2A56A

Fluorescent protein asfp595, a143s, on-state, 5min irradiation
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
HGSASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GFP-like non-fluorescent chromoprotein FP595 chain 1
publication title Structure and mechanism of the reversible photoswitch of a fluorescent protein
pubmed doi rcsb
source organism Anemonia sulcata
molecule tags Luminescent protein
total genus 9
structure length 64
sequence length 64
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.40 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 2a56A00
2A50A 3CFFL 5EXCA 2G3DA 2GW4A 3LF4A 3CFAL 2A52A 2A56A 2A53A 2G2SA 3CFHL 2G16A 2A54A 2G5ZA
chains in the Genus database with same CATH superfamily
1N2OA 1UFVA 4G5YA 3UK2A 4MUEA 2G16A 2IECA 3LE8A 3Q10A 4DDHA 2A86A 2OGFA 4EF6A 5KWVA 4MUHA 2X3FA 4MULA 2A52A 3UY4A 3HL6A 3AG5A 3EMOA 1N2GA 4MUNA 5HG0A 2GR7A 1MOPA 4MUIA 2A88A 1N2EA 5BW0B 1V8FA 3IMGA 4FZJA 4BHRA 2A53A 3ISJA 3IUEA 2A50A 3MUEA 3Q12A 2LMEA 4MQ6A 3COYA 2A54A 3AG6A 3CI0K 3IUBA 3COZA 1N2BA 3CI0I 4MUJA 3IOBA 2A7XA 3CFAL 3CFFL 3QTTA 1N2HA 1N2IA 2G3DA 3CFHL 2G5ZA 4MUFA 3INNA 2A56A 2A84A 2RETA 4DE5A 4IXJA 3IOCA 2EJCA 3IVXA 1IHOA 3IODA 3IOEA 4MUKA 4MUGA 5G2FA 3COWA 5EXCA 2G2SA 3UA0A 3IMCA 3IMEA 3MXTA 2GW4A 3CFIA 3LF4A 3IVGA 4DDKA 2I52A 3IVCA 4DDMA 4EFKA 3COVA 4G5FA 3N8HA 1N2JA 2GR8A
chains in the Genus database with same CATH topology
1N2OA 1UFVA 4G5YA 3UK2A 4MUEA 2G16A 3LE8A 3Q10A 4DDHA 2A86A 4EF6A 5KWVA 4MUHA 2X3FA 4MULA 2A52A 3UY4A 3HL6A 3AG5A 1N2GA 4MUNA 5HG0A 1MOPA 4MUIA 2A88A 1N2EA 1V8FA 3IMGA 4FZJA 4BHRA 2A53A 3ISJA 3IUEA 2A50A 3MUEA 3Q12A 4MQ6A 3COYA 2A54A 3AG6A 3IUBA 3COZA 1N2BA 4MUJA 3IOBA 2A7XA 3CFAL 3CFFL 3QTTA 1N2HA 1N2IA 2G3DA 3CFHL 2G5ZA 4MUFA 3INNA 2A56A 2A84A 4DE5A 4IXJA 3IOCA 2EJCA 3IVXA 1IHOA 3IODA 3IOEA 4MUKA 4MUGA 5G2FA 3COWA 5EXCA 2G2SA 3UA0A 3IMCA 3IMEA 3MXTA 2GW4A 3LF4A 3IVGA 4DDKA 3IVCA 4DDMA 4EFKA 3COVA 4G5FA 3N8HA 1N2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A50 A;  3CFF L;  5EXC A;  2G3D A;  2GW4 A;  3LF4 A;  3CFA L;  2A52 A;  2A56 A;  2A53 A;  2G2S A;  3CFH L;  2G16 A;  2A54 A;  2G5Z A; 
#chains in the Genus database with same CATH topology
 1N2O A;  1UFV A;  4G5Y A;  3UK2 A;  4MUE A;  2G16 A;  2IEC A;  3LE8 A;  3Q10 A;  4DDH A;  2A86 A;  2OGF A;  4EF6 A;  5KWV A;  4MUH A;  2X3F A;  4MUL A;  2A52 A;  3UY4 A;  3HL6 A;  3AG5 A;  3EMO A;  1N2G A;  4MUN A;  5HG0 A;  2GR7 A;  1MOP A;  4MUI A;  2A88 A;  1N2E A;  5BW0 B;  1V8F A;  3IMG A;  4FZJ A;  4BHR A;  2A53 A;  3ISJ A;  3IUE A;  2A50 A;  3MUE A;  3Q12 A;  2LME A;  4MQ6 A;  3COY A;  2A54 A;  3AG6 A;  3CI0 K;  3IUB A;  3COZ A;  1N2B A;  3CI0 I;  4MUJ A;  3IOB A;  2A7X A;  3CFA L;  3CFF L;  3QTT A;  1N2H A;  1N2I A;  2G3D A;  3CFH L;  2G5Z A;  4MUF A;  3INN A;  2A56 A;  2A84 A;  2RET A;  4DE5 A;  4IXJ A;  3IOC A;  2EJC A;  3IVX A;  1IHO A;  3IOD A;  3IOE A;  4MUK A;  4MUG A;  5G2F A;  3COW A;  5EXC A;  2G2S A;  3UA0 A;  3IMC A;  3IME A;  3MXT A;  2GW4 A;  3CFI A;  3LF4 A;  3IVG A;  4DDK A;  2I52 A;  3IVC A;  4DDM A;  4EFK A;  3COV A;  4G5F A;  3N8H A;  1N2J A;  2GR8 A; 
#chains in the Genus database with same CATH homology
 1N2O A;  1UFV A;  4G5Y A;  3UK2 A;  4MUE A;  2G16 A;  3LE8 A;  3Q10 A;  4DDH A;  2A86 A;  4EF6 A;  5KWV A;  4MUH A;  2X3F A;  4MUL A;  2A52 A;  3UY4 A;  3HL6 A;  3AG5 A;  1N2G A;  4MUN A;  5HG0 A;  1MOP A;  4MUI A;  2A88 A;  1N2E A;  1V8F A;  3IMG A;  4FZJ A;  4BHR A;  2A53 A;  3ISJ A;  3IUE A;  2A50 A;  3MUE A;  3Q12 A;  4MQ6 A;  3COY A;  2A54 A;  3AG6 A;  3IUB A;  3COZ A;  1N2B A;  4MUJ A;  3IOB A;  2A7X A;  3CFA L;  3CFF L;  3QTT A;  1N2H A;  1N2I A;  2G3D A;  3CFH L;  2G5Z A;  4MUF A;  3INN A;  2A56 A;  2A84 A;  4DE5 A;  4IXJ A;  3IOC A;  2EJC A;  3IVX A;  1IHO A;  3IOD A;  3IOE A;  4MUK A;  4MUG A;  5G2F A;  3COW A;  5EXC A;  2G2S A;  3UA0 A;  3IMC A;  3IME A;  3MXT A;  2GW4 A;  3LF4 A;  3IVG A;  4DDK A;  3IVC A;  4DDM A;  4EFK A;  3COV A;  4G5F A;  3N8H A;  1N2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...