4MUNA

Crystal structure of pantothenate synthetase in complex with 2-(5-methoxy-2-(2-nitro-4-(trifluoromethyl)phenylsulfonylcarbamoyl)-1h-indol-1-yl)acetic acid
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
286
structure length
283
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 92
structure length 283
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4munA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4munA01
2Z08A 4UZEA 2X0KA 1N3LA 4ZCTA 2CSXA 2VTBB 5KWVA 4EG6A 1LI5A 3IVXA 1H3EA 1F7UA 4J76A 4P2BA 4L2IA 4S1OA 1WZ2A 1JEEA 1O96A 4EG8A 3VGJA 4ZT6A 1M83A 3HGMA 1O0BA 2CUZA 1TEZA 3ZJTA 1KAQA 3ILVA 3IOEA 4MVCA 2RD2A 2PG3A 1N2IA 3DO8A 1WXFA 2E89A 1FYDA 4CDMA 4NZPA 3CVUA 1OWPA 4EG4A 1U3CA 4PBSA 4BWVA 3CVVA 1COZA 4MW4A 4MUIA 2J08A 5IHXA 3FNRA 4YP5A 2WQ7A 2IJGX 4UZFA 2QTMA 3IOCA 5DB4A 1N2GA 1JZSA 3TS1A 4KPUA 4J75A 1PG0A 3P0JA 2EJCA 3IVCA 3PNVA 3AKZA 3RK1A 1QQTA 3CVYA 2DEUA 2CV1A 4ARIA 3IUBA 4U7JA 3IMGA 3H9BA 2Z3VA 4MW2A 1WY5A 1OBCA 3TQIA 4YP7A 4WSOA 2E0IA 1JMVA 3RHSA 4DE5A 3RJZA 1I2DA 1PFVA 1EUYA 2D5BA 1MOPA 2ZUFA 3CLUC 3TQOA 4EG3A 1CT9A 2CYCA 3NBAA 2HZ7A 4Q16A 1QJCA 3HMQA 1N1DA 1YUMA 1KQPA 2CT8A 1D2RA 4MQ6A 1NP7A 2JA2A 3ND7A 4MVXA 2Z09A 2HGZA 1PG2A 3ELBA 2DPLA 1KH2A 3CR8A 2H2AA 1ZH6A 1U7XA 1BS2A 5KCMA 3X1MA 4I6EA 4I6JA 1NYLA 2AZXA 1QRUA 3H05A 3PXUA 2YWBA 4HK4A 5TS2A 1Q11A 2CYAA 2A1UB 3IH5A 2J09A 3P52A 4JXXA 4PBRA 4L2IB 1KORA 1O96B 4JYZA 1IFXA 4AQ7A 3SDBA 1K92A 1NI5A 3K32A 3VRHA 4K03A 4ZCQA 1WXGA 1N2BA 2OQ2A 1TYAE 2YXNA 4OJMX 1IQ0A 4XFDA 5LLTA 3COWA 1GN8A 1LI7A 5JBNA 3D6UA 1GTRA 4AS1A 1M8JA 5J58A 1ZJWA 3X1KA 4EGAA 2DETA 1J09A 1IQRA 1T6YA 1J21A 4MW9A 2PIDA 1IQUA 3AG6A 2GOYA 3TNJA 3IOBA 4MUKA 1KKUA 2J07A 3H9CA 4NATA 4DDMA 1K4KA 3KT6A 4KPUB 3MLBA 1IHOA 3M5WA 1JEDA 1JIIA 5FO0A 3ND5A 1O0CA 1O94C 2QTNA 3CLTC 4MWBA 4PBTA 2CV2A 3MMXA 3LOQA 1A8HA 4I6GA 3DPIA 4JFAA 3CLUD 3FY4A 1YI8A 3AG5A 5H16A 4DDHA 3ZXSA 3COYA 1MAUA 2C5SA 4MUGA 1N2JA 3LCJA 3NBKA 1M8FA 1OWNA 1KH3A 5F23A 2G36A 1NURA 1PFUA 1WXEA 4WNYA 3P0IA 3KFLA 4OUDB 2E18A 2JANA 2WQ6A 4MW1A 2CYBA 3KT3A 4NAUA 1QRTA 1VBKA 1JIJA 2A7XA 3GMIA 3C8ZA 3PNYA 3RK0A 4RPIA 3PRHA 2CFOA 3ZGZA 1P7PA 3H97A 2A4MA 1NUPA 2IELA 1GTSA 1Q15A 5IJXA 1F4LA 5DK4A 3ZIUA 1XNGA 2D13A 3RBAA 2R5WA 1N77A 2X1LA 1KAMA 3JXEA 1R6TA 1F7VA 3TZEA 3ZJUA 3KT0A 5FO1A 4ZCRA 1NUTA 1OWOA 4A91A 2AG6A 3G5AA 3ZXIA 3H99A 4YMIA 1IRXA 1PFWA 1J20A 3FDXA 1MJHA 4NX2A 2VXOA 5LM3A 4NAHA 2DXIA 2QUIA 5DASA 2XRZA 3CVXA 4NDAA 1YIDA 1YULA 1KP3A 4XSVA 1NSYA 4HJRA 1UFVA 4RUKA 1MC1A 1O94D 3CLTD 3SEQA 1WOYA 1I6KA 1NUUA 4KR6A 5KHAA 4FZJA 4JZYA 4EG1A 4E1AA 1LW7A 5TEVA 3UC5A 3A2KA 1QU3A 4MWCA 1GAXA 2PZ8A 4G5FA 2VTBA 1J1UA 1IH8A 1VLHA 1NUQA 2PZAA 3N05A 2XRYA 4U8HA 3SEZA 5HUHA 5HUJA 3A4IA 2DR2A 2YY5A 4MAFA 2DLCX 1YUNA 2BTEA 4ZT3A 1XJQA 5TEWA 5AHWA 1JIKA 3CA8A 1RQGA 1TYBE 3MLAA 4YP6A 2A1TR 3IMCA 1WQ4A 3X1JA 2RE8A 2AKEA 1MRZA 1XNJA 1KQNA 3COZA 3G6KA 3QTBA 2NSYA 1QTQA 3BL5A 3DLAA 1TFUA 2A84A 3A05A 1TQ8A 3KT8A 1MBZA 4H3SA 3SZGA 3FHJA 2CV0A 1JILA 4ZT4A 1H3NA 4KKVA 4EFKA 2A1TS 4G6ZA 3UMVA 1IVSA 4ZCPA 1Q77A 4MWDA 3DV2A 1G8HA 2A88A 3Q4GA 1ULHA 2DERA 3L92A 3HFJA 2X1MA 1WJGA 4ND6A 1G59A 1R6XA 5J59A 4MUJA 1NZJA 2O8VA 2D54A 2J4DA 1K4MA 1Q19A 4DNXA 3AIIA 4ZCSA 3PNBA 1WKBA 3FG9A 3AFHA 2QTRA 1VBNA 5BNZA 2NZ2A 4PY2A 3F3MA 1K97A 2O5RA 2WSIA 1N2EA 1ZH0A 3S3TA 3RFFA 4TS1A 1KH1A 1EXDA 1HYBA 1OWMA 1ILEA 1O97C 4QRDA 5J5AA 4F3RA 4ND7A 1O5TA 3IODA 3OP1A 5EKDA 2QUJA 1N2HA 4EG5A 1M1ZA 3G59A 3VU8A 2A1UA 3TZLA 3FH0A 3GUZA 1I6LA 1X8XA 1O95C 3SP1A 1O6BA 1QU2A 2A86A 4EF6A 3UK2A 3CLSC 4KR9A 5K0TA 2QJFA 1PFYA 2OV4A 4R0NA 2B7LA 3D6VA 2GM3A 2X3FA 4QBTA 4ZT7A 1XNHA 2J5BA 4MWEA 3COVA 4MW6A 5LFAA 1TYDE 2I1LA 1J70A 1EFPA 3A04A 3L93A 1VBMA 1X6VA 3N9IA 3ZUGA 1QNFA 2QUHA 1U3DA 1KR2A 2DUMA 2H29A 3UY4A 1EFVA 3P0HA 3MUEA 3U1VA 4QREA 1OD6A 3IMEA 3Q10A 1EE1A 4DDKA 3HZRA 4Q93A 1DNPA 3SZ3A 3FI0A 1G8FA 2EL7A 4MW5A 2QJTA 4ZT5A 2JAXA 4MUFA 1MB9A 3QE4A 2WB2A 1JECA 2TS1A 2YWCA 1EUQA 4MW0A 1WXHA 4YBRA 1FFYA 3E27A 1TYCA 1JHDA 3CLRC 1N2OA 1U0BB 3AL0C 1KQOA 1O97D 3FOCA 1T9GR 3FWKA 4OUDA 1V47A 1MAWA 4GRIA 1M8PA 4R2MA 2V0CA 1R6UA 5FNZA 1V8FA 4EG7A 2GKSA 1N78A 1U7DA 1ZUNA 3MXTA 5DEOA 3K9WA 3N2YA 3I05A 1O95D 3FIUA 1GLNA 4DLPA 1OBHA 1SURA 1N75A 1OWLA 4MLPA 3CLSD 3UOWA 4HJXA 1S4MA 4MVYA 1EJ2A 4X0EA 2QUKA 1T9GS 1VL2A 1F9AA 3ISJA 2E21A 4G5YA 1M8GA 4MUHA 4CQNA 4F4HA 1H3FA 4HPWA 3SYTA 1B6TA 4KR7A 3INNA 1GZUA 1JZQA 4GU5A 1QRSA 2PFSA 3NV7A 1KP2A 2ZP1A 3ND6A 5TGTA 3FETA 4MUNA 2V0GA 1I6MA 1YIAA 4DJAA 2BYTA 5H7XA 2IP1A 1M8KA 4XFJA 2HMAA 3HV0A 3IUEA 3CVWA 4MUEA 4ARCA 4U63A 1GPMA 1H1TA 1T6ZA 2QJOA 4MVWA 1NUSA 1WXIA 4CDNA 4CT0A 2ZUEA 1EFPB 1G8GA 2PXHA 3ZJVA 4MULA 3GLVA 3IVGA 1Y42X 4ZT2A 3IDFA 3Q12A 1MB2A 3HL4A 1EFVB 1JGTA 3LE8A 2PZBA 4JXZA 3N8HA 4K0RA 4R2LA 5HG0A 3OTWA 3QTTA 1WQ3A 5K0SA 4MW7A 1T6XA 3CLRD 1J1ZA
chains in the Genus database with same CATH superfamily
3DDCA 5JC8A 4QYXA 2BCJQ 4LRYA 2ODBA 3Q8WA 3PUJA 1NVMB 3I09A 3MFQA 2A5GA 1DKOA 1E0JA 3F9IA 3PC6A 4BX8A 1U2QA 4B6SA 2X6QA 5DBIA 2C1XA 2D5CA 1II9A 2I7CA 1RLOA 2QM8A 4INZA 3UWMA 1VYUA 4EDHA 2I4NA 2A2ZA 2W6MA 2XNCA 1RWOA 1XCGB 1VZ2A 1ZW6A 3PKZA 1JTFA 3C16C 4Q4AB 1WNFA 1Q84A 3MS2A 1DKQA 2QX4A 3L46A 4J6FA 1UBCA 4TLAA 1MW8X 1ZIOA 4E1BA 4C0LA 2PL5A 1S1MA 2RB5A 4JJIA 2GZHA 2I0FA 4L4ZA 4FQ5A 3Q3VA 4N9QA 3CVUA 4AK9A 4PBSA 2C4WA 4FONA 3STHA 4GRAA 1S2MA 3EISA 4S1WA 4F9FA 4YYEA 4GI1A 1I3OA 1OZ0A 2QEQA 1QQAA 2JS7A 2HJSA 3RT9A 1GTG1 3DDUA 4P8RA 3TLAA 4B81A 1QLJA 1Z07A 1TUEA 4CKCB 2HSGA 4Z7QB 5AVTA 3D3QA 4DN6A 3GLFA 5B1SA 3T34A 4KREA 4HP8A 4EWLA 2RHGB 2RK6A 5DM1A 1P4HA 4RQUA 5HM6A 3ZVMA 4C0SA 3IVCA 1IUNA 2XYGA 3KR1A 1K7EB 1RM4A 5HNKA 1ZJZA 2GQ0A 3EVBA 2ZYGA 1D5CA 1IUPA 3SR0A 1AQUA 1FZTA 2EW1A 1PFKA 1EU1A 2CFTA 4NE2A 1KJ9A 1Q7TA 3ACDA 3NOVA 1Q0HA 2VJKA 3DUFA 4HOYA 4WSOA 4MJ7A 5JWRA 3JSXA 4G0ZA 4QASA 4B4KA 5IMSA 1QIJA 4QJ3A 3KJGA 1S89A 1MHPA 1RE1A 1T10A 1TCBA 2I6XA 4M1ZA 4TV8A 5TQVA 2I22A 1K9SA 1EUYA 3W34A 1IZYA 3LX6A 3ZU6A 4EZBA 1EDZA 1WHSB 4YV0A 2F3UA 2COEA 3K2IA 2YXLA 1VE5A 1NT4A 2EZ8A 4WZ6A 1Z38A 4RLFA 5SY6A 3TKYA 2FEWB 5BSKA 4KR2A 1DRUA 2DTXA 1FRQA 3GHHA 1HZJA 1ONNA 1RDFA 1QJCA 4ZHQA 4L27A 4R1OA 4BLSA 2CT8A 4NEGA 3G7UA 2Z6QA 3R76A 1QLHA 4I50A 2IHUA 3F5FA 1Z75A 1JG3A 1U7XA 4BNIA 2AL7A 4CKBB 1CUGA 4CEJA 3TIVA 4YVFA 3X1MA 1NYLA 3BB3A 2AZXA 2G80A 2WWHA 4N7BA 4B7UA 5CT5A 5FPYA 3AEYA 1QRUA 4A1FA 2G0NA 2J67A 1JAIA 2RGBA 3OOYA 1BA2A 3C6YA 2XZPA 3H4TA 1FMJA 1NATA 3SYMA 3LUJA 3Q85A 2PRIA 3HEBA 1JIUA 4DQVA 5I8PA 4IR7A 1UANA 1LQTA 2X4IA 3VSAA 5C8YF 3ESYA 2BRUA 2B7CA 3K0FA 2PDAA 4O2BF 4XWAA 2BCGY 1Y8ZA 2JFFA 4WEQA 3PF8A 5G53C 2XNDD 3A1SA 4BE7B 1Z5NA 2PZEA 4ZJZA 1L1FA 1BYIA 5BP7A 4M3NA 1A27A 3CSDA 1H1DA 5KNCA 2W2KB 1ZJWA 1FLNA 1DINA 2GPNA 2OFFA 4KMRA 4N18A 4DLBA 4KFCA 1TIPA 3I2YX 4YRZA 3DPSA 1II8A 4QGHA 4CXMA 1C4KA 4LDAA 4UM9D 2X8JA 5KNDD 1TGYA 3KKNA 4C4ZA 5LP6F 1KO5A 3GGSA 1W7AA 5A4MS 2C99A 3SR4A 4N3GA 5EZQA 1YJQA 1ZNQO 4NAVA 1IOLA 2C59A 4PXAA 4UBOA 5TY0A 1OI2A 1U98A 2JHCA 3QVTA 3F1LA 3DW3X 5FT9A 5DLEA 4G2TA 2CZGA 2O0MA 5FR1A 5IBPA 2ZQZA 2IE0A 1Y89A 1T15A 4MPDA 1GFIA 3N0VA 4H3VA 4JHXA 1Z22A 5DXFA 5JYCA 4PYIA 1DKLA 1OTHA 1N5IA 3FWYA 4L7VA 4R69A 4TQ9A 4IIHA 3HDTA 4JI5B 2C31A 3IALA 2FN9A 3ZZTA 2LV8A 2YV4A 4P34A 4HDMA 3D9QX 4GWKA 3SZLA 2JHPA 3TSZA 4UATA 1CUYA 5KYXA 5EIBC 3L84A 4AJIA 1RRCA 4KUGA 2Z5GA 4ECAA 4PYQA 3OF5A 1U11A 2REXB 4WNYA 5EHQA 3UK6A 4PQYA 3WQRA 1CUVA 2WM8A 3URMA 4GW3A 3SLKA 4G4SO 4IXJA 1SGWA 1NJ6A 2HWUA 1D09A 2JJ1D 2R1VB 2IUTA 2ZBGA 3IDQA 2XA1A 3R0ZA 4LG1A 1QIGA 2VJPA 1LNSA 3NS7A 4B7XA 4OG2A 1AV6A 3GAAA 1GTSA 1TA4A 3B1WA 3BCHA 1Z4OA 3J7AC 3RV4A 3JRNA 2X0DA 3RBAA 3RJTA 4L0DA 4TQUS 4DY4A 3H11A 2LXNA 4DZTA 5KMGB 4R9UC 3QGMA 1FTWA 2OHGA 4IOLA 4S2EA 3U80A 3TEFA 4TLLB 3T9EA 2X6RA 3VTFA 2CL6X 4Q7QA 3QFHA 3ZJUA 3EGOA 1QTNA 1DKUA 1EVLA 1LK5A 1BU5A 4ZP1A 2WOOA 1XJ5A 1W35A 3G5AA 4TLBA 2NZUG 2PR2A 5IN4A 3U4QB 3G02A 1MJHA 1G64A 4I5IA 4KPGA 1BTOA 1R6AA 4OYHA 3DONA 4MGEA 5A9SA 2H06A 1MRSA 3CRNA 1O4WA 1VP9A 3B36A 2FSHA 2RG1A 4GYKA 5FUWA 2QUIA 5K3DA 4CJXA 2A92A 5B64A 1ZWKA 4BLTA 2I2FA 5CCXA 3L4SO 1CZHA 5CEEA 2WKPA 3F5SA 3PDIB 2XUJA 1UFVA 3M4NA 4BE4A 3QY0A 4BZXA 3QUBA 1WOYA 3DQPA 3O0TA 1QZUA 1JT9A 2ZJ5A 3OJXA 3TQQA 1PJSA 1UZLA 1MQSA 2AFIE 1RP1A 2BWJA 4RS3A 4XIJA 1QBGA 2OLJA 4ADSG 2GJ4A 3GVHA 3NDRA 4HLUA 3EC1A 4MVJF 3KLOA 4PR0A 2HMWA 3TSOA 1GGVA 4HQRA 1Z2NX 2JARA 4C6RA 3ZJ4A 2Q27A 2BFBA 4LK3A 3ZCPA 3FYDA 4EVSA 1PNVA 3EASA 4ZU6X 1GPUA 3NXKA 2ZJ4A 3OCCA 5EIBD 2OOSA 3C5VA 4YAJA 1W5TA 1E0DA 3O8QB 5KWJA 4O0LA 4CKZA 4BGIA 1U3TA 3LHKA 1RZRD 3U9LA 3TLGA 2BI8A 3L0BA 1CZLA 2R7MA 1HFJA 3CZPA 3RC1A 3K4HA 1I2ZA 3QBTA 1BH2A 4P92A 2OD2A 2I4LA 2V9PA 3OQOA 2VCHA 2HFKA 3NLLA 4M86A 3RS5A 4M22A 1VMIA 2QP9X 2XVMA 4RYLA 3D8RA 4UTXA 3CA8A 4OK5A 4AP5A 2W8BB 5F2OA 1XZPA 3GA5A 3RS4A 3W9UA 4ZYZA 4LRQA 3IMCA 4J0CA 4N12A 2CHUA 1KI6A 4ZKEA 1Q0UA 3K8ZA 1GD1O 4CFZA 1AKWA 3E18A 3ZW7A 3COZA 1K7CA 4YWHA 3F98A 4ZVSA 4C05A 1DXOA 1SG0A 1HEYA 2GUGA 5KOIA 1RD4A 1QTQA 2QYHA 3G9XA 2NIPA 1DL5A 1VYVA 4XH9B 4B17A 1KEVA 4G07A 5KPJA 3NVDA 2PU7A 4KHZA 3V7YA 3GLGB 4G8CA 3N8IA 3KTDA 1RXEA 1J00A 1OUMA 1ZNYA 3MWEA 2X19A 3FPAA 2RAUA 2ZYVX 3GQBB 3HJGA 3VUFA 1IVSA 2V3WA 1IHXA 1NJFA 3BRCA 3LGSA 4TMTA 4Q0MA 1LXCA 1NTOA 1TZCA 3D81A 4ND3A 1IK4A 4U7WA 5A2GA 2NO4A 4B3HA 2IYNA 1XELA 4OU4A 3ZW9A 5HIAA 3D6AA 1RWMA 1UJ5A 1AC5A 4JP2A 4HTAA 1KEZA 1T8UA 2GR7A 2O8VA 2D54A 5AW6A 4YTEA 1BCSA 1Y1PA 3N0XA 4YCJA 1UZUA 3HCPA 1J8DA 2CB9A 1MC8A 4HFJA 5EE9A 1AKQA 5TV2A 2QTRA 4YGYA 4HNQA 5A04A 3QKSA 4BNTA 4E6PA 3AF1A 5HRAA 3A0UA 4IVNA 4PLTA 3G9ZA 3DC2A 1CQJA 1R5OA 2WIDA 2ZE5A 2ZJ7A 3LY7A 4N54A 4TS1A 4JYAB 2X1VA 1HYBA 3DOFA 4D9JA 2PUVA 4FT4A 4DMCA 1F8FA 4QRDA 4EYGA 4ENSA 3LGXA 1ZL0A 4R7ZA 3CI0I 5J5AA 1IVNA 1M6VB 1MJ5A 1O5TA 4C4XA 5CFMA 1LNQA 5EIFA 5ICEA 4EG5A 1M1ZA 4AURA 4BPBA 1VGQA 1KO7A 3A4TA 4BAZA 3GL9A 4JX8A 4LVOA 3GUZA 5JAPA 2XTAA 2F4VB 3EAFA 3BRWA 4I66A 2MJLA 1K8XB 5F3WB 2ZK7A 3QITA 3VQTA 4B7CA 3FMFA 4G9BA 4MKZA 5FOWA 1VHLA 5HRCA 2DE0X 3UK2A 5KVSA 2OMEA 3SKXA 3R3SA 2C9YA 8LDHA 1XVLA 2PQMA 3DFUA 4R0NA 1XJ0A 4DNFA 2B7LA 3RRJA 2ZB8A 2OCKA 4E88A 1E7MA 1WXXA 7YASA 4MV9A 3NOXA 5FWAA 2GD1O 5FEMA 1JZTA 4QXQA 2ZQ5A 5CURA 2VDLB 3CTMA 1E5DA 3LYLA 3OA0A 3LW8A 4XFKA 2JAQA 4QOGA 1PE0A 2Q8NA 3AR3A 1SCUB 3FSGD 2PCLA 1S2DA 3PA8A 1RABA 2NU8B 4AS3A 2CHFA 2A9QA 3C3BA 3L6RA 2BFFB 2ES4A 1KZ1A 2Y66A 4WY8A 3HBMA 4IVPA 2VDQB 1NBHA 1ZRNA 4TXMA 4MIYA 1RIFA 5SYNA 3H2ZA 1PSDA 1MQ8B 1U3DA 4FC7A 5ER9A 3P0HA 5EIOA 1U8UA 3FVWA 3ORRA 1RWNA 4I4TB 4PINA 1XCJA 3W2IA 4GD3Q 4JR0A 3EEFA 1K7XB 4MV8A 1S8FA 4FDLA 2XTNA 3V4VB 3ZD8A 1BXRA 2GILA 2Y1LA 1YBHA 2OOKA 3ZGOA 4EIWA 3VR5H 3SZ3A 3D8NA 3HCOA 3LCVB 1R0BA 3HXOA 3IO5A 3R3JA 3K0AB 1JLLA 4E46A 3MTGA 1NVWQ 5H4GA 1X1AA 4MROA 5J5VA 2PO5A 4YREA 1TPYA 1A8PA 2PXXA 5CX1B 4B46A 1I51A 4M55A 3GJTA 4KSBA 2HLDD 5GY7A 4EARA 4PYMA 3TRJA 2YWCA 1JR2A 1EGAA 3A11A 2JFOA 4YBRA 3H75A 1P2TA 3LQ2A 3AFOA 1U2SA 2A7QA 2EHJA 2P30A 2XUKA 1Q44A 1TCVA 5JMPA 3T3DA 1TJ4A 1NW9B 4M9SA 1AZSC 2FXVA 3WMWA 5G4KA 4B4VA 5JNUA 1LX6A 2C8JA 2OL4A 4U3JB 1CUEA 3EULA 3B6IA 3GUUA 2QP3A 3DAOA 3WLPA 3LVFO 3QXJA 3N7UA 1SCIA 1C4OA 5C1BA 2MR5A 1S2GA 2C7RA 1N78A 4MV5A 1ETHA 4LC1A 2W98A 4XZ3A 2DFKB 5FLXA 3UJNA 4TZKA 3QJ5A 3VPGA 3FWZA 4PGHA 3EC2A 1R4MA 1X9IA 3GGDA 4EVRA 2AG0A 1DAHA 4GGPA 4OHWA 4XX0B 3P45A 2YXPX 1SUCA 5EYPB 2GWHA 5JI3E 4O08A 5JPDA 3D0QA 1M8GA 1H3FA 1JU3A 5IAEA 1YR9A 4G0XA 2GCIA 3INNA 3A4NA 2ZW9A 2V7EA 1A04A 4FTWA 3U7QB 2BCEA 2O2CA 3IEUA 4HFMA 4NOMA 1VE1A 3CW9A 3NV7A 3PQFA 4QPNA 5LP1A 1ADGA 5KTYA 2P9YA 2J7PA 4KHPB 1C8KA 2P7HA 5FAXA 2BYTA 3ZD6A 2D1QA 2HCTA 4GLFA 3AZOA 3I8OA 4N40A 1JXOA 4ZHSA 4GLLA 2XGOA 4QDOA 1SD5A 1AXRA 1GUAA 1ZD3A 3FFBA 1PEKE 2Y27A 5JZ9A 4IDPA 2L42A 2Z2JA 4G0NA 1WPXA 1DCFA 1A4RA 4ZZ0A 1Q3TA 4JVOA 4WZAE 4FX2A 5CH5A 1YFLA 2Z56A 4YJ3B 4Q48A 3SCZA 2FUEA 4ZQGA 5DBHX 1XWIA 4MR9B 5FAKA 1N8TA 2KS6A 4HI0E 1VYTA 2CN1A 2I4MA 4FR2A 3WXBA 2DFPA 2WNHA 1CZRA 3AETA 1CULC 3A28A 3UPDA 3VYRB 4LWQA 4KN9S 4H7IA 4C7BA 4BQEA 4C2AA 3O6VA 3EVGA 2A5LA 3EVNA 4O4LA 2PRJA 5CEJA 5JFGA 3RI3A 4JP3A 4K0RA 4PCVA 3IT1A 2XUAA 3MCTA 2X8WA 4ZZIA 1SHLA 4Q1VA 5JC1A 4XYBA 1I94B 4OMFG 1KYVA 3DMGA 1EDBA 3IP8A 4I1RA 1YNOA 4JQZA 2GM4A 4FLMA 1U5CA 1BAPA 2IY9A 2CXRA 2PRZA 5DYGA 3ZWBA 1KZ4A 4W5JA 4Q00A 1LPMA 2AJCA 3L1HA 3BFJA 3VHQA 4BYMA 4L2IA 3WWCA 4HQNA 2J9FB 4W5WA 1GA6A 4ZDJA 3P9ZA 3W6UA 2E4UA 4PFJA 3HSKA 4XIGS 1UPBA 4O2AB 1E5VA 1TEZA 1BFKA 4G0PA 5L3RA 4L51A 1A9SA 1HXHA 4W82A 1K2VN 1Y8CA 2CHQA 2QG4A 3KHTA 2E89A 3SHTA 4YJGB 3OLZA 2Y1EA 4WGGA 1FSPA 2VUIB 1ZUNB 3O03A 3L5OA 5CIYA 4MRRA 1PL0A 1W34A 2ZCUA 2ZUSA 5DRYA 1EB8A 4MW4A 3VNAA 4I9UA 4IYRA 1U2DC 1LV8A 1YZNA 1ZD4A 2VK1A 4K8RB 3RWMB 5JNWA 3FE2A 5LDHA 1WS6A 1F0KA 3WWPA 2AC7A 4GXTA 3LUBA 4MR8B 3T4EA 1EMDA 2D2EA 2ZKIA 4EJ2A 1AO0A 4FGKA 3OQ1A 2OGFA 3I37X 3KOMA 1VOTA 2VOEA 2LTAA 1E5XA 4A0SA 4QEDA 4OB8A 3SNKA 2X77A 1UXGA 3CNQS 4NNOA 5F64A 3ZE0B 3ZG6A 4DG9A 3EWAA 4UQPA 2MYNA 3HA7A 4LJ4A 4OXXA 2V96A 1X92A 2EFDB 2IPNA 5D3QA 2J31A 3IE0A 4IKOA 4LYYA 4RTKA 2G63A 3E5RA 1M1XB 2REBA 4HAVA 16PKA 3RV3A 4BEBA 4EJ6A 1NVVR 2RH5A 4W7IA 5DT2A 5FUYA 3SC6A 3DKKA 4OY3A 3CYFA 3T5BA 2DBRA 1TCAA 5IM5A 2DWCA 2ZB4A 2DUNA 1DEAA 1OCEA 4KRGA 1FW6A 3GFRA 2FPPB 4R01A 4N0QA 3V97A 1D7OA 4TN1A 1FMLA 1X7GA 5FFMA 5IJ0B 2PQ6A 3NQ41 1UADA 4IRUB 4MS3B 3VAZA 2G4CA 1F2DA 4KGDA 3DBVO 3ML1A 4Z3KA 5B1EA 2IHBA 1JG6A 2Z2KA 2P3QA 1FQKA 3TCKA 2ON6A 4W8HA 3OKCA 5L3QA 1OFIA 4D8WA 5JSQA 4YYZA 2YZMA 4Q4CA 1R6VA 1KH2A 1RI1A 1TMKA 4FE3A 1ZH6A 5CB6A 5A6SB 1EE2A 5THKA 4OKSA 2YS7A 4BWGA 2IYXA 1ND5A 5EZ6B 1GFZA 2RIPA 1VHDA 3PCRB 1XTQA 4MP6A 3KKZA 4D5EA 3RFTA 2FQ1A 3DMPA 4AZVA 2MSDB 1BGVA 3DHVA 5I9IA 1KQFA 1B6RA 1HGXA 2P8SA 4TVBA 5BMVF 1K8ZB 1H6AA 1QH1A 3IEKA 1GG2A 2FZ4A 5EJ2A 5TGDA 3P9YA 1L8LA 1JJFA 3A3OA 3U31A 2BLLA 1SUEA 3ET5A 2IVFA 2QDKA 3ADOA 2GERA 2QE7D 2V8BA 1O96B 3M2TA 3K9QO 3MQ2A 5AVXA 3WNVA 4CLOB 4ED9A 5A7FA 4JGBA 2JB9A 4PLCA 3T99A 1DC6A 4MKFA 3DFMA 1XLUA 1D0VA 1UZNA 3UOGA 1N2BA 3FAZA 1GKIA 2O14A 3ANNA 3FLBA 4FFDA 4U1RA 3WAJA 4BB9A 3L82B 1Z08A 3M70A 4XFDA 1PEYA 4HQ0A 5JBNA 4BLQA 1EVKA 1T3GA 4N3AA 3GEMA 4DXDA 1GTRA 2NQ2C 4FEYA 4L3VA 4WKOA 2XRMA 3P1JA 4UD6A 1K88A 1VFPA 3CPJB 4E5KA 2EBHX 1MAHA 1E3TA 2YWEA 3QUAA 2HF7A 1PVOA 3FRIA 2IHNA 3W7BA 1HOXA 1NBMD 1SQGA 1WX1A 2QUBA 1WA5A 3AP3A 3H8VA 1W94A 3IBGA 4KI0A 4BKQA 3QU9A 3UJDA 3ADDA 1Q1BA 1TF5A 3FNGA 3FDFA 5IZCC 2XD4A 1FRNA 2J3KA 3VTKA 2DPMA 1CQZA 2QGFA 4A23A 5L3SB 2YV3A 2P5UA 3C1OA 3REGA 1FU7A 4Q4DA 3WAGA 4Z9BA 1BMDA 4JJZA 2GW4A 4M4SA 3E9NA 1N1GA 2OGUA 5KNCH 1JG7A 1P2GA 1LSOA 3QKIA 4QUDA 3WLAA 2AYXA 2VHEA 4B3JA 4H6PA 3FWNA 3EPJA 5E4YA 1FDUA 3C5CA 4QQRA 2SICE 2BFEB 3OZCA 1LC0A 5C1OA 2VPYA 1NVGA 3EBPA 2H5JA 2BFCA 1V0JA 4QUEA 4RHXA 5EXDA 5LUBA 1O9BA 4C22A 4NRDA 2HWXA 1JLRA 4FT2A 3PQ2A 3I42A 1JTVA 3DEAA 3VR5D 3W1EA 1W75A 1PR5A 4C3VA 4OXNA 3PQ6A 4LJ8A 4QARA 1WB5A 4ID3A 1DUVG 2J0SA 4JENA 4HAWA 4KAXA 3RLIA 2VT7A 3ELUA 4D4LA 4CTNA 2EERA 3HCFA 3KVVA 3GJ0A 3RAEC 1EESA 2E1PA 2C00A 3K3PA 1ZZEA 3MTQA 2DQKA 4GR4A 1Q15A 5DJ5A 3X43A 4F3NA 3AHHA 1EM8B 1YBFA 1C4XA 2GLTA 2O0JA 3M1LA 4LNUB 3U0BA 2C95A 3JATA 2DSTA 3WLRA 1RJ9A 2XECA 4I8DA 1JHVA 1I5OA 3QYAA 4OP1A 1XTUA 4K6OA 1QONA 2GKOA 2GJAA 2FVYA 3DLCA 2VUTA 4NYJR 3ZY2A 3CFFL 1QP8A 2FR8C 1LS1A 2Y2UA 3FNIA 3G6WA 1EG7A 1PGOA 4IS3A 5DGTA 1ORWA 2FWAA 5FO1A 5FTMA 3V9PA 4F9TA 1SHZA 2G5TA 4EAQA 4HB0A 3P2JA 4MAAA 1XPUA 1E1RD 1FUEA 3JZIA 3FDXA 2Q6VA 1X1EA 5AXAA 1SR8A 3TO5A 2P2CA 1XRLA 4B3FX 4LQCA 2Z4SA 2OFXA 3DTTA 4GQAA 3IR6A 3AY3A 1QHYA 1B00A 2J45A 4HGPA 4I2VA 1YZTA 4ESVA 1JFFB 2V0NA 1Y5LA 5CLQA 5JCOA 3T5TA 3AF6A 1ZCBA 1SEVA 4RVOA 5DCLA 5LWQA 1KP3A 1RAEA 4AJHA 4HJRA 4FCVA 3P5SA 1EUDA 3JQRA 3GUHA 4FFMA 2R6ZA 4KN5A 3KQMA 2G2SA 3DNFA 4UCFA 4CMAA 3TR0A 1K9VF 2XNJA 4XARA 5KSYA 2OV3A 3I5XA 2IKSA 3G85A 4JQOA 2JGKA 1ES9A 1YH3A 2X0RA 1EVQA 3W6NA 1PR2A 3WGIA 3A9UA 1QYIA 1FOEB 3OIYA 1YOVB 1E9AA 3OOSA 4W9NA 3Q2OA 1KVQA 2WUGA 2A0YA 4QQNA 1NW3A 3Q3JB 1JIVA 2CWDA 1SZCA 2DULA 1Z4PX 2ZAYA 4CMEA 3L8MA 4QHSA 1NUQA 3MG9A 1EFUA 2DPHA 2D4HA 3BXEA 3F6CA 3AXTA 2VO1A 2UYCA 1Z39A 3L7LA 1SBIA 1UXKA 4MMXB 3U4MA 5BQOA 3GJXC 4E2YA 1JEQA 1QHXA 1EB9A 2ZBPA 2Y6UA 1RRKA 5DXAA 5T4FA 2DYKA 4FOLA 5I7FA 4ZRMA 3T7JA 2ECQA 1X7XA 5ALXA 3ZHSA 1NLMA 3FN4A 4GG1A 5CLJA 1VL5A 1R15A 5HWSA 3WGZA 3PTZA 1Z2OX 2OPHA 4A2CA 4OLBA 1TDJA 2H1OA 2W6ID 1S3SA 4Y9RA 4M9RA 4HB4A 5THXA 5KNBA 5K3SA 4M9UA 1SKMA 3Q9NA 1LD3A 2LVBA 3NB0A 1ZD9A 4BOYA 3N07A 1GRQA 4TM7A 1KF0A 4B3CA 3OZFA 5H68A 1RBYA 1LSJA 2P9HA 5K0LA 1T4BA 1L5MA 1NQXA 1UKAA 1WWKA 1V16B 1Z7GA 2HF9A 5LOVF 1CRLA 2UUCB 1XTJA 3IQEA 2QZSA 5AW8A 1XAGA 3LS2A 5HIJA 5KQSA 2AZDA 3IL2A 1QQBA 1A5TA 5AHXA 2O2XA 3E3LA 3ROEA 2YWFA 3N39C 1GUYA 3KZKA 4LJLA 4NIMA 3TJMA 2G16A 2LKDA 3IEPA 4EW1A 4Q3EA 4YIHA 4RANA 4RJKA 3TBHA 2X1MA 3F3KA 2DSNA 4O2AF 1Z4QA 2JLAA 4ALKA 4E14A 2BFMA 2JZOA 2B78A 2XE7A 5EWLB 5HQJA 3PQ3A 2P5YA 3IBFA 1R37A 2V4MA 2GWRA 5EFZA 4Y1EA 1FYWA 1ZKMA 5AVKA 3BZBA 5JTTA 3H9UA 4H1UA 3S1AA 2ZSIA 1EA5A 1CS0B 3DWEX 3UF0A 4NI5A 1TRHA 1M5RA 5FRDA 2PUJA 4JI3B 1NT2A 5DGXA 5DHSA 1OYYA 2ZJYA 3C98A 3F3MA 3KKLA 3L0DA 4LBWA 4R84A 5HMMA 1UWLA 2BRUC 3ILSA 5HA5A 3UW3A 5IC4A 1YB5A 3UKDA 1TYEB 3CNEA 1Y1KE 3LWBA 5FTKA 3L0CA 3OZAA 4KX3A 4NMLA 2AQHA 4KYTA 2UUPA 5DBGA 1FDRA 3PFFA 4B5KA 1NXPA 4DZRA 2XUOA 4MUMA 4WXMA 4OJTA 1IZ7A 5EP2A 3DOUA 3WYBA 4DM3A 7ADHA 3N8NA 1VPVA 1E5TA 3CUKA 4LISA 1M0TA 3GFGA 1H65A 1ABFA 4KDEA 3EG9A 3O92A 1U9ZA 4X61A 5D85A 2F9FA 5H83A 1O5OA 3FFAA 3LVRE 4KO2S 1V11A 1AIPA 1ZP6A 3PNLA 3LU1A 2GBPA 4GT1A 4KQ9A 1UKYA 2ORYA 3D6VA 4OHXA 2BSAA 2G1AA 2C03A 3AQIA 3CO0S 4BCCA 1VSTA 4WJZA 1ORHA 2HNBA 4HF7A 1GG9A 5GV8A 2ZDGA 3QJGA 4OHFA 4PHGA 4MWEA 4HBGA 2OB2A 4G1UC 1H6BA 4AYWA 2X76A 1F51E 4PYNA 4JT9A 3WISA 3CWCA 5NULA 1WY7A 2XXAB 4G41A 1PYGA 5KB3A 3IIIA 4LHXA 2Z1DA 4RD6A 2NVOA 3DMTA 4ENWA 3N9IA 3C6ZA 2NM0A 4C5AA 3SC2B 1Y4UA 4OQFA 2G3DA 2G09A 2FOLA 3TVYA 3FOFC 1JVSA 3AWIA 3A9SA 1SRQA 2G1JA 2RGDA 4Q3BA 1H05A 3DTVB 3BE6A 1WW2A 1O03A 3BORA 1I4LD 4Z3OA 3HZRA 4JJGA 2AKAB 4FOPA 1G8FA 1M2WA 3IYLW 1GPKA 3ETJA 3GIWA 3H8SA 2WU0A 4DFDA 1CJVC 4MUFA 2NO1A 4WADA 1YU9A 3PUIA 2HBQA 1GGMA 2JIQA 3SLGA 1HT1E 2WKQA 3AUYA 2Z2YA 3ILXA 2WHPB 3PUXA 3D7RA 5FTWA 5HFNA 1WXHA 5C3UA 3QXXA 4PGFA 5TF4A 1WXWA 1G3MA 3IB3A 1C5KA 2I2AA 3TLJA 3BEDA 4POOA 5C80A 4OX9B 2ZJ3A 3L41A 1I7NA 4BO1A 4HQKA 3PNPA 1QORA 2A6PA 2R2AA 1XN1A 4NYMQ 1V47A 4OUDA 3V8PA 2Y1KA 2C5LA 3QOWA 4MKGA 3DHWC 4QXMA 5KNCD 1JDVA 4A8JB 4FM9A 3MJRA 3OQJA 1YONA 2VWGA 4LV6A 3C4VA 3RBVA 1JFSA 1ZD8A 3G8YA 1U7DA 4C5BA 2VRWA 2EJWA 2HHAA 2MTBA 3R09A 4G1CA 4GZMA 5DEOA 4CI9A 4PSVA 1UUFA 3PPWA 3WK9A 4MLPA 4ZQEA 2ODWA 5A9TA 2P78A 1QZ3A 2AUMA 1ZCJA 3HJBA 2P90A 1GPNA 2F4NA 4WESA 1QCDA 1JUDA 1L6RA 3ZIDA 5KUTA 4R7GA 3EEBA 3OPMA 2FV8A 2O23A 4R81A 2DFLA 1WCXA 3NRJA 2QQ0A 2WZCA 4QYIA 2X42A 4KR3A 4KR7A 4S2UA 5JHHB 2NXCA 4IV0A 3E7WA 4XD2A 3THSA 1TTPB 2L19A 2X6TA 1EVZA 2GBFA 3Q0IA 4HLUC 3VISA 4ITRC 2ANCA 1E2DA 2KB0A 4CRWB 2ILVA 4F46A 5FV4A 3SVTA 1PGQA 4Y30A 1IMJA 1CJMA 1UT8A 5IC5A 4RYDA 4P82A 1QIIA 5FPPA 1TTQB 1JT2A 3C6KA 2PL9A 3WL5A 3LY8A 4JJEA 3V55A 1PAUA 1V5FA 2QJOA 3R24A 3A1TA 3R0XA 4CM6A 5A4AA 4ARCA 3CJQA 2O8DA 5CPBA 1W5FA 3KD3A 2X3YA 3ST7A 3TI7A 2PXHA 4E5NA 1KU0A 2O2YA 3O83A 1HE1C 2IW1A 2PYDA 4PPYA 3S8YA 1RPNA 2F1RA 1W2GA 2FH5B 2L69A 3C24A 2H65A 4UPDA 1YF3A 4Y2GA 1C1HA 2GNPA 2BMVA 3KJZA 4C03A 1QYCA 1RLTA 1PK7A 1YDEA 3M8KA 5DV9A 3SVZA 1JPNA 4ZAFA 1ONSA 1TK9A 4LE0A 1PJ8A 1SG9A 2BKLA 5KVAA 2GAIA 1N9KA 3TAXA 1G5PA 4QFMA 4BVKA 1JKFA 1UMCB 3GDGA 4I81A 4D44A 4DQDA 1JSRA 3VYUB 1IZ9A 1JJ7A 1KYZA 3IIEA 4BJHB 4A15A 3WDMA 3EIXA 1SKAA 3CVVA 4DWVA 5LYJB 2NO7A 2Q21A 4QOSA 2X7XA 4M1KA 5LD2B 2HO4A 1HTTA 3TX6A 1MH9A 1UPXA 2FW1A 2NV2B 4ZO4A 3W5HA 5C0OE 4E5PA 3FGNA 3AWDA 4AG6A 1APBA 3RYIA 2O3QA 3UHFA 1CE8A 1TXGA 3HYSA 4KVZA 1FFXB 2QN1A 2ZJ2A 5CNKA 4RA9B 4BFWA 1Z9BA 4J2OA 4BB5A 1UWKA 1BC5A 1LZLA 1YGYA 3LDUA 1VPTA 4O2RA 4C4YA 4DMGA 4CLRA 1G0OA 3ZX5A 1RNLA 1SOAA 3LT2A 3VGJA 4NNJA 1J56A 1CIPA 5KAPA 1SULA 1VE3A 1HLDA 4ENRA 4IFTA 3HR7A 2ATIA 3OWHA 4YQEA 3NAMA 4IDCA 3FNQA 1N2IA 2QY6A 4NLLA 3PXAA 1EHIA 3HO6A 1VZ3A 4XGNA 3FNHA 2PKYX 2ZBQA 4LTMA 2GBGA 3BA1A 4IQ0A 4QDXA 1M73E 4P4SA 3E4CA 1VIDA 3KE9A 3LQFA 4PRYA 2R65A 5JQWA 2VH5R 1FFEA 3O38A 3BRSA 1S96A 2UVPA 5FUXA 3KUKA 4BRUA 4WI1A 2GD6A 2PNFA 4BB0A 2PYZA 5DK6A 1A7JA 2IOFK 3ETLA 5HS6A 2I29A 2I78A 1YS6A 3HJTA 1Z3IX 5EQJB 4WFJA 4DT1A 1AGXA 2BFDB 3B70A 5FLEX 2EGHA 1ZGCA 1KI4A 1MD9A 3RK1A 1ZD5A 4EFMA 1HYEA 3JARA 2DEUA 3DL0A 2Z6VA 3QBVA 1GPBA 1RXUA 5CLHA 2CNBA 2OHFA 4TMYA 4R2XA 2Q5EA 4MKRA 3KJXA 1NBME 1A82A 2HX1A 2Q3FA 3ESAA 4Y2YA 3PHIA 1KGSA 5C8VA 2JKZA 2BEJA 5FFNA 3PC4A 3ZC3A 3C7CB 3PNQA 1O57A 2XWQA 2WYHA 4XWYA 1TZJA 5AXDA 3L0YA 4ER5A 4PYKA 4JC5A 3R3VA 1L4UA 3REQA 3GCGA 4YI3A 3H4VA 4LWZA 1E2PA 1YDGA 4NJMA 3SVLA 3INYA 4ZKDA 3DH0A 3CH4B 2XIJA 3QBDA 1YCFA 3ZHYA 2GASA 3I1JA 4Z1OA 2WJAA 2ZBDA 1YUMA 4KE8A 1TW2A 2ZRBA 4ZV9A 3B82A 3TXAA 2D06A 2J0EA 3HVUA 4DJDC 2H59A 1A98A 1QS0B 4OL0A 4JBGA 2QY9A 3KTFA 1J49A 3KR9A 1EFLA 2JFGA 1EJBA 1BD4A 3AB7A 4J90A 1N5OX 4ZO6A 3SFZA 1D1TA 2JW5A 1GNVA 3U4DA 1DSSG 3OZUA 4BNMA 8AT1A 1FXWA 3ZD7A 2BV3A 1OFVA 3M5DA 1W5SA 4C0HA 1NV9A 2ZR0A 1PIWA 2IS4A 4Z4EA 3VNSA 4ALMA 2O4UX 2OAQ1 2WBLC 4JXXA 2FSVA 2HWYA 4XPZA 1CB0A 2VS1A 3SYKA 2WT8A 3EGCA 1FUUA 3AERB 3OURA 4AB1A 1TAUA 2QUAA 4Q3NA 4L85A 3HSSA 2QRGA 4UEOA 2NO0A 2QTVA 3LCUA 2CLOB 3KD2A 4QNNA 1P0MA 4YRSA 4L6IA 4KIUA 4ZCQA 4Z51A 2B8EA 4JKIA 2Y0DA 5KHOC 1WF6A 2HJ9A 3MMSA 5E6SB 4BNYA 3WIVA 3H3JA 4BFVA 1RRMA 5U1PA 4L50A 4ZTZB 3PPVA 3G3EA 1C7IA 1EYZA 2X5OA 2G4VA 3HU5A 3P0FA 4G1FA 4IGIA 2AEEA 1Z5PA 4L8WB 4LRWA 1VA5A 3QV1A 2B4RO 4MZXA 3GD7A 4ARBA 1GL6A 1V1RA 4BZZA 2UUBB 4LF4B 5AVRA 4WRRA 1VQ1A 2DU8A 1IQUA 3AL2A 2GOYA 3K6KA 5DM0A 3TNJA 1DAMA 4IXNA 3TTTA 4CF3A 1C0LA 4CWAA 4F7WA 2FW6A 2J6HA 4OI1A 4NATA 2JNWA 1QQ7A 3QNWA 3AQ4A 1IWOA 2EJTA 3BJEA 2JIDA 4D4KA 4WJLA 4BCDA 4YAKA 1P4SA 1SD2A 3M5WA 4FGSA 2O8FB 3IERA 3LUPA 3MWGA 5C81A 1QDUA 2BEKA 4CV2A 5C8DA 1Z8NA 3BRWD 4PBTA 3PFWO 2IS2A 3MMXA 3R0QA 4QTUB 2CHGA 5DMHA 3I5MA 5A4KA 5JCJA 4C89A 4JFAA 4ISBA 1NUHA 3HBNA 2ORED 2XQFA 4LFCB 3DXZA 2P91A 5K3FA 1M1YA 3D8TA 4R8KA 5BWOA 3QE9Y 2RBGA 5FBQB 1AOXA 3K5WA 5ALUA 2C5SA 3WICA 2OCDA 1Y6FA 3E53A 4R9SA 4E4RA 1N2JA 2FU5C 4KIWA 2J30A 5BYJA 1NDUA 2EWVA 3VYSB 1KMHB 2H5EA 2OCXA 5IT5A 1PFUA 1QFJA 2JLRA 3KXLA 4JT8A 3P0IA 2AG8A 2JBAA 4J49A 1CRQA 1Q17A 3I5YA 3EPPA 3GJ6A 4NYMR 4PLZA 721PA 4F1WA 4NBTA 4WA8A 3ZWPA 1YQDA 4I2NA 1LA2A 4XA8A 4YHBA 1K6IA 1NRJB 2GHTA 4X7BA 5FBHA 2C2WA 1F5NA 1GG8A 1HFKA 1UXOA 4BX0A 2AFHA 4AP9A 3H97A 1AZTA 1ZIDA 4HWGA 1NLYA 2IELA 4TWAA 3QIVA 4EPRA 4WBNB 3IKMB 4KQMA 1TVEA 4BV3A 5ICMA 2GPWA 2IYOA 3ZIUA 3NIDB 1U9CA 4LYJA 4UVEA 4M98A 1TA9A 2CGEA 2WIJA 1HE3A 3EY9A 4UXJA 2G4LA 2PWPA 2ZETA 3NWJA 3BK2A 4OBWA 1X8KA 5D3KA 4B76A 4FSDA 1JDZA 1GPLA 1FNNA 2EW2A 2PN1A 2YWDA 3HWWA 4JITA 1LB1B 5K6AA 2Q5CA 3SHQA 1NUTA 3MD9A 5TMPA 4OI0A 4V3CA 1D1SA 2AG6A 5KREA 1T3LA 2JD1A 4HDNA 5E7MA 3JWEA 1SCNE 1PFWA 3KALA 1J20A 4IIXA 2O52A 4PTLA 2G5PA 2HGSA 4BRZA 3DB1A 4AYTA 2W00A 4PZLA 3GDHA 4KB5A 5KYKA 2G40A 3S8MA 2YDXA 1L7DA 1VMEA 2H31A 3T6KA 1IN4A 4MGZR 1L4GA 3GT4A 4C4SA 1U7TA 2V4ZA 2OGSA 2NQTA 2KLHA 4U6SA 4AUMA 2QENA 2Z9DA 4LVUA 3HUEA 5DHAA 4ZMRA 3UPUA 2BF7A 2BMJA 1XU7A 1YCGA 2GHQA 5M5BA 1I8TA 1E9CA 3FDZA 3G88A 1H4TA 2Q0SA 2XQGA 2XADA 2FDRA 1RWKA 4ZOLA 2WKWA 3NNNA 4AQDA 2AV6A 2HLHA 1XU9A 4D82A 5AW0A 1MN6A 1SQSA 3UMCA 3OZIA 1X9GA 4XWGA 2A9JA 1N7HA 1VL6A 4M9XA 1XTIA 5ALEA 1M2OA 3UAXA 1JQDA 2WWYA 1DKNA 3NTVA 1J8MF 4HTFA 3RYCA 4J91A 3KWLA 3WP0A 1G7CA 3K0SA 3KE8A 2WSBA 4IG9A 3LDAA 1W44A 1DTEA 3B1JA 5AJYA 2R84A 5LU9A 2H48A 1Q0ZA 3VHRA 3MUFA 3SG0A 1ODFA 2ZJOA 1NMYA 3CGGA 2G67A 4F2PA 3V4SA 3HN7A 1E5LA 1QDLB 2FPGB 2J7PD 4L5JA 3C4QA 5JLAA 1PZFA 3TX2A 4C6SA 1QB8A 2WILA 3I9MA 4DY6A 5D5PA 3CPEA 4IDGA 1AF7A 3GO4A 3UAGA 1YUNA 5E2BA 2L18A 3GLFE 1Z8DA 1XX6A 3UKOA 3FYCA 1Y9DA 5AHWA 2JI8A 2EQ5A 2CY0A 2FI1A 1JWBB 2OQIA 3D8SA 3M6FA 1Q0LA 3PHJA 4I8IA 4C06A 2I3DA 4XQCA 1Z37A 4IIGA 2IOYA 3ROGA 2A1TR 4TV9F 5AQEA 5IX8A 5ULLA 2CE2X 2H2HA 3CUTA 5HOEA 2V45A 5JNSA 3EUEA 3U4GA 5LMCA 4BCBA 4ZCIA 2RHTA 4ZEXA 1XNRB 1JXAA 1N6RA 2IEIA 3HO8A 1UM8A 3DFKA 3IOYA 3N8DA 4J0GA 4DILA 3WLLA 2ZCJA 3OT5A 1E2LA 4YONB 2IXDA 2PX3A 1PK9A 2YWHA 3QHAA 1DADA 4PC3A 3V4ZA 4WUVA 3S6JA 1BROA 3C1TA 3W7VA 5AD1A 3H5VA 4UU8A 1H3NA 1VGVA 4M1OA 1JAHA 4AFNA 1PT8A 3IR5A 4H7EA 1RBZA 2FLKA 5KNBH 1G20A 4LSGA 1UFRA 3DV2A 5HZKA 1KEEB 3DAGA 4GX5A 1IPHA 4Q4JA 1GU0A 5HFAA 3T0FA 1E8MA 4NULA 4WDQA 5DF1A 4RF4A 1KFCB 2QTHA 1TM5E 1AK2A 5HCNA 5CFLA 1G59A 2E4XA 4P93A 2AC2A 1TEVA 4M7OA 4RTNA 1WLYA 2W90A 4FSXA 4X44A 4K9DA 4LDQA 4DNXA 1Q1EA 3AIIA 1J25A 4IINA 1WUYA 3T5PA 3OEEA 3ICQB 4RW0A 1X13A 4UTPA 2G8NA 2HIGA 3IEXA 1KY3A 2PSSA 3B1YA 1JLMA 4HWRA 2YJ4A 4W63A 4ZVMA 3SOPA 1E59A 3KLBA 3LUGA 1XVVA 5ELLA 3B1ZA 4A92A 1X1BA 3H1BA 3IHTA 3OQPA 5EI5A 4DOMA 4LJRA 3CISA 1XZHA 3RS2A 1HLPA 2ZRHA 4BLOA 4D0GA 3NBQA 3NMUF 3T15A 4DPLA 3HR8A 3B5IA 2EBFX 3TCNA 2XYHA 5FDFA 5E6UB 3OE4A 3RS7A 3GPCA 1CNEA 3GJ5A 1GTL1 4JT2A 4OHZA 5CB4F 2F43B 2NSLA 3W0LB 4ZJUA 3RVOA 1L7PA 4AZ0B 2XY4A 3AESB 3EXFB 3FZGA 3O1LA 5F3DA 1ULUA 1ECCA 3TW4A 1IOWA 3WK6A 1ZMTA 4GDFA 1NU6A 2AYZA 2LCQA 1ESEA 2JIPA 3STXA 4AX8A 3PVZA 4UOZA 2RB4A 5LA6B 3U49A 7REQB 1JWLA 4LPSA 3LC0A 3UJPA 2IPAB 2WSYB 2XYRA 2II6A 1I2BA 4O4IA 1HDZA 3GNQA 1SBCA 1DEKA 1RRVA 3WS7A 5BPFA 1K6JA 2NTVA 1SVSA 3L7NA 1E9VA 4B71A 2ZT5A 2OV4A 4RD1A 4TL6A 3EZLA 3JQ7A 1E2QA 3OUZA 4GNKA 3RBXA 1KSJA 2ZAMA 3VTZA 4FJ1A 3DP9A 3SSNA 3A6KA 5JS8A 4PAOA 1H9BA 3SEFA 4BBPA 2IZ7A 3CF4G 2ACEA 5ALJA 1DTWA 2ODTX 2WU3A 3I2HA 2J3MA 3TLKA 1Y8QB 2PVPA 4Y8VA 3NNDA 1GLVA 1J70A 1XA3A 1UPCA 5AVJA 3V8NA 2CVFA 2JLWA 4GM0A 2YYSA 1NMXA 2F59A 4ND8B 4DPKA 2ST1A 2NWQA 1KY4A 3E1KA 3ZGNA 1KR2A 2R62A 2XYQA 4DABA 4EMTA 3UY4A 2YN4A 1ID1A 2JHAA 1MT3A 3PDUA 5ALHA 4WOKA 4GP7A 3BIJA 5ESRA 2LWIA 3AUJB 3EIWA 2ZYSA 4G8DA 3H5NA 1EE1A 4RH0A 1EUCA 1LBIA 4MWGA 5JZSA 3VPCA 2PGNA 2BKEA 2XDQB 2DHDA 2FW8A 1QO7A 1V7CA 3DKRA 3GNSA 4BBJA 4YRFA 3I61A 4KPYA 2ZJBA 4X1IA 2P5SA 3RNOA 3KG2A 4TKVA 4LZZA 1DELA 2W83A 3OIWA 1O89A 2C2GA 5TQ0B 5AVVA 3V7NA 2JIZA 4BMOB 5I3CA 1Y1RA 2UAGA 2TMKA 3K5IA 4OI2A 4QQFA 5EHXA 1NNSA 1CUDA 3JAWB 3OCWA 4D3YA 1G38A 1S2IA 2GVDC 2H9AA 4P3NA 5CTJA 4CFYA 4RL4A 4ARVA 5IWAB 4N3NA 4C3ZA 2BI7A 3SJCA 2O48X 3I9FA 5KVQA 2HK6A 2F64A 3FGOA 1OVGA 2ZE6A 4JB8A 1W85A 4DV7B 1JVBA 3KQTA 4US2R 3MCWA 4Y2VA 1H4QA 3W05A 1X80A 2J32A 3GRKA 3ZV5A 1X15A 4ZOAA 5TMEA 5CCDA 1XA0A 4L7QA 2MMGA 4EG7A 1KWGA 3U09A 2VNKA 2YW2A 2Y6VA 3T4UA 3NHUA 4JBHA 3KPUA 1T0BA 3ND8A 3QUQA 3U56A 1XZMA 1CUZA 1NSTA 2K87A 4IH1A 4TZTA 4E94A 4HJXA 3QUSA 3Q40A 4M99A 1P5FA 3AR5A 4UBLA 1DQNA 2IWRA 3ITKA 1HDCA 1KSHA 3VHLB 2IZOA 4PGMA 3CEHA 1W9HA 3FVRA 3GZNB 3ZI0A 4KLAA 4REOA 1GG5A 1XT6A 1VA4A 2WFZA 4N0MA 2GNAA 3RC9A 2ZBFA 3L18A 5E9QA 4KOEC 4I1SA 1XRSB 1I1QB 2ONKA 2XMGA 3EFHA 4R1QA 2VC2B 3WYGA 2J6BA 1IG3A 4WN9A 3V5NA 2F6RA 1GDDA 2VPIA 4W9NC 4XJVA 4EY4A 4LYEA 4BVHA 3IRUA 4BY9E 1SUWA 2I3BA 2H1HA 4X7RA 1AUVA 1Z6AA 3AY0A 4HDSB 1LU9A 2Q4OA 4D7AA 4Z4HA 1P75A 4CEIB 5CFQA 3ZVNA 2F00A 4HRYA 3A14A 2QD3A 4MARA 4Z4CA 3WB0A 3DE0X 1KYTA 1Y6ZA 4ZTUB 1T9BA 2DY1A 5ARCA 4ZGBA 2IX3A 1STOA 1G5TA 1KJJA 1DV2A 3H17A 1QVWA 2PT5A 1BD3A 2X22A 3AUTA 4N3BA 5ALYA 5EHNA 2FSIA 1ZK4A 3E22A 1QH0A 3IA2A 2WAYA 5G1NA 1Z7BA 4WBNF 1T5LA 3DLPX 8MHTA 4MS4B 4RMHA 1S6YA 3H1AA 3W5JA 3ZDEA 3I62A 1N9GB 1CY7A 1GL3A 4RF2A 5JZVA 1YO6A 2H1FA 4EY5A 4AKGA 4PLHA 3HXQA 1RYHA 4G23A 3EF1A 4YPVA 1K6MA 2PKEA 5CDGA 3OTWA 4FIDA 3MINA 1TAHA 4OEHA 5HCUA 1H2RS 4A5SA 2AIRA 1SUDA 2PJUA 4FD3A 4MA4A 1BHO1 5JS6A 1LLUA 5K20A 3U44A 2CSXA 3EXEB 4QTTB 2WTEA 3DOOA 5BO5A 1U7PA 2R1TA 3U37A 4LYDA 3AY7A 5P8WA 4G0MA 2HA5A 3BGOS 3BWXA 3PT5A 4R3UC 4KVGA 1N0IA 1IPEA 3GEEA 3AOEC 3S68A 3W5AA 3LBAA 1HPLA 1CJUC 5EFOA 3RF7A 1D2GA 2BBSA 2HPAA 3GZTB 3KR2A 4UEKA 4B6GA 4DLSA 2RJ3A 5CEFA 2VTEA 3KYDB 4IQFA 2A58A 3FKSA 5M2QA 3EA0A 1VI6A 4FR0A 4WN3A 2EKQA 5HEKA 2OCGA 2BEUB 5JDIA 3CJTA 4P38A 5DH9A 3UENA 1O08A 3QX3A 1YS2X 4YLEA 3D7SA 2YVKA 3B9BA 1WM1A 3SJAA 2GX6A 4G3XA 1V2HE 4E09A 4LF7B 3HR4A 3OIUA 3SZOA 3WNBA 2QSYA 2PL3A 4ZZ1A 4F4JA 2VP6A 1I1HA 1NOIA 3VM6A 3E3AA 3HL0A 3T4XA 3USCS 3I9LA 3TS1A 2VKQA 1H5NA 1O0SA 4R8MA 4NZ9A 2M6RA 5IT4A 4A0RA 3WHPA 2QN3A 1WOMA 3C3JA 3N6VA 1HQCA 4WZBA 4PRKA 1X1DA 2NV6A 3OQIB 4EQ6B 3DEZA 1T5IA 5K3CA 5T7BA 4GE0A 1F48A 2O2JA 4FMPA 3NDBB 1I33A 2HQBA 1E18A 1N5MA 4HWOA 4Y6QA 1MC4A 1D8TA 5DBEX 1BGWA 2O3UA 2A14A 4YPOA 1RC8A 4TYYA 4GPBA 4Q47A 4W99A 1PDWA 1MG5A 2E0IA 2Q8PA 2YOHA 3GJYA 4V0OA 5H1YA 3RT1A 1PZNA 2QK4A 4DR3B 3IQFA 3AVXA 1QPBA 2IIPA 5KBYA 1QKKA 2RC5A 5G0UA 3WK7A 5KNBD 4MP3A 3D3JA 2BN4A 4HUJA 2VF7A 3CUYA 5EZYB 1CXZA 1T1EA 4TS3A 3DDOA 4P5EA 2V98A 2OD9A 2C0PA 3WGJA 2HZ7A 2E4WA 2G1KA 1WPGA 2WTAA 1N1DA 1RYEA 2FZGA 2I7DA 4HNRA 3ZZNA 2J3HA 3P2KA 5J2TB 1UBKS 3CR8A 3VI3B 1WMFA 1XYGA 2H2AA 1D0SA 2Z4RA 3JX9A 2IS1A 2HJWA 4URXR 3SX2A 1E3WA 4R05A 4O29A 4R5HA 5FA5A 2FEOA 2ZIZA 4JWKA 2PBRA 3RUHA 1GGNA 3LAWA 4MYDA 2QIOA 2W6OA 1M2VB 3D0RA 1WAMA 3DMTC 3F6YA 3FDJA 4Z8XA 3U3MA 3H05A 3TZCA 2HYIC 4X7PA 2WAMA 3C3CA 4DCGA 3LPMA 1XBTA 1RJEA 3L40A 3OTGA 2HDOA 1EPUA 4QG7A 2VDVE 1P1FA 4REQA 5DWVA 3DEJA 4F5WA 3HA5A 3E7PA 4A2QA 1XYVA 2NYVA 2VAMA 2KMLA 4ILEA 4RMJA 3BAZA 4XTRA 3WLQA 5GZ3A 3WLFA 2A9OA 3Q5EA 1IQ0A 1XCMA 1N57A 3OT1A 3ADCA 1SBNE 1ZXXA 1J5EB 4PO1A 3L04A 2B1QA 2EIHA 5AYVA 2C4HA 3X1KA 4YUZA 1IL0A 5JCZA 2B20A 1Y5NA 4PQGA 1Q7EA 2OO3A 5T4HA 2Z8YA 1NBAA 2P11A 5F78A 3G9TA 5TF0A 1QF6A 4PLWA 3JWGA 3FNEA 4PGGA 1PTKA 1UWCA 2VYNA 1NL3A 3PHGA 4OMUA 3ZCVA 5LA6F 4YAGA 2PT7A 3EPRA 2IITA 1QX3A 4GBJA 4YASA 3CMCO 2IXAA 2NPOA 2PUWA 3QHPA 2YUTA 4U4AA 1JS1X 2ZTMA 1L4LA 5EGSA 3ZK7A 1GYPA 2GMWA 4CODB 4MO2A 3ZH2A 4EJFA 1P6UA 3F6EX 2I7TA 2P2SA 4FBLA 4X6UA 3VDMA 1Y7PA 3AG5A 5REQB 3VGPA 4KQFA 4Q9LA 4NJEB 3TMYA 4BC0A 3B8EA 2VP3A 3T9FA 2YFKA 4EO4A 1IN5A 3IEMA 3BFXA 1P39A 2H5IA 3JZDA 5B37A 5AVYA 5K0ZA 3I58A 1KI9A 3B7GA 3B1FA 2G36A 3DZBA 3RD5A 4RMIA 3BCSA 3NR2A 2EQAA 3RG2A 4CDRA 4EB6B 1AJEA 3MILA 4KRYA 2CMFA 3KFLA 4V0QA 4TL7A 4EELA 3UC9A 1EDDA 4EZEA 5ES4B 1NBWB 5CBPA 4OYLA 3MRTA 3I64A 2J3DA 2XUGA 3FHCB 4G8JA 3GMIA 4LXYA 1VCHA 2YBEA 3I4FA 3EDQA 5EKTA 3M81A 1IATA 2ZS8A 4F3CA 3VNUA 2ODNA 2A4MA 5GAJA 3M6MD 1QGUB 4NARA 1KHTA 2QLBA 2ZSAA 3HNRA 1PI3A 4UKDA 4DV4B 4IGFA 4HDOB 2D13A 3BMXA 4YO8A 1PWYE 1VJDA 3DVAB 4K1XA 1WNTA 4TTQA 3V3KA 5K8VA 5KYWA 2C2MA 1DBSA 2ETVA 3KTAA 2YFYA 1DJPA 3HDQA 2D5LA 1KIMA 1Z0DA 2N1MA 1X1CA 2OENG 3C3EA 3JXEA 2B1RA 4N47A 3DKIA 1Q3KA 2QR3A 5G3ZA 3KT0A 4XJSA 1DJQA 1RWQA 4O1MA 5KYUA 4DUYB 1EINA 3LT1A 1E2EA 1G17A 1T2DA 2UDPA 4HNTA 4NPAA 3HRKA 4EOGA 3GMDA 4AW9A 4RV5A 1F14A 4D9EA 2QTFA 2GN1A 5AVZA 2XAAA 4ZC1A 3HLTA 4ND4A 4Z9YA 1GPYA 1G18A 3I6YA 1NJ5A 2VWHA 2ZXUA 1MX9A 3BD9A 2IHZA 2P9ZA 4PLGA 4IZIA 4ZN6A 1L5ZA 1AQYA 1YV9A 2PV0A 3Q2IA 1CUUA 1CF2O 4JNKA 4LOIA 2R6GA 4O2BA 4WCDA 1EWRA 2QM3A 4CF4A 4EHAA 2O8EB 1IN6A 1ZNZA 2PKXA 5CFNA 1Y6QA 2BELA 4XVQA 4F92B 2IWHA 2QX8A 4MUBA 2ZYAA 3ESQA 5KEIA 1DQPA 1OJ7A 1Q22A 2DR3A 4FHZA 3M83A 4Y7CA 1TM1E 5KHAA 4DREA 5JNTA 3PJRA 3LKZA 1QG6A 1GA4A 2QPAA 3ANSA 1BKDR 4QGGA 1VE6A 5GOTA 2BM9A 1SWWA 2WIAA 4HCJA 1MABB 1OLUB 4QWMA 3EOBI 2Y2VA 3LNTA 2I76A 1RBMA 3DXFA 2B1GA 1PW5A 4MWSA 1ZUWA 1JALA 1XMIA 1T2AA 3LP5A 3UATA 4KSYA 1UT6A 1B8PA 1VE7A 3WC4A 5LP6A 1MIOA 2PZAA 1C8VB 3OJWA 4PZPA 1CKEA 4EGCB 1ECLA 1YK1A 3KEMA 3IIMA 4IIVA 1HY3A 4D26A 4FKZA 5F7JA 1I24A 2V3CC 1NY5A 5F5NA 1A77A 5C5IA 2H1VA 1O9GA 1W19A 1TT7A 2WEKA 1P19A 3DM9B 3GGOA 4GEGA 4JLSA 4JZKA 4MOWA 2XQVA 3OM0A 3OCYA 4YP6A 2AFIB 4P0PB 1JJVA 1JAYA 4ZWNA 3SX4A 3VZBA 4OMDA 3FBWA 4N7MA 5LWHA 3NWPA 5EQDA 1FF9A 1R4ZA 2YVQA 3IQHX 4KXLA 3ZHBA 4EECA 1ID8A 1MDFA 4BLRA 1G6HA 3L8FA 2AXEA 2I2CA 4QYSA 1OMOA 1S7GA 2V58A 4U7TB 1COWA 2F3TA 1BHJA 5THQA 5BY2A 2GCOB 4J9VA 5F4BA 4FWTA 2O1XA 3KT8A 2KYRA 3O2SB 2GHRA 1CS4C 1ZJ6A 5EUQB 2XYVA 4UFNA 3TNLA 1RMQA 4JUFA 3I6ZA 3VNRA 3GPBA 1W0KA 4LV8B 1J39A 1HQKA 2PGOA 4DJ5X 5IJZA 1IBMB 2HNKA 4MQBA 3UK7A 5K6RA 5A3SA 4JP1A 1ICIA 2RH8A 2M6KA 2A5FA 2QLMA 2A88A 2OCIA 2YJGA 3OLYA 4MMZB 3KHSA 1JB1A 1F9EA 2D0IA 4LSZA 2BAGA 3OPYA 1PJQA 4D98A 4FI3C 1L6IA 1M9NA 4FNAA 2XDWA 1P8JA 3T5MA 3AJ9A 3BAFA 2W2OA 1T43A 1YMUA 4C01A 1FJXA 3FM9A 4TSFA 4B4UA 3BWVA 3KZCA 3JAKA 3OPXA 2VJMB 1W93A 3CW8X 2D8MA 1P1JA 3BH7A 3I9V1 5MFZA 1ILWA 3GEIA 2DKNA 4PR3A 2F8TA 5CFZA 4KK4A 2CFRA 4IZHA 3TMAA 2FSVC 1AHPA 4MWTA 3IDOA 2QRMA 4DA0A 3ES9A 1A9TA 2JGDA 3QF7A 3R7WA 5K4AA 1E7RA 2KPOA 3KDAA 5ALWA 4XKJA 5C18A 4D57A 1AQJA 2QQEA 2FKNA 4EHFA 4NR0A 1DKPA 1NC1A 4RDXA 2MINA 2W70A 3RFFA 5MN5A 3AHEA 3MHPA 4ZOQI 4RPLA 4X63A 2EWMA 5AK3A 5LJLA 5IXJA 1ZCZA 4X5OA 3RR2A 1N0VC 4L9RA 1BJRE 1GP2A 3EEOA 1EBBA 3VDRA 1MLDA 4A7PA 4HT3B 1GTJ1 4KZKA 1ZXLA 4JDPA 4LRSB 4GP9A 4C7OA 2KWIA 1NBIA 1Z3CA 2Q9UA 2BP7B 1UAGA 4TKUA 1F6DA 4J7CA 2X13A 4MVJA 1AUPA 5AVUA 2CVZA 4EK9A 10MHA 3A27A 1FK8A 2IYLD 5GOZA 2H4HA 1WL8A 1Q5PA 3G23A 2P5TB 4PXYA 5LB2A 3JYPA 5LNK1 1U63A 2NU7B 1KZ9A 2M9MA 1B8VA 1EFTA 2QL5A 3GG2A 4FIZA 3E2PA 2XOEA 1D9XA 1Q1GA 4TX1A 3OT4A 4X41A 3HYTA 2J5BA 3F47A 3QRWA 5T8KA 1E0AA 3WLHA 2E4YA 2HU5A 3OLXA 3G2LA 2JCBA 1WU8A 3BZUA 3THXB 3UFXA 2C92A 1KDOA 1SUIA 5CYGA 4ZQFA 5J2TF 4EKDA 3T5AA 1R8JA 2E6UX 1H2FA 3LMKA 3T7EA 4OIFA 2ZM5A 4B2LA 1FL9A 1VFNA 1QAMA 3VR4A 1V4BA 5GVRA 4RK5A 3ZZ1A 1Q57A 4HUTA 4IHJB 4OLHA 1QH8A 5CT6A 5ETJA 3MUEA 1OQAA 1KU6A 1IEXA 2G5CA 1P7ZA 2RMKA 4A82A 1ECJA 5C9ZA 3GJQA 2JGLA 4S35A 1QG2A 2Q9BA 3KPJA 3CX7A 3D8HA 1GSAA 4MX8A 3FI0A 5DHQA 1PV2A 3WRVA 2QJTA 5FXMA 4G5OA 5L4SA 2ALJA 1ISMA 1OZGA 1T29A 2O3JA 2RGCA 1RW4A 1U8XX 1WEKA 1ZIYA 1Z5ZA 1H1LB 1DHTA 2VNSA 3EQ7A 3FUWA 1V37A 4ZANA 5JAQA 2YQ5A 4RFSB 1IDN1 5DSZA 5IF3A 4Z54A 1N0UA 3WAKA 1DAOA 4BJ6A 4CM1A 1R4AA 1GO2A 2BGJA 2XCTB 1IEQA 1P31A 4QWWA 4BO8A 4J94A 3L7DA 4DSAA 4FZ5A 5I7WA 1YJXA 4M0CA 4Q4AA 4ZEMA 1EWKA 3L8DA 4X85A 1H5QA 4QBGB 1SBHA 1M7GA 4JKOA 3X2SA 5JYBA 1Y1TA 1G63A 2SKDA 3IQIX 3GUVA 2W37A 4EO9A 3ADBA 4FINA 1P9WA 3WO0A 3ZV7A 1QUFA 1VHTA 3B12A 1CC1S 3EC7A 4U0KA 2WSSA 3MXTA 1JDBC 4X20B 5F98A 4G4SP 2EDAA 1XEWY 4EGFA 1PQPA 3QWAA 1V1MB 2DWPA 4RCVA 5BN5B 3MIZA 4AKSA 3QVUA 3NX4A 3QPVA 1FP6A 1E1LA 1ODKA 3FBGA 4PSAA 4CKCA 4IOMA 3ISJA 2PZLA 5KTKA 5ILOA 2AK2A 1S3GA 1KDRA 1U65A 2RGYA 4DL9A 4YLYA 2QL9A 5IASA 3JD1A 2RETA 3RB8A 4ZJPA 4F4HA 2CNOA 2YKGA 2FDCA 1RWWA 3FGZA 3PJEA 3Q7QA 5EA2A 3RUIA 2GXAA 1BWSA 3TEJA 2FN3A 3NDPA 2G77B 4GZ6A 5JCJD 4X66B 1XV5A 3RYFB 3WDSA 4Y2UA 4DIKA 1KP2A 1YC2A 3D54D 1JMKC 3H3XA 2YIMA 3TE6A 4MS1B 3NRBA 1HL7A 1TQ4A 4N7RA 4Q12A 2FK8A 1CP3A 1IG0A 1V9SA 2MSKA 3B2QA 4MEAA 3QVWA 4Y1RB 1LY1A 4CKXA 1ZQ1A 3BDIA 3F6SA 2WVAA 4OK6A 2G9NA 2C3OA 1CYDA 2GDZA 5SY4A 4Y2JA 5KVCA 5CJJA 3AM1A 1KMIY 1GKYA 4UTVA 4TM8A 4W5HA 4JUAA 2F1JA 4G81A 5ALQA 4L1KA 2C4TA 1KVSA 3RSGA 1G8GA 5AVQA 1BZYA 2WAOA 1N25A 1PL8A 1L7NA 3NJRA 4H7FA 4UMEA 4GP6A 4ZT2A 5KX5B 4L4UA 3ZNQA 3FVVA 4QPZA 4EGJA 3DKPA 4FW8A 4NQZA 2VZEA 4QU8A 3WIDA 5FBWB 1U8EA 4YRGA 3D5QA 4A10A 3N6RA 4JIMA 1JGTA 1WKCA 3A9VA 2PZBA 1Y63A 2GSWA 5KDLA 3P2IA 4NK5A 3JRXA 3RTAA 1N6LA 3GX1A 1ZAKA 4I99A 5DO9A 1LTHR 5J2UB 4DYDA 3S5UA 2PK3A 1Z6PA 2RHDA 4JI1B 3ZKWB 4CKBA 4E4TA 2PVCA 2IXTA 4QBHA 1QRRA 5I7RA 3G0GA 2IRWA 4GO1A 4ZVOA 1FUIA 4DAOA 1PV4A 4UZEA 5A3QA 5EERA 3RHFA 1UMDB 1S5PA 3DCNA 1R0RE 1AO3A 1XZKA 2AUNA 2DWOA 2WUFA 4HB3A 4C7KA 5FF9A 2VTBB 1Q21A 3K8OE 2YHIB 3GAMA 2BI4A 2CNDA 3IIJA 3SHOA 3F71A 3KB8A 4IDHA 1DE0A 3VNQA 3TEMA 1QANA 4NBNA 3OU2A 2P9QA 3R5HA 1E99A 1SIUA 3K05A 1DIRA 1A4UA 5DZSA 3QKUA 3SJ7A 1XFDA 4OFXA 1XKTA 1G0NA 5CUQA 3TIIA 3G0DA 4XQ0A 3SXUB 2JLBA 3L7YA 2PLFA 2Q2NA 1MX1A 5CA0B 1UJ4A 2G06A 1PNQA 1RQLA 1NQVA 3FOAA 1F0YA 1UKBA 3ENNA 3MJCA 4KDRA 1TLFA 4CDMA 4DIMA 3QBEA 3H2GA 3B6KA 3K4QA 2DRIA 1COZA 2D8AA 2XGSA 4UPVA 2W2KA 1UJBA 1UAAA 2HU2A 4XASA 3UZUA 2X40A 3TBFA 3NH9A 4NWIA 4C2BA 1EWTA 2M1XA 2ZITA 2ZIWB 5CTAA 5KC9A 1L5SA 1XF1A 1IN8A 1Z82A 2NSHA 4DMUB 3CXRA 4L3WA 5D3MB 3VOAA 1E9FA 2D1YA 5IBRA 1ABBA 4NFSA 4MPRA 1ZPDA 1B26A 3MOSA 2XKKA 3ICOA 4GYJA 3MJDA 1GLGA 1M5UA 1P6XA 3K0BA 4UAGA 4CN8A 2ZJFA 1MF7A 2ZTUA 3O47A 3M6WA 4X60A 3FVTA 1ELOA 1E3LA 4G4IA 4HAYA 5SZKB 4UEJA 2CLSA 2DUJA 1J2TA 3G5MA 9MHTA 1BN6A 1ZH4A 3OKPA 2FW0A 1GPWB 2GPTA 1QVAA 4HPJB 1JLSA 1WUIS 1SCBA 2EP5A 3VX3A 2RI0A 4CN9A 4F21A 3ZU2A 4PN7A 3B7PA 5FJIA 4WT7A 3GFQA 3L43A 1KP9A 3NHRA 1DC8A 1R5NA 2D5BA 2F3PA 2Q9AA 2QOEA 2J8ZA 3N5CA 1UEJA 3QNMA 4GLOA 4MRVA 5EJ8A 3FOZA 2SCUB 1DO8A 3TOZA 5BUSA 4Z86A 1PZHA 1FC0A 3PXEA 3ITDA 2CXSA 1Z6XA 4R8LA 3OZRA 4PLYA 3CE6A 4QPDA 1A9QA 4LY6A 2JA2A 1NP7A 1M2EA 5ENZA 5LZ9A 1N3BA 3EUFA 4IDDA 3OX1A 2R1VA 3QH4A 4U2FA 3B5EA 4DDUA 2D0OB 3GP8A 3G49A 2BE9A 1BS2A 2ZVJA 5DHFA 1K3UB 4H17A 4GM4A 1XZFA 3K6SB 1BRTA 1JAXA 2PPVA 4P7KA 4TTSA 5EJMA 1TJPB 1QRAA 4Q9JA 3OPNA 2NN3C 3K7EA 4JQYA 1M1NB 4X9XA 4MV4A 4DIOA 5KMGA 4GMGA 4J0EA 4DRXB 4AYXA 3DCIA 1Q11A 1JFRA 3R6GA 4U2EA 5G41A 4YMUA 3PC8A 4CCYB 2GSDA 1TM7E 3RTDA 4ZO9A 2NP7A 3EN0A 3G9QA 3P9PA 2YRXA 1H0HA 4Q9DA 4RVGA 3U4QA 3OEED 1OXTA 3V46A 5BN1A 1EJ6A 5GPBA 2D00A 2DZDA 2C29D 4RVHA 1NASA 2NAPA 2O1EA 1SKYB 4AU1A 1I7QB 3D0OA 4AC9A 4OJMX 5EE1A 1E8NA 3PEFA 1T3ZA 2H16A 5I9SA 1DAFA 2ZYRA 4JL6A 3RFCA 1GOTA 3RU9A 3HXMA 2IHKA 1KI7A 2LPMA 2VVTA 4QG3A 3FFTA 3U60B 3VU1A 4DM4A 1EZ4A 3PDIA 1QR6A 2GPAA 3EDCA 4IHKA 3C87A 4YA6A 1OZHA 1YXMA 1VM6A 5FHQA 3ZYZA 3RGWS 4ZJYA 3H83A 3G8CA 5JLJA 3UMMA 3U3DA 1QQ5A 1JW9B 2P40A 1H66A 2W9XA 3FOWA 3C3PA 4UARA 3DXYA 3ZNOA 4LOKA 5ISMA 2DP4E 1SN7A 4C9BA 4R1PA 2YASA 2E4VA 2JGEA 1FXUA 2ZE8A 1QV6A 1ZA2A 5FO0A 4ES6A 4PIPA 3S29A 2P9FA 2EZ9A 4LMRA 3IAM1 4BECA 1XMXA 2OBNA 1M0EA 3EJWA 3G8BA 3NTQA 1EGQA 3F5QA 3O8QA 2HYDA 1XTBA 3PFBA 4Y6RA 5HKKA 2QYSA 3QFTA 3KWJA 4Y2QA 5EHZA 1NG1A 3ZLVA 1YZFA 4D8XA 1A9ZA 3GMSA 3WO1A 4F96A 2WJIA 1HYQA 3FYUB 4K9MA 5IUJC 4YRKA 4BO9A 3CUWA 5JJCA 2VUSA 3ASYA 5KOJB 2P2YA 4K46A 4OQYA 1LRKA 1A69A 1PR4A 2W8BA 2Q0XA 3D8UA 3ZWWA 1QPGA 2WQ6A 4J8PA 5CB8A 2B1JA 1DAGA 4IHJF 4WLNA 3QVJA 3CE9A 3GI1A 4L75A 4HDKB 5LXTB 1KJ8A 1E1CA 2X86A 3OU6A 4Q7LA 3T52A 2X1HA 3JCZA 2HRRA 4HBZA 4NHOA 5D6NA 1IN7A 4N49A 1LC3A 3PVCA 4A0GA 4H4CA 1AHNA 2B8WA 2QLFA 3W9YA 3GLGA 3CB4A 3EXIB 3PQ4A 3R8XA 1X7WB 3OSZA 3EGDB 1ZMBA 2X8BA 4YRNA 5KTRA 1DFHA 1M2NA 4DBLC 1DBRA 5T64A 3I1IA 4CM9A 5KJ6A 3T1NA 3GV0A 3FZNA 2XVAA 1E62A 2EX1A 2FSUA 2JIZD 1MNQA 3OKFA 3QX7A 4UDNA 2G1PA 1G66A 1KK1A 2MSLA 4M21A 5CA1B 3HFRA 4JOQA 1C50A 3G5TA 5IXYA 4OQPA 1FPQA 1ZN7A 3IV9A 3W2EA 2OG1A 2Q28A 3OD5A 4XJTA 3N86A 1L7QA 4D4GA 1UPAA 4GC9A 1DJMA 1N32B 3FHLA 3P97A 3DWGA 1WZEA 1X0XA 2GYYA 1QHFA 2TMYA 4DTIA 1PHRA 1DAIA 2WV7A 4G0VA 4Z4GA 5J43A 2Q4EA 4HQ6A 3OD1A 3NTUA 2ISCA 3P2MA 2AMLA 3CBGA 2ZB3A 1WXDA 3GH3A 3D7LA 1MR3F 2WC1A 4KOAA 2QG6A 3LX4A 3ZHRA 3BIFA 4EENA 3U19A 1ZN2A 3CH6A 4PX2A 3AFNA 3JQ6A 1MKYA 1U90A 2YZKA 1QGOA 1IUKA 1IY0A 3TOXA 1FEZA 3EVCA 3LD9A 5KYYB 2C54A 1F60A 4AUEA 2HU7A 3EIOA 5E2IA 4CMBA 1VJTA 3C3KA 4YUXA 2AYYA 4J4TA 4B6OA 5JDIC 1KS2A 1M6VA 3NPAA 5KTTA 3AEQB 3MXOA 1EK0A 2OWDA 4HN9A 4R2HA 4BJ5A 3LNCA 2ZRKA 1K86A 1OOEA 2O8BB 2WV9A 3CXUA 1D07A 1U2ZA 2XCOA 5I7VA 4IYJA 4AY4A 3QG1A 1L4FA 1EIZA 1MIHA 1ZGGA 1NG9A 5FQOA 2FPRA 3KELA 1I3NA 1XRNA 4PLPA 4Z2YA 2HIAA 4MAFA 1N7JA 1EI9A 2VLIA 2VNAA 2ZKLA 1N2CB 4CMHA 4AJEA 2RDMA 1QX4A 3JWPA 3O4FA 4M9ZA 4N9WA 3VDNB 2I03A 2WJPA 2W6PA 3T9BA 2FF5A 1E60A 2WU1A 3ET4A 3QEKA 3ZK9A 1LPBB 4P5PA 1Z35A 1JQKA 4F9GA 3OY2A 1T2EA 3ZVKA 2BUAA 1NKTA 1SH7A 4J16A 2DF8A 5CNIA 3KDPA 5H4HA 3VBEA 3G6KA 3H16A 1QIHA 1SCUA 3OJLA 1GKUB 2P9CA 2NU8A 5J2UF 3QYJA 1TFUA 2BFFA 4HN2A 5JARA 2O2EA 1TQ8A 2XT0A 1E3EA 4YCBA 3W3ZB 4JC8A 3ZGXA 2GN6A 2PH7A 3HZOA 3MWDB 4H16A 1S8OA 1NU8A 3HI6A 1WVGA 2AN4A 4GKVA 4I4TA 3KSZO 4MUXA 4JI2B 4AUKA 4UDYX 4UM9B 3BMOB 5CG1A 2OE2A 4UAJA 4Q4HB 3BH6A 3H6KA 3LLUA 1U3VA 1PS9A 1CJCA 3MAGA 4H0NA 3KUUA 2J3IA 3K0AA 3AUSA 5JU6A 2HR1A 2EFCB 4RWZA 5J4KA 1R6XA 1BG6A 3B60A 4OBEA 3GVCA 5CX1A 1GTMA 5JPIA 6PFKA 2B8JA 3TJRA 5C2JB 2AR0A 2PBZA 4C0AC 5ELXA 3A2LA 5CA0F 4R8SA 3PNBA 4RZXA 2VBFA 3FR8A 4K3VA 5AKEA 2YCLA 3L5KA 4YMGA 5BV8A 1NIPA 3DGFC 2GEBA 3FKSD 4IIDA 2JBHA 5J4YA 5JRJA 2AW3A 2OILA 4U3JA 3WBBA 1IHUA 4RJ2A 2IZ1A 4DCCA 4F97A 1V2GA 1KGDA 3R9WA 1ZH0A 1AKEA 1JQ3A 3ZE2B 4HH1A 5KIAA 4PNEA 3M4ZA 4CUZA 4D41A 4HVCA 4CBVA 1Q1AA 2E2WA 3I6MA 1JDPA 1OY1A 4YJKA 5AOBA 3DL4A 3O75A 5GV7A 2Q2WA 5ADWA 2FQWA 1JNXX 2QW1A 2W4IA 4PVDA 4QQ8A 1WSDA 3B38A 4F3RA 2WTXA 3I5AA 1ZOPA 4NPHA 2HTFA 3E0QA 4ZYVA 1AMNA 4XX0A 4L5BA 1QHNA 2ZLBA 1WU7A 3KZVA 5JY1A 4B8WA 4QO8A 5JCPA 2JGRA 2IX9A 2FG6C 1PGPA 4FMDB 3ZXUB 4TRMA 3WSVA 3E23A 3U7QA 2V6BA 4X1YA 2A86A 4F5EA 1H0KA 3ZHUA 1DRKA 4NEQA 4RIGA 1B6SA 4EGSA 2BKAA 2DH6A 3EZXA 1CUFA 3PFKA 2P2ZA 2IQ5A 4M0MA 4IQ8A 2ZBVA 1ISIA 4HH4A 1LDMA 5EXTA 3W06A 2A1IA 5EP1A 1UAYA