4MUNA

Crystal structure of pantothenate synthetase in complex with 2-(5-methoxy-2-(2-nitro-4-(trifluoromethyl)phenylsulfonylcarbamoyl)-1h-indol-1-yl)acetic acid
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
286
structure length
283
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Pantothenate synthetase
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 92
structure length 283
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4munA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4munA01
3HGMA 3FHJA 1QNFA 1TYAE 1YUNA 1GTRA 1U0BB 1YIAA 1KAMA 2QUKA 1JZQA 4BWVA 4DNXA 1BS2A 1O97C 3G6KA 1KAQA 1JIKA 4ZCSA 2A4MA 3OTWA 1YUMA 1JIJA 1JHDA 3E27A 1J70A 3FNRA 2CSXA 3COZA 5TGTA 4MW0A 4F3RA 4ZT4A 1H3FA 1P7PA 3MMXA 3PXUA 4KR9A 1OBHA 5J58A 5FNZA 1NUSA 2RD2A 3CVWA 3ZJVA 3G5AA 3IOEA 2J07A 5FO0A 2CUZA 4JZYA 4CDMA 5FO1A 3INNA 1M1ZA 4K0RA 4EF6A 1NYLA 1G8HA 4R0NA 3RHSA 2H2AA 1U7XA 2CYCA 2DEUA 1Y42X 1TFUA 4PBSA 1X6VA 2DUMA 2PZBA 4YBRA 3UOWA 5H16A 1GN8A 1UFVA 3KT6A 4H3SA 3TZLA 1V47A 1ZH0A 3CLUD 3L92A 4UZEA 1WKBA 1N78A 1J09A 1GLNA 4A91A 3UC5A 2DXIA 4MUFA 4HJXA 5H7XA 4MW6A 3Q12A 2X1LA 1PFWA 5KWVA 5KHAA 4QRDA 2QUIA 5DASA 4UZFA 1O94D 2HMAA 5HG0A 1R6XA 1RQGA 2QTRA 4AS1A 2Z3VA 3CLTC 3CVXA 1IH8A 4MWBA 4HPWA 4J76A 1KH1A 1JZSA 1SURA 1WXGA 2CV0A 1QTQA 4F4HA 3X1MA 2B7LA 2IELA 3DLAA 3FIUA 2AZXA 1QU3A 3RFFA 3AG6A 2PFSA 4QREA 1QJCA 4JFAA 1K4MA 3N05A 1EFVB 1NURA 4PY2A 1N77A 4RUKA 3HFJA 3FETA 3U1VA 3IMCA 3N8HA 1KKUA 3GUZA 4I6JA 3F3MA 3CR8A 3SEZA 2WQ6A 1EJ2A 1KQNA 1Q15A 3MUEA 3D6VA 3CLSD 4EG6A 5DEOA 1EFPA 2V0GA 1F9AA 5EKDA 4Q93A 1HYBA 2R5WA 1T9GS 1WZ2A 4NAUA 4QBTA 3Q4GA 2H29A 3CVUA 1K97A 4KPUA 2D13A 3MXTA 2PXHA 1TYDE 2Z09A 1MBZA 1QU2A 1O95C 4GU5A 1CT9A 3QE4A 2C5SA 1O96B 4MULA 3Q10A 4MWCA 3ILVA 3SYTA 3IOCA 3LOQA 1IVSA 1NUUA 3OP1A 4K03A 3VU8A 3H99A 1QRTA 1T6ZA 3COVA 1VLHA 1N2GA 3IVXA 4MW1A 1M8JA 4OUDB 5LFAA 4U63A 1WXHA 3DPIA 1N1DA 4CT0A 1IHOA 1J1UA 1U7DA 3TQIA 2O5RA 3A2KA 4DDHA 1MRZA 3FG9A 1N2HA 3P52A 4GRIA 4DE5A 4HJRA 4U8HA 1N75A 4RPIA 1JIIA 4EG3A 5KCMA 5JBNA 4MWEA 1NP7A 3FY4A 1EUYA 2A1TS 3ZJTA 1WQ3A 4ZT3A 1N2JA 4JXZA 2CYAA 1OWPA 4XFJA 4U7JA 4TS1A 1B6TA 2DERA 1VBKA 3DV2A 2A1UB 2YY5A 1O97D 2PZ8A 1T6YA 1WXEA 1WXIA 2HZ7A 2RE8A 1U3DA 1YULA 1JMVA 4MVCA 3IOBA 4EG8A 2AKEA 4PBRA 4MUJA 1GTSA 3IODA 3M5WA 4FZJA 4MUHA 1TEZA 3CVYA 1VBMA 2IP1A 2OQ2A 3ZGZA 2QJOA 3ZXIA 1EUQA 1I2DA 3RK0A 3FDXA 1R6TA 1IQ0A 1XNGA 3N9IA 1KQOA 2JANA 1T6XA 4PBTA 1O5TA 3A04A 1NUTA 4KKVA 3GLVA 2HGZA 4NDAA 2J4DA 3P0IA 2TS1A 1K4KA 4KR6A 3FOCA 3ND7A 1I6MA 3KT3A 3NBAA 2WSIA 2J5BA 2GOYA 4YP6A 1T9GR 1MOPA 3NBKA 1QQTA 1H3EA 4HK4A 1WY5A 4MUNA 2E18A 1EFVA 1ZJWA 2D54A 1JEEA 3K32A 2XRYA 3CLUC 3DO8A 3X1KA 1KH3A 1JILA 4WNYA 1KQPA 1MJHA 2ZP1A 3N2YA 2CV1A 2DPLA 4MUGA 3HMQA 1XNJA 1N2BA 3COWA 3COYA 3P0HA 1EXDA 2AG6A 3SEQA 1O94C 3VRHA 1TQ8A 4MW2A 3QTBA 1WJGA 1K92A 3IVCA 1H3NA 4MW5A 4ZT7A 1O6BA 2YWCA 2PIDA 5TEWA 4JYZA 1ULHA 4ARCA 1Q11A 4MVYA 4G5FA 1JGTA 1O96A 2X1MA 4WSOA 3BL5A 1WQ4A 1WOYA 4XSVA 1JEDA 1GZUA 1X8XA 2V0CA 3KT8A 4DJAA 1MAWA 1WXFA 1S4MA 3AFHA 2VTBA 4I6GA 4JXXA 2QTNA 2JA2A 4ZT2A 1OWMA 4DDKA 2E21A 3CLRD 1O95D 4R2MA 3CLSC 4P2BA 1PG2A 2DLCX 3MLAA 3H97A 3S3TA 3UMVA 3RBAA 4EG5A 1IQRA 2CYBA 4CDNA 3TNJA 5LM3A 4EGAA 1MB2A 3SZGA 1JECA 4L2IB 2PZAA 2A1UA 3ISJA 3UY4A 4YP7A 3IMEA 3PNBA 4DDMA 2CT8A 1N2EA 3HL4A 1PFVA 3IVGA 1XJQA 1LI7A 1KR2A 1F7UA 2GKSA 4MW7A 5K0TA 1PFYA 4NX2A 2WB2A 3IDFA 1KORA 3ZUGA 4EG1A 5IHXA 1PFUA 1KH2A 2ZUEA 2DETA 1PG0A 3AIIA 3D6UA 5F23A 1M8GA 2OV4A 1NUPA 2DR2A 4ZCQA 2NSYA 1NUQA 1N2IA 1OWNA 1TYCA 1KP3A 1G8GA 4MVXA 4ND7A 5AHWA 2VXOA 1O0BA 4MW4A 1Q77A 4MUKA 3AG5A 3PNYA 3KT0A 2A86A 1YI8A 4ARIA 1OD6A 4OJMX 2J09A 3PRHA 2QJFA 1OWLA 3CVVA 5IJXA 5J5AA 4DLPA 2WQ7A 4ZCTA 3ZXSA 4G5YA 1GAXA 3I05A 1D2RA 4XFDA 4NZPA 1LW7A 3FWKA 4S1OA 3JXEA 4MAFA 3TS1A 3X1JA 1J1ZA 1IQUA 3RK1A 4ZCRA 1M8PA 1NSYA 1OBCA 1MC1A 4EFKA 3CA8A 1NZJA 1NI5A 1YIDA 1ZH6A 1QRSA 2XRZA 2J08A 3MLBA 4ZT5A 1OWOA 3CLTD 4NATA 1I6LA 3AKZA 1TYBE 2BYTA 3VGJA 4MLPA 4KR7A 5J59A 1COZA 3H9CA 4MWDA 1F7VA 3G59A 2A84A 3LCJA 1QRUA 1Q19A 3A4IA 2QJTA 5LLTA 5BNZA 3L93A 3SP1A 1KP2A 1A8HA 3ELBA 5HUJA 1IRXA 1LI5A 1O0CA 3HZRA 2A1TR 2NZ2A 1DNPA 4MVWA 3UK2A 3H9BA 4E1AA 1N2OA 2O8VA 2QUJA 2D5BA 3SDBA 3H05A 2A7XA 1MB9A 5TS2A 3SZ3A 3A05A 1ZUNA 3NV7A 4I6EA 4J75A 1J20A 1M8KA 3P0JA 4MQ6A 1XNHA 3LE8A 3IUBA 5DK4A 3FI0A 3GMIA 4L2IA 4OUDA 1F4LA 4CQNA 1M8FA 2Z08A 3QTTA 4AQ7A 2BTEA 1N3LA 2I1LA 2QTMA 4X0EA 5DB4A 4R2LA 3KFLA 2QUHA 1H1TA 1R6UA 3IMGA 2A88A 4G6ZA 3ZIUA 4Q16A 3TQOA 2EJCA 2E0IA 4YP5A 3ND6A 1MAUA 4MW9A 1G8FA 3IUEA 3FH0A 4EG7A 2ZUFA 1IFXA 5HUHA 1J21A 3HV0A 3RJZA 3CLRC 2X0KA 1EE1A 1VBNA 4ZCPA 4MUIA 3ZJUA 1G59A 2EL7A 4ZT6A 1U3CA 1EFPB 2YWBA 1V8FA 4MUEA 4YMIA 3C8ZA 2CFOA 1FYDA 3TZEA 2PG3A 4KPUB 4NAHA 3AL0C 1I6KA 2VTBB 2YXNA 3ND5A 5TEVA 2G36A 1FFYA 1ILEA 1VL2A 3K9WA 3PNVA 2IJGX 4ND6A 2JAXA 1GPMA 1M83A 4EG4A 2X3FA 3IH5A 5K0SA 2E89A 2GM3A 2CV2A
chains in the Genus database with same CATH superfamily
2A9QA 1FFHA 4I9FA 3E8SA 3E9DA 1TFRA 3KYCA 5CPFA 3V4LA 4YCMA 1XEWX 5DW0A 4W9MC 1SOVA 1GTRA 4YJ2B 3JASA 3GLGA 3B9BA 5KTYA 4E5NA 2GVNA 3AY3A 1FQJA 4DUYB 1REQA 4AZSA 1OHHD 1RKBA 2ODAA 3LY7A 3BZBA 5JTUA 3HJTA 4MRSA 3HCAA 5BP7A 2JAWA 5GONA 2XXAA 5HIKA 3CUEF 3OKPA 3JQAD 4FYYA 4NENA 4KRFA 2HQSA 4AUNA 3BD8A 1R0LA 3IQWA 5AW4A 1Y6QA 2GAAA 1BSVA 4IX1A 3KD3A 5M29A 3GEGA 4YJ3A 1XPRA 1LF5A 3G5AA 1W0JA 5LZ2A 3TTYA 5JXIA 3WHIA 2J07A 5BSEA 4E70A 2FSHA 3COSA 1KIFA 1I30A 3NASA 2A53A 4LZPA 1KJWA 4PZUA 5C52B 2O2CA 1M1ZA 3HY6A 4C87A 3RTBA 1SCAA 3WFZA 3RHSA 3C6XA 4MS4B 3ORHA 1FCJA 1IY8A 5BQPA 3VU9B 3LF4A 4PBSA 1X6VA 2PZBA 3D8HA 3DEYX 1WUJS 3MJCA 2JGAA 4O59O 1YOVA 2HADA 2W2OA 1ISHA 1D2NA 2BGKA 1GFZA 1J09A 1DG1G 4IKPA 4K6GA 5AM3A 3UMRA 2A9FA 3VYVA 3VBEA 3VJRA 2DXIA 3CURA 4QPNA 4RC9A 1K0FA 5AOAA 3V8BA 2CWDA 3SMVA 3N0TA 1JPVA 1C80A 3NWPA 3ZY3A 4YO7A 4DYVA 1FFAA 1U8TA 3K0CC 2XF8A 3ABRB 3EXHC 2WIAA 4C1BA 4Q6BA 1JXOA 3Q6NA 1ETHA 4D2IA 4OBWA 3FMOB 3KWLA 1E98A 1LNZA 1Z5PA 3I45A 3I9OA 2BEWA 4OB8A 2Z3VA 1COWD 1FNCA 2PY6A 4LX8A 3QIAA 3Q7QA 1EIZA 3FI9A 2JLWA 3RS8A 2I6UA 4UMFA 1GNVA 1I7LA 2HFJA 2R6R1 1T9HA 1PYOA 1LXCA 2GNOA 4TVBA 3LA6A 3UGQA 3X2EA 3QE9Y 1QTQA 2WJHA 4OBBA 3S7TA 5KQSA 2C1XA 3M33A 1VCNA 3O5AA 4WNCA 1VHQA 3S1AB 3MT0A 2NU9B 2MHCA 4M8NE 4TQUS 3HBAA 1KYVA 3G2NA 3KVOA 1AT1A 1C4XA 3BMOA 3DOUA 3GP3A 4GYKA 4QREA 4U5XA 3S5UA 4U2DA 1UPUA 5M2QA 1JWBB 1U7ZA 1GA4A 3DB1A 2XZLA 2P0AA 4ITRC 1E9EA 2CHUA 3EA0A 1OIWA 4RUKA 3HN2A 2MSLA 4B9AA 3EDYA 1S9HA 3FB1A 3DZGA 5SYAA 1RJ9A 1H4VB 2A7QA 4X5OA 1PO7A 3GUZA 2ZIXA 3CR8A 4I6JA 2ECPA 4QA9A 4GOJA 4AXXA 1RHJA 4RQUA 3ZQJA 2IOHA 1EJ2A 3CEPB 1MABA 4G63A 4JB3A 4KIFA 1WRBA 4I3HA 8GPBA 4TZ6A 4NPHA 4ZU6X 4BVFA 2PWPA 3AEUB 5IYZB 3ODPA 1TC1A 3THXB 1EFPA 2X9QA 5EEHA 5EEGA 3O26A 2C2KA 2C58A 1GKIA 2QP3A 2Y2UA 3A37A 3NAGA 4FZ3A 4WOPA 1GU7A 4AIRA 3GLIE 2GPSA 2H29A 2XMRA 4LYFA 4MR9A 5I7EA 1L3CA 2CK3A 1T1RA 2OR3A 3TJMA 1FB5A 2FW1A 1I36A 2GT1A 4OY3A 3WI7A 5FI1B 3IBCA 1BWSA 3SHFA 2AI1A 2IPXA 2D2IA 1GV0A 1TPYA 2Y1OA 3QELA 2JCVA 3KXPA 5NLLA 1ONOA 3D02A 3IXQA 3C6YA 3DPSA 4ZIRB 4M76B 3HG7A 5EZQA 4MWCA 3SYTA 4ED9A 3KYBA 4CPDA 5I8PA 2RHWA 3EQ2A 4I50A 1D9XA 2DYKA 2FZVA 4KXQA 3NFYA 3HWRA 1S02A 5ICEA 2ODWA 3B9QA 2YICA 1UDBA 3GCZA 4X7RA 1WBJB 4OUDB 1T13A 1YJXA 2CCKA 2H1HA 2V45A 2XGMA 4QDUA 4RA9B 5CB8A 5JV5A 2JLUA 1GLVA 2FX5A 1HDCA 1ZNXA 3FG9A 4ND8B 4QUAA 4DE5A 2WE7A 2PO7A 3F5DA 2HN9A 5EIBC 1JIIA 4HVCA 5JW6A 4OI1A 4MWEA 2QAGB 1VG0B 4MK4A 2P65A 3H2KA 2E4AA 4RD3A 4RSGA 4BFUA 2O8CB 3W5JA 5HR5A 4EB8A 4JC8A 3DMPA 2JFQA 5CIQA 1M3SA 2UZ0A 4ZVUA 1A9ZA 1K4YA 2H4WA 3GGOA 2VNIA 5K8UA 3MM4A 1Y8RA 3S2UA 1VMEA 1M1XB 1ZJ5A 2F1IA 4F21A 3K70D 2X7JA 2VHCA 4DKJA 1ISMA 1HGXA 3STVA 2ZSBA 3FYUA 4AJ2A 3L4KA 3QNUA 4MMZB 2C4UA 1ELOA 3DC2A 1AKEA 1GPBA 4MP3A 4R9RA 4MUJA 3H8JA 4TTVA 4QZVA 1PU2A 1V11B 5I01A 3DR5A 1L8LA 3HCDA 3O4GA 5BSGA 1EXWA 3D2LA 4EX6A 1GA6A 2BEUA 1DBQA 2C07A 3LHKA 5T4HA 1WW2A 2YFKA 5KYUA 4PGHA 3RQSA 2I4TA 5D3QA 1UBHS 3WLHA 3ZDBA 3BMQB 3EWIA 3SYKA 3AB8A 3OX1A 3K0SA 2J3KA 3UT5B 1TMOA 5ITSA 2QL5A 4I1IA 3UXMA 3M6MD 4NEHB 4QXOA 4YMWA 3H1GA 1DV2A 4MEJA 1AD2A 2FZCA 3LAWA 1SJ9A 3KQQA 4OGLA 3GO4A 1G7CA 1GRQA 1T6XA 1X8KA 2DULA 2H2GA 1A88A 1CUHA 2H92A 3N2EA 4YBZA 1X80A 2Y1LA 4JMPA 4MYHA 5DHTA 4NYMQ 3OA2A 2CDAA 1CY6A 3HYSA 4NV0A 4OGKA 2KBFA 2H4HA 4DM3A 1Z6AA 3AKYA 2Q4DA 3H1PA 4XWOA 4E5PA 1OH6A 3U39A 4FVTA 2K2QB 4MHOA 5HM8A 1DOAA 2SKDA 4B35A 4B3HA 3AY0A 3KLMX 4R9VA 5FPSA 1REQB 3KXIA 4KV9A 5HRCA 4KLAA 3HYCA 1GXSB 4G4GA 5EZ6B 1GADO 1V3VA 3UM9A 4DTIA 1UBTS 2G5ZA 2OBXA 4NENB 4RY9A 2VHXA 3S55A 1T5SA 1XQYA 2LCFA 3DO8A 4HNAA 2R84A 4D5GA 1KH3A 2R6ZA 5INTA 1YRYE 4M4SA 1JR3D 4L1KA 4YJ3B 2OLKA 4S1VA 3AHJA 2FZKA 3BGWA 5HA5A 2AOWA 2X0DA 1H65A 1DOHA 4TT3A 4D97A 4JC0A 1SKUA 2F1JA 3COWA 1XYGA 3BD7A 1I4EB 1U5BA 1A9YA 2DJ5A 4JBIA 2G7ZA 2H3HA 2Z5FA 1U28A 3FVRA 4MR8A 4G89A 4IGKA 3H9GA 4XWWA 4DEYA 2AS0A 3PZBA 1Q21A 5L8VA 2ZYHA 3MS2A 4P6VF 5MDHA 1SVSA 4C7XA 3VI3B 4INZA 2FUCA 5TEWA 4ZI7A 1Q0UA 1U8YA 3M6AA 2IUFA 4GWKA 5K51A 5K0EA 2JI8A 1Y5MA 1LDNA 1HK7A 4IUDS 5DWDA 3ZHTA 1SU6A 2C8VA 1ZSVA 3RIYA 3MBIA 2R6FA 4H1HA 4F8EA 1NI3A 2ERXA 1SNYA 2HDWA 3II6X 1BD4A 1CQWA 1RPJA 2MTBA 3HSSA 2QUAA 2BEWB 2AJTA 2JZNA 3OIGA 1YS6A 3QBTA 5AXAA 1X14A 3KT8A 4KAXA 1HQCA 1I0LA 3ORRA 5HF9A 4L8WB 2GN9A 4U2EA 3BA1A 1W8DA 5F7JA 2NO7A 5KPDA 1SKBA 2GETA 5F1YA 2YH2A 3A6GA 3OJEA 3VNQA 3T5CA 4YV0A 1UFQA 3C74A 2GN2A 3K5IA 1ZRMA 3KL4A 4CRWB 3TL3A 3C3DA 5BW8A 4J4TA 3B1VA 3BMOB 3TINA 3UMVA 3JD4A 1UOPA 4HEQA 2QT1A 1KMCA 1HYHA 1SBHA 3EHDA 1SHKA 2GD6A 2OV2A 4IIHA 4MYUA 1ISFA 3KJHA 3UHOA 1RWNA 1SPXA 1NYTA 3F6RA 4LRWA 5TDHA 4M8KA 1PZFA 4CG2A 2ZIXB 3K4QA 4IO0A 4YT4A 1YNOA 5AVOA 3W5DA 2QVZX 2DRIA 4EW3A 3C4JA 4C2UA 1DT5A 2Q2VA 2HAEA 1HEYA 1AO0A 1FP2A 4L3VA 5C4MA 1Q7GA 4ROTA 1KBOA 4XJSA 1TW3A 3AILA 4BLVA 3SF8B 1IN5A 1T8RA 2VBGA 4EWLA 4G0XA 3BK1A 4ALNA 4TYWA 3KXLA 3VR6D 4F06A 1AZTA 3QFTA 1CY4A 1KJZA 1XVIA 2H51A 3B1XA 3G82C 3DLTA 4I1RA 4MR9B 4EG1A 4OFWA 5JVDF 2KPOA 1HY3A 4MR7A 1G38A 1KRXA 5L4NA 4N3NA 5E4TA 1V9SA 3UMJA 4C0WA 4E4TA 2QRHA 1PJTA 2E55A 4UCXA 3H75A 1FTNA 3QU2A 2B92A 2ZUCA 3QELB 3K6RA 3TLXA 3FYDA 3WSVA 4BJ5A 2M6SA 2C99A 1TCCA 2W71A 4X64B 2Y1EA 3D8TA 3U4AA 2CVPA 3HUDA 1G64A 1V7CA 5EE9A 1TEHA 3P5BA 4GYYA 3RNOA 3UWOA 4NFLA 4ZVOA 5MN5A 3CUTA 3IL2A 2JZOA 1W36B 4MDEA 3DXFA 1KGSA 2D5LA 1A71A 2HLDD 4R2HA 1RE1A 2OHFA 2XMSA 3HGQA 3W04A 2QYOA 5L7YA 4G1UC 3ZHRA 5F3WB 5F21A 5CA0F 2HJHA 4IFIA 5BNWA 1QOQB 3CFFL 4AUKA 2BHTA 3ZGYA 4B43A 4L22A 1XWWA 1URPA 3AMVA 4DLKA 1IQUA 2PNJA 1YRLA 2ZEJA 2Q6IA 5DCYA 5C9ZA 1T2AA 1Y8RB 3K8QA 1U2TA 3IEUA 3SQDA 1RRPA 1FBTA 3BKXA 2P0EA 4REMA 4RK0A 1HNXB 2W6JA 3AI7A 3WGQA 2TMGA 1DIGA 1JZTA 2AX4A 1JA9A 2OZVA 2ZR8A 2XRZA 3L0PA 2BDUA 3LCCA 3HADA 3W2FA 2QGZA 3VNUA 5DLYA 4L5IA 4MAAA 3AL3A 2WAOA 2YIMA 4GX1A 1YL6A 2NGRA 2X0RA 4WECA 5E7MA 2BGGA 1CUDA 1XCMA 2GJAA 3OF3A 3UC9A 4MLCA 3T9CA 3A3OA 3O8QB 2P2ZA 3FCSB 3IEIA 4JP2A 3G0CA 3UB4A 4BN0A 1EX7A 3CMCO 4LJSA 3FGOA 5JI2E 3HVUA 3TFQA 3RVQA 2CLDX 1GFWA 4EF5A 1FMCA 1ZH4A 3UV3A 1U2DA 5TPZD 3BXZA 1UKEA 2H2FA 2PR7A 4BFCA 5JQWA 1P9OA 4D82A 3B8HA 1XTVA 3CTPA 3V33A 4BNDA 2RGUA 2VJNA 2WYOA 3MOIA 721PA 1QVVA 4ZRNA 3PC7A 2A1TR 1P73A 2XWPA 3FDJA 3PITA 3BDAA 3E9RA 3HLTA 3G7UA 4YAJA 1W88B 1CUYA 1IRIA 1O4VA 3P96A 3L4JA 4LF9B 2EX4A 1J2JA 4RHCA 1G98A 2FOXA 3FPJA 4KO4S 1I3MA 2C4NA 2OSBA 4HTFA 4NEQA 4PHFA 1KC1A 3SJZA 5B4UA 1DAKA 4CF6A 1I7QB 2P41A 4J75A 4D80A 4D9GA 2ZJFA 3V8PA 2F1RA 1BDJA 4GIBA 4F84A 1NUHA 4Q4JA 3RV3A 4BWVA 3FVQA 2L0XA 2ORED 4RDIA 1OB5A 1T2EA 2X3UA 3JYHA 3NFRA 3T6KA 5JAMA 2BTEA 1YCDA 3Q7TA 3I52A 3K30A 5FL3A 4CQLA 3KYJB 2E2WA 1OPRA 1VG9B 2JH9A 1U5BB 1EFAA 4HLQB 2DTDA 2W93A 2ZRDA 3D7KA 2P7IA 3D2AA 2NUPA 2P9CA 1IHDA 3E9MA 5BW5A 3K9CA 1GFSA 4W1SA 1NXQA 1SUFA 4G1FA 3E4DA 2ZI3A 4JBNA 3ZEAA 1U2PA 3SS7X 3RVMA 4XUEA 5A9RA 5CDFA 4PLCA 3BSSA 4HLUA 1RPAA 3CPSA 1YQTA 1DLJA 1U99A 3VR4D 3WL7A 2B99A 5ALFA 1B1AA 2J9RA 1AXEA 1U7TA 2OV3A 1W5TA 4H59A 2NYVA 3RHZA 3ELYA 3RSHA 4ZI7B 3IPXA 3GCGA 3IT2A 4BO7A 2PL9A 4ZZ0A 1J90A 3DTVD 5IAAA 3OZSA 2VF2A 3RIHA 2VQ6A 3HB7A 1YQUA 1DIBA 3QLUA 2A58A 4PZDA 1B8OA 1LJLA 4JJ6A 4C07A 5DLDA 2R0QC 2W6ZA 3V00A 3HB9A 4YRZA 3IIEA 4N41A 2JHAA 3K35A 1CIVA 1H2EA 4R2KA 1HOXA 4WCFB 3NYIA 1NMYA 5D85A 4DBVO 5BNTA 5JSUA 5BYBA 4BNJA 1ADJA 3Q7RA 5EJ9A 4FHGA 2ZYWX 1T8PA 1TLTA 4ZDJA 3K0HA 5DI3A 1U3UA 3MBKA 4II3A 4LZJA 4OQLA 4C5CA 1AQJA 1JEYB 1J23A 2QHXA 1RYNA 2ZRGA 2JAOA 1E20A 5T7BA 3D43A 4UUAA 5G3YA 1QNFA 5EE5B 3ZXUB 3VKVA 4B76A 2PWBA 1JZQA 5LVAA 1QR6A 4ZOLF 1WDMA 2EU8A 1CUBA 5E95A 2G72A 1KS9A 2P3OA 5K0JA 4URYR 3G17A 4MCHA 2GF2A 5TQVA 5TV2A 3SSMA 2WFLA 3FJ1A 1D4AA 3JALA 4LSWA 4LHXA 1SZCA 4ECEA 3JWGA 2EHDA 5TS3A 4XW2A 2O0MA 3DTNA 4RGVA 2AH5A 4YRMA 5AW1A 1DIHA 1RRVA 1YJQA 1DX4A 1WXQA 4UNRA 3S40A 5K8IA 1TO6A 2FPPB 2ZAOA 3HYRA 4DYDA 3H04A 5EXXA 3H1FA 3RVSA 1YU6A 2QMZA 3WP1B 4ARAA 3WGUA 1KMNA 3O4HA 1AHPA 1NVWQ 2C84A 5DWQA 1DZ3A 4JZYA 1SVMA 5LNK1 4UVDA 2X4GA 2D8AA 1T2DA 4IDAA 3M6LA 1NYLA 4LXTA 3V4PB 3ZY2A 3ONVA 3N6RA 3S28A 4BLPA 4CE6A 3WLMA 4Q39A 2PGXA 2DEUA 3TEFA 3T1VA 3TD2A 2EZUA 5JNVA 2B82A 4UEKA 1TJ5A 2AF3C 3U6KA 1NBWB 1A7JA 2WUGA 2JH3A 1ZI9A 1ISJA 1L4NA 3A2MA 1YA8A 1RCTE 1VXOA 1VECA 3W2TA 4NS1A 4A8JA 5EXTA 1ODIA 4CMEA 2DKNA 4JX9A 5G4KA 4GVPA 3I1JA 2H4JA 1O94A 3DJYA 2I7VA 3JVUA 5KCZA 2G08A 1ESEA 2P4SA 4X8OA 3K5PA 1CQZA 5B4TA 3ONDA 4BKPA 2XH8A 2MSDB 3VR5D 4EYKA 3T1OA 3GUHA 3U1BA 4JJIA 3W2IA 1GL7A 3PC3A 4LG1A 3NHPA 1AV6A 1XMVA 3K8YA 4FJ2A 1OZ0A 4NYIQ 1LJ8A 3QXGA 4Y2VA 4E5DA 4PWYA 4TWBA 2GEUA 1ZIDA 2EGUA 4KVZA 3VZCA 4CLEA 4RCYA 3BCUA 2WICA 2G1JA 3AF6A 3WFIA 5LP6B 5B58C 4P7BA 4H9GA 4IP0A 3MUFA 3T12A 3WNDA 4Y9RA 3DFFA 2HWUA 2VHTA 1XDBA 2XB8A 3ROQA 4CKEB 4CYMA 4RPCA 3D6HA 4D3DA 3AF4A 1Q7CA 3D6AA 1KKUA 1C9MA 1XTIA 5DN6A 1TZJA 3I58A 3WB2A 3D0OA 2BCJQ 2CUNA 2IOQA 1TM7E 4W6ZA 4RD6A 2Z6VA 1CDZA 2GARA 3HUFA 3AUUA 1G7TA 1WCWA 1ZD4A 3EN0A 4I08A 3MUEA 3E4CA 3B2NA 2XIQA 3M4NA 3CW9A 3PSAA 1IJKA 1E1LA 1R00A 3NCHA 3DO5A 1N25A 4C2TA 3M5PA 3SR0A 4G1EB 4F3TA 4CW7A 1D3AA 4L3WA 2P27A 4Y6QA 5DT9A 4JMLA 4BO3A 4JVMA 1MHTA 6GPBA 3P0RA 1Z36A 1CZHA 3O03A 2O3JA 4RFVA 1KK1A 1NYRA 2PXHA 1YACA 1XZFA 2CHGA 3KSUA 4D3SA 2X40A 2V5UA 2A5YB 1QVWA 2FQQA 4C08A 3JQ9A 3OIDA 5D7BA 4W5OA 5D01A 1LBTA 6REQA 1O96B 2C2YA 4FKZA 5LQNA 1KEZA 1D7AA 3QU9A 4AY4A 3EAQA 3ILHA 4C6SA 4ATNA 1NV9A 3HKEA 3VV2A 2CXHA 1OA0A 3MCUA 2PUTA 5HIMA 1ZICA 5F12A 5IANA 3H42B 1NJFA 2JATA 2Q1WA 2VJBA 2SCUB 3V4VB 6AT1A 1BDHA 2C7VA 3WQBA 4BGUA 1JHPA 2D0IA 3DPIA 4PFQA 4EMTA 2A9JA 2J8ZA 4BBPA 2VL7A 5CVDA 4K9MA 2D00A 3TTXA 4NY1A 2AN5A 4GZ5A 3U56A 4TXJA 3H5TA 3M8KA 4TN1A 3URKA 1B6RA 1GR0A 3IDZA 1NP7A 2PWAA 2QSZA 3DT9A 3PFBA 2NUPB 3TMYA 5K0CA 3ZJTA 5DBEX 1YE3A 1I3LA 2GERA 1W4ZA 3FHCB 1F20A 3EH1A 4A5SA 2YZMA 1DIAA 4QLOA 3PLNA 4RKRA 3A8TA 3OESA 5DYIA 1JTFA 3NJRA 3U7IA 1KR5A 3U4CA 5FTLA 1KE2A 3FOAA 2IXFA 4L4UA 1BROA 3B53X 4NZNA 4Q24A 5E1MA 1BWPA 1W19A 5HQ3A 4N54A 4I5DA 2F48A 1R7RA 4WUVA 1BVYF 1ICIA 2FR8A 2QV7A 3DSRA 4MPTA 5C8DA 3O4JA 1PWYE 2XUHA 4NNOA 3SHTA 1GTSA 3NUZA 1CEEA 1D2MA 1X1AA 2WUEA 1GPLA 2WTAA 1IEWA 3B6EA 3C45A 5EP1A 1LY1A 4DXDA 4RQTA 1HMPA 3B7GA 1VIDA 1W1IA 2ZPAA 2VOJA 1XA4A 2H5LA 1WMFA 3MQFA 1F6BA 3ZLJA 2WMOB 5DGXA 4ZGWA 1G20E 3F9RA 4RF2A 2FWRA 1AIPA 4UTXA 3WRYA 4EY4A 5JCOC 2VAWA 7AT1A 4HAWA 1XSEA 3BE6A 3KEGA 3SCZA 1MUUA 4Q7JB 4ZZ2A 2OAEA 2ORIA 4PPFA 1QV6A 3RU9A 2HGZA 3K6SA 1ODKA 2O0JA 1JHXA 2A59A 1PR6A 1WHTB 2LGJA 1HQDA 2RKWA 1NF2A 1N0UA 4HB3A 1EFRA 3RYCA 3GBPA 5H3CA 1XZMA 1EU1A 2RCYA 2IYSA 1MOZA 1OZGA 2OFPA 3ZI0A 5KTMA 2RI0A 1P5HA 3PSHA 3T7RA 4LXIA 3A6LA 1Z0FA 2VF8A 4IDCA 4GC5A 4JIMA 4L6CA 4TRJA 3UHAA 4BGDA 1QHEA 4KGDA 4L16A 4FMCF 4UNQA 2J33A 3BUSA 5IMSA 1ZJWA 3JZDA 1V5WA 3WMXA 1ADYA 4MMYB 2OBMA 1SU4A 4EELA 4TTSA 2H6EA 3S27A 3B5JA 3DTTA 3QF4B 4UU8A 1I7SB 5AUNB 3AETB 2I2CA 5F9MA 3WWYA 2ZSAA 3VPXA 1GV1A 1SKQA 5BRNA 1BFDA 1VCOA 3QVUA 5MGNA 1U7PA 3OLXA 3GDHA 3P0HA 3C16C 2PRKA 4GBJA 4I55F 1PZGA 4WQMA 1ZJZA 3S68A 3M2TA 2C1ZA 1P61B 4LHYA 4OSOA 3N87A 3VH2A 4IVPA 4FDVA 5AXBA 5KYYA 1DB3A 1ONSA 1UL1X 5EIAA 1P4JA 3RK4A 4LRTB 3TKLA 1JHZA 2FPGA 4LSGA 4HNVA 3M9WA 2IY9A 2Q29A 4QQKA 2F7SA 4OK5A 2QG9A 3UAYA 3BHNA 3F6BX 4O8ZA 2SBTA 4WOBA 4PVCA 3BCHA 4ZV7A 5DU2A 4J1TA 5CH3A 5CM8B 4FWTA 3MJFA 2LKCA 4US2R 1Y1QA 4FGJA 4BMDA 1N3YA 2M1XA 4R98A 3RBXA 4DUZB 4FMDF 3RUPA 1Y8CA 2GZ2A 2PBZA 3T5PA 5IXSA 2VA8A 4J4HA 2F00A 1NMQA 2V1XA 4W1QA 4NU5A 3PHCA 3HXMA 1IZZA 4AQDA 2J0EA 4CKXA 5JSHA 3TE6A 1JFRA 2IBSA 2ZRNA 1AZSC 3PQCA 2I71A 3CZ5A 3DZBA 4KEAA 1EDDA 1B8PA 4BNXA 3HJRA 1UJMA 1IULA 3EG9A 2WHEA 4XWGA 4XVRA 3TTVA 2F8SA 1BXGA 1UWCA 1OCEA 3O8OB 4U7TB 3UJPA 4G5XA 2HI0A 4GR9A 5FAKA 1ZXBA 1TO1E 4PG7A 4JB2A 1IHPA 4KR0A 4TROA 2ZXEA 4M1SA 1E2QA 4AG5A 5K0FA 3EZ7A 1FRVA 2XDWA 1WUHS 3DOJA 4JH0A 4NHOA 5JS6A 5F73A 2X8WA 4TV9A 1JECA 1W9MA 3S99A 5KTKA 2WU1A 1BNCA 3WWZA 5JYEA 3TD6A 3NEYA 4EABA 3TKYA 4H7EA 3TVTA 1TT5A 4NVRA 5JDCA 1Q84A 1GR1A 3DOOA 5LZ7A 1JAXA 2ZI7A 1SD2A 1M34A 4J0HA 4KE6A 2Q3BA 4MQLA 4WK4B 3G8YA 1Z6TA 3N59A 4WKGA 5I8WA 1Z06A 4PF1A 1KDRA 1KQGA 1KR2A 2NXJA 1UH5A 3MWEA 1IHXA 3HB5X 3BMNB 5F2OA 4C0BA 4CMHA 3DZ8A 2C9YA 4BQFA 3KUXA 4C3VA 1VKZA 1DQSA 1C9YA 3HL6A 1OOEA 1IN8A 1SBYA 3C8DA 3FNGA 1Z7WA 3VC7A 3HXOA 1PZEA 4URWR 4BO9A 2W43A 4BQIA 4QULA 2OGZA 2DR2A 3M4XA 3OX3A 3TVYA 3ZHVA 1XN4A 3RS3A 4BFYA 1TYCA 2VH2A 2OT3B 4EGSA 1QYWA 5AFSA 1M2JA 3L40A 4EPXA 2XJ4A 4TVSA 4QD3A 1Y1TA 4LXGA 1EE9A 4CTNA 1PFQA 3MINA 1FU4A 2YZKA 1FSZA 3HKEB 4LF7B 3BIFA 1U5CA 4GPIB 4OJMX 1FQKA 2DECA 3GQBA 4INJA 2R96A 4OK6A 4IOLA 3ZW7A 1JQKA 5KI6A 5J5AA 3ZWPA 5K3CA 1VMKA 1JVNA 2F9LA 1RI4A 4DFDA 2R1VA 2XNJA 2Y77A 2CDBA 5BN3B 4FN5A 2WPDD 3C3BA 5I7UA 1XLTA 2ZWMA 2OSVA 2DQZA 2PHZA 4XFDA 4XFKA 4X7BA 1QCYA 3SLGA 3NX4A 1R50A 1LW7A 2IXEA 1Q74A 1PGNA 2WM2A 3B2QA 4L8GA 3UG6A 3JXEA 4KMRA 7MDHA 5TGDA 3EMDA 4I4CA 1VBFA 5J4YA 3ZVMA 5A04A 2GCNA 4EFMA 2F3RA 4BVGA 1DT3A 2JDIA 4S3MA 3RSSA 2BWJA 3C3CA 4JIGA 4C7BA 1G42A 5JXJA 1W0JD 2BKUA 5ICSA 4Q4DA 3AVVA 4CM8B 3LQQA 5CDHA 3BL8A 1RPZA 2I78A 2EWMA 2CXTA 3DBLA 2JGEA 3DL2A 2ROQA 3OPYI 4Q05A 5A0VA 4WADA 3D64A 3ETCA 1NW3A 3TXYA 4HLNA 3MAAC 4EMBA 5H0IA 5IRCD 3RC3A 3HA3A 4AG6A 3TR5A 2RKOA 3HZZA 4KXNA 4CT5A 1MJNA 1GPAA 1TTQB 4RFSA 5CLQA 1YDFA 3L8ZA 4PR3A 4FIZA 4TN5A 2J1LA 1E1RD 1MT3A 4I3GA 1VZ3A 3Q5DA 5AJHA 1N5JA 1O7JA 1UK9A 1L1QA 2QMOA 2AFIE 1G4UR 3ABZA 3IXMA 4CV2A 4OD0A 4L7QA 1AKRA 3MWGA 4F4IA 5IZCC 4NZOA 4EI9A 3D31A 3FCAA 1MG0A 1J1IA 2FK8A 3A4IA 4TXHA 2J31A 2GFHA 4FR5A 5EPEA 3RTEA 5DM60 4DS3A 4R71A 1OT5A 4F85A 1I94B 5E6UB 3WYGA 5HBRA 3ZNNA 1W4AA 3GMSA 1P8AA 1SVUA 4Y6RA 1KYYA 3CN7A 1JJAA 1IOZA 5K9ZA 5ED4A 4OEHA 2UAGA 5IBCA 4PAQA 2REOA 2Z43A 1U2ZA 4K2AA 4RIFA 1XZKA 4IMRA 2CW5A 2B34A 1ZM3A 1X7GA 4LJLA 1XCJA 3R20A 1MXHA 1F2TB 3LHFA 4B48A 1MB9A 2VNAA 5TS2A 2G28A 3E9ZA 2UUBB 1ZGAA 1ZUNA 4A4DA 1F17A 3L7YA 3DEJA 4R41A 3VR1A 1JTEA 1V7PC 3D0QA 3CUVA 3V8VA 2FXVA 3WXBA 1T0HB 5F2NA 1TGYA 2D8MA 1SG6A 3KNZA 1SQSA 5C8YF 4B84A 2NZJA 5A4KA 2ZSJA 1P1IA 4E5UA 3LO5A 2Z8ZA 1SA0B 4L0CA 4MTCA 4P0QB 4ZAGA 5BRAA 3UJBA 2I6SA 2EZTA 2HHJA 3G6WA 4M1YA 1W581 4G01B 3I8SA 1SHJA 3OTHA 4BVHA 1RJDA 4X20A 5J9FA 4AJOA 3KFLA 3Q3CA 1HZJA 3M83A 1BDMA 3KDAA 5IF9A 2XB2A 1YR3A 5FNVB 4EHNA 2XKJE 4EZIA 1THMA 2FPGB 3EPKA 2Z8XA 3B82A 5LBTA 2PX0A 2IYWA 1ITZA 4YP5A 4C7MA 1W52X 3FH0A 4IIVA 1SXJE 4HFMA 2DWPA 1E4EA 1N9ZA 3DAPA 3G2IA 2DHEA 4L4XA 3RJZA 5IK2D 1F3OA 3U13A 4LZNA 1EE1A 3UAGA 5K03A 2IHZA 1FVXA 2Q1UA 1SOUA 4PYQA 1PJBA 1VKJA 1S89A 2YN0A 3H13A 4N0PA 4WL0A 5EPUA 4F1JA 5EHXA 3H65A 2EKBA 1J5PA 2CJYA 1QVAA 3HCFA 2EJWA 1U3CA 5FLYA 2FKAA 4TMZA 4HQRA 5H4HA 3JQBA 4YPOA 2H52A 2G1AA 1NC3A 3NPMA 4AAYA 1XRMA 1ZMOA 2V7GA 3K5WA 1CF4A 4HNHA 5ES3A 2VZ0A 3CGGA 3HRKA 4TKUB 4TXLA 3WLEA 1KI4A 1OF1A 1ODCA 4QUIA 1AURA 1FX1A 1IM2A 1G18A 2CNKA 1K86A 3IGFA 3EIOA 3LCUA 4GG1A 3CRQA 1UBUS 3V3TA 3B3FA 2BHSA 2I2FA 3F4KA 4H77A 4DR1B 1BXGB 1YGYA 2Q41A 3QA3E 3K2BA 4F9EA 3GHHA 3T94A 4GVLA 1Z5NA 4JLBA 1CRPA 3LPMA 3Q0TA 2JF0A 4A03A 2JEZA 1AKQA 1RBYA 3MJVA 4HH0A 1Z13A 1A7AA 1YA6A 1E6WA 5DTIA 4B40A 4L72A 1IBRA 4DEXA 1I2BA 3R3WA 3DD1A 1KAQA 1JLHA 2XDYA 3ZDFA 1JIJA 1QH0A 2CVOA 3P71T 5L40A 2VOEA 2P91A 2X0IA 3OEWA 3MT9A 3RF6A 2IDJA 4HWKA 2Q6KA 2QTZA 2COEA 3C0KA 1JXAA 3JQRA 3R5XA 3MRSA 1XCPA 4ITUA 3PQ4A 3MLEA 4BIMA 4E94A 4FQ5A 3H6KA 5AXCA 1POWA 1TL7C 2QG6A 1P1CA 3D6TB 3OEHA 4FGSA 4YMUA 3K20A 2YV3A 4QYMA 4RNCA 2QZZA 4FFVA 5BXYA 4UUQA 3KJQA 4MV8A 3RUIA 2E5WA 3PGVA 3F1KA 1S4QA 2NU6B 1VP3A 4X1IA 4EK9A 2ISSD 3DZJA 4X8MA 2JCYA 5EZYF 1D0IA 2XUAA 5LR6A 3R8XA 1AK9A 1RI1A 2FF5A 1VHTA 1TKRA 2RI6A 3B70A 4LTDA 4TS3A 2BH2A 3OT1A 2FHPA 2AD1A 3L77A 1OAAA 4MRRA 3KT6A 1V47A 2DFNA 1RI2A 4JXJA 3MINB 3N07A 2I8LA 3TG2A 1E5TA 1BCRA 2Q2QA 2CL6X 3C3MA 5CT4A 2Z2XA 3HB0A 4MW6A 3PUHA 1CUEA 1GCAA 3H2ZA 2X1LA 3IP5A 2J5QA 4KDEA 4C3ZA 4UAJA 2NU7A 3NWEA 4Q15A 4KK4A 3DGFC 3HCNA 2RC5A 1MX9A 4O29A 4D43A 3A0UA 5THQA 4H4CA 2GJSA 3Q2KA 4NMHA 1EB9A 2FN9A 3RU2A 4C5BA 1CJUC 3Q40A 3B1KA 4I46A 3VDNB 1GRRA 3LKBA 4NXMB 1IY9A 3O9MA 5FWYA 2F1OA 1EEXB 2XTMA 2BJVA 4JJAA 5D86A 1KOGA 1GUDA 3NUGA 4ZEWA 4ZI5A 3VZPA 3PFHA 3T7EA 3ZWAA 3QHPA 4IG4A 4Z2YA 3DBLB 5IM4A 5IKOA 5FPYA 1RQRA 1MA0A 1MLDA 3ZV3A 5A1TA 4H7HA 4D9MA 1B16A 1JIVA 3OOSA 5IEJA 1VPTA 1HT3A 2A9RA 1N36B 3QM1A 1OFTA 1QFSA 1Q17A 1RJEA 2JGDA 2XCOA 1Q7RA 3C5EA 3CF4G 2ZAYA 4KQWA 4U9UA 3KP1A 2YUTA 2JC3A 2LKDA 4ZDWA 3P9YA 4DQDA 1AUQA 3HSYA 1G6OA 2HUPA 1RR6A 3GFSA 4JODA 1B00A 3GXBA 4FXPA 4BYMA 4DIEA 2AX3A 1SC6A 2SECE 1OYVA 3HDQA 3M1IA 1QCCA 1WL8A 3C8MA 3OLWA 4KRYA 3R5SA 4QASA 2IS1A 1R18A 3MNFA 4HYQA 2BFBA 4MQUA 4C43A 1RYDA 1R4MA 4PCUA 3PNPA 2UUCB 1CDOA 3RYFB 5I9MA 3WKEA 4UAVA 2A0FA 3QEAZ 1A5AB 1T9GS 4RJIA 1R4ZA 4IPTA 5J2TB 3SIWA 3TAXA 1N6OA 4P86A 3D3EA 4B82A 1R6AA 2Z09A 3KLOA 4HPXB 1M2OB 3LFHA 3A32A 4YRPA 1QU2A 4GR5A 3HLYA 4GU5A 4OXIA 4E11A 4LBYA 3JQDA 4WHMA 5LDDC 1UPFA 5JT1A 5PNTA 2PMWB 3VDMA 3OBBA 2ONKA 2J0SA 2ZSKA 3Q10A 2I99A 2JHFA 1W4LA 4RJTA 4E1VA 1XO1A 2J85A 4DJ5X 1YDMA 2IGTA 2IEDA 2QTVB 3ZZNA 1IVSA 3EIWA 1BX3A 3AWDA 4A0QA 2B9EA 3GK3A 1T1GA 2DFDA 3EWSA 4HRVA 4V0SA 2Z1MA 1VLHA 4MVJD 4KQKA 2K2WA 2OM6A 2W7TA 2ZREA 4U2CA 3H5IA 3DBHB 4DMKA 1XXHE 3O8BA 1KXZA 5GV8A 1PTJA 1QPBA 3GJRA 2YL2A 4ZCIA 2C31A 3IIKA 5D3MB 5H80A 2C4VA 4TSRA 3MCAA 3PX2A 5G41A 4AF7A 5KWIA 1NRXA 3A2KA 3M81A 3GNQA 2H63A 4L3OA 2NO0A 3CI0K 2Z2KA 3TZHA 4LK2A 3B7PA 3RBVA 2YWEA 1UXHA 5LC1A 3QW4B 4MQ5A 3GEBA 1M1NA 1GVNB 2BSXA 4G86A 1FVHA 2QG4A 3UK1A 1ST3A 2YQ4A 5AVYA 2C8KA 3BK2A 3GGCA 4K3VA 4MS1A 3WGKA 1O97D 3NIDB 2X5JO 4EJSA 5A05A 2H08A 3BRCA 1E4EB 3AXSA 3T5GA 3CC8A 3L7JA 1PEYA 2I4IA 2REXB 1MXFA 1NXPA 3LXUX 2GMWA 4PFSA 1NPYA 2IF0A 4HDSB 3B6JA 3S2FA 3M5WA 2BI7A 1HF3A 4INAA 3JWEA 4OLFA 4QGAA 5REQA 3Q7EA 3A2NA 3BJEA 5KX5A 2P8SA 4ZA2A 5I4IA 1LPAB 3S2GA 2WAXA 4MKXA 1EPUA 5HKKD 5JASA 5TQJA 4BX2A 4LMRA 4YLEA 1YFJA 3WQHA 1KSJA 1JLLB 3SJCA 1TM4E 3HUUA 4X6UA 2IYFA 4QFMA 4H0FA 2PMFA 4B79A 5K2OA 3A6ZA 5KVSA 3SXJA 1SCUB 3VHRA 3PJFA 5CX4A 1Y1LA 3TIIA 4C0JA 3DBRA 3LUKA 5TF0A 1PW5A 1YVUA 4L15A 5FAXA 3UANA 5K8VA 4WN9B 1Q50A 3MMPA 2HYIC 2MSKA 3N2GB 4Q9AA 1F6DA 4Q18A 5AVXA 5EINA 2XVXA 3ND7A 4GQIA 4ZV9A 1ECCA 3AC0A 3R7WB 3EZ9A 4YP6A 4HB0A 4Y2UA 5C37A 2PO5A 4A8HA 4HNRA 5HILA 1C8KA 1C4OA 4R16A 2AHRA 1QQTA 2AC7A 4O1MA 4UXJA 5EHZA 1L8AA 2E18A 3BWEA 1EAYA 5EWJB 2WWTA 4Y2GA 4BOYA 2WG2A 3CX4A 4LE1A 3Q8WA 2FUEA 4WAUA 4EJMA 4LDZA 4Y9UA 5K4HA 2HT6A 2XQFA 2JGRA 2Q3JA 3E2PA 2EXXA 3HCWA 3TZQA 4P4TA 3KXKA 2FMFA 2YIVX 3FAKA 4JHLA 3GEDA 4A3SA 3U7QB 3TNYA 2Z5LA 3E5HA 3DV0B 3EMKA 3W9YA 4ZZ1A 3SI7A 1EE2A 1ONNA 3U4IA 4PLGA 1LDEA 2CUTA 4BY9E 4DIMA 3OZ7A 2Q21A 4B17A 1EVQA 3D0KA 7ADHA 1V8BA 2WAMA 3ISVA 4W5QA 4LDPA 3WL6A 2B3TA 3OT1B 4ABYA 5G2OA 4A23A 1TK3A 4BVAA 5KKNB 4WNAA 2PYZA 2YWCA 3QVJA 3F1LA 4BU1A 3THYB 3NOOA 4P4LA 4OQMA 1TM1E 3EGXA 4OHBA 1I80A 1XEAA 5CURA 4AVYA 4WK6A 1Z6XA 2WYVA 1E8NA 4EZEA 3S70A 2P2GA 2VI5A 1ZCBA 2ZB3A 4PZZA 5KNBH 4U3JA 3HO6A 4R9SA 1VIMA 3S29A 1YFZA 4O4JF 2ZRLA 3R9IA 3ILSA 1VJCA 1OLOA 2GN8A 1U04A 2EGHA 4GYWA 4DG9A 1JVSA 1LPNA 2Y1FA 3FCEA 4ZCMA 3LFTA 2B7CA 5FOUA 2NZVG 2NPOA 4D0LB 1NU6A 1KZ1A 2ALJA 3DG9A 3NLLA 4NG4A 5GQSA 1ES9A 3P2YA 1SGWA 5JS1A 3IDAA 1NN5A 5HX7A 2B2NA 3DVSX 2W8BA 3CIOA 2JLZA 3DAOA 3OTQA 4QU0A 1KYXA 2VDKB 3PEYA 5BURA 3WK8A 1OLXB 4RYDA 4DHWA 1PG2A 3WLSA 4OX9Y 1JG2A 5HPYB 4K3UA 9ATCA 4Z0HO 2A56A 3BE8A 2JFNA 4MUBA 5CDYA 1HDZA 2IYYA 1A7UA 3CFYA 4UUMA 3TNJA 2NXEA 1N2SA 3RM3A 1JEQA 2JGDB 4JLKA 4AZ3B 2QTTA 3YASA 4V1CA 3SZGA 1PQYA 5KVQA 4O0LA 5I45A 2GZDA 5T67A 2A0YA 3GNLA 3QXHA 3TLBA 5JBIA 3KOXA 1Z0IA 4PYNA 3UN1A 2PZLA 1LF0A 2Q46A 2OPBA 3U7JA 4HT3B 1NW6A 4HLDA 4KJZA 3IR6A 2GZRA 1NASA 3CBQA 4HCJA 4J16C 4XPIA 1JU4A 3QVGB 1SKYB 1YT5A 2OORC 5K3DA 2X4DA 1OBOA 2GEKA 2JGMA 4JU9A 3S44A 4M0MA 5ED0A 4E3ZA 1XHEA 1KMHB 4DT1B 1E1MA 4L8YA 4MW7A 2GLTA 4LYHA 3UT6A 1ZN8A 4Y0VA 3ZR4B 1JB9A 1Q0HA 5EWLB 4Z4HA 2PRIA 4EB6A 4BC0A 3NYWA 2A50A 1LBEA 2EX1A 3JVVA 4CKZA 3MTBA 1FSPA 1N3BA 2WU8A 3UVEA 4ZU3A 2CNLA 4CLRA 4NU8X 1MJGM 1WS6A 4DV0B 1NZFA 1EZZA 2F3PA 2W2TA 1G66A 4OQYA 4AWAA 1E77A 1GTJ1 4G0PA 1WB5A 3TYXA 3AG5A 3QV2A 2XDAA 4ARIA 1ZIPA 2PL1A 2C5HA 1U9YA 3F3YA 4DJDC 4II2A 2D0DA 4LHVA 5IPFA 4QTXA 3HGTA 3IUYA 5IJXA 1VL0A 3NTRA 2EYUA 1EXVA 1I8TA 1QAQA 2DF8A 2PS0A 4FNMA 2NYAA 1K08A 4G5YA 1B6GA 3QLJA 5C5EA 2DBYA 1AXGA 3I05A 5AM5A 4URXR 3EGEA 4GZLA 1ZN7A 1PQWA 2GN4A 2O3QA 1EYZA 5D87A 3HBFA 5B3AA 5F9FA 1CIJA 2J48A 1DWUA 4K6FA 4N76A 4QBHA 3UJ3X 5K8JB 2V59A 1T8YA 3MD0A 1BX1A 1BE1A 1XDGA 3I23A 4S1OA 2XZOA 3ZDCA 5BNFA 1L7XA 2WT4A 2Y6VA 4RELA 3T9DA 3TS1A 1W96A 4F6RA 1M1NB 3WK7A 2LIVA 1FFEA 1R4NA 3UJHA 1Z7GA 1RYMA 2G6BA 2GK3A 3CPJB 3LPCA 4WGGA 3WK9A 4ZCRA 2VXBA 2WOJA 3EXHA 5BNIA 3HKBA 1WNTA 4ZPXA 2NNWB 4MS1B 4PG4A 1NSYA 3JYQA 1YVPA 1RQ7A 1T3ZA 1S2GA 3FOZA 1OBCA 1E2LA 4EFKA 1U6KA 1WLYA 4BMPB 3I6BA 4YGXB 5BUCA 1NY6A 1B1CA 1ZH6A 2BLLA 3ZE6A 2E6UX 4KIJA 3ZTYA 4BGIA 5ICMA 3IQDB 2GD1O 1TA0A 2J3HA 4NATA 5I9TA 4ENTA 4DIBA 2NSDA 4TMYA 3MCVA 1KPGA 4HY3A 4PGFA 2OAGA 2GN1A 3DMHA 4NTZA 3QMVA 5J59A 2RJ3A 5REQB 1E8MA 4BMNA 5HKAA 3FTEA 2Z30A 1FXSA 2VDMB 2VYVA 2YJ4A 1L1FA 1U0EA 4LI3X 4OI0A 2AYXA 2YR0A 4XD2A 5J5VA 5IU6A 1TPZA 2AC4A 4X7MA 1Z0UA 2DWQA 2Q5OA 4ER0A 3A6PC 5FWXA 1AKNA 1UM8A 5F52A 1IL0A 1L5QA 1YTLA 4J03A 4DPMA 1NYQA 4LHWA 4EECA 1P9WA 3QWHA 3GGGA 2WD7B 3HJBA 5EVJA 1U9CA 3REGA 3RSOA 4JZKA 1O0CA 3TFWA 1T4CA 2YJGA 4PRZA 5JQGA 1OI4A 1JT2A 3C3YA 3ZHZA 3VC1A 4BO5A 1DFGA 2EBWA 3VSAA 1KL7A 2WHPB 4Q19A 4QGBA 4NC9A 3OUTA 1Y98A 5AI0A 1LH0A 3HY4A 1YO6A 1CHNA 1LPBB 4CR8A 4DMHA 2ET6A 3MERA 1ZIXA 3KQKA 1FRNA 4F96A 5HK8A 3H1EA 2JK1A 3LX6A 4QJBA 3ZHXA 4ALKA 1MO6A 3HYLA 4EBBA 9LDBA 2ZPTX 5EY5B 2HA4A 3O94A 4JDUA 1QDUA 2Q6OA 5IH7A 2BGLA 5K7SA 5GGYA 4H27A 3ZD7A 1S1MA 2IDKA 4I5GA 1JBKA 1NVVR 1TXGA 3QOXA 4CIBA 4NEGA 2VBIA 2E4WA 5DN6D 5F7XA 2C57A 4JLDA 1LPPA 1KHHA 2G9NA 4PC1A 1H22A 3H83A 5FHRA 1X3LA 2C5GA 5CA1B 4C7OB 2V7WA 5A2QA 1SVNA 1GGFA 1KEPA 3GCXA 1T36B 2OOKA 4OJNA 3ZKAA 3CMMA 4CMGA 3EEYA 5K6AC 3CB4A 2H9AA 3HBLA 1E7RA 4U0JA 3QXSA 3WX0A 1WW8A 1N7IA 3D8RA 5C34B 4GWLA 2EJCA 5G40A 2PIAA 4WNAB 3JAKA 2PKQP 4JJFA 1DS6A 1DXQA 1G8FA 2ZT5A 4P8RA 5JCJA 1D6MA 2WF9A 4KE8A 1PJZA 3SYNA 1WUTA 4RZXA 3ZK9A 4A0RA 2UZAA 3OE7A 1ZG3A 4D57A 3OFND 3VPHA 3R0ZA 3I2FA 1WU7A 3FSRA 2GM4A 1SVIA 4W8GA 1LB1B 2W37A 4BNVA 3L8YA 5ENVA 4HNUA 2EL7A 1NQUA 4N4AA 4UNIA 5FI3A 5IFKA 4HL6A 1A9PA 4IJ6A 4NONA 1BEZA 1QO0A 2A14A 2NZWA 3DLPX 1XCGB 3E82A 5U4QA 3V1YA 3ZV6A 5FKJA 3DAGA 1D8TA 2XWJI 3IJ5A 4JLJA 1WSWA 3PUVA 5M04A 1FX0B 4IJUA 1WD7A 2CCJA 5B3KA 4PC3A 3B51X 1GGJA 3NKLA 1TZ2A 2WVJA 1TM3E 2ONZA 4L08A 2QR3A 2W8BB 5AHXA 4GRAA 5DBIA 3ROMA 3DE6X 2BFCA 4YMGA 2IJGX 4UARA 3SDZA 4NJMB 5KYKA 1D6NA 3BCRA 3H9EO 3W6UA 1EWRA 1ZJYA 3G0GA 3L7IA 4Y9DA 1Y9AA 2IVZA 3DP9A 1Y82A 2P3QA 1XX6A 1YIAA 3EFOA 5M7EA 3PXCX 1ZI8A 1QX4A 2EFCB 2OO3A 4CQMA 5K3OA 1DUIA 2JFPA 5TRTA 2GXQA 2HWKA 2Y8EA 2F59A 4L75A 4RBNA 1BD3A 3P2KA 3RRNA 4EFDA 3I92A 4I8DA 4KN8A 4LJRA 4MOWA 1Z6GA 1K6MA 3A1NA 2QM7A 1CS0A 1QHHB 4A73A 2AFVA 3ESAA 1J07A 4XPIB 3AHGA 1NX9A 5JLAA 2HK7A 1IWPB 2WWYA 2ZQYA 4X9XA 4AZTA 3U7GA 1NTRA 1CB7A 5JADA 4QPPA 5HZGA 1IN7A 3U4HA 3TLAA 4AN0A 4TYPA 5CFOA 2A5FA 4TV8F 5JBQA 4Q4HA 4YT8A 1R8JA 1KEEB 1YRAA 4EB6B 4AJ9A 4HEA6 2JLBA 3WQQA 4EI7A 1YQWA 5EPOA 4PR0A 1J97A 1ORRA 1W35A 3E9YA 1G8JA 5TJ9A 1KO5A 4CLRB 1BW9A 3T3OA 1SC9A 4R2JA 2RK4A 3BWVA 3KQPA 5BXQC 5DM1A 4RDXA 3JQGA 3OQJA 3TZLA 4UMVA 2Q7XA 3CLUD 3C87A 2ZUSA 3HI4A 3LUDA 1N78A 3QUQA 3MB8A 4HQKA 1YR8A 4R51A 4KTTE 4OPMA 2HSDA 1JJVA 4O2LA 4CG3A 1ACMA 1U9IC 1AMUA 4ALMA 2FPMA 5H7XA 2IDMA 4AYWA 2ZUDA 2I91A 1IBMB 1Z39A 2RHDA 1XHFA 2JCBA 1XTQA 1YB5A 1CS4C 2V9ZA 1JKIA 5E2AA 3WE7A 2O8EB 3PXDA 4OUKX 4Q9LA 4Z9FA 2L18A 1GU0A 4PRYA 4GYJA 2FDRA 4JITA 2X58A 4Q21A 4ZHQF 5ICGA 3S8EA 4L5CA 1H2WA 2PLFA 3MFYA 4F97A 3FMIA 3EYAA 1WLSA 2BFAA 4V0QA 5AOBA 3DO6A 2ATEA 4ZAWA 4OMCA 3VQTA 4LXYA 2QRPA 3HI6A 4CG1A 4RVFA 1EXNA 4C4SA 3HJFA 4NQZA 1GPDG 3BK7A 4F6RB 2HRBA 2CXPA 1EGQA 2YN2A 5BV2P 4NOMA 3U5ZB 2WYHA 2O8DA 3F2VA 3DE7X 2AZXA 1KVTA 4HDRA 2HCTA 5CD9A 3GFTA 4JFAA 3OA0A 2JJ1D 2PZJA 3F6SA 3T4EA 1KOJA 1KK0A 1KJIA 3LDGA 5T4FA 1E9CA 4FCVA 1D4ZA 1N6RA 4P98A 4NBVA 3IMCA 3N8HA 2Q5IA 2QLJA 4JLMA 5EUBA 1ZD3A 3KR2A 3TSCA 1B2RA 5BSKA 5JSZB 1T9AA 3PCXA 2WQ6A 4ZO8A 1H5QA 2AN1A 4C2BA 3W6ZA 1W5EA 1YDHA 3H4IA 1RPTA 3BGOS 3GZ4A 3OD1A 3AVXA 2WJZB 1UJ2A 2JIMA 2EBFX 2H1VA 1FLVA 1QRAA 1FUEA 3EIFA 3F7MA 4JLOA 4OYYA 1HC7A 5AK5A 1CERA 2V0GA 3WL8A 4NFYA 5KWEA 3PGXA 1F9AA 5H3LA 3AF2A 2V9PA 4O2BF 5ER9A 2Y1XA 3TD9A 3TUIC 1SULA 4C9BA 5CEEA 3FFXA 3NONA 1BJRE 4OMUA 4AIIA 3WSTA 2GBGA 2OCPA 1ORWA 3PS9A 2WM3A 4HGNA 4HKTA 4GPBA 3KEFA 2D2XA 4JUFA 4OU5A 1J4AA 1U8XX 5JQGB 1U8UA 3MTGA 1GPUA 2OBBA 1H1DA 2XBLA 2WIBA 1ISGA 1E2EA 3QE4A 4DIDA 1YQGA 3E2MA 4XB2A 5FOTA 2GBPA 5DM4A 2WM9B 1HFEL 4DQVA 3HVJA 1D1TA 4CDGA 2XCSB 1MRSA 1M2VB 2FEOA 1CQIA 4B7AA 5ALLA 4C5AA 2A8YA 4JI4B 5HFAA 3F2IA 4K03A 3TX2A 3VU8A 4TL9A 3AXTA 3CZCA 3P27A 3PTLA 1T6ZA 4NYMR 2IZ6A 2WK1A 4YDQA 3KALA 1B8VA 1M8JA 1CEQA 2CEKA 4UDXX 2ATIA 1ABEA 1N1DA 1A5ZA 1FP6A 4BMVA 1SOAA 3IESA 3RS2A 4F6LA 3U60B 3CVJA 2NO9A 1V41E 1U7DA 2FW9A 4M6WA 5I9IA 3ZWWA 5C1DA 1Q1EA 3NHKA 4HRAA 1BE0A 1C2YA 1N2HA 5I4CA 3R7BA 4G0ZA 2VQDA 2WM8A 4PC6A 1LPSA 1SXGA 2ZLBA 3BEOA 4FE3A 2B4RO 4XGNA 2C7BA 5ALOA 1W5BA 3VFDA 1WQ3A 3L0OA 5KJEA 2PLNA 1N2JA 1N6IA 3I2IA 4UAGA 2H57A 3TNFA 1OWPA 1KOLA 3W3AH 2O2ZA 4EF4A 2A0UA 2AMJA 1VBKA 3JAKB 4D7AA 4YRGA 3ZVKA 1T6YA 1XUOA 1GG9A 4Z53A 4WRRA 1VJRA 2LV8A 2QGFA 3SEFA 2YHIA 3I04A 4J1SA 4P7KA 5A4IS 4YAIA 2OWEA 4O3MA 1EHIA 3L82B 4G9BA 4GDMA 3DFZA 5EXCA 4ZO9A 4A6XA 1ESZA 4PAGA 2J59A 3ZCXA 3M1AA 1C7JA 4TZTA 3N28A 1KARA 2ZWPA 3KSBC 2FWMX 4MS3B 1XTZA 3PDWA 3T34A 3W8DA 1TCVA 1CD5A 1J7JA 1E6KA 4JOBA 4NOKA 4RH1A 5HOEA 5KOYA 1DO0A 4GMFA 4PLWA 1E3WB 2JGIA 1DQZA 3QPWA 3B52X 3THWA 3TQQA 1GUFA 3IX7A 1R6TA 1U4SA 1GG2A 3A9VA 2C88A 2Y93A 4M9CA 4O4HF 1DLIA 1PNTA 3J7AC 3FUTA 1QS0A 4B3RB 4IO1A 2AJ8A 3OY7A 3QKWA 1VGVA 3IHKA 3OJLA 4GPZA 1ZZGA 4NDAA 4WEOA 1SXQA 1PD1A 1QHFA 4AJPA 3GEEA 3P0IA 1MG5A 2TS1A 2CVQA 3TW4A 1OXSC 2GBLC 3OJFA 3EZYA 3HBJA 5CYPA 3IJEB 3T52A 4M22A 4NMMA 3H84A 3ONEA 1I6MA 2OG1A 4NNJA 2J5BA 3H3JA 4FDAA 3TSZA 2JDID 3DOCA 2YKGA 3DS8A 1RXVA 3OC0A 5DCLA 3HJAA 4RZQA 1DC4A 1SUWA 5IARA 4CI9A 4LRQA 1HPLA 4Y18A 4HK4A 4FBLA 2H06A 3MOGA 4RNDB 4FEGA 1E2JA 1YNSA 4N18A 1UZUA 4O1HA 4MDYA 4KSBA 4FOOA 2P9EA 1THZA 2XB4A 4EKEA 4KQFA 3EC2A 4QICA 1UC5B 1HNWB 4MV1A 1KQPA 2CV1A 2GCPA 2VDRB 2F1HA 3VH3A 1JU9A 4DSUA 4QPJC 4WMLA 1N2BA 1G7SA 1Y89A 1SUSA 3O2SB 3DZCA 1A04A 2G4VA 1J0BA 2YBEA 1GKLA 1LSOA 5C18A 5DEIA 1TK2A 4GOKA 4AY3A 4UTVA 1A9TA 5EJ6A 2FZWA 1ESCA 3QKIA 4B5KA 1Z2OX 3ASZA 3ZZ0A 2Q9CA 4ZT7A 5SY9A 3M6FA 1PQUA 2J9FA 2PKCA 4X00A 4Q47A 3RG8A 1V39A 4RLFA 4BQQA 4JYZA 3QMPA 1K2WA 4P4UA 4Q9NA 2GEJA 3HB4X 3S1LA 3W5HA 3VU3A 1M7BA 1VB5A 5DGHA 1CTQA 2C92A 2A33A 3RREA 4EL5A 4FINA 4FW8A 1H2BA 3VPAA 4RHUA 4NLLA 2HV8A 1AXRA 1I14A 1VE3A 1IVYA 1WZIA 1J25A 1H0HA 4I8XA 5AK3A 1BHO1 1XAIA 3BQ9A 2H2DA 2TECE 1WZNA 2VO1A 2W0MA 2O5VA 3MIIA 2QMYA 1CE8A 1QLWA 4FFMA 4KW7A 1S01A 4BXOA 4N7MA 3L06A 4Y1RB 2E21A 4GSLA 4NCNA 1Q57A 4IY1A 3AF1A 4R3UC 1O89A 5JCPA 4I7EA 1VHLA 1XAJA 3BB4A 4OQXA 1KPIA 4F60A 2XUIA 3ULKA 4HDRB 1SHUX 2R6JA 5CFRA 4CXMA 1RKXA 4UXIA 4UNSA 4EEKA 2F3SA 3HTXA 1JH8A 1T2VA 4GE0A 2C0CA 4QUDA 5KO2A 4DUGA 4OQNA 2PZAA 2A1UA 3ZW9A 6LDHA 4IJMA 1WY7A 5L95A 3K71B 5GJBA 4PXAA 1ADBA 3UXYA 4D92A 4KVFA 3SK0A 3QBDA 2IU0A 1PJCA 1YR9A 3I4LA 1NE2A 1C9KA 4WLEA 3HL4A 1E2GA 4L4ZA 3VHQA 2I8AA 2NYRA 3ZVNA 5AH0A 4HAVA 5FBKA 1JJBA 2ZFUA 4RS4A 1M54A 2B98A 2PSJA 2WYWA 1BDBA 1K06A 1JKFA 3FMGA 4Q1AA 3U9TA 1PFYA 5C8XA 1K8RA 3IDFA 4PCAA 5IHXA 3BAFA 4YH1A 3QKRA 2HJ9A 3IV6A 3EVFA 3RO7A 1T9CA 1TUIA 2IODA 4PLYA 1IEQA 5T6BA 2XNSA 1HBJA 1E5QA 4LE2A 2UYOA 4JU8A 1GSAA 1GAQA 1L5ZA 1EK6A 1BKSB 1NUQA 2JJQA 2I2WA 1TUEA 4J3FA 4L5AA 3ZTWA 2OC4A 4ND7A 1AMOA 4ASUA 3I3SR 2FW7A 4FSDA 3TRDA 3RTGA 2EP5A 2VHQA 1PQ4A 4PGMA 2NP7A 3WG9A 1QGUA 4LC0A 2A86A 3N74A 3T3NA 1AKVA 3FM9A 3GN2A 1IPEA 1PE0A 3MBOA 1RLUA 1JS1X 1RAFA 3SSNA 3VKUA 4CV1A 3L0BA 3CVVA 2OYCA 4FEAA 2ZDGA 3PD1A 1JL3A 4LECA 5HMLA 5DRTA 3T7AA 5LU8A 3P4YA 4N5HX 2IWRA 2J7KA 1V1MB 3TDMA 2EF1A 3NGLA 2WUDA 2HHHB 2IZOA 1C0PA 1SD1A 1NW7A 3CXUA 4EUNA 1GYRA 3K9LA 3MZ0A 4E32A 3QVSA 3ZCRA 3C1AA 1EG7A 3IUSA 3R3JA 2AWNA 1NIPA 3HE3A 4I4LA 1Z07A 3G8DA 4HGYA 2I87A 1CJSA 1FDVA 2QLFA 2WUWE 3GLTA 3HCPA 1P1KA 3KEOA 3KPVA 3NRCA 1DKUA 3PPIA 4G09A 5GJWC 4B71A 3ILXA 5LOVB 5IS2A 1M8PA 3ZIDA 3OEHD 4D41A 4OHRA 1YRBA 1WE2A 4N6OA 1YJBA 3DE1X 1MC1A 2QT0A 2OVFA 2QN9A 2W8ZA 1H2AS 4JBWA 5L3QA 2YHIB 4FIDA 3EVTA 1V9CA 1E2DA 5AW6A 2PD6A 5GJCA 3GC6A 3QJGA 3IJPA 2H59A 4I36A 3SDSA 1I6LA 2VR1A 4PYKA 1WWKA 1BHSA 1SC3A 4PYRA 3BIJA 3VGJA 1JSRA 4KO1S 4ZDKA 5HQTA 2FWAA 1E1KA 3UB3A 3BDIA 3B89A 4HWRA 2P5SA 1YHYA 3RRFA 4C4RA 4QHYA 3PQEA 3RT1A 2AZDA 4Y6PA 1X13A 1XLVA 1HT0A 2VWHA 3THOA 4DMCA 2PFKA 4MI3A 3VH1A 2FXIA 3GJ6A 2W2VA 5KQMA 4N39A 3WDSA 1QAOA 1E7YA 1Q19A 3R4VA 4FB5A 1XELA 1Z6YA 3BSWA 3ASVA 5A7GA 2HA6A 2ZBVA 5EJ7A 3TIFA 2H4XA 2WKRA 2N1BA 3ELBA 5BW4A 3FBWA 4O6VA 2DT8A 2D5CA 3LP8A 1ZNQO 2MSNA 1JIQA 1I51A 2HU5A 5K3AA 2ETXA 4OCZA 1H2YA 1SUAA 3H87A 1EI9A 1OBVA 1ZEMA 2TYSB 1ZMTA 4P2GA 3AJRA 4WLFA 5E0KB 3SDBA 4AMBA 5FBWB 4E22A 1H6DA 4NZ9A 4QECA 3C4VA 3SZ3A 5DI9A 5ALYA 4D4JA 1MB3A 5F3RA 3JATB 4LA4A 4L0MA 4WXRA 3NV7A 4ZVLA 2HA7A 1P0MA 2XNCA 2PX6A 3K8ZA 1KIAA 5KQPA 3UOGA 1VSBA 2CLSA 4MQEA 5CTJA 4PPQA 5LZ8A 5ALKA 5IUKC 2H7VA 3RTCA 2CV2A 4WJZA 4K9QA 13PKA 2XAAA 4AQ7A 5AOVA 4I5FA 4GLOA 4OOEA 5FLEX 1N3LA 3OCJA 4DR4B 4H7JA 3K1ZA 2KYRA 2RGDA 1YRQA 1DG3A 1LBIA 3LD9A 2QTMA 3GD7A 1V48A 3NTQA 1CY0A 2P6MA 4ER7A 4G3XA 4FT4A 5T5QA 5JR3A 1JHQA 1M5RA 4EGCB 1Z4KA 4R2LA 4PZPA 1NAIA 1QORA 2IV7A 5AW9A 3CYFA 3L7OA 3JAMA 1QZ3A 2NU8B 3P9PA 1X7ZA 3ROTA 4AS3A 2HNKA 5I7HA 2G6TA 2R4UA 4P3OA 1N0IA 4CF5A 2J9FB 3ZUPA 5K6TA 1W2WB 1IZ9A 1LNQA 2BRUC 2OTCA 1Q0PA 2AJLI 2G67A 2XB9A 3KU1A 3MWKA 5TT0A 3AT1A 1ZL2A 4DLAA 3PLAE 4U1RA 1GL3A 3IT0A 1NVUQ 3BVPA 4C7KA 3VU1A 4QLBA 1SOMA 3QMMA 3O6VA 1AUOA 1II8B 3DHNA 3U44B 4INOA 1X1DA 4OK3A 1CRWG 2QY6A 5FADA 1DCMA 4TLEA 3I4FA 1J8VA 2OCLA 2QAGC 5AVZA 4BJ6A 2GZ1A 2FEMA 4Q4CA 3SHOA 3A36A 2AD5A 1BAPA 3GWGA 3WMGA 3ONWA 4PYOA 1AKYA 4KPUB 3O83A 5F5LA 1HKUA 1XQ1A 2J7PA 4GPEA 1AS3A 4QDKA 4H1WA 4CEJA 3QUSA 1OTXA 2J5XA 2Q0QA 3B12A 4DRXA 2V5VA 2IH2A 2QM0A 4BCDA 3B6ZA 3O75A 4KWTA 3WWPA 2QN1A 3ZV4A 2PMEA 4EUEA 2MSEB 3LLUA 1UPAA 5BO5A 3M3PA 3DHVA 2YZ2A 3FHJA 1JKXA 3ERCA 4D44A 1YUNA 3I1IA 4CN9A 1DJQA 1I5OA 2A9VA 4ICIA 1K7YA 2VYQA 3X44A 3T5DA 4A9AA 1MVOA 3Q98A 2JJ2A 4MWSA 5JCOA 4HOYA 1QIFA 1H2ZA 4HYEA 1C7IA 4QUKA 3U48A 4DANA 5ABPA 4XOUA 2Q3CA 4NYIR 2OHVA 4D4MA 5AI8A 2W2XA 1YMVA 3O4RA 4F8JA 3COZA 5IULC 2Q1YA 1CV2A 2Y92A 3SF0A 5JISA 2VJPA 5LWHA 4YWJA 1H3FA 3IOMA 1RQNA 1TU3A 5J58A 1UC9A 3ZHCA 2WVAA 5DNAA 2C04A 5CIWA 3IOEA 2XYHA 2C3YA 5F4ZA 1GQ2A 2XVZA 4AJIA 5CFPA 2YRFA 3DE0X 4II7A 1L5MA 5EHNA 4PPNA 1YZYA 3FBTA 1EH5A 4K0RA 2B2XA 3P4XA 3TOZA 2QLTA 4CM9A 4WA7A 3RT7A 1V6AA 3I9V6 2VWPA 1JLKA 5H5JA 4DDVA 4EPWA 2OFFA 4YP1A 3W7BA 1YS4A 2EEPA 3QHAA 4H18A 1NJ8A 1TF5A 1HDXA 1H05A 5A7HA 3L79A 2PGLA 4X93A 1Z4PX 2G40A 2I4MA 1E6CA 2XTJA 2BKAA 2C4MA 1QHSA 5DOZA 4M7WA 1UZLA 3HO1A 4LYDA 2LRHA 4Q7KA 3JQEA 2INGX 5ECWA 4OHZA 3DWGA 1NUAA 4LZOA 2R1TA 3ICCA 3E5MA 3PHIA 1HMYA 4DEVA 3ZE2B 3OP4A 2HM7A 4IHJA 1NXXA 2WHQA 1RCFA 4PONA 1Z08A 5IAEA 3OCXA 2L17A 3K5HA 3WYNA 4BLQA 3PD0A 1CULC 3T4UA 3WZ2A 5FUYA 5G4LA 4O4IF 3GZTB 3JSAA 2HEGA 2VAPA 1BOFA 4F3KA 4UTRA 1IN4A 4ER5A 2C54A 3SVTA 1SUEA 3QY0A 4P38A 4OGGA 1HFJA 3OWOA 5CJJA 3FIUA 1Z47A 3TTUA 3TMKA 4ID9A 2DBVO 3CLVA 1YKSA 1A8UA 1SEPA 3JD0A 4HDKA 4LCEA 4B1FA 3OAAD 4F93B 1KO7A 1PLKA 4PYIA 3EDMA 4OXXA 3TSYA 2FFAA 1P0PA 3HVRA 1S8NA 1FYWA 1M6HA 5AKYA 1SBNE 2ZIVB 4RHFA 1AKWA 3GLGE 1ZP6A 5KUTA 2YWRA 4HN9A 1RWBA 3E53A 4DTCA 2DQYA 3FJYA 1CRQA 3WO1A 4L8FA 3ZLTA 1ENOA 1TM2A 1KMMA 2ZI4A 4K1XA 4AZ0B 4B6EA 1H42A 3IE2A 1DCFA 4IZIA 5B36A 2M6LA 3NW9A 2Y0CA 5FV4A 5LU9A 3ECSA 3ANXA 3MTIA 3VKGA 1X1BA 2QX6A 1XEXA 2X8BA 4GLJA 2IIBA 3FLMA 5TC4A 3CZRA 3QF7A 4FE4A 2Q5JA 4EYEA 1ZITA 3IILA 5BN4B 3FLAA 4HFRA 2A5GA 2FJPA 4DGSA 2BI4A 2PLAA 2V4MA 3G1TA 2PZKA 3R9XA 5HDBB 1P4AA 4NMXB 1PNQA 3EG5A 1ZGCA 1OFVA 2GEDA 2PX8A 5D3KA 2WZDA 4YXFA 3SIXA 3NH9A 4OP2A 3WSWA 2FHSA 3QU5A 1ZHHA 4C29A 2ASEA 1RAEA 3TMAA 5HBGA 3T3EA 4JWTA 2WDPA 1LK0A 4OBEA 3H99A 4QGGA 3I9LA 1K1EA 2FRVA 4KAJA 4UXHA 1TAHA 4BNIA 1XKQA 4IDFA 3FSEA 3FBGA 3I34X 3PJRA 2VDPB 3W1EA 2ID9A 2R1UA 3DLIA 3EGCA 3I9NA 4GM4A 4MINA 4YQZA 3EIUA 5TVGA 1W25A 3EFHA 3GJ7A 5FWAA 2Q1TA 5K3BA 4PZYA 4DLWA 5G3ZA 5JXHA 2ZT6A 4DB2A 3FCXA 4PX2A 4YRRA 2AIRA 2EHJA 1OIXA 2EW1A 1TF7A 5I3CA 2ZCVA 4HEA1 1DDGA 1KFKB 2PUEA 4JXZA 2J9ZB 1ESMA 4LN1A 1S9DA 5IZCA 2GBCA 4XOIA 1X7ZB 1NLFA 4M36A 3N0RA 2W98A 3PIRA 2YYAA 1Y5IA 4G2TA 3H2JA 4QEDA 4X94A 4GEKA 1F2VA 1W36C 1MZPA 4XWTA 5B2EA 4WOKA 1EGMB 5J4VA 1F1BA 1WXXA 3QXCA 3QG1A 5LKRA 1NSFA 4N8EA 1V1RA 2PGDA 1P33A 3PGA1 2ZYUX 2VF4X 2VQSA 2P2NA 3H16A 3LTNC 1SH7A 2TRSB 3E7DA 1JMVA 1VPDA 3F90A 5CA0A 3IOBA 3P94A 1U6JA 3AM4A 1TZKA 2WNHA 3FHLA 1WR8A 1KQ3A 3KTFA 4GXNA 4HAIA 5FTNA 4POOA 2J3EA 2HYDA 4S0XA 4YFYA 3H18A 3WMRA 1WSBA 3AHEA 3HR7A 4BV8A 4C01A 3KTAB 1E5DA 4AN1A 2A35A 1OGYA 3STHA 2Q1SA 3RGWS 1INLA 3E03A 4QDXA 4XIYA 1BE6A 1SIBE 2BW0A 2QJOA 3N86A 3QV1A 3EARA 5GVRA 3ICQB 4TQAA 1VG8A 4B3DA 2LDBA 1MIOB 2RK3A 4AURA 4DRXB 1KQOA 4Q3LA 2RJOA 4QOHA 1NP3A 3A04A 3P19A 2W2MA 2WWRA 4FOPA 4G5GA 3EF3A 3LDUA 4GSKA 5JNWA 3LBNA 3A3PA 1EP3B 2CE2X 4OSPA 4PTLA 1H9BA 1L4HA 2F4NA 4N9WA 4YC7A 4R9UC 5CAEA 3NXSA 1FP4A 4MYTA 2JCGA 1TA4A 2GDZA 1UADA 4LKRA 4UHDA 3LGAA 2VFAA 1QVRA 2VZ9A 1FE8A 2C94A 3C2QA 2OV6A 3KXDA 3W5SA 4HXYA 1YR6A 2B5OA 1UEXC 2FW0A 2H16A 2O3SA 3KWFA 3OQHA 1YDEA 3FX2A 3UMFA 1DDOA 1GNLA 3ZLVA 3AO0B 4MP6A 1EFVA 1LV7A 1NPDA 5EJ5A 2PXCA 1UWLA 4GSYA 2YYSA 3ETLA 4K9SA 1R8YA 2BP7A 1JDTA 4X62B 2Q4EA 2WF7A 4AFNA 2ZP1A 5C7IO 4ZQFA 3UQZA 4DWJA 4EKIA 2F3UA 4E1BA 4C4PA 3H11B 1B6SA 1HWYA 2C78A 5ILOA 1N33B 1I1QB 4XEUA 4PPYA 3UJ8A 2HPVA 2YUIA 1QQ5A 2JFYA 1YQEA 1UFKA 4F4UA 4MW2A 5E3IA 1AB5A 2NUBA 1L3IA 2VJLA 4HQ0A 4O2AB 3VSBA 1SVWA 3QOYA 3WNVA 5KREA 5CVUA 2XOXA 1KYZA 2QD3A 5FQOA 1YE8A 3VPFA 3RABA 4LRXA 4RSMA 6ADHA 2BLNA 4UCQA 5DTEA 1IN1A 3CN9A 4KBFA 2AQIA 5DO9A 5EJAA 4AMZA 4DCSA 1UJNA 3U49A 1XTRA 3M5CA 1RBQA 2LIPA 1OA1A 2O9JA 3KFXA 1J56A 2BVNA 2H0AA 2XEDA 3PPVA 4GICA 3ZPXA 1YBVA 4H3KB 3LUCA 2XVYA 5ALPA 1A50B 2HU7A 1WQ4A 5CVJA 1JJ7A 2FZLA 4TL7A 3U17A 4HZUA 1UXOA 1PL6A 1Z34A 2EZ4A 1N7GA 1ZRHA 2JJYA 2DP4E 3F6PA 3HMKA 1QLJA 4NBSA 3U3OA 3V2HA 1YAJA 5AW8A 3ZJ4A 1GZUA 1V4BA 1T1JA 2JEYA 3E9CA 3IIJA 4CTOA 3BRQA 4KHZA 4KXVA 4BO1A 3EUFA 1BJKA 4YRQA 3NBFA 2VP9A 1M6VA 3D7RA 3GX1A 4P54A 4AG3A 3T0IA 5BV7A 9LDTA 5B64A 1ODLA 5I6DA 1YK0A 2D3TA 2UZ3A 4I4TA 4KO8A 1LVUA 3SC3A 3PHGA 2JVIA 3QJ5A 3LT0A 3VU0A 4EEXA 4ON9A 2FKNA 1QPGA 1L5GB 5GM2A 4B7UA 1QQBA 3GP8A 5CDSA 2C5FA 3O1JC 4N9QA 3S3TA 2BH9A 4NABA 3JQFC 3O3NB 3V1UA 5KOIA 1XA3A 1S8OA 3W3AA 4P35A 2OK8A 1OXKB 221PA 4WPGA 5JLJA 5IX8A 2DUNA 3WLTA 3A7EA 1NW5A 3ES9A 1LQ2A 3IELA 3P9RA 3RYTC 2C7GA 4I99A 4WCFC 3ZWDA 4YP7A 5JNLA 3AHIA 5ILQA 1YONA 3KHUA 1EZ4A 1JNYA 4DDMA 1S8AA 5IP5A 4MIEA 1EWQA 3OE7D 1WDKA 2WJJA 3QHQA 2VYND 2AKYA 4L02A 3AR4A 2B1GA 3GWZA 3RS7A 2Y68A 1XJQA 1E2BA 1U5AA 2YTZA 5EIBD 4CMJA 1GCUA 2H31A 3JS5A 1CX9B 4ZOLA 4JEMA 4BZXA 1YRHA 4C0AC 4LQCA 3WYDA 1QV9A 3LKZA 1IBLB 1TGVA 1DKMA 1PL7A 3OLYA 4O33A 3RUCA 1KORA 3ZUGA 4QIHA 2C9OA 3CSDA 1PFUA 3AFGA 4IIUA 4M1EA 4Q9DA 4RMGA 4RMIA 1JLSA 3V7WA 1U2RA 1WEKA 3EUAA 4B4WA 3A1VA 3GPBA 1MNAA 3NIGB 1V4NA 3OI7A 5ISMA 2OV4A 2ZCUA 2CLMB 1A0OA 5AKKA 3RADC 3V97A 2WTEA 4RKYA 1C8LA 1G8GA 1TCUA 1GNPA 1X7WA 2ZJZA 4P5EA 4W5WA 1D6SA 1U9ZA 1ZCJA 3MN1A 3PXBA 3QA9A 3RVKA 3ZN2A 1NG9A 1OE0A 2WIFA 2RBKA 2DFKB 3O4VA 2C9ZA 1J0AA