4MUNA

Crystal structure of pantothenate synthetase in complex with 2-(5-methoxy-2-(2-nitro-4-(trifluoromethyl)phenylsulfonylcarbamoyl)-1h-indol-1-yl)acetic acid
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
286
structure length
283
Chain Sequence
b'PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 92
structure length 283
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4munA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4munA01
1O94C 3MXTA 4MW9A 1RQGA 3ILVA 1N2JA 1WKBA 1VLHA 2C5SA 2PZ8A 3TZEA 1YIAA 4OUDB 4YP5A 1VL2A 1D2RA 4MQ6A 2A84A 2BYTA 2YXNA 3ZXIA 2PZAA 3INNA 1O95C 1O5TA 3CLSC 3E27A 3CLTC 5H7XA 5BNZA 4J76A 1YUMA 2NZ2A 3JXEA 3VU8A 3TNJA 1NUSA 1GLNA 5TEVA 3UY4A 4DE5A 2J5BA 1Y42X 3G6KA 1F7UA 2E18A 1N2OA 2J4DA 3HV0A 4ND7A 1J09A 3DLAA 3FH0A 3N9IA 3ZJVA 1F9AA 3HFJA 3NV7A 4MVXA 2VTBB 1QU3A 4DDHA 3CVUA 2A7XA 3FI0A 2J07A 4FZJA 1WJGA 5IJXA 4NZPA 3FHJA 4I6EA 1XJQA 3MMXA 1QTQA 4YBRA 3CVWA 1N2IA 1JHDA 4KR7A 1ZJWA 4MUKA 4MWEA 3H9CA 2CYBA 2A1UA 3MLBA 4KKVA 2ZUEA 4JZYA 1QNFA 3DO8A 1TQ8A 1YULA 1M1ZA 3TQOA 4NX2A 1CT9A 3FOCA 3N8HA 4L2IA 3K32A 3DV2A 5DASA 2DUMA 2EJCA 3PNYA 1EUQA 1JEDA 5FO1A 1EE1A 1PG0A 2CV0A 2PXHA 2DXIA 1I2DA 3FETA 3IMEA 2IP1A 1NI5A 2IELA 4NAUA 4MUFA 2CFOA 4ZCTA 5F23A 1NSYA 1OWPA 3Q10A 4AQ7A 3PNBA 3PNVA 2CSXA 3LE8A 1ULHA 2AZXA 3H05A 2DEUA 1PFVA 1IQUA 4QREA 4XFDA 1QRUA 3AL0C 4MUNA 1O6BA 4ARIA 1O97D 4NAHA 4ZT3A 3U1VA 4Q93A 2PIDA 2QJOA 4MW1A 2OV4A 1NUTA 3CVYA 4ZT4A 3IDFA 1K4MA 3LOQA 3VGJA 4WNYA 2CV2A 5KWVA 2PFSA 5LLTA 3P0JA 2A1TS 4YP6A 1I6MA 1R6UA 2Z08A 4MW2A 1TFUA 1LI7A 3AIIA 2O5RA 4QBTA 2X3FA 4AS1A 4CDNA 3SYTA 3IMCA 4DLPA 1K4KA 4YMIA 2O8VA 2JANA 4HPWA 2IJGX 3ZJUA 3D6VA 4UZFA 2V0GA 1WOYA 1U3CA 5H16A 1NUQA 3AG5A 3AKZA 1QRSA 4DDMA 4GU5A 5LM3A 4EG7A 1EFPA 4DJAA 3ND5A 2VXOA 1H3FA 1FYDA 1OWLA 3G5AA 2D54A 2X1LA 4R2LA 3IOEA 2B7LA 2DETA 2X0KA 3UC5A 1KR2A 2BTEA 4CQNA 4UZEA 1KH1A 3A4IA 4JXXA 1NUPA 2E21A 1NZJA 1N2EA 3H9BA 3PXUA 1UFVA 3GLVA 1TYDE 3CR8A 4YP7A 1H3NA 1U7XA 1COZA 3SEQA 1BS2A 1KORA 1ILEA 1TYBE 4ARCA 1MJHA 1KH3A 3F3MA 1J21A 3NBKA 3RHSA 2HGZA 3SP1A 4XSVA 2AG6A 1MAWA 2CYAA 2D13A 3X1MA 1KH2A 1IH8A 4MW6A 1A8HA 1XNGA 1JILA 1J20A 4EF6A 3CLRD 1J70A 1ZUNA 1OBHA 1V47A 4A91A 3VRHA 1IVSA 4ZT6A 1IQ0A 2OQ2A 2XRYA 4K0RA 4RPIA 2PZBA 3IMGA 1G8HA 4MW7A 3A04A 5TEWA 3CLUD 1JIKA 2QUHA 3ND7A 3P0IA 4NATA 1G8FA 1WXGA 4P2BA 4HJXA 3CVVA 4F4HA 5FNZA 1OD6A 3AFHA 1EFPB 3IH5A 1IFXA 1J1UA 2E0IA 2A88A 1N1DA 1ZH6A 1M8FA 1KQOA 3CLRC 3L92A 1KP2A 4PBSA 1XNJA 2CYCA 4K03A 2EL7A 2V0CA 3KT0A 4MLPA 3TS1A 2RE8A 1Q11A 1GTRA 2ZUFA 3AG6A 1F4LA 3G59A 4J75A 3IVGA 3IODA 1QRTA 3IUEA 2D5BA 4KPUB 1M8GA 1KAMA 1PFUA 1NUUA 1JIIA 2JA2A 1KP3A 2QUKA 3UK2A 1N77A 1YUNA 4MUHA 4MW0A 5EKDA 1MOPA 3PRHA 2PG3A 1SURA 4KR9A 1IRXA 5K0TA 4WSOA 2WSIA 2QTNA 1EFVA 5J58A 3RFFA 1N3LA 4MULA 3GUZA 1DNPA 1XNHA 4MUJA 1GN8A 3ZIUA 2DLCX 3HL4A 2QTRA 3C8ZA 4ZT5A 3S3TA 4G5YA 2A86A 3ISJA 4EG8A 1T9GR 1I6LA 1KQNA 3BL5A 2QJTA 3P52A 1LI5A 1IHOA 1Q19A 1GAXA 1T9GS 4MUIA 4EG6A 5IHXA 1JEEA 4JXZA 3HMQA 2GOYA 1WXFA 1O97C 4MVYA 5FO0A 5DB4A 5KCMA 4GRIA 4HJRA 1VBKA 1JGTA 1N2GA 2XRZA 3FNRA 4JYZA 1H1TA 4H3SA 3HZRA 4MWDA 1T6XA 3FY4A 1X6VA 2Z3VA 2X1MA 1N2HA 1U0BB 1J1ZA 5HUHA 4R0NA 3COVA 1O94D 2WQ6A 4DNXA 4U7JA 2Z09A 3FWKA 3NBAA 3GMIA 5HG0A 2H2AA 3Q12A 1YIDA 3N2YA 3I05A 4ND6A 1TEZA 5DK4A 1M8JA 4MAFA 3ZXSA 1WY5A 1MC1A 1NURA 2DERA 1U3DA 3L93A 1T6YA 3ND6A 1EFVB 1R6XA 2I1LA 2RD2A 1O95D 2WQ7A 3QE4A 1QQTA 3CLSD 1N2BA 1B6TA 3CLTD 1Q15A 4KPUA 1P7PA 2TS1A 1QU2A 2G36A 4EG1A 3QTBA 4S1OA 4NDAA 1M8KA 3DPIA 4ZCRA 1Q77A 4CDMA 4ZCSA 4G6ZA 1OWOA 4MVCA 5K0SA 2CV1A 2A4MA 2DPLA 2YWCA 3KFLA 2ZP1A 3CVXA 3MUEA 3ELBA 4EGAA 3FDXA 4MUGA 4I6GA 1H3EA 3ZUGA 1JIJA 1GZUA 4MWBA 5JBNA 4PBTA 2QUIA 4XFJA 3TQIA 1T6ZA 2NSYA 4QRDA 3ZGZA 1OWNA 3COWA 3CA8A 4OJMX 1N78A 2HZ7A 1JZSA 4U63A 1G8GA 3COYA 2E89A 1N75A 3FIUA 3IVXA 3X1JA 3IVCA 3X1KA 3IOCA 3H99A 4I6JA 1VBNA 1WQ4A 1M83A 3KT8A 1O0BA 2QUJA 4EFKA 1ZH0A 1M8PA 1NP7A 2QTMA 5KHAA 2CT8A 2DR2A 5TS2A 3H97A 3RK0A 1K97A 3UMVA 3MLAA 1S4MA 4MUEA 4DDKA 3D6UA 1WQ3A 4HK4A 3CLUC 1F7VA 4ZCPA 4RUKA 3KT6A 4EG3A 1O96A 1FFYA 1EUYA 3COZA 4PBRA 4Q16A 4X0EA 5HUJA 2J09A 1WXHA 3SZ3A 2H29A 5LFAA 1LW7A 4EG5A 2GKSA 2HMAA 5AHWA 1KQPA 2QJFA 3A05A 3P0HA 5DEOA 1TYCA 1X8XA 3HGMA 5J59A 4EG4A 1KKUA 1K92A 1JMVA 2J08A 4KR6A 1G59A 3IOBA 1WXIA 2CUZA 1JECA 1V8FA 3SDBA 4OUDA 1MB2A 3RK1A 2YWBA 3ZJTA 3RJZA 3IUBA 1VBMA 3M5WA 4CT0A 5TGTA 3K9WA 3KT3A 1OWMA 1QJCA 1R6TA 1JZQA 4BWVA 3UOWA 1I6KA 1KAQA 4ZT7A 3OTWA 1MB9A 3TZLA 1GTSA 2WB2A 1MBZA 4TS1A 1EJ2A 1HYBA 1MRZA 1PFWA 3QTTA 2A1TR 1O0CA 2A1UB 1OBCA 4R2MA 5J5AA 1EXDA 1MAUA 1O96B 3Q4GA 4MVWA 3SZGA 4G5FA 4PY2A 2R5WA 4ZCQA 3RBAA 2VTBA 2AKEA 1NYLA 4MW4A 4JFAA 1IQRA 1WXEA 2GM3A 4MW5A 1YI8A 4L2IB 2JAXA 3A2KA 1PFYA 1GPMA 4F3RA 4MWCA 1TYAE 2YY5A 3N05A 4U8HA 4ZT2A 3FG9A 4E1AA 1WZ2A 3OP1A 3SEZA 1U7DA 1PG2A 3LCJA
chains in the Genus database with same CATH superfamily
3Q9SA 1MX9A 2JD2A 2ODNA 1R8QA 4GC5A 4J0EA 4A0RA 3P9SA 1A2QA 2SKDA 5JWHA 1LLQA 2H57A 2F3PA 1V37A 3HA5A 4FEYA 3MTDA 3MT7A 2CD9A 2UZ1A 3AZQA 4O6VA 4Y2JA 5THXA 2FZLA 1UK7A 2GPSA 2CNWD 3DDCA 2BGNA 2P7IA 1M76A 2C77A 3GBSA 4NYMQ 1M2JA 3BXOA 1CE8B 4F11A 2Q2WA 1CJTC 2YIJA 1BKSB 4C0AC 2RK6A 4JX8A 1JL3A 3OTGA 3B6ZA 4BP8A 3TL6A 1NWHA 4OL0A 4P5DA 2AG0A 5LOVF 1RZ3A 3DEZA 4ACAA 3RYFA 1KI6A 3DEKA 3P4UA 1PWHA 5ESRA 4Q4JA 5EIOA 3AF5A 4J76A 4OP2A 1P6QA 1QDUA 5T8KC 4FYMA 1ENZA 5JYEA 1FYFA 4CCYA 4LJRA 2G1JA 4U7GA 2NQTA 3BXXA 2CFRA 5KTPA 3L0DA 1T9CA 3UKOA 3C6KA 2VDOB 2WJAA 2QW8A 2XQVA 3V32A 4DA4A 3AR9A 1XAHA 1URPA 2AK3A 1O5IA 5TMPA 3ZCRA 2LPMA 1WHTB 4RXTA 2DHEA 4ND7A 1PNRA 4DIKA 4NHOA 3FSGA 4WUTA 3D43A 3WJ2A 5JDIC 2JASA 4JVNA 1YS9A 1E0JA 1L4NA 1SUAA 3CPHA 3IIIA 3LW8A 4WXRA 5C3UA 2B2CA 3FTNA 4K9PA 4J0GA 1QANA 3IAXA 2IBTA 5HIKA 1MGOA 2VUIB 2J1LA 4Z7OB 5FBRB 1XAIA 4ZMSA 2X8AA 1R10A 3FHLA 2AR9A 1T2UA 4BASA 1JHDA 3I9LA 4QUGA 3LK7A 2FYTA 4OBWA 1XUOA 4TTVA 1D7AA 2VBIA 2Q1UA 1JLLB 1G6HA 2V7GA 5I5GA 3D2BA 4KO3S 4XCVA 2H1SA 3EVDA 5U4QA 2VHJA 4ILKA 3G2LA 1BXKA 1AV7A 1HTTA 3QMWA 2O7RA 4JLMA 3KR0A 3OU6A 2XF2A 2VPTA 4O4LF 5TS3A 3TLMA 2AW5A 5H9VA 4GYWA 4F38A 3ZVMA 4HEA1 3RK4A 4D9NA 1P44A 3OICA 1PGJA 4G8JA 3IBYA 1GAEO 5CB0A 3BXZA 5AESA 3B2QA 2UV8A 1V0JA 4XIIA 1XXLA 3UN1A 3K32A 3WQSB 1I3CA 2RFLA 3F3SA 1YHZA 2EJCA 3M3PA 2CE2X 4M9CA 4XUGB 4ZXFA 3RUEA 2EW1A 3ORRA 5ESXA 4UTNA 1L7RA 4FCTA 4OSPA 2Y0DA 2VNAA 3SYMA 4Q82A 3KOWA 1PV1A 3NAMA 3QELB 4OQDA 3WQQA 2K87A 4GVLA 5CLFA 4MSUA 1Y5RA 3ROKA 3R3WA 5JCOC 3ZV6A 3FR7A 1K06A 4AD8A 2YFHA 2QZJA 3OJWA 4RMHA 5EKUA 4I1SA 4TSFD 3FUXA 1J99A 3OE4A 4UQPA 2GZHA 2VSFA 3V8NA 3AUKA 1T2NA 4A23A 4U6NA 5KDOA 3G2NA 3PSAA 2PQ6A 4O08A 1OXBB 1E3WA 3OD1A 4EY8A 1E59A 1T1SA 2RGWA 1A82A 1ODJA 1P1JA 4A0HA 5AVTA 4DDVA 4WCVA 3ZBTA 1AGNA 3X1ZA 2ON6A 3AEYA 1YDHA 4M7OA 4N5LA 4NE9A 1K86A 1KPGA 1X1AA 2QZPA 3EPLA 4PWZA 1RAGA 3LSYA 5CNIA 5HK8A 3SQMA 1U8FO 3IOYA 4NFSA 4DIDA 4BFVA 3VGJA 3SR4A 1XFAA 3CTMA 3HCPA 4YI3A 2I2CA 5DWVA 2CV2A 2F1HA 1LQUA 3TBHA 3S27A 4UNPA 5ENVA 2Q6KA 4P1ZA 3BDAA 2PBRA 5D86A 3U4AA 1YR2A 3U40A 4BFSA 3MRXA 1W44A 1UBCA 4NK5A 1OLUB 1Z0KA 2FAXA 1XOIA 1FX0A 4E2ZA 2ANCA 3HG7A 4QOHA 3KYDA 1Z5OA 3AIIA 4MJ7A 4QQRA 3U19A 2RHDA 4QBTA 3V2GA 4HG2A 5JJ5A 1TM3E 2DPYA 3MELA 4CDNA 3ILHA 5DZSA 1XLUA 4IQGA 4ZTBA 4NCAA 4HPWA 1NE7A 3WWEA 3JVUA 4RV9A 5AK3A 3WLQA 4NYIR 3R2JA 3U2QA 3X1DA 2WHPB 3N70A 4GYYA 3VNBA 2GCEA 3L7IA 1M2EA 4XJTA 5KSPA 4DLTA 1EU1A 2X0JA 4ZOCA 4NYJR 2NZ8A 4JLOA 5C5DA 3ECAA 2VJLA 1CEEA 2H1LA 1L5FA 4ES6A 4YROA 4UD6A 2J3QA 3RD5A 3UK1A 2Y99A 2QLFA 3FOWA 2MYNA 3A4YA 1OI4A 1Z06A 2N47A 1OWLA 4EIWA 2QJWA 2GD0A 2X6RA 3GVXA 4BXOA 2XMGA 2E48A 2X1LA 1ZD4A 1E2HA 1QH8B 1G9SA 3EZXA 2ODEA 3FPAA 1DRWA 1N25A 2WIKA 3SQOA 4HTFA 4F4IA 4D3SA 4TKZA 1YR8A 3W90A 5T7BA 3IV6A 3UJ8A 3Q8KA 3EVNA 2J46A 1W1UA 2Z95A 4HEJA 1IL0A 3WLHA 3FRIA 4QPZA 2V6JA 3NDPA 2RHOA 2GYVA 1XK7A 3AEQB 1GPDG 3W9BA 1JH9A 2JLBA 3RVNA 2HTEA 2FETA 2X4LA 4WQMA 1PZEA 5F1OA 2KQUA 3T9BA 2QVZX 3ZOZA 5FADA 1IEVA 5EPUA 5KDLA 1S2OA 1COZA 4DCMA 4DXHA 3BSYA 4EB8A 3VX3A 3V1KA 4MWOA 5J2TF 1KNQA 5B1DA 5EFZA 4YRDA 1TLTA 2ECFA 4I4NA 2COKA 5G4KA 1UKYA 3VZCA 5K3OA 3FTDA 1Z07A 1GU0A 4QLOA 5BRNA 2ZITA 3R0JA 4ZI2A 3J80A 2OHGA 4C7KA 1MHTA 2Y1LA 4TMZA 4MB6A 2Y66A 3DF7A 2R00C 3EEYA 4C5AA 4ZHQF 2WVJA 3LUCA 4UM9B 1LK0A 4ZI7B 3KL4A 1FTSA 4IGFA 4YRSA 5AUNB 4GEGA 2GUWA 5IAAA 5JLJA 3GJ4A 4WL0A 1IMOA 4EYQA 3O8NA 1TJPB 1W5FA 4WGFA 3O4RA 2R1TA 3IKVA 4Z86A 1EFHA 4X3CA 2ATVA 5FBWB 1MO2A 1XCPA 3AONB 5IUJC 3AHCA 1F9EA 3HLKA 4JI2B 1HT0A 3R7FA 3ZUPA 5BXYA 3FTCA 3RSHA 1CR0A 5F4ZA 4QYIA 3U17A 1XQ9A 3IH5A 2B4YA 3NOQA 3V7FA 4CM4B 4R4JA 4CF7A 3H1AA 2CNNA 1MO5A 2A5FA 4RHXA 4D0RA 1H2FA 1ZH6A 4BJ6A 1JG7A 1K2VN 2ZYHA 1PK7A 1TUGA 1U3GA 2Q3LA 4L15A 1QMGA 1X2BA 4A6DA 4B32A 5IVKA 4FGLA 1GNTA 1SCAA 4OXNA 3UT5B 4L4RA 1E4EA 3B8HA 2RE8A 5BW6B 4QDUA 4CR7A 4CXMA 2ZBPA 4FZ5A 1KI1A 2YMLA 4I0WB 3WIOA 3NQ41 3SMVA 3W05A 5JHHB 5H80A 4J75A 1D5WA 1NYQA 3DL0A 2J8ZA 2G3YA 2PEZA 3EXHB 2Q5QA 1KDVA 4DZRA 2O2JA 4R1UA 1GUAA 4N01A 1ZMRA 2B8NA 3MWDB 3OIWA 1VOTA 3T35A 1BQ3A 1FS6A 1V39A 2TMGA 1IVNA 3EXFB 3H5NA 3RU2A 1S89A 2ZSFA 1Y1RA 4JUDX 3VSDA 2PRYA 1E61A 1WDWB 3O31A 3O8OB 3G9TA 5AM1A 3CUYA 1KZ1A 4KR9A 5A4MS 2GMWA 1IRXA 4CQLB 5BNTA 3LYUA 4O8CA 1LNSA 3NT4A 1GQOA 2OP1A 2P5UA 1PQ4A 3GVCA 3OA2A 4DDTA 4K6OA 1NPYA 1Q14A 3DFZA 4IDCA 2AXQA 4TWAA 1UFKA 5ALNA 1GUBA 4G5SA 3TLAA 1HWYA 3VYWA 4Z7NB 1PGOA 1T36B 2X14A 3B1JA 3K4HA 4NOJA 4CQMB 3KJHA 4NCXA 2EATA 2IXAA 1YFLA 1DWOA 4IV5A 3A4MA 4X24A 3ASUA 5TQ2A 3SZRA 4HS4A 3OCXA 2GUGA 4O4JF 2WJIA 1H22A 2OPBA 3K1ZA 5J2UB 1CQJB 1RZUA 2IZ5A 2XZOA 2VDWB 1EIZA 4AJHA 3EPHA 1MZVA 1UR5A 1IHOA 3KZCA 3TL2A 3D1VA 1TD1A 2X8JA 4L8FA 4N8SA 1Q19A 4H3VA 3X1WA 4CM1A 5CRIA 2R4UA 3BTOA 4YJ2A 1T9ZA 2G1AA 3FAKA 3VISA 3ONVA 4F2DA 5F5NA 1UDAA 1SR8A 3HMQA 5GWXA 4DCJA 4RH3A 4RTOA 3A0UA 2CNOA 3GRCA 4UUNA 4JSTA 3CLHA 3GFRA 4IZHA 3GJSA 4IDGA 5LMCA 2C59A 2Q0HA 1EWYA 3F74A 3DB1A 1ATIA 3HP1A 5KI6A 3NAGA 3VSCA 2AI2A 3Q6MA 3T5PA 3NJ8A 3FB1A 4HDRB 5I7FA 1H69A 1C8VB 1Q91A 3VC2A 2VCYA 3GV0A 3FWYA 4X00A 3JV7A 3HBFA 1HLFA 2BFFA 2C0QA 3UB2A 1DS6A 4AJEA 1ZUD1 2HJRA 4J0FA 4J3FA 4NFYA 5HDQA 4PO9A 1QXSA 2G6TA 5ENDA 3ZY5A 1SELA 2OBNA 3I9V1 2LMEA 1IWBB 1X7DA 3Q12A 1QCZA 2HLDD 2P35A 4ND6A 3IEUA 3VPAA 3QW2A 4D9JA 4KMSA 3R7AA 1IXYA 4MAFA 1Z9BA 2X9QA 4RE6A 4ATNA 2X13A 4L08A 3AO0B 1U80A 4LOAA 4ZODA 3FWNA 1COWA 4NBNA 3Q6IA 3R9XB 1L4KA 1I2ZA 1Q0LA 1EWQA 3QE4A 4LE1A 1YB2A 3ZE7A 1JPJA 2QRPA 2ZJ1A 4DIEA 3GCWA 2X0EA 1K3UB 2P3QA 5DOZA 2WILA 3OIDA 3VV3A 2PWAA 4BQOA 3D2CA 3DZCA 5DRTA 1TECE 2VQDA 4WSOA 4UULA 1W4LA 1M8KA 3OX3A 1A9YA 1DJQA 2Y6UA 3DPIA 4BCBA 4D57A 4Q3NA 4DPMA 2H4XA 1Q77A 1VLJA 2I8AA 2Q2VA 5CH8A 2OCIA 3C6YA 3PFHA 4QXPA 1I1OA 1E7YA 4XX0A 3SMQA 4AI6A 1RSZA 4C4OA 1HA3A 3L84A 4KBGA 1UJ4A 3MUEA 1YS4A 1ZDMA 2PU7A 4JQSA 4YQZA 3SBOA 2PRIA 2Q8QA 3IQXA 3EBLA 4AX8A 1WX1A 3QLJA 1LCIA 2Y0EA 3E61A 3GMTA 3KJXA 5FXMA 5IKMA 2OQVA 2AFVA 1A7UA 3WRYC 4UXHA 3TQIA 1J9ZA 1GSAA 3EIQA 3L79A 4R9VA 3OAAA 4YXWA 3KZNA 4JKIA 3CS3A 1TC1A 3HA3A 4YIKA 2A53A 4YALA 3DQQA 5DM4A 4IOJA 3K9FC 2HWKA 4BTVA 3QI2A 3D31A 2JHCA 3IVCA 2DUNA 2OWEA 1Y48E 1NGSA 2B8WA 3E15A 3KELA 3VI4B 4ECAA 1V1JA 2JJ1A 1Q50A 2O0LA 2PRZA 2MR6A 1ZH0A 4LNUB 5FBQB 1A9XB 3ZWOA 4A36A 4YVFA 5FUQA 4I1PA 4XM1A 3ANLA 1YHNA 4BO8A 2Q3CA 1T5HX 2I0FA 4DDKA 2CDAA 1VZ3A 2O8CB 1OCEA 2Z4TA 2QN6A 2CVZA 5FT9A 4KXWA 5A9TA 5BSEA 5EMHA 1UJMA 1KKLA 3I58A 4A2CA 1ESEA 2XYGA 3QEMA 5C3MA 4N5HX 1EUCA 2ONCA 1HNNA 4X3OA 1SJ9A 2GK7A 3NP9A 3G88A 2I66A 3QP9A 5FLKA 2VHEA 2ZAOA 2R751 4I9GA 3OCYA 5IW8A 3C3JA 1QOZA 5CDHA 1PT9A 1SVUA 1Z37A 2QD1A 3GP3A 5F9FA 3OE7A 4RIHA 3JYHA 3IE0A 2VYVD 1S3IA 4YC7A 5L4SA 1UKZA 1MG0A 1N3YA 2YRWA 1GAWA 1EZ4A 2FOIA 3L7MA 3TLZA 2J4CA 1TLLA 2GJ9A 4J07A 4E4TA 4CKBB 5GJVC 1EB8A 2COEA 3C41J 3ZK7A 1V41E 2EERA 3ENVA 5AOVA 1W46A 3DTNA 3O0TA 1JPNA 3RREA 2QD5A 2BGGA 1ZGZA 1PS9A 4GMFA 1U2PA 3BG5A 3H83A 3QJGA 3PEEA 4GOKA 4ZP1A 1JKIA 4A5SA 4CF5A 1W0CA 3VH2A 1PJSA 1DL5A 4DCPA 3PITA 1QF6A 3KRTA 1SKQA 4LJ7A 1S2LA 2F3SA 1BFUA 1GRNA 1X94A 3D3EA 3NALA 3UYLA 4P0PB 2GA8A 2H2IA 4ZQFA 3D6FA 2C2XA 3QY9A 1JFTA 3FKQA 5KC9A 1NXSA 3BICA 3QX7A 4YMHA 2HH9A 3THRA 3LHDA 1YCDA 1SPXA 1HYBA 1Z26A 3FDFA 4HQOA 3ZW7A 4RH0A 1VJ0A 4QRIA 4HB2A 4BNVA 4LYEA 1CY4A 3PF9A 3U60B 3NHWA 1NXXA 3MJFA 1O0CA 3GRZA 3INTA 1N9GA 4A0SA 1ZNQO 2O50A 3KZMA 1NQ5A 2BFBA 3VZDA 5KOHA 1GOTA 4G5FA 3IQZA 4JR2A 3R7NA 5K3AA 1KHTA 5CT9A 3AL2A 4J1QA 4WX2B 2GM3A 2IXGA 2YIVX 2ZB2A 1XN4A 3KV1A 2RI6A 1MG5A 3B20A 4E1AA 4IIJA 3EVGA 1XZFA 4GE3A 4K5QA 4PG7A 3NBXX 4BPRA 1FJ2A 1DAPA 1KP3A 2YOFA 1PG2A 1TVCA 4RACA 5KYVA 4YRBA 3EH1A 3MXTA 3KB2A 3O94A 3WYGA 4URFA 5JNVA 2C3PA 4J7AA 3N5CA 5JZMA 3AFOA 4KZKA 3WLEA 1NPDA 2FEOA 4C01A 2HIAA 4J94A 2YQ4A 4LK3A 4Q9JA 4D92A 4M8IA 3E9ZA 4I50A 4XQGA 2E4YA 1GVNB 2OKCA 3QX3A 4ZGGA 4MQ6A 5BN4B 3JQGB 3OQIA 3RU9A 3IEMA 3ZXIA 1XK6A 2CW5A 3QU4A 4Y6SA 5DN6A 5HUQA 2W6CX 2XDAA 3DV0B 3JVVA 3SFZA 4IUDS 2FPPA 3O1JC 3SIWA 2CVOA 5JFOA 4BS9A 5LZ8A 2M98A 4F5DA 2XAAA 4AULA 3H6HA 1PIWA 5JDCC 2ZJ7A 1P3Y1 3AC0A 4X3PA 3JATA 4G0PA 1PWEA 1TM1E 1Y6FA 3BBPA 5DLDA 4F4FA 2ZXUA 3C16C 4DIOA 2MMGA 4XCXA 1FNMA 5ITVA 4DEXA 4JEHA 2UYOA 3UJNA 5J4VA 2UYHA 1YR1A 3UVEA 2LCIA 3SPXA 4R71A 1SOUA 1Y42X 3T3HA 3HWRA 2HWXA 3T5BA 4K2HA 2HIHA 2ZAYA 4FX2A 3FH0A 3N9IA 3HHEA 2UAGA 3FI9A 3TK1A 4Z6KA 2P2LA 1ZCBA 2DJ5A 2ZRJA 2J07A 3N2ZB 3I73A 3IE2A 4FZJA 5K6AC 5IJXA 3PHHA 3A1NA 1CDZA 3CZPA 3VI3B 2HSGA 3WKAA 1V6AA 3LT4A 1JTFA 4AUKA 1AU9A 2B78A 1YR3A 3HACA 4RVDA 5A0TA 1Y5IA 5FUXA 1RHJA 2H0AA 4IIDA 1RRFA 4YAUA 4QLAA 4OATA 4V2IA 3QV2A 4WEOA 4HWOA 4ZI7F 3UQYS 1J2RA 3KR2A 3SX4A 5JALA 4HXYA 4CMHA 4RPJA 1TQ8A 2P9GA 3DOIA 3J81k 1U8CB 1V8BA 1ZVJA 1Q3TA 1WKCA 3FCUB 3RS7A 1NX6A 5K7SA 2AEMA 2WFLB 3BWBA 1X13A 3FOCA 4BNDA 1ZKDA 5A2GA 2IYRA 3H2GA 1CCWA 3PWZA 4FQ8A 2A6PA 5JVDB 3I01A 4OQXA 3Q7PA 3ZZUA 4B4VA 5JC1A 3KG2A 4YRTA 1LS6A 5B37A 4DLZA 3LTNC 4L50A 1SBZA 4M22A 4E31A 4PQFA 3IL2A 3RRMA 3H8JA 4Q6BA 2YFYA 4MV3A 5MN4A 2NUBA 1L7DA 1RRGA 1WV1A 1WBJB 4M0LA 3KAQA 3Q8WA 4C1BA 1OFHA 4D5GA 2A57A 4EO4A 5ADVA 4AJLA 4GI1A 3KNZA 1MQSA 2OSVA 1U2RA 2QL5A 1D6NA 4JKYA 4ZIRB 1NSYA 3OY7A 1K6MA 2W7TA 3ELWA 5CLQA 3U0VA 5IJWA 4BMVA 4N3AA 1QHFA 3NOXA 5TDHA 5HKOA 4LZZA 1DJPA 3IHTA 3OFNA 2CHQA 2QVGA 5BRAA 3CUSA 4L8YA 4LOKA 1C9EA 1QRUA 2NU8A 4YAJA 1PJAA 4WERA 3D6MA 3PFBA 4ZI3A 3HCEA 1GQSA 1KYYA 4CMCA 1Z5ZA 1KMNA 1PNTA 3LC7O 1FFEA 3GEDA 4F86A 3KUUA 1O97D 3DB2A 3LA6A 3Q2IA 4UVIA 4YDQA 1OXVA 3FVVA 5LDHA 5DX0A 1T8PA 1M6YA 4FEGA 1LX7A 2OENG 2RK4A 4PAGA 2ZIXB 2XBLA 4S3MA 5EVJA 5LWHA 4EYOA 4BKOA 2WIAA 1FFXA 1NVEA 1JJVA 2PTHA 3BMXA 3AUSA 3KCQA 4JKOA 4MS1A 4PX9A 5D00A 5DYIA 4HKTA 4ZDWA 1G63A 1YZFA 2RARA 2WJYA 2W2PA 1AF7A 1GQ2A 2QI9F 2QM3A 4MRMA 2I9PA 2NMVA 3QITA 2ZPAA 3P0JA 4CM9A 3KV3O 4GH5A 3DBRB 4C2AA 1P7YA 2IUSA 4M37A 3PRKE 4WZAE 4XGQA 2YBDA 1E5LA 4HWPA 2C98A 1LDYA 1RWPA 4UAUA 4KFUA 5G0WA 3RABA 2DOKA 1IZZA 2MJLA 2VHXA 3F6EX 3G3EA 1D4OA 3G2IA 3FROA 3HRHA 1IHYA 3GVPA 3VXKA 2R8YA 1WXQA 2XCRB 4YMIA 3RO7A 1F4PA 1NA5A 3LL7A 2Q6IA 3K1TA 2YWXA 3ZX4A 2LDXA 1WOYA 4KAJA 4B83A 1L5QA 2EEPA 4I55A 1XLTA 1JU3A 2J9ZB 2RBEA 2FUNB 1TZ2A 3EIEA 1Y7HA 1OGJA 1KVTA 1YBFA 1DADA 2OXEA 1XMPA 4R0MA 1GY8A 3AV3A 1EG7A 2BTOA 4JCCA 2GPYA 5BV0A 2HA2A 1VYVA 1NBME 5A7HA 3C15C 4ALNA 1XHFA 1ISMA 1SBIA 3C5HA 2EJVA 1J5EB 4RHCA 4LYAA 4OMCA 4OI1A 4EHLA 2DECA 2PBZA 5C4MA 5L3SA 4U9UA 1FXWA 2QLTA 2X2OA 4REOA 3W0LB 3ROPA 5KYKA 2GEKA 4L76A 3EW7A 1F6DA 5IMBA 4AXBA 4ND8A 4WN3A 4YQYA 4E6EA 2XMBA 3A4IA 5JI2E 2GBFA 3FNFA 4ZAVA 2BZGA 2JZNA 2R8OA 3GLRA 4EI8A 1F1BA 1NI4A 1CZOA 3VO8A 2L19A 5IHPA 2BISA 3WNDA 1A8QA 3F2IA 5T8KA 2GJSA 4HSEA 1XDGA 1S3SA 2BM8A 3RF7A 3ZDFA 1G0OA 1O6CA 1VLMA 3O38A 2HM7A 2JIDA 4NJMA 4RXMA 5E4FA 3CNNA 2EWVA 4X7RA 5E3JA 5EHIA 3TZ6A 3FHTA 3AFNA 3TE6A 2Y1DA 5CDTA 1A8SA 2CXSA 1JI0A 5FRDA 3FTFA 2XY4A 3SC2A 4PFSA 3Q5EA 3DP9A 4M60A 4ZMBA 2VH1A 3LP8A 4L4UA 1R0SA 3UW1A 1RMQA 4DYDA 2W6MA 4WINA 1BXGA 3FWZA 1OAOC 2Z2ZA 1OBHA 4Y2SA 5JDIA 4GWLA 3F8SA 5KTYA 4K0RA 4AN0A 1GNPA 1SAYA 3FOBA 2PZBA 3KKEA 1A9OA 1GNVA 1THZA 2H59A 1SOWA 4OHYA 1Z7YA 5EIHA 3SZUA 4CFSA 1NKTA 1DC6A 1G17A 4V1CI 5IZ4A 1JIKA 3WJ7A 1DQYA 3KHSA 1L8XA 2O54A 1CV2A 4DS3A 4IQ8A 1WXGA 1ZOOA 2PVPA 4QWWA 2UUBB 4M9XA 3Q88A 2X6TA 1GGVA 2EHDA 3N86A 4G1CA 2D1RA 1JLRA 1QZZA 2XVAA 1N1DA 4GOJA 4FYYA 1O9BA 4G0XA 2A4KA 3G49A 4NE2A 4QUIA 5KKNB 2MU1A 3BD6A 4UFNA 1Z08A 1CY2A 3VJRA 3WKBA 4ZO7A 1V6SA 1EM8B 1K8XB 1J8VA 1TI7A 2YJNA 3GLUA 3ITNA 3MB5A 4MGYR 3RIYA 5CB6A 3AG6A 5K8IA 2ZUFA 1OFTA 1B4DA 3C3BA 1LVGA 2EW2A 3G59A 1CVRA 5IH3A 2J67A 2OQIA 3ZX5A 2D5BA 4INPA 2IPOA 3V4LA 1JN0A 3UK2A 1ANKA 3SC3A 4CUKA 5DTIA 4XSHA 1KJZA 3DNPA 1U0HC 5K8JB 1ZFNA 1KFBB 3E4DA 4GI5A 3PRHA 2CMHA 4UUBA 5JCOA 2PXAA 2H65A 2XYQA 2YNMD 3OESA 4MVJF 4ZK6A 5K0TA 3VTAA 1N3IA 4X6YA 4LDPA 1GG2A 1QFXA 2QRJA 3AHGA 4MULA 1STOA 2VQ3A 2CWWA 3OZAA 2VT2A 3UATA 2QTZA 2YXBA 4CEJB 1VE6A 4PPYA 3TPFA 3GHHA 5DIZA 1RYMA 2JLVA 5DISB 3KUDA 1QHNA 1RW4A 1FDTA 1NQUA 4WJLA 3AW8A 1V43A 3AFGA 1NLMA 4M8NE 1TCBA 3L0YA 1DJOA 4H1VA 3TLGB 1IULA 3MT8A 4TT8A 1QMPA 3TEJA 4EJ2A 1O54A 3KVNA 2SNIE 4MX8A 1KI4A 2I7XA 4FE3A 4HDOB 3SR0A 1GV0A 3CB4A 1VC2A 4DYHA 1II8B 3KYCA 1BQ4A 3NV9A 4PR0A 1N6IA 2NZVG 3FMOB 4O4HF 5HRAA 3OIGA 4UQOA 4JJKA 4TUYF 1WXFA 2HSJA 3M70A 1LW6E 3P97A 4HGZA 2LZ0A 5IP5A 3M9WA 1W19A 4Q6WA 3HCCA 3ITKA 4B87A 4QOGA 4WVLA 1XWIA 1KPIA 1XDBA 2HV8A 3K9CA 1PT6A 3E5NA 3NHKA 3HZRA 1C7JA 3U1TA 1T6XA 2QENA 2M6RA 2IOQA 1O8BA 2X1MA 2QX9A 1HL3A 4RHFA 5DXJA 3LDFA 3S0JA 4IG4A 5E6RB 2A50A 1M34A 4KLRA 3K6KA 4IGKA 5IVHA 3JD4A 3GJ6A 5DNYB 4BEBA 4HQNA 2DSTA 1DIHA 4RTKA 2P9CA 3DE4X 3R6TA 4K87A 1IAQA 2I76A 3FPFA 4LVCA 3FLMA 3DMTC 1KBQA 2CJYA 2F4VB 3W2IA 1PJRA 5B6IA 5CA1A 1GNSA 1SC4A 1PJBA 4D4LA 3P2IA 2OHXA 3B1VA 4WNIA 3GIWA 3WBKA 3CEPB 4Y0NA 2YOGA 2F67A 3ER9A 1RE1A 4R16A 2VTDA 2W0SA 4CMIA 1R8JA 3DBHB 2OFFA 2QQ0A 2PMCA 5AW8A 3X3HA 3BH0A 3PA6A 5K3DA 4CETA 5CIYA 1W4BA 2C2ZA 2ONJA 4ZOLB 1J2JA 2PT5A 3PUVA 4Y2GA 4YNBA 5DVZA 3JZAA 1T0JB 3O4VA 3HM2A 4L95C 4MVCA 4DM7A 2J0QA 4IJMA 1I4DD 1UKBA 4CG1A 2MSNA 1L3BA 2GSDA 3OFSA 5HR5A 2O3SA 4L02A 1SKBA 2HRDA 3TLKA 5HGXA 5MN6A 1Q7RA 3QXJA 1CF2O 1YNOA 1LZKA 1SEPA 1TTHA 2YC4C 4W1PA 3OF2A 3CI0I 3WP1B 4B74A 4TVSA 1I3KA 4KPFC 3CM0A 3O6VA 3ZUGA 2R1UA 4PHFA 3EFEA 4S04A 3HXTA 2QVCA 2R00A 3D81A 3KLOA 5KDDA 2QBYB 2P0AA 1QQ5A 3WZLA 2FCRA 3G8AA 3OF5A 4RZ2A 3I4FA 4YJ2F 1BXRA 3DLCA 3ETDA 4P84A 3N3BC 1DAHA 2I99A 4XFJA 5HIMA 4MMXB 3STTA 4J6FA 4B2PA 5IH7A 1PVVA 5G0UA 3ZWNA 2QNIA 4F9EA 1YRLA 3SY8A 4NS4A 1PK9A 4ZRDA 4X91A 3HJTA 4Z4FA 1N75A 4OM7A 5IKEA 1J2EA 3FVWA 2WMOB 4GT1A 3IOCA 2QRMA 4IKPA 5ER6A 1GD1O 3GGJA 1FPQA 4OQ4A 5HW0A 3ZXYA 1SZPA 2XVYA 4NECA 3MVEA 4MKFA 4BRUA 1KMQA 1DKMA 1DUVG 3HPQA 4IH4A 2QTMA 3REQA 5LQRA 3A9RA 4YCSA 1IN1A 4BN0A 2ZG6A 1W73A 3CZAA 1EFRD 1ZIYA 1XMQB 4GX5A 4RVCA 3M4ZA 1VI5A 1UFRA 2PRJA 4FI3F 3TOCA 2ZU6A 1DHRA 3GJ8A 4WDRA 1JHZA 3ZGXA 4X63A 3S5JA 2P78A 1N8TA 3NT2A 5HQJA 1EUYA 2XRMA 2CVFA 1J00A 2FPIB 3ZZNA 2OV8A 1SD1A 4DAOA 1ORHA 2XVMA 1CY8A 1VJCA 2G5TA 2Z8YM 3LUKA 4HDSA 4X0EA 2CL0X 3FVQA 3IQIX 4UCQA 3DKVA 2W2LA 3IIEA 4NV0A 3SWWA 4URXR 3B5EA 1W6RA 4TKVB 4FT4A 1B1CA 4AY4A 1C5KA 3NDJA 1JDSA 1QIDA 1M6VA 2BELA 2BHNA 3ONEA 3QVTA 5AHWA 3ZXXA 1IHPA 1SRQA 3GVIA 4M0EA 1E1MA 2QM7A 3R7BA 3TEMA 3ZU6A 3AHFA 4B7ZA 2I5PO 2ODQA 4N76A 1Z45A 4RE5A 1QFJA 1QZTA 1XD2A 2YYAA 2ECKA 3SOPA 1J06A 3V1YA 4FYPA 1R6VA 3CWZA 1TEVA 3I0ZA 5JVDF 1U5CA 2O2SA 2G8NA 3LQKA 3K0FB 4IF6A 1W88B 2C2GA 2VTKA 1PQPA 3QF4A 4KSYA 4BB0A 4WGGA 3ZE1B 4AZVA 5AM0A 2I78A 4BRWA 1GG5A 2IGBA 1E6CA 1IHDA 4JY7A 5F2EA 3B6EA 3G7SA 2QGNA 1JVNA 3A70A 3EZGA 3K2IA 2PD6A 1KJQA 3EGVA 3NKFA 3O9VA 3S2ZA 2V6BA 1QONA 3WHKA 5DNUA 4DR7B 1YDMA 2ZIWB 1K63A 4ETWA 1QH0A 5BR8B 4Q1BA 5LQCA 1KYWA 2C20A 4G0WA 3SIPA 3Q0EA 1GUYA 1KFCB 2I6GA 3RS5A 5BWCA 1P8AA 3KALA 1RC1A 4MV7A 1QGYA 3U16A 3ESZA 1EJ2A 3BJMA 3OEHA 5CGQB 2J0UB 4TN1A 5BSVA 1IIBA 3TGWA 2A0KA 1O96B 4XUEA 2VF5X 1SBCA 2DF8A 1K5PA 2A5GA 3DE0X 5F3WB 3BA6A 2LTAA 3C14C 1RM3A 3MTAA 4FGKA 1J7KA 4HX2A 4P81A 2DPMA 1X7YB 4O59O 2WK1A 3I5AA 1X14A 4OU5A 1MC5A 3PKIA 5THQA 5B5SA 3GLHE 1WB9A 4W5QA 1NC3A 2YY5A 5EFOA 1RWXA 4E08A 1PJ3A 4EMTA 2JFWA 4AZ0B 5JQGA 1U9CA 2IZ7A 4KIUA 2CXNA 4LGVA 5HKKD 4S05A 1B8NA 2F59A 1PNOA 2ZYRA 5FNVA 1HEIA 3MGCA 3SEZA 1U7DA 3L41A 3NWEA 3WHPA 1EAMA 1HYHA 4DMLA 1B43A 1ECLA 5GONA 4KQFA 5FCDA 2X0NA 1WSBA 2AN1A 1M73E 1W0JD 3CX7A 3BWCA 3Q3HA 4I4TA 1AA9A 4Z0TA 3OIVA 2HYDA 3ESXA 2G9QA 4AK9A 4BLRA 2H1OA 1DO0A 2PZ8A 2UXDB 4D45A 3H0CA 1ECPA 3INRA 1D2RA 1Q12A 1DCTA 4AMZA 4ON9A 1TIPA 3QG1A 3NATA 2A8YA 3NX4A 4I9UA 4CCAA 2WYHA 4TMTA 1EEHA 2GB4A 3NC0C 4KL8S 3V1UA 5IJ0A 1JKFA 1AMNA 3GLFA 4O2AB 3VR5D 3E27A 1NW5A 1XC7A 2WWTA 1A1SA 3AYZB 2Q3HA 1HMYA 4HNTA 3INYA 1RPTA 2Q6TA 3LVBA 1H65A 2X8BA 2ZFUA 5FL7D 5L4LA 3C7KA 4KR2A 4MR8B 4RFSA 2XUQA 4OHXA 3FTPA 5U4XA 1NE2A 3IDZA 3WRYA 2H6EA 1JVSA 1AH2A 3MAGA 1G6KA 1Y9DA 3HV0A 1ZN8A 4KXUA 3WWCA 4XWWA 4BGIA 4UXIA 2GKOA 4NULA 3GJ7A 2VTBB 4Y30A 4TV9A 1ZIPA 4CGYA 4M6WA 1QQ7A 4M1KA 4OQNA 2G9UA 4TWBA 2PZGA 5JNRA 1AGXA 4DV4B 3DT8A 4LSGA 3TQSA 3H9JA 3VR0A 1D2NA 1OTXA 2JBHA 2IEIA 2CNBA 3K35A 3LXUX 4BNFA 2XE7A 3IUPA 1JHOA 4MI9A 2QTGA 3IIMA 1QTQA 2HSZA 4WFJA 3UGTA 4KR7A 5TJ9A 1C30B 2CKMA 4AYWA 1AQLA 5GIOE 3ZR4B 3ICEA 2VPQA 1JSLA 4AMUA 3PHCA 4IHJB 3U31A 1BKDR 1CUFA 1NYRA 4YUVA 3UCXA 3KPUA 3VKVA 4WJKB 5HJ2A 2ZPUA 2IK8A 1Y3CE 1QPGA 4KC0A 1SO8A 1QM5A 2C31A 2JGJA 3AEKB 3AP2A 1UP7A 2PSSA 3FGNA 3DFUA 3LUDA 1XDSA 1U7PA 2EG9A 2O4CA 4KNVA 1FSPA 3S40A 1YKGA 3HFRA 3P9PA 3VC1A 3V9AA 3GNTA 2Q07A 5AW5A 3TYXA 5JMWA 4IAOA 1S3FA 2F43B 4UDOA 4RA6A 3UCEA 3IAS6 3U4QB 2VPIA 4JUCA 3TNFA 1EE1A 3N07A 3KVVA 5FA8A 3Q2KA 4JT9A 1JU4A 2RC6A 3PJEA 1D1PA 1U1FA 1EVYA 4F1KA 3V6MA 1ZUWA 2CBGA 1ZD8A 2ZYWX 2R8BA 1BGXT 3UJAA 1EXMA 2GZ3A 3P4XA 2LE0A 1RWMA 2XUGA 3BC1A 3WKDA 4CDRA 1SUWA 1N32B 1KGSA 1S2GA 3PTAA 2IP1A 5BSKA 4JR1A 2GPBA 4OLAA 3QU2A 4UATA 2VYCA 4AFNA 4AQ7A 4JVLA 5DM60 1NP3A 3C3YA 1BRTA 1L4BA 4ZPXA 1XO1A 5FTKA 5BQOA 3ZNPA 2OYRA 1CJVC 2DKFA 1CG6A 1OZAA 3HWX1 3I6IA 5KIAA 4URYR 5LZ9A 3BOSA 3BE8A 4HSGA 2JFQA 2ZSAA 3OZDA 5FA6A 2GHQA 2GLUA 2X1HA 3GEEA 2H8GA 2I4RA 4HBZA 5DE3A 5AI6A 3EX7C 1REQA 2FRVA 4PLVA 1V8ZA 3P9ZA 4JP5A 1XROA 1BCSA 2XXAA 2P8JA 2AN9A 1XPRA 3FYDA 1Q57A 3ANMA 4V03A 4IXTA 3GDOA 2YWGA 3EMBA 1P33A 3R09A 3CSUA 2OV4A 1AV6A 3SHVA 5AVWA 5B55A 3MYYA 3Q6NA 1M72A 4ZT4A 2WJPA 2QYOA 2W6IA 2ZRDA 4JP8A 1Z83A 3NBQA 1YZVA 4CM3A 1NY6A 2FSVC 4HH1A 3NH6A 2VP9A 3PENA 4F4JA 5BWNA 1C3OB 2VP4A 3QFRA 4XM0A 5D1NA 3SQNA 3TLYA 3WQHA 3CGGA 2Z08A 3EUFA 4UPDA 4ZKDA 4Z9YA 2AJBA 2B4AA 3G2MA 2P4SA 2IXFA 3KWFA 1UMCB 3X44A 3KB8A 1J4AA 2W2NA 3K70B 2HMSA 3E2IA 2JJ2D 4TTQA 3B70A 3BX1A 2HJVA 4UZFA 1ZCJA 1P3JA 1F2UB 3TPCA 1IJKA 4UHKA 2J3MA 2P41A 5ICCA 2ZRFA 3MMNA 2FPGB 5JRDS 3ICQB 4Y9UA 3N2KB 4F5YA 3VNUA 3GLIA 2CJPA 1V5IA 3TO5A 4N65A 2ZQZA 3FOZA 2B20A 4OFZA 3ND5A 2NUPA 3D6JA 4EENA 4G4SP 4Q5IA 2ZKLA 3VR4H 4LUCA 4WKNA 2JEYA 1YR6A 1V8DA 4UNNA 1BSVA 4H60A 3LG2A 2WFMA 1PTJC 2V9CA 1S02A 2M6KA 3T9CA 4BNWA 1AK1A 1G7SA 4EUKA 1BEUB 4MV1A 3UXEA 3LVFO 3Q2OA 4EZEA 2KM1A 3R0ZA 5HIAA 3F9RA 4CQNA 3NIGB 4UZEA 3VPHA 4G5QA 3ZVNA 1JG6A 3UYKA 3JQEA 3WMEA 5LB4A 2VF4X 4UUQA 3CV3A 1G8KA 4OQFA 3LRXA 1JSRA 4Z4HA 3VHXA 1H3NA 3CZ9A 2WSYB 2ANBA 2CXPA 4QD3A 5AT1A 3CFAL 4F46A 5JDCA 4LX8A 1YFKA 4Y1RB 5CVJA 1J21A 3PI6A 1GPNA 3BTSA 4MA5A 3DT9A 2LD4A 5BP7A 3CIFA 3SP1A 2N3ZA 5IX8A 4LFAB 5KJFA 4ZAZA 4UUOA 1JTEA 1YZLA 1BU5A 1BDBA 2ZPTX 4F12A 3WWPA 1G60A 2G09A 3EDQA 4OOFA 1V2HE 2O0KA 1VPWA 3CYFA 3CBGA 2Q41A 5KSYA 1MOZA 3ER8A 2IS6A 4U0KA 4QPJC 1DQRA 1H42A 1C1DA 2D62A 5K6AA 2FA9A 2Q29A 3QXXA 1OV4A 4G0MA 4JYCA 1OTYA 2CB9A 5FTLA 5ALYA 3LV8A 2IRWA 3A1UA 1SHZA 3IEXA 4KLNA 4MK4A 4YASA 2B94A 3DC7A 4X6UA 1UKVY 4UU8A 2DR0A 3VYUB 4M1WA 4JWTA 4X85A 5IDXA 2B4RO 2FWAA 3SICE 2QN7A 5JJKA 4JA0A 3VPGA 2HUPA 1E9SA 1N4DA 1XD8A 1F60A 1Y37A 2EAUA 2JIBA 2ZR7A 3C4QA 3CLRC 3G17A 4N8EA 4QEKA 5KPJA 1W49A 3STXA 1K0FA 1BE1A 4OHBA 4UBMA 3RSGA 4PZPA 2O5CA 1OLXA 4RDIA 2XD9A 4KX5A 1EZ1A 4P3OA 3QENA 3T3NA 3I37X 3VYSB 2VDRB 2LDBA 1RRCA 2XKBA 2W6PA 4RA9B 1YS2X 4JBGA 1FXWF 3H2JA 5EJEA 3ZWPA 3ZCQA 1H85A 1G3IA 3OTIA 1JR3E 5D3MB 4E5SA 1P5ZB 5IEJA 1CERA 3WL3A 1GM5A 3L1HA 1ZQ1A 3M1YA 3UHPA 2NXWA 3F7OA 3T34A 1BW9B 2B36A 1NRXA 2OD2A 1TIBA 1UMBA 3EVEA 3OKAA 1ZGBA 1KZYC 2FRDC 3DTYA 1MR3F 1EFVA 2E87A 3L0ZA 2I8CA 3WRXC 4HX9A 5HK9A 4LZAA 3BMCB 4NYJQ 2CHVA 2XSZD 4MWTA 4CKEB 2PQ2A 2VJYA 4YIHA 4HNGA 3NUGA 2IOFK 3IB6A 4LQDA 4GKBA 3TLXA 3UF0A 2ZDQA 5DFAA 3P4YA 2QU7A 2ECOA 2O07A 3AV0B 5DCWA 3S3TA 1G55A 2ZRGA 3F5FA 1I6LA 3KJZA 1RS0A 3N2NA 4KRFA 2PKXA 2GR7A 1DIRA 3FN4A 4J4BA 1MD9A 2ETVA 2HMWA 5LPNA 2P4QA 5ESWA 3SHWA 1UBLS 2YDXA 1GU1A 2WJHA 3EAFA 4PANA 3KM0A 3TN7A 1A9TA 1JSXA 1V3UA 1OH8A 1G9TA 3FFAA 3HJCA 3ZDBA 2NP6A 2V65A 3IVRA 3UW3A 2VHWA 3AY7A 1JGTA 3W2GA 5L95A 1HEYA 2AE2A 4MWDA 4GI2A 1SXPA 1O3YA 3NB0A 1V45E 4KG7A 5EJGA 2W83A 5E1DA 5TB5A 2Z3VA 1Q0UA 4MA0A 3LUJA 3FZNA 4ER3A 5A1TA 5ELMA 4D44A 2R6JA 2GYUA 3BKXA 3F9IA 4FQ7A 1HI9A 3HWSA 5CT6A 4I1UA 4N0MA 1JJFA 2N0SA 3ADBA 3GJTA 3PKZA 4U7JA 5EJ8A 1E7MA 4CM4A 1FBTA 4Y6PA 3CZQA 2NYUA 3GNSA 1T2FA 1OYYA 1RQXA 2P2NA 2J6HA 3ZXSA 1F2DA 4N3NA 5GOZA 2N42A 4IIHA 4M89A 1T6YA 3DNMA 1FFBA 4KP7A 5BSHA 2GAIA 3SU8A 4LF5B 2LGJA 1T0HB 2HPAA 1XU7A 3UUWA 1BVYF 3MAJA 3VSBA 3MJDA 1DAMA 2WJ6A 4ZQCB 4AJ4A 4FSXA 2QSYA 3RVJA 3FNBA 5CVUA 4C88A 2D4AA 3WL8A 2WW8A 2OCYC 1X1EA 2VWPA 10MHA 4FM9A 2ACKA 4I8IA 3MWDA 1JG3A 4YBZA 4HPJB 2YJGA 4GLFA 2GVNA 4B80A 2PR2A 3CW8X 3H1FA 4S1WA 2XZTA 1UWVA 3ZWCA 4CG0A 4EUSA 1NNEA 2AZMA 3E8XA 1ZOIA 5L3ZA 2AR0A 2ODTX 4G4JA 1FDUA 2D0DA 3PLRA 2WWGA 4D98A 2XTAA 5ITZB 3OOSA 4P31A 3L7NA 5JYBA 2DT5A 3NR2A 3GEIA 3B3JA 1RHRA 4CQMA 2GD1O 5FL3A 1GADO 3NZEA 2NU9A 4FDVA 1Z35A 2FGKA 3ICWA 2QMYA 3OUTA 4O2RA 5C7YA 3G13A 2O8EA 1OAOA 3HXMA 3GEHA 3JVEA 4KXNA 2FG6C 4L4ZA 1OWNA 1PO7A 4QRDA 5F21A 3MFYA 3R7DA 5J2UA 2ZI4A 2WI8A 3TAUA 4E2XA 2CNKA 2LRHA 3HUTA 2JGFA 1R3UA 5I7SA 3D0QA 3NRCA 3BB3A 4HQKA 3MB8A 4IVNA 1UANA 4M55A 5PNTA 2XT9A 4WRRA 9ABPA 4O2BB 4JI7B 2O5EA 2AH5A 4MTLA 4D3XA 5JSKA 3H04A 3LX4A 2O05A 3STUA 1H2EA 3RKRA 4MI1A 2V9PA 2QZSA 1X42A 3RE1A 1MO4A 5D5PA 1XN1A 1AZLA 1B3RA 2O20A 4C87A 4UOEA 1DU4A 3BGIA 1NPTO 3THOA 5TMDA 4ED9A 1FXSA 3WYNA 1G1MA 2WF5A 4OEHA 2WTUA 3DVRX 2JG3A 2QKYA 4L16A 4BLWA 2P1ZA 2EHJA 5CA1F 1Q1QA 4Q1VA 3E3NA 3G8YA 1L5WA 2WG1A 4P92A 5JCJA 3W9YA 5EXXA 1AKMA 3JRXA 1NF2A 4R3UC 3SZ3A 1KYXA 3G02A 3NHUA 4YQEA 5LFAA 4GMKA 4TWJA 1R1DA 1P72A 3ABOB 5AIAA 3JTEA 2ZIUB 1Y63A 2PGXA 4LSMA 3UNXA 4EKNB 4R8SA 4F3CA 3KZ1E 4OVKA 2VQEB 2EQBA 1ULUA 4N18A 1P18A 2YIDA 1NW7A 1PEKE 5KWSA 3OZUA 2I1VB 4RY2A 4CJXA 2X0IA 4LK2A 1GFSA 1P91A 4AP5A 2CUKA 5ECYA 1L6IA 1MUUA 2D06A 2PUTA 1EUZA 2HSEA 1EPUA 3C1AA 5F35A 4FNGA 3K31A 3L0SA 4DQKA 4H4EA 4JI0B 1DAIA 1PFKA 3KWMA 2WR8A 4OFXA 4ZOBA 2EARA 2CDCA 4DIUA 5DYTA 5JECA 2VWGA 4MXDA 4EHJA 4BQQA 3CLVA 1CR6A 2VJDA 4L0QA 1CXZA 3IUSA 5AJHA 4EMUA 3TR6A 1JHAA 4X20B 1I5OA 3IPXA 3EN0A 3LWNA 4G1BA 1EAYA 4TV8A 4A03A 2XD4A 4MAAA 5AW1A 1JHPA 3MN1A 2AEJA 4IZOA 3M9XA 1QJCA 4WE3A 1JZQA 1W36D 3AFIA 3K8ZA 1DEAA 4MVJI 4FN4A 4LJAA 3K1AB 2OY0A 4RS3A 4UNIA 1A9ZA 3D4OA 1NQWA 4QPCA 221PA 2DHQA 4E2WA 3F96A 5A5GA 3II6X 1G4HA 1W5TA 5KSZA 5GJCA 2MWMA 3KWJA 4YJDA 4G41A 4WCFC 3RASA 3P94A 2HD4A 3IHKA 3JAWA 4MP8A 3TINA 4YT5A 3KR1A 1SXJD 1MAUA 1OLSB 4E2FA 3VOBA 3NFYA 3A10A 5EAIA 4PRKA 1BRMA 1Z25A 1RWWA 4FKZA 3S44A 3WGJA 1WB4A 4XLTA 3L6RA 4R6XA 1W5AA 1YUBA 2W93A 4PW0A 4R51A 3VVMA 2OAEA 1P17A 2WWFA 2YVUA 1UJBA 3M6VA 3RRBA 1JA0A 4B9AA 4LNUA 4PHCA 2GCPA 4TTTS 2PLNA 1GL9B 2XNDD 2QA5A 2IHBA 2WTMA 1C3XA 1FYEA 1NLYA 3KUCA 4LOHA 4YWHA 3D7SA 3IAHA 1GPBA 1K2WA 1J97A 1VE1A 2ODAA 5A02A 2XGOA 2NTYC 1N34B 3DMTA 4RANA 1ZMOA 3ORHA 1EUDB 4IIEA 3ZTWA 4NF2A 4OGKA 2GAOA 3N8IA 2X77A 1U2SA 1GNRA 1OX4B 5EGNA 3R74A 4KO1S 4YRGA 5CT8A 5AVUA 4L5AA 2JFUA 3EJ6A 2O7SA 1KK2A 3ILVA 2ZR0A 3A6PC 1WKBA 5T4HA 1I3MA 3KHUA 3ZE2B 2WU3A 1N8NA 3PC2A 4F3YA 1TM5E 3SJBA 3GRAA 2F1RA 1YF3A 2BEWB 1T1EA 2REQB 3ACBA 3PDIA 3BRWA 3TUIC 4MS4B 1M75A 4OUDB 3UWSA 4DTIA 2P2SA 1A4XA 1DC5A 2HB6A 4QT0A 4W99A 5CK5A 1QIJA 1N4AA 3UAYA 5EWLB 2V1XA 5JC8A 3DZBA 1PK8A 4Y9DA 4E7OA 1G2OA 1I0IA 1L9KA 1P2TA 4Y6OA 3RB8A 3PDUA 3R20A 3WAKA 2VZ8A 1NFFA 3CLTC 2WUEA 1G291 2G0AA 3DDWA 3JQBC 4A6PA 2NZUG 1YUMA 4L7QA 4WMLA 4OHFA 4YJ3A 3B7PA 4K05A 3QYFA 4RTJA 2H51A 3QYJA 4NBSA 2H3EA 3TRKA 4AY6A 1EFTA 4UPEA 3K0AB 1L4YA 1Y8AA 4LJLA 2XXJA 1OJLA 2X6QA 1DTWA 2J5RA 1C0LA 3UY4A 1SRRA 2PVSA 3A1DA 3MMSA 1VL5A 2AQIA 2ZE5A 4MWZA 3PQ5A 1N2OA 1Z8NA 1MQ8B 5AXBA 1DLIA 1DC8A 3KKQA 3ZLUA 2I4NA 1FU7A 2WVGA 4DV5B 3FSRA 1FP6A 4QE3A 4QXQA 5AWFC 4M7WA 2N46A 3RYCB 3CVUA 3FZYA 4LRQA 2G17A 5LBIA 1QAQA 1Z82A 2GYYA 5K2OA 2CCGA 2Z9CA 2ATCA 5ES3A 1T8SA 2B69A 3I30X 4PVCA 5EWMA 3CZ4A 4K6MA 1SVIA 2G16A 3RT1A 2F8TA 1C8BA 3Q9LA 4UTRA 3QG5A 2ZIAA 1T5IA 3P9IA 1JX6A 2RSLA 4JZYA 2C04A 1G7TA 3DO8A 1I2BA 3K6SB 4KLZA 1PFGA 5L40A 3IQWA 4HN4B 3HL6A 1RHQA 1NVXQ 2BRUC 1RXSA 1YULA 1T4BA 2L17A 3OOWA 4NEHB 5JQWA 3U7GA 1TA4A 4KH0A 4WOCA 2BHSA 3AI3A 3M34A 4PNPA 3VU3A 1Z63A 2I03A 5GONF 1HZJA 2NX2A 1NJ5A 3FF1A 2UVQA 4WLOA 1QRRA 4QDJA 4QTTB 3DEIA 3ZIDA 5FFFA 2PD4A 3CX4A 3EJWA 2Y0BA 1BVHA 1VG1A 1OZ0A 3SD7A 2F62A 1THMA 4CRWB 5BW8A 4OIMA 3LFHA 3BQ9A 3PF8A 4RJKA 3BWXA 1I2DA 4L57A 1DWQA 1E2FA 3FETA 3STHA 3GLFB 2O0HA 2J5XA 2VP0A 4LHVA 1PZHA 2C4UA 2F9FA 1U9ZA 2FOXA 3DCIA 1YRWA 3KHTA 4PYNA 3QIAA 3PLAE 5EESA 1OXSC 1YS1X 4RM2A 5DTMA 5LCXA 1GPJA 4KXMA 4ZYLA 2NAPA 2QRGA 1XMXA 1RJWA 2ZEJA 3KPYA 1LQTA 2O2YA 3S81A 3A6HA 1YACA 5BN4A 3JQGA 4O1HA 1MJFA 4Z3OA 1KYZA 2I54A 2JJ8A 3DV0A 3WDKA 4DR1B 5LQJA 5K0GA 1GZVA 3GHYA 2CUNA 4W5WA 3OOHA 3TW6A 4YO8A 1NIJA 1DI0A 1GNLA 5COQA 5DWQA 8ABPA 2YHIB 2QTWB 4JFRA 1ESDA 5BRJA 1ODCA 1R5BA 1E9EA 2P2DA 2HCBA 3EYAA 1T3GA 2QG4A 2HA6A 4GI3A 4LRWA 2FR1A 3UJ6A 1YZNA 4R1MA 3LRPA 1BQEA 4N3GA 4AW9A 3KTAB 3N2IA 4ZU6X 3V8VA 2C7GA 5JATA 1EGQA 3BSWA 3PCXA 4HAXA 3ZZ1A 4KAXA 2EBUA 2ET6A 1FU4A 5L3VA 5LLTA 2EZTA 2YRXA 1N2XA 3LXMA 2WWRA 3MJVA 4JLJA 3EE6A 3N0TA 3MWYW 5JAQA 3RS9A 3HYRA 7MHTA 2AFRA 5BMVF 4MW2A 2WF9A 2XUPA 4DC1A 2PANA 2VS1A 4EUEA 2P5TB 2W00A 5AK5A 1UT5A 4JYAB 3OUZA 2GA9A 2VDMB 5K0LA 2GASA 2JGRA 4C4YA 4C20A 3DE1X 1EBBA 1QP4A 1L7QA 1N6NA 4HB4A 4V39A 4RORA 3FCXA 1G5IA 1VL6A 5FI5A 2UXBB 4TOIA 1EESA 3EAQA 1BH2A 3VH1A 3Q7RA 1ZA2A 2ZB4A 1HBJA 2NO7A 2GPAA 2B2XA 3BUSA 4EFDA 2XVXA 2C5EA 4F1JA 3LHIA 1VKOA 2FX3A 3ZY4A 3G2JA 1QYCA 3OSUA 2C9MA 2BBWA 2CXXA 4CWAA 1Q0ZA 4XWYA 4AKGA 2A5JA 4F2GA 3GFTA 3OZWA 5BQPA 1ORIA 4KN9S 1U1IA 2HJGA 2SICE 2W90A 3M7IA 1I10A 1ZXBA 4HY3A 3NHBA 5GZ3A 3RVMA 4Q4HB 4E4RA 3TZCA 2BTEA 1EX7A 4P5PA 4Z53A 4DJ5X 3O8QB 4DT1A 2FMXA 1T6BY 2PMKA 2QMHA 3KCNA 1IEQA 3OBBA 1E58A 3WSTA 5MF6A 4QXOA 5D5QA 2XZPA 3LZDA 3R5XA 4DVJA 4LCEA 1GCOA 1TU4A 3AY0A 4KO2S 1GP2A 3RVLA 5C9ZA 1TTQB 2PLFA 4XRGA 4UNRA 5A0VA 3CR8A 3OT5A 5AOCA 3GAMA 2HMTA 4NV3A 4YECA 5IAKA 1GGMA 4X95A 2VR1A 2Q0XA 3OWXA 1G66A 2ECQA 1XSEA 3ET4A 3L43A 3OECA 1I4EB 5JI3E 2EYUA 2IS4A 3NBKA 3A14A 1Z22A 1X8KA 5JAHA 1TAUA 1L4UA 1JALA 1RYDA 4NABA 1JR6A 4OU4A 2AG6A 5TMEA 1C4XA 4HHEA 1ACJA 3CW9A 4UKDA 4BKRA 1IH8A 4AKHA 3UJ7A 2MIIA 4MO9A 3RS4A 1JIUA 1NP6A 4QEDA 3MRVA 2UYQA 5KREA 5IWAB 3MBOA 1Z6TA 4D6XA 1LY1A 3U44B 2MMCA 3H4TA 1AGPA 5EWJA 3WS7A 3ZYCA 4OA5A 1HETA 2ILTA 5EUBA 7REQA 3BXPA 2ICAA 1PW5A 4C0WA 2OQ2A 2ZIXA 3UHJA 3O8RA 1E79A 1PG5A 2XCIA 3V1LA 2O0MA 1PR0A 1VI2A 4R8LA 4HAIA 2KE5A 4UHDA 2WTNA 3GA5A 5DTQA 2QUHA 1QWOA 2QPOA 4BO2A 1B42A 3B78A 3C3WA 3I01M 4ZWNA 4MQLA 1EFPB 1FU8A 1ZN9A 3WP0A 3ZI4A 5I7VA 1Y8ZA 4NFLA 5KU1A 5DLYA 3QBEA 3OQNA 1I6WA 4Q3CA 2XEDA 4GBJA 3WE7A 4DYVA 3AJDA 4WV3A 3SJ7A 2EL7A 4Z7QB 3UT0A 2F1IA 2ZBUA 5H3LA 4XWKA 2UZ4A 3D2LA 4FDMA 1UK8A 4WNAB 2I2AA 3HKCB 3F4KA 5TF4A 1ECGA 4QVKA 1SVLA 1D1QA 1W87A 3HGQA 3KJEA 3DO5A 3NHFA 4A26A 1E63A 3WDSA 1JIXA 1E2MA 2QR3A 2G25A 5I9LA 1IZ0A 2CLSA 5CXQA 5FPSA 1ZM9A 4A8JA 2JF0A 5JFGA 4OXKA 2PX6A 4QZVA 3BHMA 1PT7A 4PX3A 4FLMA 1Z38A 4PSUA 4O4IB 3E3MA 4C0XA 1KIFA 2PDAA 3FLAA 3VGPA 1TJ4A 2Y1CA 3WX0A 1A50B 4NP6A 5B58T 2B1IA 3ILYA 4P82A 2QTNA 2ZYTX 4LKOA 1G2IA 3KOMA 5FV4A 5DULA 1SCJA 1KETA 4B6RA 1BX1A 3E5HA 4LOLA 1JAIA 2GR9A 3VKFA 1HDOA 1GN8A 2ASEA 4R83A 4ID3A 2ZRMA 4I1YA 4YMTA 5BMVA 4DFDA 1B8UA 2YZGA 5CFRA 1V5WA 3OFKA 4OIFA 5ALUA 4FPXA 1ZHFA 4I14A 3SBEA 4NDZA 5FLEX 1Q6ZA 1HSZA 4OYYA 521PA 5IVPA 1FQKA 2R1VA 4U8GA 5AVOA 3Q3JB 2ZDGA 3NW9A 3SKVA 1VG0B 4YT2A 3QKIA 2B1QA 1IRIA 3P0EA 4YI5A 4BX2A 1TA9A 1KO7A 1U0FA 3H1GA 4A92A 4K3UA 3GRFA 3M5DA 3UUGA 2FSVA 4JVMA 4RKYA 1EP9A 3K09C 3WGZA 5LDDC 4JJ8A 3QQPA 1AHIA 3U3KA 4UDXX 1TU3A 1JQ3A 1OI2A 3QMPA 2FFHA 3LUPA 1NMQA 4IOLA 1HE3A 4R3NA 3LY7A 5YASA 1W5EA 2OAP1 2JIOA 2XA9A 4JYMA 1ZZEA 2Q27A 3CE6A 1T1GA 1CD5A 1N7IA 2JAQA 1CEXA 2DTEA 2II6A 4MRRA 2G82A 2X58A 1M2OB 1ORTA 1PHRA 3EMVA 3EXAA 3WJAA 4BKUA 3M1AA 4HUTA 4KQCA 3A06A 4OH7A 1PV2A 1GTZA 3DMNA 8LDHA 3MIIA 3REFA 1E6WA 3OF3A 4EFNA 2Y2UA 5I7AA 3ZQJA 4CKWA 1DJLA 4BBPA 1J5PA 4N5DA 3FBGA 3AM1A 5IF3A 4Y2QA 4H35A 5LIRA 1D8AA 3F5DA 4P4TA 1V8PA 4JJ7A 4H7DA 4ZVTA 3KQYA 4MV6A 2VSNA 1II9A 3PEWA 1R6XA 4EHFA 5CLLA 5AVYA 1I1NA 3DFFA 3DTVD 3TOZA 1T4DA 1PTJA 3D5QA 3CLSD 4BB5A 5A5FA 1FTGA 1K5HA 1TAHA 1NBAA 4JOCA 2O3UA 4RSHA 3SEFA 3HDQA 3PNSA 2OL4A 5F51A 1IK6A 2WWHA 4R9SA 5BN1A 4NWIA 1J0EA 4J9VA 1Y34E 3VZPA 4JITA 1L5OA 1XVIA 3BSFA 2C2WA 4JT8A 2PH3A 1UBEA 5CX4A 1TCUA 3U7FB 3AY3A 5JRZA 1TVEA 1M2KA 4N6OA 2OQRA 3PPYA 2QE7D 2DPLA 2WJJA 5EOVA 2MSCB 2NZYA 5G1PA 3ZWYA 4WZBB 1M0WA 1P4JA 2CN1A 2CL7X 4KIJA 4PLPA 4NEQA 4QKQA 1GKLA 1QH1A 4XJXA 2ZJFA 4FR5A 1KEVA 1PW7A 1WPGA 2VHYA 1X7ZB 3FCSB 3RVRA 3S55A 3NDBB 3ANSA 4RJJA 4KE6A 3TG8A 2JIZD 4RFLA 1UBTS 5AKXA 5C7LO 2P65A 2VUUA 2LUOA 3H7IA 3QKSB 3R1IA 3ZD9A 4PYKA 1QVWA 4MV8A 1Q0QA 2OR3A 2R7NA 2UZ0A 1I3OA 3TLJA 2LW7A 3COWA 1AURA 1S2NA 2PGIA 3W4IA 2PJRA 3QQ5A 1O6GA 2WYWA 2OXCA 3LW7A 1W4AA 3FYUB 1U0EA 3COYA 4M46A 3RFUA 3RKUA 1II8A 4D9BA 3CC8A 4OGWA 3ISTA 4ZPJA 3U1BA 4IO0A 3HBAA 5AKLA 4RWEA 1M8PA 1NX9A 1EK6A 5IAOA 3K5PA 4KBFA 1V7CA 4PIVA 1EBUA 4D9KA 4EHDA 5B4UA 4RPHA 3VPDA 3TFQA 5HCUA 1DBVO 2RHRA 4JJ6A 4JQZA 4MCHA 4XD2A 4Q01A 4BIIA 4F3TA 2XWQA 4KXVA 2PSFA 3PNQA 4JI8B 4BIMA 5KYUA 3AU8A 3MTBA 4LOJA 1AKTA 4FEAA 4BNTA 4GG1A 3ESQA 3A6EA 3N6VA 3PPIA 4HN2A 4MPJA 5E7JA 1YA8A 2AXNA 3U7IA 3RAFC 3NONA 1SA0A 2V7WA 1N33B 5AK4A 5JNUA 2EFJA 4BO0A 4DNFA 2C84A 3CZMA 3KDAA 3AVQA 1RXCA 2IYYA 1LBEA 1DQZA 2A92A 5EP1A 1UKEA 3I9JA 3V2HA 1D2HA 1QRDA 3MMZA 1Z0AA 4PGAA 5CT5A 3RGWS 2QJFA 4IL5A 3URMA 2PV7A 3JQAB 4G4GA 5GIPE 2BCEA 3A1EA 5D8DA 2W48A 1G98A 2Q62A 3G5TA 3L2OB 4E51A 3GOQA 1GU7A 3T3EA 4Z1MD 1ZK0A 2FRDA 4X93A 5ADHA 1Q0PA 3KSRA 2NT3A 5DCUA 2WY2D 3OHPA 3WRXA 2Q5HA 1JMVA 1I3LA 3T15A 1JU9A 1ZCFA 5BUQA 1C8KA 1VSBA 2QTFA 3O21A 1DFIA 2DU8A 3QPUA 4DCTA 2PGNA 2QRVB 3E3LA 3OOEA 5TF0A 3U62A 4DANA 4H7FA 1LPMA 1RCUA 2MSKA 4F91B 3F49S 5ALJA 3OMXA 5I8WA 2O2GA 2EKDA 4ZZ1A 2VJPA 2QLLA 3ORYA 4M98A 2IV2X 5CB8A 1SUEA 3F6YA 1XT6A 2P6OA 4S1NA 2QGZA 4YCAA 3B2EA 2WSSA 1QORA 2PFGA 3Q7IA 1YE3A 4WLUA 5DCYA 3ZBPA 1T34A 5LQAA 3HLTA 2G07A 4ZALA 3W8FA 2AFHA 3J7AC 3MS2A 1HDIA 1PJ8A 2IS1A 1CFZA 3H6GA 4H59A 1MRZA 5JSZB 4RY0A 4EDHA 4HNHA 1CIJA 2J7PA 1OSNA 1SPBS 5I9BA 1LZLA 1Z2NX 3TAHA 4DOMA 5J3JA 3K9NA 5K0NA 4Y8VA 3Q4GA 3WQBA 4ND2A 3E7PA 3VR5H 1G5PA 1MB3A 5T3UA 3PUYA 3RJ9A 1OYOA 5DMXA 3SM9A 5HQ3A 3VNVA 1AS3A 1C7ZA 1DBRA 1L1EA 4L2IB 4BNIA 1GPKA 1IEWA 2JAXA 2WTXA 1KOFA 4P80A 1DXOA 1EDZA 1KDRA 5FFMA 5I9MA 1X3SA 3QU7A 4D4MA 2ZR8A 5AUPB 4P98A 1DO2A 2CHFA 4GYKA 4D6YA 1KARA 1MEOA 1ONNA 2IYXA 1Z12A 3NTLA 4W9NC 5IDYA 3MERA 4FYWA 4JU9A 4FOOA 5GV8A 5K6RA 3CR3C 2RGUA 5JMTA 4OI4A 1PYGA 2VDPB 1W76A 1T9KA 4M0FA 3PHGA 2FPIA 1IMJA 1S2IA 5I9NA 1HV8A 3IMKA 4GQBA 1QHIA 1Y3FE 3CJTA 1H6CA 1HZZC 3RS2A 3EIOA 1ZH4A 2ZXFA 3TZEA 3CNOA 4Z9FA 3LQYA 2IYZA 1J0DA 1ADFA 3DKKA 3CEAA 2O48X 1B0PA 3HA2A 4YJHA 3ENQA 1G4UR 1U0RA 3AZOA 3HKBB 3TW8A 1XMVA 3ECCA 1YAJA 3HDGA 4XASA 3KLNA 1K98A 1U0TA 3VKUA 4MICA 3PQ8A 3LZCA 2IHYA 1X7XB 1YXMA 5HGJA 5DN9A 3UFBA 4AT1A 3KD3A 3VOAA 3R3VA 4KXYA 2BD0A 3HSSA 1E1RA 1WVMA 1JEQB 1XTSA 3BTUA 5LQSA 3JQ8B 1M6WA 3WLRA 3P2EA 2ILVA 2HA3A 3CF6R 5A5VA 2RAVA 3VU8A 3BDVA 2OHHA 4MLDA 5C1IA 1U1CA 1ZX1A 2HQBA 1VJTA 1OAKA 3G85A 2X41A 3LQFA 4AZ3A 3AJ9A 1RRMA 3KLMX 2EFYA 1E5XA 2NOAA 1Q20A 4Z7JA 4LGYA 4JUBA 3ZE6A 4FFBA 4M1OA 3GLIE 2PH1A 3U3JA 7GPBA 4RABA 3RQIA 1ZC4A 1NBWB 2EDCA 1GPLA 2CZQA 4TXLA 1XE3A 3EGXA 4DDHA 1KWGA 1USKA 1D2GA 4QUEA 4B75A 3PQEA 4DY4A 1K1EA 3ZS8A 3N1UA 3AK4A 2C99A 2CXOA 3AVPA 3MCAA 4GD3Q 5CYPA 4YMLA 2B5WA 2F90A 8ADHA 1BFKA 4HX5A 4IUBS 4YYZA 4QX6A 5H3HA 4BKQA 5CDSA 2QTAA 3ZV5A 1V1MA 4B71A 1TPYA 1V25A 2OCAA 2CYBA 5KO2A 3MA0A 1F6WA 4PZAA 1ISRA 3C7AA 4LKRA 3RI3A 1V96A 1ZIXA 1H2WA 1JDUA 4F7DA 4G37A 4KR3A 1YH3A 3FGOA 5A6SB 3W8DA 4HATA 5KZMB 3FM9A 5AXDA 1J42A 4CHTA 4HB0A 1VMDA 2WVAA 3PQ6A 4BNKA 1EX1A 1K8ZB 1TNDA 3NGXA 3BYZA 1FP4B 5HZGA 2QV7A 1U8ZA 3UAWA 1YJCA 4UASA 2C7RA 4E11A 2Y71A 4HT3B 1HRKA 1DZ3A 1FNBA 5CM2Z 1UDXA 3WL6A 1D9ZA 1V3QE 1POXA 1QYXA 4JOSA 4A2QA 1GT91 1MO6A 3ITDA 2GN9A 3JQ9C 4F92B 4HYQA 3QEAZ 3M3HA 5IG2A 4GBMA 3GZ4A 3TDMA 1T24A 3TDNA 5K4GA 2GZMA 3LE8A 2OCPA 3VDRA 4DCUA 4H17A 4MQBA 2HHHB 1FZQA 2V03A 4JL5A 2CXQA 3N7TA 1NMSA 5EE0A 3VPXA 3H2BA 4Q39A 1RHUA 3NMUF 4HQFA 1EFLA 3DG9A 2CK3D 3ZQUA 4O2AA 3DVSX 4IMRA 3AH8A 4B47A 1LDEA 4UC0A 2ZIEA 1WQ1R 4ZZ0A 3THWB 4KQ6A 3UA0A 4O4IF 4W5RA 4X90A 3EGEA 1M5UA 2RJNA 1JR4A 4MW1A 2WABA 3EUWA 2ZT6A 3ILSA 1UPFA 1FXUA 1RBQA 3PIIA 4P3YA 4UUMA 5CM8B 2FKAA 4BZPA 2FPUA 2FLWA 4DJJA 5FH9A 1GNQA 1M10A 4D81A 1WF3A 4CIXA 3DOEA 1Y4SA 4WCFA 1RYBA 1QX4A 2IBSA 1CUAA 1TK9A 2GI4A 2AEFA 2AEEA 2R47A 2C5HA 3ENKA 4Y2RA 3QIVA 5ENZA 2EFCB 2D2FA 2FDRA 4J1TC 1ZWKA 1CRPA 2YV5A 1KQ3A 4MIOA 5FV7A 1SUDA 1DELA 1ZW1A 4G3XA 4J9UE 4GX2A 2YHBA 1VIAA 4NG5A 4XDHA 1SVSA 1GPWB 3V80A 1A8UA 3PTLA 1JIQA 1LH0A 1DEOA 1XMJA 4CMKA 4M83A 4XB1A 1AM4D 3ADKA 1F2VA 2RKBA 1Q1NA 3O7MA 4NCKA 5H16A 5E38A 3HNPA 3AG5A 5JAIA 1FVOA 4G0YA 3BWYA 4QASA 2VPWA 5E9WA 3SFVA 5BOSA 1N7HA 2VP3A 1HNXB 1KERA 1SHKA 3VAYA 4KUEA 3ZJ5A 2K6GA 4R2IA 4KSCA 4Q4AB 2VXBA 4Y1GA 2VXOA 3W5IA 4B4WA 4TTJA 3WO1A 1VJ1A 1JKJB 3QW4B 4O0MA 4X8HA 2PUDA 4LI3X 4BV9A 5AHOA 4QYXA 1ZWLA 4U2BA 1QNLA 1U94A 1HDXA 3A7EA 3SZMA 2AC2A 1R64A 1FIUA 4PPQA 4RWZA 5LKAA 1QP8A 2OCKA 1KH1A 1O6FA 1UPXA 3MXOA 2QZ4A 3N6XA 3JWPA 3H9BA 2NXEA 3A37A 4B45A 4GP9A 2HCTA 2QMUA 2FG5A 3L4JA 1XCOA 1I5RA 2ZGVA 3JQBA 3GFQA 2BJHA 3VTFA 1MC8A 3UG6A 1WMDA 3KDSE 3EQ7A 4F8YA 5BWOA 4QELA 3JYPA 3I0NA 4PTZA 1UPTA 3ORSA 4C4ZA 5C53B 2IHZA 4FB4A 1SZJG 4NK4A 1KWKA 3WNCA 1LLFA 3QPAA 3AVTA 2W6JA 4FJ0A 5FORA 3ADDA 4K9LA 4HXGA 3ZIAA 2HA0A 3I8XA 2R8ZA 3NM4A 1MQAA 4MMYB 3GK3A 4XR4A 5AJTA 1K89A 1SCNE 4ZCIA 5CB4A 4A91A 1ACMA 2JCGA 2WF7A 4LY0A 4WA8A 1S1CA 3MUFA 1YK0A 4GMDA 4DR3B 4PU0A 1MLDA 4PN3A 3T61A 3EZLA 4B4KA 5BV2P 3QXGA 2PSHA 3EISA 5KUTA 4AWAA 4ZYWA 1SU7A 1A69A 2ENWA 3PC8C 4OBBA 2BGJA 3GJ0A 1G42A 5DX1A 1E0AA 3RC9A 2Q5EA 1OKKA 1PJQA 2H5IA 4DWWA 1JMKC 4NQZA 2WWYA 1IOVA 2E2WA 2ZSKA 4GXQA 2VWHA 3E7FA 4NPAA 1AXEA 4C6TB 5A3RA 3U6KA 3CO5A 1VLQA 1QKIA 3V9PA 2BRUA 2DAPA 4P7BA 4EVQA 1E6MA 4F4CA 2V0CA 3R4CA 4QLBA 2FZGA 4RLSA 3ZHZA 1UT6A 4B3JA 4YP0A 1RM0A 3HVIA 4CKXA 2VH5R 5AD1A 2BH2A 1ID8A 1RI1A 2B7BA 3JQPA 2R8RA 4LOIA 2WWVD 2XMRA 1LNQA 3IKMB 4KPUB 2FPGA 3UQZA 4WWHA 1QLHA 2WD8A 3KBOA 4ZXPA 2WWIA 4BKMA 2YVKA 3RADC 1IPEA 3HKDA 1N5IA 2JGMA 3KU1A 4G36A 4LDQA 2QAGB 2RETA 3DYBA 4M0PA 4JI6B 2JZOA 2AA3A 2QT9A 4RPKA 1I2AA 2ZJYA 5F9HA 3E2PA 3M83A 4I8DA 1AGYA 2YMPA 4EHBA 1P7VA 2WQZA 4F60A 5IUNC 3ZU2A 2JEZA 1M6NA 1FRQA 1SUPA 2FN4A 1RXEA 2W2XA 4LTNA 3BCHA 3PEFA 2LIPA 3DDUA 3HU1A 4A8PA 2HCFA 2O1WA 3DWGA 1QHGA 5CDGA 5ALLA 1H2BA 3OY2A 5EZ5A 3KQHA 1X0XA 2UUPA 1MJNA 2OFPA 3A6KA 4PLGA 4B79A 4D25A 4ARZA 4BGDA 3O47A 2DLCX 4DCNA 4YK7A 4KYTA 3K6RA 1IWPB 4DIMA 2GBGA 4L8LA 3G8DA 1L7OA 2C0PA 4DRXB 3O91A 4ZYYA 2QU8A 2BT4A 3HC7A 1KQNA 1US8B 4Y1RA 4KPGA 4LF7B 1V3TA 3UA4A 4P4GA 3FBTA 1FMTA 1C3JA 3CU5A 4TT3D 4UM9D 2FMKA 1T9GS 2GAAA 3ETHA 4RADA 3WIEA 1HSOA 1Z13A 1YVPA 1M34E 1K3FA 4LRTB 4B35A 4GF5A 3VJLA 4NXNB 2J48A 4ZU3A 1CYEA 1XPJA 1W85A 4HCJA 1CJBA 4FNOA 5HILA 5LKRA 5LYJB 1O97C 5KCMA 3ZCSA 5DB4A 3UMYA 3QE9Y 3GRUA 1NR5A 3C1TA 3T7CA 2I3DA 3FNRA 1QS0B 3SX0A 821PA 2WD9A 2NXJA 1NVMB 2ORED 2AF3C 1XQ6A 3Q85A 1JHQA 1LI4A 1X6VA 2DLDA 3H6KA 4LZNA 4KQHA 1FQOA 4OHKA 4L5BA 2O8DB 1IJEA 3E1GA 2E5WA 3EVTA 5KYTA 4A3SA 2FFRA 3AUYA 2R44A 3CRNA 4P7KA 2AFIA 1S9DA 1CQPA 2HRQA 4WASA 3E22B 3FWKA 2DSNA 1E1NA 3PFCA 2IXEA 3S68A 1H1LB 2FE1A 2WHRA 1NVVR 4MKXA 4O25A 3U3OA 4PF1A 1DXQA 4OHZA 2IUYA 1CR2A 1N6KA 3CNHA 3N2YA 4IFBA 1YL5A 3T0FA 4AZSA 5EUCA 3BQNB 2AD5A 1XCBA 3TOSA 3SZOA 2EXXA 3KQMA 4UEOA 3K8OE 4FWTA 2NADA 1JMYA 3DUFB 3EHEA 5TNXA 4JL8A 2QTCA 4E4YA 2A33A 2GCIA 4UVDA 4EW2A 4C2UA 1F38A 3RAJA