1MOPA

Crystal structure of a pantothenate synthetase from m. tuberculosis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
288
structure length
288
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of a Pantothenate Synthetase from M. tuberculosis and its Complexes with Substrates and a Reaction Intermediate
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords pantothenate synthetase
total genus 95
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2002-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 1mopA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1mopA01
2DLCX 1NYLA 4MW9A 1EE1A 4NZPA 1SURA 1TYCA 3SP1A 2PFSA 1BS2A 4S1OA 3SYTA 4G6ZA 2CV1A 4AS1A 1N2EA 3CLUD 3TS1A 1KQOA 3AG6A 1WQ3A 5LFAA 4ZCTA 1T9GR 3CLTD 4DDHA 3CLUC 3IDFA 4MUHA 3LOQA 1M1ZA 3CVUA 2OV4A 2J09A 1KH2A 1YI8A 3UMVA 3A2KA 3CVYA 1GTRA 1ZJWA 4H3SA 2PIDA 1H3FA 1KORA 5DB4A 4ZT4A 2J08A 4KPUA 5AHWA 5KHAA 3K9WA 4MW4A 3X1JA 4UZFA 1IHOA 2YXNA 3CA8A 2G36A 1O96B 1ZUNA 1WZ2A 4DDKA 2BTEA 4G5YA 1TEZA 1R6UA 2ZP1A 1N2GA 2X1LA 2PZAA 2DR2A 2CV2A 1OWOA 2A84A 4MUJA 3NBKA 2WB2A 1M8JA 1JZQA 1J20A 1P7PA 4I6EA 2QJTA 1NUUA 4XFDA 3M5WA 4MUNA 2ZUFA 3L92A 4X0EA 1WXIA 2J4DA 2QUHA 2QTRA 4MW7A 1UFVA 3H9CA 3D6VA 5EKDA 2YY5A 1N2JA 4KKVA 1KH3A 3HV0A 4MVXA 3IVXA 2A1UA 2A1UB 2HZ7A 1OWPA 1M83A 1F9AA 3RHSA 1LI7A 3IMGA 3RK0A 1KQNA 5IHXA 4MVYA 2EJCA 4CDMA 3H05A 4MUGA 3N9IA 1T9GS 3GLVA 4L2IB 3MMXA 3IUEA 1ZH0A 3RFFA 3MXTA 4MVWA 3BL5A 5LLTA 4FZJA 3PRHA 1OWNA 4ARCA 3FETA 1D2RA 2A4MA 2D13A 4PBTA 3SZ3A 3FDXA 4CQNA 2ZUEA 2CUZA 5H7XA 3UOWA 3AFHA 1JMVA 1G8HA 1QJCA 2YWBA 1U3DA 3QTTA 4DJAA 3NBAA 3G59A 3PNBA 3Q12A 2X1MA 3H99A 2QUIA 5DK4A 4EG8A 2DETA 3I05A 1A8HA 3CVXA 3HL4A 4MUKA 1YULA 2JAXA 4XSVA 1TYDE 4DDMA 4ARIA 5DASA 2DEUA 2CSXA 4NATA 1OBCA 3COZA 5J59A 1NUQA 1JEEA 1EUYA 3ZIUA 4I6JA 1DNPA 2QUKA 2TS1A 3SDBA 5FO0A 4KPUB 5TS2A 2RE8A 1O94D 1NZJA 3DLAA 1PG0A 2YWCA 5J58A 2E21A 3OTWA 1MRZA 4HK4A 1KH1A 1YUNA 1EFPB 1K97A 1MB2A 3K32A 3KT0A 4RPIA 4F3RA 3Q10A 3P0JA 4MW5A 2QJOA 1IFXA 3L93A 1IRXA 1IH8A 1EFPA 1U7XA 5H16A 1LI5A 1YIDA 1V47A 1M8GA 3G5AA 4ZT2A 1G8GA 2X3FA 3ISJA 2Z3VA 1U0BB 1OD6A 1GZUA 3KFLA 1MAWA 2PZ8A 3PXUA 3ZXSA 1NUPA 2BYTA 1EJ2A 1K92A 3DPIA 2XRYA 4MW6A 4MULA 4MAFA 1NI5A 2AKEA 2C5SA 4PY2A 3AIIA 1U3CA 1GLNA 3JXEA 3QTBA 1MOPA 1MAUA 1R6XA 2GKSA 1JECA 1WXHA 1K4KA 2CYCA 4EGAA 3FH0A 2D5BA 1T6YA 1Q77A 3N8HA 3UC5A 2HGZA 3ZGZA 1X8XA 3TZLA 3PNVA 3E27A 3OP1A 1GN8A 2WQ6A 3CLTC 1JIJA 1N3LA 3C8ZA 1MC1A 4XFJA 1ZH6A 4NX2A 4ND7A 1IQ0A 1KR2A 3Q4GA 2IP1A 4YP6A 3AKZA 5TEWA 1F7VA 1O95C 1FFYA 4CDNA 4R0NA 3TQOA 1N75A 1MBZA 3P0IA 1JEDA 4MW2A 4MWEA 1WXGA 4MWBA 2A1TR 2PXHA 2IJGX 1XNJA 4EG3A 3COVA 1LW7A 3MUEA 2WSIA 4MW0A 1VBNA 4Q16A 4HJRA 2AG6A 5JBNA 1I6KA 4I6GA 2VTBB 3AG5A 3ND6A 4UZEA 4R2MA 4OUDA 1O96A 1Q19A 3IOCA 4JZYA 1KP2A 3FOCA 3IOEA 1IQRA 1QU2A 2VTBA 5HG0A 1NSYA 1VBMA 1V8FA 3FIUA 4EG7A 1EFVA 1M8KA 3VGJA 2NSYA 3NV7A 4U7JA 1PFYA 4YP5A 5J5AA 3F3MA 4DLPA 2CV0A 4KR9A 3GMIA 4PBRA 3MLAA 4A91A 2IELA 3P0HA 4EG6A 2GM3A 3RJZA 3CLRC 4CT0A 2B7LA 3CVWA 3HZRA 1VL2A 4EFKA 3VRHA 1KKUA 4Q93A 3LE8A 3TNJA 2DERA 4NDAA 4QRDA 3QE4A 4ZT7A 1XNGA 3ZJTA 3A04A 3SEQA 4EG4A 2WQ7A 3CLSC 4EG1A 3ZJUA 3IVCA 4ZCQA 2OQ2A 1PFWA 4JXXA 1J70A 3IH5A 4DE5A 3IMCA 1N2BA 1MJHA 3KT3A 1RQGA 1NURA 2H29A 1QQTA 1VLHA 1HYBA 1GPMA 2A7XA 2NZ2A 5KCMA 1J1ZA 2V0CA 3X1KA 5FNZA 5HUJA 1GTSA 4J75A 3D6UA 4JFAA 3RBAA 5BNZA 3SEZA 4EF6A 1H1TA 4QREA 4HPWA 1WKBA 1QRTA 1WXFA 4GRIA 2XRZA 1QRUA 4MW1A 2RD2A 4MQ6A 1EUQA 1XNHA 1MB9A 1Y42X 3SZGA 5KWVA 5IJXA 4NAUA 2E89A 4EG5A 2Z09A 1O97D 1IVSA 5HUHA 3COWA 2QUJA 1T6ZA 4E1AA 1KP3A 4KR7A 4F4HA 2V0GA 1OWLA 1B6TA 1G59A 1I6LA 1TYBE 2R5WA 2D54A 3H97A 3TQIA 4R2LA 1N78A 2I1LA 1JIIA 3UK2A 3HFJA 4ZT3A 1COZA 1WQ4A 4MUIA 5K0SA 1O97C 1NP7A 1N2IA 1WY5A 1QTQA 4L2IA 4P2BA 4ZCRA 2AZXA 4MLPA 1OBHA 3ND7A 3IVGA 2O5RA 1CT9A 4U8HA 2JANA 3RK1A 1WOYA 1OWMA 4MWDA 1O0CA 4MVCA 1NUTA 4MWCA 5DEOA 1JIKA 4PBSA 2QTMA 1O0BA 1O6BA 3ND5A 4YBRA 1WXEA 4BWVA 3COYA 2O8VA 3KT8A 3CR8A 3FNRA 2CYAA 1TFUA 1JHDA 1YUMA 3DV2A 4WNYA 1Q15A 4YMIA 1QRSA 1X6VA 3ELBA 1EXDA 1O94C 1S4MA 2DPLA 4AQ7A 2CFOA 1TYAE 4OJMX 3VU8A 1N77A 1F4LA 2A1TS 3MLBA 1K4MA 5K0TA 1GAXA 1QNFA 1WJGA 1JILA 4DNXA 1XJQA 4MUFA 3CLSD 3FG9A 3INNA 1N2HA 2EL7A 3G6KA 2VXOA 4K03A 3AL0C 3KT6A 1KQPA 3S3TA 4KR6A 1O95D 2J5BA 4RUKA 2HMAA 3GUZA 5F23A 3CVVA 1M8PA 4K0RA 1VBKA 4TS1A 3TZEA 2QJFA 3X1MA 2X0KA 1F7UA 4GU5A 1FYDA 1I2DA 3IUBA 1M8FA 1JZSA 3IMEA 2QTNA 2CYBA 4ZCPA 1J1UA 3ZUGA 4NAHA 3PNYA 1ILEA 3IODA 1I6MA 4MUEA 1JGTA 2GOYA 1IQUA 3HGMA 2H2AA 1TQ8A 1J09A 3UY4A 4G5FA 1KAMA 1T6XA 4OUDB 3U1VA 3FHJA 3CLRD 3IOBA 1G8FA 1ULHA 3FWKA 2PZBA 4WSOA 3A05A 4ND6A 1H3EA 1R6TA 1U7DA 2PG3A 3P52A 4JXZA 1EFVB 1PG2A 2E18A 2Z08A 3FY4A 2A88A 3H9BA 3A4IA 3N05A 4ZCSA 1KAQA 2DUMA 2DXIA 1O5TA 2A86A 3ZJVA 1H3NA 2J07A 3LCJA 1PFVA 4HJXA 5TGTA 2CT8A 3ZXIA 4ZT5A 4JYZA 3DO8A 1NUSA 4YP7A 3ILVA 3FI0A 1YIAA 4ZT6A 5LM3A 1N1DA 1QU3A 1PFUA 3N2YA 4U63A 1J21A 2JA2A 4J76A 5TEVA 1N2OA 2E0IA 1Q11A 4QBTA 5FO1A 3HMQA
chains in the Genus database with same CATH superfamily
3PQCA 3D6JA 2QVZX 2IHTA 1LLUA 4NOMA 4J6FA 3DF7A 4AMVA 5CU7A 1S2GA 2AZDA 1Z26A 5ITWA 3T7RA 3KZNA 1QH8B 1U8EA 3IKTA 1A76A 3L8ZA 5ICGA 1IB6A 2PEZA 4GHWA 4LRUA 4PSVA 3U61B 1DP4A 1GTJ1 2WFZA 3GIDA 3HVKA 3PQ7A 2FW1A 5GOTA 3UUWA 4MWTA 1KK2A 4HUTA 1UEIA 4JI4B 3SQXA 2OQVA 1YRYE 1ZVMA 1QPBA 3K4HA 1VHTA 2F3QA 3EQ9A 1PL7A 1VJDA 4BGVA 1KAGA 2J3JA 4MUHA 1OXMA 3LOQA 4KQHA 4HLDA 4UE3S 4NL4H 2EBWA 5AKGA 1LFAA 1IB0A 3PE6A 4LSMA 4C6TA 4YAUA 1R5BA 4JSTA 1ZCAA 1FRNA 2HPAA 4PYKA 4EB0A 2HLDD 4N4AA 3SBDA 3V80A 3DV0A 1DOAA 2WTXA 2RONA 5D3MB 5KDLA 5BT9A 1E61A 1IN7A 4PC6A 4AW9A 5A5EA 5JPCA 5KNDH 2B8EA 3OMXA 5AM1A 1KYZA 4OMUA 5ES3A 5LD2C 1B8NA 3RRFA 4E6EA 1IK6A 1A7UA 1H1LA 4DDKA 1ZH4A 4G1MB 2GMWA 2RHHA 3FTEA 1YSCA 2G77B 3RRNA 2VXCA 1YGYA 2AX4A 2YINC 5D7NA 1RYFA 3E53A 2Q5OA 3H16A 4RVFA 4GE3A 3R6WA 4DS3A 3QV1A 1LDMA 1TJPB 3OG9A 1KQGA 1LLQA 2ZIGA 4YJ3F 5FUYA 3HFRA 3JD0A 3F4LA 4JD5A 1VBFA 2OHFA 2XW6A 4TROA 4E03A 3R7WA 2F9LA 1MQ9A 1QG0A 1Y8RA 2GAFA 1N2JA 3H9JA 3HCEA 5H02A 3Q8MA 3M4YA 2XYVA 2Z95A 1YJBA 4FVTA 5E6SB 4CM9A 1E4EA 2FWPA 1M1YA 3CMCO 1KO7A 1VKZA 2HU5A 3WJAA 3AQIA 1X70A 4OXNA 2I4MA 4FLEA 1BCSB 4C1NA 5KDDA 2AE2A 4CW7A 2W6ZA 3N53A 2B5WA 1VHJA 3HRHA 1FC0A 1UKAA 2E5WA 2PSFA 4TLMB 5CIQA 4ZYZA 1RYNA 5D5PA 4FS8A 4MVWA 3AERA 4PRLA 3EXIA 1GCOA 2IWRA 9MHTA 1IN5A 1CUYA 3HM2A 4DRXA 2VPTA 3TG2A 3OETA 3W9BA 2EP5A 2I66A 3Q88A 3HNOA 5F4BA 3VOAA 4F9GA 3J81A 3EXG1 4RULA 1JQAA 3WB9A 1TO2E 3OE4A 4G1BA 4EMBA 1E58A 2AGVA 2YV3A 4LRXA 4D25A 3U0BA 3M6LA 1BVHA 3W7AA 3OPYA 5CJPA 3KZCA 4NF2A 4XYLA 2A9JA 2DFTA 2YIMA 4FB4A 1T6NA 1U7TA 3NBFA 4L8VA 3DHWC 3NTLA 3THOA 4NBKA 1ZJ4A 4E13A 3ZVNA 4UHBA 3WRXA 4IO1A 1O77A 5BSRA 4YR9A 4WRRA 2FQYA 2EQ5A 3ILYA 2D74A 1CDDA 1NLUA 1KRWA 4JDUA 5DLDA 1DNPA 2TS1A 1QIDA 3N7AA 2J3QA 4JEUA 2G3YA 1WVIA 3K0CC 1J4AA 4QM6A 3H17A 1UT5A 2RH8A 3L8EA 4RWZA 4B3JA 5AIBA 821PA 1YR9A 4QEKA 1M2KA 1UFOA 3CR3C 2PGIA 2WWHA 3L6CA 4RF4A 5JQGA 3H5NA 1NR5A 1P4JA 1TU3A 1CZHA 1OKKA 1Z88A 3DKIA 4ZARA 2BHTA 2X7JA 3ZWAA 4E5UA 5C9ZA 3BRCA 1XB2A 2GNAA 3FKSD 1D2CA 1GU0A 5EWJA 4QPZA 3OLYA 1U7XA 1BWRA 1UFKA 1T9BA 4ZKDA 2NVUB 2BE9A 4DBLC 4CV3A 3SC6A 1L7PA 2HH9A 3W1VA 2EOAA 1RBQA 2NYRA 1PS8A 1UDWA 4E7OA 5CB4B 1LSSA 5EMHA 3ZZUA 5KYGA 4PNZA 4CEJB 3OQBA 3O90A 1GG2A 2OVBA 4MRRA 2VT6A 5CX4A 2O0HA 3TX6A 3RK4A 2MR6A 3PS9A 3P4UA 5JAIA 5A0VA 2FEPA 4GWGA 3ZU3A 1SXJC 1T3HA 7GPBA 2O2IA 1IVNA 3DD5A 3LCUA 2NADA 3D54D 2FSFA 1XRNA 5CCXA 3AM3A 1L5MA 1XMQB 1P33A 1RJ9B 1BDHA 4ZYYA 1CVLA 4IF4A 4JVSB 4AMBA 1BW9B 1S2LA 2ZUUA 3OIYA 3KPVA 1GFZA 1MQ8B 3GR6A 3CVJA 4C89A 2GM4A 3WO1A 1WCYA 1GZ5A 3C7DB 4Y2JA 2WY2D 4C4ZA 2G25A 2B20A 2X58A 3IL2A 3D9QX 4PHHA 4DZTA 4MYDA 3P9CA 3JQAD 2GFIA 1QK3A 2I6SA 3NWOA 4P7GA 5JLJA 1TXGA 1CR6A 2J33A 2VPZA 1TW3A 4H7JA 3E0XA 2ACKA 2G9QA 2Y76A 5CTAA 5F7ZA 3HU3A 5JD3A 5L6LB 2JAQA 5LXTB 3IKVA 2XXAB 1CJCA 4AYTA 3MT0A 1AKWA 4I4IA 2DTEA 5ALMA 1RP1A 1LQTA 3L1IA 3CLTC 2QE6A 4YMSA 5F78A 5HZMA 4XFJA 2PWZA 1QO9A 2I3AA 2GN4A 3I01A 4IX1A 2VPPA 3ZIDA 1YASA 2R6DA 4QXOA 2DFPA 2EFCB 3Q4GA 5BR4A 4C3UA 2H1VA 1YE3A 4YP6A 2X76A 5BUQA 5K1ZA 1FYFA 1C8KA 1GQ2A 1VECA 4R0NA 1ZJJA 4US0R 3ZBUA 3KETA 3C14C 4PZYA 4AWXA 2XTMA 1G3RA 5F1YA 1JR2A 2O3QA 1XVLA 4AKEA 4ENTA 1DRVA 1NMXA 1GWNA 2BBWA 2CD7A 3JQQA 3DOOA 4PSAA 2FSVC 3RD5A 4EJMA 1E77A 2FN9A 5IAEA 3CTMA 3OFVA 1XPOA 2XCIA 4WX2B 2YCBA 4MRVA 1MXFA 4GMKA 4JNCA 4R8RA 4MPRA 4F97A 3HCBA 4BB9A 2AJ8A 3AC0A 5KC8A 2R48A 4IZHA 2C7OA 2DECA 5H5JA 2VTKA 4MW0A 4DRYA 4JBIA 4LF5B 3RIHA 1V2GA 1K63A 4KIUA 1TUBB 3B3GA 2Q41A 1IK4A 3PEUA 3Q7QA 5DYYA 1E3SA 3DFIA 5ILGA 2AFIA 4FDUA 4C3ZA 5KKCA 1Z28A 4CKBA 2IUSA 1VFPA 3GWGA 4BGIA 1DKMA 1BFKA 3G2OA 3G13A 3ODGA 3OX3A 5GOZA 3WJ7A 4CM5A 3QPVA 1AA6A 1Q19A 4IH1A 4O59O 1PKEA 4DQDA 1AGRA 2K6GA 2DT8A 2WHYA 4LDZA 4US1R 3R9IA 3SXUB 2HNBA 4U7GA 4RK7A 3THXA 2A53A 1KZYC 1CB0A 1D7OA 3Q11A 3UJ9A 2C9ZA 2W4MA 4TV9A 4XYMA 5CT9A 5KPJA 5A4IS 1V8FA 2Y66A 4NYJR 1H2ZA 4G67A 3L41A 1QO7A 1JKIA 1W46A 4HO1X 5AJZA 4OHZA 3KVRA 3TTSA 1MCZA 4Z99A 2PFKA 3BZUA 5TQ0B 5TLSA 2XB8A 2D6FA 4OQNA 5SZKB 3UENA 1TMGE 3GAZA 4WFJA 1ESCA 2WUFA 4GBED 4Y2HA 2YFHA 5HK9A 4QYSA 1VE3A 4G1EB 1W2GA 4R1NA 3LF2A 3QNMA 1E4VA 3F6SA 3NATA 4DMRA 1XZIA 4EYQA 4EW2A 4XA8A 3IPLA 3ZGYA 5ALNA 2B7LA 1NLFA 2OO5A 1X1SA 4RK1A 5CFLA 3NHFA 4UJ5A 1L5RA 3HXOA 3C6QA 1XA3A 3N74A 4HKTA 4JBHA 5DO9A 2I1VB 4RGBA 2QZSA 4LHXA 1LNQA 2B1RA 4RFSA 2DBZA 2C2GA 3DEFA 2PH3A 1LNZA 3IX7A 1H4TA 3QXCA 3U7QA 1W29A 2EWWA 3EGDB 2HA2A 2O50A 3O2JA 4KO8A 4OPMA 4YEDA 4FPXA 4IHJB 1J07A 3LXMA 1JE1A 3AI1A 3E5MA 3NC4A 4FK8A 3D1LA 1E2NA 3N1UA 3BTOA 3A9TA 3E58A 3V2UA 2HEGA 3B8EA 4DJJA 1JJVA 1I2MA 1NC3A 1H22A 3ZYZA 2BMDA 3COSA 1GCAA 1I01A 2MSDB 3BFPA 3DM9B 3DUFA 2AFIB 3R23A 2V0CA 3UYKA 1WMBA 3KJHA 3M3DA 3V8NA 1RXCA 4KQIA 1Y3FE 3KQLA 2PKEA 3DNMA 3D6UA 4G23A 3CGGA 4EO9A 3PXBA 1AQNA 5K4AA 3VHXA 1NF9A 1WPQA 2OT3B 2YYAA 3EA0A 4LI3X 2IXGA 3I9V1 4TTJA 3HO1A 4Q3KA 4QREA 2JCBA 5BSHA 5C8XA 5K0FA 1PV4A 5IARA 3KXKA 4XWYA 3ABRB 2Z30A 4P9NA 1Y1LA 4GRIA 1DRKA 4B4OA 5JCXA 1OH6A 2I8CA 1KI8A 1BGXT 1WHTB 1M1YE 1Q3TA 1ENYA 4V0RA 2JC3A 2AFHB 2OCAA 2XHZA 2ZIXB 4HMOA 4YXWD 5AVYA 4PU0A 2D4AA 3U44B 5AHRA 3MPOA 1CLUA 4W5TA 1UQTA 4CKYA 5IEBA 3AESA 4F4HA 2DKNA 4KX5A 4LIPD 4LRYA 3DZJA 4PZCA 2QT9A 2QD5A 3DE3X 3BXHA 2QQFA 3I5XA 3FTFA 3GEDA 4G81A 5DWVA 3T94A 4F1KA 4BNXA 1T0IA 1ZOPA 4LYGA 1QF7A 1K2VN 2BP7A 4OSPA 4F85A 4YMUA 4BFUA 3M5CA 1R2QA 3ZKWA 1DSSG 1W88A 3IP6A 2I9PA 3T9DA 3CGWA 4EHNA 1M2NA 1Z45A 2C2ZA 3D5EA 3O8QB 4LDJA 1CQPA 4PXYA 4Q1AA 5LP1A 1N4DA 5KSOA 1IUNA 3LI2A 1GV0A 4XDYA 5B58C 1AJEA 1EUDA 1JAHA 2O5RA 2RKBA 2UDPA 3ZNPA 5G4LA 1WOYA 4CHTA 3RU7A 4ND2A 3FLEA 3VDMA 1XZMA 4F04A 2VFAA 3NBXX 2OCBA 1FNDA 3KTFA 3NIGB 2ZYAA 3ORRA 4EHIA 4H1TA 2AW5A 2I7DA 2IIBA 4YLGA 4KIJA 3T7TA 1O0BA 1YA6A 4QDJA 4BLOA 4QUEA 4BHTA 2E4ZA 1E2UA 3B1XA 4PGHA 4KFCA 3HDHA 2QPTA 4XEHA 3URKA 4ZO4A 1PW7A 3M6XA 3UHPA 4RVUA 1E2LA 5EINA 1Y63A 4XH9B 1A95A 3MYRA 4Z4QA 1BROA 4IIHA 3UHFA 4KV7A 2GR9A 1YQ9A 3FBGA 2BKUA 1Z4MA 4PQYA 4QGGA 5FH9A 3OH8A 3RS3A 2ECPA 3RVBA 4CM7A 3U80A 2JA1A 2WIBA 1Z0JA 1W7AA 4MVJE 2EERA 1FQJA 3FGNA 4YRFA 4AZTA 1CUIA 1NKTA 1SFRA 4GD3Q 5K8TA 1ACJA 3DLCA 4QU9A 1I51A 3DDZX 3IA2A 1PWZA 3G5MA 3NEJA 4PC7A 1XTQA 1MX5A 2HB6A 1Y8QB 3HEAA 2ZJAA 3HDVA 3MCWA 4H0NA 4W8OA 2H57A 4D9BA 1YKGA 1EU1A 1MB0A 1NM5A 1P4AA 3KPJA 4IIJB 4OHCA 4P4SA 5B4VA 2XD4A 1AMNA 1YS9A 3VOTA 1M1NA 2W7TA 3BM5A 1LLCA 3DMTC 1JLLA 3TLCA 1HNZB 1E3WB 4AMYA 1SGWA 2Z6VA 4PG4A 3H0EA 5FIUA 4DNFA 2OCGA 4JGBA 4E4TA 3JS5A 2PH7A 5U4XA 3T12A 1MMFB 3M4JA 3QYJA 3LAWA 2VG8A 2PUAA 1F20A 4M76B 4N3CA 2W2LA 2GKGA 3T34A 4B4KA 3R4VA 4O08A 2L18A 1UKEA 1ORRA 3IAS1 5F1KA 3ISVA 2C8JA 4PXAA 4XWKA 2IDMA 5ENZA 2ID8A 2P1RA 1NKSA 2WG1A 3ZK8A 4HVLA 2GOYA 2A30A 4NNJA 1VIDA 3EQ2A 2NTVA 3WP1B 4BRSA 2XGMA 2JEZA 2ZKLA 4L76A 4Q3LA 4KYIB 4RQAA 4RETA 1WKCA 5TR9A 3HNPA 1XALA 4DZRA 4U5XA 4EY3A 4C7KA 3IDZA 4WIAA 1M7BA 2FEMA 2J45A 4P7JA 1UOOA 1DO2A 1GZVA 1XLTA 1ZJZA 4Y2XA 4ZJZA 5JZBA 3VKVA 1KRXA 1Q1EA 4UDNA 2VZ0A 3CLRD 3IOBA 3FMPB 4PZPA 2XXBA 4JI8B 1CFZA 3D7MA 2J9RA 3S1AB 1DMRA 1KZ4A 3HBMA 1ECJA 1IAVA 1QLHA 3G2KA 5K01A 3AV3A 2E37A 4U7WA 3OMWA 1RRCA 4G5OA 4QO8A 1JHYA 3A7DA 2D7CA 3VPAA 1XZEA 5FA6A 2CCJA 2W6JD 2JAPA 1E4EB 4HNQA 3ZQ4A 3WFJA 3G0DA 3AU9A 1AF7A 4G4SO 2HHJA 5JS8A 4RPGA 3L7DA 1UR5A 3FTDA 2IK8A 2VHUA 4ZGBA 2EXXA 4DWJA 4YPFA 1KZ7B 2Q0HA 1K7CA 4IOMA 1KRHA 3WYFA 1T9ZA 4MQ5A 4RTSA 5J4VA 2NTEA 2WSYB 3BMNB 3UA3A 1FUUA 2JHCA 1CB7A 1VHDA 1DIGA 4J0EA 1BCRA 2GTHA 4ZTZB 2ZCVA 1D1PA 3MXOA 4GNKA 2A0FA 5BVHA 1U11A 4OO3A 5CG2A 4GM0A 3WMXA 4JOCA 5FA8A 4X00A 5CLHA 1GPUA 2GPNA 1C80A 2IU6A 4ZGGA 2V6BA 1FMLA 1MP0A 3TSAA 2GXSA 1DQPA 1XTVA 2N46A 1DZIA 3MSCA 4NMWA 4YYEA 3N0TA 4R1OA 2I1WA 3LYLA 1FU4A 3OLCX 3WWZA 5CA0A 5LYJB 4L78A 4GYWA 2UXDB 4Z3DA 4MHOA 2ZJBA 1BS2A 1E9VA 1LD3A 2FPSA 2XOEA 3T9CA 4RENA 3PF9A 4A8JA 1XAJA 2RI1A 2CJWB 4CTJA 1SO8A 3R8FA 3KB1A 4GWLA 5ALIA 1KC1A 4WDRA 2ZUWA 2FE4A 1CJVC 1X1EA 3R3XA 1RU3A 3QEKA 4YNBA 4PLVA 2HMTA 3GA7A 4GOLD 2WD7B 4RV9A 3UVEA 3WA6A 4I4TF 1RYDA 3D3JA 1NVXQ 3AHJA 3G85A 4I8DA 4KYTA 4AKTA 1H66A 5CYFA 1JLLB 4DPKA 1OPRA 3HA2A 3SKXA 1X39A 4N3BA 4YCMA 4BQRA 1Q1GA 4O0MA 4CG0A 4EJSC 1ZESA 2YXDA 3H5TA 5C51B 1SC9A 1IJEA 4MIOA 3I30X 3X1JA 1U0LA 3DZIA 4FZ3A 1E8DA 2F9MA 2CBXA 4LY6A 3ZE8A 1PGNA 3TB6A 3F74A 4KQFA 2W6PA 2C4UA 5DNWA 3R5SA 3TLBA 4DM7A 2ZJ4A 3GROA 3CURA 3ZCVA 3MAAC 5HA5A 3GLGB 1E1QD 3O94A 1IIBA 2AE1A 4U7PB 1ML3A 1J9GA 3L0SA 4JUBA 1JIXA 2WSSD 5AM2A 1LV7A 3ZX4A 2Q62A 4R9VA 5FLKA 2H7XA 4QBIA 1P7PA 2EKZA 1Y9JA 3EPPA 1QCDA 1UEJA 1ADYA 3V4SA 4QJ3A 3H7IA 4M0MA 5EI5A 2ADMA 4CLEA 3SZUA 3WK8A 4O3MA 2FPGB 3CHYA 1WXIA 4DIDA 2BFDB 3K9BA 1PR9A 1N77A 2GX6A 2FW9A 1N0IA 4Z0NA 5A05A 4IY1A 3RREA 1F9AA 1ZEJA 1M3SA 3CRW1 4MI1A 4YAEA 1V3QE 4GFDA 2PS1A 3ZS8A 1LLFA 1FLAA 2CVZA 2G6TA 3ENZA 4MKXA 1Y3BE 4X1IA 5LQCA 1EBFA 2O4UX 4A0QA 5K0LA 1N3IA 5TGZA 1LZKA 2GZ3A 2P9CA 3TQFA 4CCAA 3T3EA 1PJAA 3M6WA 2V7WA 1UMBB 2ST1A 4CM8A 4UBJA 2ECQA 2X5OA 1BKYA 3N2GB 4F38A 2PA0A 5T8KA 4KUGA 4FYHA 2I4TA 2Q2NA 4J3NA 5B5SA 1CKEA 4Y1GA 4R7GA 3A3NA 3FDXA 1ZGAA 2AB0A 3GEBA 4MVJA 1PJZA 3B6JA 4N49A 5DRYA 4Q9IA 1ZOIA 3UOWA 3AUUA 2GHQA 3ZI0A 3C4QA 4S04A 1RYZA 3C4VA 3Q9NA 4UJ3A 1LB1B 3WJ2A 3DBHA 4J7AA 1F3OA 1IMOA 2KLHA 1UPFA 1ZLYA 2REXB 1ZONA 1MJGM 3HDQA 1VP3A 4KAJA 4EG8A 4FEGA 4CM6A 1F6WA 3GD5A 1SU7A 3IKJA 4M9RA 1VJTA 4JENA 1PV2A 5HS4A 4H6PA 1NQ5A 2ZUVA 3ZV4A 2RARA 3AHGA 4MAMA 5K8CA 2AFHA 1A9OA 2ZIXA 4R3NA 4BMSA 4OGKA 2XWSA 3BWXA 3VO9A 2B6NA 4BYMA 5F7JA 4JEHA 8ABPA 1EUYA 3CKKA 4CIXA 4RH0A 1NJ6A 1AZSC 3Q1KA 4KPUB 3URMA 4YXFA 2WDZA 4PX9A 3UANA 1ZIOA 5HBGA 2CLLB 2RETA 1YI0A 5HEKA 5TQJA 1EFHA 1KPHA 2QB5A 1A97A 1C2YA 4U8GA 3NRJA 1YUNA 5AUQA 1I36A 2A78A 2OSVA 2B4YA 3BL8A 5K2MA 5AHOA 5HHTA 2AKYA 2OK8A 3NBQA 5FOVA 5F64A 2EX1A 2QAGB 2XWPA 3TFQA 3TYXA 4BRUA 4OLBA 3HZZA 1D6MA 2V6JA 3VHLB 4EECA 1TU0A 3EZGA 1I5EA 4I1YA 5H9WA 3NDRA 2CFTA 3LA6A 2QY6A 4XARA 3TTXA 1IWOA 5JEDA 5K3BA 1W5EA 1DWOA 3KOZA 1PJCA 1RP7A 5B37A 4IIVA 3DC2A 3GAMA 2Y71A 4Q1VA 5DM60 5DM70 5A4AA 1RZVA 1Z06A 4OQXA 3M6IA 1L5KA 5JNRA 1GKIA 1A71A 5C1BA 2J0SA 5M29A 3IP5A 3K2QA 4BQSA 3Q6NA 1ICEA 3CO0S 3DDWA 3IPCA 3NNNA 1DAEA 1G42A 1ZJYA 4IBOA 3LUPA 1RLTA 4XD7D 2MJLA 4YB8A 1R8SA 4KWIA 5AW6A 3LLVA 4J4TA 4GKJB 1SC1A 4IGKA 5L3SB 4W9MC 2ZE7A 4MHTA 1NT4A 2X9GA 1IPFA 1EINA 1CETA 1NE7A 1IDOA 1XZLA 5DTMA 4OQMA 4LF8B 1W93A 2ZDGA 2H5LA 2X19A 1PL8A 4JCOA 2TYSB 3AZOA 1XUOA 1U7WA 5AXDA 1MOPA 4DYVA 1W8IA 2GKSA 3QK7A 2DBRA 4IF6A 4QOGA 2PT6A 4NOKA 4UAUA 3RSGA 2ZCUA 3TL6A 5K4HA 3CT4A 4EWLA 2I62A 1KJYA 4ZOAA 4F3TA 5REQB 2IZ5A 1FCJA 4XSHA 2XMQA 4URYR 5D87A 3U3DA 4LCJA 5A0TA 5I7VA 2PR2A 1GUFA 1VIMA 3PXDA 1TCVA 3GRPA 4QOEA 1UDRA 3VPHA 3ENQA 3DH0A 4KRGA 4LV8B 4AKIA 1NVGA 3IHWA 3NHAA 4LHYA 2CXQA 1H9BA 2HEIA 3U40A 5EHZA 1BQEA 1FP1D 1YH3A 1YZGA 4H2DA 2W11A 4MQEA 4BLVA 2GR7A 1ULUA 4YI5A 1PI3A 2ECFA 3BXGA 2IP1A 4NPAA 5DXJA 3VFDA 3WI7A 5AW7A 2BHLA 2GYVA 4OL9A 4B46A 1LEHA 2WKPA 1YBMA 1YI1A 4YJ3B 5K8JB 4CEIA 1KERA 1LNSA 1RFLA 4PYNA 1XDGA 3DMPA 1JG4A 1H8EA 2X3UA 4ERXA 1GYRA 4OK6A 2ZUBA 4TZTA 1X8LA 3DEYX 3GZNB 1JBKA 3KOOA 5FFNA 2YUTA 1S1MA 2GZRA 1ID1A 4RD6A 4MZXA 2IJGX 3AW8A 3DDHA 3TKYA 3FLBA 3SQWA 3NEPX 1HM5A 3EXHC 3RUCA 1Z47A 3DLBA 1D2HA 2AOTB 1LSOA 1V45E 4UTOA 5IANA 4WK0B 1E7YA 3VPXA 3H4MA 3SY8A 3WYGA 2FAXA 3PRYA 4K40A 4MS3B 4AURA 5CB6A 3H0CA 3E84A 5HVNA 3KEGA 2X9VA 3OZCA 1J97A 2QVYX 2ZIVB 1KE2A 2F00A 2VF4X 4GMXA 3UKDA 2YZMA 2ZSDA 2XH8A 2C3PA 3GBSA 5ICCA 2DH6A 2N42A 3QVSA 2LWIA 3R09A 3ZLJA 2P9QA 4BV8A 3OO1A 4B3MB 5IH3A 1K2WA 1K0FA 4G0XA 3TBHA 5IFKA 4GE0A 5HG0A 2EG5A 4BZWA 3EZNA 2NTYC 3IV6A 4R2JA 2G72A 4WLFA 1GPH1 1J2TA 5EKSA 3S44A 1PNTA 3G82C 1EQAA 2BDEA 1A1SA 1D2EA 1NI4A 2VNSA 4GPIB 2BFBA 3WKDA 2CV0A 2HSGA 1S8AA 1PJ2A 2NXJA 1TVMA 1E9BA 2XMGA 4C0LA 4YAWA 3OZFA 3PRJA 1D2MA 4X6LA 3UK1A 2C99A 3LDAA 5CJJA 3T7EA 5AW4A 5L7WA 4WK2B 1LTKA 3M1LA 1S9DA 5LA6B 8MHTA 3O8DA 4ZI2A 4DHWA 1QYXA 3NNSA 4KE7A 4Q93A 4QUAA 4MLZA 3FZYA 3BBLA 2NU8A 4M9UA 1C9YA 5DYNA 1QH0A 2C98A 1OROA 3L0CA 4P36A 1ZKDA 4D0SA 1T8TA 3ZJTA 4AI6A 1HT0A 2QVBA 4XQEA 4TSFA 4PTLA 5KZMB 3IKMB 3DO5A 3GLTA 2NZWA 4KCGA 1PFWA 2R8RA 1KSGA 4DE5A 3OQIA 4Y6OA 1MJHA 4G0ZA 1QJ4A 1HE8B 1E96A 1ORWA 1LX6A 1R8QA 2IL1A 2P2LA 3L05A 4B4DA 1EM8B 4LTMA 4BVJA 4AY5A 2P0EA 4KYUA 3ONVA 5J63A 1E6MA 2H7CA 2W2XA 1LTQA 1ZXBA 2INGX 3D3QA 5HCNA 3DAPA 1K86A 1VJGA 1E99A 2FSIA 1UBJS 4OJNA 5BNZA 3ZNOA 1YJXA 1RKBA 1Z33A 2E5FA 2WHEA 3NHLA 4WPGA 2GK4A 1YQTA 3BRWA 5DSZA 1KBZA 1XDBA 4BWFB 4GM4A 2AEMA 4YACA 4GSLA 1JQLB 1R0YA 1LRLA 3PPXA 5ALSA 1OX4A 1RQNA 5FYQA 2CXNA 3SZGA 1WB6A 4LWQA 3ZN2A 3L7BA 2Q3MA 4IIXA 2DTDA 2HO4A 5TY0A 2LNDA 1GGHA 2QW0X 1XL1A 2EKPA 2XCOA 1P2UA 3AM4A 1ZC3A 4DGSA 621PA 4PG7A 4MYRA 1YVEI 2HREA 3KDAA 2X0JA 3RIXA 2WTBA 2OR3A 4X7MA 4XDGA 1NYRA 4G26A 3H97A 4CQMA 1QGUB 4QLBA 2RC6A 2VDVE 4OQEA 3UJAA 3UK2A 4G37A 1OUMA 2BEUA 5GGXA 3SNKA 4YRIA 7ABPA 3MUOA 4BFCA 4UULA 2ZCJA 1TCCA 1D7AA 1ZP6A 2OORC 2FG5A 2WF9A 1ADBA 4J0DA 1WXWA 4U2FA 1R6BX 1J25A 1SBCA 4UDXX 5FXMA 3OQOA 4Z51A 1S7GA 1V7PC 4OCZA 2BI8A 4EJ0A 4QZVA 2GF0A 4H9GA 3NRBA 2BFFB 4B47A 4P2BA 3QKUA 3ND7A 4GRAA 1C1XB 1DIHA 2YHIA 5HS6A 4QJ5A 5CMLA 4AECA 1BQ3A 2H2HA 3OM1A 4MWCA 3CEHA 4EYEA 5TMBA 1XYYA 1GKYA 2QTMA 1GU7A 1I1NA 1O6BA 3D4IA 3O7MA 4I7EA 3ID6C 4LYDA 2VA8A 1UZUA 5JWHA 4NULA 3RVRA 3HFGA 4D9KA 1OFUX 2WJ3A 4QOIA 4LE2A 5SICE 3PFIA 3K2IA 3QGMA 3ANYB 2CLOB 2GVZC 2OBFA 2YMLA 3V48A 1FJXA 1QRSA 2MMGA 1SD2A 1SR8A 4HN9A 1CUVA 1Q12A 2FSUA 1SZPA 1ZINA 3L0PA 4FGLA 1HDIA 1GAEO 3CV3A 4PPFA 3QWAA 5K3AA 2ON6A 3WR5A 1U8YA 2R44A 4X97A 2PGOA 3AXTA 2VDQB 4NWIA 1XPRA 4QO7A 3TOZA 3BOSA 3VU8A 2F7SA 5C3MA 2WWIA 5K3FA 4UTRA 1Q50A 4Q3CA 4BO4A 4ZFNA 2VNKA 2OOKA 1MR3F 3I04M 1VGQA 3FGPA 4HAOA 3CLSD 5EZYA 1CD5A 2VK4A 4CKEA 3LPMA 2X9NA 4G2NA 3SF0A 1L4BA 3VR6H 1EFLA 3UCEA 3ORFA 5IWCA 2ZRDA 3A6ZA 2VUIB 2VT7A 3R9XB 1O95D 4NI5A 5CBPB 2BWJA 2BKLA 1L8XA 1BN6A 3ZU5A 3GJ6A 1ZL0A 5FQOA 4WXEA 2PSDA 2QOEA 3UMBA 4FILA 1N4AA 2Q99A 4N5LA 1A5BB 4N5NA 4XPIB 4UM9B 5JVDF 3JVUA 1IDN1 5HNKA 4A10A 3NXSA 3P1JA 4G07A 1AURA 3PPIA 5JJ5A 2P6MA 1PR1A 4M4SA 2B82A 4YRMA 1HA3A 1IWPB 2QN1A 3PV0A 4AKGA 2VYND 4V0ME 1MOSA 3DDUA 2O2EA 4TKUA 1E1NA 5ULLA 5B12A 5B55A 5J3JA 3NP9A 1OHHD 2A9RA 5K0NA 3ZKWB 1FS6A 2BZSA 1P2SA 3LS2A 3HO6A 2G1UA 1K5GA 4JI7B 3HUEA 3QSGA 3TTTA 4BWYA 1OZFA 1M2HA 3PA6A 4LDQA 4QM7A 3MFYA 2Z04A 1KI7A 3DYVA 1ULAA 2I80A 2IXBA 3W4IA 5DNCA 2YQ4A 3JQ8A 4QJ4A 2HFKA 3II6X 4FJ2A 4G5QA 2FWIA 1UBCA 2WQZA 4UM8B 2WWFA 3I5MA 4TS3A 3PI6A 1DG3A 4DLLA 2DY0A 1AE1A 4D9EA 1F14A 5P8WA 4EHAA 2JK1A 1DJNA 5KI6A 2ZR7A 4M8SA 1RXIA 4L72A 1F2UB 3IEKA 2B1IA 2CHFA 3OOEA 4DFDA 4GKBA 2FTKE 1JQBA 2EZUA 1UDAA 2TMDA 1PFVA 2X40A 4WVLA 5HIMA 5C7YA 2JCYA 5J2TF 3SHFA 4Y6LA 1AUXA 1I14A 1PHRA 1V9LA 2QYTA 4W5HA 1T36B 3F6CA 1Z6GA 2XB9A 4YJ2F 4GIBA 1GR0A 4JYZA 2BE7A 4JQSA 1HV8A 1ZI6A 3FI0A 3FNQA 1XRJA 1U1EA 3LUCA 3DQQA 4DWWA 2P6NA 2W2MA 4Y2QA 4KQ2A 5AXBA 3FNEA 3N2YA 2ZYIA 5BSTA 1J21A 4NCBA 5TSDA 1EH5A 3GIWA 4KPFC 3EDMA 3MTDA 1SK8A 4WXPA 5CT8A 3ROFA 1UM9B 3IP3A 1ZL2A 2W43A 1SC6A 3LLSA 4QBTA 3ST7A 4CV0A 2GJSA 2PNFA 3GVHA 3T6KA 1UBRS 4EUFA 3FYUB 1RAFA 2VNIA 2ZI4A 4LXUA 3BJMA 4XAQA 2V9PA 3PHJA 4NQRA 3A4MA 3NVAA 2LP4Y 1OE0A 3FKSA 3Q7RA 3BN3A 3GFFA 5REQA 2O8BB 2G9RA 2HQSA 2NO0A 1EFKA 1T5BA 3IELA 4NCHA 4F4DA 3GUYA 1XMIA 2FMIA 3FYTA 3AUFA 1XMJA 2NUAA 1QH8A 2R66A 5LU8A 3L4SO 4NMHA 3VI4B 1UC9A 3RHZA 3HDGA 1QYWA 2QRVA 3JVVA 2WF6A 3KQVA 4ZCTA 4M60A 2C8LA 2HTEA 3AGPA 3RYHA 3O4HA 5CDSA 2B34A 3EHEA 1FDIA 3WLJA 2RH9B 1LLDA 2FGKA 1SU4A 5DHPA 3SVLA 4LC1A 1ZSVA 1TM3E 1YI8A 2C4KA 3BILA 4AJJA 2BKEA 4D4IA 4BQEA 1TYZA 3S7TA 4ESHA 4V39A 2ZRLA 5CYPA 2DZDA 2QJRA 3W6PA 1PP4A 5BQXA 4BQOA 2ZT6A 3P2EA 4LNUB 3ADOA 4LY9A 1XAGA 4BX2A 4MVJG 1W8DA 4LS3A 3N58A 1OU4A 1ZGGA 2P91A 4GI1A 3G0HA 2O8DA 1YU6A 3HQ4O 1FP2A 2DJ5A 5CAEB 1FJHA 3AM1A 2UAGA 3OT4A 1N1MA 1CULC 2QX6A 3NW9A 3IQWA 1WHSB 3OJEA 4RE5A 4QJIA 1NBIA 4EUKA 2Z8XA 1NVVQ 3EGEA 4LZAA 2XMSA 2G6BA 3PHLA 4FDAA 3BB1A 4S12A 5EJMA 3VX3A 1UMKA 4CLRA 1ZA2A 4HYYA 3QU9A 2ACEA 1PHPA 4ZN6A 3FVVA 4RDXA 4DIOA 3HG7A 4UDYX 2BGWA 1KVUA 3GA5A 3OURA 4MW7A 2F1IA 2N1MA 2X15A 4PAGA 2RGEA 2SCUB 3HP4A 2BRUA 4KKVA 4MV9A 4Y1EA 2WF5A 6CHYA 1AK1A 1JDJA 3ZHQA 1RLMA 3OVMA 2P11A 1L4GA 4XX0A 3DFMA 2DUNA 1FBNA 1YB6A 2DQYA 3MTEA 2VJNA 3G0CA 4I9NA 1E2FA 4LHWA 4TTRA 3DT9A 4WLVA 1BVYF 5AK6A 3C7KA 4DAEA 5LZ9A 1X0XA 3JTEA 3JQEA 4UD2A 3L4KA 3DR3A 2ROQA 2C95A 2GN6A 3TLGB 3OD5A 1MRSA 1FXWA 3E18A 3I4LA 3I32A 3MMXA 3O74A 4U9IS 1U28A 3EDYA 1W4ZA 2X8JB 1VB5A 3JSAA 4AJEA 4D74A 1KEKA 4B7XA 3D1VA 3UBTA 2ZANA 1JKMA 2GK3A 2YJNA 4M99A 1KEZA 2DR0A 3GFSA 5MHTA 4JH0A 1G8MA 2BEKA 2XAUA 1X7ZB 4IVRA 2W4QA 1P0IA 1JIVA 1ZVKA 2ZKIA 1A8PA 1E5QA 2SCUA 2AZ4A 3FGZA 3P96A 5EFZA 1LJLA 1UMBA 3EARA 3TUJC 2IOFA 1J90A 5LDHA 1WP9A 1ZMTA 3PZRA 2GYYA 3RSQA 4L5YA 1RQXA 2KBFA 4YYZA 1C29B 1I2BA 2FN7A 2C0CA 4J43A 3C3MA 3QXXA 2IA5A 1ONNA 3AETB 4TYPA 4ND8A 4GO1A 4F8YA 3ZDCA 2QUIA 1Y5LA 4MKGA 2NP7A 3F98A 3I2JA 2C59A 2HPZA 1YVRA 3NIWA 2PX0A 5AI4A 5L3QB 3NHMA 2OAP1 3JQFC 4R8KA 3WKEA 1JJIA 2D1RA 1D07A 1IMJA 2M1XA 4EJFA 4L73A 4U5QA 1BJRE 2HM7A 3SGLA 2R4TA 3UB2A 1DUVG 3CEJA 1F8UA 2PPLA 3EGCA 3WHPA 4K9MA 1SD1A 1XMOB 1S02A 1JDBB 2W98A 4R6WA 3U81A 3NHYA 4ER0A 5IRCD 1HFJA 4JLWA 4GS5A 2DH5A 4C7MA 3RF6A 2DWQA 1DUSA 2V7UA 1D0SA 1DHRA 3DPSA 2VNHA 3K0FB 2VYVA 1EI9A 2V7QA 4B8WA 1MFPA 4X64B 2XY4A 1XXHE 2B35A 4Y1FA 4JBXA 4X66B 3GLGA 3MEQA 1JHZA 3G2MA 4FIZA 1W4LA 4QLAA 1IH8A 1Z4KA 3IJEB 4INAA 4IR7A 2G76A 5AJXA 3TSYA 4LC9A 4RSRA 2LKCA 4YUWA 2WNSA 3KK0A 3R20A 3AIOA 1M8GA 2ATIA 4FSHA 5FNVB 1GGNA 2VYNA 1X7DA 4DC1A 2GT1A 2IS6A 1WCV1 1KGDA 1PJQA 4MUMA 4ND3A 1EHIA 4W5JA 3BC1A 4YP1A 1GDTA 1C1HA 4NEHB 3THWA 5DX8A 1W75A 1YV9A 4HFNA 2PZ8A 1Y1QA 3DM5A 3SJCA 1KDTA 2BJWA 4JJ6A 4BTLA 5BYAA 1PJTA 4FYVA 2CLKB 4JIMA 2A56A 2Z3ZA 2ODPA 2QRJA 4AO8A 3EPLA 3D4NA 2WWGA 2IH5A 2XRYA 3VZQA 4LNHA 5IKXA 3U16A 2WHQA 1U6KA 1PJ3A 5HRUA 1Z08A 2JARA 2FW6A 4Q47A 1NI5A 1W0KD 4QNRA 3L8HA 4C22A 3N2GA 1EAMA 2XYPA 1SVLA 4ZAFA 4ER3A 1UM9A 1Z8FA 2C58A 2WABA 4CM3A 5T7BA 1HDZA 1U3CA 4RZUA 3WLAA 3JQ9C 3MJVA 3S4YA 3I92A 1X19A 5HTKA 4HNRA 5IEJA 1HQKA 1PNVA 3SI7A 3GDGA 4OYLA 2CVPA 4Z3OA 3IEIA 1B6RA 1H6DA 3DWFA 4PW0A 4TS9A 3UC5A 3N8HA 2WKQA 4Q1CA 2P8JA 1CW2B 5CH3A 2SICE 2YMMA 5IVHA 3ICPA 1NJ5A 1I10A 4M0KA 1SVSA 1NFRA 4QODA 6AT1A 5DGXA 1FDVA 1DCTA 3ORYA 1DVRA 1K88A 3PQ5A 5NLLA 4A03A 1X7GA 3D2LA 2C7QA 5EESA 4KOEC 3UAZA 3SQOA 3MOSA 3HBNA 1C7EA 1QSGA 2BC9A 2ZS8A 3KQMA 1IM5A 2RAPA 2ZIFA 4RGYA 3HDYA 3K0BA 5DGIA 1H4SA 1P74A 4BNLA 5BSWA 1JFVA 4I5IA 3N7TA 3U7HB 3H1GA 3H8WA 1QOQB 2PQ6A 2EFDB 1PQWA 1XN1A 1V1MA 3L3BA 4RBNA 1QS0A 2D3WA 3BMQB 4FEAA 3QNUA 3A4LA 3D64A 4V2IA 4ZVLA 5I9IA 2D2FA 5G53C 4ACAA 2O59A 2VDMB 4H1HA 5LQKA 1SWWA 5ECDA 1XFDA 2XB4A 2ZRPA 4NQZA 4MA0A 3WLLA 1GN9A 1QIMA 2WM2A 4XLZA 3RDPA 4PG8A 5CFRA 2FP3A 2EIHA 3LLMA 3COVA 1QF9A 2CVFA 5FPSA 1D6JA 4OA5A 3SFTA 3WWOA 3ZWQA 4A7PA 4MI9A 1PK7A 2WM9B 4JJ7A 1ODCA 4QQRA 1T2DA 4DR7B 4YASA 3IMFA 2QLFA 5ECYA 5E0KB 5EKXA 1O6CA 3QMVA 4IZOA 4QEDA 4DPLA 2QVGA 2FLKA 2HBQA 4P7KA 5CD9A 1XXLA 1OLSA 2RGYA 1KI3A 2G82A 1KP2A 4TXMA 1YQXA 2ZAOA 3FOCA 1VPLA 1ZJ6A 2O19A 4V0KA 1IPHA 4NV3A 3VNRA 4Q4AB 3GJXC 1RWXA 2YNMA 1VBMA 2Q9UA 3VR3D 3PT9A 3SN6A 4Y2SA 1Q2XA 2KX7A 3NO4A 3QQPA 3C5WP 1EFVA 2BL4A 2IPXA 2W6JA 2NU6B 4FFWA 4ZI5A 5BWLA 3HRKA 2WLSA 4RYDA 5J5AA 3RT9A 2QLLA 4C6TB 1G4AE 2QP4A 3O8LA 4IL5A 4GPBA 3CSSA 3JAMA 2GEDA 2BCJQ 1FB5A 2WF8A 4DSTA 1GT6A 1NW4A 3HJNA 1NRWA 5C4MA 1JQ3A 1KMHA 1QVZA 3GNLA 4AX4A 5U9CA 3EA5A 3NDPA 4JB0A 2IEIA 3PC4A 1VXOA 4K6CA 4YAFA 4R2HA 1P7CA 1UK8A 2NUPA 3LY5A 4C0QC 3Q2OA 4EFKA 1MUUA 3QBEA 4ITRC 3TNJA 1C7IA 4JR2A 3LO8A 4NDAA 1BCRB 4B2IA 2UUCB 3KYCA 3IBCA 1KQFA 4R8LA 2ZJ2A 3E22A 5LSAA 4HF7A 1N8TA 4HB2A 1JMKC 4QQ8A 5BN4A 4ZICA 1YBAA 3ZJUA 3I0MA 4RFVA 4G86A 5IVPA 3LZDA 4K46A 1J70A 3G8AA 4ZYLA 2VBIA 1JLSA 2ACWA 2O1XA 3ITEA 5KC9A 2JLXA 4ML3A 1HZZC 3O0DA 2CSUA 5A4KA 4CDRA 2QIOA 1GEEA 2VBFA 1GL3A 1EB9A 4P83A 1FTNA 2R11A 3ZDZB 4LOAA 4F5DA 4CGZA 2YL2A 2O2YA 3QX3A 2CL6X 1R88A 4NE2A 2IY7A 2XCRB 4M0CA 3TXAA 4MYHA 4ALMA 1NJFA 4XW2A 2XOXA 4RTNA 2G4VA 2JJ2A 3CLVA 1G2OA 5JUWA 1CERA 3ENWA 2AOWA 1Z2NX 3F5DA 4EJ6A 3HB7A 4INJA 2CHGA 4W1RA 2HRRA 2Q6OA 1HUQA 2RIPA 3OAAD 4AJPA 1Z6QA 4L8LA 4J2HA 3C8HA 3K5WA 3QOXA 2FSSA 4W6QA 4AB1A 1ARZA 4LGCA 4NBTA 2HJGA 1JV2B 1OLOA 2KJQA 3L79A 3NBMA 4WECA 4P7BA 4B84A 4P35A 4C0XA 1T6ZA 3R3JA 4FE7A 3VPSA 1U5AA 1Z2CA 2XVZA 2BGRA 4NK5A 5LWQA 3NOOA 4OOEA 4EHJA 1JKFA 2RMKA 3C4JA 3TX2A 2IXDA 2B98A 4YT2A 3KLBA 1UK7A 1HL7A 2OB2A 3F8SA 1SEVA 3L2OB 2P6PA 4MQEB 3V7FA 2GRJA 2G88A 4MKIA 1K3FA 4YJFB 1OI2A 1UBHS 3N70A 5EUBA 1XZDA 3T7JA 4DSUA 1WQ4A 1TEVA 3OZEA 2F9FA 1J8YF 3M6AA 4BNKA 1O97C 5BW0B 2FNAA 2KW5A 1TJ5A 5AVKA 5JSYA 4JB3A 4EL0A 2F8LA 3I28A 4ZIRB 4YGYA 1CHDA 4WJKB 4OP2A 3ZY5A 1WY5A 2JAWA 1LPBB 3IBSA 4FSXA 4ZCRA 3U26A 4WGFA 2J9XB 3O95A 5ESRA 3B85A 4LXQA 2YZKA 4GI5A 5AKXA 3IEVA 2CK3D 4JCCA 1UADA 5FPQA 1XQ9A 4F2WA 3JQGB 4MMXB 1QG4A 1SBYA 2OTCA 4ENSA 1OGJA 2NSLA 4HN2A 1VI2A 2AYYA 3V4RA 4GW3A 3RAFC 1JWAB 3FB4A 3QVOA 3T7CA 4DB2A 4WEQA 4KN6A 2A9PA 1VXRA 2LE0A 2VHZA 3CPJB 3CUTA 4K5QA 4MA5A 1WMSA 2HU7A 2VJKA 3H9GA 4F21A 1SM4A 1YUMA 1ZQ9A 2HIHA 2WJWA 3I8XA 3SC3A 3ZWCA 5KWJA 4HNTA 3GLHE 3GCDA 4ACBA 3O73A 2YWHA 4TWRA 3R5XA 3BGIA 4HC4A 2QX4A 3I1IA 5IZCC 2GXAA 1ZUHA 1ULTA 2QNRA 4WCDA 2IIVA 2Z1MA 1LK0A 3AKEA 3AP1A 1U8ZA 1AGYA 3N75A 4I50F 3ZU2A 5L3VA 1SU6A 3QMMA 4GX1A 3NH9A 1SCUB 4FSDA 4IIBA 2A1TS 2OV3A 4P82A 2JCXA 2NU7A 5K0TA 3OKCA 5HKKD 1UZNA 4QJBA 2BBTA 4CL3A 4DMHA 1DTWB 2EX4A 2EG9A 1IIRA 1A5SB 2ZRIA 2OMKA 3INNA 3LXRA 2PXCA 1Y6RA 2PBZA 4O4LB 3BMOB 2VEDA 3SYLA 5BN3B 2JS7A 1TECE 1AF4A 3FSRA 3RYIB 1A8QA 1KDRA 5DF1A 4FS3A 2HXYA 4O4IF 3O8QA 2FUNB 3GAFA 1DKQA 5D3KA 2YJGA 4EUNA 3R9XA 1KK1A 1W73A 1AU9A 3SC2B 1UJ4A 2XMBA 2WK1A 4ODIA 1XMXA 2JJQA 1VJRA 3KXIA 3EH2A 4RLQA 2QTLA 5FL7D 2FKNA 2BIFA 1RRVA 4LY0A 2OC9A 3KAKA 2PS9A 5HZKA 2QTNA 4D4HA 1UC4B 3JAWA 1R0LA 3LUDA 1E7WA 1L7XA 3MT9A 4A27A 3PUYA 2X5XA 1MO3A 1I6MA 4LDPA 1TX4B 4GOMD 4YH1A 4URUR 5KTPA 4P0TA 3KG2A 3KJEA 2H2AA 3U44A 4TRNA 1QFYA 4A4DA 4LQLA 4RHFA 2WWYA 1PQYA 1CYDA 4OTZA 1B16A 2IYTA 2DCMA 1OFTA 1KAMA 1KSHA 2Q0SA 1M1XB 1E9RA 1NVVR 5IP5A 5TPWB 5AW9A 3SVTA 3E3OA 2IUTA 1E1LA 3I9NA 2QD2A 4QBKA 5FLEX 4Q05A 3RANA 2ZWVA 3FWKA 1BC5A 4ZK6A 2VYQA 3ISTA 1RQPA 1TFRA 2Y0CA 4Q18A 4EZEA 3SQDA 2ZZKA 3PQ8A 4M87A 1VA4A 2YXEA 4Z9YA 2QMUA 2D0DA 2YR0A 4EQ6B 3BWEA 2RGDA 3HR4A 4CMEA 1C3JA 3IT3A 5JDCA 1Y8CA 2VUTA 3MRVA 4X62B 1F2UA 4FYXA 1J56A 3WL7A 3ZJVA 1NV8A 2Q6TA 3SYNA 4CL8A 1FNBA 3PKZA 2YZ2A 5IXJA 2DRIA 4HP8A 2O3RA 5TGTA 1NF3A 4O29A 2V4MA 4A5SA 3UJPA 3U7QB 4XX1A 1MV5A 2WYOA 5K3EA 4QA9A 4RA6B 4R84A 3J7TA 3DO8A 4XOIA 3ZR4B 3V7UA 5A04A 2JBAB 3H2JA 4YAOA 2IXTA 3SLRA 5GVSA 4W1SA 2B5VA 5H80A 1QYIA 1B00A 3EQ8A 4O4HB 3GXBA 3CZ9A 3VYVA 1JLRA 3H5VA 4IAOA 4GKKB 3RFCA 1Q95A 2WNIA 3PTLA 2DQZA 5AK0A 3X43A 1UC5B 3EEIA 5H3LA 8ADHA 5G3YA 3ZE1B 4ZCMA 5L4LA 1XHLA 2C9MA 3G2QA 1U4OA 3EF3A 5ICFA 4BYGA 1W52X 4Z2YA 3KSBC 5HM8A 2JIRA 2RC5A 5BQFA 1U2ZA 3NJ4A 2R9VA 1A50B 1YCHA 2C4MA 3S1SA 1DC7A 4AZ0A 4GYKA 3A3OA 3WRYC 3O2QB 2AJBA 5BSFA 4KAXA 2IIPA 4G5HA 4X63A 3E1SA 2IXFA 1BHJA 3SMVA 2C4TA 3ANXA 4D1YA 4DA4A 2M6RA 3NC1C 3TCXB 2ECKA 3DOJA 2ECOA 4RNDB 1SUDA 1VYTA 3GJ8A 3H75A 3R41A 4RJIA 4WOCA 1BMDA 1U2GC 4I2NA 3VYTB 4AJOA 3HH8A 2GH1A 3JY6A 3A9VA 3KFXA 2R6R1 2F8SA 1EZZA 2NPOA 5HQ3A 4DDVA 4X65B 3I09A 3JZDA 1OQAA 3MJTA 3VGPA 1GKKA 5EMMA 5LOVB 4XASA 1ICIA 3GEGA 3RS2A 3S40A 1PGOA 1HDOA 3ZWDA 3PNKA 1FX1A 2G83A 2UUOA 4HDCA 4RY9A 1TNDA 2OO7A 3N8NA 3RVJA 4DCNA 3Q5DA 2F67A 3EASA 2DR2A 3DZCA 4BVLA 4PRZA 5C8VA 4TRMA 2PX6A 3NBKA 3KL2A 1KEEB 2Q7XA 4XM0A 1H2RS 5FTJA 3QVGB 5FI5A 5L40A 1PZGA 4NBUA 3RS5A 3GDWA 5AFSA 3U19A 1HNWB 1WDLA 2PGNA 4UBMA 4B81A 3HEBA 4MQFB 1ZM7A 4FHEA 5FOUA 5JSFA 2Z5GA 1YS7A 1XKXA 1G20B 4R8SA 5JJKA 3T1QA 1WXXA 1E2IA 5ES4B 3ASUA 5CFZA 3IVXA 5AM0A 4GPTA 3WFZA 1JEYB 3OFSA 1EVIA 2PSHA 4F9TA 4HGYA 2PPVA 2QK4A 3F49S 3JARB 1C8BA 2C1ZA 4PAWA 1Y7HA 3LVRE 4DR5B 3FPCA 1VRCA 3HKDB 4GZ6A 3VR2A 1K7SN 1WB4A 4F6RB 1FFEA 3NUGA 4L2IB 4R5HA 5DN9A 2A3RA 4O4LA 2PU7A 2IITA 3C97A 3N39C 3L01A 4P98A 5AD1A 2IU0A 1SRQA 2HO5A 1NJ2A 2HWKA 1JSCA 2Y4NA 4XIIA 2BKXA 2Y0EA 3K5IA 1ULSA 1Y48E 2GWHA 1T35A 1SOUA 3CH7A 4XTCS 4RJTA 1EG2A 1U7ZA 5D85A 3KQWA 5BN1A 3E9RA 3SJAA 4F3CA 1UFRA 2GD6A 5GP1A 2OYSA 5CDTA 2MWMA 1U9IA 1Z22A 1EVKA 5F1PA 3R0QA 1OXXK 5JAQA 3UW1A 4YR7A 1CF2O 4Z4IA 1K9SA 1XQ6A 1DRUA 2Y27A 3IULA 2OV2A 2OBLA 1W25A 4YGXB 4AD8A 3MGBA 2JPDA 4RQBA 4WY8A 1MT3A 2G2SA 3C6XA 3EDQA 2IOYA 3P19A 1QZTA 1TIBA 3OQMA 1GVNB 1R5JA 1YULA 4L50A 4I1SA 1BOFA 1TKAA 3EC2A 2IEZA 1E3WA 4XSVA 3SHQA 4B6PA 2OGFA 2P30A 3Q3IA 4CIBA 3T1YB 1XNQB 2O2HA 3COZA 2CLFB 2B99A 1DT3A 5EPOA 5BW4A 2NO5A 1DT5A 4BO8A 1PFKA 2Y1XA 4QGSA 1TZKA 2RE8A 1XKQA 1EX6A 1NZJA 1VC2A 3P4XA 5ALOA 5FEMA 2CDBA 1HG0A 2E21A 4TRJA 3VSCA 4NP6A 4S1NA 4X94A 5EC8A 3RIYA 3ZZTA 1EK5A 2H31A 2QTZA 3WIUA 2FHPA 3QV2A 3KSZO 2O8EB 4B73A 1BN7A 5I4CA 1JR4A 4CCSA 4HWOA 3OIGA 4K28A 2NVBA 1K7EB 2EW1A 3H5LA 2VHVA 2FRDA 5KOHB 1IRXA 1EA5A 4EITA 3MFQA 4A8PA 4KLRA 2JD1A 3PB3A 1L7EA 4KIWA 2RGNA 2J9FA 2Y1WA 4ZT2A 3V4LA 1G8GA 2VHJA 1WW3A 1FIUA 8GPBA 4QHYA 2D0IA 5INTA 5HRCA 1QO0A 4M9CA 3QELB 4L57A 1VKJA 3BTVA 3VPFA 4INOA 2P0YA 3RRMA 4OH1A 1T26A 2RHTA 2VZLA 3ORSA 4XJVA 3ZXSA 2XKKA 2RG1A 1FP4B 3M33A 1CQZA 1Z6YA 4ABYA 2BHRA 4W5OA 3FKJA 4CBVA 5F5NA 1JDBC 1CZNA 2RAVA 1DGQA 1DIOB 5F9FA 4ZU1X 4C01A 2XTZA 2WJ4A 2XDYA 3DD1A 1Y5MA 4TV9F 5BMVB 1M33A 5DEIA 2HJSA 2X8BA 1PGPA 4HD8A 3S2YA 3SS8A 3KOUA 5I8WA 1Y1RA 5FOXA 1EUDB 2BR4A 3C3DA 3WGTA 3HKDA 1R6DA 4M0FA 1TEXA 1KVSA 5EJ8A 3K1TA 3HBJA 1UPCA 4FKZA 2ILTA 4RLFA 4GF5A 4FJ0A 2FPPA 3JARA 4MKZA 3S29A 3OTIA 3BWBA 1L5OA 1P39A 5G0SA 1KNXA 3W5JA 5ESWA 3HRIA 3CBGA 4LOIA 4BKOA 3CMMA 1DMSA 1LUAA 2R8OA 3E5RA 3OP1A 3SJBA 3V33A 5KX5A 1O2DA 1GDDA 3UT6A 1QIKA 3EVBA 2WTAA 4MQBA 4PZLA 3WLIA 5EJFA 1NDHA 1V1MB 1OI4A 3IVAA 4ND7A 4OYYA 1N2XA 4RY2A 3RUFA 1M7HA 1NLZA 3EG5A 4PYMA 3KYJB 2UXBB 3TVYA 3UYLA 4YLYA 1G20E 1X2BA 2GERA 3SHTA 4LKOA 3OEHD 4MJ7A 4S3MA 1B3RA 3OI7A 5DX1A 5ALGA 1N75A 5B3KA 1T5DX 2WZDA 2QMYA 1U0RA 3O75A 2IYLD 1JEDA 2WJGA 2XCQA 3N8DA 4JLAA 1NP6A 2Q1WA 2WUEA 3HBLA 1NLYA 3W2HA 4IH4A 4HH1A 4WZBE 1WMFA 1PG5A 3VZBA 2ID9A 5TC4A 2X0RA 1QE0A 4JU9A 5B7NA 1WLSA 1EE9A 1HE5A 3H3FA 4RF3A 1B2LA 1K8QA 3F90A 3ZCXA 3KKQA 3FAZA 2CJWA 2WT9A 5JMTA 3LNTA 3PDUA 1HLGA 4E21A 1W85B 4BL5A 4BMPB 4JYMA 3KVVA 1Y98A 5AUNB 1YJCA 1WETA 4B31A 2P6RA 3OLZA 4GXRA 3DF9A 4Q4AA 1HDYA 3B5JA 3GRVA 5DLPA 3TEFA 3U9SA 3M83A 1GNTA 5IT9A 1DCMA 1EUCA 1GZ4A 5ICSA 1DLIA 5T4HA 4KHPB 3IOEA 3AR5A 3IR7A 1I8TA 4NBRA 2PGLA 2CXHA 2QN7A 1NVBA 4GOXA 3OM0A 4MUXA 1IY8A 3O92A 3NB0A 4LG1A 2IIQA 4XQ0A 3FIUA 5H4HA 2YZGA 3JQDA 1C3XA 1P0MA 1WCXA 4IDEA 2Q28A 4BE9A 1CRPA 1XRQA 2WJJA 2P35A 4CDMA 1EAYA 5BOSA 4RX1A 3UUGA 1OBFO 5JATA 4DIEA 2IELA 4JY7A 4X1OA 2JI7A 1ZPDA 3CLRC 3PFFA 4F3YA 3VYRB 2HK7A 2HXGA 2RDMA 3W5AA 2XBMA 3SBOA 5KVCA 1FFCA 5FAKA 5L3SA 2XD9A 1FYWA 3A6JA 3WBKA 2A67A 3C0KA 2CLSA 3REOA 3HZRA 1LRJA 3RTBA 3KOWA 2PGXA 3JYOA 2AZTA 4X7PA 4MZDA 1KKUA 1E6KA 2IHJA 4YIHA 2FN4A 4J9VA 4JLOA 4AUMA 1VPDA 4UOZA 1CF9A 3E3LA 4H1UA 1GPYA 4LFAB 1WQ1R 2ZWPA 2ZYHA 3U3KA 4DV7B 3I9MA 5K0EA 2O2JA 3NAZA 2H2GA 4ZCQA 1LK7A 4PZAA 1K27A 4D9NA 2YQZA 3W5DA 3EPRA 4X93A 2WR8A 4PFKA 1XJWA 3TR6A 3WMEA 4A8TA 4EJ2A 3EW9A 5AOAA 2QGFA 1EQUA 3D81A 5EUQB 4ZV4A 3DTNA 4IV0A 3O4GA 1UC8A 1EMDA 4IYJA 3HR8A 5C46F 2EEPA 1AB5A 1ADCA 1U80A 3V4VB 5I7RA 1EWQA 1M67A 1YRBA 3LPAA 3OAAA 2J9ZB 2PGAA 1JDVA 3P94A 4O4IB 5JMOA 1PR2A 1JP7A 3VYUB 3DVQX 3K9HA 4ZRMA 3M6MD 2HOQA 1OB5A 4ALLA 2RD2A 1O87A 2WG2A 1EUQA 4UATA 1JLHA 2PMCA 1EZ1A 1T2UA 2DE0X 1OREA 2RGWA 5EE5B 3ZQUA 2LR0A 1PN3A 2VAXA 4EGCB 3KALA 4BFYA 2TMKA 3COWA 1PWXA 1Q20A 1ZITA 1QH1A 1KP3A 1UXKA 3FOBA 4PLPA 4F72A 4PPYA 2YFQA 4OBWA 1F9EA 3WXMA 5AJTA 4EABA 1MX3A 1JH9A 2XR1A 1KY2A 3THWB 2JZCA 1Q0TA 4QPJC 3WZMA 5AW8A 3FUXA 4NE9A 2I4RA 3QBDA 1NASA 1AKYA 2GJ4A 2Z8YM 3AOEC 5EE9A 2D2VA 4QTXA 3KZVA 3DHNA 4EPXA 4OHUA 5KTOA 1M6VA 1Q0QA 1U9CA 2FEKA 5CLLA 3R7SA 3DBRB 5IN4A 5EP2A 2JGDA 3D0KA 5EWMA 2ZTSA 4TLAA 2P69A 4O1HA 3VYWA 3C8UA 3HV2A 2UZ0A 3EIEA 2IE8A 2YYYA 1R0CA 1NF8A 2QR2A 2FW7A 3ADDA 4WCVA 2N75A 3QJ5A 3LY8A 1YB4A 3PCRB 5ECGC 3LK7A 4C2BA 3ZDEA 2RHGB 3T9BA 5JC8A 5LMZA 2O8CB 2C5BA 2Q27A 3ULKA 1J5EB 2OZLA 1UBSB 3BK1A 3AF4A 4PG6A 4TV8B 4XQ9A 1OFGA 2PYZA 1IWBB 2EATA 3QIAA 2CMKA 1JIKA 4FYJA 2JBHA 5EZSA 4A9AA 1W2WB 3E9NA 4PPNA 4XJSA 3DHEA 1PEDA 1WXEA 1NU8A 3P2YA 2HSWA 1YMQA 1JHXA 1V16B 2GEVA 3COYA 1PGQA 1V95A 3CW2A 3EFOB 1RW4A 2KI5A 3JQ9A 3AY6A 2GM5A 4H16A 3UWKA 2FPGA 2X5NA 3C48A 1BFUA 1QZ3A 1TGVA 1XAHA 3MBKA 4EHHA 2GDJA 3RNLA 3ACDA 4TMKA 5I9NA 3P8ZA 1Q57A 2WVJA 2YWFA 4N03A 4R81A 4KZPA 4D96A 5K09A 3HSYA 3ZU4A 4HSGA 3J80A 2C77A 1OI3A 4XB2A 5FOWA 1NXVA 2WIAA 5IUKC 1DU4A 3B70A 3HCFA 1UKVY 2WBLC 3LHSA 4CF6A 4JVOA 5FTWA 1Z7YA 3OY7A 4HCJA 2QLTA 5FI0B 4B6OA 3DMNA 2P9BA 5CIYA 3LDUA 2I7VA 3B3QA 1WJGA 4EY5A 1ADJA 4RHYA 5AJUA 3WLTA 2QAJA 5JARA 1D4AA 4FN5A 5TS3A 5KCZA 1TIKA 4WKOA 4QEZA 4EHBA 2XUIA 1AQ6A 1JDPA 1NG1A 3OZAA 2QDXA 1MG0A 4DJEC 4UTNA 1APBA 3U4QB 1EX7A 1QC5B 5LUAA 3N0VA 1C0PA 1TO1E 3OQVA 1WSAA 3R7BA 4C0KA 2PX5A 3E9MA 2YOGA 5HYVA 5AM5A 4HQ6A 4XX0B 3L06A 4J1NA 4J16C 2C82A 5HCIA 5K3DA 4LX8A 4D8VA 3DV9A 4EHLA 3PD1A 4IP0A 1FMTA 4F4CA 4BLWA 2H9IA 2X0KA 3KXLA 1QLWA 2IHNA 4CKBB 1YU9A 2XSZA 3OEED 3W8FA 5HUQA 5JNUA 3F6RA 1K5HA 1PE0A 2H5IA 1T1EA 2JAHA 4GMHA 2J1LA 4UFNA 3RFVA 5HQ3B 4NAHA 4LMPA 4O33A 4UHKA 4QTTB 1T4DA 2WE8A 2HCJB 2GETA 3L7MA 1HI9A 3OF5A 5IXYA 1TQ8A 2SKEA 3LT0A 1L1QA 2BT4A 2C96A 2C5EA 2EL9A 1EJ6A 2HCBA 2Y1GA 5LQSA 3S5UA 3EOBI 4DMMA 5LZ4A 3BORA 5E9AA 5SYAA 2BGUA 4KRXA 4LJYA 3FHJA 4Q3NA 2BKVA 3NJRA 4TL8A 2GBIA 3U1VA 2IS2A 1BXGB 1T6BY 3C7AA 3D3NA 1RAHA 1XO1A 1ZK4A 2WM3A 4FQ8A 3NGMA 1WZNA 3JYLA 2GASA 2PM8A 4OAQA 4PVDA 2Q7OE 3T1VA 3P7MA 1QGAA 2Q6IA 3BF7A 3CX3A 4HWRA 1I32A 3G0OA 1H9AA 1RXVA 1GNQA 2E18A 4XWWA 4L3WA 1E9EA 1KOGA 2AEJA 1YZVA 3S8EA 3ZY6A 1PS0A 2DXIA 3WFIA 2ZOSA 1LY1A 2PMBA 2AR7A 3A14A 4F4IA 1JWBB 2YZNA 1BGVA 2OL4A 5JCJA 1JTFA 2K2WA 5DRTA 3A9SA 2M98A 4MEAA 5FUVA 4GKVA 5LMUB 3HP7A 4BVKA 3IE2A 2ZIEA 4O4HA 1CU1A 4HRAA 1GA4A 4KXXA 4MYSA 5CVTA 4ZEWA 3BCSA 1J2RA 3RVSA 3U2QA 3E22B 1II0A 1GG9A 3P0RA 5TQ0A 1XD9A 2JBAA 5B30A 5KINB 4LVNA 4ZT6A 1T2NA 3A4YA 1O9HA 2QRGA 4ZZIA 4IIGA 3STXA 3TR0A 1M2OA 1S3SA 1VRVA 1YMUA 5IC6A 4CM4B 3FYUA 4A16A 1YD7A 3S2UA 4CE6A 1A7JA 1Q11A 3DDNA 3FUCA 2HLDA 1WUHS 2HC9A 4ZMBA 3KAQA 2PS0A 1Z62A 3L8FA 4GGPA 3JZIA 5M34A 4U6QA 1BX0A 2Q9BA 1LZLA 5CBPA 1P5ZB 1ACLA 3KWFA 1VPVA 1O1YA 3SP1A 3DVRX 5J43A 3H2YA 4GR5A 4I55F 4KXYA 1JQEA 1ZAYA 1C5KA 1RBYA 3BHNA 4WGGA 4F11A 4L6AA 1N2EA 2EGHA 1WPRA 1Q2UA 1F5NA 3QVVA 4UCFA 4C0BA 4CKEB 4E2YA 4YRCA 1WQ3A 3DZKA 2ASEA 2DLDA 1TA9A 1UPAA 3KKEA 2Q46A 1NVFA 1DAFA 3LX4A 4JXKA 4BFZA 5EY5B 5AVWA 3HHPA 2O07A 1U3WA 1I7NA 4J49A 4BKQA 2CY0A 1A7AA 1TZMA 2WJZB 2RGNC 4HRYA 5BVHB 10MHA 4BN5A 1DPGA 3PK0A 3CVYA 5AI8A 1YZHA 1YZUA 3QFCA 1ZZEA 2OK7A 4JHLA 3TVDA 4CL2A 2IYXA 1UDXA 1C3EA 3U7GA 3TNFA 2J08A 2EV9A 3MELA 5BWCA 1Y8QA 3UGJA 4MXDA 5CITA 5EJ4A 3ACBA 1H8HA 3ZNQA 2A50A 2E2WA 2C9YA 1NFQA 2I2FA 1O96B 1ZUNA 3NCTA 3U7RA 4MX8A 1BX1A 1XKLA 5EEHA 1RXEA 4G5YA 2DUJA 4R2IA 3U37A 4B40A 4IIFA 2UU9B 1M73E 2C3MA 2Q1TA 1WW8A 4TKUB 2A84A 1I4LD 3JZMA 3PX3A 4I46A 1IOVA 3MTQA 1NONA 3E15A 2JIQA 3GPBA 4PZZA 2VPXA 2YWRA 2JDIA 4LNAA 4Q9DA 5DP2A 5BRJA 2PZLA 2VCYA 4GXTA 3OZ7A 1KIFA 1CC1S 4NBNA 4I6EA 4NMLA 4XFDA 5G41A 1AK2A 2D1YA 2FMHA 3QVTA 5TX7A 5GONB 3G8YA 4X0EA 1G6OA 5E6UA 1KXZA 5FF9A 2I8AA 2RGUA 2ONCA 3H9CA 3ICVA 1TT7A 4PHTA 1JPJA 3A6KA 4NIMA 4BIMA 4TTSA 1AUVA 3M1IA 4D81A 2QLMA 4XCXA 4GUAA 2C5FA 4N9QA 1RE1A 1ZBDA 3BK7A 3MMPA 3GMDA 1RQRA 4UAJA 5ALHA 3RK0A 2QZJA 3EUEA 1N36B 3PC8C 4MVYA 5ALTA 5J40A 3TLXA 4MUGA 3N9IA 1OFUA 4LPSA 1NMEA 1CUJA 2MOKA 1WEKA 1CRZA 1D09A 1NJ8A 3H42B 5BYJA 3RJ5A 2BMFA 2UVQA 3GWZA 2I3GA 2YN0A 2XNJA 4FHFA 4IQGA 1NVTA 4FFLA 1E1RD 4MHSA 1ORVA 3LPCA 4ZOLF 2YVUA 4I8XA 1TQ4A 3Q3HA 2A59A 1ZHFA 3OJLA 2JNWA 5FX2A 3N6VA 5FBLB 4UNPA 1A5ZA 5SYNA 3GVXA 1QBKC 4OSOA 3FR7A 1GPWB 4KO3S 4BKUA 1Y8RB 4HNHA 4QTYA 1QTIA 3ADCA 3AEKB 3NHKA 2H08A 4IMPA 3RUDA 1SHKA 3MK31 1NKVA 1FQOA 3RC3A 1NDUA 4ZGWA 1JKJB 2X2OA 2CEKA 1ZCFA 4L0MA 2XUQA 5E2AA 2H5EA 2LCIA 2W4IA 2VHYA 3QEAZ 2CJPA 2V3WA 3EBLA 2VK2A 4N39A 4KVZA 4QASA 3V42A 5A9SA 3T52A 2A8YA 4NPHA 4GL4A 5HR5A 4OK3A 3VDQA 4L1KA 1A8HA 5J4HA 4G5GA 2Q3FA 2VF2A 4AL4A 2Q2OA 4FE3A 3AEQA 2JFQA 4RV5A 2OGWA 2XLBA 4YQFA 2DEUA 5KJFA 5EIWA 5J59A 2X4IA 1Y7LA 2A5LA 4JKIA 3BDIA 3NH6A 4OGFA 5C35A 1Z8NA 3PNLA 1A9RA 5TS2A 1DEHA 4H35A 4ZQBA 3DOFA 4IW3B 4BVAA 3HCWA 4WN9B 1C1XA 3RKRA 2OORA 3K9LA 2B3TA 4IO0A 3ZCPA 3OTWA 3Q87B 5CH5A 1C9JA 1U7PA 5JDCC 4QAJA 4RPIA 4P33A 5GADl 4OXYA 4UXIA 3GVPA 3DEIA 5JSKA 5ELXA 1JYEA 3PEWA 4DKXA 3MBIA 2PV0A 4FGKA 1IFXA 1XJ0A 5LP6F 2QPAA 5BW8A 5JNWA 1A27A 1QWSA 2QQ5A 3BIFA 2I5PO 1T9CA 3OCZA 2PWBA 1IHUA 5E6UB 5BSUA 1UBLS 5IUJC 2AUTA 1HLPA 3E7XA 4GLJA 3DGFC 4H7DA 3S68A 4IUYA 1U0BB 3CG0A 1Y9AA 2OPBA 2C88A 4GMGA 4N3GA 5I9TA 3USZA 3ZHVA 1N78A 3B1YA 3PVCA 2G08A 2ZG6A 3HADA 1NUPA 5FI1B 5DCLA 5IBQA 4DCOA 5AH0A 4BNIA 3PCXA 2BY4A 5B4TA 3PKJA 4WFKA 3DPIA 1HE1C 2M6KA 3GPLA 4AQYB 3QXSA 4IGFA 3G17A 4ILKA 1VRWA 3UMJA 4BXOB 3I6ZA 4PYOA 4Q9HA 2C5SA 3KUDA 4LYJA 1KVRA 2YVLA 2QRVB 1J8VA 3MM4A 5I9MA 1YQUA 3OHMA 1RHQA 1TA4A 1LC3A 1NRJB 3HVJA 3D8SA 5JG7A 1G21B 4QU5A 3UAVA 2XXJA 3CZCA 2EX0A 3VH3A 1K4KA 5K2OA 3AVYA 2J31A 3QLEA 4UTXA 3TLJA 5H81A 1ZCJA 1YZQA 2DP4E 4CR6A 4R7TA 1EM8A 1UPUA 4M9ZA 3ETNA 3OF3A 2GPJA 2NQTA 2QM0A 4CR8A 2VTDA 3N87A 3OQIB 4NY1A 2HA0A 1AVTA 4HL6A 4P53A 2CKDA 3U4GA 3UJ6A 3D2BA 1IXZA 2P5UA 5CLQA 4FYYA 4H18A 5AWFC 3B1FA 4BRZA 1KVTA 3B9RA 4MV1A 1EK6A 1P62B 3WNCA 3WYNA 4E5MA 4ZQGA 3A6GA 3JR3A 2IVFA 2N3ZA 3ADKA 4MPJA 1YE8A 3GA0A 1BU8A 3RTGA 3L6BA 2DR3A 1H0KA 3IQXA 2BDTA 1LCIA 2ORYA 3MT8A 3T1HB 2Y68A 3H4IA 1LF0A 4EB8A 1JMYA 2QU8A 3EW7A 1VCIA 4MP8A 5FBQB 2BPOA 5CT5A 1JQKA 1NVKA 4L9SA 1HPLA 2IZ1A 3FSJX 1XNJA 4UUOA 4FCTA 4YUZA 2I22A 3TI9A 5LBIA 5JROA 2FSHA 4MV4A 2C1XA 3UAGA 3BJIC 1W581 4F6CA 1A2KC 4Q9KA 5JCZA 3CH4B 4DLTA 2ODQA 2XA9A 3O38A 2BGKA 1I6KA 3NTVA 3G89A 2PCLA 4FYIA 4HWSA 4TWAA 4Q9LA 5FB3A 2GI4A 3SS7X 4FDVA 3TSZA 2ZWOA 2KHZA 1SXHA 4WERA 2PNJA 4EKYA 4A2WA 5B53A 2AXEA 4MDHA 1T1JA 1LSJA 4TTVA 5KHOC 2JZNA 2XADA 1CS4C 3C1OA 3MNFA 4RL4A 2IDKA 4CTKA 4JJEA 1GIAA 3WL5A 1AHNA 2F3UA 3UFBA 6PFKA 4BXOA 4QYIA 1M76A 5EMKA 3K70C 3IBGA 1V35A 3L8GA 4Q9NA 3RSFA 4EG0A 4B5KA 3M34A 3U4DA 2XTAA 3B51X 1XZHA 4W1QA 4P3XA 2AG1A 2QZZA 2RJ3A 4M88A 1QQBA 4M0DA 2FPWA 4R3WA 4BO6A 3ELYA 1PFYA 1KOLA 4D99A 5DULA 3C3YA 3SE0A 3ZHBA 2XJ4A 5IJ9A 2IF0A 1AMOA 3SQNA 1TZ2A 1XZJA 2QXUA 3DCJA 2WU3A 4EOGA 4XJXA 3SXUA 4B6QA 4ZYWA 2BH2A 2JIZD 3PQ4A 1B93A 3CF4A 3ESXA 4G4SP 2P2SA 4WINA 3U1BA 3LX5A 3W5BA 1REQA 3GLFB 3QI7A 3UJ7A 1CX9B 3VRHA 2IV7A 3LE8A 3KWJA 4LE1A 3NHPA 3C39A 1VGVA 2XMDA 1YCGA 2BM1A 2L82A 1CUGA 2C2WA 2PWAA 1CEQA 3D7KA 3DCYA 3H7AA 4TV8A 1QHIA 5EP4A 5FUXA 5E2BA 5GIOE 1E0AA 1Y7IA 1T91A 3A28A 2YC2C 4BEVA 5B2ZA 2OQ2A 2JHAA 1E92A 5CVCA 1TAGA 4S24A 4ALIA 1E59A 2LIPA 5AMXA 1X7XA 4JJKA 3UAXA 2YVQA 5A1JA 2AC4A 3CYFA 1KU0A 1Y82A 4B43A 3ZVMA 3C43A 1GPMA 1MVLA 3ELDA 3U48A 4DIMA 2E5LB 4INPA 5KTRA 3JQGA 1XIVA 1GTSA 2PU5A 3P45A 2YRFA 4FU0A 3Q72A 3DSRA 4OY3A 3CRZA 3DBHB 2QD4A 2COEA 5JADA 3SSNA 3OLVA 4PO3X 3HFSA 1WSDA 1XCBA 1E6UA 4LXGA 4IS2A 3DR5A 3LW8A 1S7CA 2ZSEA 3LC2O 3JD4A 1OAOA 3FHLA 2NU9A 3N8KA 4NS4A 1DINA 4BECA 4DV2B 4CPDA 2FR8C 4Z5XA 1UWVA 1R4ZA 3S5JA 2VDUE 4ONEA 3TDNA 2G5PA 2Z1NA 4JUFA 2WHRA 2P2DA 4KMOA 5FWXA 3ZVRA 3V7WA 2G9VA 5LLSA 3MSXA 4XD7A 13PKA 2H59A 3OFNA 1JDZA 1VE9A 2RBEA 4P08A 5LL6P 3WIVA 5C53B 2I9KA 1OXUA 1EG7A 1G3MA 4Q37A 2H4FA 2UZAA 3CH5A 1VSUA 1U90A 1AGNA 1G3QA 3P9QA 3QG1A 3BA6A 3SIWA