1MOPA

Crystal structure of a pantothenate synthetase from m. tuberculosis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
288
structure length
288
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pantothenate synthetase
publication title Crystal Structures of a Pantothenate Synthetase from M. tuberculosis and its Complexes with Substrates and a Reaction Intermediate
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 95
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2002-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 1mopA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1mopA01
3ND5A 2CSXA 2CV1A 1J21A 4JFAA 2D54A 2D13A 4EG6A 1QRTA 1MAUA 1ZUNA 1I6LA 4U7JA 4DDMA 2YY5A 3QTTA 2ZUFA 3UC5A 1YIAA 2CYAA 1M8KA 1KKUA 4QREA 1Q11A 2DUMA 1R6UA 1IRXA 4MW1A 1I6MA 3ZJVA 1EJ2A 3LE8A 1TQ8A 4EG1A 3RK1A 2RE8A 1T6XA 3COVA 4MAFA 4OJMX 1WXEA 1QTQA 1O95D 4NZPA 4Q93A 3M5WA 4MW7A 1JZSA 3ZJUA 5K0SA 2GM3A 2CFOA 1GAXA 1WZ2A 1I2DA 4XFJA 4DE5A 3ZGZA 3OTWA 1O95C 2IELA 3TZLA 2D5BA 2CT8A 1VBNA 1EFVB 3MLBA 3NV7A 2DETA 3I05A 3D6VA 1OBHA 1MRZA 2HMAA 3F3MA 4QRDA 2DR2A 4EG4A 1TFUA 1M8JA 1NYLA 1Y42X 3DO8A 2VTBA 2V0CA 1WXFA 4DDHA 1O97D 2HZ7A 1T6ZA 1J20A 1FYDA 4WSOA 5IHXA 1F9AA 3VRHA 4ARIA 4HJXA 3IDFA 4ZT7A 2DPLA 5K0TA 4EFKA 4KKVA 4MVCA 1NUUA 3UY4A 3E27A 5LM3A 4H3SA 1WOYA 4NAHA 4CDNA 3N8HA 1MOPA 1JGTA 1NUTA 2E0IA 3FNRA 1H1TA 4QBTA 4ZCTA 4MW9A 1VBMA 1GTRA 1EFPA 3HL4A 3ND7A 3CLUD 3FI0A 1NSYA 2A4MA 2I1LA 3P0IA 5TEVA 5F23A 1N2EA 1N75A 1N2IA 2GOYA 1G8HA 3IH5A 1KQPA 2JANA 4MW4A 1T9GR 5HUJA 4EF6A 1CT9A 1OWOA 1SURA 2ZP1A 4MVYA 3ISJA 1KAQA 3CLUC 4J75A 2AKEA 3N2YA 1MJHA 2JAXA 4I6JA 4U63A 1GTSA 1OBCA 4OUDA 2CV2A 4BWVA 1MBZA 4ZT6A 3IUEA 1GZUA 1M1ZA 1V47A 3KT3A 3N05A 3RK0A 2XRZA 3SZ3A 1O5TA 5J59A 3INNA 3AKZA 1KP2A 1G8FA 3VU8A 1KR2A 1A8HA 3ELBA 2XRYA 3P0JA 1MB9A 4YP5A 1NP7A 1NUPA 2NZ2A 4GU5A 4ZT5A 5H7XA 1QU3A 3IOBA 4R2LA 1XJQA 1KQOA 2E89A 3NBAA 1O96A 1P7PA 4NAUA 4A91A 5KWVA 4CDMA 4NATA 4EG5A 2E18A 3MUEA 4K0RA 1H3FA 4MWDA 1G59A 2OV4A 1IHOA 3LCJA 3CVVA 1WJGA 1PFWA 2CYBA 3H05A 4MWBA 3H9BA 1JIKA 1IH8A 1TEZA 2BTEA 3DV2A 1M83A 1N2OA 1D2RA 1EFVA 1PG2A 2G36A 1WXIA 3IMGA 1N2JA 1J1ZA 5HG0A 1J70A 3SDBA 1XNGA 2WQ7A 1O6BA 3MXTA 3UK2A 3RJZA 2QUJA 1VBKA 4JXXA 2A1UB 1LI7A 3FWKA 2QUHA 1ILEA 1J1UA 3Q4GA 1LI5A 1N78A 4MULA 2X1MA 3ZIUA 1COZA 1JEEA 1K4KA 4YBRA 1QRUA 3HGMA 5DB4A 2A7XA 1TYDE 1JMVA 4JXZA 1VL2A 2X3FA 2RD2A 1TYCA 3P52A 4MW6A 1KORA 3SEQA 3CLSD 3H9CA 4MUJA 1R6TA 1UFVA 1G8GA 1Q77A 1EXDA 3A05A 3IUBA 1J09A 3QTBA 2QTNA 4ZT3A 3IVXA 4K03A 5H16A 1OD6A 1IFXA 1ZH6A 1GN8A 3Q10A 2OQ2A 3KFLA 4TS1A 1Q15A 4EGAA 4AQ7A 4PBTA 2AZXA 1T6YA 2QTMA 3FH0A 2IJGX 1O0BA 1KH2A 4XSVA 2J07A 2A1TS 4NX2A 3OP1A 1ZH0A 1ULHA 5TEWA 3MMXA 1WY5A 4MW2A 2C5SA 4I6EA 4L2IB 4RUKA 3G59A 5AHWA 3TQIA 1O97C 3UOWA 5KCMA 3TZEA 1K97A 3TNJA 3NBKA 2EL7A 2ZUEA 1KAMA 4ZCQA 3BL5A 4KPUA 3IOCA 1PFUA 5IJXA 4PBRA 4MW5A 2PZAA 2YXNA 3U1VA 5LFAA 2E21A 2WSIA 2PZ8A 1FFYA 2PIDA 3G6KA 4WNYA 1OWLA 4MUIA 4XFDA 1WKBA 2J09A 2EJCA 3ZJTA 1GLNA 1S4MA 5J5AA 1NUQA 4MWEA 5DK4A 4ZCSA 1R6XA 1OWPA 2IP1A 2J5BA 4PY2A 4MUHA 2H2AA 3SYTA 1O0CA 4DLPA 1MAWA 2Z09A 3JXEA 1MC1A 4MLPA 3COZA 2O8VA 2QJFA 4KR7A 4MQ6A 3C8ZA 4MWCA 1RQGA 1IQ0A 2QUKA 4G5FA 3X1KA 3FY4A 1YIDA 2QJOA 3TQOA 4MW0A 2TS1A 1U7XA 2B7LA 3FOCA 4MUKA 3AL0C 5TS2A 1QJCA 4MVWA 3KT0A 4ZT2A 3ND6A 2VTBB 2YWBA 1PFYA 2V0GA 4GRIA 4MUNA 3SP1A 1XNHA 2CYCA 3CR8A 1V8FA 3HV0A 3N9IA 1DNPA 4ND6A 5DASA 5EKDA 1O94D 3ZUGA 5FNZA 1OWNA 4S1OA 3COWA 2HGZA 4R2MA 1Q19A 1EE1A 2BYTA 1JHDA 1O94C 5KHAA 1M8PA 1EFPB 4HPWA 2PXHA 3KT6A 3PNBA 3VGJA 3ZXIA 1U3DA 2CV0A 1JECA 4DNXA 1YULA 3Q12A 1JZQA 3FHJA 4F4HA 4U8HA 4P2BA 1IQUA 4CT0A 4F3RA 1JIJA 1YUNA 3IVGA 4AS1A 3PRHA 1X6VA 1M8FA 4OUDB 1PG0A 2R5WA 3GLVA 4YMIA 3UMVA 4HJRA 4L2IA 3CA8A 4YP7A 3X1JA 1KH3A 2H29A 1NURA 4JZYA 2DXIA 3HZRA 4G6ZA 1NZJA 4PBSA 3RFFA 1EUQA 1B6TA 4DDKA 1EUYA 4ZT4A 2J08A 4HK4A 3CVYA 2PFSA 3K32A 1N3LA 3TS1A 3HMQA 4UZEA 5FO0A 1N2GA 4G5YA 1NUSA 3CLSC 1O96B 4FZJA 3MLAA 4NDAA 1N77A 1QU2A 3X1MA 1GPMA 4DJAA 1TYBE 2Z08A 4KR9A 2J4DA 3IMCA 4MUGA 3AIIA 4X0EA 4I6GA 3IVCA 1LW7A 2WQ6A 2CUZA 1WXGA 3H99A 1KQNA 3IMEA 3PXUA 1JEDA 2WB2A 4MUFA 2A86A 3S3TA 3GMIA 4EG7A 1ZJWA 2A1TR 2DEUA 1NI5A 3L92A 4MVXA 2QTRA 1N1DA 3ZXSA 1JILA 1TYAE 2QUIA 3AFHA 1OWMA 2QJTA 1WXHA 4R0NA 4YP6A 2JA2A 1PFVA 1QNFA 3P0HA 4JYZA 2DERA 2A88A 4UZFA 3GUZA 1WQ4A 3IOEA 3L93A 5TGTA 3RBAA 4ARCA 1YUMA 3IODA 2GKSA 1QQTA 1JIIA 3CVWA 4KR6A 4RPIA 1HYBA 3A2KA 4MUEA 4EG3A 5HUHA 3A4IA 3PNYA 3K9WA 3PNVA 1N2BA 1H3NA 5LLTA 1T9GS 3FETA 1X8XA 2YWCA 1K4MA 3LOQA 1VLHA 3KT8A 3A04A 3CLTD 2X1LA 5BNZA 3D6UA 2A1UA 3FIUA 3CLRD 5FO1A 1N2HA 3DPIA 1XNJA 5DEOA 4ZCPA 1WQ3A 1I6KA 3H97A 3FDXA 3CLTC 1F4LA 3AG5A 2NSYA 1KP3A 2VXOA 2A84A 3CLRC 5JBNA 2O5RA 4ND7A 3CVXA 4CQNA 1IVSA 3CVUA 4EG8A 1U0BB 4ZCRA 1F7VA 2DLCX 1MB2A 1F7UA 1H3EA 1QRSA 2AG6A 3G5AA 4E1AA 4Q16A 4KPUB 1M8GA 3ILVA 3AG6A 1YI8A 2PG3A 3QE4A 2X0KA 4J76A 3SZGA 5J58A 3RHSA 1KH1A 2Z3VA 1U3CA 1BS2A 1U7DA 3HFJA 3COYA 3FG9A 3DLAA 3SEZA 1K92A 2PZBA 1IQRA
chains in the Genus database with same CATH superfamily
3AUUA 4ZO9A 1BA3A 1TZKA 3LV8A 4N0PA 4YDHB 4MI3A 1E94E 3O0TA 4DQLA 1J2JA 2FN4A 3VO9A 1CXZA 3EDCA 4EG6A 4KVFA 3PC4A 4CNQA 3QHQA 1C0EA 1UR5A 4GOJA 4B3SB 4LHWA 3QFRA 1UBRS 3C3PA 1PFGA 2RK4A 3UC5A 5C8VA 2EFYA 5SICE 3S70A 3T5PA 2O8DB 1C7JA 1A4IA 1JWAB 2XWSA 2CEKA 4ZWNA 5H8WA 2VPIA 4W5JA 1OHHD 1U9ZA 4E3ZA 2BEVB 3BTUA 4AJ9A 1P72A 5FV4A 1LBHA 1M2EA 2VRCA 1C30A 4QBIA 2P6RA 5JSUA 2D5IA 4RJ2A 4AJOA 3LTEA 3RREA 2HCBA 3WSVA 2OZVA 4OV6B 5DF1A 2XGGA 1P9RA 3IDOA 1VCIA 1G8SA 4NJEB 1RM3A 5E1MA 3DW1X 2OFOA 3F5QA 3MMZA 3CZAA 1HQYE 3LPMA 3WIUA 3DHNA 4M0DA 1V6CA 2Q2NA 3U1TA 1ZRNA 1ORRA 2JJ2A 4LYGA 4YRJA 4ZZ3A 2JRCA 3DR5A 1HX7A 3OIUA 4YAEA 3A32A 1MQAA 3OPMA 3JALA 2HBRA 2I3DA 1RABA 4MARA 4BL5A 4P7BA 1V26A 1U3TA 2HL6A 4S1TA 5MN4A 4D42A 1HPLA 1NBIA 4ZU3A 4BQIA 1ZIDA 3LLVA 3AH8A 3WYAA 5GIOE 2JJ1D 1VBNA 2CT8A 4M1QA 3I3SR 2DHDA 4XM1A 4M0PA 5G0TA 4QPCA 4NJMB 1NUHA 2AJ8A 5L6LB 2MSNA 1MRZA 5A4JA 2QLBA 3C16C 1V45E 5L45A 2EEZA 1F0NA 3EZGA 1N6RA 1K7CA 2JLXA 2IOYA 2Q9BA 1O8BA 3CUYA 3JZAA 3CONA 4LXUA 3P32A 2HH9A 5CA1B 4OVKA 4Z4EA 1N6KA 1O97D 4WTOA 2AOUB 5HRCA 2H1VA 1T6ZA 2WSBA 1V5FA 2Y99A 2VJKA 4MQ5A 2PFGA 3HVKA 3I9V6 2FEXA 3X1WA 3VRHA 4C22A 3I23A 2QTHA 2QI9C 1T0JB 2XCUA 1NW3A 3FFXA 3V2IA 5LM3A 1L8AA 2O0HA 4RHTA 3LPDA 1OPXA 4CU2A 3W5DA 3PX2A 1HYHA 1P44A 4KSYA 5IABA 1SCUB 5ALQA 1TAQA 2QVXX 3PDUA 3OO1A 3HA5A 3GJRA 4KTVE 1QYXA 3B2EA 4QNNA 2J3IA 3WJ7A 1QGUA 5FL7D 4D8UA 3SBXA 1XZDA 3AF5A 3G13A 3GR6A 1NSYA 2GRAA 1SCIA 1XZEA 3D3KA 2HTFA 3E9MA 5IVHA 2QN8A 4UNSA 2W2QA 1NY5A 4CLOB 2PN1A 3WRXC 4A6DA 1ONPA 1KQPA 4LXIA 4RGYA 4EL0A 4R6WA 4FKZA 1LDBA 3EVNA 1CT9A 2D62A 3DEIA 1QF6A 1L5WA 1W52X 4YRDA 2AN9A 5E8JA 1JDNA 1KEWA 1T8WA 4AJIA 2JAXA 1JMKC 3OM0A 2HWXA 4EJSB 2UVDA 3GK3A 1OBCA 4X94A 3R9IA 4BHTA 4HN2A 1DRUA 3L01A 2I91A 3ZDEA 3AHDA 3AQ4A 3IUEA 3B85A 3BF7A 4GSLA 5JHGB 1SBZA 2R1UA 4WZBA 5JUWA 1VIAA 1A5SB 4V39A 4RFSA 3QG1A 4PIPA 2AF3C 1H6DA 3H5TA 4IVPA 4Z0PA 4BO9A 4L5JA 5CLLA 4ZC8A 1OX6A 5U4QA 4K2HA 2H85A 1I2BA 5DXFA 2FGKA 4QNRA 5ITWA 3C14C 2R1TB 3ASUA 1QQ5A 2QRNA 1P8AA 4QJ3A 5JAMA 2Z6UA 1CFJA 2QP9X 1PLLA 2XRYA 1WUIS 2O7VA 1P75A 1TNDA 1USKA 2P4UA 1X92A 2QRQA 2ZPUA 2ZTVA 4CQMD 4Z5XA 4D6XA 5F52A 2IYLD 2I87A 5BRAA 4OF4A 1NLZA 7REQA 1H0HA 3KK0A 1Z8NA 2NSDA 3NBAA 3OU2A 3UJNA 3K6SB 1HGXA 4FYKA 3U5ZB 2NZYA 2AUMA 4D4MA 1H4VB 1AQNA 2F9MA 1C50A 3IEMA 5KB3A 3NM5A 3THWA 1NV9A 3DULA 5L3SA 3LT5A 3R5HA 3ZCRA 2XYVA 3PYMA 1QIEA 1YB5A 1IXRC 5FNVA 1XGKA 2NUPB 1F4VA 1WJGA 3GJTA 1PFWA 2JJYA 3UW1A 4EYOA 3H9BA 3I39X 1QK3A 4RD3A 4X92A 3N75A 4BV9A 1AGRA 4P4LA 1QTRA 1M83A 1R6AA 2F67A 2P5SA 2G36A 1MFZA 4F4DA 3KWLA 3V4LA 4Q24A 5AHKA 1KOJA 1QM5A 4MR9A 3SDBA 1Z37A 2RBEA 3PXBA 1N5RA 3IPCA 3PKZA 5JAIA 1WUHS 1TUBB 1EGAA 1XMIA 1QLJA 1FQJA 3FWKA 4ZCLA 2J8ZA 4YPVA 5JCJD 2BM0A 1NSFA 3CF4A 3DVSX 2R9VA 3Q4GA 1JALA 4IFEA 1TTPB 5CXSA 5A2QA 2DHRA 4C4RA 2AXQA 5EIBC 4DLLA 1IXZA 3FNFA 2JGDB 3BJMA 3K20A 4IUBS 4WACA 3GJQA 1RHKA 5KOJB 2C95A 4RZUA 2V03A 3O8BA 4LCEA 2WMOB 2D3TA 5K0CA 4C05A 5AVRA 4HMPA 4GKAA 3OIDA 3ZCSA 2TMKA 2RSLA 3GJ5A 3PF9A 1GCAA 4KRXA 4BB5A 4BNDA 1QPZA 1KORA 2F90A 1ZOSA 1I7PA 1WLSA 3G5LA 3T95A 3UWDA 3BIXA 1E1DA 1VG8A 4G5HA 1YB7A 5BVHB 2I8LA 2OSBA 4LJ5A 1G8GA 1I10A 3B8EA 2ZR0A 1YJ8A 2B37A 3GJXC 3K2IA 2X2EA 2C2OA 1GUAA 3PX3A 5FAKA 4W9MC 1WDKA 2DPGA 3G2PA 3AUKA 5G2FA 1E64A 3QKRB 2F4NA 1I3NA 4I81A 5JVDB 2QTWB 3A70A 3T06B 4YDQA 3SF0A 4IJWA 1KEKA 3E22A 3DUFB 3EGOA 2B2NA 1V2GA 5DH9A 3VAAA 4OLFA 1XTUA 4KXQA 1Z36A 2CE7A 3DTVD 4MI9A 5H16A 3JYNA 1C9MA 3FPAA 3EQ8A 5A6SA 5KYKA 3BGWA 4C3VA 5A3RA 5T5QA 1YJ5A 3IQIX 4TKUB 4UE6A 2GEVA 2XB4A 2QZ4A 2WFLA 5DTQA 3U4QA 2AJCA 2NG1A 4CKCA 2JLAA 4KPGA 4UAUA 1HDRA 1JDVA 4EYSA 5DLEA 2FFQA 1ULHA 4UPDA 4L76A 5BWOA 5EJEA 3ASYA 4MK4A 1OR8A 1ABBA 1BH2A 4V0KA 4TL8A 3J81A 3PI7A 2BCJQ 1D03A 1X0XA 1ZD9A 2C5SA 4LE1A 2WE8A 2R8PA 1LEHA 2IEGA 2WAMA 1SOUA 2W2KB 3PITA 2PK3A 4TL6A 4EX6A 2AFHA 1GDDA 3G8DA 3D3QA 3ND9A 3WBFA 1MDFA 2Q3FA 1V7PC 3G68A 3V33A 2OK8A 1RYHA 2HNKA 2HOQA 1MGPA 4LPKA 1C2YA 2EGUA 5FOVA 2MOKA 3TOSA 5L51A 1J7JA 4PBRA 2RGYA 4D4IA 4OB6A 4RTOA 4ZO6A 5KQGA 1HYGA 2ZETA 2GD2A 2V4UA 1FFGA 4PCUA 5K01A 2PIDA 5HIIA 4LX0A 3SSMA 4B4KA 4Q7LA 1JDPA 3P2JA 3WYBA 1UWCA 4GI2A 2Z1MA 1FSGA 2RG7A 4II2A 3MUOA 1QH8A 2GTIA 4V02A 5ES4B 1SKMA 2YFQA 1M2NA 1CUWA 1TAGA 1AZWA 1IY2A 3BSSA 4RA9B 2ZWPA 4BP8A 3QEAZ 1EVJA 5L6MB 1P5ZB 1I80A 1XCGB 2FV8A 3THYA 2FEKA 4RK5A 3FLAA 1YDWA 3L0CA 1LFDB 3CURA 3PC8A 1Y3BE 3Q5DA 1M2FA 5BW4A 1U5AA 2HLHA 1YIDA 3ULKA 3ELDA 3K70B 3DCJA 2OCBA 3EGXB 3AM3A 1STOA 1W5AA 2WVJA 3TQOA 2B35A 4BFVA 3N8IA 2YV3A 3E9EA 4ESEA 4G0QA 2PUCA 2VDLB 3DZDA 3W5UA 1J0EA 4JENA 5C9ZA 4EQ6A 3B60A 3I8SA 4JOBA 2N46A 5DX0A 3A6GA 2JW5A 1GY8A 1QBKC 4M2LA 1CVRA 5TMDA 4A8JB 4X24A 5FUMA 1PYDA 1GEGA 3AR3A 2XQKA 3GQBA 4GRIA 1E79A 4OYRA 1K1EA 3IXLA 4Z7JA 3BCRA 4TUYB 3TLXA 3N9IA 1UZNA 2IEZA 4ZO7A 1OMOA 1YF3A 5B4TA 2HO4A 5FBWB 4R7GA 4WCFC 3HP1A 2C31A 3CT4A 5JASA 3Q9NA 3PKJA 1IBMB 4ZVTA 4JB2A 4UE3S 3SEFA 2PXXA 4BLTA 4E15A 2WU1A 1Z22A 2AVDA 1TA4A 4HG2A 1FYFA 1M1NB 3G3EA 4ZOLF 3FF1A 1XRRA 2AKAB 3WWCA 2MSLA 3O1HB 4OHOA 3MHPA 1P9OA 2J4CA 3T9CA 4N7MA 5IXJA 1TPZA 5AXDA 3I6MA 4K28A 4PSAA 1TI7A 3G6WA 1FMFA 1H8ED 3K1JA 1JH9A 1B6GA 4YDSA 2CV2A 1YB6A 4MYDA 4GG1A 1X74A 2W7TA 2DSTA 4MLDA 3AERA 4CTMA 3MWGA 1K3TA 3L04A 3WZMA 2C2YA 4KTTE 3N6XA 4GLLA 1WBDA 3DKPA 2Y2UA 4OUDB 1OASA 3Q3CA 2J31A 3S6JA 3HCDA 4KGXA 1UADA 4R1UA 4XEUA 3NASA 3KSRA 3NHYA 1ZMBA 4D3SA 4JLUA 4A9AA 1P0PA 2WT9A 3Q0EA 4FKMA 4FT4A 1KRWA 3DWFA 1V8PA 3J81k 4BQRA 1CIJA 4NARA 2QAGC 2WZQA 3DVQX 4TMZA 3FCCA 4LBZA 2A9FA 3NUQA 4NZMA 4QM6A 4NOKA 5G4LA 2O48X 2VNHA 3IUYA 3TH5A 4AAYA 1XVAA 1RXCA 1DB3A 1KU0A 3NC1C 4ITUA 2ZE8A 2PJZA 2ZT7A 3DZHA 1FVOA 1CUFA 1REQA 2QRZA 4FUTA 3OZFA 2VWPA 4K9SA 5HZHA 1AHIA 1CJUC 1AVTA 3AM4A 1QRRA 1AO0A 4G5YA 1KMMA 4E2FA 2ZUWA 4HGNA 1CS4C 4YAUA 1MVOA 2OLKA 3PK0A 2G16A 2XE6A 4DV4B 4UOEA 2UXCB 1BRTA 5ITSA 1EAYA 5K3FA 5JNRA 1HDXA 4BEJA 2SCUA 2AZ4A 2OAQ1 1G1MA 2YXBA 2IYZA 2CJWB 3B5EA 4Y2HA 4YRIA 3RLIA 1IRIA 4X84A 4F92B 5JZSA 4UVEA 2XNCA 3ABSB 3ZY5A 1NVKA 1ZONA 3HCFA 3OJFA 4UUMA 4CVNA 1C0PA 1QPGA 2DUJA 2MINB 4TTPA 1H2ZA 3H4TA 5JZVA 4O5OA 1G17A 2XMDA 3PPXA 3IIEA 2HREA 1W6UA 3FUTA 4BJ6A 1AQJA 2OCLA 3EULA 5MFPA 4WXRA 5HP4A 3UJHA 1F17A 3L92A 4HUJA 5I8PA 1XFDA 1JXAA 5HUQA 2QTRA 3DS8A 3EFEA 5HEKA 4W8HA 2C04A 2Y71A 1Z13A 4QWMA 2DVMA 2QVBA 2RBKA 3ETNA 1GG9A 2JFUA 1DIHA 2PS0A 1TCCA 3AFHA 4EUFA 1PR3A 4BFYA 1HURA 3BL8A 2IITA 3BMNA 4KDCA 4QRIA 4RDCA 3Q1LA 1O57A 4M1SA 2WW8A 4N6OA 4KQFA 4WASA 2F4VB 2HSWA 1IM8A 3M5CA 4ARCA 1TZCA 2I2XB 3E18A 3IBYA 5ECYA 4CDGA 5BW5A 1WLYA 4OP1A 1RMQA 2FPIB 1SBQA 3I09A 4YFVA 1Q0RA 3PVSA 1DAEA 5F2KA 3ZWWA 2B82A 3BM5A 3TKYA 1QH0A 5HUHA 1JV2B 4P8RA 5LP6B 2B8TA 3RKSA 1RDFA 1UM9B 1W4BA 3AGQA 4ZREA 2ZRIA 3FETA 4BNGA 2YDYA 2C7GA 1K7YA 2QUAA 1BAPA 2DSNA 6LDHA 4EW6A 1I2CA 2LMEA 3O4VA 3VISA 3KL4A 3WQQA 3R9WA 5ENDA 3P7MA 4JBLA 3BXFA 4C89A 4CKWA 2RGXA 4PFSA 1P2BA 4ZAVA 3ROFA 4IKEA 4ZOAA 5ER6A 4I08A 5FO1A 3PXXA 3RSSA 1JR3E 2J0UA 2QD3A 2CHQA 1H4TA 3GUUA 1KOFA 2NT4A 3AEZA 4CWAA 2WP0A 1NLUA 1NHWA 2QN9A 4K81B 1F4LA 3DH0A 5HF8A 5AW9A 2QMZA 1VP3A 2RGCA 3CCFA 2VXOA 2DUWA 3Q1KA 1NX9A 1W2HA 4LHXA 2EARA 2QRMA 5DK6A 2HA4A 1U7WA 3OQOA 1QFYA 1SOWA 5SZKB 2E55A 2JGMA 2JKVA 3G0IA 3GCWA 3PNQA 3GGGA 4JP1A 2HU2A 4P31A 3V97A 4DIBA 2XYHA 2HU7A 4HY3A 3KR9A 4E1BA 2Y0EA 5FWXB 2QGFA 3CU5A 4ND8A 4EUSA 2AHOA 2HK7A 2P6PA 3F6RA 4NABA 2Z5FA 4QTUB 5KTOA 5K3DA 2DLCX 3DL7A 1UPTA 3VR3A 4TKLA 1K5GA 1PZHA 3ZS8A 4US0R 5K3AA 5AVSA 4F97A 5BYAA 2VCHA 3ILVA 3GT0A 3AG6A 2RB4A 2E4UA 4FI3C 3CH5A 3DNFA 4N5NA 5IT4A 3AMVA 5CW2A 1BD4A 1RE1A 1JNXX 4G9GA 2X0KA 2BT4A 4QTZA 4TV8B 3GO4A 3I1JA 2BMWA 4I5FA 5AVKA 1O94A 4R5MA 1NA5A 1YRWA 3T3IA 3ZWMA 4YASA 2WYWA 2YJZA 2CMFA 3K1AB 1BZYA 4R4JA 1E1QA 1KYVA 3NEYA 3UB3A 3AIMA 4DMKA 2OGWA 4GPZA 4QOFA 1YMQA 3OEHD 2GESA 2F2TA 1YJXA 4FFWA 4YCAA 4LXQA 4MKZA 3UM9A 3PR3A 4JYCA 2GZ3A 1SVWA 2D13A 4RF2A 3OPNA 1UXJA 3KVOA 1OBFO 3KEOA 4RLQA 4G09A 3GLKA 3HVHA 2G70A 4PZCA 4HNGA 3SQWA 3EIUA 1FLDA 3VH1A 4IUDS 2IW1A 2F3QA 4M76B 2PRKA 1DIRA 3BA1A 5ALZA 3ZHCA 2GBLC 1GFIA 2Y76A 3VKFA 1H6CA 1GG5A 1I30A 3CE9A 3NH6A 5AJHA 5F73A 3UMRA 3X1ZA 2ST1A 3JARA 1FJHA 2KS6A 3QWBA 1ULAA 2VRBA 4TRRA 1K7FB 2B98A 1WKVA 1P4RA 2LPMA 3WK6A 1RM0A 4KQWA 4RVDA 4R68A 5B4UA 5JDCC 1XHEA 4QELA 4F72A 3KQYA 3OOSA 2AUTA 4PYIA 1OTYA 3HBNA 3IQZA 3DT9A 1JAHA 3R3HA 1NV8A 5CHYA 5E8RA 1L4BA 1C7EA 4JI7B 3EZ2A 4HDSA 3VKGA 4L7VA 3W5IA 3ZLTA 2VOJA 1A9OA 2RETA 4LK3A 2VAPA 4DE5A 4XIIA 3TSAA 4I66A 4TMXA 3KKKA 2GETA 2HA5A 2NW6A 3BTSA 5AM2A 4AQYB 2VNKA 2WSYB 2LNDA 3FOEC 4ROTA 5ECWA 5F9HA 4FCCA 5JNVA 5T3YA 3DEZA 4I4TB 3AETA 1PR6A 2PLNA 4WZAA 1NYLA 3TKAA 4CMIA 3U7GA 3L7BA 3T1VA 5CVTA 5HZMA 4XB2A 4HEA6 3FLEA 2C20A 5J3JA 3D8HA 5LN1A 1N8SA 2UYYA 3PHBE 4OQLA 4QC2A 2BBWA 1V3TA 3BJZA 3GUHA 3QWIA 4GX0A 3QK7A 3UMSA 1K06A 4OQPA 1Z5UA 1ZHFA 3LHDA 1OJLA 4JLPA 4J90A 1NX6A 4XQEA 4BJ5A 3S55A 1NUUA 3ZDYB 1XZJA 3NX4A 3VPHA 3HDVA 3IC5A 1I8TA 3WGTA 3N8HA 2GN1A 5E2AA 3DBIA 4DQUA 2XUIA 4R2IA 1IB0A 1XDBA 1MX5A 1Y8RA 1PX0A 4Q7EA 1KJ8A 1IHDA 2BF4A 3QWHA 2E82A 2ZJ8A 2BR5A 2YJNA 2DKOA 3DBOB 4LTNA 4YB8A 4ETWA 2WT4A 4J0HA 2IWRA 2ZPAA 4NFLA 2EKZA 4BV3A 1YH3A 1W9MA 1YZKA 1HNZB 3I9JA 4J9UE 2AW5A 4OUKX 3T7RA 1VCOA 4HD8A 3C6MA 2PKXA 5KS2A 5DP1A 1RYEA 3EX7C 1D0SA 1BC5A 3ANSA 1YBAA 1HV8A 1B3RA 1KEVA 3PZBA 3O8NA 2VP5A 1UPUA 5HKLA 4DL9A 1LB1B 4AMVA 4E4TA 4YYZA 1MMFB 5BT8A 1Z6ZA 4LMBA 4MYRA 1GZ3A 4ZV9A 2IYVA 3R6DA 4KAJA 4MQEB 4OGGA 3KWMA 5DI3A 1NQUA 4LZWA 1KI1A 4JUBA 3AL3A 3VR0A 1WB9A 1L4GA 1JPUA 5CH3A 2C5HA 3TUIC 1OZGA 2PUFA 2A0YA 2FDRA 1GGHA 1X1RA 1SOMA 3NKLA 3TQTA 3CBQA 4MWGA 1KI4A 4NXMB 5CXQA 1AC5A 3QW2A 1OAAA 1Y5MA 5LQDA 2LRHA 4EA8A 1D2EA 2WVGA 2FXIA 3A28A 5KYUB 1I5RA 2A9KA 3OCYA 4FFBA 3QELB 1H5UA 1JNYA 1M74A 5HQJA 4N47A 1ZMTA 3JQAB 5HK8A 4ZAYA 4YY3B 4G0YA 1LRJA 2O7SA 3BQMB 4JLMA 4DLBA 1YZQA 1JE1A 1MB9A 1Y81A 3OT1A 5H7XA 3BFPA 3BRWA 2Z5LA 3QI2A 4WZBE 1QZZA 1SVSA 4OHXA 3GMTA 1JQ5A 1V5IA 1HE2A 4I1RA 2DQZA 2G8LA 3AHIA 4RELA 2PO5A 2Z2YA 3X2FA 1OAOA 2EG5A 4RKRA 4CDMA 4YHHB 4XSHA 1BEEA 2NZUG 3MUEA 1T3GA 2VPTA 1H3FA 3FNIA 2O4CA 3LLCA 1PT9A 3ER8A 4J16A 1FJXA 2JLVA 1NJ2A 4IJKA 4GFDA 1L3CA 3A2MA 3MLEA 2P2GA 1ZK1A 4XPZA 2O3QA 4KDFA 5K9ZA 1KZGB 2Z8ZA 4G5RA 1E62A 2VPXA 4I99A 4U2FA 1KIFA 1GGEA 3G9QA 4DLAA 1ISRA 3M9WA 4ID3A 4KG7A 1YTLA 3OICA 4L5CA 13PKA 5AUOB 1IY0A 1EG7A 1ZJJA 3F5FA 1A3CA 1R4AA 1TQDA 3W3AA 4X54A 2X0FA 3KETA 1ENOA 1ZU4A 5CDUA 1S2IA 3HCRA 2ZG6A 4FS3A 3DQZA 1SVNA 3UK2A 1NC3A 1T5BA 4WQMA 1YAHA 4BV2A 1XQVA 1BJRE 5HJEA 1QE3A 1OLOA 2XOEA 4W99A 3WRVA 4HH0A 3K1ZA 3QLTA 1J1UA 2VDWB 3GNTA 1LI5A 3LCRA 4C7XA 1DCMA 2J3KA 2NO9A 3GLTA 5I01A 1LS1A 1P6UA 4PCAA 1AGPA 1QRUA 2R7KA 4D99A 2X0NA 5C0OE 1E8NA 2P5YA 3CO5A 3EGDA 2C82A 2JIQA 3LPLA 3U17A 1CYDA 4MKHA 5FQOA 2CXPA 1G8KA 3DAGA 2EC5A 4O4IA 2JH9A 1H2BA 4OX9Y 2UVQA 4MW6A 1JIXA 2VSQA 4E5DA 1AS0A 3BRCA 3HVRA 2VJQA 3S2GA 1VLMA 2BEUA 2CZGA 5AVJA 1F8UA 4IWNA 4MPJA 4MUJA 3FR8A 4DPLA 4KI7A 1BWSA 1TKAA 4IDNA 2GPTA 3DJYA 1Q0ZA 2QTNA 3KM0A 3VYSB 4JBYA 3GZNB 2FPGA 4BZZA 3SMVA 2OYRA 1DMRA 3WNVA 1CUCA 1M33A 5K4HA 2YQ5A 1ISHA 4C76A 3I34X 4R98A 2QPAA 2VHWA 1R15A 2OQ2A 3R0IA 2H2DA 1UKBA 3I5XA 2HQ1A 3HU5A 4BRWA 3VU9B 2ZCVA 1GL6A 1OZ0A 2X8BA 4C78A 3P2IA 3K5WA 1NW6A 3UJPA 1VJCA 2YWJA 5DSZA 2VBFA 5TEWA 1KSHA 1DLJA 1JA0A 3NVAA 4PONA 3TXAA 5ILGA 2FWMX 2RCNA 1T29A 3GN2A 5DIZA 3T1QA 3G59A 5GZ1A 4HLUA 5HPYB 4AKIA 1T9BA 2D2IA 5KCMA 3RC9A 3IV7A 4DV5B 5TQ0B 3QPBA 2JI6A 2EL7A 1GTZA 1DCFA 1ZVVA 3EVBA 721PA 2HPAA 1W0JD 4O1MA 5D1HA 1OFHA 3VH2A 1UDAA 5T4EA 3IOCA 1XMPA 1UANA 2CWWA 1TT5A 2O2YA 1Z38A 2CY0A 2FG7C 3GFBA 4B4UA 1J8VA 2ZRCA 2YXNA 4NBLA 1J8MF 1ULBA 4H7DA 3LS2A 5HIJA 2OORA 3B3FA 1RKQA 2AFHE 3LX5A 5KVAA 2X9VA 1OWLA 1AK2A 1E2NA 2ZROA 3F1KA 4OLHA 3G5TA 4IMPA 3WB9A 3GW8A 4ZI7F 4AYWA 5E6UB 4EJ2A 5JPDA 1FRVA 3O2SB 4AUKA 3PIRA 4M1KA 4B9EA 2VQSA 4Q4AA 2DWQA 2HF7A 4D81A 3P0RA 3FUCA 4FFSA 4D8YA 4ZGWA 2WHRA 1Q17A 3JALB 4L22A 3RRBA 2Z1DA 2B6NA 1FP7A 2QVYX 2WF6A 3IJ5A 1DLIA 2VO1A 2QQ5A 2IYSA 3H2JA 3DB1A 1ADFA 4DR2B 2KBEA 3H8WA 5T4BA 3C3DA 4F38A 1UBOS 2QD4A 2WWWA 3C98A 1AKUA 3D6JA 2QL5A 5CX1B 4ZRMA 5ERYA 4WBNA 5A2GA 2W43A 5KTKA 4WIAA 1PW7A 5F7OA 3WGIA 1DKOA 1XDUA 2NOAA 3SFTA 3DE6X 3HB1A 2VPQA 4BFXA 5KSOA 4CG3A 4KDEA 2VHYA 4RMHA 5EUQB 1XZBA 4FT2A 2P9HA 3VGPA 3KT0A 3B82A 4XDYA 1FK8A 2JIDA 5KSZA 4B09A 1W5BA 2COKA 1FNMA 3BK2A 2YOFA 1VSVA 1QC5A 4L8WB 5KHOC 4JUDX 1I7QB 2V0GA 1OU4A 2SBTA 5ALUA 2IODA 2ID8A 5BWCA 4BNNA 3CLKA 1KYWA 2OYSA 2P4QA 1KDOA 1CRLA 1AHNA 1JF8A 1B3BA 2F7SA 2H6EA 1RADA 1A4XA 3K4HA 4ZRNA 2BR4A 3TZKA 1RZRA 1O7JA 2NGRA 2VYQA 4S2EA 1USVA 5A5VA 5IS2A 1TGVA 1UQTA 1XTKA 5ALHA 2BMAA 1NN0A 2BP7B 1WTAA 3ISVA 4MQ4A 3EXHC 4DWVA 3HB7A 1PW5A 1K3UB 2EFCB 3ND8A 1RTKA 3I2HA 3VAZA 3CYFA 3ZUPA 1C3EA 1QGUB 4PYLA 3UMFA 5J2UA 1JFTA 2A59A 5FOSA 4DNPA 3AY6A 2O2IA 4Q48A 1KJ9A 3MJSA 2OXTA 3RKRA 4KR3A 4WXPA 2IUSA 2H31A 2J45A 2YH2A 5KPJA 4Q1EA 1R0LA 3FHJA 5CFMA 1JQ3A 2Q4BA 4U2CA 1PQPA 3H5WA 5IAAA 3VR4H 3GT7A 4Q1AA 2VH1A 4HWSA 1U7ZA 4ZHQF 1G6OA 4TQ9A 4RY8A 3QUSA 5JAOA 3GLGA 3MHTA 4H1HA 1PJ4A 4JI5B 2EP7A 4K05A 2DOKA 3ROXA 4GGMX 4RV9A 4CLXA 5JSZB 1JTVA 4HO1X 1ZD5A 3QYFA 4BBPA 1P2DA 1XTZA 2Q3BA 5FA6A 4BE4A 1A2OA 2Z1NA 3BA6A 3IE0A 4WZBB 3OZAA 5DN6D 3ESDA 5A5EA 5CCDA 1J7KA 3EGVA 4LRUA 3S1AA 1EFKA 4CMEC 2FSSA 4LQDA 1LCIA 2IYPA 4RD2A 4EVSA 2WHEA 3L8MA 3OP4A 2WWXA 2OLEA 3C3WA 4IILA 3QKIA 1DVRA 3WB2A 1QYVA 3SWWA 4BNHA 4BO7A 7REQB 3OUUA 2QG6A 2GPBA 1VB3A 5FUBA 4GX5A 2RKOA 4ATNA 1WMSA 4I36A 2GCIA 4DLXA 1CRWG 2HYDA 3F6YA 5KMGB 1DHTA 4LN1A 1B1AA 4UAJA 1SEPA 3VU1A 2PSHA 2HMUA 1CJVC 2C4VA 3LDHA 3G2JA 3HJHA 5L3SB 2OO5A 2WTEA 1N9GA 4DR5B 3IA2A 2FQXA 4IDEA 4K3UA 1TVMA 1R0CA 3UKJA 3ZK9A 5GJCA 4K6GA 3VHXA 2Y4OA 1AV7A 1FB5A 1XR3A 3HGTA 4PLCA 2JLRA 1RPZA 2UVPA 1Q0QA 2YV2A 4FNGA 4Q4HA 5BSRA 4NCXA 1SC6A 3GEHA 1GAQA 1QCDA 2DEUA 4RABA 2QVGA 2XKAA 3OQVA 1BOOA 3CRRA 3CEMA 3E61A 4MR9B 3EBLA 4NNJA 5DXAA 3QNUA 3L8YA 4RHUA 3RUDA 3P4YA 1CQZA 1H2WA 1SM4A 2ZZKA 4AP9A 3NGXA 3KLPX 4IDAA 4Z2YA 4RMGA 3QIVA 1ML3A 1GGMA 1PJQA 2RHOA 1Y4ZA 4MV9A 5G0WA 1B15A 4HLUC 1EXVA 5FXMA 4DNQA 4GXTA 2QAGB 3ZWXA 3ZZNA 4BNXA 2NO4A 4DIUA 1DEXA 3E4CA 1KFKB 3U3RA 1C3VA 3D2CA 3IKVA 4EVQA 2PXCA 2H2GA 3PDWA 1HYQA 1TEHA 1G6HA 4JUFA 3L7NA 2CUNA 1Q7TA 2FQQA 3E82A 3T9FA 4FOLA 2JLZA 3QYJA 2QTLA 1ZGCA 4PSCA 5H59A 3GOHA 4BNDB 3LUHA 1ZWLA 1P3Y1 2GTHA 4ZV4A 1GPKA 3LAWA 3A1SA 2ZI9A 1NFQA 1NLYA 2WWRA 3LECA 1NZFA 4U02A 1KZ1A 2H5EA 1NMSA 1K4MA 3PGLA 5K0GA 1TLTA 2ESRA 4D0GA 4WFKA 2GXAA 3HBJA 2AI2A 4WNCA 1Y8QB 3E22B 2UZ0A 4HPJB 4N8DA 4URZR 3IVMA 3FIUA 4DMGA 1QS0A 2CLHB 3QBJA 2HQOA 5BT9A 2PYZA 5A6SB 3NCTA 1S1CA 2CHFA 5DM70 4JGIA 3CRVA 4AF8A 4ZN6A 2D74A 2JCGA 4L07A 1SG0A 4DQDA 4WVFA 3RCBA 1XD2A 1CUJA 3D43A 5E7IA 4MS3A 2O5EA 1QHFA 2WKPA 4I4NA 3ZQKA 1ESNA 4CKCB 2XCRB 1Q0LA 1T8YA 2H4JA 5AKHA 3ZV5A 1WEHA 3LF4A 1S9HA 4WECA 1S7GA 3I9MA 5HOQA 2V6FA 1JRLA 2ACVA 1GV0A 3K0AB 4FJ2A 1DKNA 2X86A 1D8AA 2FZKA 4C4TA 2AFHB 1NN1A 4CE6A 1VP9A 3UQYS 1AKMA 2ONCA 3RC2A 1WS6A 1QRSA 1UMDA 4JGGA 2E5FA 1WV1A 2EU8A 4WV3A 4H4CA 1CUVA 4ISBA 3TTVA 3NBMA 3OBIA 2Z43A 3M9XA 1AX9A 3STUA 5B1IA 3I72A 4Q6WA 3OQ6A 5CHEA 3RFVA 1KYQA 1P80A 1SCJA 4FBLA 1IJBA 3JD4A 2CB9A 2C8KA 4FQ7A 3DO6A 3A7EA 4M0UA 2Z3VA 1SQ6A 2IVZA 4ZEVA 3DPSA 3DAOA 5GV8A 3KKNA 3VMFA 1SQSA 3FSGA 1CVLA 1OT5A 1V8ZA 4PNEA 1FDIA 1CZOA 1LI4A 1QH8B 1HQKA 2JPDA 4ENRA 4H1WA 1JLKA 4N0EA 4UBMA 4FIDA 4H6PA 1P0IA 1IHYA 3PFNA 2QF7A 5E7QA 5TNXA 3GAMA 3HI4A 3KB8A 3FDFA 1WXXA 2IIVA 5LLSA 4KV9A 1ZMOA 2JFYA 4O8CA 3KVRA 4YBZA 4D6YA 4E51A 1TQ4A 2D6FA 2GEDA 4HZGA 2ZUFA 4ZQHA 1YIAA 4FEGA 4AFNA 2IZ7A 3F96A 3ZY2A 1U3UA 2QW1A 3I9V1 4IJ5A 3G9XA 2WLTA 4DFDA 1P8JA 2E7ZA 2JZOA 1Z25A 1R64A 2FPLA 3CEAA 3T1TA 1P4JA 2VXBA 3N2IA 5IYZF 1W36C 3EFHA 4FYWA 4IF4A 3LJKA 2O0JA 4AN4A 4EQ6B 2IY8A 3K30A 2C88A 3U48A 2P1DA 3GQBB 4FHCA 5EY5B 1TECE 3ZGLA 3OCCA 2H92A 4O59O 4RMIA 1H2FA 2FR8C 1QYWA 4NZPA 1DQYA 3TG8A 2XIJA 5LDGA 3N5KA 3A6HA 1YZHA 4HAWA 4Z0TA 5GP1A 3QXCA 4D98A 3ADCA 2REOA 1D09A 3L79A 4ZDIA 2OILA 1ZXLA 2JATA 2ZR7A 3SM3A 3GMSA 2V74B 4HEHA 4EYKA 5K8LA 2ZSBA 2B0CA 3KJGA 4QU5A 2YRXA 2ARKA 4JOQA 3VZSA 3RWBA 3JWGA 2B34A 3T7CA 3MTQA 1Z5ZA 3HL6A 1EVKA 1K08A 4TKZA 3SHQA 1W5TA 4A15A 1U1DA 4WDQA 4RJJA 4ZAZA 5CBKA 1XIVA 1L4UA 4QJIA 2HMAA 3DNMA 2NXEA 5LP1A 4I5IA 1FTWA 3FYUA 3H18A 3ZU6A 4B46A 5M5BA 1IZ0A 1LTHR 1YVEI 3U16A 2I6UA 5A7FA 2SKDA 5JLAA 1U04A 1II9A 3BE4A 2HZ7A 4OATA 1A9SA 4C0HA 2LD4A 1H0SA 2ATVA 1TTQB 1Y89A 1Q3TA 3B53X 4QYTA 1FYDA 4PG6A 4WK4B 2CVZA 3RRNA 4EA9A 1F9AA 5AW3A 4PAGA 3I62A 1JP7A 1ZAYA 4HJXA 1EU1A 4QKQA 3B70A 3LUFA 1F2DA 3DFUA 2GYUA 4WZAE 4BZQA 2GRUA 1TIBA 4KRGA 1XDSA 1OI7A 4IXMA 4CDRA 3K6JA 4BVGA 3U6BA 2CEAA 2J7PA 4U8GA 1AURA 3D7SA 4E11A 2PPLA 3UMBA 4IOLA 3VH3A 4LTDA 4BV8A 1GTRA 5JTTA 4G81A 2FYTA 3HL4A 4D9JA 3FI0A 3QXJA 1XVIA 4Y2TA 2JS7A 1A9PA 5TSDA 5B1DA 1R4MA 3IXQA 3PWKA 2A56A 2WMDA 4N6NA 3VFDA 5D7NA 1ZUIA 2JVIA 3SHVA 3E9NA 1NW4A 1Y9JA 1IEVA 1N6HA 2GZRA 3V1YA 2Y68A 4J75A 2IXEA 1FYWA 4DT1B 4ZZ1A 5DX1A 5JANA 2Q0QA 3OIVA 1DOAA 3QKSA 3QVSA 5BSMA 4PZZA 2XUHA 3FZGA 5FR2A 5AQ1A 2XVMA 2SCUB 2VPZA 4MVJD 1EWKA 3M7IA 4INJA 4LF8B 4GRAA 3VPAA 4DUZB 4GYJA 4F4UA 1CETA 3IHTA 4HDNA 1K5HA 1V47A 3KT3A 2IYTA 3RK0A 4AJ2A 2CHUA 3FWPA 4DRXB 1QONA 1JHVA 5TS3A 3AV0B 4KJZA 3PX7A 1ESCA 2XSZA 1G8FA 2XOXA 2I66A 3OAAA 3QY9A 5A4MS 3OQHA 3MRXA 1DUSA 1FFEA 1AZSC 2PRZA 1HE4A 3ELBA 3PUXA 4FQ8A 3WDMA 4CIXA 3F4BA 1LPSA 3PRJA 1QIIA 1SCDA 1B8OA 2GLXA 2ONZA 2OR3A 2PNFA 4GPAA 4EM6A 2NTNA 4MB0A 3QIAA 4W7SA 2J0QA 2MR6A 5EPEA 2J9XB 2K6GA 4PHGA 4OA8A 5JRZA 3L4KA 5LNK6 1O96A 4FE7A 2LW7A 4NAUA 2WY2D 4F06A 5H3LA 3BMNB 3ADBA 1NVBA 3EMBA 4ISCA 3EEOA 4Z2AA 4PO3X 3ZD6A 2M1XA 1DFHA 3O2NA 3TW0A 3RRYA 4KWCA 4XR9A 2XB6A 4IR7A 1C0LA 3GGOA 4H2DA 2FN7A 3QHPA 3QA3E 5JJKA 1EGMB 3K0SA 5DYGA 2ZXUA 1KYIA 4G8JA 5IUNC 4IIFA 4ZICA 1H9BA 2XQIA 2WHXA 3CLHA 2AJBA 3HC7A 2C7RA 1WNTA 2X9GA 1Z7WA 1TQHA 2HV8A 4M1ZA 2JAWA 4WXEA 4KLZA 1EXNA 2WNHA 2ZLBA 3ITDA 4FZ3A 4QO7A 4CKWB 4DVJA 2IWHA 3C3CA 1QTIA 3LVFO 1HOXA 3QX8A 1L7DA 2XWBF 4YV0A 3E9DA 2OCXA 1P3DA 2F3PA 3A4LA 3TECE 4RIHA 1N78A 4MULA 1QUFA 4QATA 3AHEA 1U2QA 3JQBA 4HQ0A 1PL8A 2AZDA 1SXJC 5EE0A 3UOGA 4FS8A 5I4BA 2PANA 1TYDE 1RAEA 1F8FA 1FDVA 1NDHA 1E63A 2FJPA 1VA5A 4JVSB 3OTOB 2PKRA 3PA8A 2PLAA 1MO6A 3FMIA 2NADA 2WR8A 4M9UA 1ZK2A 4CM7A 2I7VA 4NV3A 5HIAA 4ND8B 3JD1A 1L1FA 2M1ZA 5E6SB 3SIXA 4CQJA 4XQCA 5LMZA 1XZPA 3VVCA 1KO8A 5DHUA 2WB4A 4I4CA 4UCWA 4ABYA 1FY2A 4HH1A 4P5PA 3B1YA 4RQBA 5TVGA 1ZDMA 2H57A 3N59A 3OZRA 5B3LA 3U7JA 4PO9A 5FQNA 1T0PA 2CCJA 5DNAA 3K5IA 5IKMA 2PX0A 2GXSA 1LQTA 4P80A 2VBCA 4E31A 1LZLA 3M70A 2GF0A 3QE2A 4PBTA 4HPXB 2RGRA 3NHAA 5AMXA 3O8LA 1SG9A 4F8JA 5L3QA 3QLVA 4OKSA 4EENA 2O7NA 4XW2A 1KU6A 4IL5A 1RVDA 4P08A 3SYMA 5B6PA 4KOAA 4L0DA 2JLQA 3MFQA 4IIXA 1ZI6A 4B6GA 3UAZA 2H17A 4UEJA 4GP6A 4LZNA 2F00A 3OJLA 5A9SA 3EUFA 1L1RA 1GNTA 4ZOBA 4BNLA 4LJSA 1FU4A 3KKZA 4L2IB 1RXIA 3CWQA 2WYIA 1DHRA 2QN7A 3F3KA 4XGQA 1YB4A 2BKXA 2EKBA 5KVCA 1EP1B 1FL9A 2BBSA 3FKJA 3KHSA 2NTYC 1PN3A 2GMWA 3NBKA 5FCDA 3VI3B 3DHEA 5KJCA 1KI6A 2LIVA 2WEKA 4ROSA 1AGXA 2BBOA 1A27A 4C07A 3EUEA 2ZIAA 3C7KA 2QVZX 3PJDA 2E21A 2B20A 2XAUA 2ATIA 3FZYA 3SLRA 3ABZA 2K5UA 1ZIXA 4GD3Q 3RU2A 3ID6C 3ZU2A 4MUIA 5HHTA 1NR1A 1SHZA 2BW0A 1Z35A 2FSFA 4B3GA 4W5QA 3GWZA 3DMTC 2H2WA 4LF5B 1Z2DA 1GARA 3ET5A 4LJRA 3A1NA 5BYBA 2Y0BA 4GR4A 4JSTA 1CP3A 4IVNA 4J7AA 1JKXA 1XEXA 4FDTA 5DK4A 4HDSB 4OPMA 4E2WA 1ETUA 3STTA 5FOTA 1TLFA 4DLPA 4BX9A 2H1FA 3NPAA 4HTAA 2WDZA 1R0YA 3WWDA 4Q3DA 1INLA 4TT8A 4MWCA 5AXBA 3MUFA 3VX4A 3L5OA 4S0XA 4TV9A 4KFTA 4L5IA 1T2NA 1ZK3A 5G0SA 5INTA 3VYWA 2B7CA 2DRIA 4E22A 5TMEA 1DAOA 4FZVA 3OX4A 3AOEA 3AETB 4LOIA 1SJ9A 1YL6A 4IOJA 3B51X 2B94A 1T8SA 4PLHA 3NC4A 4WZAB 3W9BA 4EW2A 2WA2A 2ZSDA 5K20A 4CMIB 1WF6A 2WSSA 4M6WA 2X1VA 3BZUA 1BEUB 4MV3A 1PFYA 1SKBA 2EAUA 3VO8A 3NJ4A 5F3WB 2YHUA 3B6IA 5ALVA 3CFYA 5AW7A 1THZA 1AK9A 1HDCA 4FGUA 2IF0A 4IFBA 1HFEL 2QYHA 4GNKA 2Q99A 5DHQA 5AVUA 1OC2A 4MX8A 5CT8A 3O8OA 4BTVA 2CFCA 4A36A 1NLFA 1Y3DE 2BSXA 2WKRA 4G36A 4GXRA 4K26A 4QTTB 4RK6A 4TTJA 5BR7A 1HBJA 4NPCA 4K6MA 4EGSA 4TVOA 1FRQA 2R6R1 4XYLA 5JNUA 221PA 2Q6IA 2BFDA 1Y8RB 3NB0A 4YI5A 1A2QA 1MC4A 2PV7A 3H5IA 2I5PO 3THSA 5KHAA 4AYXA 1L5QA 3MUNA 4P22A 1XTBA 1P4SA 1R0BA 3RTEA 3I5AA 2EQ5A 3L49A 121PA 5GMOA 4Y2JA 1C9NA 5DNWA 4O25A 1ZY2A 3E5NA 3C4QA 4BU0A 2C77A 2X13A 1T2EA 3Q3IA 2ZPTX 3C8DA 4RYDA 5F9MA 1I01A 4BDTA 5TGDA 3PRHA 4G24A 2H11A 1E2KA 2W0MA 2WF7A 5DI3B 3WZLA 4HGPA 1PG0A 2HJVA 4BO8A 1RXSA 4J4BA 2B4AA 3S29A 3KPJA 3F5SA 3SBDA 2XJ4A 1OTHA 3AUTA 1V4BA 1Y0BA 3BICA 1EZ1A 4JKOA 1Z0DA 2WIGA 4RVHA 2HPVA 1NURA 1IUOA 4JZYA 2JFFA 4H6XA 4IIJF 4Q82A 4D1YA 4YRKA 2PGXA 4XVQA 1NYTA 1VIYA 1MV8A 1W88A 1JR6A 4U7WA 1OHHA 2W6JA 3UA0A 4M1YA 5HMLA 1YL5A 1V1RB 3PD1A 2AMVA 4IEFB 4Z86A 1JLHA 4LE2A 1OYWA 3RFFA 1E9CA 2PBZA 3TOZA 3UHFA 3WGMA 1V1MA 4EB3A 1WW3A 1Z2NX 2ZDHA 4TVSA 1E2FA 3U1BA 3OT1B 3M3DA 2X7JA 3KB2A 4AM8A 5KOHB 2QRKA 4YH1A 5IVDA 4GO1A 4XH9B 1V3UA 1W2WB 4XYEA 1NUSA 1PK7A 2X42A 4OXXA 3ZNQA 5K99A 2ZJ1A 2XUAA 2Z08A 1PD0A 2ILTA 4C4AA 4WCVA 3P20A 2YZGA 3NQ41 1PQ4A 1YVPA 2Q62A 2UYQA 4HL6A 4U6NA 1E6EA 1SQFA 3M81A 1D0IA 1N1EA 1DJNA 3H83A 2GSWA 4KQIA 2QPOA 2DUUA 1A97A 4ZJYA 4XIGS 1EBBA 4K9MA 2PV0A 4LQ4A 4QVGA 2VAVA 1JEDA 3AT1A 3DAFA 3PXUA 2JJ1A 2IXGA 1U9IC 4AIIA 2BI8A 5FUYA 5BV0A 5BSKA 3E9ZA 1ZD1A 3QRWA 2VHQA 2WAXA 2P69A 2WZDA 4UBNA 1Y98A 4CM1A 4WKBA 5ADWA 5GONF 1ZSYA 3E7FA 2Q27A 3UGJA 2OK7A 5K3BA 3VOTA 1PTKA 3VM6A 1ZK0A 4OEHA 3PC7A 1KO1A 1XTJA 3K2QA 4R1TA 2SHKA 1FTQA 4YV1A 4WEQA 4DZRA 3SQXA 4TROA 1XRPA 2VWHA 4Y9UA 1QQ7A 3W5BA 4OYYA 2WINI 5JNTA 3THXA 1T34A 1A72A 3LYHA 1YAJA 2Z95A 2XMQA 3PEWA 3TN7A 1JLSA 3GEPA 1YR1A 3AK4A 3GUZA 4LFAB 4URUR 3KZVA 1L5OA 1CUXA 3CNOA 3EGDB 5EZ5A 4S05A 1S3IA 4GP9A 4OHWA 5FTWA 3LDAA 1BJTA 3W5HA 4O4IB 3MJVA 1J5XA 2VF8A 5KSPA 2DBYA 1MO2A 2VWGA 5FL7A 4F46A 2BEUB 3Q6IA 4FSXA 4D97A 2D0IA 1ZU5A 2Y67A 1NQWA 3DE7X 3BIFA 5DMHA 5ED0A 3HM9A 1ADBA 3A4TA 1ODTC 3WP1B 4ZCIA 4LOJA 3DZ8A 3MCWA 2Q49A 3GX1A 3R7FA 5TVKA 4BOYA 5HIMA 4LJLA 1K6EA 2IDJA 4CNBA 1PLKA 2O3SA 3INGA 4D9EA 5BYKA 3RU9A 1U0JA 2PYIA 4CMGA 2Y1LA 3DZKA 2YYYA 4P7GA 4H9GA 3TUZC 4KC0A 1OIXA 4LQCA 4G9BA 2X0DA 1T5IA 4YUZA 3MTEA 4YCJA 1LVGA 4RNCA 1PJTA 1LSOA 1UOOA 1WDWB 3CSDA 2NQ8A 4EHHA 1UAAA 2PQ6A 4CQNA 4C6RA 4DCMA 2ZI3A 4Q39A 5MHTA 3W90A 3IQXA 4QBHA 2Z30A 4WKGA 4LWZA 2OEPA 4F45A 2RDMA 3FX2A 2WG1A 1BQEA 3SKYA 1OZFA 3B6JA 2PSSA 2BIFA 4JVNA 3HNPA 5DWDA 3BBPA 4C7VA 1FX0A 4C2TA 3PXGA 1ATIA 3ZWAA 3R5TA 4QU9A 2V5AA 3QVGA 4CM9D 4B83A 1N5KA 5D51S 2OPHA 2GNOA 4CKBA 1LF5A 4UCXA 3E7WA 4CLRA 1KY2A 1VM6A 2UYOA 3LC2O 4TYYA 4DSNA 5EWJB 1N9KA 5J58A 1KH1A 4L78A 3AVXA 1IQPA 3HDQA 2Y0DA 1G6KA 1MOZA 2P9FA 4NCBA 1MD9A 4P98A 3DLAA 4L02A 3C3XA 3TRFA 2NVWA 1RPJA 3D2LA 4IV5A 1PZEA 1E9VA 1GFWA 1S02A 2WU0A 4EHAA 2GM9A 4KRYA 4GOOD 4HVAA 3KZMA 4QLOA 3A25A 3AWIA 5AOBA 5ENZA 3SF8A 2ZIEA 4Z1MA 5ES3A 2PMWB 4PQEA 4BFTA 3SIWA 4R1LA 4GNRA 4U7JA 5BPHA 3LP8A 2QTZA 1RCTE 2CJYA 2JFZA 5CM2Z 4C4XA 3AF0A 2VN8A 3EARA 3PUJA 5AM5A 5JCJA 4Q03A 2VHJA 1THMA 2O0MA 1T4DA 3IHWA 3PFIA 5EJ5A 1K98A 1YCGA 2G9VA 4UXHA 3EXG2 2VG8A 2GN2A 3NATA 3UEOA 3WJ2A 2Y1OA 1CLEA 1E2QA 2YJTD 1E99A 2QVCA 3U09A 3CRQA 4ARZB 3I42A 4P54A 1QC5B 4C3ZA 4EG1A 5TMPA 3T7JA 1BD3A 1HT0A 3JWIA 3BD9A 3EIHA 2NXNA 4MAFA 3DYVA 1MG0A 1THGA 3GJZA 2Q4TA 2AN3A 1IVYA 2G06A 3NXSA 2I6XA 4YRAA 4LZAA 5LU9A 2L19A 3B8HA 1KA9H 2CFOA 2IYYA 1VRWA 1BXKA 3NUZA 1M5RA 3BXEA 1B8VA 1XTTA 3PB3A 3UTDA 4DMFA 3OTWA 3OFVA 2I2DA 3QU2A 4YECA 4I0WB 3FNHA 1HE5A 3V4FA 4JQSA 2PUBA 3M34A 1SZJG 1I2MA 3HUTA 5J2UB 2C2KA 3BQNB 3UMJA 4IVQA 3ELUA 1OBHA 2CD9A 4LDRA 4ZXFA 5BWLA 2W37A 1Y4AE 3PE3A 3VTFA 1GQOA 2NVUA 2V3VA 2DFPA 3NHUA 1Y42X 2P8JA 2ZB7A 4LSWA 4NZZA 5L4NA 1DFGA 3H2KA 4XWKA 1OYYA 1QAQA 3SZLA 1GZ6A 2W11A 1PF7E 1U3VA 2A9RA 4Y9DA 2RGNC 4EOGA 1TOAA 2JCBA 1ABEA 1JEYA 4KREA 1E89A 4X6XA 1T43A 2VP9A 3DCIA 4WSOA 3W34A 3PRYA 2BFEA 2V7PA 7ADHA 1XRLA 3K9GA 3R0QA 4L1KA 4MS1A 2YC2C 3O21A 3NANA 5K0BA 3TNFA 3D0KA 3V8NA 2JC3A 3IT2A 5EIWA 5F78A 5TLSA 4CDNA 1TTTA 1YS2X 5EXDA 2A5FA 2ENUA 4I7EA 3S1AB 3SZMA 3T5MA 3DFFA 4BEBA 1GG8A 1ONOA 3H13A 4R54A 3ZI0A 4BNYA 3UPTA 3QVJA 3E2IA 3F4KA 3PUKA 3LH5A 1RWPA 1M2GA 4R1OA 2H7CA 3SXPA 3STYA 1LLUA 4FWTA 1PYGA 1NXTA 4TYWA 4WFJA 4OA5A 5BNTA 4D4HA 4IWYA 5LB2A 3Q7TA 1CB0A 1YRAA 1EP3B 4JLDA 5JNLA 1LZKA 4PQYA 1T4CA 3FJYA 5IXSA 1QOZA 1V96A 5EJIA 3SD7A 3T1HB 1LS6A 2VK2A 3AR2A 4JSRA 1R6BX 4NMHA 4RTQA 1RXEA 1IY9A 3DWGA 2ORVA 3OF3A 4KEAA 2HRCA 1XZCA 4KYIB 2C2ZA 5GVRA 2QN2A 5SZJA 4PVCA 2IDMA 2UUBB 1UUFA 4GM0A 3B5JA 3BG5A 1N1GA 1GRQA 4IUCS 4KUEA 2AV6A 4PNHA 5B7GA 4IXWA 1E9FA 1RI4A 2VJCA 5EE9A 2CC2A 3VHXB 4UQLA 2GJ4A 3SZ3A 2O3RA 1G9TA 4B34A 2BCEA 4HNSA 1CS0B 1O9HA 2GA9A 2NO0A 2UVPB 4W7IA 1KP2A 5CA1F 4O3MA 2PS9A 3F90A 1I9CA 1BDBA 2ZOSA 1KP9A 1GU7A 1H23A 3K0CC 3NLLA 3H6HA 2FWIA 4YRRA 2PH1A 5LDHA 2XRMA 1OIVA 3H3FA 2YFKA 1SXQA 3N8DA 3ASVA 4JYAB 5C37A 1R27A 5ESWA 3SX4A 3O3OB 1KBOA 4IIYA 2BR3A 3NHZA 4LJAA 2IE0A 1LBIA 3GG9A 4XI9A 3TMKA 4CMCA 4H08A 3HKCA 3WTBA 1USWA 2CLMB 1ELOA 1K4YA 1IYZA 3D8SA 2AR0A 4IKPA 2V98A 3HXKA 3VPDA 3QP9A 1QORA 3O8DA 1L4KA 1OVMA 3CVVA 2HIMA 1OXBB 1JIQA 2JFPA 4OD0A 3TCXB 4M0LA 4OBXA 4EFMA 4M8IA 1I4OA 4UHKA 2ZRJA 2JLYA 3DDZX 2R6FA 1BFKA 3DOIA 3M8KA 1W4LA 1Z5WA 3FSRA 1Z08A 5CK5A 3HLTA 2P9ZA 3IGFA 4G67A 3RIYA 4FOTA 1Y9AA 5T64A 5HG0A 1M1YA 4X63A 5KREA 3S8YA 2WHPA 1OA1A 4FR5A 3K05A 3MWKA 2XT9A 1GNSA 3RW9A 4K9DA 3KUUA 5IX8A 4A8HA 4ED9A 2C57A 2EZ4A 3V4PB 3KE8A 3R7SA 1M3SA 3B1KA 3B9RA 4JWTA 1XEFA 3WL4A 1PJBA 4DJDC 1NNLA 3ZIUA 4GKVA 4J0QA 1XD2B 1XC7A 4HUQA 2QAJA 3U7RA 1DRKA 4MS3B 4OLBA 4D0NA 4RVUA 1WSBA 1GJRA 3AM5A 1YI1A 3Q41A 5AKGA 4EAQA 2A35A 1WWKA 4K6FA 5LBTA 3ANTA 1X7XA 3FKQA 2H2HA 4IICA 3EXIB 4RWEA 2JD2A 5AK3A 3SC4A 4RU1A 2PBRA 2POCA 3H11B 1LNQA 1NBME 3A1WA 1O6ZA 3OM9A 2AX4A 4KXWA 5D87A 1MABA 2C9BA 2B83A 5AH0A 5HKKA 2YASA 5D5HA 3JQ8A 1VFPA 2F55A 3EZNA 3QU9A 5KNCA 4JLSA 1Y6GA 3U31A 4V2IA 4XM0A 3AVVA 3DZIA 5ARBA 3IP1A 2BMVA 4B6PA 2ZI7A 3WFJA 4EFDA 2R8ZA 1B7GO 1CDOA 1JHRA 2IS1A 1EAMA 4IMRA 2Q5QA 3NHBA 1ZNQO 1UZMA 2XEXA 2F1HA 3FM9A 3OQBA 3T6KA 4G37A 3N2ZB 4PHHA 4XSVA 2ZUSA 2G4VA 3ZIAD 1XJWA 1JXMA 1C41A 2EGGA 2JD0A 4KBYA 4KIJA 1SEVA 3ZDBA 3CSSA 2WAYA 5A7HA 4QICA 1CUGA 4TRNA 2Q7XA 3CF4G 4DILA 2VDRB 5ITZA 3RRMA 4GZ3A 1W85B 5BXYA 3NOOA 2C0PA 1ECGA 4JELA 1AGYA 1H1LB 2G71A 4LJ9A 3RVSA 3H2HA 1U7HA 3IBSA 3KLMX 4LBYA 3VJLA 4PXYA 5CTAA 1BIFA 3MGAA 1OFTA 4EPXA 1ACMA 4N18A 3CN9A 3VR5A 2R8OA 4B71A 4RX1A 3N7AA 3RRXA 2VQ6A 1QPBA 4YR7A 1BMTA 2VUUA 3CG0A 1JVBA 3ZK7A 1JSXA 2PZ8A 2ZE6A 5CJPA 5LQMA 4NBUA 1FIUA 5DVZA 1YCFA 3ZDAA 2XVYA 1RHQA 4K1XA 2CVPA 1DC8A 3DZFA 5KNBH 1N7IA 2A0XA 2FMXA 3JCZA 3RT1A 3SBEA 3U7QA 4YR9A 3P9NA 1NVEA 1XA0A 1Z26A 3C48A 3D1VA 2I99A 4M46A 4IDOA 4PY2A 1RWQA 2DBQA 3E9YA 3NBZC 3P9ZA 4FK8A 3V8BA 2ZBVA 4IXJA 3QOWA 4KR7A 1XZAA 2FDCA 2X5KO 3PGXA 5G3YA 3UGTA 1IOZA 2KW5A 4RKEA 4JBGA 4HWRA 4JR0A 3LBFA 1IDOA 3S4YA 4RO0A 2BM9A 2TS1A 4B3CA 3G9ZA 4RSRA 3ROMA 4RW0A 1E98A 4GC9A 4R7TA 4RE6A 1UBEA 2C4NA 4ZT2A 3VNSA 2V5UA 2R1ZA 3A06A 5EIOA 4MPDA 5FOQA 2R68A 1BWPA 1VYVA 3LRTA 3CR8A 1ODCA 3I0MA 2Z6AA 1KAGA 3B89A 1YR6A 3W5CA 1DNPA 5JLJA 4FGLA 3AI7A 1P77A 2G9QA 4IH4A 1GWNA 4PQRA 1YA6A 2C3OA 2XJ9A 5M3BA 4N9QA 2GJ8A 1RCFA 1VE9A 1R4NA 4IX9A 1II8A 4RSGA 2W6IA 2XWJI 3OE5A 4P5EA 4FEAA 4F5ZA 5HOEA 1WVMA 2Z58A 4GMXA 4ZI7A 2R7AA 1J07A 3CPSA 1KNQA 4O3FA 3K9BA 2ZUUA 4HAYA 3N6RA 3ZU4A 2BFCA 2HNAA 1J2EA 4GUAA 2JLUA 5K03A 2HBZA 3ZKAA 2PUWA 4YA6A 1R4MB 1IJFA 3NJRA 4A8TA 4HDOB 5KNDD 1GCOA 1XQ9A 1P91A 2RIPA 3O0DA 3U37A 2ZYDA 4Z0NA 4FFMA 4P53A 4A6EA 4DPKA 4HQFA 4FD3A 2JLWA 5AJVB 4GXQA 1O6FA 1V16B 4JDPA 4L4YA 5GV7A 2R3SA 3LWDA 3OEHA 3QKSB 4NPAA 4G3XA 2QUZA 3KZ1E 3WL6A 3T7TA 3DTYA 3RVMA 3OCXA 2K4MA 3JWJA 1T1EA 4JC4A 3UMVA 3IT1A 2H7XA 4QA9A 1T5DX 3IO3A 4HDNB 3QEKA 3T9AA 1VE3A 1HLDA 3L7CA 2QRGA 1G20A 3LY5A 1ZP6A 4M86A 2HHJA 1FDUA 4LF6B 1SOVA 3M9LA 4J1TC 2P91A 4TUYF 4QEKA 1C1YA 1TCBA 1W73A 4OQQA 4ERNA 4B3RB 2NV2B 2LWIA 5IKEA 2XZLA 4LS3A 4RBNA 3RYCA 1Z7BA 1Y3AA 1N3LA 1YS9A 1Z75A 1AO3A 5FO0A 2X0RA 4UQOA 1MO3A 4C2AA 1MA3A 2FUG6 1QHXA 1N2GA 1J8FA 2OLJA 3EK2A 1O96B 2AYZA 2QXUA 2W8BA 3BK1A 3C7TA 2QORA 3F49S 5COBA 5CFPA 3INRA 1D7AA 3HB4X 1MZPA 4ZD6A 3I76A 3IV9A 3MCZA 5AK4A 1VG9B 2E6KA 4MJ3A 3FTQA 1N0IA 3P9CA 4HLQB 3A2NA 4JUAA 1DAIA 2Q5CA 1EIZA 1ZVMA 4K6CA 2FMTA 1DT3A 5DFAA 3MERA 3W5AA 2ZUBA 4DMUB 1I0LA 1O9GA 1B16A 2EBHX 3GJ4A 4M87A 4QYWA 3LXXA 4XA8A 1HYEA 5IFLA 5I4CA 4EKNB 4PXAA 2O6HA 4X41A 2WT8A 3BH0A 1EFRA 2C98A 1V5EA 3IQWA 3T3MB 1YS4A 3FVVA 1BKYA 1VJTA 3R75A 4B43A 1ZW1A 3HSYA 5BVGA 2FLWA 3PFHA 4NHOA 3OFSA 5AK0A 4OJTA 3V7FA 2LP4Y 4BX8A 4FZ5A 1TO1E 5GZ3A 5F1OA 1G41A 5CLFA 5H9WA 1E4VA 2IYQA 4WW0A 1N3IA 4I9UA 3AM1A 1EESA 4C7BA 2HCFA 3PC3A 4G0ZA 3SHTA 4BUZA 1AKVA 4X00A 1KZHA 2A58A 2QJTA 4K9NA 1VIVA 1POXA 2RKBA 5FI1B 1YDEA 5EJMA 4CM4A 5CCXA 3ETDA 3DLHA 1GZ5A 4TWBA 5CLIA 2ZS7A 4D0SA 3FN4A 5H5JA 2D2FA 2GZMA 3IOEA 5IMSA 2A7QA 2E9SA 1EFDN 2WJ4A 4Y8VA 3NYRA 1AU9A 3ZIDA 2OBXA 2VT3A 1BMFD 3OKAA 4RS3A 3O94A 2PKYX 2K87A 1R9GA 3I30X 4MUEA 4DN6A 1OXUA 2RK6A 3OEWA 3SICE 2BEWA 5EXTA 3ZPXA 2XH8A 4YCLA 5FPQA 1JQAA 1BXGA 4XIJA 5DZSA 1UJ4A 3O03A 2Q0SA 3BULA 1CBUA 2OKGA 3FZNA 4CI0B 2PRYA 2QZZA 3FJOA 1SU8A 2ZQYA 3AHJA 4R8VA 4U9IS 3LOQA 2EZ8A 4O2BF 4A73A 2ZDGA 3GC6A 5LC1A 2ZBFA 3BHMA 1U63A 1TM5E 4FCTA 2L17A 5CA0F 2PL3A 4HKTA 2D1TA 5KYXA 3PUWA 2I54A 3ADKA 3SCZA 2NTVA 4BO0A 1V7QA 5ALJA 2WWHA 2ROQA 3KTDA 4KQXA 1UP4A 4FW8A 5I9NA 5KTMA 1USUA 2ILVA 2JI7A 4L85A 5DO9A 4OGKA 1T5OA 2D8AA 1ZXBA 3C3KA 4TN1A 3JAKA 5CVDA 5BOSA 2QLLA 2PX8A 4AMUA 3B12A 3CMCO 4GI3A 2W2PA 3SSNA 4U7DA 4AI6A 2R6CA 4JFRA 4I55F 1JMYA 5A9SB 4JT8A 2G82A 2XDQB 4LVOA 4QUGA 3BMOB 2GEJA 2C2WA 3L4SO 4Q9NA 3U3OA 2EV9A 3UK7A 4DEXA 1YQWA 1ISSA 1VSQA 3CM0A 4HR7A 5F33A 1KHTA 1P73A 2AI3A 2DWUA 5HDBB 2ZB3A 4KVGA 2AG6A 1KI6B 4XWOA 4C2UA 3TDMA 1I2AA 1C3XA 1ZA2A 4U7TB 2FF5A 3GBSA 4UD2A 3RNLA 3NVKI 3RWOA 2JJMA 3CZCA 5LP6F 2G63A 1KGSA 1ORWA 1NQ5A 2QD2A 1Z68A 3HFJA 3IUQA 2F1KA 1SHLA 3QKWA 4BO4A 3JTEA 4BO5A 1SFRA 2J41A 4Y9RA 2WSMA 3EWIA 3UXYA 1F2TA 2POQX 3UJ7A 1RWXA 3VC3A 1XEXB 1T3HA 3MTJA 4MDYA 1A5AB 1HG1A 2CVOA 2P9BA 2AZMA 3Q7PA 1URPA 2XE4A 3O82A 5FBZA 4CMHA 2D54A 1DJMA 2FLKA 4NG4A 2GUGA 5IM4F 4ALNA 2VAWA 1PV2A 4DDMA 3PKIA 2DR3A 3LL7A 1AGNA 4JLNA 5F12A 1PL0A 2GYYA 1YCHA 4RDIA 4TV9B 2Q07A 3RSCA 1SKQA 4JQZA 5IVIA 4YRGA 5J43A 2W98A 3VZBA 1YUBA 1ZGZA 1GYRA 1YK1A 3JQGA 3TL6A 3W6OA 1H2HA 3TL2A 3VUFA 3L7AA 1T24A 3CRW1 3E9CA 4NONA 2QMHA 3CW9A 4RETA 5CNIA 3HKDA 3WGLA 3ZJVA 4LGCA 4QD3A 4B84A 2JIRA 1W44A 4M6WB 1E3MA 2B21A 3PVZA 3L6EA 3JW8A 4UMVA 1Y34E 4LZOA 3UWPA 2ODBA 3E23A 3ZWKA 3DLBA 1FP2A 4DQVA 1O95D 3OCJA 4R3NA 3HLKA 3PIDA 4DA6A 3G88A 3PF8A 4P7JA 1C4WA 1QHHB 3CX4A 2IYRA 2EOAA 2WNSA 3O8OB 3IEIA 3UJAA 3UB4A 2CNWD 2VK8A 2Y4NA 3MZ0A 3GZ4A 4TV8F 3DOFA 2NVOA 3WL3A 3AC0A 1DRJA 1D4AA 5BN1A 3ZGZA 2NU8A 1AUXA 1GQQA 5CFOA 2BFDB 1HMPA 4OJQA 1D4FA 1EFVB 4MGKR 1J39A 3MLBA 1FMCA 3CSUA 4KFUA 4KQ1A 3SFVA 1EWQA 2GFIA 3D6VA 2OXRA 3C1TA 1ZGHA 2AN4A 4XXHA 2OBMA 2G5GX 2GD1O 2K7ZA 2B8NA 2FVXA 3LQFA 4IIHA 2ZRQA 1E2MA 1Z4QA 4OIMA 5SYNA 4L4ZA 4QDOA 4RJIA 3CWZA 1M8JA 3ESXA 5JO9A 3LW8A 2Z2JA 4BVAA 2D7JA 3DO8A 4I50F 2VTBA 2W00A 4MROA 3WA6A 5AK6A 1E66A 3OOEA 2FW9A 2GAAA 2FFRA 2VTKA 2ZYTX 3AUXA 1V4VA 3BDVA 3N3BC 3GU3A 4MA4A 1WG8A 4O4LF 2ZM5A 1OH6A 3S7TA 3EFBA 3EOAI 1WM1A 2DPLA 4GWGA 1LBQA 4R9VA 2G1AA 4MNTA 2VUHB 3FAKA 3WP0A 3V9AA 4BNMA 3E27A 3UT5B 1N33B 1ZW6A 1MB0A 5BN3A 4Q9DA 2OO7A 2O1XA 2R62A 3X1DA 7YASA 3PD0A 4WY8A 2X7HA 2HUPA 3MBIA 5HF5A 1BJKA 1CF2O 2ODTX 2Y1WA 1CDDA 3G5UA 4BX2A 1V1MB 5TEVA 4X5OA 3GEDA 3LI2A 3N8NA 4XIYA 1GCIA 5EKSA 1IBCA 1FNDA 4XGRA 3PDCA 1L5RA 1LY1A 2QTFA 3OOJA 3MELA 4FU0A 2OB2A 2YUIA 4YAIA 1A8UA 4QYSA 4JI0B 5HCIA 1NJ8A 2YJ5A 2V96A 3BS4A 3FVTA 4I6JA 1GTSA 2IK8A 3NAGA 5AIBA 4I4TF 3VSAA 3L84A 3FHOA 2BD0A 3DEFA 3BCHA 4YCDA 4YAJA 2MR5A 4UREA 4WVLA 3KHTA 4Q12A 1LGYA 4B3XA 4P2GA 1RP7A 5HWSA 1J23A 1YQUA 3RSQA 1BFDA 1PCXA 2AUNA 4DNOA 4QT4A 3O9MA 1J2RA 3PYXA 3UOAB 1JJBA 4FMDF 4XX0A 3K31A 1GT91 3NUGA 4YI3A 2GJ9A 1NMZA 3V7NA 4K8RB 4TZ6A 3LA6A 3I58A 2C03A 1NUPA 1UXKA 3WYDA 2VYNA 3QKTA 2IU3A 3A8TA 4KO4S 5C7IO 1Z17A 2O52A 1XJQA 4CT4B 1HLFA 1NRXA 2CXOA 3UYLA 4BEWA 1Q92A 3R3VA 5JAQA 2J9ZB 1I3CA 1NQAO 3GRVA 4TLMB 1EVZA 4DLSA 3VI4B 3THXB 1GSOA 3CINA 1YHZA 3RNOA 1VYUA 1XQYA 1ECPA 2BRUC 2OKCA 3KG2A 4YDRA 3ZCXA 5C80A 2CLSA 4KYUA 4B40A 4ZEOA 2PZLA 2I22A 2VOEA 5KVVA 2C97A 3DM5A 2DPMA 3DYBA 4AG3A 5HRAA 2P2CA 1X7ZA 3R2JA 2GLUA 5LQUA 4JASB 4JWKA 1TZMA 3Q40A 2BTEA 1SU4A 4TTSA 4WBSA 1RQ2A 4Y30A 3OURA 4OHCA 3KYIB 1NDUA 4KOEC 4MMXB 1L4MA 1Z7YA 3IMGA 4QPPA 2I1VB 3GARA 5K8TA 4IRXA 2VQEB 1L7AA 1VMAA 2I3BA 3G2MA 4ER7A 1U65A 4NBWA 3CVOA 5CPBA 1U5BA 3GLIE 1R8XA 4C08A 2OV3A 1T2CA 4RQAA 2A2ZA 4C9BA 1MORA 2CMGA 3BD8A 4PO8A 1UBUS 3R7NA 3OLCX 1S5PA 2AFIA 3KOOA 4P0QB 3PD7A 1M1YE 2PGNA 5DN6A 1ZA1A 3ROKA 4YONB 1JMVA 1LC3A 2OYCA 2RFLA 3IKMB 3V42A 5BVHA 1EM8A 1FA9A 2HQRA 3HP7A 2QI9F 5BUQA 3VTKA 2C5BA 3VAYA 1QQAA 2IL1A 4AECA 5AW8A 2VJPA 2O8BA 2H9IA 1IN6A 3L4BC 4QUEA 3U81A 3FGPA 1LD3A 2HX1A 3EIQA 3PEEA 2ZITA 3PQCA 4AO8A 4Z4QA 3ESZA 1TM4E 3H9CA 2I2FA 4QUKA 3VOSA 1W46A 3BHJA 1L5KA 2OHOA 3AEQA 5DGCA 3IUBA 3MRVA 2FUCA 3DKVA 1QIFA 5FWYA 2YWFA 4O5AA 2P65A 4CKBB 1KETA 1C1XA 4CV2A 1YDMA 1YKSA 3L77A 5CVCA 4CLRB 1QFZA 1K8RA 1E6CA 2I1QA 3N2GA 1N3BA 1PJRA 4TXHA 1T2DA 2RH9B 3EVAA 1OY1A 1Q15A 3FHCB 1XZIA 4E4YA 4B6JA 3QJGA 4BDSA 5T8KC 2MYTA 4I5EA 2N1BA 1JDUA 1PSZA 4R8RA 1LWNA 1ZH0A 1KO4A 2QL9A 3HP4A 4OXQA 3E9RA 5BQOA 4FONA 3SF8B 3LT4A 1X3SA 4II7A 2V4MA 2JK1A 4NQZA 4XGKA 3FNEA 3CUUA 3LWNA 5ADUS 1N0UA 3HCAA 5L40A 2FSVA 2A78A 2YCLA 3NKVA 3OCWA 4MPTA 2FZVA 2XTJA 1U0FA 4JEIA 5FLYA 4YT8A 4Q3AA 3VR5D 4B3IA 2J1LA 4KNWA 2FUNB 3EWAA 3LWZA 3EEIA 3L8ZA 1L7RA 3PLRA 5KNCH 1FLAA 2XOKD 3ILSA 5I7FA 3ENQA 1NFRA 4WNYA 1JJVA 5YASA 5GJBA 3O73A 1JS1X 3GGSA 4XFDA 1CFZA 1FTYA 1YRHA 2VXYA 2YRFA 1Z33A 4PZPA 3TRDA 2G88A 2IT1A 4R83A 3ZVLA 1KI9A 1FBNA 1YE5A 2HXYA 1XCBA 3FVRA 3S0JA 3DHVA 5IK2D 5KC9A 2IH2A 4YAWA 4JBNA 3RIGA 4NULA 5JAZA 4J49A 4TSFD 4CMBA 1CC1S 3JQFC 4WMLA 3GAFA 2GX6A 4P86A 4ODIA 2Z09A 5CJJA 3KJIA 3GFFA 2YCBA 5EIHA 1L4HA 3RROA 1NPTO 4CN8A 4DSOA 2EX0A 2O06A 1JXQA 1M6HA 3M6XA 4CIYA 5F98A 4L9AA 2QJOA 2QLNA 3FUUA 3LUPA 2O1EA 3AUYA 4PLWA 4PS0A 4CKXA 3P5SA 1KL7A 1AF7A 1UKEA 4FNOA 1A88A 4RKWA 3HU1A 2NVUB 2IYAA 3VR5H 3CZ4A 2VPYA 2VT6A 2NZVG 5IJ0A 1GPNA 4PAWA 2QX7A 1SXGA 4KIFA 1A8PA 5IPFA 2O3JA 1CRZA 4D9HA 5KKCA 2C5LA 1V8DA 4NDZA 2YZNA 4RCVA 3GQVA 3LO8A 4BFSA 4KLNA 1KMNA 2H1RA 5DGIA 1N6PA 4HDMA 4PFJA 3VKWA 3EGIA 4I1UA 3LUAA 4QSMA 4R9SA 1OWNA 2Q0HA 4S1OA 3UC9A 3FFTA 4CL0A 4WOJA 1NW5A 1R18A 3WKAA 4WKPA 2BV3A 4EK9A 2EKDA 3PNSA 1JUDA 2X15A 3PQEA 5ILOA 4J7CA 3BWYA 3EH2A 4ZO8A 4R2MA 2R44A 1PT8A 3B1WA 3M83A 3UUWA 3H4IA 3F7NA 3CB4A 4RHCA 5D8DA 1TMGE 1P17A 5EI5A 2ZREA 2OP1A 1MJFA 3SKXA 1D9ZA 2O6LA 2VYFA 3II6X 1YBHA 1GGKA 4Y2SA 3SM9A 4A5OA 3TJMA 4JR2A 2ZWVA 4U8HA 1T4CB 1WMDA 5E7MA 4B7UA 4AY4A 4IYJA 2ECKA 5L9AA 4HQ6A 2DX7A 2GZ2A 3GUVA 5IANA 1IHXA 3BFVA 2WWVD 4Y3UA 4AB1A 1F5NA 5CUQA 1EEXB 3RD5A 1B00A 4XFKA 3JATB 3SS8A 1BHQ1 4N54A 3OFKA 4YCNA 5J63A 2AD1A 3X1JA 4DR7B 2IHBA 4AJPA 1E1RD 3K0KA 1YL7A 5IJAA 4NC9A 3OZGA 4FN5A 5L3RA 1E69A 5IWCA 5HZGA 1J2TA 3GGDA 3EVFA 3F2IA 2V9CA 1Q0SA 4HK4A 3TPFA 5L7WA 2IZZA 1E8DA 1QZXA 2ZJ5A 4NOJA 4OK3A 4QDZA 1SRRA 1V11A 5AM4A 5FOWA 1PE0A 3GJ0A 5IXYA 4KVZA 4UM8B 4FPXA 1ESZA 1G20E 1RWMA 3PEFA 2O2JA 4FZJA 1JLMA 4J6EA 3V48A 4ZOQI 2JI4A 3DDCA 4U5XA 2O5VA 4GI5A 2WV7A 3H7IA 3N74A 3HKCB 2P7IA 3ESRA 5KWSA 4N48A 1UL1X 4X8HA 3KOYA 4INAA 2H2FA 4WK2B 4HWOA 2XNKA 1RM4A 3WY9A 4EEXA 1UDRA 3FCUB 2IXBA 3KC2A 3PDIA 4DR3B 3I2YX 3GLIB 4E7OA 1SWWA 2V1UA 1ZL2A 3KUXA 5CGZA 2YNMA<