 4OJMX 2OEPA 4UM7A 4L3WA 3VC2A 1Z3IX 4MAFA 4H3HB 3KBBA 3Q98A 3FTNA 5IBRA 3SC3A 4TS1A 3ZD6A 4ALMA 2BGRA 3EEQA 2O05A 3M4NA 1PFVA 1T1EA 1M33A 3C5EA 1YBFA 1DX9A 1JALA 3DMPA 3DOUA 3NVDA 4MWSA 3KFVA 3UJ9A 3WL5A 1TZJA 4BVAA 3O4GA 4ZJYA 2CLEB 2HK6A 2J9RA 3CI0I 3AEXA 1OBOA 3T5PA 3FKSD 3E22A 3PNVA 3C6ZA 4RMIA 1Z0KA 3L41A 3RUEA 2RK3A 4IH4A 1FRNA 1TCBA 4PPYA 4WA8A 4O4HF 2I3ZA 4YAJA 1NQUA 2D4AA 2PMBA 5SZIA 1LJUA 4ABYA 5J4KA 5BMOA 4X66B 1KBOA 2P0YA 1QHIA 1A7AA 3QBTA 3HN2A 4A0GA 1G38A 4GS5A 5HCNA 5BR4A 2F8SA 3DBLA 2ZI9A 1YJ8A 3LHFA 3W9BA 3HTXA 5JIBA 2VPZA 4LV8B 5C8YA 3RRNA 1JEQB 5B7QA 2QJRA 4HXEB 2RB5A 1E2UA 4WINA 4NENB 4NJMA 1V1MA 2HX1A 4LKRA 1H3EA 4NE9A 4QOFA 1QORA 3GZJA 4ZD6A 1XD2A 4LC0A 4MGZR 4DDMA 3QXSA 1DAEA 1MHPA 3KL2A 3NYIA 3HJBA 3OIWA 3RUIA 3V2HA 4DBZA 1Z07A 3ZR4B 5BNWA 2XMRA 1YR1A 4I8DA 3LD9A 1YCDA 3I5MA 5IM5A 3RD5A 3QXGA 1N5RA 1I5RA 3KLOA 2W6JA 3M6FA 3WGGA 2QV0A 4L5YA 4MUHA 1FP4B 1Q19A 4JR2A 3I3OA 4IIVA 4BECA 1P9WA 5LWQA 1XNHA 4XCVA 2JGDB 4LZLA 5A9TA 3UK7A 4B6JA 3GQBA 5CPBA 5TQJA 2AI2A 2C4HA 4C07A 5EERA 4G5HA 1QRDA 2CK3D 1Z35A 2EX0A 1PNVA 5IVHA 3GC6A 5B2ZA 3VPXA 5FWXA 1RHKA 1N5MA 4MW6A 3QSYA 1OVMA 3LX4A 3VX3A 3D1JA 2KSQA 3IQWA 3N6VA 2XA9A 3HCBA 1MC1A 4HAZA 3EPLA 3VVMA 3ROMA 1NATA 1Y5LA 1K8ZB 3VOTA 2C83A 2H2IA 3ER6A 3MCWA 1UJ2A 1TIBA 3SZRA 2RI6A 3HXMA 1W35A 4DQUA 2HQBA 3C6MA 3AM5A 1V4BA 1PD1A 1D6JA 1SRQA 4MLDA 3BGWA 2HRDA 4Y7DA 5E7QA 3CVJA 2FPMA 4U5XA 3ZTTA 4D9IA 2YWDA 3OZWA 4DR4B 3PEWA 1J99A 2WG0A 4C21A 4H3VA 2ZTVA 2DHQA 2V7BA 1SXJC 2DECA 3ETHA 3NNNA 1ZESA 1R7RA 4XJXA 5FA8A 3SDZA 1ZCBA 2BGUA 3I34X 1GZ7A 2PUHA 4P92A 2ZJ7A 2G3YA 3NHAA 4Q19A 3CM0A 2CW5A 1E63A 1TLFA 2Z4SA 2QR2A 3EDRA 3I23A 1SBIA 4LISA 4MVJI 5IYZA 3LDAA 5FJIA 1ZWLA 2HGZA 1X38A 1AGRA 4Q39A 5CDUA 4ECAA 4N49A 1HDIA 4Y2GA 1G4HA 1AM4D 2P40A 1EWTA 5KOYA 3ICPA 1YNOA 4IQFA 2CD9A 4Q0MA 3DR3A 2VZ9A 1C41A 2NNWB 3C39A 2EERA 5B37A 1Q11A 4FHEA 3V7FA 5F51A 5DRYA 4UHBA 4ER7A 4ZZ2A 3HXTA 3AESB 4C5BA 1S4QA 121PA 2G67A 4FU0A 3UAZA 1CS0B 3NH6A 5IJ9A 2JEYA 3H5IA 4J2TA 5AH0A 4UAJA 3DC7A 4EWLA 4HDQB 1XDSA 2Y1KA 3O5AA 2ZUWA 3PDHA 3HO1A 3DF9A 4N0QA 4BBZA 3Q3GE 3P9PA 3FPJA 3ELUA 4IGAA 5DSTA 3OZEA 3ZQUA 3P0HA 2P0AA 4IY1A 4K9DA 2WFAA 4CTMA 2QSJA 1B4DA 1AUQA 3OTIA 1JG3A 3PR1A 4KG7A 2Z6VA 3KKEA 1A27A 3LCMA 1R64A 3PRHA 2R8BA 2IHBA 2R96A 5AJYA 3SBDA 3O1IC 5IN4A 1UK8A 3UKOA 1CW2B 2G06A 4J0IA 4MK4A 3IAUA 7ADHA 1H4QA 4BY9E 3REGA 1ZD3A 1B6RA 3M82A 3HI6A 3H2SA 1DEOA 4PIMA 2RE8A 2PKCA 5BSKA 1BHO1 3OJ0A 4MUKA 3R7SA 3LHKA 4DMMA 1L4NA 2P9FA 1UBRS 2FUKA 1NVVQ 2X8BA 5CW2A 3ITEA 3LPAA 1O8BA 2W0MA 1Q7TA 1KFKB 1ZIDA 1MRSA 2G71A 3LQ2A 3GLHB 2H17A 2HXYA 2VSYA 2XKKA 4TTSA 5SY6A 5EHQA 2F3SA 3WK4A 1FXUA 5HK9A 1MH1A 4MQEB 4C4PA 4Q3AA 1LW6E 2IQ5A 2OAP1 4J29A 5ALQA 4EHKA 1WPGA 1R3UA 1IOVA 1O58A 4F4CA 1SKMA 4HN9A 2WAOA 1XHEA 2JW5A 1E3IA 3ENVA 4C3OB 5ABPA 1GT91 5B1IA 4LK2A 1WZEA 2PUWA 3BHNA 2WU8A 3IVMA 4JJ6A 4HS9A 4BEVA 4KQ6A 4IJMA 2XT9A 5DWVA 2B8WA 4CKZA 3GLIB 1I7DA 3RAFC 1BVYF 2WYIA 3AV0B 1E94E 4EG5A 1HEIA 1C1DB 5ICGA 3IURA 3SFTA 4PAQA 2AVDA 5CVVA 3W3AD 4MWCA 2PLNA 4E5UA 4RK0A 5HEKA 2WFMA 5C81A 4P3OA 1POXA 2CDCA 2Q3DA 3KYCA 4EKIA 1C1XA 3RAGA 4Q4CA 1KZ6A 3DCNA 3AL2A 4S35A 1SC9A 2I4LA 1B26A 3FNHA 4GKKB 2PMKA 1IPFA 4L9RA 1P9OA 2ZIZA 3K2IA 3LNTA 1HQDA 4BJ5A 5JXIA 2ZSEA 2Z5GA 4DLTA 1XPOA 3QW2A 2JI4A 3BJRA 5CDTA 1YZLA 1O97C 3FSEA 4HF7A 3SXPA 1ZXXA 4ERNA 3K4PA 1ZGGA 4P54A 5IBQA 5HZKA 5A05A 1QE5A 1CYEA 1K4YA 1URPA 4OP3A 1HORA 4M1WA 1X1RA 2AW3A 1H1LB 4Y6RA 3L0IB 5G4LA 4X62B 2UXBB 3RIEA 1MO4A 1IZ9A 3ONNA 3N6XA 2EWMA 1MX1A 2FRVA 1IN6A 4UTVA 2RHCA 4WY5A 1XTIA 4MGYR 1Q3KA 3AGPA 4YH1A 4MW4A 2XJ9A 1CNMA 2B34A 3S2UA 4QVKA 1CZKA 3DLAA 2IDKA 2XCTB 2J09A 2UZ1A 5JY1A 1MDBA 4XSGA 3VVCA 4BRUA 2Z1DA 2VF2A 2CK3A 2ZPTX 4MPDA 5GONA 5F35A 2KS6A 2WF6A 4WNIA 3T9EA 4GLLA 4XUDA 3WOVA 3TK1A 1WUYA 3LLSA 2GM4A 5EMMA 1LLDA 5B2EA 3KZKA 1QNFA 4D3SA 4YDHB 5H4HA 3KKOA 5D01A 3T9DA 2X0KA 4YWJA 1KP2A 5B3JA 3TQQA 2AUMA 4DLPA 4KIUA 1J8QA 1WY7A 1COWD 1F2DA 1EWKA 3EXEB 3P2OA 3RU7A 1JEQA 4O6VA 4L6IA 4DIBA 3KJNA 2C7OA 3IP5A 3R4VA 1B1CA 1I4TD 4ONEA 2PYIA 4C0QC 3SC2B 2PZKA 5G3ZA 4PCAA 1MPTA 1MVNA 1Q0HA 4G1FA 2Y0DA 3UW1A 4CM4A 5EQTA 3L0YA 4F60A 2VQ3A 1Y4ZA 2FB9A 4QL3A 1KK3A 1XZAA 1U5BB 4HNVA 2VHQA 2RARA 2DJ5A 4PHCA 1UBTS 3EPKA 1I3OA 4M7RA 3O2NA 2I55A 5IASA 4QOEA 3MA0A 1V5EA 3MS4A 3JPYA 2IXGA 3OZTA 2ODWA 4CQMB 3BJEA 4C30A 3LF4A 4KXFB 1E4EA 3AYXB 3GCXA 3HB7A 5PGMA 3T06B 4CN9A 4Y67A 3PGLA 5FNVA 1GQYA 1MFPA 1JEDA 3IAM1 4IO1A 4QGFA 3FGPA 1QFSA 1TJNA 1T0BA 3K3PA 4EARA 4HNAA 1EVZA 3I01M 5FWXB 1C8BA 4C2BA 5KQLA 3C8HA 2VTVA 3AI7A 3HNOA 4HUTA 3I83A 1YD7A 2C5LA 3BGOS 4BFLA 1Z62A 5K8VA 5CLLA 3E4CA 2FLKA 1WL8A 3RRJA 3KFLA 1ZH6A 2HSZA 2FN3A 3ONVA 4REQA 4CU2A 3ZDQA 1TF2A 3PUHA 4EGQA 5LM3A 2GJSA 4ZJZA 2P79A 2I6QA 3T0IA 3W5DA 1EFPB 4HH3C 4PGFA 4XWOA 2X77A 3C48A 3K96A 1YHNA 4IJ6A 2O2HA 4H6PA 1AJEA 3UHAA 2AR0A 2JLAA 1NI4A 2PU7A 3AJAA 3ZCPA 2M1XA 3AW8A 5IYZB 3BL6A 5G40A 4RIEA 4I66A 5KIAA 1BC5A 1VIVA 2V4UA 4DG5A 3TZKA 1KQOA 1MENA 2Y1DA 1FDIA 3BGSA 3N70A 4RH1A 5KJCA 2CDNA 2NTYC 2WAAA 3CSSA 2CJFA 5EHZA 1UZMA 3N2GA 3THWB 4ZK6A 1E3QA 2OHJA 4GPD1 4KWTA 1HYQA 1A9PA 2XYPA 4K28A 1IMOA 5HF5A 1GNPA 5BUSA 3DONA 1DX6A 4PLZA 3S1AA 2AOTA 4LSMA 4BV3A 1YMVA 1S2GA 3DC2A 2F9LA 3GRCA 3BXPA 4NG5A 4N5IX 2FWJA 2RJNA 4HFNA 3RKUA 1MBZA 5H81A 5T4FA 5HJ7A 5K09A 4PTZA 1WUKS 3EOBI 1GP2A 2IYSA 4JQCA 4IDBA 4FGZA 5CT5A 2VIIA 3VPFA 1MB9A 4PNHA 2YV1A 3D3JA 1BAPA 1XU4A 4KPEC 4BX3A 2F48A 5GZ1A 1XN1A 1RLIA 4YMHA 4GPBA 4QUIA 1MCZA 2JLSA 3R23A 3VNQA 3PUIA 4RS4A 1FNSA 4DC1A 4MQFA 4YRQA 3CLTC 3L0CA 3HBFA 2FFHA 4S12A 1W19A 3KYDA 2Q4DA 3OIUA 3J81A 4B87A 1WCIB 3O8NA 4QHYA 5EZYF 3M4ZA 3NHSA 5B36A 3EBPA 1WCXA 5IBPA 4LW8A 3AQ4A 4YHHB 1GUDA 2A8YA 1WOMA 2D06A 1HE3A 3OJLA 3PQ8A 2M6LA 2XXAA 2Q5OA 5KNCH 4KBGA 4X00A 1K3FA 4NCNA 5AI6A 3GP8A 2RGDA 5A6SB 3KQOA 4KMSA 3UGTA 1RM3A 5CVJA 2PX8A 5JAOA 4R1MA 3TEFA 1LK7A 2J5XA 4NL4H 4CCAA 2KB0A 3KALA 4G8CA 3GVPA 4J4HA 1R18A 3HA5A 1W8IA 2HSDA 4QTYA 2R8OA 4XD7D 3VJKA 1DAMA 3TDKA 4BRSA 4F8JA 1A1VA 2ZS8A 1EZ4A 3H9BA 4L3VA 4D4MA 2YASA 1XQ6A 2ZRFA 1YKSA 3N2YA 4LFBB 1W0KA 3PL5A 2YOFA 3O91A 4RTSA 3GFBA 4UCFA 2P0EA 4F7WA 2YFYA 5HILA 3ZU3A 1NV9A 4DJDC 4EG4A 2GPTA 2IW1A 1DOZA 3GZNB 4AMZA 1G5PA 1PWYE 2GPWA 5ED0A 5JT1A 3KJEA 4FPXA 4KX5A 1F0PA 4G97A 4LHZA 4PZ0A 3UJPA 2XGGA 1FU7A 1QG4A 1MABB 3G88A 3FPSA 4ZODA 5CHEA 1ST3A 1Z68A 2E5FA 3AF1A 3I37