1MOPA

Crystal structure of a pantothenate synthetase from m. tuberculosis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
288
structure length
288
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords pantothenate synthetase
publication title Crystal Structures of a Pantothenate Synthetase from M. tuberculosis and its Complexes with Substrates and a Reaction Intermediate
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 95
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2002-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 1mopA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1mopA01
3PNBA 4U7JA 3ZIUA 4MW7A 1KQNA 1QRTA 4HPWA 3SP1A 3COWA 2A1UB 3IODA 1GTSA 2A86A 1COZA 1JIIA 2E21A 4MVCA 2X1MA 2J08A 2YWBA 4KPUA 3CR8A 1JIKA 4NZPA 2TS1A 4CT0A 3FIUA 3FG9A 3LOQA 3ZUGA 4Q16A 1U3DA 4UZEA 3FOCA 4KKVA 3Q12A 2WB2A 4XSVA 4ZT5A 1J20A 4MUNA 4EG7A 2GOYA 3AFHA 2XRYA 3CLTC 4HK4A 1JIJA 1P7PA 3DPIA 3SEQA 5LM3A 3CVUA 4X0EA 1LI7A 3K9WA 4ND6A 3FY4A 1VBKA 5KCMA 2CT8A 1EJ2A 1OBCA 1QU2A 2IP1A 2A1TS 3FHJA 3MXTA 1PG2A 4S1OA 1O0CA 4KR7A 1O6BA 2QUKA 3IMCA 2WQ7A 1D2RA 3HGMA 2V0CA 2NZ2A 2I1LA 1Q77A 3D6VA 3IDFA 2DPLA 3AG6A 1M8GA 4G5YA 2E18A 1N2EA 4EG5A 4ZCQA 3N9IA 4MULA 3U1VA 5KWVA 1NUTA 2EJCA 1GZUA 1OWNA 1NUQA 2A7XA 4MUEA 4ARIA 4ZCPA 1KORA 4U8HA 3Q4GA 4MUJA 1NP7A 4MUIA 2BTEA 1IVSA 5TEWA 1N75A 5F23A 3L92A 1N2JA 1PFWA 2QTRA 2J09A 1O95C 4XFJA 1A8HA 3ZXIA 5J59A 3X1KA 3AKZA 3VRHA 4YP7A 1N2IA 5DASA 1EXDA 3QTBA 2CV1A 2CUZA 4HJRA 1ULHA 3GMIA 5HUHA 4UZFA 3UC5A 5TEVA 3RFFA 1RQGA 2QJOA 4L2IA 1GLNA 1JMVA 2QJFA 4K0RA 3ZJUA 3H9CA 4G5FA 2A1TR 1JEEA 3LCJA 4BWVA 3INNA 3IH5A 2PG3A 1O96B 1J21A 2CYAA 1U3CA 1OD6A 1VL2A 1WOYA 3UY4A 1EFVB 2QUHA 1MBZA 3ZJTA 2BYTA 2DLCX 1WZ2A 2DUMA 3E27A 1FYDA 4I6EA 2AG6A 3ND7A 4JXXA 2V0GA 1H3EA 2B7LA 3HL4A 3N8HA 4YBRA 3PNVA 4OJMX 2CV2A 3BL5A 1WQ4A 3CVXA 1TYBE 2NSYA 3CLSC 1H3FA 1XNHA 1VBMA 4CDNA 4OUDB 4MVYA 1IHOA 4QBTA 1I6MA 1QRUA 2DETA 2A1UA 3IVXA 1TYDE 2J5BA 1GN8A 4YP6A 1B6TA 3P0HA 3ILVA 2CSXA 1KKUA 2D5BA 2QUJA 2PXHA 2D13A 1M8JA 2CFOA 2YWCA 4QRDA 1MAUA 2PZBA 1LI5A 4HJXA 3UMVA 3CVWA 4YP5A 2C5SA 3HMQA 2YY5A 1ILEA 1DNPA 3ELBA 4DE5A 1KAQA 2QUIA 1WQ3A 2WSIA 2YXNA 1VBNA 2IJGX 5AHWA 4DDHA 3ZXSA 1M8FA 1Q15A 3M5WA 2ZUEA 3G59A 3X1JA 1I6KA 1PFYA 3LE8A 1GTRA 3KT6A 1T9GS 3A05A 1N3LA 3FWKA 3JXEA 4MUKA 1O94C 1TYCA 3MUEA 2ZUFA 1NYLA 4JZYA 5FO1A 4ARCA 1K92A 1QJCA 1G8FA 1H1TA 1IQ0A 4RUKA 3KT8A 1N2HA 5TGTA 1NUPA 1Q11A 2AZXA 3IUEA 1KP3A 3G5AA 1O97C 1M83A 3TQOA 4FZJA 2CV0A 1NZJA 1QU3A 1V47A 3COYA 4NAHA 1JILA 4MWCA 1NUSA 2HMAA 3IUBA 3IVGA 3HFJA 2JA2A 3MLAA 1BS2A 1UFVA 1N2OA 1EUQA 3N2YA 3CLUD 2H29A 1F7VA 1I2DA 5K0TA 2DR2A 3IVCA 1WXIA 2A4MA 5J58A 4EG6A 3AL0C 4R2LA 5BNZA 1K4MA 2PIDA 4Q93A 4AS1A 4MQ6A 1CT9A 1OWLA 1EUYA 4EF6A 3S3TA 1ZUNA 4MW0A 4PBTA 1OWOA 4MWEA 4J75A 3L93A 1NUUA 4I6GA 4MAFA 4E1AA 5LFAA 3H97A 1T9GR 1QQTA 3QE4A 4JXZA 3SZ3A 1M8KA 3RJZA 1N2GA 1QNFA 4DDMA 1O96A 1QRSA 2Z09A 3AIIA 1M1ZA 1YIAA 2OV4A 4MW4A 3MMXA 3CLTD 3RBAA 3F3MA 3OP1A 4XFDA 4ZCTA 1EFVA 2VTBB 3OTWA 1WJGA 1EFPB 1O94D 4KR6A 1Y42X 1X8XA 2H2AA 1XJQA 2DERA 2A88A 3DLAA 2X3FA 5DEOA 3AG5A 3DV2A 4ZT6A 4DNXA 3CVYA 2PZAA 3NBKA 4MWDA 4NX2A 4L2IB 1JGTA 1VLHA 3D6UA 3KT0A 1J1ZA 1JEDA 4OUDA 4ZT7A 4U63A 1G8GA 3SDBA 4EG1A 4F4HA 3ND5A 3H9BA 4DLPA 4AQ7A 4PY2A 1IQRA 1IRXA 3CVVA 1U7XA 1MRZA 2DEUA 1OBHA 1JECA 1MJHA 1PFUA 3IOEA 3TNJA 3UOWA 4ZT4A 1IQUA 1YULA 1G8HA 2QTMA 3GLVA 4GU5A 1ZJWA 1WXGA 1NI5A 3KFLA 4J76A 3NBAA 4MVWA 1LW7A 1J70A 3FI0A 1O95D 1JHDA 4F3RA 1SURA 3ZGZA 2D54A 2R5WA 1KQPA 3CA8A 1GAXA 1U0BB 4ZCSA 5H16A 2J4DA 3MLBA 4EG4A 1YI8A 2QJTA 1T6ZA 1YUMA 2AKEA 4MW5A 4EG8A 4EGAA 1KH3A 1TFUA 2X1LA 1KH2A 3COVA 1PFVA 3TQIA 3G6KA 1N78A 3KT3A 2WQ6A 3N05A 1O0BA 4MWBA 4DDKA 1K4KA 3FH0A 2DXIA 3A2KA 3H05A 1J09A 3C8ZA 1N2BA 2RD2A 4K03A 3P0IA 5EKDA 1F9AA 1V8FA 3IMEA 1YUNA 4KPUB 2PFSA 4PBRA 3ISJA 1T6XA 1F4LA 5K0SA 4R0NA 1NURA 1N77A 1R6TA 4WNYA 3PXUA 2EL7A 4TS1A 1ZH6A 5FO0A 3CLSD 2CYCA 2Z3VA 3VU8A 5DK4A 3PNYA 3TS1A 4ZT2A 1XNJA 5IHXA 1MB2A 3TZEA 1XNGA 3RK1A 3PRHA 3NV7A 4EFKA 4NAUA 1G59A 3CLRC 3QTTA 3SYTA 1O5TA 1KQOA 2HZ7A 3IOCA 1JZQA 4MVXA 2O5RA 1KP2A 1IH8A 1WKBA 3H99A 4MW6A 4R2MA 1WXHA 3HV0A 3GUZA 2PZ8A 1GPMA 2J07A 1S4MA 1KH1A 1U7DA 5H7XA 4MW9A 1MAWA 3SZGA 1MC1A 1OWPA 4JFAA 3IOBA 4MUFA 2RE8A 2VTBA 4MUHA 1QTQA 5KHAA 2Z08A 1JZSA 2G36A 1T6YA 1EFPA 3A04A 3FNRA 1IFXA 4MW2A 4P2BA 4CDMA 4MW1A 3A4IA 5DB4A 3FDXA 1YIDA 4NATA 5LLTA 3ND6A 4YMIA 3RK0A 1TEZA 1N1DA 1F7UA 2A84A 4JYZA 4CQNA 4GRIA 3UK2A 2CYBA 5FNZA 2JANA 4NDAA 1KAMA 1OWMA 1FFYA 4ZT3A 1R6UA 1O97D 5TS2A 5JBNA 1Q19A 2ZP1A 5J5AA 3DO8A 5HUJA 1TYAE 2IELA 3HZRA 3IMGA 1J1UA 4ND7A 4A91A 3RHSA 4PBSA 1WXFA 4WSOA 3SEZA 3I05A 3COZA 1K97A 4ZCRA 5IJXA 1WXEA 2GKSA 1H3NA 1NSYA 2E89A 3P0JA 1MB9A 3VGJA 1I6LA 4RPIA 3CLRD 2X0KA 3FETA 1MOPA 3Q10A 4KR9A 3X1MA 3TZLA 5HG0A 2VXOA 4QREA 1TQ8A 1PG0A 1HYBA 2QTNA 4G6ZA 2OQ2A 4I6JA 4MUGA 1EE1A 4EG3A 2HGZA 2XRZA 1M8PA 3K32A 1KR2A 2E0IA 2GM3A 2JAXA 3P52A 4MLPA 2O8VA 1WY5A 1X6VA 3CLUC 4DJAA 1ZH0A 4H3SA 1R6XA 3ZJVA
chains in the Genus database with same CATH superfamily
1XOIA 4BLTA 2PKQO 5E3JA 3PGLA 4KACA 1AN0A 4INPA 1Y6FA 3JSXA 5CMLA 1HPLA 1WDKA 1V16B 3QLUA 4I81A 2R7KA 4DSUA 3RVRA 3OC6A 5AW6A 5HSGA 4WRRA 4P4UA 3BB4A 3QUQA 2X1MA 1JJAA 2VQFB 4GSKA 3EDOA 1AMUA 2YJ5A 4NECA 2WWHA 1BW9A 4YEDA 1ZOSA 2CVZA 2JI4A 3GA7A 4XGKA 3AEQB 5K4GA 4AXBA 1U4NA 2OOSA 4NE9A 3HO6A 1XWFA 2ICAA 3AVOA 4OB7A 2NUPA 2GBPA 3FCOA 2J7PA 2ZEJA 3E35A 5CURA 5AOCA 1TAGA 2LMEA 1HQKA 3SK0A 1PV4A 2L0XA 1U9CA 2OZKA 3TMKA 6CHYA 1RXUA 1SEVA 2CK3A 3X44A 4US2R 3G2MA 1FXUA 3B85A 1RQXA 2W2KA 3FKQA 4NEGA 5JCPA 2NTYC 4PFJA 4PRLA 1OJ7A 5KWIA 3RTCA 5L7TA 4S1OA 1HF3A 5A3RA 2I2CA 1B8UA 2LWIA 3OX2A 2E85A 4ZD6A 2QUKA 1DXOA 4FZ3A 3B1VA 4JBIA 1MJFA 4MIKA 4FXOA 4UNRA 2ZWOA 2ODQA 3FI9A 3C24A 2RGNC 1XQXA 2R3SA 2IIBA 4ND2A 1PVDA 4L4YA 1GNLA 5KSZA 1CIJA 2VP6A 2X7XA 1L7NA 1HZJA 1N3YA 2BGNA 3E81A 4IGFA 1LBIA 4MV6A 1LDYA 1GPH1 4OD0A 5KSPA 3FOWA 3MTEA 5MGBA 1T5DX 2V9ZA 2WJ6A 1W5AA 4WNAA 4ZQIA 1Y33E 1TYEB 4CFYA 3ZN2A 3ASVA 5B7NA 3IAEA 2R7LA 3UJ6A 1CTQA 3TNLA 1LPAB 4MUEA 1QRDA 4EKNB 3KOYA 3QJGA 5C4IA 4X61A 3GLKA 3HBAA 2BFMA 1HI9A 1PZFA 4BP1A 1C0KA 5DOVA 3FGNA 4X84A 3NALA 4I0WB 3CUWA 1IVSA 1Q0UA 4O4LA 2PUVA 2ONYA 4HLDA 1G19A 3QSYA 1IG3A 3PEEA 2D3WA 1VSQA 1K3TA 5KX5A 1H8HD 1P1JA 1SK9A 1FYXA 4WZBE 1HTWA 1R37A 1HM5A 3FPKA 3BDVA 1N2CA 3NP9A 4ZVVA 2GPSA 3C2QA 1GCOA 3ORHA 4K9LA 4R84A 4G1MB 5DGTA 3HCDA 4FFWA 4C2BA 3GMIA 5HUHA 2PEYA 4A0QA 1WHSB 4D42A 5BQXA 4Z4FA 1HDOA 4A8TA 2IXGA 2BISA 4CODB 1CUCA 1JLRA 2V5UA 4OQ4A 5DYGA 5K8IA 3GGPA 2CGEA 2H18A 3GGDA 4B17A 3ZJUA 1Z2CA 2NNLD 3PEVA 4G5FA 2H8KA 1ICIA 4CQJA 2G83A 2Z3WA 1AM4D 3KUCA 3OZ7A 3IQWA 3PPYA 7REQA 2Q62A 1S1CA 4QDOA 4EHLA 3LQ2A 4MVJM 3L1HA 4A1FA 4CUJA 2FPPB 5ADVA 1IEXA 3OPXA 3OLXA 3TQFA 5ARDA 4EATA 1RLTA 1Z4OA 1GNSA 3CRW1 3FWHA 2YIMA 3FFXA 4L0DA 1C7FA 1KBOA 1NU8A 5DDIP 5JI3E 2KE5A 3PICA 1PHPA 4HEA1 5AXCA 4LF6B 2YBDA 5J4LA 3ITDA 1D03A 3UBMA 1XZHA 4YA6A 5ICCA 1NW5A 2O2HA 4MYRA 5EHGA 1FRVA 3NP7A 4LVNA 5IU6A 3MCAA 2AG6A 2I4TA 4NF2A 1H3EA 5FYQA 1ZN9A 5IULC 2JHPA 5JADA 1ADYA 1R0RE 2ZR8A 3BWBA 3U7EB 3RT9A 3LZCA 3ZCQA 2Y71A 5AW7A 2M6RA 5HRAA 2R8YA 1MKYA 3E48A 3P5SA 3TVYA 3WIOA 2CMFA 2H9AA 2GARA 3CLSC 3WIDA 2YV2A 4D82A 5SYNA 3TXAA 3EW7A 4PTYA 2FUCA 3K8YA 2ZJZA 2OBYA 3W78A 3VOAA 1HT1E 3RUAA 1SUSA 4FJ1A 5TV2A 2CMKA 3UA4A 3AX6A 4AO6A 3QBVA 3K1AA 1QRUA 3A3YA 3VMFA 6REQA 4G2NA 3HG7A 1MAVA 3LT2A 1YL6A 2G4CA 2UZ0A 2WD9A 3H2KA 4RBNA 1FYVA 4UUBA 4YP6A 3TL2A 4ALNA 4EO9A 2PU7A 1WZEA 5HX7A 2C2YA 5B2FA 5GWXA 4F96A 4U7PB 4PQGA 2B4KA 2W43A 1UJ6A 2B8WA 3K2QA 2HC9A 3DTNA 3Q2KA 2X6QA 1DKOA 4LVCA 4OAQA 3B1YA 4GE3A 4HJXA 3A8TA 1L7DA 1EBBA 4YACA 3GVXA 4C0HA 1SG9A 4UCWA 1H4SA 2X58A 1J8MF 5FWAA 3PFCA 1ANKA 4C6RA 4D1YA 1AKYA 1GP2A 2A2ZA 1AN9A 1OU4A 4ENTA 1P4RA 4C7OB 1DC3A 1X70A 2JBWA 5A7GA 4IMIB 4GM1A 1VC2A 1EVIA 1VBNA 2YZGA 3FBWA 3TGWA 4PYNA 4S0XA 2GZDA 4BGVA 3WFIA 2P9TA 3OICA 3Q9NA 3MPOA 1GTRA 3A6LA 1UL1X 2OCBA 3RSHA 3MXOA 4DJJA 1RM5A 4FMDB 5PNTA 4W8GA 3CG4A 4G2TA 4JCCA 4K9OA 4QC2A 4QJ5A 3N7UA 1IONA 2EX4A 1IL0A 1XZDA 4F93B 4QOHA 1M73E 2C83A 5TJ9A 4E32A 3NVKI 1ORTA 5FA5A 4E30A 5KOIA 1EU1A 2VHEA 1OZGA 3DCYA 1XJ0A 2NW6A 2B83A 5JYDA 2ZBGA 1LV8A 3LC7O 4JEHA 2AX4A 4Q3LA 3LBYA 3SM9A 4M55A 3DUFA 1WR8A 4IM7A 1T3GA 1CW2B 1G0NA 1S89A 1IBRA 1OBVA 2PUDA 1I3MA 2AKAB 3OZEA 2YYYA 4EW6A 1SZDA 3FGOA 1M2OA 4MVJP 2HUNA 1ZHHA 2JA2A 2XYRA 3OAAA 4ZZ0A 5JCOC 3H0KA 4NCBA 2BP7A 3E4DA 4LF7B 1N2OA 2IYWA 4IHQA 3ZE8A 1G7SA 1JDBB 1ZRNA 3N6RA 1RDFA 2PZMA 2VRWA 1Z25A 2HFKA 4CM5A 2HTFA 3BEOA 1M1YE 1WXIA 1XZIA 3QPDA 3VPCA 2I80A 2I71A 4ER0A 4EZBA 5HM6A 5KSYA 1U1IA 3AL0C 1M2KA 2PD6A 4IWNA 1GGKA 4LWPA 1JKXA 4CV0A 3A27A 4CXMA 1FFDA 2OGUA 3OOSA 2JIZA 1SGWA 3H1TA 4ZYVA 3WE7A 1B00A 5JXIA 1OHHA 2QLBA 2IU3A 3FYUB 5C1BA 3OEWA 2DPGA 4KO8A 2G16A 3FFBA 3VO2A 4W9RA 3KVVA 1FMCA 1Q20A 2XF2A 3INRA 2WOOA 1NBHA 3B70A 2QSYA 3QU4A 2ONCA 3D8UA 5EZ5A 5LFAA 3U26A 1CF2O 2TMYA 2IYFA 3KAQA 1FQKA 1H4VB 3PWSA 4ZI5A 1NTOA 1Q21A 4OB6A 1DX9A 5BOVA 3UJ7A 4K6OA 3DW3X 4B80A 4RKFA 5LZ9A 5IKXA 1VYUA 3FMGA 1NMYA 3KOOA 3NI2A 2ATEA 2N1BA 2QZSA 2VVTA 2GAFA 4W5NA 3Q2OA 2QR3A 1YS1X 1YS4A 3W9BA 4EPXA 4P38A 3RPEA 1EHCA 2EYQA 3D81A 1T3ZA 2Y93A 5F7XA 1P1HA 2BI4A 3GR6A 1DAPA 4ABTA 1JLLA 4GMGA 3ER8A 1KO5A 4C7XA 1SHJA 2RHTA 1FSFA 2FXIA 1XLUA 3GJ7A 2FPMA 3A9RA 4Q7JB 5SY6A 4PR0A 1W6UA 3B7PA 3MQFA 4AP5A 3GFPA 2P9EA 2X8JA 3ROZA 4UULA 3NASA 4OQEA 1XL1A 2J9YB 4EQ6B 1N8SA 3KB6A 5DHPA 5EUMA 4OP1A 3F9CA 4TWAA 4ZQBA 1QGUA 1KEEA 1AT1A 1H9BA 2K7FA 1FMTA 5K3SA 4XB1A 4B43A 4JB8A 2B92A 4NTZA 4D02A 4PC6A 1CZLA 1OBHA 1QHIA 1IWBB 1R8QA 5BW5A 4YQFA 5HIKA 5D3ZA 1ZHFA 4HX9A 2YV1A 2NO5A 4RA9A 3OZIA 4BLQA 1OMOA 4BQQA 7MDHA 3EXAA 1V95A 5TR9A 4DIMA 4YCJA 1JR3A 4G5RA 5CVEA 4LPSA 1AKTA 1SBTA 1Y9EA 1A2OA 4QSHA 4KE8A 3AYXB 4EGQA 1B1CA 2PSJA 2X8WA 2GHQA 3FUWA 2ZUSA 2XNKA 2PPVA 2J4DA 1QRAA 3MLBA 1LLCA 3EC1A 3M6LA 4RHTA 1E66A 1L6RA 1UBSB 4YAIA 3FR8A 5IXYA 1LJ8A 3B3GA 1KQ3A 2IY7A 3LW8A 3V34A 3B1WA 3SG0A 2CVOA 4ER3A 3T7TA 3G2QA 1N5DA 4CKCB 2OB2A 4URHA 1KSHA 4IS3A 3SNKA 1A9TA 1U8ZA 4JBGA 5JVDA 1ZNWA 1N9GB 13PKA 1FU4A 1VYVA 2QG4A 5KPDA 3JVIA 3V2HA 2DFVA 4CI9A 3RSGA 5CBPB 1N2BA 2XQKA 2ETVA 3DOEA 3NKFA 3Q5EA 1OGJA 2EZ9A 5IVIA 1DEAA 3BA1A 1SXJA 3BXGA 3IMEA 5LQSA 1RADA 5G0WA 3SIPA 2PBRA 1SOUA 1NBWB 4IMJB 1EA5A 4NHOA 2NU7A 4WCFB 4R98A 3ZR4B 4A9AA 3AF4A 3E61A 1RXCA 4DADA 4NH4A 4LDNA 1FBNA 2X3UA 1QDEA 1ZLYA 5EKXA 5TMBA 1IY9A 3ZV3A 5ALHA 3LXXA 1R6TA 5JO9A 3ES9A 3E9RA 3CEPB 3IR5A 5CM8B 3ROQA 3W04A 4A7PA 5JS8A 3E9ZA 3SGLA 1XD2A 5K6AA 5DX1A 3OIWA 5BVHB 2GHRA 4ZWNA 1CX9B 2HT6A 3AU8A 5H83A 1X7WA 2JATA 1CJCA 1GL6A 2PX4A 1CRLA 2HAEA 4PX3A 5LZ8A 3RFUA 4DIUA 4K6HA 3QEBZ 4Q21A 2AFIA 3AL3A 4EABA 5C7LO 1FDIA 3IJRA 2QW8A 4YJFA 3OLWA 3HYSA 4E5KA 2NMVA 1DRJA 1CDZA 1P39A 2R66A 3H13A 4JQYA 3GJ8A 4EFKA 3JQ9C 2GAJA 5AP9A 2FZ4A 2I6TA 4CKBA 4MS4B 3FRIA 1JZQA 3A6ZA 5BMVA 1RLOA 2PL9A 4I55A 3SY8A 3W1EA 4ZMSA 1NV8A 2I6GA 4IJWA 3H3XA 1R00A 2V8OA 1Y80A 3LQRA 3RWMB 2HNKA 1SVIA 3HJAA 4DCVA 2ESRA 2VPTA 3KJGA 2NUTA 4MGEA 4TX1A 2E82A 2YZ7A 4KUHA 1BQEA 1YS9A 4IUCS 2RK3A 2RE8A 5BSVA 1OAAA 1D9ZA 2PRKA 3AZOA 2F9LA 3CXRA 3KZNA 3A04A 1EFPA 5IUKC 1TVKA 4OHPA 1N7JA 3KEQA 4INAA 1I33A 2IXAA 4FZRA 1SD1A 5EFOA 5IBQA 4F4UA 4UTNA 5BN5B 3TEFA 3EB9A 2XA2A 1YWGO 1P9RA 2DQYA 2WZQA 2GPAA 1XQVA 3AU9A 4OM7A 3SEFA 5CVTA 4O1MA 2FW9A 1ZIPA 2F43A 2X9NA 2YHIA 1F7UA 2Y0PA 4WOJA 3H2SA 1QFZA 3MWEB 4G0PA 4MARA 1KAMA 5ESDA 4AWAA 2B99A 3BXOA 5GVRA 1GPLA 2NXEA 1HXHA 3OE4A 3OLYA 2X4LA 3LBNA 1D1SA 1P2BA 4ETNA 2OM2A 2JLWA 2G1JA 3DAHA 4DC1A 4LYFA 5EUQB 1BHSA 4GFDA 4H17A 3UCEA 3STTA 1ZD4A 5AW5A 4ARVA 4JJFA 3EGDA 3MMSA 4Q39A 2BY4A 4YCMA 2WFZA 3I2HA 3VAAA 4HB4A 3I4LA 3OQ1A 4OKIA 5FUXA 3I05A 2GRAA 1S9HA 1YZHA 3HUUA 4XOUA 1SBIA 1CS0B 1SFRA 1TJNA 2G28A 2X6TA 3MRXA 3QA9A 3R3UA 2JNWA 2R86A 1OROA 3O2SB 2PSSA 4TUYF 3UUFA 4RZUA 3VGPA 1BNCA 4UM7A 1ZD3A 4PYQA 1NG1A 4F84A 3EIQA 3CRMA 2ZVDA 3U0VA 3L8FA 4GM0A 2BT4A 1C4KA 1B6GA 3W2GA 3HJGA 3PLNA 4MA5A 2IHNA 1A8SA 2RIPA 1UM8A 2WFLB 3K1TA 1Z06A 1A27A 3O95A 3F5MA 4UKDA 1S0UA 1BHJA 1ITZA 2FWPA 4I2NA 5FUYA 5EVCA 1IDN1 3CMCO 1ZM2A 4TVKA 3ZH9B 1U0SY 1W46A 2W2TA 1NKTA 1FNCA 2BTQA 5CNJA 3H2JA 4CMAA 4NCIA 1VA5A 3LF2A 5JQGA 3VPXA 4DR3B 2HIHA 1NN5A 4IP0A 2ZRMA 5EZYF 2PX8A 4QM6A 3H4TA 2C5GA 3DHNA 1ZI6A 1ZGJA 3EA0A 1ZJJA 1BYIA 1D8TA 3NVDA 2JLVA 5IC6A 3GJRA 3KQKA 1XDSA 3TAXA 3PLAE 2PT9A 3FPAA 5BUSA 2BZ1A 3DYBA 3ZBQA 1F3LA 4B75A 4AJIA 1RYBA 1QC5B 2NGRA 3KQTA 2PZKA 3LQ4A 4QLAA 1NF9A 4DCGA 4L4SA 5AD1A 3CR8A 1I7NA 1Q7TA 1URPA 3WBKA 1AKNA 3ZUGA 4Q16A 1U3DA 2FN3A 3JQ7B 4LJLA 2GEDA 5J4KA 2BBWA 1L3CA 4M60A 2WU8A 1H2YA 2EBFX 4I3GA 4NYIR 3R44A 2Q5HA 3D3JA 3Q6MA 4XSVA 2FSUA 4P98A 2VRBA 4RVNA 3W6OA 4EG7A 2ON6A 2Z1MA 2Y9MB 3OE1A 4B45A 2Y1EA 3L84A 5DISB 3PBKA 1FL9A 4IV5A 3RTAA 3KKZA 3W5AA 4UFNA 3E23A 3CGGA 2C9OA 1GJRA 1H66A 3C1OA 5HMLA 1G21B 1PL0A 2C7OA 5B4UA 1WVMA 2DSNA 3WKCA 3U6KA 4AJOA 1ACJA 3MTDA 2IP1A 3FHJA 1UP4A 4JBYA 2VDMB 1XMIA 3MWLA 3TB4A 5JNTA 2R6JA 3U4AA 5JZMA 2H0AA 3ZQ4A 3AHCA 4ETWA 3T61A 3IMCA 1A7KA 3GLHE 3MWDA 4NZOA 2PZEA 5IAKA 3STUA 4DLKA 2WQ7A 4MWOA 2H63A 2GAOA 1J8YF 3TPZA 4NJMA 3HB5X 4TKUA 4RESA 5FI5A 3AG6A 2QROA 3N87A 3TNDA 4BO7A 1O0SA 1YJCA 4R2HA 1Z0KA 1YR9A 2L18A 1E3WA 2MSEB 3ZTTA 3D2AA 3RHFA 4FMDF 3WRXC 4DNQA 3GAFA 5I4IA 5BWOA 3U7GA 1P3Y1 3U1VA 4TTSA 5EG5A 1SXHA 5KWVA 3E22B 2DBZA 3T95A 1U02A 5JYEA 2EJCA 3PDIB 5JJIA 1T2UA 2C3OA 2EZTA 3BREA 5JDIA 4BHRA 1CUXA 1OX4A 4Z7NB 1XALA 4DCPA 3WGGA 3BL8A 4BZZA 1RTKA 1TM7E 2QNIA 2YYAA 1YVPA 2ZIWB 2FH5B 2ZVJA 4IILA 5F12A 2CXOA 5TEWA 2VWQA 5E6RB 2W48A 4BN0A 4OHBA 1MTZA 1KE1A 4EWLA 2BJWA 3N0XA 1EGHA 2XR1A 3HU3A 2ZE6A 1U31A 3VQTA 4D4MA 4N1AA 5J59A 5FPPA 1DDIA 3HS3A 3K35A 4WK6A 3TQCA 2P75A 1M6EX 3CEJA 2CV1A 3DFMA 1EDOA 1XN4A 1ZUHA 2QU8A 4KRFA 1SVOA 4PCVA 5FNVA 3O93A 3GJ0A 3F6YA 2ZJ3A 5CCXA 1T4BA 1TM4E 3C3DA 3T1HB 4UQOA 4C0AC 1PDVA 3GFQA 4L0CA 4E5YA 1RZUA 1XMPA 3L4KA 1V41E 2AC7A 5F4ZA 2BH2A 4PPGA 2OXIA 3H9CA 4PX5A 2NZJA 4KDFA 4RXUA 2V7GA 4IJVA 2JGKA 3G9QA 2A9JA 3KB1A 4E11A 4ZHSA 1HT3A 4YMSA 1SB9A 2I6FA 3QU2A 4AAYA 4WHMA 2VNIA 4FGSA 2HU7A 4L3WA 4D57A 3FKSD 1GKKA 1MB0A 4I1SA 3JVUA 1T6BY 3M6AA 3PPVA 4TV9B 2IPLA 2QPAA 4LZPA 3R0ZA 5ERYA 3LLSA 4LX0A 4PQFA 3DEHA 4ZHQB 3ZBTA 1NYRA 1Z5VA 1IK6A 1EFVB 2HA4A 2ABWA 1XDWA 3HDVA 1U94A 2OGSA 2V9PA 4RX1A 1JNYA 5I8ZA 1ULSA 1NSTA 1OGIA 1I3CA 1VJ1A 3RUEA 1MX9A 1N7GA 5D51S 1KI6B 2CJWA 3D4NA 4DV2B 3F47A 3FSJX 4OAPA 2FG7C 4GSYA 3V8BA 2O2GA 4G24A 5HIIA 3ZI7A 3N8KA 5F1YA 5IJ0A 3E84A 4UHJA 2H2FA 2CF6A 1UC8A 1PTJC 1QPGA 4W1PA 4A16A 4DBLE 3OIVA 4RVFA 4G85A 1T2NA 4BZWA 1X7XB 1N1EA 5IC4A 1AKQA 1IHOA 3ENKA 3L7AA 4IIBA 4QBTA 5BUQA 4V0RA 1E2MA 4PZPA 1Y0BA 2PZJA 4AZ3B 2DETA 2RAPA 1FJXA 4FDLA 2YHUA 5JZVA 3MJVA 3DEFA 5CCEA 3CXUA 1E59A 2V03A 2JVKA 3B2QA 5AJWA 2ZPAA 3ZWOA 1DIHA 2OZLA 4KNWA 3RROA 1JYSA 4MGHA 5KKAA 3VYWA 1RJ9A 2VPQA 1LJUA 5B55A 4YFVA 1T3LA 3EXHA 3VTAA 2P1RA 3CB2A 3RS3A 4CN9A 4HWKA 1TCAA 3BQ9A 1QIJA 1PWEA 4WQMA 4Y2HA 3WGMA 2PZBA 2PUGA 1LI5A 2EDCA 3A4TA 4MGZR 3SS7X 4EJ0A 1E6EA 2YWFA 3PD7A 1RAFA 3AY6A 3LK6A 2UUCB 1DNPA 4F3TA 1MAHA 2CZCA 2BEKA 2TSYB 4RAOA 2EVWX 3VDNB 3ZGXA 4H1UA 2PJDA 5IDVA 4IO0A 3RQSA 3V2IA 3FF1A 4C4TA 4Q6BA 3KQNA 4MQBA 3S2IA 1M72A 2YUIA 2QN8A 3NCHA 1AU9A 2NTVA 3P19A 3LGSA 2X42A 3MINA 4G5SA 2YZNA 3EUEA 3DFUA 3F4KA 4OHKA 1QM5A 3BDAA 3FKJA 2OBFA 3B9PA 5KYWB 4ZGBA 4W63A 3WB0A 4UM8B 3LRPA 4GBED 3D7MA 3IHWA 4Q4JA 5FYDA 3NHSA 1BHO1 3RRJA 4BWFB 3H5IA 1NN1A 2HREA 2WUGA 1H8EA 3O84A 3AB8A 2J6CA 1U2EA 4P3OA 5AVKA 3JYOA 3Q8KA 3K31A 2XXJA 2YC2C 3LZDA 1DMRA 3E0XA 3I5UA 2I67A 4LOIA 1OXXK 3OQMA 1C1DA 1X77A 3KJQA 4OH1A 3VTZA 1T0JB 2HV8A 2IYPA 5EIEA 3ADKA 3JZDA 3B3JA 1TAQA 1X7ZB 2BOVA 3IL2A 2HZBA 1AKWA 4F9GA 2XYQA 3BWDD 1XZNA 1G5FA 1L8OA 1PYOA 2PR2A 3U5ZB 2R8OA 2AOVA 5CXSA 2GZ1A 2JFHA 4XE5A 4M99A 4G26A 2HPHA 3AGPA 4Z1OA 1U9ZA 2FETA 2Z2ZA 1YTLA 3R5TA 1MX3A 4JI1B 3V6MA 4HXGA 3LIIA 3RRZA 3NUGA 2H29A 3VNQA 4Z53A 3RV3A 1G5QA 4W5WA 4X6YA 4X20B 3LP8A 2DR2A 4MI9A 5EYPB 1N9KA 3KPUA 2B3DA 3MAAC 3D8BA 4PGAA 3HKBB 3M2PA 3K4HA 5FV7A 5J58A 4CPDA 3BSYA 4R2LA 4XUEA 3RVJA 1EBFA 3PQDA 2OK8A 4LYEA 1CUVA 2QNRA 3AF1A 3QLUC 4AC9A 2BDUA 3IQFA 3MMZA 4IHJA 2BSQA 1G9XA 1KEZA 1SUFA 1QIGA 2QE7A 4K3UA 1DBPA 3WNVA 1UPUA 4E2WA 1MAAA 3FNBA 1G20B 3VI3B 1M0EA 3TRDA 3CHYA 3TZHA 2HDWA 4EITA 1E2UA 2QDXA 1ZVJA 2E9SA 2AJBA 2OAEA 2FPKA 1RKUA 1T9ZA 2QLLA 4MGKR 4YT8A 3MJSA 1PZNA 2IHKA 3DSRA 3KHUA 4BVGA 2XEDA 2OUIA 3CFYA 3UF0A 5FJJA 1T5IA 1U3VA 2XRFA 3PC7A 2PGAA 2JGRA 3NS7A 2QN1A 4G67A 2GDJA 4U8GA 4HFMA 2PMEA 3DNMA 1FP4A 4OFXA 1YZNA 3EFEA 1SNYA 3IRVA 1JFFB 2QTWB 3A7EA 1KP9A 1X15A 3II6X 3MFQA 4QPNA 1ODIA 2OD2A 3KB2A 3PDHA 1E63A 1SCAA 2W22A 5BVGA 1IZ0A 3A6GA 1XJQA 5B6JA 1ORWA 1V8PA 2Q99A 2XNCA 3SR3A 1QG0A 3WGZA 2QSZA 3GELA 4QZVA 5EJ8A 3M82A 2DAPA 4FT4A 1E92A 2VJQA 1POWA 1WD7A 3CVYA 1VLHA 2GPBA 5F51A 2QQ0A 3P9RA 4PV7A 5T6MA 1ZGGA 4E3ZA 2GRUA 3G9TA 1HO3A 4BEWA 1UP7A 4RQTA 1RE0A 3D31A 3F1LA 2DEUA 4I50F 1MJHA 4N54A 4RZQA 3TNYA 4Y2XA 3KJFA 4GECA 2IIPA 4LF4B 2R87A 4CF4A 2GGSA 1JT2A 3O1HB 1SHLA 2F1OA 5JBQA 4NYMQ 2J46A 3OP4A 1VB5A 1WXGA 2G1UA 4B0OA 5BWMA 2ATXA 2WSLA 3ESZA 3NBAA 3Q72A 5JXHA 2AXNA 3AWIA 1AQNA 2MHCA 3EVEA 1T3TA 1NM5A 1O95D 4HOYA 4DA6A 3F6SA 3M9WA 3PE6A 4E3WA 3ZV7A 2VK1A 2II6A 1ISFA 3JYHA 4L08A 2FKAA 3W8DA 4KODA 4F1KA 1C0PA 1EUDA 1PT6A 3OIFA 3PQ7A 3OQ6A 4JENA 4PZLA 5AXDA 3T0GA 1X86B 1LVUA 1VGVA 1H2RS 2P79A 5LP6F 3LLUA 4UMVA 3NH6A 4PAGA 3GEHA 1VPVA 1ZSVA 3C74A 3RV4A 3CNLA 4KRXA 4YPFA 2I3GA 4GZMA 3AONB 3VPFA 3M1YA 2B94A 4RZIA 3GXOA 3O73A 5JD5A 1Y1KE 5BSKA 2ZE7A 3SE0A 5AKGA 5JCJD 1N78A 3EJWA 3AZQA 1T0HB 2WFAA 4ZKEA 4US1R 1RT9A 4HMOA 5E9AA 3EWIA 3HA2A 3C6QA 2R7AA 4GMXA 5LDHA 3C8ZA 3TSOA 1V35A 2BI8A 2PEZA 3IP5A 1TK9A 5FLKA 3R7FA 1Y7LA 1NWCA 2FRVA 2LDXA 3H9GA 5TPWB 4B2PA 5JJKA 5A7FA 5JJCA 1WHTB 4F5WA 5LZ7A 1TJ3A 1YUNA 1JI3A 4KLRA 1NFRA 1W4AA 2AB0A 4QYTA 1U0JA 4B4DA 2RJ3A 4BGEA 1Z17A 2O7QA 4RK4A 3ZZ0A 5IYZA 5K0SA 3SVTA 2Z04A 1A8QA 5EJ2A 5CDUA 1M7HA 2P65A 3T5TA 3GJZA 1R0SA 1DL5A 2M6SA 4ZREA 1LA2A 2ZYAA 3G6WA 1T8PA 3KIPA 4NZMA 5CJ2A 1ZS9A 3B1XA 1GYPA 1SRRA 3LOPA 3HMKA 4CTMA 3VU8A 2WT9A 4R8LA 4MRRA 3PNYA 4YAEA 5AOBA 2H92A 3PHGA 4F91B 1B23P 1N3BA 3UEOA 1USUA 1RIFA 1SCJA 1XNJA 3FZNA 3BGIA 1OASA 1RBZA 2QXUA 4JVMA 3AW9A 3C14C 3VKFA 2GYWA 4WA8A 3PJRA 4JR0A 4BLOA 1KI9A 2P2SA 3ADPA 5CK5A 1HURA 3ZVNA 3IR7A 4N39A 3LDAA 2QMQA 3B6IA 1X42A 3R5KA 3QTTA 2JEZA 1PJCA 2X0NA 1AE1A 1NI4B 2RHCA 5A0FA 2GJAA 5K3OA 1IM5A 5CUQA 2I2XB 1IH8A 4KK3A 3RAJA 4WY2A 5EQJB 4B35A 4TYWA 4KHZA 4XDYA 3OT1A 3P4YA 3BB3A 1IC6A 1NMQA 2WE8A 1Y8QA 2X9GA 4RJ2A 4YJ3A 1N9ZA 2JAOA 1VKNA 3A1EA 3DDWA 3KQQA 3WWYA 4YY3B 4KC0A 4IX1A 4RV9A 4TMYA 3TR0A 2ZI3A 4AROA 1D4ZA 1Q5PA 2OORA 3KJZA 4TTPA 4J0EA 5TQVA 4GPZA 3NBYC 4N9WA 4L3VA 5FLEX 2E37A 1QTQA 1YQWA 3NOOA 4BNNA 5D5HA 2W70A 5FX2A 5C8VA 4HGRA 3ZUPA 1LLFA 5KCZA 1PX0A 2RKOA 5ESWA 1RMQA 1I4TD 1WDWB 3VZBA 4BS9A 3DBHA 5AVXA 4CMKA 3ECAA 1W9HA 4K6GA 2ZRFA 3JD3A 2V4MA 3DQPA 3I9LA 4G8DA 4IJKA 1V39A 4V02A 5C2JB 1H05A 4NFHA 2QRVB 3D5TA 1Y98A 1UODA 4CEIA 1QSGA 1B43A 3H3JA 4Q3DA 3IEXA 2FOXA 3T7IA 16PKA 2ZKIA 3E15A 3AR5A 4HDNA 4QPPA 5L9AA 1QQAA 1NVTA 2XPCA 3KYCB 2G8NA 1UMBB 3U2QA 2XVMA 1P61B 5FPTA 5TS2A 3KUXA 5D6OA 2W2VA 4OL9A 4UQLA 2BKVA 1XTUA 2OO3A 2V9CA 3BXFA 1CKEA 2IELA 5JI2E 5KU7A 4X6UA 3EBLA 3JPWA 1RXIA 4ENWA 1NBOA 2YNMC 4KRYA 3TXYA 1YBHA 3HCCA 3PENA 3COZA 1P0IA 2NU9A 4EW1A 2DYKA 2FWMX 5KNDA 5TS3A 1RHMA 1ZP6A 5EWMA 3U16A 2HTEA 1XMOB 4YP0A 3BRSA 1K7EB 1Y9AA 1NSYA 5HJEA 2OTCA 3S8YA 1ZCJA 2RCNA 4MOWA 1UDAA 5B1HA 4S04A 3GCGA 1MDBA 3UMRA 2IYYA 1ZR4A 4HGOA 5IBRA 4Q24A 2C5AA 2XUHA 3AQ4A 1T5TA 3JQEA 3FKSA 4KTVE 2PPLA 4NMLA 3S29A 3MUNA 5EKSA 5LXTB 4F5DA 1R16A 2WUEA 2ZGVA 3TZCA 4C1BA 3DQZA 3NJRA 2C97A 1VHLA 1W35A 2AH5A 1NXQA 1TU0A 3LCRA 1PR2A 5AKZA 3EGOA 5EQTA 5G3ZA 5B58T 2O57A 4KXWA 4U5QA 2UYOA 1RBQA 2GM3A 5BW4A 4G4SP 4MQMA 4ZI3A 4KVZA 3BIXA 2HA6A 2ZW9A 4IIJF 3VR6H 2A8YA 1NG9A 3EC7A 1YASA 4CM9A 2ZSHA 4K05A 3A31A 2XWJI 4HPWA 3WYCA 1XROA 1YZFA 2O0HA 2Z0MA 4FHDA 4GSLA 3ROMA 1ZLXA 3STWA 3C4VA 3DGFC 5IK2D 3TZBA 4C2UA 3M89A 4AU1A 2FWAA 3BWVA 4J43A 1TAHA 5AVRA 5HOQA 1YS6A 1U5AA 2OZEA 3UOGA 2E21A 2GCNA 2PUWA 3K6KA 4CF5A 3CZRA 3DF7A 2XMSA 3AM5A 1MPTA 5JH7F 2N42A 5LMUB 1MRSA 2V7WA 3ZLBA 5JJ5A 1QHYA 3AUXA 1RKBA 2I2FA 4DHWA 1H0HA 1VB3A 3P1JA 1B6RA 1KRWA 2D0DA 3Q12A 4E46A 4P36A 5JJBA 4KBGA 3AEKB 1JQDA 1RJEA 1J20A 4A6XA 2BMDA 1AQUA 3SICE 1HBJA 1TO1E 3AUUA 5H82A 4DA0A 2BCEA 3PHHA 2HSEA 4I4TF 1FFBA 2I55A 3ZWPA 2H48A 4OH7A 4LSGA 1LI7A 1UWLA 2IEZA 3JVVA 4XH9B 2PKYX 3FD8A 3HXLA 2QUZA 3INTA 4HGZA 1JN0A 1EJ2A 1QU2A 1FMFA 4AICA 2R0QC 1HZZA 2G25A 5KTKA 1PG2A 1RMTA 2HHCA 3OM1A 2UYQA 3W6UA 4LZNA 1IB0A 3DDZX 1T1EA 4OY3A 5LYJA 2L2QA 2FW6A 4LDQA 5FOSA 3ZQKA 1HFJA 3DMTA 4J16C 4U5XA 2AWNA 1DBIA 5FIUA 4A82A 4QFBA 5JG7A 1U5BB 1P7WA 2G5PA 2UYGA 5DIZA 3CONA 3L05A 4GH5A 5ESRA 5F7ZA 3V8RA 4BAUA 1GQOA 4MVJD 1QLJA 4DW8A 4IIXA 4KGVA 4B74A 3SBOA 3WGIA 4KFUA 5KB3A 1IZYA 5DIFA 3VKUA 1DQRA 2FWNA 5I7AA 1DVRA 5BN4B 2DM6A 1IBMB 2DFTA 3ZHQA 3I8SA 2Y1WA 4CWAA 1F2VA 4MKRA 1IBSA 1KYVA 4R0VA 5D3KA 4EB6B 2IH2A 3RVSA 4QUDA 1PGJA 4HNAA 2AHOA 2UVPB 1Z08A 3PWZA 4M6WA 3H5VA 4AJNA 1K08A 1GUDA 2H1LA 4NZNA 4G65A 4HLQB 2FPUA 1HRKA 2JH8A 1E3EA 1Z0AA 2W6QA 3T3OA 4U2FA 1SU4A 1HDYA 1JLSA 1YQUA 1Q0RA 2JJ2D 2QTRA 2R1VA 4I19A 4KQEA 3ESDA 5KI6A 3X0DA 4CMBA 1U0RA 4Z51A 1WW8A 3ET4A 4G84A 3SQDA 3WKAA 2Z5FA 3GZJA 2CUZA 2XA1A 1TZ2A 4IR7A 1MABB 3I6MA 5K3CA 4BNIA 4UZFA 3FOAA 3P96A 4KMRA 4KL8S 2OCXA 5L3QA 5CB8A 3R9XA 3W0LB 3RE1A 1WEHA 3GUYA 1KMCA 3RRFA 3V80A 3VISA 3HB7A 4DLAA 3C7AA 4HRYA 2I8CA 2OO5A 3HZZA 4V39A 1JAIA 5KDLA 1BXZA 4NQRA 1MEOA 3CF6R 4JBHA 1Y4UA 4DSAA 1BD4A 2OQIA 4KE6A 2QZ9A 3FLEA 4N5HX 1SCUB 1PIWA 3FRJA 4W5HA 4B6OA 4WJLA 1XVTA 4JFRA 1C4XA 1OBFO 2DHDA 2RK6A 5K6AC 3ONNA 4G5XA 3QKUA 5A06A 3GLRA 4H1WA 1OAKA 1QFSA 3DBRA 3U3XA 1FTGA 3WQHA 4W5TA 3UY4A 4MQ5A 4PLPA 1IBLB 2NO7A 2MDTA 3EEFA 3RWBA 3VAZA 3M4XA 2OK7A 4HYTA 4DM7A 2BJHA 2RGCA 1DARA 1PFKA 3P5BA 2XUPA 4GOJA 1T1JA 5FFNA 3JD4A 2RH8A 4II2A 4OJMX 5HA5A 3T3NA 2JD1A 1I7DA 2Q7XA 3L0OA 1C7EA 3D7RA 5EE1A 4ZVNA 4REOA 4RTQA 4ISBA 2C82A 2OZPA 1Q2XA 3IUNA 4EUKA 3C3KA 3KEOA 4BATA 2O4UX 5BQOA 2NPFA 4EH1A 3ADDA 2AL7A 2A54A 3IERA 2CVHA 2FR0A 2XD9A 3NRJA 4L16A 1TCBA 3OQHA 4P31A 5G2OA 5JATA 3ZVMA 1MUUA 1EE9A 2F7SA 5CX1A 4B9AA 4FIZA 1JDTA 1I6MA 4ZCLA 1MO2A 3GEDA 3E7FA 1QF7A 3R7WA 3VR6D 3WC4A 3LRTA 4BO5A 1IPHA 1JIQA 4DA9A 1T9BA 1BS9A 2ID9A 4TRRA 5F7JA 2VDKB 4RK0A 1USGA 4NKRA 4RFSB 1L5SA 1T9AA 4CUKA 5HM8A 1RYEA 1BWRA 3IMFA 1CQWA 1SN7A 4M1WA 4R2XA 5BQFA 1NGSA 3BICA 2CXUA 1DDGA 4RQBA 5ALSA 2P3QA 4JVSB 2RBKA 4BCCA 2GPNA 3OT4A 4MI3A 3H11A 4PN3A 3SJBA 1IJFA 2GZRA 2HXYA 3CNHA 1HDEA 3IXLA 3O4HA 5AKYA 5I7RA 1KZYC 3OMXA 3A58B 3G23A 2D5AA 4MPJA 5FR1A 4RQUA 4ZVUA 1RPAA 1SWVA 5AW0A 2PE5A 2WA1A 1P9NA 1HTBA 3DBIA 4U9HS 3CUEF 1A2KC 3ZU6A 4B7XA 2YZKA 3VFDA 2FZKA 3FCEA 4G0YA 2Y1DA 4P7BA 5M7EA 6NULA 3IS3A 1WKCA 3R4CA 5AVOA 4GKKB 2XQFA 6PFKA 5C8YB 3BE5A 2D62A 2J67A 1U4SA 3X1JA 4TSFA 4L5JA 2CN1A 1PEAA 3DV9A 2AS0A 2W0SA 3H8SA 3ILHA 2QPLA 1N3LA 4W99A 1ZIXA 4M7WA 3WA7A 1XPOA 3D3KA 3OLVA 5ALJA 4K6CA 3MUEA 1JWLA 1P7ZA 3A6JA 4FE7A 1QUFA 3BXEA 2Z3ZA 1LW6E 1RKXA 1JPVA 3MOSA 2VJYA 3GGGA 1SVMA 3B2NA 4LA4A 4ONEA 3WK6A 1Q7BA 2C3UA 5J1SB 2OHJA 2VJLA 3RS5A 2B1IA 5L4LA 2BHRA 2IGBA 1CUSA 3G5AA 2O54A 1O97C 2QUBA 4TMKA 4GMKA 5HQ3B 2I33A 2ZREA 1LSJA 1O6FA 1F3OA 3L4EA 1PI3A 2JZCA 3G8AA 4Z8YA 4YRJA 1WL8A 3D3WB 3BERA 1DWUA 4ZZIA 1UPFA 1W52X 4LYHA 4PAMA 3ELYA 4X1YB 4JR2A 3WJ1A 1GDTA 3DM9B 1J00A 4LXQA 2Q1WA 3PT5A 3VU1A 3WLJA 3SC6A 4MYHA 5CTJA 3WAKA 2HIAA 2CLIB 1G3MA 3OG9A 5LMCA 3DD1A 2CXSA 1F17A 3PNKA 1ZJYA 1I5RA 1CIPA 3MGCA 3MRTA 1M6YA 3AESB 1R4NB 1JG7A 1G6KA 3Q0EA 4FUQA 1A76A 4FYXA 3ICVA 4MP6A 1GA4A 3RYFA 2GR7A 1UKZA 5LDDC 2VYVD 1H5UA 2BEUB 4FFBA 1YJQA 2H11A 4KFSA 2PIDA 3F9IA 1EFRD 1ODJA 4IJQA 4YAWA 2VPPA 3IJPA 2WR8A 3QKSB 1V8DA 2CHFA 3K09A 4R51A 4XXHA 4Y6QA 1HDXA 3CRRA 3FWNA 3QU9A 4O8CA 3WFJA 2V3CC 3N6XA 4UAVA 3FFWA 4JX8A 1GY8A 4W8OA 4FXPA 1NUUA 1OX6A 3D3QA 5EERA 3VHRA 3VHXB 1CUWA 2JFFA 4FGZA 1E7RA 1QQTA 4I5DA 1I13A 4JLDA 2QL9A 4HYEA 3U80A 1WPQA 3ZNQA 2O14A 4LXIA 4A0HA 3C5EA 1QR2A 2WVJA 2YN0A 2W6PA 4DDMA 2WWGA 3KLBA 3L0CA 4LDAA 1FPMA 4UVGA 3TSAA 2CLEB 4YQEA 1IUNA 1MF7A 2G09A 2OAP1 2VDJA 3ORSA 3AIIA 1H93A 3NYRA 3HP4A 3QM1A 2HUPA 2FZLA 2O1XA 1TIPA 1N6OA 3K5WA 1PR0A 1YQQA 1X7HA 2F55A 3Q2IA 4NZ9A 1V26A 1M3SA 5TGDA 2POQX 4MR9B 2BFEA 2ENWA 4MRPA 2DT8A 1RQ2A 3K70C 3G2JA 2Q6VA 2BEVA 4Q03A 4KGXA 1JDVA 4Z54A 3G02A 4IOJA 5AI9A 4L1KA 2IYAA 3FPBA 4AWXA 5IPFA 4KSYA 4M0FA 3VJLA 2ZTMA 2FE4A 5DEOA 3FVQA 3GEIA 2YTZA 2ZSAA 4RD0A 3O8CA 3BBLA 4TS4A 1P2UA 2ZJ0A 4D41A 4AI6A 4NDNE 3GWZA 4F1JA 2XITA 1PU2A 2GI4A 3AB3A 1A3CA 3AINA 4IIGA 5EHIA 5T4BA 4BFTA 5A9SB 1JYFA 3PC2A 2G63A 1XIVA 3JARB 4GPBA 4RV5A 4DLPA 4RQAA 2XSZD 4ZOLB 3BMCA 1EUZA 5HK8A 1GFSA 3MJEA 2QMZA 3LQQA 3IOEA 3M83A 5KSOA 5GADl 5KNCD 4ZT4A 1QTIA 4X62B 1EIWA 4Z7JA 4NS4A 1QB8A 4RDHA 1BE0A 1OKKA 3ACCA 1JEQB 5DFAA 2HK7A 3TPCA 4JYAB 1DTWB 5LWQA 4CFZA 4OQLA 2RG7A 2F8TA 4XGQA 3GAMA 1WIWA 1J39A 2GM5A 2I7XA 4II3A 3LI2A 4NU8X 5HCNA 1G60A 4EJSB 2FQ1A 4HD8A 5C7YA 1YR2A 5KQLA 2ZJ1A 1GPYA 4F3RA 1TA0A 1YE3A 4C6TA 1COWA 1IATA 2R5WA 2GCGA 1TF5A 1AH2A 3N76A 3BWEA 2WHPA 2X8AA 4H6PA 3FOZA 2BFFB 4HQFA 4YJHB 2W6JD 4JLMA 5DLDA 1YI8A 2FVYA 3DKRA 3U62A 4A0GA 4ERXA 4QXRA 1KJWA 5F1KA 5HKKD 1U8TA 3Q7QA 3RUIA 3DO6A 3OZBA 1HLGA 2IXFA 4X5OA 4EGAA 3HXOA 4CHTA 1DTEA 2QTVB 2FFQA 3COVA 3P4XA 3ANLA 1RZVA 3ULKA 1G5RA 1GGHA 1N0IA 2YINC 3JQQA 5LXTF 5BYKA 1U6IA 4N49A 1NVBA 3WLHA 1XLWA 4WN3A 1YV9A 4NAVA 4O2AB 4P8RA 5MGNA 1JWBB 1Y3CE 4YALA 3D8NA 2Y27A 2DHEA 2ILVA 1U8XX 4FMBB 1BEUB 2YXPX 3T52A 2DXIA 4PAQA 1ZD2P 4B8WA 3P0IA 3AHJA 3EVFA 4BZPA 4OBWA 5E9QA 2C5FA 2OO7A 3J80A 3RAFC 1BXRA 2PO5A 4WADA 5EWJA 2ZT8A 3ADOA 2GILA 3TINA 1FUEA 3GRCA 3NHYA 3SOZA 1Q14A 4ZYXA 3I1YA 4EEZA 1T9DA 1OA0A 4ZVLA 3ZY2A 4E70A 2R1TB 4RGVA 2HCTA 4EHAA 3BJZA 2VTDA 3JQAB 2RFLA 4KJXA 1YCDA 4E5NA 4YT5A 1N5KA 1GDHA 2H5IA 2NTEA 3KRTA 2O0LA 4PLGA 4RHUA 3H3FA 4DEYA 1U8EA 521PA 4WKOA 1OTHA 4OI2A 3UFBA 1OC4A 1RRKA 1ZK1A 2E4UA 2XAUA 3BEDA 2JLRA 4KXFB 5FOXA 3LDGA 2YOFA 4YMWA 5EHQA 3TS1A 2CL5A 1QJ4A 2K87A 5LUAA 3E9NA 1EP3B 2Z1NA 3OOEA 2IHZA 3IMKA 4O59O 1UQRA 2VXCA 1IY8A 4QDUA 3R74A 2WJJA 1F6DA 2Y8EA 3DOFA 3GJXC 4JJGA 3F73A 1MPXA 2FW7A 4OQNA 3GVPA 4LCBA 4IV0A 4YRQA 1YJ5A 5U4QA 3NBQA 4L8VA 1I1NA 4U9IS 5EP4A 4QEZA 3RAGA 1CHDA 5HGXA 1X8KA 4P54A 3ZWYA 1T8UA 2QNBA 5BSGA 4NJEA 2IEDA 2O2IA 3PYMA 4X97A 4F86A 1Q0TA 4J1TC 4FYKA 3W1VA 4UJ3A 5KNLA 2R7MA 4OL0A 3H2IA 1K4YA 1L8QA 3C45A 4ANFA 1YGPA 3FLMA 3SZGA 4JFAA 4AZVA 4R9NA 3E05A 1PR3A 5AUQA 3GC6A 3UHPA 1YJAA 3LQYA 4A2CA 3WL8A 1F20A 1ORHA 5FTWA 2ACVA 5D87A 4YJGB 5LOVB 3WNQA 3DTYA 3L79A 3VC2A 5BNTA 2XVAA 2IWHA 5AK4A 4FCTA 4MVJA 3TD2A 2G6TA 2VSQA 1ORRA 3BMOA 3GRUA 3PU6A 3PUZA 4D99A 2WJHA 3LFHA 1G5TA 1Q1QA 1U04A 2R6CA 4JDUA 4BX0A 7AT1A 2C9CA 2XCUA 2ZJ8A 2BGLA 1G21E 3G2OA 3QI2A 4FR0A 4FYVA 4JLUA 2I5PO 1E5TA 2ZBDA 4C6SA 2JAUA 2VF7A 3U19A 5CAEA 3RF6A 1VG0B 4BAZA 1X2BA 1KVQA 2A59A 1CEQA 2JLBA 2CYBA 3C5CA 4U2KA 1V7CA 2VT6A 2FJUA 4DLLA 2ZXFA 3DOHA 3E7WA 3LV8A 1E9SA 4G0WA 2AUNA 2E2WA 1L1EA 5T6BA 3KVNA 5D01A 1TCVA 3EN0A 1I32A 3ISTA 2ZP1A 5BV2P 2KW5A 2WJ4A 2D0PB 2QPOA 3NONA 1LK7A 1FLDA 3NHZA 3GLHA 2O8DB 1BX3A 2VK8A 2R47A 1F48A 3CC8A 4ND7A 1J4AA 4R2IA 1FDTA 2ACKA 4BHTA 4BE9A 1HC7A 3JW8A 4NPAA 4FFNA 2XXAB 1R4MA 4M8IA 4BNDB 5E6UA 4BNZA 4CL3A 4RY0A 1J24A 2X9QA 4FBLA 4RF4A 1XHLA 1YF3A 4OQMA 4ND5A 1KO4A 2GKSA 2C2MA 3BD7A 2JBHA 4YBZA 5KMGA 4OU5A 4KO1S 4YUXA 2NPIA 2GR9A 4FYJA 4ZAYA 3RYTC 4Q4DA 1TVCA 3M5CA 4R1PA 1F2TA 3HDGA 3SKXA 3IE2A 3AEZA 4FPXA 5KTTA 5LIRA 3LHSA 4RNCA 4RTSA 3ZDDA 2G3YA 2WW8A 1LTHR 2H1FA 3IUMA 1YACA 2HD4A 2QTNA 4HS9A 1DJMA 4ZRMA 2H2IA 2QD2A 1WSAA 1BQ4A 1F1JA 1LSUA 2JAHA 3SC2A 3JATA 4Z49A 5BR7A 2J3JA 4RZ3A 4UEJA 1HUQA 5HKLA 1TKCA 2RKWA 4PGMA 4YYEA 5KNDH 3Q8MA 1DO8A 4DJAA 3JQAD 4PO1A 3I30X 1EZ1A 1AQIA 3ZJVA 2OGTA 1YK1A 4N76A 3ISVA 221PA 2A58A 3OECA 4LAFA 1NN3A 1XX6A 3PC6A 4RLFA 4F7DA 4MR7A 1HTTA 1I4WA 2Z8ZA 1KHHA 3ZKWB 1U0OC 4E6PA 4E15A 4QGBA 5A71A 4EY4A 1COZA 1I5OA 5HJ7A 1MZPA 3ZLUA 2BD0A 5TARA 3QMVA 3ZGVA 2JHFA 1JNXX 3QUCA 1XFAA 1II8B 1XRPA 4WFJA 1Z4LA 3RIYA 1V1MB 2O2CA 2YWBA 3N58A 4Z86A 2QQEA 1FX0A 5F52A 2PSDA 4OK6A 3RSCA 4XYLA 3LP5A 3RBXA 2JI9A 1THZA 1W0CA 1KY2A 2J9FA 4DPKA 4Y7DA 1NMEA 4AY6A 3OU7A 1AURA 5JO0A 2OWEA 2VHJA 4YJ2B 4JJ7A 4D4HA 4DYVA 4O4JB 1WSBA 3HDHA 3G5UA 4IMPA 2REBA 3SQMA 1XTSA 3S7TA 4B7AA 2XCRB 2XRYA 4DV7B 4DA7A 2W8BB 2YWDA 2XRMA 3OFKA 4UASA 2JGJA 2JJ1D 5AXAA 3ICOA 3TL6A 4D3SA 3MT8A 2HBRA 1P2FA 1VBKA 5KCMA 1KF0A 1ECJA 3SSMA 2EFCB 3F98A 2VDVE 1WP9A 2A57A 4QPCA 2BUAA 2VPZA 3HBLA 1R0ZA 2WKRA 3H1EA 3KNZA 4UOEA 1BRTA 4W7SA 3UFXB 4H6XA 2YHAA 4QPDA 4Q3AA 4A4DA 1NYQA 3TL3A 4KITB 3ZNOA 3UUEA 3WK5A 2XMBA 4G5YA 4TKVB 4L85A 4YRKA 1A04A 5K2MA 4AJ4A 1P7CA 3E3NA 4CTNA 1NM5C 4B3HA 2DQSA 3PR1A 1K6MA 3BYZA 3IV9A 2Q1TA 4G0XA 3ZJ5A 5B57C 3CCFA 4HDKB 3O9MA 2DY1A 2DP4E 3DYVA 5FQNA 2OR3A 1D0IA 1PSZA 1M2GA 1TOAA 1RI3A 3A6PC 2QN3A 1DAGA 3VR5A 4FKMA 3R8XA 2HF2A 2EKPA 3QIAA 1L5HA 1G7RA 2OBLA 3D3EA 3EE6A 4MV7A 1MTOA 1GZ3A 4OLJA 2PL1A 2W6OA 2XKBA 4R05A 2XTMA 1U2GC 3KZ1E 4MWZA 1I51A 3VU3A 2HWXA 2HRCA 3L4JA 2QBYB 5HE8A 3WP0A 5TNXA 3WLOA 3ZEIA 3V3TA 2B4QA 2L17A 2X19A 5JAUA 5EMLA 3K72B 1T0UA 2VBCA 5LWHA 1DKPA 4WVFA 1N2IA 1GCIA 4D9EA 5I4BA 4CVNA 3M4JA 4A2WA 2IH4A 2O8EB 2WF6A 2Q6IA 4ZVSA 1R4ZA 2L42A 3ZGLA 3RFFA 4DRZA 4N8SA 5FFFA 3PZRA 2NSLA 4YASA 3L9WA 3NRBA 2C59A 4YDQA 2A5LA 3HY6A 1RYZA 3MSCA 2H0QA 1E58A 1F0PA 2ASEA 2IZ6A 3H18A 4RANA 2CDNA 2GASA 2OHIA 4FOLA 4P4GA 3S8MA 2HB6A 2ISSD 4DMUB 4DA4A 3JVEA 5FWXB 3T3EA 4D8VA 1X7YB 4LGCA 1KDRA 4UVHA 2ZI4A 3R3SA 2W37A 1KGDA 1I3OA 1PLLA 1NVXQ 2OZVA 3U3JA 4F6RA 3QVJA 4L76A 4XW2A 4L9AA 3W7BA 3DD5A 1CQIB 3QXCA 3A9TA 3ONEA 3ECCA 1MCZA 2NU8B 4DMHA 4EA7A 1O8CA 1G3UA 3M1AA 5EJ6A 1LQTA 1QYIA 2MU1A 1SCQA 2M1ZA 1XEAA 3DWGA 1WPGA 1WOYA 1PSDA 3NTUA 3EBOA 2OCPA 2RIRA 3LY5A 4FR5A 2WNSA 3HJUA 4ZI7F 4MA4A 3FTFA 1SA0A 1PRYA 4NBRA 3W3AH 4DUGA 2DLNA 3QVSA 1DCTA 2GYUA 1H9CA 4R5HA 2FG5A 2Y1CA 2EDAA 4KUEA 1C2YA 1ESMA 1ZI8A 2JIBA 4OGKA 4D9GA 5DNWA 3LLCA 3U7JA 1UJBA 4B3BA 4JIMA 1LVGA 3LYHA 2VHQA 4PCUA 4B3XA 2DX7A 3QFFA 3GEMA 3UMFA 3Q5GA 5K09A 3CVXA 3OQPA 1T8TA 3DE3X 3HCBA 2W90A 5FCDA 2WRZA 1S2LA 4B3SB 1W4RA 2N3ZA 3BE4A 3NM6B 3DAYA 4L15A 4C14A 2ORVA 3V4LA 5ALOA 4I1RA 5DTQA 3U61B 1J0BA 2JCYA 1MEJA 3U17A 1G20E 4BQSA 2Y0EA 4LQCA 1JG1A 2A1UA 2C0CA 2GBGA 2W83A 3HGTA 4FCWA 2VK4A 2VJBA 3GUVA 1ZUIA 2LP4Y 4L8FA 4MKIA 3ENQA 4FFDA 5DLPA 4A8JB 4CM1A 1XNRB 4FE3A 3A1DA 3KKPA 2WFMA 2D5BA 3CPHA 3HR8A 3R5SA 3OQJA 3C43A 4I1PA 1L4MA 1X80A 4UU8A 4DMGA 2O8FA 1PVVA 2ZRQA 5B58C 4NCKA 3KSAC 3E9MA 5CBKA 4AS3A 3TVDA 3BFPA 2HHLA 3NVAA 4B84A 4TSRA 3W3ZB 4MROA 3T0IA 5F9MA 3P9XA 3EQ7A 2JFUA 3TO5A 1W88A 2JKVA 2QB5A 3GB9A 4JP2A 3W7AA 1T8RA 1VHTA 1VJCA 1VCOA 2PKEA 3IYLW 3DOCA 1WAMA 4QOFA 4FEEA 1KR5A 3M5WA 5A5FA 1CLUA 5ICFA 2K7ZA 3RSFA 4KE7A 5AHOA 1UBFA 5JSQA 1NNI1 2FEXA 1KTIA 1GFWA 2VI5A 4UHKA 1TYCA 4QRHA 3DAFA 2BKLA 5AJXA 2YWXA 2JIRA 3OQNA 1IN1A 2J6BA 2ANBA 1H1TA 2GN8A 1XQ1A 3MFYA 2IIVA 4HH0A 3R7SA 5EXPA 4DNOA 1NASA 3L7KA 2OHGA 5CDHA 5BN3A 3OZFA 4FUTA 3U0BA 1A95A 1JV2B 3EY9A 1O77A 4JBXA 1WCYA 4RIFA 2AUMA 1NVVQ 1UJ4A 2GM4A 2J9XB 2WLSA 1EUCB 1FTQA 1J56A 1XEWX 1JILA 3GEGA 3CISA 3GN1A 3HABA 3RFCA 3E3MA 2R8XA 4HDMA 3A1UA 3TMAA 5KJCA 1NIPA 3OSUA 4RK5A 3K7EA 4JC8A 3SQXA 4ER5A 4FMCB 4RZ2A 3UJAA 3HCAA 1VP3A 1ISMA 1LTQA 3CLUD 3GHYA 4Y9RA 3QEOA 3TSWA 1CBUA 3VJKA 421PA 5J2UB 3ORQA 3WYAA 3COSA 3THWB 3LO8A 3PCTA 4B6JA 4IXJA 4MEBA 1U8FO 2C4NA 4KZPA 4BU1A 4DREA 4EG6A 2P2LA 4AY5A 3U39A 2D6FA 2AR0A 4JI6B 1MB4A 2PRJA 2VP0A 3NEAA 1IEVA 5JAMA 2BFBA 1CU1A 1W49A 4BO8A 1M1UA 1RPTA 3WA6A 4FD2A 2G5CA 1QCCA 3R23A 4CE6A 4L8LA 4YV1A 1KU0A 1B0ZA 2FK7A 4V0SA 3DUWA 2QV0A 4PHHA 5J4VA 3TM5A 2PWPA 2FOIA 2NUAA 4V38A 4GMDA 3ZXXA 2XDYA 3CYFA 2CLFB 4F72A 2Q0HA 2EFEB 4GMFA 3RIMA 2YUTA 4K28A 4UNPA 5AQ1A 2XY4A 3MWYW 1QP0A 3U3OA 4HL6A 3UZUA 2WTNA 4MPTA 4Z4QA 4AY4A 121PA 1GG2A 5IWAB 4JL6A 1MJGM 1E0SA 2C88A 1OV6A 3DZHA 3PQ4A 2VDWB 1DPFA 5LD2B 3UWOA 1V96A 3MB8A 1PSWA 2FMUA 1IXKA 4G1CA 4KH0A 4ZCTA 3LD9A 3OTWA 2VTBB 2O8BB 1TUBA 1N34B 3GLGB 2HX1A 1WP4A 1ZIYA 2HLNA 2WABA 1RQPA 3KXKA 3AEUB 1AKRA 1ZK3A 2R8RA 4P2GA 4W9NA 2JA1A 2VSFA 4IVNA 4YIKA 1MHPA 2H2WA 2W0MA 3K94A 3M4YA 3PXGA 2AMYA 3EMVA 1DJQA 3MCVA 3VUEA 3ZQUA 4BASA 4CF6A 4URXR 3DE4X 4LQDA 2ZU6A 1NNLA 1EM8A 5AOAA 1H85A 4FKZA 2D1SA 4X65B 4ES6A 3DMTC 4G0OA 2FDXA 2Z30A 3KT0A 1CUJA 4GKJB 1C0EA 1ECCA 3L3BA 2X1VA 4AMYA 1GSHA 3QNMA 4ZT7A 3ZHZA 4JLJA 4TS3A 5K3BA 1ZAYA 3HKDA 4Y2RA 5A62A 5LL6P 1JG3A 5ECWA 3G8CA 2XB2A 1V11B 2ECOA 4K26A 3IP7A 2PGNA 5ALGA 1GL3A 4W5JA 4ARZA 3T34A 3GGCA 4BNXA 1RPZA 2IEIA 3AR3A 1GQSA 4YDRA 5T4FA 4DJEC 1M0SA 1IZZA 3F46A 3JR7A 4MUXA 1LBQA 4QRIA 2PBLA 4UEWA 4CTOA 5FDFA 3EZYA 4MB6A 4UTVA 4U2BA 5C4GB 1R5JA 4EGSA 1LW7A 1YZQA 5SV2A 4WEQA 4XWOA 4I66A 2VZ0A 2B30A 4M0CA 3AKCA 2NXWA 1J22A 1JKMA 3IKTA 1PF7E 1L7VC 1RVV1 2PAAA 3CA8A 5FF9A 2MYTA 2NACA 3L8YA 3WV5A 1GA1A 3AJDA 5H59A 4R5MA 3NHWA 1WZNA 5DP1A 5K4AA 3GFVA 1TO6A 3W1WA 3O31A 4TYMA 5L51A 2GN4A 3ER6A 2BELA 1YONA 2H4FA 1UZNA 2Y67A 3V4SA 3A1TA 2OO5C 3CFIA 2XKJE 1MB3A 2WT8A 2F9MA 3KLMX 1GSOA 1KH3A 4HATA 4PW0A 2J9ZB 2DFPA 1J2UA 2OB1A 2IZ1A 3R2JA 3VX3A 1Q1BA 3KQSA 4HNUA 4FNAA 2QL6A 1BX1A 3D4BA 3AUYA 1TZJA 3ZK7A 1P8JA 3NOVA 3DOOA 3FH0A 4Z3KA 1SPBS 2RGRA 1X9GA 1TMKA 2G9RA 3QGMA 3VTKA 2VWHA 3OX1A 4PNHA 4JI3B 3ENVA 5KTMA 3ERCA 3Q7TA 3RNOA 3EPHA 3IAFA 4ZQEA 5EJ5A 3R6WA 4UCFA 2I34A 2CHGA 1EWTA 2PFSA 4D0SA 2JFWA 1I2AA 4QDXA 1L5RA 4DOMA 2DF8A 1F4LA 3I52A 4ATNA 1TU4A 1ZONA 3SDZA 1PW5A 2VAWA 1WXWA 3SXUB 1V3QE 2GO7A 5G1PA 3WBJA 2X77A 1JR6A 1FFHA 3AFNA 3GCDA 2JDID 2LIPA 2Y0BA 3ANSA 1UBLS 3N7TA 4XQ0A 2I3ZA 5JEDA 4OXXA 5H68A 1QZZA 1MH9A 4M8KA 5H9WA 5CH3A 3CNEA 3HWSA 3EFOB 3KCQA 4JBNA 1R50A 4ZVTA 4TOIA 4O4JF 1NQWA 3AY0A 2FJ0A 3CVOA 1PNVA 2I54A 2VAPA 1NULA 3L6RA 4WZAB 2AG5A 2OMKA 3QG5A 2ZB4A 1EESA 3HN7A 2QP9X 3LG2A 4JT8A 3FROA 4FB4A 3DKIA 4KDCA 1KQOA 1GL9B 1X13A 4H7JA 2W6ZA 1ENOA 1SKYB 3HRKA 1DXQA 2I52A 2WWWA 4F6LA 5M29A 4ZO8A 3VNVA 1WKVA 3A1WA 3LUGA 1ZVVA 3NOQA 3QLVA 1D2AA 2IPNA 2GNOA 4AQYB 2H6EA 1KH1A 4TUYA 3S5JA 4DMMA 4CQLB 4ESVA 2HWYA 5BT8A 1U2QA 1UT6A 1MC1A 1XTIA 1IAQA 2OFOA 3V8EA 3ZDRA 4D9IA 5JFGA 4EI7A 2O0KA 1A4IA 3IOBA 2ADMA 4MDEA 3X1YA 4X7MA 1BCSA 4LCEA 5EIBC 5ARBA 1Z39A 3OE7A 4L0MA 3N2GB 3HUEA 1VZ3A 4DV5B 2G17A 3C15C 1Z0DA 2O7VA 4JBWA 5AK5A 2POCA 1JKFA 2XWSA 5E4TA 3FZEA 3SMVA 4CG0A 5D85A 5BYBA 5FBWB 2DPXA 1SVUA 4UMEA 4LKOA 4QECA 2OD7A 2QU7A 5B3LA 3FDXA 3NG1A 1IYZA 2X4IA 5D7NA 1FNDA 4X54A 1IUOA 5LCXA 4TWJA 2AG0A 3REFA 3T7AA 3AI2A 5EZYA 3E53A 3G49A 3IULA 4COKA 2G80A 5INTA 1YSCA 3V1NA 3N28A 1RWQA 2IHJA 3PDCA 4NDAA 3M49A 2MMCA 4PS0A 1OF1A 5UKDA 4QJ4A 5A4MS 2XB4A 3LT4A 3Q7SA 3SF0A 1R88A 1GRVA 4MIOA 3RVPA 3SHQA 2EL9A 3QUAA 1AKUA 2Q29A 3PK0A 1QOZA 1DOHA 1Z6PA 3BD8A 2WJVA 4YUAA 5K0BA 3OIUA 1Y5IA 1BDBA 1RAGA 2FSVC 5KPJA 2DHQA 2R4QA 3GCZA 4LECA 2IS6A 2XAAA 2PMWB 1C7IA 2DWOA 4RIGA 2ONKA 4R01A 4NENB 4WAUA 5BSMA 2HSDA 4KGZA 2P6MA 1P3DA 2VBFA 1XLTC 4IW3B 1KSJA 3W9SA 3DNFA 4HZUA 4AF7A 3IURA 4FYHA 2X0FA 1LPNA 1ONSA 1LRLA 3UTCA 4ZO9A 1FBTA 2X0KA 3CLRD 3K5IA 1OLSB 1U8AA 2EBUA 3FETA 3JSAA 4PPFA 4R6WA 2QQFA 1J49A 3I28A 4IIHA 4QBGB 1TQ8A 1SM4A 5IF9A 4KR0A 1B3RA 3A3NA 4AYXA 3ZLJA 1SKUA 4B2LA 3K09C 2WZCA 2OGZA 3T5GA 2A78A 1DIOB 4DMCA 1W85A 3H5NA 4IF4A 1NVDA 1GPBA 2FWBA 2WAAA 4PCLA 2VNKA 3DZGA 4OXQA 4R41A 3VH4A 1C3EA 1T36B 3PDUA 4NH0A 1WY5A 3CINA 4NONA 4Q19A 3TI7A 2J3IA 3WKBA 1ZH0A 4HSGA 4L5CA 5L53A 4OQFA 3EMKA 1IJEA 3KJNA 4U7JA 2WJGA 2J32A 1ZM4A 4ZODA 3PUJA 4YMGA 3NAZA 5K0CA 3HTXA 3F96A 1YT5A 1S2MA 4OIMA 2NSJA 3IODA 2YZMA 3NO4A 4RNDB 1V1RB 1V3TA 3Q87B 1ZRHA 4LTMA 3TLEA 1VTKA 2R11A 2ZSUA 3RS4A 3WL6A 1BVYF 1K68A 5DYYA 4XVHA 2C3MA 4XGIA 1E8DA 2GK7A 4KPUA 3TLGA 3VR2A 3LYUA 3S2UA 3LUCA 6ABPA 5AJZA 1QOPB 2ISCA 5KAMA 5JYCA 2EC5A 2F1JA 4NESA 2KJQA 3T5CA 3FOCA 2YJTD 3TTSA 4I5FA 4XEHA 3MT7A 2EZ4A 2X5XA 4WKNA 3VOSA 2PT5A 2GOYA 1ARZA 2GH1A 3JQ8B 4QO7A 1ZISA 3DZKA 4BU0A 3IT0A 2JVIA 3JQCA 1L1FA 3TLKA 3MVEA 1UDCA 1PQUA 4M1TA 4NLLA 4YUWA 3KO8A 2NP6A 3EXEB 2XI4A 2Z1DA 1MOZA 2P4SA 4I2VA 4BVLA 5I7VA 1CE8B 4JEIA 2A1TS 2Y4OA 1VP9A 3A2MA 5JFTA 1QOQB 4P4SA 5B1DA 1Z6ZA 2IYUA 3ON5A 5A9TA 2ZI5A 3I6ZA 4HAIA 3OPNA 3OETA 1LFDB 4JCOA 2P9FA 2QIPA 5IASA 4LRXA 4M0LA 3LDHA 2C2GA 3CLHA 3CX7A 2CXQA 4Q4AB 1V4VA 2K5UA 4FS8A 5K01A 3ORRA 4N41A 3GLTA 2KX7A 4UM9B 2CNKA 3WGLA 1E0DA 1MU0A 2OCDA 3F5FA 4LSZA 2Q3DA 2O1WA 4BV2A 1EZZA 1GNVA 3QXSA 5F64A 2V74B 4MI1A 1J07A 2R1UA 2OD9A 4X60A 4YVFA 1DEXA 5AVVA 5K4HA 3HCPA 3JWIA 2EWWA 4C7VA 5GQSA 4MYUA 5JW6A 4MUJA 2AQHA 2GSDA 1NP7A 2QY6A 4Z1MD 5GZ1A 1PQPA 2Y9PB 3MD0A 4R3WA 2J9GA 3PFGA 1U4OA 2LTAA 3OFNA 3ONWA 1X39A 4JT4A 2PWYA 4D46A 5LU8A 2BFPA 3BSFA 4D26A 3PPXA 2TRSB 4ENSA 3RVKA 4E5UA 3VRHA 5ITVA 4NFSA 3WYBA 3FMOB 5DASA 1KYYA 1HSOA 3H8JA 4G41A 2BFCA 2ASVA 1VL5A 4FHFA 1BGWA 1J25A 2Q49A 4M0DA 3NU1A 2BGTA 2PUTA 2XKAA 4AP6A 4YRAA 5I9LA 1ZUNB 1EFAA 3WR5A 1KRHA 1S2NA 2GMWA 2QVZX 4LMRA 5T41A 4CLOB 3J7AC 1E79D 1KDOA 4G3XA 1YQEA 2QJFA 3F4BA 4QNMA 5G41A 1GPWB 3IFSA 4XTCS 1U80A 1Z7GA 4L57A 5E8JA 1JEEA 4MWGA 1IE3A 4JWKA 5D3MA 2BMWA 1QYDA 3HDJA 4Z7QB 4DUYB 4U0KA 2ZQ5A 5E38A 3ZHYA 3HCOA 3UN1A 3FSEA 4OFWA 2BN4A 5G4KA 2GBCA 2XGGA 4GLOA 4LJAA 4QBFA 2ZAMA 4XUGB 1VJDA 2A6PA 2AJLI 2DTEA 4AM8A 3ILSA 3L7JA 4LC9A 2HQOA 2B5OA 4D3ZA 3BD6A 1EVEA 1MBZA 1QGYA 1W2HA 1XAGA 3L82B 1JU9A 3QP9A 3QX9A 4K9KA 3FSGA 4MWSA 5D3QA 4TQUS 5T5QA 3ZDXB 1YB7A 5I4KA 4JYCA 1GUFA 1PTKA 2XMGA 4G56A 4JT9A 1XDDA 1BQ3A 2NQ2C 1V3UA 1J0EA 1VOTA 1Z2OX 3KXPA 5LA6B 2DVMA 2P6NA 4BAGA 4NULA 1ZMBA 5DNAA 5BSRA 3DBLB 4MRVA 5DTJA 1ZZGA 3L9XA 1R0XA 5IJAA 5LQUA 4KXLA 5BRNA 1A7AA 2H4JA 4I1YA 3IDZA 1R9GA 4WLUA 3UB2A 1T2CA 1Z83A 2RHHA 2H00A 3AR7A 3K9LA 2IOFK 3ENWA 4RVGA 5KNBD 2A5GA 1VL0A 3FWZA 3HJCA 4CKCA 1KU6A 5E1BA 4BO1A 5K03A 5KJ1A 4PO3X 4RXTA 1K9SA 4OGWA 3W34A 2PYZA 5A4JA 3PI6A 2J5BA 4OI1A 5C1IA 3EGXA 1UCFA 1VYHA 2EGGA 3OOYA 4MI6A 5KOJB 1WUHS 4QVIA 2EP8A 1ONNA 1TUGA 3MQ4A 4N7JA 4NBVA 4UD6A 4C4PA 4CMEC 2D7JA 4XQ9A 5CBPA 4EQZA 1J8DA 4A6DA 3I4CA 2VJMB 1E20A 1OXMA 5D6NA 3WK4A 4NBSA 2CD7A 1CR6A 1H4TA 2CY0A 1EIZA 2OKCA 2CEKA 1YAJA 2C5SA 3JCZA 3HMQA 2YY5A 3QYPA 4RPKA 3ZJ4A 2AVNA 3HA7A 1H6BA 3O1LA 4G4JA 4BC1A 4WCFA 2IS2A 1GSAA 2PCLA 1ESCA 4E51A 4R9VA 2HHAA 1EG7A 4X1IA 5FEUA 3G7UA 3WGHA 3HNRA 1A9PA 1JZTA 1A9ZA 4NCNA 4NHEA 1M6VB 4Y1GA 5CVCA 1C1YA 3JAKB 3NC4A 2HWKA 5REQB 3DBOB 5CGZA 4LJ4A 1M2JA 5IW8A 2H08A 4B44A 1GG8A 4YAUA 3I2KA 4C29A 2MINB 1B74A 2PJUA 3DJFA 5TE9A 4UCQA 4BNUA 2VHXA 3PKIA 1YKSA 2GBIA 3C87A 4K86A 4MRMA 4OEHA 2GPYA 4EMBA 4IJUA 1BEEA 4AMVA 2C2OA 3GJSA 4GOMD 4TPKA 4WX2B 3KEFA 4A73A 4YI5A 2B3TA 2XGMA 5ALKA 3ZYZA 1E6UA 4TKZA 1C8VB 5FOTA 3ZD6A 4PXYA 1GAWA 1JEYA 1FJHA 1YVRA 3CRZA 3OFVA 1JHUA 4UNQA 2Q28A 3RUHA 1W73A 3K5PA 4OFBA 1A0OA 1BKYA 2QAJA 1NZJA 1QU3A 1UEXC 1YU6A 4YFYA 1KWKA 2A92A 3TGPA 5IUJC 4BMPB 1IN4A 1JHVA 1CPYA 2B1JA 4JLAA 3USZA 3FDZA 5C7OO 3IVGA 2X40A 3N70A 3D02A 1E9VA 3IDSA 4LDJA 2WPDA 1E99A 1U3GA 4GYJA 4MHOA 5SYMA 3R77A 4M1OA 3HYCA 3NC0C 2EKDA 1FP7A 1ZVMA 3WMRA 4INZA 5FUBA 4KQWA 4R1OA 1EP9A 1EYZA 3I3SR 4BMNA 5BN5A 2J6IA 2XUQA 1SJ9A 2Q1UA 2XGJA 4DGQA 2E4YA 1OUMA 1BSVA 2FUG1 4AP9A 1S3IA 3M3HA 3OSZA 2A5JA 4RKRA 1WXDA 4FWTA 4J2OA 3HBMA 4I50A 4RH0A 4QNNA 4I1UA 4B4WA 3MWEA 1N0WA 5JPDA 3FUXA 4UTZA 3U4QB 2YWHA 3NTQA 3KCNA 4I6GA 3RHZA 3VO1A 3CX4A 4U9UA 4L5AA 3EF3A 2R2AA 3R0XA 2ZIZA 4PSCA 1W25A 2JRLA 1P5ZB 1ZOLA 2C9YA 3G5LA 1HDIA 3CE6A 3FPSA 2C7RA 4KJZA 5DTRA 1SUDA 2CHEA 3PF8A 5EFZA 2ZTLA 5HR5A 3HKCB 1SBYA 1Q84A 3NBMA 4KXQA 2AC4A 1E1LA 1B0UA 1OFGA 2PXCA 3ZWXA 3ZWBA 1ABEA 3VI4B 4B47A 5K3AA 1CS0A 2HCFA 2JASA 3R3HA 4K46A 2A3RA 2VJKA 4L28A 4RH1A 4LV5B 4EBFA 1EDBA 5LP6A 1TGVA 1OPRA 2ZYUX 1PLKA 2AN3A 3BULA 3K9BA 1U6KA 3BXZA 2OECA 3LQ1A 4J90A 1MIOA 3GP3A 2X0IA 2XZOA 5CA1F 1XZMA 2OE2A 4PLTA 4M2LA 1QVAA 2Y66A 4QFCA 5T8KA 4Y0AA 5IRCD 3BMQB 4BTEA 2WFLA 2ORED 1JXMA 2HJSA 2HMSA 4DBLC 1QKKA 3DULA 4UBLA 3EWNA 1PEKE 4P0QB 4HH1A 4H6WA 1ZOIA 2VJCA 3NXKA 2GTIA 4BDSA 5CFOA 5BR8B 3G0GA 3I39X 4BQOA 5KYNA 3DZDA 2ZYWX 5IVHA 4L07A 1O94A 4X90A 4ARBA 1MXHA 1IQRA 4QELA 5DCUA 1JHPA 1H9AA 3O0DA 4JIGA 2IYSA 3ZEAA 1PFUA 1SKQA 2QM3A 1D1PA 1W0JD 4W1RA 1WOMA 1GUAA 2Z83A 5BQPA 4JQZA 3UK1A 4DJFC 3VKGA 4IGKA 1UT5A 1M33A 1N6LA 1TB4A 4PFKA 4WI1A 6AT1A 1CY1A 2BE7A 2V6BA 3PUWA 5LYYA 3ZH2A 1D7OA 1OVGA 4QOEA 3JS5A 1JH8A 1QC5A 1NSFA 3HLKA 4B4OA 3HZHA 2Y3IA 1XN1A 1ZAKA 5YASA 5GIOE 1VG1A 4ZGGA 1ISHA 1DV2A 3DYIA 4V0MA 1S3FA 5C0OE 1SURA 5LQKA 1T13A 3HB9A 4L51A 4QU8A 1SQ5A 2G5ZA 2Q5LA 3UWKA 1U7WA 1BN6A 4Z0TA 1MOSA 3FPCA 1FXSA 4UPVA 4AN4A 3OVMA 2FFBA 4I9HA 1QKIA 1E7SA 5KYYA 2ODAA 4I99A 4HT