4MUNA

Crystal structure of pantothenate synthetase in complex with 2-(5-methoxy-2-(2-nitro-4-(trifluoromethyl)phenylsulfonylcarbamoyl)-1h-indol-1-yl)acetic acid
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
286
structure length
283
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 92
structure length 283
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4munA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4munA01
1JECA 3G5AA 2A7XA 5H16A 1IQUA 1KORA 1WXIA 3FH0A 1KH3A 1YUNA 4NDAA 4CDNA 3A05A 3SDBA 4ZCTA 1CT9A 4F4HA 1LI7A 4Q16A 4DDKA 4ND7A 3L92A 3AL0C 2J5BA 4MUJA 3VGJA 1O97D 3RK1A 3AIIA 3ZIUA 2CYCA 1T9GR 1FYDA 1B6TA 1KAMA 3HL4A 4HK4A 3IVGA 4MW1A 3CLSC 4R2LA 1JEEA 4EF6A 1Y42X 1JIIA 1F4LA 1U3DA 3IMEA 4MUHA 4MW9A 4MWBA 5AHWA 1PFUA 1H3EA 3MLBA 3A4IA 3N9IA 1OBCA 4KPUA 3ZJTA 4L2IB 3NBKA 5LM3A 4QRDA 3QTTA 2B7LA 3X1JA 2QUJA 4OUDB 4R2MA 5J58A 1VBKA 1N78A 2PXHA 1J1ZA 3FNRA 3SP1A 4KR6A 3C8ZA 5LLTA 3LE8A 2IP1A 3N8HA 1M8FA 1XNJA 3KT0A 1IQ0A 3E27A 1GTRA 1F9AA 1MRZA 4YBRA 1EJ2A 2O5RA 3IUBA 3ZJUA 1TYAE 1NSYA 5K0SA 2OQ2A 3SYTA 3AG6A 1PG0A 3KT6A 4F3RA 3UK2A 3MUEA 2WSIA 4R0NA 3COZA 4MULA 3IOEA 1K92A 1XNGA 5TGTA 2DR2A 1WZ2A 1F7VA 4MVWA 3N2YA 1MB9A 1MOPA 1EUYA 1GTSA 2QTRA 4KKVA 1YIDA 4DNXA 5TS2A 3AFHA 3HZRA 3PNYA 4WSOA 1OWNA 1BS2A 5KCMA 4YMIA 1QNFA 3H99A 1G8FA 1R6UA 1J20A 1NYLA 4AS1A 1JIKA 1X6VA 2CYBA 1EFVB 1MC1A 3OTWA 1G59A 3A04A 5DEOA 1O0CA 2V0GA 1LI5A 2XRZA 1GLNA 2JA2A 3ND5A 1H1TA 1NUSA 3IODA 4MWCA 5EKDA 3TS1A 1K97A 2E0IA 5IJXA 3IDFA 5DASA 2H29A 2QJOA 3RBAA 5JBNA 3PNBA 3RJZA 2A1UA 1KR2A 1A8HA 3CLRD 4MLPA 2C5SA 1QTQA 3X1KA 3COYA 1YULA 1U7XA 2YXNA 3LCJA 5J5AA 3D6UA 4DDHA 3H9BA 1KQPA 3GLVA 3TZLA 2J4DA 4FZJA 2VTBA 1H3NA 1O95C 1N2GA 1PFYA 4QREA 3U1VA 1KQNA 1T6YA 1YIAA 4ZCPA 1ZUNA 4ND6A 1KH2A 4MUFA 1JZSA 3S3TA 3MXTA 1WXGA 4HJRA 4KPUB 2CV2A 2JANA 2A1TS 3KT3A 2IELA 1XJQA 4ZCQA 1M83A 3Q10A 1WY5A 3CLTC 3RFFA 2DLCX 2A4MA 4RUKA 2PFSA 3P52A 2CSXA 1NI5A 3DV2A 3COVA 4MW6A 3ZUGA 3TNJA 4EG3A 2A86A 2YWCA 3HMQA 4ZT5A 2HMAA 1X8XA 1NURA 2QTNA 3DPIA 1N75A 3FHJA 3KT8A 4P2BA 3IUEA 4PBRA 1WOYA 4MWEA 4EG1A 2EJCA 4GRIA 1MJHA 2VXOA 3PXUA 5KWVA 4EG7A 3IOCA 5DK4A 1J09A 4ZCRA 3HFJA 3CVYA 1JILA 1IQRA 3IH5A 5LFAA 2R5WA 1TYDE 2GKSA 1N1DA 1IVSA 2CT8A 4EG5A 3AG5A 4MQ6A 3FY4A 4JZYA 2X3FA 1Q15A 2G36A 3IMCA 1QU2A 2D54A 2CYAA 4H3SA 2A88A 3P0HA 1SURA 1N2OA 4MUGA 4NZPA 1N2HA 1KAQA 4BWVA 5H7XA 3I05A 3IMGA 1KQOA 4PBSA 1J1UA 5IHXA 3Q12A 3CVWA 4TS1A 2JAXA 1HYBA 3CVXA 4HPWA 1J70A 1WJGA 1IRXA 5BNZA 1O97C 1U0BB 3DLAA 4ZT6A 1PFWA 1NUQA 1GPMA 2A84A 1OWLA 3P0JA 4A91A 2X1MA 1O96A 1MAWA 2QJFA 2DUMA 1MAUA 3CLUD 1WXFA 4ZT3A 1OBHA 3TQIA 3H9CA 2A1UB 3ND7A 4ARIA 4MUNA 1M8JA 1IH8A 4S1OA 3FG9A 1YUMA 2Z3VA 1EFPA 3HGMA 4YP5A 1ZH6A 3ZXSA 4ZT7A 2BYTA 1EXDA 4G5YA 2CUZA 2DERA 1PG2A 3H05A 4CDMA 1VL2A 2DEUA 2VTBB 2BTEA 4EG8A 2RD2A 4NAUA 2AG6A 3VU8A 1N2EA 1J21A 4XSVA 2J09A 3F3MA 2V0CA 1N77A 3TZEA 3SZGA 2YY5A 4RPIA 2J08A 1MBZA 1MB2A 1Q11A 3IOBA 4MUKA 3LOQA 1GAXA 1I6LA 4Q93A 3INNA 1TEZA 2DETA 4PY2A 1XNHA 1RQGA 2QUIA 3MMXA 2AZXA 3VRHA 1TQ8A 2Z08A 3PRHA 2QUKA 1NUPA 3GUZA 3FIUA 4DDMA 5TEWA 1T6ZA 2X1LA 3QTBA 4KR9A 4U7JA 2HGZA 1G8GA 1R6XA 3Q4GA 1VLHA 3H97A 4K0RA 4U8HA 1JMVA 1O5TA 4ZCSA 4DLPA 4MVCA 4NAHA 3ZGZA 1EUQA 4HJXA 4MVXA 2CV0A 4EFKA 1JIJA 1I6KA 1KP3A 3CLSD 3SEZA 1O94D 5FO1A 3X1MA 1ULHA 3FETA 1S4MA 1M8PA 3COWA 1JHDA 5F23A 3CR8A 1I6MA 1O6BA 1T9GS 4GU5A 4MAFA 4CT0A 2RE8A 4MUEA 4ZT4A 2WQ6A 2DXIA 1K4KA 2PG3A 4JXXA 2WQ7A 3G6KA 1KH1A 3CLRC 3GMIA 4G6ZA 3IVXA 1WQ4A 3UOWA 1JGTA 2NZ2A 4WNYA 1COZA 4I6EA 2J07A 4J75A 1FFYA 2CFOA 4DJAA 1Q19A 4ZT2A 5J59A 1JZQA 2QTMA 1N2JA 1UFVA 4MW0A 3CVVA 4UZEA 1O96B 2A1TR 4MW7A 3M5WA 4QBTA 4I6JA 1WXEA 5FNZA 4EG4A 2ZP1A 3NBAA 2E18A 4NX2A 1D2RA 2QJTA 5DB4A 1QRTA 3BL5A 1O94C 1DNPA 3AKZA 4MW4A 4EGAA 1Q77A 1JEDA 3FI0A 5HG0A 3UMVA 4YP7A 5FO0A 1EFPB 1TYCA 1PFVA 1NUTA 1VBNA 2Z09A 4MWDA 5TEVA 2CV1A 1QJCA 5HUJA 4JYZA 1F7UA 3CA8A 3HV0A 2EL7A 2PZAA 3SZ3A 4CQNA 2OV4A 3ILVA 1QU3A 1R6TA 4DE5A 3OP1A 1KP2A 3NV7A 2PZ8A 3ZXIA 1OWOA 1TFUA 4MUIA 1U3CA 3RK0A 3KFLA 1QRSA 3K9WA 2ZUEA 5KHAA 4KR7A 2TS1A 1P7PA 1M1ZA 2NSYA 5HUHA 4I6GA 1QRUA 1G8HA 3G59A 1V8FA 3ELBA 3PNVA 2IJGX 1WKBA 4G5FA 2D13A 4L2IA 1IHOA 1NZJA 3A2KA 1EE1A 1V47A 4J76A 4MW2A 1LW7A 4OUDA 2GOYA 2PIDA 1I2DA 4K03A 3SEQA 3D6VA 1K4MA 4MVYA 1NUUA 4JXZA 4AQ7A 3TQOA 1O95D 4OJMX 1OWMA 3CVUA 4UZFA 4NATA 4XFJA 3ISJA 5K0TA 1T6XA 3CLUC 2I1LA 4XFDA 1GZUA 1IFXA 1WQ3A 1VBMA 4PBTA 3JXEA 4JFAA 1M8GA 1GN8A 4E1AA 2PZBA 3CLTD 3IVCA 3QE4A 4U63A 1N3LA 2XRYA 1OWPA 2HZ7A 2GM3A 4MW5A 1WXHA 2X0KA 2E21A 1M8KA 1OD6A 4EG6A 4ARCA 2YWBA 1N2IA 4YP6A 1ILEA 3RHSA 1H3FA 4X0EA 1KKUA 1O0BA 3MLAA 1TYBE 1U7DA 3UY4A 1EFVA 2DPLA 3FDXA 1YI8A 2D5BA 2ZUFA 2E89A 3UC5A 1ZH0A 2O8VA 3P0IA 2AKEA 2QUHA 2H2AA 3FOCA 3DO8A 3ND6A 3K32A 3L93A 2WB2A 1NP7A 1QQTA 3FWKA 3ZJVA 3N05A 1N2BA 1ZJWA
chains in the Genus database with same CATH superfamily
3KQHA 4G5SA 1K5PA 4L1KA 1CVLA 4MVJH 4C30A 2XGSA 3EVNA 1TB4A 3BK1A 3E5HA 2ODPA 3W8NA 1YUNA 1DDOA 3MJDA 2HK9A 3F6RA 2QU7A 2V1XA 3CV3A 2BP7B 2IYOA 5BSWA 3PWSA 1YJ8A 1Z4QA 4R1TA 2CFCA 3N2GB 1L4GA 3O2NA 4RE5A 2B4YA 3DNFA 4HGYA 2IU0A 2NPFA 2XH8A 4EHFA 3RC3A 2D0IA 1HUQA 3ZGNA 3I6ZA 3E3LA 2IEGA 1XDBA 4B1FA 4QUKA 4PC1A 1KQGA 2QXUA 1QGZA 2NTYC 5AM1A 3TOVA 3FWNA 3FUVA 4DQVA 5KQGA 2V7QA 1RXEA 4AYTA 1JQLB 2RI6A 5DM2A 1YB4A 3AEZA 1DCKA 3WIEA 3A4IA 4DMFA 1XKXA 5BR7A 4KX5A 1AO0A 5GGXA 1E61A 4HDNA 4ZZ3A 5HHTA 4GX0A 4KO2S 2I29A 1YJXA 1J23A 1MO2A 1ZM4A 2XHZA 3GLHA 1HA3A 2P35A 4ZICA 5EA2A 2WYWA 3SOPA 5EIEA 1J1ZA 4Z9BA 4F1KA 5KTPA 4RX1A 4PWZA 3KTDA 3PDJA 3W2GA 3Q7IA 1RMYA 3L79A 1E6MA 1G3QA 5ALVA 5FBHA 4MGZR 2AOUA 2BR4A 2X0FA 1H05A 1KYZA 2IU4A 4RIFA 4ZEOA 1PWZA 1T26A 3HY4A 5MDHA 1WB5A 4KQMA 1Z26A 1NXVA 3L6BA 3E5MA 3PEFA 3IBGA 1GLGA 2Y92A 4N82A 2J41A 1Q2XA 3HO1A 1NNEA 4GKJB 1L7RA 2DF8A 3G0HA 4JJIA 1IRIA 3DZJA 2W6JA 1A76A 2QM3A 2GCEA 3B6JA 4MS4A 3S40A 3A37A 4OYYA 5GONB 2A54A 3VV2A 3OH8A 3ZY6A 1G4HA 1T3TA 2IFTA 2JLAA 1G4AE 2DLNA 3UK2A 1L5VA 1U02A 1NRXA 1CNMA 1ZHFA 3PNSA 4PSAA 2GYYA 5AHOA 3B5JA 5TGTA 3OQMA 2PGLA 4P7GA 1REQB 5BR8B 5ICGA 3JZFA 1EHIA 1MRNA 4Y1GA 1TTTA 1ESDA 4TRNA 4YC7A 1E63A 1KFJB 4TMKA 3TRFA 3FRIA 3ZVMA 2DB3A 3PNPA 3CVUA 4A0FA 4DLUA 2GCPA 2I3AA 5JSHA 5HJ5A 2ZGVA 3BJRA 3MJ4A 2OMEA 2QTFA 2RHLA 4CQMD 1GUZA 1JYFA 1NT4A 2OBLA 2OOKA 4WY8A 4YMIA 1ONSA 4IYRA 1CRLA 2MMGA 3N3AC 3ZGXA 1VB3A 1Z2CA 1H93A 2AX4A 2YIDA 5A5FA 3K96A 4M0EA 1L5QA 5DRYA 3ZDEA 1XQ1A 4KMSA 2L0XA 2HRQA 3R0XA 4W5HA 1IJFA 5IAGA 1X94A 2PKQP 3NORA 4A10A 1CJKC 1AG9A 1QGAA 1TNDA 4PGGA 1D8TA 3CTPA 4JSRA 2BMDA 2C4TA 4ZDKA 3IODA 1A50B 2QLMA 4JLNA 3W6ZA 4LFBB 3D6JA 3KKMA 2W2KB 1IPHA 2WFLB 4ZAXA 2EOAA 2ZVQX 3CPSA 5B1EA 4H31A 3WKCA 4DIKA 4NECA 4TXLA 2H29A 5JJIA 5IAAA 4OM8A 3RBAA 4E94A 4E12A 5AQ1A 1GNPA 1W44A 5F77A 1QVZA 2W11A 4CKEA 3KO8A 1R4NB 5LQMA 4NWIA 1KR2A 1A8HA 4GYJA 2AFVA 2I2DA 3N0RA 1OZGA 4C76A 4YAIA 4NBKA 4UTVA 1VA5A 3VKHA 2G76A 3HRHA 2WA1A 1ORTA 3FB1A 3PHLA 4NCHA 4YPOA 4PO1A 3TOSA 5EIBD 1JH8A 5JH7F 2DBQA 3NDIA 1OW3B 2FZCA 2WJAA 1OGIA 1PDOA 3C6YA 3DZDA 1EQUA 4BBZA 3ZLVA 1PJCA 2GNAA 3BXXA 3QSYA 1VL0A 1U7HA 5KJ1A 2HDNB 3EXAA 2J3DA 3JALB 3PDUA 1Q74A 3TLGB 1MU0A 2B34A 2PPVA 4UM9D 5EGSA 3STXA 5JJCA 1JL3A 5K99A 1U3UA 1V5EA 3EIQA 3L41A 2JFWA 3S44A 4OU5A 4C9BA 4ZYUA 1VIAA 3S27A 3P2JA 1OA1A 1Q0SA 1R6DA 3IC5A 4IDFA 1Y4UA 1GU1A 1HDGO 1MTOA 5EMNA 3ZY4A 1PK7A 3LPLA 3U4HA 5B3KA 1ZO8A 5I4CA 2DWUA 1NNI1 3K35A 3RU2A 1I1QB 4D42A 2J45A 1G41A 2A0FA 2YWCA 4M1EA 3W7AA 2IHNA 1VHQA 3P0FA 4IBOA 4D3ZA 5E95A 3EQ8A 3RWMB 3TOXA 4AW9A 1WOYA 2VF5X 4BO2A 1MJHA 1WDMA 2CXPA 4XWKA 4P34A 1B3RA 1WW2A 4ZCRA 4ZOLF 3GJ8A 1T9DA 2RBEA 4RZ2A 2QLNA 5CR9A 4DIBA 4BFVA 1Z0DA 5KU1A 4UCWA 1UK9A 1IY1A 4DZTA 2R5WA 3N8IA 4Y2RA 1YKGA 1NF8A 2DH6A 3IDQA 3LC1O 4YRJA 2D8MA 1YZFA 5TT1A 2R7KA 3UN1A 1YD7A 4DYHA 5K0FA 3VZQA 3T1TA 4AN1A 5C37A 5T4BA 4AY6A 1Q2UA 3HBNA 2K6GA 1TW2A 3EK2A 5GOZA 3AUFA 3UTDA 3T3DA 2I8CA 3A28A 3CE9A 3DZ8A 4MA0A 3C1UA 4BB5A 4GBMA 4ERXA 1DQSA 3QBJA 2H7CA 1M72A 4CFSA 1GFSA 3B9QA 1SURA 3IKJA 4Z99A 3WJ7A 3A1WA 3A1FA 4UAUA 2GDJA 2B21A 4KE9A 1NKVA 3WV4A 1WVIA 3N5CA 3C14C 1RRMA 1XR3A 5H7XA 4YJFA 3VR4A 4CDGA 1K75A 2HW8A 1G0NA 2XODA 4TXHA 1EH5A 5PGMA 4RCVA 3VNVA 2QNIA 2YWDA 1KOJA 2ACKA 4WPGA 3TI9A 1SCAA 3NIGB 5F7OA 1TYEB 3FMVA 4FYYA 2R2GA 2C7VA 2WV9A 4MLZA 4MR7A 4EB8A 5CPFA 2R4QA 1QYRA 3T5PA 4IYJA 3K92A 3FPGA 4ZT6A 1GPMA 1JAIA 3HJGA 4QHSA 3RVSA 1RXIA 4KV9A 5E0OA 3TD2A 3LDAA 5L3RA 2A5YB 3QVUA 4KQHA 1PQPA 2P78A 2YASA 3GUHA 4ABTA 4RACA 4UAVA 4JUDX 4IFEA 4WN9A 3VKWA 3OZAA 3HJNA 4Q4HA 1E2BA 3LX8A 3I12A 4JXKA 4TSRA 2I7TA 2OCXA 3HKBA 1IPEA 1C7JA 2J7PD 4RGBA 4F5WA 4D3FA 4GP9A 3K70C 3T35A 1IONA 2JLSA 5AM2A 2KW5A 5CDTA 2FPUA 1O5OA 2Q5IA 2Q4BA 1VKRA 2XQVA 4GOKA 1XD9A 4ENVA 1QNLA 3SHOA 4TV9F 1A96A 3DXXA 3RJ5A 4KYUA 3KPVA 3AEXA 2XSZD 3IQHX 4HADA 3WB1A 4J49A 1L8OA 4HEA6 2ATCA 2AG8A 2VTBB 2WJPA 2WKSA 2XMZA 5LQCA 1RI1A 4DV7B 3K0HA 3HA3A 4JLOA 4S04A 3ZU5A 3UG6A 3H13A 2C97A 3OM8A 4IKPA 5CD9A 5K01A 1Y5IA 2IV2X 5LQUA 5IJZA 2ZWMA 2OFOA 2HNAA 5JD3A 4IGKA 3LRXA 3SZGA 1U0FA 3AEUA 4AF8A 3LQYA 3PUZA 2XR1A 5LNK1 1MB2A 2GJAA 5C1DA 4KSBA 4P2GA 3R7BA 4XD2A 3E23A 2AW5A 3I52A 1JZTA 2P65A 2WZDA 4X1YA 3S2EA 5JAPA 3INNA 1ECGA 4H15A 4AZWA 3Q98A 1A9RA 2DETA 1P44A 2UUBB 1RQGA 4CG2A 1KI8A 1POWA 2Z8YA 1RW4A 1T0HB 1J1IA 2W00A 3LO5A 5EZSA 4KQ1A 1VIMA 4K26A 2NYUA 4WXEA 3EEQA 4OREX 3HV2A 5C1IA 2LXNA 4D74A 1EZZA 3A0RB 4Y6OA 4YR9A 3KYCA 1QLWA 2QUKA 5DT9A 3V32A 1L7PA 1FC0A 4IDCA 2YJ4A 1T6ZA 2ZPUA 1CR6A 2NVBA 4LCJA 4KR9A 1DIOB 2FHSA 3DD1A 1Y5LA 4K0RA 1TA0A 3SQOA 1OZAA 5B4UA 2AS0A 1PWXA 2H1LA 1T0UA 3BGIA 1YJ5A 4W6QA 4RLSA 4S05A 2FK7A 3UZUA 2IZZA 3OZDA 1SCQA 1ULBA 1OUMA 2N46A 1SKYB 4FDMA 1E1RA 4WASA 4HUQB 1AKWA 1NPDA 2ZS9A 2XXBA 1HURA 2CY0A 1M8PA 4QXPA 1IM5A 1A4XA 2X9NA 3A1CA 5DI9A 1I6MA 3HB1A 1XPRA 4DEYA 4BEWA 2UYYA 3QLJA 4EJSA 1SPXA 2V5VA 2FDRA 4QFDA 3OJWA 1LV7A 2VWHA 2HSDA 2OHVA 3PWZA 3FLMA 3KK0A 1NN0A 1Z7EA 3SIWA 4BMSA 2VPYA 3FDFA 3JQAA 4TUYB 3N2NA 4D9HA 5KNDA 2BISA 3M81A 2XW6A 4Q37A 2QLLA 2ZVDA 3JAMA 1L5OA 4LYHA 2CHQA 1UMDA 1XVAA 2CLMB 2X9GA 3WMGA 4AJHA 4ZI2A 3MVEA 3OQBA 1FMTA 4V1CI 2WIJA 3EQ9A 3UQYS 4C7XA 1IB0A 3OPNA 5CX1A 1U1GA 2AN3A 3GRCA 3AESA 3QLUC 5KYVA 1ZH2A 5TLSA 2E2WA 1WCIA 4MW7A 3R3SA 2Z98A 4QQFA 3WMWA 2JG3A 1TLLA 4Q1AA 5C46F 1PGJA 3I5YA 1XLVA 1TVKB 4RJLA 1EWVA 1U0GA 4PLVA 4RZIA 1KDRA 4XD7D 4DA0A 3W8DA 5ADVA 5KYXA 1W29A 2QD3A 5FX2A 2FPMA 1KE1A 1EP2B 3GN2A 3LC0A 1MB0A 2BSXA 1AIPA 3QKWA 4L8WB 4F1WA 1Y48E 2IGTA 1QHGA 2WOJA 3AR6A 3LCRA 4J0IA 4OD0A 4QOSA 5EIOA 1DNPA 2WJ6A 2AOVA 1I4WA 1W75A 1TT5A 1ZRSA 5G40A 3C4QA 4PC7A 4HZIA 3GYGA 1RJ9B 1ZM2A 1FJHA 2PV7A 1TLFA 1TIBA 2V96A 3LRTA 3KQOA 4TTJA 3ZCPA 4L15A 1BRTA 4UHEA 2DOKA 3IQIX 4DT1B 3FJYA 4YJHB 3MFYA 5GP1A 2IECA 1ISHA 1CERA 3DUWA 1WXXA 3KYDB 4TWJA 3TLJA 1QMGA 4JIGA 1P1KA 1ZN7A 3RRXA 1KJQA 3VPDA 2CJFA 4FINA 5HQ3B 1R9MA 1UL1X 3IELA 4Z53A 1R5JA 4L57A 1V6CA 2OV4A 4M37A 4NE9A 2IPOA 4S1WA 2JGLA 2PGOA 4DE5A 2ZSDA 4TKUB 3COJA 4WACA 3FNFA 2Q3BA 5CTAA 5C8VA 5CYFA 1E3LA 1Y9AA 2ISQA 3CF4A 3EDCA 3PKJA 1TUGA 4Z9AA 3SYRA 2XXAB 3H9JA 3JPYA 1US8A 4MI9A 3VPAA 4PLHA 2PFGA 3FUWA 4HNQA 2WTAA 4MRSA 2YV1A 1BSVA 5U9CA 4CMJA 4L4ZA 1G3IA 1KEPA 2JH3A 3EMDA 1YKFA 5J40A 3HYTA 2NSYA 1P61B 1G8JA 1SU6A 2I34A 2WR8A 2Z2IA 4YP9A 3SJAA 3UXYA 4EVRA 4ZZIA 421PA 3LOUA 3NPMA 1DQYA 1NULA 3R5SA 2JIPA 2OK8A 4Y2QA 4L4UA 3P7MA 5REQB 1FP6A 2HRBA 2J4FA 2D13A 3OC0A 3SG0A 1J5EB 3Q3CA 4XDHA 4UPDA 3TF5A 3QH4A 3P97A 3QNMA 2QZJA 4Y2XA 3KR1A 5AHRA 3A2KA 2PA0A 3AR2A 1IOVA 1PR5A 3SAJA 2VKTA 4RM2A 4DEVA 3ZHXA 4QOGA 5JMWA 3I58A 4TTIA 4HNVA 3KUXA 3S8EA 4Q7MB 3KQMA 4S1PA 5FWYA 3EGOA 2HWKA 3F5DA 3BIJA 1X42A 2ZZNA 2XEDA 3WRWA 3WRVA 1QC5A 2M98A 5DOZA 2BR5A 2BTQA 1N8KA 3CLUC 3QBEA 2QR5A 3ZI7A 4B2YA 2REBA 1XCJA 4XVCA 3WRXA 3NDJA 4N48A 1BDMA 3HG7A 5H8WA 2FRDC 2O57A 2XYVA 4YJ3F 1MEJA 1KEEB 4L28A 1QOQB 3PQFA 4JCCA 4P5DA 2CJYA 3SQDA 4EQ6A 1ZAYA 3D7KA 3I9NA 4L08A 4NMXB 3GFTA 2WHXA 1T1EA 4R4JA 9LDBA 1EMDA 2HN9A 1RE0A 4DNPA 2B99A 2D7DA 4BDTA 5KYYA 1K8XB 5ECYA 2G9RA 1VSBA 1WY7A 4EG6A 4BFSA 3W5DA 3V48A 3DT6A 2VT3A 3V7YA 4CQMA 4YB8A 4CT4B 1U9JA 1KKUA 5IJ0A 1V41E 4KXXA 5GZ3A 2ASVA 1LY1A 1IHUA 3MLAA 3B8HA 5KX5F 1R8JA 2ECFA 4EAAA 1GGEA 4ZVKA 5G3YA 3RRBA 1UJMA 5DIZA 2WTXA 1J25A 3TMAA 2IYFA 2DPLA 4KXLA 4XIJA 3VHLB 1OT5A 3MPOA 4DEXA 4L73A 2Q3DA 3ZXXA 5JSZA 3ZU6A 1N6PA 1HOTA 2EJBA 1XL1A 2HK6A 3GBPA 4XLTA 2EZTA 5A05A 3VDXA 3GFVA 1XC7A 1XZIA 1EK0A 3ZIDA 3ZD7A 1KVTA 1KXZA 2AZMA 4WLVA 3ZV7A 4X92A 3NAQA 3WWYA 2L17A 3PXCX 5FWXA 3G2OA 1Z4OA 3KTAA 1QJ4A 2WB2A 4LYGA 5DLPA 4A9AA 1BKDR 1N1MA 3IYLW 4KFTA 4JIMA 3U44B 3R9WA 2GLTA 4B4UA 1CUEA 4B85A 5CVUA 5ENZA 1SUFA 3FVQA 4M8LA 2A59A 3TR6A 3GVPA 2Z8ZA 3QBVA 4IJ5A 5K0LA 4FW8A 4CKBB 4KYIB 3WWEA 4YO8A 4BNZA 1I30A 2V7PA 1J0CA 4CXMA 1BE6A 1HE2A 3A6ZA 3PTLA 3U62A 2VLIA 4R9NA 3U3JA 3VOAA 4EA8A 2R66A 1IY0A 1GAJA 4HZGA 3A6EA 2GHTA 1VXRA 2WMNB 3P0EA 4ZD6A 1K7EB 4B31A 1DG3A 4WZZA 4YGYA 3W1VA 1NVDA 4B4KA 4ZJUA 2CXTA 2FMTA 1JG7A 4I19A 3ZKAA 4WBNF 1EQAA 3KOUA 4GDMA 5FTNA 4URFA 4KI7A 5AHWA 3MWEA 3PQCA 2C94A 4XLZA 1UODA 5LP1A 5JXGA 3D1LA 3U7GA 4YUAA 5ALOA 1TCCA 2VK4A 3ILSA 2NU8B 1DS6A 1O94A 1M75A 2G9UA 3D6AA 3KQUA 1UQRA 3I3OA 3W06A 2WRZA 4LJLA 3PI7A 5KOJA 1MX5A 1FYXA 3ZDBA 4ESOA 3QEKA 4CWAA 2WTNA 2H06A 2GZ3A 4LVCA 3V7WA 3WOVA 1PT7A 3U80A 3NGXA 3RROA 2DQYA 2G07A 3R7NA 4ZIRA 1VBKA 2HK8A 4FKBA 5EKUA 3FNRA 3SP1A 2GGSA 2F8SA 4OM7A 3NWOA 2A67A 2RBKA 2GN9A 3BF7A 3C8ZA 1Y3BE 3DE1X 3F4BA 4I55F 3PXDA 3G0GA 4HR7A 3K0FB 1CZOA 1T8UA 5JVDB 2PX4A 2QN6A 3DQZA 4YBRA 2AMFA 4MSUA 1NAIA 4Q3CA 4HH1A 4QECA 1P1IA 3W4JA 3A1EA 3DB1A 1USGA 3VTZA 2AEJA 2G4VA 4R1QA 3I01M 3C8DA 4GUDA 3K1YA 4I3HA 4L3VA 4F4FA 3NHKA 2IC5A 2PRIA 3SX4A 3ZUGA 1E2JA 4O4IB 4LMBA 1RIFA 3U31A 1JDBC 3PCRB 4R1SA 4R16A 5J2UA 1G5HA 2WU4A 4JELA 1OXTA 3FZQA 1MB9A 4MVWA 2IS6A 1LDBA 1ZGCA 5BMVF 1IN1A 4WKBA 3MPUA 4NR0A 3QEBZ 1XA3A 1T6BY 4H27A 1C3JA 3OFKA 4CR7A 5D87A 4PXSA 5THKA 1UBNA 1BS2A 1JTFA 5CRIA 4AP5A 1OU4A 3L02A 2ZRFA 4Z7OB 2A8YA 4NCAA 1TRHA 4MR7B 4DNQA 4RMJA 3PQ7A 4MI6A 3FMFA 3U56A 1AV6A 1FQOA 4I0WB 3S2ZA 2VHJA 5JNVA 4ZEMA 1SM4A 4JJZA 5DSXA 1EDOA 2ONCA 3TUIC 2YWRA 1P62B 3EFOA 3ILXA 2JCXA 3LIPA 5BN5B 3WHKA 4PE5B 1UEJA 3CNQS 4JN6B 3RS8A 3RTBA 3A27A 1GKKA 3A2NA 4RF4A 1XBTA 1AC5A 4X3PA 5JSKA 2GRUA 4X44A 3AERA 3UKDA 1O7JA 3TD9A 3V4ZA 2Y6UA 3FCSB 1GITA 2QM8A 5B5SA 2RGWA 4RELA 4TTAA 4V38A 4Z0TA 3H1GA 3WGKA 4EARA 5KWJA 2J7PA 4L5BA 4A23A 1JEOA 2NADA 2FQQA 2D7JA 3JQFC 3G9UA 3M4ZA 3V1NA 3ABZA 1I4DD 1I3LA 2A1UA 1AGYA 3B9RA 4MLPA 4N8DA 5AJWA 2W9XA 3KV3O 1A27A 3MS4A 1JXMA 3NTUA 4EM6A 3ZJYA 4YUXA 1OVMA 3GLIB 3LCJA 4TXNA 2UZ3A 4DDHA 1XTIA 3O95A 4XYMA 1G0OA 2F8LA 2XSZA 3O4RA 1U3FA 3P26A 4N5HX 5K6RA 1LFAA 1RWKA 4Q3DA 2NM0A 3TJMA 3H04A 4PANA 1WNFA 2IHYA 3I5AA 4XCXA 5BWOA 1Z4JA 4RPLA 1SQFA 4KAJA 3NHUA 5KJEA 4B6GA 2LZ0A 2ZATA 5AI9A 3S6JA 3T7JA 2R4UA 2XVYA 1H2RS 1BFDA 1DC4A 1A71A 1R0WA 2EQ5A 3NUZA 3IP6A 4I36A 4TVKA 4ZCPA 3ZH2A 4CMIA 5C7IO 2JZNA 2ZREA 1HF3A 2A78A 3N8NA 1KU6A 5WRFA 4Y1RB 4NMMA 1OYVA 3ZVKA 4I4NA 3KT3A 4YJ2B 3OKAA 4W5NA 3IVAA 2IELA 5TF0A 4IILA 4FCVA 5I4BA 1W5FA 1WY5A 2YW9A 2PV0A 4FMDF 2B7CA 1DAEA 3FVRA 3NM4A 4AURA 1T9CA 1IZ9A 3HUDA 5LDHA 4Q1VA 3EIFA 3CB4A 2RAFA 2PANA 5FA5A 1HNXB 3TLYA 2GEJA 1BGWA 3EEIA 3GRUA 4UD2A 3IKTA 1NG1A 5G1NA 2Q2WA 2XKAA 4P2BA 2NQTA 4K9RA 4DLBA 1MIHA 2F55A 2DBVO 1CUUA 1BGVA 3I2GA 2JRCA 1W5AA 1FMJA 3LBYA 4LVNA 4MWEA 5JC8A 1T0PA 3PFGA 5HZHA 4NZYA 1MXHA 2PMKA 2ODQA 5A9TA 3SBDA 1EWRA 1ODJA 1OYWA 1RKXA 2G0NA 3E7PA 1XYVA 4J2OA 1Z06A 2Y0PA 3HFJA 1DIGA 1N5IA 1RQXA 2AIRA 1L7XA 4HLDA 2AFIA 2CD7A 4EA7A 4X8LA 1JILA 3BWYA 3ZHTA 4Z4IA 3QVMA 1JYSA 2I4OA 3L06A 3AKCA 3STTA 4GSYA 4DV3B 3TIGA 1QFZA 5SZHB 2PTHA 3T1OA 1Z0IA 1VFNA 1XWWA 2EU8A 1VL1A 3KELA 4L5IA 1Z37A 3TL6A 1RKVA 3OX4A 4FC6A 1PNOA 4UFPA 3D2AA 2A88A 2J3LA 4WZBE 4U2DA 2QXYA 4W4TA 4AKHA 5IPFA 1Z7WA 3ITEA 3L05A 5SYMA 2PEYA 3W77A 3GJ6A 4BXOB 2MJLA 2BHSA 4OP2A 3O8NA 4F46A 5AK5A 3P71T 4XQGA 3G0OA 4IDEA 1Y6RA 1J1UA 1MNQA 1Z0SA 1FUEA 1IQPA 1GNRA 2HSWA 2JGJA 2P0YA 3KHSA 4U6NA 4NXMB 2G2SA 2ZE5A 3LZDA 3ME5A 3KP1A 1Z5PA 5B1YA 2Y05A 3CVXA 2OYSA 2NXEA 5ALWA 3GZJA 2XCQA 1N2ZA 5HPYB 3CG4A 2CN1A 1ZHOA 1T13A 5G0WA 4BU0A 1SUPA 4RCZA 3JQRA 4G23A 1IXZA 2UVPA 4XH9B 5DHPA 2NU9A 1BXGA 3EAQA 3ZHBA 5JCJD 1U4SA 1G66A 4XD7A 1LPOA 3Q7EA 2VH2A 5AKEA 3WGMA 3ORRA 3H3JA 2D6FA 3V8MA 1EJ0A 5EE9A 3GL9A 1VLVA 2PUJA 3RVPA 4QZVA 1CY4A 1QFJA 1EM8B 1GAQA 2ILTA 2ZLBA 3OEED 4W5RA 1YRBA 1EX7A 4LXXA 4HGNA 2PT5A 5K8VA 1NXXA 4G0PA 4JVNA 3AVYA 2R96A 3JVDA 3IOYA 4G4SO 4ITRC 3ZDAA 1KYXA 1IZYA 5L45A 3D5QA 4N76A 1RKBA 2L2QA 4QT0A 5F2NA 1PZXA 5K8LA 3DEJA 2QD4A 2X7HA 2R1TB 1BHO1 1YMVA 1IYZA 1Z5UA 2COUA 1BA2A 1A9XB 1UZLA 5JZBA 1AGPA 3EMBA 4I1PA 4O2BA 4PPGA 4UU8A 5ILQA 4II3A 2HAEA 4CF6A 3VO9A 5BY2A 5DU2A 1XTJA 1DBQA 2V6FA 1R6AA 2JJ8A 3TSOA 4KK3A 1UM9A 1CUXA 1VFPA 2EWVA 2H2GA 5EWMB 1Z5NA 1EFTA 1IY8A 1EPUA 2DPXA 2KMLA 1QR2A 2GJSA 2RJOA 4WH0A 4EJ6A 2OECA 3EARA 3LQRA 5IZ4A 1V16A 4C89A 3DOCA 3OTIA 4O02B 4RKEA 4R8RA 1TM1E 4DDWA 4LOJA 3HLTA 1NASA 2I2CA 5LWQA 1NU6A 2PIAA 3MAJA 5JNWA 2OAEA 3O73A 2ZT5A 2REQB 1OMOA 2D1QA 3LT5A 4BQFA 1SC3A 1W59A 1A8IA 2VAPA 1ZVKA 1KZ7B 1XTKA 3L8MA 4KIWA 3UF0A 1TQ8A 2Q46A 4HBGA 3R0QA 5I7SA 3F3YA 4GRDA 5HDQA 4F45A 4U9UA 2R0QC 3GLRA 1NUPA 2LDXA 2M9MA 1NIPA 3NDRA 3ND9A 4PF1A 4ZOAA 2VSQA 2PMDA 5HF8A 5I51A 4UTNA 3RS0A 1WD5A 3UYKA 1W36B 2BSQA 4KXMA 4NYIR 2NUBA 4RLFA 1DQZA 2ECKA 1UBLS 3QWAA 3RNOA 3T99A 3ELUA 1P0CA 1G2OA 4G81A 4MVJP 1CTQA 3FKQA 1A5TA 3KZNA 3L7MA 3AI1A 4H59A 4LJ4A 2XMCA 3T3NA 4LJ6A 3BK7A 3DFZA 4RYLA 2OHGA 3JV7A 4L4YA 1IB6A 2N42A 4JR0A 3JQBA 3JQDA 4MUBA 3TL2A 2J30A 3OZSA 3ETDA 4X71A 2A0YA 3NVMB 1TJ5A 2WFZA 3LC7O 2CE7A 3HCDA 1V8OA 1Z07A 2AD1A 4RADA 5CUQA 5CCXA 3NBUA 3W3ZB 2O8CB 1Y9JA 4NV3A 4C7JA 2PUVA 2ZTLA 3A4MA 5J5CA 4ZO8A 1WNTA 5B4VA 1HX7A 1XZ8A 2PN1A 4MUEA 5BN4B 5FNVB 3W05A 2DXIA 4AWBA 2A4KA 2WU0A 3NYIA 4MDHA 2Y1EA 1KH1A 3CLRC 4OI2A 5AVZA 4UFOA 2HTFA 2R65A 2XCSB 3ABIA 2QORA 4KHPB 3GPIA 3NDPA 4EJ2A 2IXFA 5AKIA 1BEEA 4AY4A 2XVXA 3K09C 4HC4A 1FFYA 4B82A 2AN1A 5FUVA 2W83A 3NG1A 4Y2VA 2A1TR 5I7FA 4OY3A 4BAUA 1GXSB 1XXHA 4I6JA 3U9TA 5K2OA 1C1XA 4G5GA 4M83A 1TC1A 1XA0A 4Q6BA 5LZ7A 4BEJA 2WI8A 3SXUA 3KDPA 1U2DC 3VR2D 4N5NA 3SQMA 4G36A 1OZHA 2ZYHA 1OJ7A 1XZQA 4ZVTA 5LVAA 1QRTA 1MC5A 3CRMA 2OYCA 2OCDA 4QSHA 1CZLA 2W6ZA 2HRZA 4LXGA 1B00A 2I71A 4MVJF 1M1UA 1E5XA 3Q11A 3T0IA 3EZLA 4ENRA 2BOVA 1EFLA 2ECOA 3HB5X 4E46A 1GFIA 3UPUA 1MG5A 2IYUA 2QRZA 4WA8A 4ZAFA 3GHHA 4BJ6A 2CV1A 2ZSJA 3JZAA 3DAFA 5KTMA 5DV9A 2ZJ0A 1VOTA 2X9VA 4WXYB 4Y9UA 2W4QA 4GKBA 4YRFA 1T3GA 1UF9A 1TVMA 4HLUC 2G1JA 4UD6A 4ZPXA 3NBFA 3ICOA 3OP1A 1NQAO 1WMSA 4U2BA 4OQFA 3TEFA 3JATA 4MUIA 1TKBA 3ICVA 2HMWA 4UVIA 2WAAA 3G8AA 2XDAA 5LZ9A 2Y67A 5KSOA 1J0EA 4BAGA 4R0MA 4KR7A 4D97A 5KI6A 4RD2A 3W0LB 2CUKA 3MAAC 4NYJR 5FPYA 5G4KA 1BW9B 1EWQA 5DLEA 4B3JA 4EKNB 2VDLB 3HCFA 2IJGX 4BV9A 3SC3A 3HJUA 1RCFA 3TECE 5CJJA 2DH5A 4AP9A 1GUAA 1AKYA 4C4AA 3KUCA 2ORVA 4N9QA 5TF4A 1UKBA 2HQSA 3CW8X 4JB8A 1P0MA 2H1FA 4WX2B 3QUQA 3WQBA 4WZAE 1FUIA 2BZ0A 2ZJ1A 3CR7A 1C3EA 3FUTA 4JX8A 4Y2GA 3ZZ1A 1EHCA 1ZD8A 1BN7A 4QPPA 3K0SA 3QWHA 3QKUA 3I09A 1XZNA 1ECBA 2JLBA 1EP1B 1MW9X 4XQ9A 4FGUA 4TTRA 4LVUA 3KZOA 2RC5A 3I2FA 2R6FA 3L7AA 3NATA 2GTPA 3VR4H 4Y2YA 4A6DA 2JLZA 4X54A 1AN9A 3WB0A 4D8XA 4FFBB 1Y6FA 2UXDB 3NHMA 2HU8A 4LTMA 1DELA 4B8ZA 3UBTA 4J0KA 1WQ3A 4P81A 1GGKA 2BGIA 2XD4A 5T8KA 3OIFA 1QANA 2C2OA 1V35A 2P4QA 2O23A 3KALA 3NHBA 4KVAA 3WKEA 3WAGA 3NONA 3IVCA 1N3LA 2FB9A 1ORDA 2JVKA 1XZBA 2VZLA 1A8PA 2JKZA 3GRPA 1GTZA 3KETA 5IVKA 1XLWA 1C50A 2PRZA 2CC2A 2QZPA 3TNYA 4EUNA 4JDPA 4HVLA 4Z3KA 3MOSA 3L04A 5K8TA 1OD6A 3GDHA 2QP3A 4LDJA 4BVAA 5HTOA 1O0BA 3JQ9C 2R7NA 3PNMA 2Q6LA 2C98A 1T24A 4TLMB 4WLFA 2CLCX 5HBGA 3BBLA 2C58A 1R8QA 3UV3A 3RC1A 3DL4A 2O2IA 4KXUA 1YO6A 2ZRCA 3OE5A 3QGMA 1LB1B 3DAPA 4HNAA 2BGWA 2AR9A 1YBMA 2XB9A 3NYWA 5CVDA 4TQGA 3P0IA 1J0AA 5FTJA 1UANA 3BMNA 1ZGJA 1VSUA 1WHSB 2P5TB 4AKGA 1RWMA 4WFJA 4G1EB 4O1IA 1QQTA 4RSRA 3S68A 2NP6A 4OA8A 3RFCA 5AUQA 4HN2A 4MJXA 4Q7KA 4AYXA 3CU5A 4B44A 3FDZB 1IQUA 3NALA 1VG1A 3N2KA 3DOIA 3ACBA 1AHHA 5KTRA 2A30A 1CETA 4G5OA 4JP2A 4M21A 2P0EA 4Z54A 4ZCTA 3TGLA 2FWPA 1XNQB 4Q1BA 2HJGA 4V0KA 2QAGC 3B8EA 3QMMA 4O3FA 3J80A 2WD8A 1JFTA 4UHFA 2DSNA 2GZHA 3RCBA 3UGKA 3FRJA 3HNRA 2A94A 2GAIA 1G291 2O7SA 2Q27A 4B79A 3AVUA 3G2QA 3TCXB 5KMGA 2OGTA 3E3MA 1ZL2A 3DZKA 3RK1A 1W581 1RYHA 1K88A 1KNQA 3AUXA 4V2IA 3ZK9A 5L3QB 1KAMA 3HCCA 1QFMA 3UO8B 1AKVA 2GYVA 4N7BA 3FPAA 3N6RA 1JF8A 2VP5A 3HLKA 4ARVA 5FAKA 2GD6A 5A3VA 4BMVA 3G79A 3IR5A 2OQVA 3T7DA 4NJMA 1YT5A 3K3PA 4CHGA 2RGCA 5AJUA 3ZN2A 2A1IA 3DM5A 1AUVA 1NOIA 3PFNA 4KXVA 2VK2A 3C6BA 3H4TA 4G25A 3ZTYA 2BHLA 4YAKA 1FU4A 1NN5A 1RYMA 5DM4A 4X00A 3OT5A 4UHKA 3FGOA 1IZ0A 2FQXA 4EY4A 4FWTA 1DRJA 3E7WA 1DKMA 2C7QA 1W5BA 5DXJA 5EWJB 1IPFA 4DREA 2WAOA 2BDTA 2FFBA 2W43A 4UUPA 2C8JA 5CM2Z 5GOTA 4PU0A 3VPGA 4OHRA 3STVA 4CQJA 4CJXA 4EA9A 5AXAA 4DQLA 3UHAA 5BUCA 3STUA 1XZDA 3L0OA 1IQ0A 4QFCA 1Z5GA 3VC7A 4C5CA 4IIJB 1A2KC 5EYPA 7REQB 2CWWA 4P5EA 4BUZA 3FTFA 2AVDA 1C29B 3WLLA 5KNDH 2HR1A 1Y8QB 1E2NA 1MABA 1OU0A 3T54A 4B3SB 4C03A 2GKOA 3P8ZA 2DWCA 1I2BA 3K1AA 4LF8B 5JY1A 1ZXXA 2G5TA 4R05A 3MUEA 2PS3A 1R4MA 1KJNA 1JLRA 1MVLA 3SJUA 1NY5A 1ABEA 1UPTA 2XITA 1JAZA 4IS3A 3H11A 1MOPA 4D8TA 1SCNE 5LQNA 2QTRA 4KO3S 3EZ2A 3JR3A 4D98A 2XCUA 5HEKA 4BRUA 3ANTA 4J1NA 2NUTB 5HIKA 1U9ZA 2HA6A 3TSAA 3BAFA 1G9SA 1X0VA 1DRWA 1Z16A 1T8SA 2H0QA 4H1TA 4OYLA 1ZEJA 4UQPA 3SR0A 1VXOA 1NBOA 5HCUA 1QP0A 1P7YA 5K3FB 1CR2A 2Q6OA 1Y37A 4ESHA 1DL5A 4YAGA 3HP4A 4XE5A 1WHTA 3LFHA 4OI1A 1YR7A 3DLCA 3WL8A 3UENA 3ASYA 1PS8A 2GMWA 2WTMA 1UDBA 1R0YA 2CLOB 3EA5A 3IXLA 3B78A 3PUKA 3AKDA 2XA9A 2XDYA 1S02A 5JYEA 5DHQA 3N0WA 3T8YA 3EGCA 1E1CA 4HQNA 5JCJA 1GKIA 2PWAA 5DRTA 3BMOB 1O58A 4XRRA 1ZK2A 3EGDB 2PMEA 3HGQA 3QXJA 3OQVA 5ELLA 1GZ3A 5DASA 2OY0A 3GJ3A 5DK6A 3CIFA 1YI0A 2Q5EA 3DL7A 4DCUA 4YK7A 3DF7A 3VR6D 3GV0A 1T8TA 2ZYSA 3A6JA 3DNMA 4JB0A 1LI4A 4Y0AA 2GCGA 4YH1A 5TVGA 1Z47A 3GUCA 4O4JB 4AZSA 4IINA 1I9GA 2QW8A 2BVNA 2VPTA 3WNZA 4H7KA 2X77A 4QPJC 4BJ5A 3D6UA 4F84A 1CVRA 2I6FA 5JQGB 3IPYA 1HT1E 2AFHA 2JZOA 3IS3A 3LWDA 3B1VA 3GD5A 5JOQA 3S2GA 3RVLA 3AETB 1JTVA 4OK5A 1L0BA 4R9UC 4M88A 1HDXA 4OCZA 1I7NA 1GA4A 1T2CA 2GLXA 4JC8A 3U1VA 3U5TA 2HA0A 3KQYA 2A9FA 4XJTA 4ND8B 3WK7A 5BVHB 5BWLA 1S96A 3ZNNA 2O8BA 2BGGA 5CB0A 1ZUNA 2A3NA 5AM4A 2C5BA 4R5HA 1CHDA 1KVRA 4BKOA 4MUFA 1XOIA 2Y71A 3C70A 4I4IA 2EP7A 2GZ1A 2OCBA 2RARA 1WXGA 2FSVC 1IK6A 2GCNA 5DHSA 3S3TA 4WAUA 4OKIA 1XJQA 4JI0B 4F8JA 4EO7A 1D5WA 3OJEA 1U2TA 4JUIA 1PVDA 4RE6A 3U60B 4UEQA 3NOVA 2AZDA 3CZCA 4LV5B 3DOUA 3WGLA 3M2PA 2VOJA 2ZYRA 4KGDA 3SDSA 4FLMA 1G60A 2Y1WA 3VSBA 2B35A 3NCTA 4RSMA 2VT6A 1TFRA 2Z3WA 5E0KB 1SFRA 3KT8A 4FNAA 3ZV4A 4DANA 2X5NA 5JD6A 2CFIA 4ARUA 2Q3MA 4BMZA 1P0IA 4WY5A 2GI4A 3UJBA 4A5SA 4JB2A 3FRHA 5EN4A 3MBKA 1T1SA 5HS6A 1EK1A 2E4VA 1U4NA 2OM6A 3GEGA 5I9BA 1XXHE 1M5RA 2RHJA 4Q9KA 5IULC 5KDOA 1WSAA 2Z1NA 2IOYA 2FEOA 2PZKA 3HQ4O 1IVSA 4TMWA 3ZDRA 4AS3A 4B4WA 1OV6A 2FSGA 2XXJA 3DDZX 5DNVA 4Q15A 1V4NA 1QGED 2BAGA 3I0ZA 2G71A 5HMMA 4LHSA 3VV3A 5BN3A 1HDRA 1TF2A 4DBVO 3ON5A 3EXEB 3C45A 4ML3A 1KAGA 1Z2EA 4QDXA 5DX1A 2WZBA 2R8PA 2ZQ5A 1NQUA 1FP1D 1THGA 5HE8A 5G0VA 4KPFC 4D5GA 5KCZA 4QOJA 2JHPA 4DCTA 4PZ9A 3DOFA 3U3ZA 5AW4A 3WL7A 2PLNA 2MU1A 4XIGS 4JJFA 1Y8AA 1RS0A 3F78A 3NT2A 3W79A 1K6MA 3EEOA 2YZNA 2OO7A 3WGGA 1CUJA 1RPNA 2HNKA 5CHEA 4GMHA 4TS1A 2FV8A 4IZIA 1JA0A 2CGEA 5H82A 2X0NA 2ZIEA 4RTMA 2I4TA 3WRYA 4BGIA 4OHKA 3DLAA 4REOA 3ZU2A 4F6RB 3SEAA 4FOPA 2G1UA 2PH3A 3NFRA 4JBNA 4EI2A 2ZWOA 1OY1A 1WB4A 4K9OA 3RV4A 4AQDA 3CEJA 3EHDA 2R4TA 3BXEA 1DOZA 1J0BA 3QKSA 1X8LA 721PA 4UHHA 4Q0MA 4BB0A 1U04A 3F8TA 5IP5A 5J23A 1WXFA 3HGTA 2VC2B 4IIUA 1H0KA 4N5IX 1OBHA 2AH5A 3AFGA 5ALEA 5E6RA 2IHUA 2OB2A 3RFTA 2ZAIA 5G02A 1LDGA 4EECA 3T5AA 1OFVA 5FCDA 3OZVA 1PWYE 1QBKC 2PGJA 3VAZA 2D1FA 2C61A 1BWRA 2FP4A 1YL7A 1X7YA 4HXYA 5FOSA 4QPCA 4BMCA 3WP0A 1ZH6A 2TMGA 5I01A 1W85B 3FM9A 2Q6KA 2IYZA 5CVTA 2IE8A 2PXAA 3RVKA 3HDHA 5MN6A 2WUWE 5KINB 1ISJA 5LXTA 1QZTA 1N2CB 5CXXA 5HFAA 2BTEA 3ZE1B 2RD2A 1QQBA 4YP0A 5HF5A 1LUAA 2PRYA 2QI9C 3MRVA 4CI0B 3MJFA 3WBKA 2C2HA 1DX6A 5CA1B 2QTBA 3H5OA 4LBWA 2BUAA 1KAOA 4GBGA 4RBNA 2ZJ5A 3INTA 1G8AA 4RPIA 4P0PB 3AFMA 3NTOA 1Z17A 1LPBB 4QYWA 5A4IS 3H65A 5AKLA 5LMNB 5CGQB 1T2EA 3EXHB 3LOQA 4HMPA 4NL4H 1FNCA 1DEXA 1I6LA 2JIBA 5D3MA 5HKKD 3UXEA 4CLDA 1GLVA 1XLUA 3ZR4B 4PY2A 1UQTA 1B8UA 1XNHA 2Z9DA 1RAGA 2DFVA 2O2GA 2QUIA 3M4JA 2DUNA 4HATA 1F12A 1JE0A 1LNSA 1YDWA 2JHFA 4PS1A 4RXTA 5FF9A 3TAUA 1B2RA 1NLMA 1L7EA 1YRLA 1HWYA 1GA1A 2HJWA 5FOVA 4D6YA 5FUBA 2XGJA 4LDQA 2XV1A 3GUZA 4GVPA 1EP3B 4I50B 1A4UA 2PGNA 3L8EA 3G5MA 1JLLB 4EITA 3WY9A 1VPDA 2D1RA 1SC4A 1TW3A 3EGWA 4I9HA 3CX4A 4RA9A 5CK4A 5FI1B 1Y3CE 2V7EA 4TKZA 2IXTA 4JBYA 1NVFA 1P2VA 2P1RA 1PAUA 3RANA 5B58T 1VC2A 3H0KA 5FR2A 1YUBA 3BKWA 3JARB 5IAKA 4JR1A 4DTCA 4W5JA 3I6IA 4MVXA 4TKLA 5TPZD 5M2QA 1V3TA 3J81A 4XZ3A 2WM9B 1J90A 2HF7A 1KP3A 2ID4A 5IXYA 2IZ7A 2EW1A 2KJQA 4U7FA 2FEPA 1C0PA 1N6IA 5TQ2B 3R3XA 2BMVA 2DR0A 4UC0A 5DM0A 5FPHA 1YVDA 1M0EA 1HNZB 3ZVRA 3DHNA 2O1EA 2EX4A 4PG6A 4OQYA 5EZYA 2W8BA 5EJ6A 2V55B 1TTQB 3HVHA 1QE0A 4B9AA 2WHYA 1ADCA 1R3UA 4JC0A 3RLFA 4CT0A 3W90A 1CUIA 1JJIA 1GR1A 1RYDA 2ACVA 2AHOA 4QOHA 1O0SA 3EAFA 4S0ZA 3SE7A 4X62B 3UOWA 1T5SA 1JGTA 3E9ZA 5A3JA 1JG2A 3TYXA 4DC9A 3IJRA 2O2XA 2P79A 3QVLA 1FP7A 4LX0A 3GMDA 2IYLD 5F52A 5D6NA 5JCOA 3UJ7A 1U1FA 4DNFA 5LD2C 3W2TA 4JQYA 4DLZA 4YRBA 1T5OA 2H07A 2SECE 1K1EA 2GJ9A 1YZNA 2IDJA 3OPYI 2H92A 1A9YA 2BTOA 2IU3A 2GZMA 2ZT8A 3AIKA 4XWYA 1O4WA 1RLTA 1VDZA 1XZPA 3W7VA 3FE2A 5JEEA 3ENWA 2DVMA 1F20A 2TYSB 4HDOB 1JJBA 4G9GA 5FHRA 3F2VA 3R09A 5IM4F 3RREA 2YFQA 2Z2YA 3JVVA 4P3KA 4TOIA 1QH9A 4LZOA 1M6VB 1KOGA 3LT2A 5F7ZA 4Q3NA 4G1UC 1P7WA 3P4YA 4KTTE 5TV2A 1D2AA 3D9QX 2G9NA 4WXRA 4R3NA 2FU5C 3LL7A 1AM4D 1X9IA 2O8FB 1HTBA 1XDDA 5BW6B 4JJEA 4ZI7A 3R0IA 4H6VA 1Z75A 4LQ4A 4UARA 1M54A 4NIMA 3WE7A 4BO5A 1JALA 2I65A 4E4YA 2FN7A 4J1QA 1F0NA 3NANA 3FGZA 2AVNA 2L42A 4F8EA 2PLWA 3WIVA 1GWNA 4A6PA 4A1OA 2FZVA 1NI3A 3CA8A 3LUDA 4IXWA 1QQ7A 1OPXA 1QSGA 4LISA 4JP1A 4DQDA 2WSBA 1YWGO 2PUHA 3TQTA 4DLYA 4FFOA 4ZYZA 3LKZA 1R8SA 2ZSKA 4B75A 5DNUA 4GE3A 1ZITA 1WUKS 2A9QA 1Z7YA 1U0OC 1MO4A 4KUEA 4DLKA 4ARBA 1W88B 5K9ZA 2FUKA 1X77A 4BNUA 4EHNA 3RK0A 3UA3A 2JFGA 5B2ZA 1IAVA 4ZN6A 1RHKA 3ZCVA 3CCBA 3D6HA 3DE4X 5E4FA 2TMKA 2JCVA 5JXHA 1L5NA 4YRDA 5JROA 1M1ZA 1PEYA 4CV1A 1D03A 1QRUA 3G02A 3PK0A 4MB2A 4A0SA 4L0DA 1V8FA 1WLSA 1XEFA 1W25A 2XUFA 2OBXA 2VT2A 3RFXA 1X1AA 3EDRA 3UT5A 2XUKA 3Q85A 3GCWA 4KMRA 1ZGBA 3I9OA 3NU1A 4XDZA 4CGYA 2WSLA 3THXB 4RZHA 5A7GA 1UBEA 1N9GB 3AUAA 4OUDA 1VJCA 3BEOA 3X0DA 2CSUA 2FWAA 3D6VA 4G4GA 5B3AA 1P2UA 1K4MA 4IVRA 4LECA 3BB3A 4TN1A 3JVEA 4DRXB 2VHUA 1FFBA 3L18A 4OQDA 3W6NA 3AF6A 2B1GA 4ZZ1A 3RJ9A 2HBZA 1SXJB 5IMBA 5CCDA 2KE5A 1S8AA 1YB5A 2ZSHA 3ITKA 4WI1A 2JJMA 1FXSA 3ZK8A 4UJ5A 1ISPA 3ZS9A 3ZDYB 3QI2A 3LPDA 4TT8A 3DYVA 3D2LA 1DX9A 1N36B 4PBTA 4IUCS 4GI5A 1MC4A 4FFMA 4HAUA 3CZQA 5B1DA 5K3CA 4BLWA 3GPBA 2LBPA 3CWCA 1YQGA 5GINE 2C7PA 2MSEB 3QE4A 2Q3EA 1ZW1A 4GT1A 3HWRA 4U2EA 1JDZA 1MUUA 4NHEA 1XLTC 1MRSA 2UZ1A 5SY9A 3RIYA 3LYAA 1IN7A 3PT9A 3JWJA 4EGJA 5C8XA 8OHMA 1YU6A 2FJUA 3PJDA 4G1MB 4D0GA 1XZMA 2QY9A 1MD9A 3OHPA 3OZRA 1R0XA 2NG1A 4OU4A 3TK1A 3W2FA 4U2KA 3T5DA 3WGOA 3ZCTA 4MS1A 3ZWXA 1ZKMA 4YP6A 3ECSA 3O82A 1FTQA 3B1KA 3OIDA 2W6NA 2OESA 2B9VA 5A6SA 1M1YA 3GA0A 4C29A 2WJWA 2WWIA 1DFIA 4FQ5A 4LBYA 1PJ3A 1V11B 3K9BA 5AKHA 3OC6A 1PZMA 1V26A 3VU1A 2PLAA 4BRWA 5K45A 2EX0A 2RHTA 3ZQUA 1UPUA 2O48X 3HA2A 3RYHA 5I7RA 5K8UA 1APBA 4ROSA 2OB1A 2BMWA 1DINA 5SYNA 1VKJA 1YC2A 4C5BA 3AX6A 4TLDA 2EJWA 2PQ0A 2OCLA 4B8WA 1FFXB 4RH0A 3T1NA 3L93A 4URHA 1H9AA 1NP7A 1W52X 1AHNA 3I45A 2O1SA 2WJYA 3GOHA 3BB4A 3LBNA 4UUOA 3VR6A 1WP9A 2R5NA 1XCLA 4YYEA 4E5NA 3AUTA 5FOTA 2WBLC 1RADA 3RD5A 1P5JA 1XRMA 2E9SA 3R0VA 4XUGB 4QDZA 4C1BA 2QENA 3L0PA 5FBQB 4RDXA 2ZWVA 3KFVA 4EYEA 1ZCBA 1EEHA 1QZXA 3SKVA 4F8YA 2ZR7A 5LP6B 2OD7A 3QX3A 1R00A 2R00A 1QIIA 3LW8A 3E58A 3RGWS 3KSZO 4CKWA 4JJKA 3S0JA 3TQCA 4QUBA 1K8ZB 3BG5A 3EVZA 5K3SA 2GX6A 4F4UA 3GLQA 1PZGA 3F47A 4RV9A 1SIWA 3GVCA 2XWPA 3PC3A 3HKEB 5KPJA 1FYDA 1LQUA 4M54A 4DCGA 3QOXA 5FI5A 4US0R 4IVPA 4BTEA 5E7JA 2O7QA 3MF4A 1GRRA 3NR2A 2OCGA 2RHGB 4QQNA 3ECAA 5KNBD 4DIDA 1P5FA 1QQAA 4UVEA 5EUBA 4KQKA 5EE5B 2VWQA 1R5NA 4YIKA 4L2IB 2B4TO 5H9VA 4I9UA 1YRAA 2KLBA 2WKWA 4M2LA 1AMUA 2H2DA 2BGJA 3BZBA 3E9EA 4R3WA 3K70D 2ONJA 3O4VA 5DCYA 1HL7A 2FMIA 4QE3A 2X2FA 2YOGA 4JP5A 1HZJA 2AOTB 1QK5A 2G77B 2ECQA 3F7MA 3ZCQA 1E0DA 3M9WA 4ZVRA 3AY7A 3TZQA 3P20A 3JD3A 3AJ9A 4Z51A 2J46A 1DOAA 2PX6A 2R7AA 4AB1A 1FFAA 1SR8A 3OQOA 4N7MA 3C48A 4Q3AA 4TYYA 5E6UA 1GQYA 4R6XA 2A57A 4B6FA 5KBYA 4P83A 4F3TA 1NX9A 2ZUTA 1EUDB 1Z0AA 1PJLA 2QQGA 3AJAA 3C24A 3CMMA 3HM2A 3RO7A 1NFFA 5FL3A 2BEJA 3HJBA 3B9BA 4NSNA 4A6EA 4B3HA 5JMTA 2WUVA 3FPEA 2I33A 3I04A 1U3WA 2PYZA 1OLXB 3A6GA 3WKDA 3LT1A 1OASA 1ZOLA 3WYEA 3QU2A 1J0XO 2G82A 4NEGA 2WSIA 3QE0A 1MHTA 1V3QE 2DC1A 4KIFA 4MWTA 5IXJA 4K6CA 1GTSA 3GG2A 4OP1A 4KKVA 4X6XA 2EWWA 5IF3A 3AFHA 3PNYA 3KZ1E 1PGOA 3QLEA 4OH7A 3T9EA 5CCEA 5I45A 3MIIA 4WSOA 3MWFA 3M8KA 3PDWA 4GI3A 3KLMX 3RVBA 5E2AA 3WHLA 4HEJA 4LY6A 2ZRAA 5HK9A 1IN6A 3DVRX 1FYEA 4FDLA 2LCQA 1JXQA 4IOLA 3B6KA 1YJCA 3GDFA 1DQNA 1QPZA 4RC9A 1SVNA 1X6VA 3WYGA 1MC1A 3GRFA 1Z5ZA 1G20A 2G4CA 1ZLXA 5K6TA 4AJ2A 3F7NA 1RI4A 1AE1A 3AXSA 3CM0A 3IAXA 1L7MA 4IIBA 2V4MA 1E2GA 3RRJA 3EVBA 1HFKA 5AJHA 2FRXA 1U7TA 1ODCA 2VBGA 2VUHB 1C0EA 1JR3E 2J9YB 5L3SB 3TIFA 4FFNA 2QZ4A 3VHRA 2E0IA 3KYBA 4PW0A 4QPNA 1X0XA 1SJ9A 1TO2E 4V02A 1O9HA 5LA6F 4BO1A 5HZGA 1ISGA 1WLYA 1RC1A 2BDUA 2NPOA 3AI3A 4PX9A 2IYQA 4R5MA 1M2KA 3F9RA 2IHTA 3QF4B 2YWEA 4P53A 3IIJA 4OOEA 5AKYA 2IYAA 5F1PA 5ELXA 2CVOA 3OZCA 4KXQA 4W1RA 2WZQA 4ALJA 1YULA 4RJTA 1AQLA 1VIVA 2YXNA 1Z7GA 4Z49A 1QP7A 2G8LA 4JEHA 4AS2A 4MWGA 1DGQA 1SVWA 5EKXA 4CM7A 1E5LA 1K2VN 3MSXA 5LWHA 4GKVA 1AUOA 1R0LA 2HA5A 1X7GA 3HYCA 2I6TA 5TARA 3ZZMA 2HQBA 1TJ3A 1P6UA 4MAAA 1ZOIA 2A5LA 2JFXA 1G1AA 1YS4A 4LYAA 3RKRA 1AGRA 5IDYA 3H16A 3KKOA 3EWAA 4RQBA 1OBVA 3WNDA 3P9YA 4NCXA 1NJ8A 1PEAA 5EZ5A 1JMYA 4AO6A 4FC7A 2F8TA 3TRDA 2EJTA 1N1GA 5AJXA 3EIXA 2OR3A 1CQIA 3WK9A 1H2YA 3R9XB 4J7XA 3B1XA 2Y27A 3FYUA 1FPMA 1EP9A 5L40A 4C14A 3KQVA 1SD1A 2KQUA 4MI3A 2HH9A 1H69A 4WK0B 4ZVOA 4YV7A 3JQEA 4UUQA 2CSXA 3MS2A 5C52B 5P21A 1T5DX 1GD1O 2ENWA 1SEVA 2FQYA 2H3HA 1MJNA 3F9IA 2A86A 1PFGA 3KR2A 3HVIA 3OO0A 4HEQA 4XUEA 5ELMA 4W5TA 4Q4AB 4HRVA 4IFTA 2FW8A 3QA9A 5IZCA 5AVSA 3B1ZA 1U5AA 3CX3A 3DV0A 3MQ2A 2PCLA 3D4BA 4JYBA 3E8SA 2BUBA 3QY9A 4P0TA 4CTNA 3ZBTA 3P2MA 2DZDA 5KWVA 1FX1A 1RJWA 3KE8A 5B1IA 4HQRA 3P9RA 4LJ8A 4GO1A 4OHPA 1GG9A 4G1FA 5IH7A 2RK3A 1UPXA 3NIDB 3SSOA 3UMGA 3W2EA 3AR7A 3TFWA 3TLGA 1JJ7A 1KZ9A 2FW6A 2YNMC 3IPRA 5ALYA 5TMEA 4AZ0A 1XVTA 5TPZA 4CIVA 3ER9A 1DBSA 2YKGA 2XQKA 1F6WA 2XUIA 3QEMB 4Y6GB 3WDLA 3PL5A 4NVRA 4Q9HA 2K5UA 1AKTA 1T2VA 1TZBA 2AC4A 4O4LA 4RHTA 5M34A 1I7PA 1ODKA 3W5AA 4WKNA 2VJLA 3AC0A 5I4IA 4G0MA 2JGDA 4Z0HO 2ZYGA 4BO8A 1FY2A 5LBTA 3TM5A 5BVGB 3ZTWA 1NW4A 3DLHA 2QPOA 4R1PA 5BQXA 1RP7A 3BWBA 4GMFA 2XZDA 3M4XA 5DTJA 2HXSA 3VU9A 1GNQA 4QQ8A 3WGZA 4XAQA 1F1BA 3EH1A 2ZCJA 1B15A 3MTQA 3OQNA 4R84A 3CVWA 3K0AA 2VSNA 3A11A 3M4YA 4NDZA 2HSJA 4DM7A 3IIIA 1KQFA 3GLFE 3DBLA 2C9CA 3N6VA 2FWNA 1GPUA 1YS9A 1NUQA 3PD0A 1CEQA 4IS2A 1E7SA 3OF2A 3L8DA 2BGLA 4KVFA 3TDNA 1O8CA 1O96A 1AMOA 3EUFA 1K2WA 4O2AF 3KVVA 4R2JA 2R68A 3T3EA 2GAOA 2C29D 2R7LA 4YT5A 2F64A 2G5GX 1ZUWA 3LVBA 3NEPX 2WUEA 3CLUD 4UREA 5E8RA 4FYKA 4MVJM 3AUUA 1RLMA 4F6LA 4HD8A 2A9OA 1E2EA 2JFQA 1EXVA 4JU8A 3AHCA 2Z58A 3AM5A 4X41A 1DRVA 1JFVA 1VKZA 3DC7A 4OIFA 3Q9SA 3ZH9B 4JL5A 5KQPA 2BR3A 4UCQA 2OHJA 4FGKA 3WGQA 4CLOB 5F98A 4FGJA 5DCWA 4RZUA 5HTKA 3FG9A 1J8QA 5IJAA 3VX3A 1G7SA 2GCIA 3WS7A 5SZJA 2VYQA 3Q87B 4BE7B 1ZA2A 2FPKA 3FVWA 4W6ZA 4YRTA 4DG5A 1D2MA 1TE2A 5CVEA 5IXSA 1VHTA 4L0QA 3OIYA 1A82A 2OLKA 1TX4B 3K9QO 4PAGA 3QOFA 4WBXC 3G1WA 4KRYA 3WZMA 4F3CA 5EIAA 4K87A 5DHFA 2VSYA 3BH7A 2P30A 4NNOA 3LTNC 3E61A 1FTGA 3AVWA 2B4AA 1X19A 1H65A 1ISIA 2MSWA 2QS9A 4HDRB 4UHBA 3A9UA 3I9V6 2HIAA 3OM9A 3ZK7A 4FYPA 4JEMA 4KFUA 1FF9A 1GT91 2P6PA 4O25A 2JIZD 5UKDA 5IKEA 1E9RA 3BJEA 1ZL0A 2ADFA 3EMKA 3C7CB 3JVIA 1H0SA 2AZXA 5BW0B 2EATA 2KBFA 1ZC3A 1A7UA 4NNJA 2W6CX 3I6QA 3MC1A 3ZWPA 3R9KA 1UQUA 2QN3A 1ENYA 4WUTA 4BNXA 1XE3A 4PCLA 5DIFA 5DNAA 3PU6A 5FJIA 3OOYA 3WYFA 3DMFA 1XNRB 4BOYA 3HFSA 1UINA 4DDMA 4KODA 2CMGA 2DR3A 4U7JA 1VLZA 1E7MA 3H17A 3HPRA 2XJ9A 3U7QA 2F48A 1A95A 2ZVJA 4Y2UA 3H97A 3FBWA 2Q07A 3PITA 2B8TA 4DSAA 1M1YE 2FPXA 5AK0A 1M34E 3R3JA 1AXEA 2XYQA 1VSTA 2JEYA 3KLOA 2I5PO 5IJ9A 7MHTA 2C77A 4Q4CA 1GSAA 2PR2A 2RGAA 1HYQA 4FFLA 4CF3A 1BHSA 1W73A 4U5QA 1FS6A 1YZKA 4MGYR 3OIUA 5EFZA 1EZ1A 2P2YA 1JPNA 4K9NA 4ZVUA 1SHTX 4OLAA 1RPAA 5F23A 3GHYA 1JB9A 2EV9A 5D7BA 4PO9A 3ZLBA 5F9FA 5K6AC 3BBPA 1CE8B 1HDYA 3VNRA 1KPIA 1YS7A 1NP3A 1NVWQ 4RW0A 5DMXA 3WNCA 2PG3A 1YOBA 5L95A 2OGSA 4YRIA 4JBXA 3L7KA 2ZYDA 3B36A 2AUTA 1EWYA 2D8AA 4LV6A 5H3HA 3VTAA 2FWBA 4XOUA 1MHPA 4ZDIA 2QTTA 4WNYA 1Y4DE 3E9QA 4OQLA 5EG5A 3SBEA 5JYDA 2H8GA 1FSFA 2JH9A 1M76A 1E3TA 1T5IA 5EAIA 2AWNA 10MHA 3FMIA 3RSCA 6YASA 4C0WA 2EGUA 5AW2A 2A9KA 3LLCA 2HF2A 1A8UA 5F76A 1PL0A 3E82A 1XPUA 3PZRA 5IC6A 3NBAA 4ZVMA 3IAHA 4WD3A 4PRYA 1N1EA 3GI1A 3NHRA 1ZNQO 3BL5A 3WLOA 1O54A 3SYLA 1PYGA 3HEMA 2XVMA 4PQGA 2Z0MA 3KAQA 2ON6A 4EGAA 5LQKA 2COKA 4E32A 4F5EA 2B69A 2WIKA 3L7YA 2F7SA 4W99A 3K2QA 1UEIA 4N6OA 3MWKA 1O57A 1BX3A 2UAGA 1V1MB 4TL7A 5SZIA 1WW8A 3RQSA 3DCNA 1CR1A 1NF3A 3FTCA 2IOFK 3Q7RA 2WD9A 3RS9A 4YIHA 4YY3B 2A9PA 2RETA 2OYRA 4P80A 5GONF 4E51A 1XPJA 3PNLA 2PZAA 3I6YA 4FT2A 1ZCZA 3X2FA 1AA9A 3K5PA 4HHEA 3AF2A 5ES3A 4Z7NB 4PRZA 1IC6A 4UXJA 2PZ8A 4B48A 2QMOA 5K09A 1PUXA 4HEHA 3SZLA 3AFNA 2B37A 2Z95A 1FYFA 3PRYA 3NRCA 1XMJA 5H9WA 3ESQA 2BFDA 1PT8A 1DDGA 3N0XA 4BB9A 2O9JA 2YQ4A 4ARZA 3F0TA 4GL2A 4HAZA 1G5FA 1KEKA 3ODPA 2DQ4A 2F1KA 3AVOA 4IHJB 1F2TB 3G59A 4LDRA 3AIOA 4S1NA 1MB3A 5DE3A 3ROXA 1VJTA 3AONB 1Z3CA 3THWB 1PK8A 2BZ1A 2MWMA 5A1TA 2G6BA 2V7WA 1S01A 1G3RA 2LTAA 4BMPB 1I2ZA 1QHHB 3ETHA 4WDRA 1WW3A 3AVXA 3AM1A 2PIDA 2GCOB 3THOA 5CW2A 4E7OA 2RHHA 3QXGA 3I1JA 2G17A 4QNRA 3GK3A 1NQOA 2CXOA 4HQKA 2ESRA 3OCVA 4AIRA 3GGDA 3U48A 4JXZA 2CMKA 2EHDA 3FGPA 1YK1A 1USIA 1UJNA 3E81A 2ZTMA 3T38A 3EWIA 5C80A 2WD7B 3D0QA 4M1ZA 3DLIA 5FBVB 1HR0B 1MQAA 3K9LA 2HA7A 5CLJA 6PFKA 5AKXA 1JAXA 2X8WA 1AK2A 2FSHA 1J7KA 2Q5JA 3FSEA 3MNFA 1R0CA 2VTVA 2CNKA 2V4UA 1CJCA 4JFAA 1L8XA 4YEDA 4RGYA 5ALXA 2YL2A 3GT4A 2O8NA 2NVWA 2LGJA 4REQA 4YAOA 4EY6A 2IBSA 3REFA 1NRJB 2OXFA 2OFFA 4JOBA 2IVZA 3ZVLA 4Y6QA 1OBFO 2AV6A 4U9HS 5FUXA 1J8YF 3EGIA 1IUPA 1KL7A 2J9XB 4CQLA 3A0UA 3NUQA 4MW5A 3VNQA 1PZEA 4C4PA 1CW2B 2MINB 4ZRDA 2E21A 1CY2A 1ELOA 1M8KA 4KFSA 5B1SA 3PG5A 3ZWDA 4QGBA 4CLRA 1U28C 3NXKA 1R8YA 3QELA 4KDEA 4RO0A 1SUEA 3RHSA 4DMHA 4PN3A 4OXYA 2GDZA 2G5CA 1JIVA 1Z83A 3R3ZA 2I03A 4FE7A 4F2HA 4GXQA 4ZEWA 3ZNPA 1TUBA 3PX7A 1U2ZA 2D5IA 2N47A 1FSZA 1OLUB 1LWOA 2WT8A 2O8VA 3HO6A 5E9WA 1X38A 3P5BA 4B3TB 2JJ1D 3LGSA 5ER9A 2HIGA 1RCTE 5FR1A 3HU5A 4PTYA 3DO8A 4JLWA 4BASA 4AULA 4R8KA 1KIAA 1PW7A 1C30A 1NU8A 2I8LA 3DV9A 1T35A 3H1PA 4I1YA 1EUYA 2BBOA 2EYUA 2FUG1 3ETJA 4KSYA 3V2GA 4CG1A 4DZZA 1KO1A 3Q0TA 4ESVA 1UJCA 3W8FA 3IEKA 3SDBA 2UZ0A 3Q3IA 5LUAA 2MIIA 4BIIA 1PR9A 1OLSA 1I2MA 1ZI6A 4BIMA 1Q57A 4E4TA 2GVNA 4Q16A 1BCRA 3LIIA 4D1YA 4C87A 3RT1A 3PJEA 4MRAA 2X23A 4LXTA 4RESA 4MDFA 2Y4OA 5FV4A 1QX4A 1BMDA 1C9KA 4WBSA 1X70A 1IZZA 4N0MA 5AHKA 3JTEA 3VGJA 4ETNA 4EYSA 3QLUA 1KI6B 1DUVG 4K05A 3KKKA 5EVCA 3THSA 4AO7A 4MW1A 2AEEA 2NAFA 3FZYA 4EF6A 1Y42X 5T3UA 4LYEA 4IH4A 4M49A 3LY9A 4UUBA 2WJHA 2E4UA 4AUEA 2QDXA 4A8TA 4DMMA 4N49A 5DP2A 2Z5LA 3FTEA 4PAWA 3G5UA 2Q5CA 4DR3B 3I5XA 3E22A 1BH6A 1G38A 1QHEA 3A6LA 1AQIA 2IITA 2Q2NA 4LNUB 4B84A 1QTRA 4K40A 3G2NA 4HCJA 3GAAA 1ZVMA 3A3OA 4OBBA 2W93A 1RQ7A 2C88A 3W1WA 4ZTUB 3IUJA 3C6KA 4MUXA 5ES4B 5K8IA 5AESA 1WDLA 3NBQA 3ZDQA 5KQSA 3QPAA 3WBBA 1V43A 3SBXA 3E9YA 5CEJA 4CCWA 1VIDA 2C82A 1GA6A 3OX3A 1I24A 1J8MF 3QHAA 4XEUA 2YICA 4FYHA 3I9LA 5T4EA 1FDUA 4EL0A 1NYQA 4MGIR 2D2VA 3JAWB 3FCUB 1DKOA 4QNMA 4DN6A 4LF5B 1L5HB 1RXUA 1RXCA 4HDMB 4JLVA 4JNCA 4CKZA 5HW0A 4ER0A 5GVSA 5K0SA 2FCRA 3MJHA 1ZCAA 1EVJA 1G7TA 4CBVA 2Q9CA 3V1TC 4ALLA 1J8FA 4R0NA 4EEXA 3M89A 3NTVA 4V0MA 4MKFA 4GOLD 3AUKA 2I6SA 2PKRA 4D9GA 2CK3D 3NP9A 3R74A 1PZFA 3RPEA 4WMLA 3JSXA 3LA6A 4US2R 4DLVA 3LDGA 1MN6A 1PQYA 4BECA 2OZPA 4AKEA 1J9GA 5I9TA 3SM3A 4LF6B 4GPBA 5EJ7A 1DXQA 4IJKA 4YMGA 1T15A 2QQ0A 4WECA 3JW8A 3A36A 3P96A 5CB4B 4B46A 3VYSB 2ZSBA 1R6UA 3NT4A 1AF7A 5EWLB 4INAA 3Q3GE 3SIRA 2FSUA 2J3EA 2LCFA 2JJ2D 3UMFA 4ARSA 1R4ZA 2HQOA 2OZLB 1BTOA 4UASA 2V9ZA 1II9A 3HYNA 4RLQA 4TYQA 4RFLA 4NS4A 1U7ZA 4J3NA 4YXFA 2EZUA 3O4GA 3KQQA 3T9CA 2XUPA 1NXSA 5C1BA 4D2IA 2WKQA 1WV0A 3MGCA 3TW4A 2QLTA 5CEFA 1EFKA 2ZSAA 4NQRA 3VR5D 4H7PA 3LCVB 2P9QA 4BVJA 2SKEA 4EB6A 1CIVA 5A5VA 2H1RA 3DYBA 4URXR 3I4LA 2FRDA 4ZQEA 3EQZA 3C41J 2Z43A 4CM4A 3A9CA 1W4RA 4A26A 5JBNA 5C5CA 1OH8A 1UT5A 4FWIB 5I6DA 5I3ZA 1HLDA 1LH0A 1SOAA 3AT1A 3CLRD 5B7NA 3X1KA 3STYA 2CMFA 2B94A 1KPHA 3HC7A 3WB9A 3EGXA 4ICIA 1UDAA 1PUIA 2E49A 4A0RA 3A6FA 3IAM6 2FZKA 2VS1A 4YDQA 4HGPA 1YVEI 5BQ5A 4EY3A 1H4QA 1FX0B 3MT9A 2HM7A 1XN1A 4GG1A 3UVEA 1NW7A 3WFJA 5BXQC 3QFTA 2NW6A 1XRPA 1SVUA 1E5VA 1TI7A 1P19A 3B51X 2JAWA 2Q2VA 3UUEA 1NBAA 1NI4A 1T36B 1YJQA 4TUYF 1BXRB 1CUAA 3ZXUB 4CL0A 3WGTA 3DMRA 4FOLA 3RHZA 2Y4NA 2NPIA 2RDMA 4TXMA 5HILA 4IICA 1H4VB 2ZKLA 4Y7DA 2A1TS 3MGKA 3ZX5A 2JIZA 3RFFA 3SXJA 1Z82A 3KD3A 2OBBA 2QR3A 4CW7A 2UXCB 3EDQA 1N32B 4TMTA 3SEFA 3ABQB 4EYKA 2BFPA 2JIQA 2BM0A 3UWOA 3HKDA 4DPMA 4FS8A 4OSOA 4RXMA 3TX6A 1OXKB 1ZBDA 1AJEA 1F14A 4LSWA 3FAKA 3D3JA 5AW7A 2GJKA 3C3XA 4CM3A 1GVNB 2C2GA 1VCMA 4QUEA 4WGGA 4Z4GA 2QN1A 5KQLA 3DKVA 2FXVA 3B2QA 3LNTA 1RRCA 4BNKA 3I4FA 1SKYE 2IYEA 2GR7A 4NH4A 3EF0A 4TTSA 2ONKA 3L0YA 4P36A 2IZ1A 4UE3S 4ZA2A 2XMBA 3L4JA 2AI1A 1JKFA 4OHUA 5EQJB 3PPWA 4JI7B 1CRWG 4HQ6A 4BUCA 3FY4A 3LXRA 3FFXA 1BIFA 4NCKA 4WK4B 3IMCA 3LSTA 3R8FA 3R6GA 4F9TA 4IEIA 1SVKA 2VSXA 2D54A 1IMJA 2EJUA 4IXNA 4MRMB 3AL2A 1W4LA 3R7SA 4OKNA 2QVGA 5JPCA 1PT9A 4E3WA 3O9MA 4U39A 2GETA 3KAKA 1SHUX 1UXOA 2VA9A 3MMPA 1KAQA 4NOKA 4RFSA 1U6KA 3QX8A 4MRNA 2VTDA 3E9NA 1H2HA 3GFOA 3GEMA 3WLEA 4HNUA 5KYUB 1R0KA 2UUCB 5IHXA 1GUDA 4GE0A 3C8UA 1PJ4A 2XCRB 4YLGA 3CI0I 1RCUA 4ZXPA 1LWNA 3KHUA 4BCDA 2CLIB 1KY2A 4K6FA 3VR6H 5CFOA 3HYRA 4MV9A 1W87A 1UM8A 4C7KA 1ZVQA 3RUHA 5DI3B 4EKGA 3S29A 3TE6A 3BFKA 3M6VA 2JFFA 4A91A 3QPBA 2YW2A 1QF9A 4KN6A 2HJHA 4RKQA 4LZAA 3D81A 5EUCA 3QWBA 1GTJ1 3VUFA 3ZY3A 1TF7A 1ZONA 1LS6A 4X6LA 2ZRGA 5CXQA 1EWKA 1RT9A 4NJEB 1UT6A 4FZ3A 2ZAYA 4DMRA 3UUGA 1PEDA 1WM1A 1Y0BA 4HH0A 4KUGA 1VLMA 1PP4A 3K9GA 3UAYA 1OFUX 3KWMA 1EXWA 4Y9TA 5ARBA 4RK1A 3RC7A 1J2EA 3GIWA 2AQ8A 4IXDA 3WYNA 3O9VA 2IS2A 2HJ9A 2ZIAA 3C1TA 3AEKA 4I4TB 4UDXX 4XOIA 5JPDA 1VJRA 3RSOA 4XSGA 2QD2A 1Y6GA 3ZXSA 3MBOA 4P86A 3C2QA 3Q5DA 1RQNA 3HCNA 2R2AA 1MMFB 5FFFA 4F3YA 3KTFA 5KTOA 2DCUA 3I53A 1IDOA 5LQSA 5C5DA 2WHPA 3O8QA 4R2IA 5A3RA 3IAEA 1WEKA 3NKFA 2FMUA 2F9FA 5SY4A 4RQUA 5JAHA 1WKVA 4DTIA 1PGPA 2AJLI 1MJ5A 3HKCB 1JI0A 3O1HB 5LR6A 1BC5A 3H5VA 4FSDA 5A9SA 5AOVA 2HMSA 4MRVA 2ZT7A 3MMNA 2YN2A 3A70A 1O9GA 2VIIA 3A9VA 1GNLA 1LXCA 1Z15A 2ZAOA 1XTVA 3KUDA 4MR9A 1TO1E 4NZMA 1LRLA 5K51A 1K66A 5EXDA 2G3DA 2I91A 2VDUE 5C4GB 2IY8A 2X0RA 4LCBA 4MZDA 4DLTA 1V1JA 1KJIA 2IUEA 2J0UA 2OXCA 2J5KA 1CUYA 2B4QA 1AO3A 3FLBA 4MINA 3JQFA 4KDCA 4QAQA 1PD0A 5LLDA 1I13A 1ULZA 3M34A 3HFRA 1BJRE 3LLVA 3RU7A 1CS0A 2VYCA 4XFKA 5B3LA 3LVQE 5DNYB 2Q1XA 3WXBA 4C3ZA 1CQXA 1YGPA 3H75A 4JLSA 2GBGA 3ZWVA 1JKXA 3C39A 1VLHA 3O8OB 1CNEA 1W1IA 3NJ4A 3PQ3A 1EIZA 3N75A 4TMVA 3ZWAA 2O50A 5KAPA 3GZ4A 4QJ4A 5I5EA 3M6UA 1HT0A 1EUQA 3KJHA 4HJXA 1QTNA 2AK3A 1Y9ZA 1GIAA 1JAYA 5AQEA 2CV0A 1WUYA 4I5IA 4HQ0A 3W5SA 1M2OB 5AI4A 2BFBB 2P41A 3ZYZA 1AMNA 4ZDJA 4N0DA 6AT1A 3ZD8A 3W2IA 1ZK3A 2V6IA 5KNBH 1K86A 1EDBA 2FFJA 1SBCA 4JC4A 1E3DA 5ADUS 5JJLA 5BVHA 4AMVA 3KXLA 2B0JA 4YCNA 4TLAA 4IGIA 4YRAA 2IX9A 2E4ZA 3ONNA 4MUAA 3N2ZB 1E4VA 1GNVA 1MQ9A 2P67A 2VO1A 3AB8A 2R84A 4V0OA 4DWJA 2W0MA 3UT0A 2WMYA 1VPVA 1WB9A 2YS7A 3AM4A 3ESXA 1SCKA 1XA4A 3L1IA 1KDTA 3QVWA 3OMWA 3OTHA 1LVHA 2OQRA 3G2MA 4B7AA 1D4OA 4DJAA 4F6CA 3SYNA 2YJTD 3Q0EA 3DUFA 4XPZA 4IIDA 1Z33A 2AA3A 5AT1A 3AM3A 1EU1A 3OOSA 5JANA 1KHHA 1NVAA 5BYKA 3EG5A 2BGRA 2O2HA 5K0ZA 1DC6A 4AJEA 4D3DA 1I4TD 1D2CA 1B8VA 2O1WA 2W6MA 5B6PA 1YVPA 1DUSA 1EHYA 3C4JA 1RHRA 2JAHA 3DT8A 4ZODA 1KSHA 3WNVA 4BB6A 4C7OB 4IJMA 1UAAA 1MJGM 3CURA 2CHVA 4GZMA 1U9CA