3ISJA

Crystal structure of pantothenate synthetase from mycobacterium tuberculosis in complex with 5-methoxy-n-(methylsulfonyl)-1h-indole-2-carboxamide
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
287
structure length
287
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Application of fragment growing and fragment linking to the discovery of inhibitors of Mycobacterium tuberculosis pantothenate synthetase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 88
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3isjA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3isjA01
2A1TR 1KP3A 4G5YA 2HZ7A 1TYCA 4OUDB 1GPMA 1F7UA 1K4KA 1KH3A 1QQTA 1VL2A 5KWVA 4NAUA 3A2KA 3DPIA 4X0EA 2H2AA 5TEWA 5KCMA 2WQ7A 3CLSD 1GLNA 3ZJVA 3IVXA 1X8XA 1T6XA 4Q93A 1H3EA 1X6VA 4GU5A 1SURA 1N78A 4OJMX 2OV4A 3KT0A 3FI0A 3PNVA 3ILVA 4MW1A 1NZJA 1NYLA 1O95D 4NDAA 2EJCA 1WQ3A 2JA2A 1WXEA 3TNJA 3UOWA 1O5TA 3IOBA 1Q11A 4ZCQA 1KAMA 5J5AA 2DETA 1WXIA 3FG9A 1H1TA 4CQNA 4PY2A 4FZJA 4OUDA 3X1JA 2HMAA 4MVWA 3PNYA 3FY4A 3UY4A 2QJTA 3GLVA 1N75A 1N2EA 2A84A 2D13A 3ZGZA 1LW7A 3RHSA 1EFVB 4K0RA 1O94C 1G8FA 2QUHA 3CLTD 1JZQA 3HMQA 5TS2A 1CT9A 4KR7A 2E21A 2BYTA 5HUHA 1G59A 1MAWA 1OWNA 3G59A 4ND7A 1MOPA 2AZXA 2R5WA 1Q77A 2PG3A 3P52A 1GN8A 4HJXA 4ZT2A 2BTEA 3L93A 2HGZA 2XRZA 1ZH6A 4MW5A 2PZAA 4MW6A 4DDKA 5FO1A 3TZLA 4ZCTA 4EF6A 4KPUA 3CVYA 1TFUA 2WSIA 1I2DA 3CR8A 3QE4A 4MVXA 2A1UA 2PZBA 2A1TS 3L92A 2X1LA 1QRUA 1VBMA 3DLAA 5J59A 2GM3A 1JIJA 5LM3A 3AL0C 1N2GA 3IVCA 1YULA 2JANA 3H99A 2J08A 1EUQA 2YWBA 1O96A 2QUIA 3TQIA 1MC1A 4F3RA 2DXIA 2WQ6A 1MRZA 1N3LA 2CFOA 4MW4A 4JFAA 1DNPA 1UFVA 4DNXA 1EFVA 3IMGA 1T9GR 3MLBA 4JXXA 1GZUA 4J76A 2PFSA 3GMIA 3HFJA 3N9IA 1QTQA 1FFYA 2CYAA 1ZH0A 1Y42X 3HV0A 5KHAA 3HL4A 1Q19A 3IUBA 2JAXA 1YIDA 1F7VA 1IRXA 1JZSA 3CLUC 3CVXA 5DEOA 1JIIA 3LE8A 3SEZA 1MAUA 4UZFA 5TGTA 1KKUA 1MB2A 1IH8A 2QTRA 4ARIA 3Q10A 2RD2A 1NP7A 5DASA 3ZXIA 3FOCA 4EG7A 3QTBA 1PFUA 3C8ZA 4J75A 5JBNA 2A7XA 1H3FA 4NX2A 4MUIA 4QBTA 2PXHA 2IELA 4U7JA 4MW9A 3RK0A 1U0BB 4U63A 2QJOA 4EG5A 2DLCX 5F23A 4XFJA 3COYA 3CLRC 1M8PA 3N05A 5BNZA 3IVGA 3KT6A 2D5BA 1JIKA 1VBKA 4PBTA 1JEDA 2QJFA 2CSXA 4I6JA 1R6TA 1XJQA 5IJXA 1M8FA 4MWDA 1J1ZA 3A04A 4DE5A 1GAXA 1OBCA 4ZT7A 4BWVA 3PNBA 3MMXA 3HGMA 3CVWA 5EKDA 5K0SA 3PRHA 2DEUA 4U8HA 4MUGA 2QTMA 1WXHA 4R0NA 1BS2A 2AG6A 2ZUEA 1QRSA 2CT8A 1J21A 1KQNA 4MLPA 3DO8A 1GTSA 1WKBA 4ZT6A 2X0KA 1J1UA 3NBAA 1F9AA 4CDNA 4ZT4A 4MUFA 4Q16A 5H7XA 2J4DA 1COZA 3IH5A 5HUJA 1G8HA 1JEEA 2QUKA 5LFAA 1M83A 1U3CA 3FHJA 1I6KA 1D2RA 3P0JA 1NSYA 3TQOA 1Q15A 2E0IA 4P2BA 3CLUD 1U3DA 3NV7A 4A91A 4ND6A 1HYBA 3LOQA 4MAFA 4H3SA 1NUQA 3X1MA 4R2LA 1QJCA 1N2JA 1KH1A 2A4MA 4HJRA 5DK4A 1PFWA 2Z08A 2EL7A 3D6UA 3RK1A 1NURA 2NSYA 1EE1A 3Q4GA 1XNHA 1U7XA 3CVUA 4DDMA 3P0IA 2CUZA 2WB2A 3IMEA 3CLRD 2O8VA 3FH0A 3AFHA 1JILA 1OWMA 1JMVA 1G8GA 1TYDE 1O0BA 2OQ2A 4RPIA 2I1LA 4EG1A 1V8FA 1R6XA 4HPWA 4R2MA 2AKEA 3ZJUA 3RBAA 4EG6A 5AHWA 3KT3A 1KR2A 3E27A 4QRDA 2A86A 1YIAA 3PXUA 3ZUGA 3ZJTA 3N8HA 2YXNA 3SEQA 3OP1A 1MBZA 4MUHA 3ISJA 4I6GA 4ZT3A 1LI5A 5HG0A 4L2IB 1JGTA 4ARCA 2Z09A 4E1AA 3MXTA 3SP1A 2DERA 2DPLA 3TS1A 2Z3VA 4MW0A 4MUNA 3VU8A 4JYZA 1OWPA 1J09A 1OWOA 1EFPB 3LCJA 4CT0A 3IODA 1N1DA 4DLPA 3QTTA 4XSVA 1OWLA 1N2BA 4NATA 3S3TA 3VGJA 2G36A 3ND6A 4JXZA 3M5WA 1NI5A 1NUUA 4ZCSA 1KP2A 1U7DA 4UZEA 5K0TA 4ZCRA 2QUJA 3FIUA 4YMIA 1KQPA 2NZ2A 1VBNA 2YWCA 1QU3A 4WNYA 1MB9A 1V47A 1M1ZA 1XNGA 3AG6A 1YI8A 3DV2A 2CYBA 1OBHA 3GUZA 1QU2A 2VXOA 2DR2A 4L2IA 1KH2A 2V0CA 4YBRA 3MUEA 3A05A 4G6ZA 1KORA 1N2HA 3NBKA 3COVA 3AIIA 3SZ3A 2GOYA 3ELBA 3H97A 1GTRA 3X1KA 3ND7A 2D54A 1O97C 3KT8A 2C5SA 1EFPA 1R6UA 2IP1A 2ZP1A 4EG3A 1WY5A 2YY5A 2E18A 4S1OA 3G5AA 1I6MA 3HZRA 1N77A 3H9CA 1IFXA 3ZIUA 2V0GA 2CV1A 3MLAA 4EG8A 4DDHA 4TS1A 4KR9A 1RQGA 4YP7A 4PBRA 3ZXSA 1WJGA 3CA8A 1ULHA 1NUSA 1KQOA 5H16A 1IQUA 5J58A 4MW7A 4MVYA 1JECA 1EUYA 3IOCA 1QRTA 1T9GS 1EJ2A 1H3NA 2J07A 3SYTA 5TEVA 2H29A 1OD6A 1T6ZA 3AG5A 2A88A 1NUPA 4KPUB 3COWA 2E89A 2A1UB 3P0HA 3H05A 3K9WA 1B6TA 1MJHA 2QTNA 4MW2A 1XNJA 3F3MA 3U1VA 2B7LA 4YP6A 3VRHA 1N2IA 4EFKA 4AQ7A 3INNA 4G5FA 2DUMA 1O96B 2VTBB 5DB4A 1M8GA 4MQ6A 1K97A 4MWBA 3FETA 3TZEA 3N2YA 2J09A 5FO0A 3FDXA 1WXFA 3KFLA 1IVSA 4AS1A 1YUMA 1PG0A 3UMVA 4YP5A 1EXDA 3K32A 1I6LA 3BL5A 3G6KA 1YUNA 4CDMA 2X1MA 1ILEA 4HK4A 4DJAA 4KR6A 1O97D 4MULA 1VLHA 1K92A 1WOYA 3UC5A 1A8HA 1QNFA 3JXEA 3CVVA 4MUEA 1T6YA 3OTWA 1M8KA 4ZCPA 4NZPA 4RUKA 2J5BA 3CLSC 3IDFA 1WXGA 1F4LA 3IUEA 3UK2A 1NUTA 1IQ0A 1P7PA 2PZ8A 4MVCA 2CV0A 2IJGX 5FNZA 1IHOA 1N2OA 3COZA 3AKZA 1J20A 2XRYA 1WZ2A 2ZUFA 1O95C 4F4HA 2VTBA 4GRIA 3Q12A 3D6VA 3FNRA 1K4MA 3IMCA 3ND5A 4MWEA 5IHXA 1TEZA 4WSOA 1TQ8A 1PFVA 1WQ4A 1ZUNA 4EGAA 2RE8A 3SDBA 1JHDA 2PIDA 1IQRA 3H9BA 1KAQA 4NAHA 4EG4A 1FYDA 1ZJWA 1O0CA 1LI7A 1M8JA 4I6EA 1TYBE 1PFYA 3RFFA 4MWCA 3RJZA 4K03A 4XFDA 4KKVA 4QREA 1J70A 2X3FA 4PBSA 4MUJA 3A4IA 4ZT5A 2CV2A 3CLTC 3I05A 2O5RA 3IOEA 2GKSA 2CYCA 1TYAE 1S4MA 1O94D 3FWKA 5LLTA 2TS1A 4JZYA 3SZGA 4MUKA 1PG2A 1O6BA
chains in the Genus database with same CATH superfamily
3VH1A 4JWKA 4HC4A 3A8TA 5D6OA 4B3CA 2HZ7A 3K1AB 4M9XA 3PHIA 4JJZA 3AF6A 5T67A 1RRVA 5TQ2B 1ZINA 1XPUA 2IECA 2D1TA 2OK7A 5BXQC 5BN5B 3BUSA 5DLQC 2PRSA 1U0FA 5CVCA 1Z5UA 2WABA 4X71A 1MO3A 2R8OA 4DPLA 7ABPA 8ABPA 1P9NA 4NAUA 3TVDA 2GFQA 3FGPA 3JVEA 4OJQA 3REFA 8ATCA 3OQJA 4EMSA 1KMHB 2EGGA 2WQ7A 1NYTA 3SXUA 2BWJA 2FPIA 2Q9UA 1XRNA 3A1TA 1VKZA 2AQIA 3NANA 3PFHA 3H1AA 4WBNA 3EOBI 2UYCA 2G5CA 4OLJA 3VVMA 5AJYA 1H3EA 3AF1A 1TRKA 3UHJA 4MCAA 2E7ZA 1YXMA 3N07A 2AN1A 2X86A 2C88A 4RD4A 3LTNC 4BJ6A 5AVRA 1V5IA 621PA 4KRFA 3OOSA 4RTNA 2J0UB 5H3HA 1WNFA 3ZEIA 4Y2VA 1JHRA 1D5WA 5EJ2A 4DWWA 1OSNA 1YOVA 1EBFA 1ZGAA 2WJJA 1OFUA 2BGKA 2C5HA 3TW6A 1O95D 1OYVA 4I1UA 4WK0B 2H48A 4ANFA 2JA2A 4C7OB 2B1QA 2O50A 3NTOA 3CFIA 1ZCJA 3IT0A 4P22A 3FYUC 2CL5A 5JW6A 5JMOA 1E64A 1YI1A 4RFVA 3LBHA 4R71A 4JXJA 3MJDA 5BSEA 2OFFA 3QJYA 1WXIA 1RLIA 3LNTA 4JI7B 1SUIA 5CYGA 3U31A 5DP1A 3S8YA 2QPAA 5DHFA 1PR1A 4JB2A 4TV9A 4BMPB 3B7PA 4AG6A 1NV9A 4K9NA 5I7EA 2G06A 1JAYA 1T8PA 2NPIA 2V96A 2ZBFA 4LBVA 3TTVA 1E3EA 2ZYVX 3T0IA 3SX0A 3R7FA 4R2KA 1GAWA 5DGCA 5KTMA 2LZ0A 3GLKA 2FUKA 2WJGA 1C7QA 2F17A 1WLSA 4DJFC 1B41A 1VJRA 2ZROA 2HFJA 3IBYA 3DULA 4K0RA 5KX5F 2QUHA 2OCDA 3E4CA 3PITA 3OZWA 4QYTA 2P6UA 1GM5A 1YRQA 1DIBA 1GD1O 3CC8A 4WECA 4YQYA 4KVFA 4BP8A 3OLYA 1T0BA 3B1KA 2EQBA 2I54A 2QRUA 2II6A 4UVDA 3GGJA 3CKMA 4YRJA 3N28A 4Z4EA 2O0JA 4E30A 3AHEA 4GHWA 3SC4A 4N5HX 1NC1A 2AMLA 2WFLA 3E7PA 5K3CA 5A0TA 2OV8A 3ZKAA 2Y1EA 1E5LA 2R3SA 4HAWA 4UNIA 2ZRMA 7YASA 5KC9A 1GAEO 1JU9A 1KVUA 1Q17A 2XR1A 2GAJA 2RAUA 1TA4A 1ZDMA 3O0TA 4ABYA 4QTXA 1UPCA 5BV7A 3CVYA 1R6AA 4DIUA 4YIKA 5DBFA 3ZZTA 4BLUA 2QAGC 1DDGA 4DNFA 3PC2A 4KDEA 1P0IA 1WPGA 1A4XA 1DBPA 1P7YA 2WSSA 2ZREA 3H5IA 4I99A 4IHQA 1TNDA 1WPRA 3PXGA 2CXNA 4NE9A 2ODWA 2W70A 1OPRA 3ZJ4A 5FX2A 4AY2A 3E5MA 2G3DA 1UOEA 1ZM7A 1MFZA 1NRXA 3IKVA 5DTJA 1O96A 1Y3FE 2I1VB 5AESA 4UTVA 1LDEA 3T3NA 2D2EA 1SUCA 3TCKA 2HYIC 4RZHA 1VRWA 2CNBA 3LLUA 3EMVA 5E0KB 2D7CA 4ZAWA 5HUQA 5DNYB 1XCOA 2WYWA 3TLZA 2PU5A 1NTOA 3MB5A 3PXBA 1ISPA 4J7AA 4Q4DA 4WK4B 4RHFA 1KRWA 2O2SA 3KYCA 4HXGA 2FZ5A 3FXAA 4EABA 1XRSB 2PH5A 5KSWB 1P19A 1DFHA 1QOQB 1SMKA 1G3IA 3T1VA 4DSZA 5I4CA 3BGSA 1UXIA 2JAXA 3GLHA 1FTSA 2HM7A 2RETA 1JZSA 2JCBA 3HCRA 3AESA 4OSOA 1HURA 1L5VA 3S99A 4I1OA 4D3FA 1IN4A 3L01A 4ZEMA 2QBYA 1SKBA 4DLXA 5JZOA 4LGCA 3B9QA 1KKUA 2Y1XA 3ST7A 2EBFX 3WTCA 5K3EA 4X44A 4O2BF 1X80B 3TL2A 1JT9A 1ZIYA 5I45A 4EEKA 1CIPA 4BRSA 3N7UA 1Y5LA 2FEPA 1P18A 5D3MB 4IJ6A 4XKJA 5IM4F 2ZITA 3KJEA 5FNVB 1KJYA 3TLKA 4B3JA 2O07A 1IXKA 1YDEA 3SICE 3BF7A 2PD4A 1ZD2P 2CSUA 4KXNA 3T3MB 2I4NA 1DKUA 1RW4A 5IT9A 2Y1FA 4BMVA 3I73A 3FNQA 4O2AF 5C37A 2ODEA 2DAPA 3CGGA 4IUBS 5HM8A 4RMIA 3WE7A 3Q8LA 5BNZA 2EFEB 1JIKA 3WKEA 4G4IA 4R2IA 4E5DA 3ZD8A 1BWPA 1XQ6A 4DXHA 2VZEA 4PNZA 5JS7A 1T8YA 5FF9A 1M8FA 2B25A 3LQRA 3PDCA 3T7IA 1F2UA 3EXFA 3NC0C 3PUIA 3Q7RA 3B5JA 3R7BA 2AW5A 4RJIA 5DEIA 3X2EA 2I52A 2WTMA 1PN3A 1X92A 3LX8A 4JL6A 3RTAA 5A9SA 1A5SB 4OLHA 5G0WA 3KQVA 4PF1A 4YPFA 1LK0A 2R6AA 3AJEA 3VOAA 2Z2XA 4GO1A 3CN9A 4HQNA 1BAPA 5CYPA 4P86A 4M46A 1VPLA 4WJKB 1QTIA 4IEFB 4E5VA 1TVKB 4FYXA 3IBGA 4S0ZA 3ZIAD 1E32A 3OJLA 3CISA 4LY0A 2R1TA 1E1KA 5JAQA 2FN7A 1EVYA 3BWDD 1CERA 5TVKA 3GBVA 4Z86A 3IH5A 4F2WA 5LL6P 4QKQA 1JKMA 2FG7C 2I6TA 2VDOB 4Q00A 4UVEA 2Q5OA 4WCDA 3DFZA 4YHBA 3OLVA 3REOA 2CNDA 4O1MA 4UCFA 4AJHA 5EUBA 4JKYA 5KJFA 2OQVA 4P3XA 2GILA 1EGHA 3TX6A 3TQOA 4UBLA 2UUAB 2ZYDA 5FQNA 2CJFA 5DSXA 5ENZA 4JWTA 3R3ZA 5K7SA 1S1CA 3NR2A 1UMBA 3KQNA 2FG5A 1CJVC 3EIWA 3QWBA 3W8DA 2WC1A 1HF3A 1SQSA 2CNNA 3OQMA 4G0WA 1YNOA 2G7ZA 3H42B 1JG3A 3G2IA 4KI7A 5TX7A 2OBXA 2REQB 1MT3A 1TMOA 2IPNA 2W5UA 2UYHA 2V6BA 1VIMA 1SPXA 2FQQA 4WCFA 3X1DA 1A9TA 1JTFA 2HIMA 3D5QA 3A36A 4IIHA 3QOFA 1UCFA 3BL8A 4JBYA 3QFSA 1BDBA 2ZJOA 2OORA 1U4SA 3FPFA 1U8UA 2W0SA 3PB3A 3ABOB 4PGFA 1V2GA 2F2TA 4S3MA 4V3CA 3SC2A 3ZYCA 3CX4A 3VYVA 4OGLA 5A6SA 4Y1FA 1AXGA 1DCTA 1SHLA 5ALPA 2CKDA 3O1IC 3AM1A 1TVCA 4GMDA 5CR9A 5ICFA 4AROA 3T5DA 1M75A 3LHFA 1ESDA 1TGVA 1Y4AE 1JPVA 3DDOA 3ISVA 3PKIA 3QW4B 4KFUA 3D43A 5FAXA 4EOGA 1NNEA 4N3BA 3UICA 2B35A 3SY8A 3KKEA 2VP3A 3UQZA 4BBPA 2A7QA 5F78A 1KMIY 2I1LA 3ON5A 4QVIA 4X6LA 1G8KA 3VA7A 5LXTF 3KSBC 3VVCA 5J2UB 3OZ7A 3AILA 4Q19A 4M8IA 5EJAA 4MTCA 1FFCA 2F00A 3L6CA 2BJHA 2PD6A 1FVHA 2FEXA 4IDOA 2R1ZA 1GU1A 1NI4B 1XMVA 2E4ZA 4RY0A 1SA0A 3PS9A 4M1ZA 4LGYA 3PJFA 2LP4Y 4C29A 3V4OA 3C1AA 1VKJA 3OP1A 1K8RA 4LF4B 2B4QA 1XZDA 1RM5A 4YT8A 1CLEA 2ZPUA 1UM9B 5JXWA 5AKHA 3UGQA 2XLBA 4KK4A 5ES4B 1XEXA 2J32A 2NW6A 4ALMA 2VHVA 3P1JA 2VJQA 4ARCA 2Q0XA 2WHQA 4N3NA 1G18A 1CX9B 2MINA 1E1CB 2D74A 1MVOA 2ENUA 2C7BA 3AHJA 5H82A 2JHCA 2ZAOA 1HUQA 1TD1A 4MIEA 3PEYA 1ZGGA 4NQZA 1DC5A 4BNIA 4LNHA 2X15A 2QRLA 3MB8A 1SQGA 2VYND 1AMUA 1ES9A 2EOAA 2NU8B 5IX8A 2D5IA 1Z6XA 5TQJA 1YQDA 3ZYZA 1B8OA 4DIEA 1EG2A 4HFMA 3UIEA 1SELA 1X15A 3URKA 1OLUB 1MXHA 4F2DA 2WJAA 1N6PA 2B34A 1VFPA 4W7HA 4TT3A 2NM0A 3RAEC 4GFDA 2BI4A 2RB4A 1P4RA 1RXIA 2IYSA 3A4TA 3NKFA 4G2NA 4DMCA 1E7YA 2R44A 5REQB 4LYHA 4ZI7F 3W1EA 2HBQA 3V80A 4WADA 3T61A 4YRBA 3KDSE 1WMFA 4IEEA 4D4IA 1N8NA 3ZCTA 2PX4A 1ZG3A 1RFGE 1O8BA 1PJ4A 5GM2A 2JBWA 4LX8A 3AV0B 2BL4A 3OG9A 2J3LA 2PBFA 2QGFA 1ZD5A 2IX3A 1QU2A 3CJRA 1ADCA 3DOJA 2DR2A 4M1OA 1KRXA 2F3TA 2I6XA 4RK0A 1TCUA 5E1MA 1BE0A 1XZLA 4IJ5A 5C7IO 1S2LA 3MT9A 1DEHA 1TA9A 2AEFA 3UB2A 5AW3A 1EU1A 4IVRA 2AHRA 4X3PA 1J7JA 3D2LA 4NJEA 1HDYA 1GGKA 1YB2A 2C8KA 1P31A 2TMGA 3GG9A 1GSAA 1XWFA 1Z5NA 4JT2A 3THXA 1L6RA 1QV9A 4GQIA 2P9ZA 3AZPA 3ZU6A 2YXLA 3M4ZA 5CB4A 1DC6A 1G6OA 1A8IA 2QZ9A 4F1JA 1E3QA 1YK1A 1E5TA 4OA5A 4AY3A 5HILA 3VNVA 1I6MA 1P4AA 3QLTA 1N77A 3NM4A 4MIKA 1UFRA 3L06A 3MLAA 1V11B 2A5DA 2QY6A 2VSNA 3QY9A 1GCUA 4OK3A 4DXDA 1XFAA 2JFOA 3G5TA 1Y0BA 4UVIA 1PJQA 2YXPX 5FPQA 1M2OB 4OU5A 3WL4A 4Z54A 5L7WA 2PDAA 3PTZA 2GM4A 3MERA 3HYCA 3BM5A 3UAWA 4YCNA 1ID8A 3UUGA 3AV3A 4WH0A 4TZ0A 2ONJA 1XP8A 1EP3B 1UQRA 2AZTA 4JYCA 4A0FA 4B84A 2ODTX 4KQIA 4EYGA 6PFKA 2I7TA 1ACLA 3C4JA 4KSCA 1NP3A 3D6TB 4CCWA 2OYCA 1T2FA 1W85A 4L8FA 2IS1A 1WW8A 5TEVA 3HR8A 3K6KA 1LU9A 3SKXA 3O03A 4JMLA 2RKWA 2RK4A 4MRMB 4FCTA 3UAYA 1A5BB 4FFBA 3P0HA 2EZ8A 4QNRA 5AYVA 2QTNA 3F4KA 5K3FA 5FOUA 4BYGA 4HUTA 1EP1B 1UM8A 1U0NA 1VBFA 3HPQA 3VR1A 3U1VA 3HKCB 1QAOA 2ILVA 1PV1A 2X1HA 2QP4A 3U6KA 5ALGA 4RTOA 3I9JA 4MLCA 3RASA 2BW0A 1WXDA 1FNCA 3ZQJA 4Y7CA 4KLRA 3WWYA 4YAGA 1UODA 4GMHA 1GYPA 3CW2A 4P2GA 2RJNA 4RA6B 4YR7A 5F3WB 2YMQA 1T1IA 1U3VA 1CPYA 1G2PA 1N6KA 1TQ2A 3KJGA 3P4XA 4HVCA 3L8FA 5JZSA 2W4MA 3PUVA 1RCFA 4YCAA 3S5JA 3NIDB 5B12A 2AKAB 1A71A 4F7WA 1YUMA 4GBMA 1WEKA 5DNAA 1FW6A 1SD5A 5CFQA 3GP5A 3II6X 3PIRA 4EITA 2FZLA 1BDMA 2FW1A 4E2XA 1GPLA 1X38A 2VG8A 3LWNA 4RTMA 1VLHA 5KSPA 2QW8A 5ECGC 5E6UB 3ZHVA 1T6YA 4FGKA 5JVDA 1QAQA 1G5HA 2YY7A 1SG9A 3I4CA 4PX9A 1VKHA 5MHTA 1NE2A 3NTVA 3P0RA 1MNQA 1AQ6A 1NUTA 3D4NA 1US8B 4GKJB 3FNFA 1ZY2A 4XR9A 5E4TA 1WB4A 4KP7A 1X8JA 5C34B 3TX2A 4AS2A 1A2QA 2GZ2A 1K89A 2FF7A 3ESDA 3RHTA 3EGVA 5AJVB 5AW9A 1HL7A 2ERCA 2PYIA 3G9QA 3LPNA 1HE4A 1IAVA 3QXJA 2FUNB 3D6VA 1D4OA 1GCOA 3GZTB 3N74A 4P38A 4UEWA 5FBWB 3EXAA 1F0NA 1LS1A 3IPYA 5G0SA 3IEXA 5LXTB 2CHEA 2V7TA 4MQMA 1U4NA 3H5RA 3A4MA 1KY3A 5BP7A 1E20A 3NDJA 2YN2A 4JVMA 4B45A 3C5EA 3O75A 2C2BA 4LVOA 2B7BA 3DXXA 4CKWA 2PU7A 3W2EA 2QMYA 4JJAA 4S2UA 3WXMA 1M6VA 2XGSA 3FSGD 4DLLA 1EE2A 3BXFA 4KKXB 4RZSA 4WLEA 4ZV7A 4DY6A 1TYBE 4WV3A 1VGRA 5K1ZA 3VOBA 5IVDA 1PW7A 3AOGA 2FWAA 4TKMA 2GK4A 4B4VA 2ZULA 4L8WB 4PYJA 4MR7A 4BATA 1FZTA 3HGTA 4AAYA 1ZSVA 2WHYA 4LTDA 2PJRA 3AI7A 1IBCA 1F9EA 4ED9A 4AJOA 2JFGA 4B3DA 3MWFA 2X4DA 4RPLA 4EA7A 1USUA 3UEOA 1Z12A 4O1HA 1YQ9A 4C4AA 2BH2A 4KSYA 4MRPA 2C2KA 3OY2A 5AIAA 5EGSA 4E2YA 2FW9A 3G17A 3HH8A 4UAVA 3KTAB 1KZ6A 1ABEA 4KYTA 1FS4A 3B13B 2AZDA 3TBKA 4RVCA 1TYCA 2RHTA 4TRRA 1DKLA 3E15A 1KH3A 5FORA 4XZ3A 1K7SN 3FTNA 5CPFA 5KOHA 3O2JA 3PIDA 5SY4A 2C9ZA 3VR2D 1JKJA 2Q50A 4N7BA 2RH9B 3VC1A 4EPXA 4ZI7B 4HG2A 5D85A 5TEWA 3AW8A 3MOIA 2ODBA 2VAPA 2OB2A 2NLOA 1LVHA 3CLSD 1OIXA 5DYGA 2CFRA 3DVSX 3NWBA 3NZEA 4CR6A 4BMNA 1UJ5A 1YT5A 3EZLA 3FTCA 4LYFA 4OG2A 1R6DA 1WW2A 4XIGS 2NZXA 4MPPA 3VSDA 3QSYA 4EI7A 5BR1A 1EJ6A 3DCJA 3ETCA 2MSDB 3Q3VA 1QFXA 4KRGA 4E7PA 3MRSA 1XRPA 1U3FA 1T34A 1IWBB 3KT0A 2AR7A 5BRNA 4PNHA 4BV8A 4A73A 1FSSA 2MSWA 4R01A 4OMUA 2ZYTX 2VNKA 2YN4A 4MA4A 1PWZA 3TNJA 3NHUA 5IAGA 1K63A 3WIVA 5C3UA 1T36A 3CEJA 3UF0A 5F98A 1W581 1XKTA 4X8LA 1TMKA 2CVZA 1IYZA 1ULSA 3WDSA 2OCGA 1W35A 4LHYA 3IIJA 1D2NA 1KMQA 1B4DA 5D00A 2VIIA 1VPDA 4ZA2A 4YQFA 4CQLB 1FP4A 4FMCF 1K88A 2WAOA 3RABA 3VOTA 4BO3A 5EFZA 2GPSA 2CUTA 5KTYA 4QWWA 721PA 1ZK1A 4UNQA 4DJDC 3F46A 3VO8A 2HYDA 2RGEA 1ESCA 3DVAB 4ARBA 4UTRA 1ACMA 2HTFA 2P2SA 5IZCA 1YZQA 5ELMA 3EZNA 3NDIA 3SIPA 4BN0A 5IFKA 4HYQA 2XTNA 1G8FA 1Z2NX 2R7LA 3K8ZA 1CUCA 2F67A 3FNEA 3Q6NA 5DM0A 5BY2A 1P4SA 3HMQA 4RF4A 4X20B 2XTAA 1G20B 5DI3B 4KR7A 4KVAA 1ETUA 2ECPA 1XXHE 1T9AA 1YZ3A 3HSYA 5ADHA 5JSUA 4RV4A 1QG4A 1G8JA 2OC9A 4TWZA 1D0VA 4NBLA 3UK6A 2XQKA 1QIDA 1P73A 3R9XA 3LBFA 4MWZA 2GPTA 4PC2A 5CCXA 4IH1A 5BWCA 3VH3A 4BAZA 5HKKA 2C0CA 4M89A 4MGYR 5EEHA 4KPUA 1BG6A 3OECA 2QOEA 1TFUA 3OSZA 2JFBA 2R8EA 1QK4A 2Z04A 3AF2A 1Q1ZA 3BH7A 3T1HB 1RYYA 4O4LA 3T3DA 3KTOA 1BX1A 4G67A 3H2KA 4C0HA 1JXOA 2C9DA 1PZFA 1Y1RA 3SU8A 1Q3HA 1E9VA 5BO5A 3CH7A 2IIBA 4GDFA 1CY0A 2CE7A 1PT5A 2O2DA 4QJ4A 4UBIA 4WLFA 3WRXC 4F6LA 4O33A 3OETA 4ND2A 3A9RA 4DR4B 2XE6A 3GY0A 3N8GA 5IMSA 3LGXA 3BL6A 3VR6A 4F3RA 1OB2A 3OMWA 4MVJF 4E32A 1R8XA 4FXPA 4UJ3A 5GZ1A 3I04A 2DXIA 3GGOA 5JDIC 1DKMA 2FZGA 2LMEA 1DX4A 5CP8A 1JSLA 4J76A 2R97A 2FDRA 3HFJA 1TU4A 1DG1G 1PP4A 2V97A 3OIUA 1R9JA 4Y30A 2OESA 1W46A 2VC2B 4ND4A 4DZTA 1XJ5A 4RIGA 4M1QA 2ID7A 5EE5B 3A1SA 3IUBA 1KK3A 3N2KA 4JUCA 5JZ9A 3CVXA 1U2PA 2DHCA 1FX1A 1QH8A 1HOXA 4W99A 2QTGA 1R64A 2D8MA 1J23A 5KQRA 3HDHA 3HCFA 2PNJA 1TOAA 2HDOA 2F43A 1R0YA 2ACVA 3GARA 4F4DA 5JD5A 1X7XB 1ZH8A 1YBFA 1W49A 1YAJA 3RF6A 3IQWA 4N8SA 3LDGA 3C6ZA 3QVWA 1T2VA 4PLGA 2OQIA 3ORHA 2HK6A 3ZE7A 2A7XA 3FCEA 4B3RB 3ZDFA 1DVRA 3HSKA 4GR5A 1D4ZA 1CUGA 1GZ3A 2VUSA 3N59A 5IJAA 4EA6A 4BBAA 2W8BA 4TX1A 3RVMA 1RZRD 3R1IA 1V25A 2Y0DA 3BZWA 4R2JA 1P74A 2C9BA 5TPWB 1G5RA 2J3EA 4M54A 2J67A 3ZXYA 1MW9X 4ZJPA 5F23A 3AVVA 2X40A 1VJGA 4FDMA 4XGQA 5E3JA 4B43A 1GL7A 1LJ8A 1I7NA 3HDVA 3PQ6A 4M36A 1WKVA 4HGQA 4YUVA 3C5HA 3I0MA 2D5BA 3IS3A 1Z08A 1JEDA 2G5GX 4CM7A 4D6XA 1XJQA 3GW8A 3MUOA 1XHFA 5L9AA 1TZKA 2D2VA 1L6IA 3Q9NA 1C3OB 1RPAA 3RT9A 3CMMA 4ZT7A 1NTRA 3J81k 5K8JB 2Z8YA 1VJ5A 5EPOA 5F4BA 1AHHA 2YYAA 1EDBA 3NKLA 3PD0A 4C4RA 6CHYA 4Q66C 3F4LA 3PRHA 4IFIA 5BR7A 1W88B 2QTAA 1Z37A 2XGMA 2EKZA 4QXAA 3TM5A 1QBKC 1OILA 4U8HA 3MHTA 2ZUEA 3G0IA 4OHRA 3HY4A 4P92A 4A8HA 4RKEA 2HY7A 3H75A 4ZDWA 3V3TA 1DDOA 2FZVA 3IUPA 2C1EA 1JDBB 4G5GA 1PJCA 1RQ2A 4GE0A 5FHQA 1NLYA 4DDWA 5LDHA 2NQTA 1V8ZA 4XD7A 1J1UA 5JO9A 2JGJA 3FDJA 4CDNA 5L51A 5FUYA 2QB5A 3CUUA 4QUBA 1J0DA 5H7XA 3U3XA 4RHTA 5LQAA 4PZDA 4QUDA 3F8TA 3TTWA 3WL6A 3QPUA 1UBLS 4QODA 1QH0A 1J56A 1T2CA 5BW8A 1MB0A 1DAEA 2X8AA 3I23A 2CHQA 4OI1A 4DQKA 3IILA 2QVZX 5BUQA 3HB4X 3ZZMA 3UJPA 1JJIA 4ZODA 4TMVA 2XVYA 1IY0A 1WABA 4XGIA 5L4NA 4JJEA 3ZR4B 2HB6A 4FGSA 4FT4A 2PUEA 1E0JA 2AFIB 1IN1A 5B2FA 1AQUA 1D4FA 2JGIA 2P6RA 2X5NA 1RYEA 4DGQA 2A4MA 2H1VA 4IDFA 3WLAA 1M5TA 4JAVC 4HJRA 2YMMA 1U8ZA 4KWHA 4UCQA 4W63A 3WL5A 4B75A 2F4VB 3RK1A 4R68A 1FSZA 3DMRA 3WXBA 3THOA 2WWFA 3E3OA 4FT2A 5IT0A 1YCFA 1XNHA 1MPXA 1PD0A 2D4AA 1GXSB 4KTTE 2G70A 1QHIA 4W5OA 1VG0B 3GA7A 1KL7A 1JKIA 2PEZA 3NASA 4L4YA 2M98A 4Q21A 4IOJA 4AYWA 1Z0IA 2K7ZA 2Y66A 3E82A 4C0JA 3CVUA 4CDRA 1GGMA 4UNRA 4J16C 4KTVE 1BFDA 2E1RA 3I61A 4ZXFA 1XRLA 4CETA 1DLJA 2R6HA 4D8UA 4FMCB 1UPFA 3OBBA 2JGDB 1GL3A 1ZISA 1C1YA 1SVIA 2ERXA 3M6AA 4Q37A 2FPGB 4MO2A 2B3TA 2BHLA 4E2WA 4R2MA 3O1JC 2I03A 5G4LA 2RI0A 4K40A 3ROFA 4IP0A 1QMPA 3ABQB 1W4RA 4AXBA 1CHDA 3ZDQA 2O0HA 2B78A 3VYRB 3T15A 1T0UA 2AG8A 3F96A 5U1PA 2X13A 4OQXA 4ZZIA 1PFQA 4CM4B 5F9FA 2A86A 4PQRA 3P45A 4YRLA 5EIAA 4R6WA 1SCAA 1CDOA 4HDQB 2BGNA 5CVDA 3RRXA 3OTOB 4U6QA 3AUFA 1VIDA 4YJ2F 4I6GA 3NVDA 3L82B 1I6WA 4N12A 2JBAB 3CZ4A 5GM1A 2C83A 5DDIP 1LTHR 3KPWA 4G0QA 5D3KA 4IIXA 5JFGA 4DMMA 5BW5A 2GTIA 1KOJA 2P9YA 1V5FA 2XODA 4JLWA 2PUGA 3U7IA 4YMLA 3PQEA 3FM9A 4TVBA 5I7HA 2BF7A 2EG5A 4DM4A 4P7FA 1EK2A 3BMXA 5B2EA 2P7IA 1RRFA 3ESYA 3QYFA 4O5OA 4I9GA 5JNRA 3CTMA 1LF5A 1KFKB 1OWPA 2QM8A 3QXSA 4EY7A 1KS2A 2V4MA 1NVGA 3HV2A 4GUAA 3LXRA 4L50A 5EIXA 3AR4A 3QYJA 2AFRA 4Q9HA 4V24A 1POXA 3HXPA 2JFXA 3P9RA 4K9PA 5FP0A 3WC4A 4ZIRA 4OO3A 3AETA 1HE1C 3GRFA 1YMQA 3MMZA 3MW8A 4P5EA 4YQZA 5JC1A 3WGMA 4I8IA 4HGZA 4REMA 2GCPA 4XRRA 1YFLA 1HNZB 1NPYA 3O8CA 2ZTLA 1EDZA 1V39A 3TUIC 3KB1A 3LOUA 5DJ5A 2BFPA 4YA6A 1RMYA 5ADVA 1K66A 5C1PA 1RXVA 2BDTA 2YHBA 1KQPA 3DEAA 5AMXA 3K0AB 1RADA 1VL5A 2PMDA 3DZHA 4JGGA 5G2FA 2VF4X 3WRVA 3T4XA 1QU3A 1M1ZA 3DV2A 1P91A 5TSDA 6YASA 5HX7A 3OO0A 2VXOA 2JFNA 3SJCA 4RC9A 3T95A 3TBHA 5FXMA 1U1GA 3WGIA 3SR4A 2OLKA 2R25B 1UBGA 1ZW1A 3AYXB 1NSTA 2WWRA 3DD5A 3LECA 4JKIA 2IUFA 3NBKA 1F3OA 3HJGA 1OI2A 2I4IA 2GA8A 2R85A 3L84A 4KIWA 5TT0A 3WAKA 3ND7A 4TXJA 3W5AA 3KT8A 4JHLA 4QU8A 4ABTA 5JAHA 2HKIA 4RJKA 4U00A 3DDUA 4QVGA 4V0LA 1XMIA 4EYEA 3F1KA 1NOIA 4FTWA 3TOCA 1XD2B 2RHMA 2DHRA 1KWKA 4E5MA 4RL4A 1Y1PA 2VLBA 4L5AA 4J1TC 1N2CB 3PSHA 3V34A 1GHTA 5CM2Z 2D2FA 4Q4HB 4Y2RA 2CV1A 3LIIA 4WKNA 4JLUA 4ZTUB 2A92A 2QSJA 2XT9A 2HO5A 2JGMA 3EZ7A 1RWWA 2C2GA 3FI9A 3LKDA 2J59A 5BVGB 1KYWA 4G0YA 4JYBA 3MRXA 4RZIA 1Z2AA 4CG1A 4E51A 4ZMBA 2R1VB 3PUXA 3HZZA 4BO9A 4DLKA 1R9NA 4RK7A 1C8KA 4MQLA 1CEQA 4GIBA 3KQTA 5EQDA 2AQHA 2VLIA 3KZ1E 4RD3A 4D42A 1ABBA 2G40A 5CW2A 4D2IA 4A0SA 3I9V1 3BFVA 1NW5A 3LX6A 1DO0A 3G3EA 3L7AA 4EUFA 1NQVA 1PR5A 2LE0A 2PRKA 2JIPA 1QGOA 5TY0A 3SWWA 4J0EA 4BNWA 4TV8F 1Z5WA 1UC4B 3EC1A 3FCAA 5DCYA 2C2ZA 1CRQA 3IAFA 4RCYA 5H70A 4JL8A 2C4WA 2R65A 4EHIA 1M2NA 2IBSA 1FK8A 1LH0A 1VHLA 5KJ1A 3AGQA 2SCUA 2EJTA 2GPWA 1C1HA 2WIDA 1D2CA 1DL5A 5EZYA 1QF9A 4G5FA 2SECE 2JRLA 3EMBA 3GEEA 4TUYF 2ZJBA 4ZP1A 1L7PA 1U7TA 2V7QD 4GM0A 3U2QA 3OQNA 2A0KA 4RIHA 4B09A 2ZUDA 1RJGA 2GAFA 2X19A 3C5VA 4MQ4A 4WKCA 4CNQA 1ZM4A 1BX3A 2DTEA 2XCLA 3CB4A 3KYDA 2WWVD 4JMPA 1DQYA 4NYMR 2QVLA 3TEJA 1NATA 3H0KA 2Z43A 1NAIA 2IRWA 2WLSA 4FWTA 1KDYA 5JS6A 3PXEA 5J43A 1EUDA 1KNQA 3C2QA 3EIFA 3EVEA 5FTMA 2P2GA 2AC7A 1KKLA 1UBCA 3LCVB 1GEEA 4L15A 2C7RA 3BMCA 4YROA 4M8LA 3ZHQA 1O97D 2PTGA 2VATA 4H0NA 3TL3A 4JUFA 4DJAA 1UUFA 1WOYA 3QPBA 4V03A 3HC7A 5JCOC 1RABA 5EE0A 5EEGA 1CLUA 4NZPA 2NU7B 3H4VA 4JLVA 3H2JA 2BGUA 3ENWA 5EMHA 4NYMQ 3VR3A 3JQDA 3WYCA 4BS9A 5GIOE 1MH1A 3UK2A 1I13A 1CUFA 3LBIA 4UU7A 3V4PB 4ZICA 1JDNA 2ZB2A 3JRWA 4CM9A 2VPQA 1GKLA 3DE4X 5LMZA 2XOKD 4ISCA 3ZNPA 3NP9A 1HQCA 1IK6A 2PWYA 1RQLA 3P7MA 5I51A 1HG1A 5BUCA 2A0WA 4B6JA 2CLCX 5CDFE 2YWFA 1PRYA 1YRWA 3R5JA 1KHHA 4P3YA 5ED4A 2OZPA 3GIDA 3LKZA 1DSSG 2BJVA 4RFSA 2Z1DA 1OLOA 1TQ8A 4TYQA 4U7GA 3U1TA 2OPHA 1VIYA 3U40A 3NWJA 2YZMA 5EINA 2QLTA 1I9CA 2WIFA 2NSHA 4X91A 4Y2UA 2YHUA 3B1YA 3FFBA 1DQRA 5FA6A 4DLSA 1W0KD 4O4IA 2YN0A 3QVTA 4A7PA 3HVIA 3VR4A 1CZOA 1GPH1 4BWGA 1LI7A 1MJ5A 1VI5A 4DRZA 4E33A 2JLCA 1T4DA 2NV2B 2HXSA 4J4HA 3PUYA 4KAFA 3FVVA 1Z56C 4MV6A 2RGBA 1GNTA 4CTOA 5A7FA 2V8BA 1L7NA 4YRQA 5CFZA 1WZNA 4BL5A 2C54A 2YFQA 4K1LA 4ZO9A 4D46A 1SUWA 2V58A 3P9CA 2Y1OA 3Q2KA 2OZLA 1Y9ZA 2CDBA 2HV8A 1SVMA 3K0FA 3MD9A 3EUEA 3AERB 1DINA 1M2KA 4ZHQF 3TIVA 1Q21A 2PKYX 3UWKA 2QE7A 4Y0NA 1OV6A 3DTVA 4CMCA 4TVSA 3AKDA 1N8KA 4MCHA 3GPLA 1BW9B 3WSVA 4B3MB 3SZGA 4EPTA 2EP7A 1O6BA 3FVWA 1PYGA 3HN7A 3VMMA 2PLFA 1AUOA 3ESAA 4G5YA 5EZ5A 3CSSA 2VDQB 3P9IA 4R31A 5DBIA 4CF4A 3QU5A 5F2KA 3VKWA 2NXWA 4JB3A 2YVLA 3SQLA 4AKIA 1Z74A 1XPJA 5GVRA 4XX0A 1NF3A 5A03A 1AS3A 3SR3A 3VMFA 4YVFA 2XWQA 2P3QA 4GGOA 1ENZA 3BIWA 3UK7A 1PNTA 3S55A 1WCYA 5FA5A 1PD1A 4JK3A 4Q9JA 5T4HA 1CJCA 3L7MA 1QQ5A 2XAUA 3OCJA 4YPVA 1DAOA 4NEHB 5LP6C 5KQPA 3NTLA 4PQGA 5ALMA 4Q6WA 3PNVA 2IDKA 2YXEA 3FMGA 4PLVA 4BNDA 1E2PA 9GPBA 3GH3A 5G02A 3U62A 4P80A 1G9SA 4WDRA 5LOVF 3LT2A 1ZX1A 4POOA 1VZ2A 4AZ3B 1E79A 3EQ6A 3FCCA 2HF2A 3FGOA 1CYDA 1OXVA 2JK0A 2YIVX 1XO1A 2A33A 4O29A 7REQA 3WLPA 2RB5A 3QEBZ 4P82A 1D8AA 3S0JA 3VPSA 4LX0A 5HTOA 3BB1A 3JRXA 2ZRJA 4QDTA 2MU1A 3NCHA 4JVSB 4MVWA 1XEFA 1RMQA 2D4HA 4C4OA 4DW8A 4F97A 1XAIA 5ALSA 4G41A 2FJPA 5ULLA 3I4FA 4BUCA 1L7OA 2NAPA 1TAGA 5LA6A 1TJYA 3RARA 3I04M 2YZNA 4IVNA 3ZWWA 3W5CA 1AHNA 2QAJA 1MGOA 4RPKA 4BTEA 2H1CA 3TCXB 4IL5A 3S8EA 2J0QA 3SN6A 1ZGHA 1LV7A 5FADA 3DOIA 1WG8A 4DR6B 2PUHA 2IDMA 3MRVA 4INOA 3V8PA 1XTVA 3UBMA 3N0TA 3LBNA 2YYSA 3FUVA 3O7WA 1YASA 4N18A 2UXBB 3IQFA 2P1RA 2BFDA 3VX4A 4ND7A 4LN1A 3MIZA 1EGQA 2YWDA 4OQMA 3K0KA 3E3AA 5CDHA 4LWPA 3DMYA 5CVVA 3OWHA 5F12A 4BGIA 4EW3A 4ZT2A 5C32A 5EXPA 3EX7C 2WAAA 2CWWA 3DFKA 1CRPA 2FN9A 3FX2A 1Y1KE 3OCUA 2FWJA 5ALDA 4RJ2A 3ZWPA 4LOJA 1Z45A 4HWPA 1MO4A 3KYJB 2EDAA 1YA8A 3KXKA 3D64A 3U3MA 1VJCA 2VSQA 1O87A 3FCOA 3U3JA 5IT5A 4YI3A 4C4ZA 2OECA 2PO5A 4WZAE 4TUYB 3SX2A 3OE7D 3R0QA 4JJKA 3Q1KA 2AFVA 3AWIA 4WY2A 3SZOA 2WU3A 1NVMB 1RLTA 1TK3A 4LISA 5CH5A 3OX2A 4WRRA 1U2SA 2WD8A 2JANA 4YP1A 2PZFA 3PRJA 4C0SA 3GLSA 4RY2A 2BR4A 1EUQA 3KG2A 4ILKA 2VJCA 3OBIA 1NHGA 4N6NA 3OQOA 5JBIA 2C2YA 4RLFA 1K7FB 5IYZF 1UFVA 5FULA 3MTJA 3FHTA 2Z2IA 2ZVQX 4JXXA 1I2CA 4YQEA 4QFMA 2OL4A 3EULA 3ADCA 1SK9A 4J1NA 1BD3A 3AEUA 5D5PA 4A2WA 4B85A 2XUPA 2Z8YM 2YHIB 4R1TA 3MGCA 3HKDB 1NJ1A 3PWSA 3HCCA 3Q3EA 4HDRA 4C3VA 4DMLA 4WOPA 4D99A 4IR7A 5JO0A 3QUAA 1VMDA 2W2LD 3T3OA 1JIIA 2DKFA 3KPUA 5B1SA 1NVFA 1QV7A 2DWPA 3DBRB 3EZ6A 3MCUA 3NYRA 3OZFA 5TGTA 5BQPA 4WASA 2IYOA 3GWGA 3BEOA 4MI1A 2AOVA 2O2YA 1J97A 3H9EO 5EVJA 1WDKA 3VI4B 5IANA 4TZTA 3FOCA 1H0SA 3QTBA 3QG5A 4DT1B 4ZOLF 2JI4A 4K9MA 2PHZA 2IP2A 3KDAA 1YZGA 1AKNA 3D2BA 3EVAA 3NV9A 5GGXA 3CEMA 2IX9A 1ZWKA 4S1NA 3OEHD 1VFNA 2B1IA 4PQYA 2I29A 2VAXA 1L1FA 1JQDA 2ERYA 1UAYA 2N1BA 3TQQA 1LY1A 1U0BB 1E2DA 1NVEA 1TEHA 5P8WA 3Q3JB 5A3SA 2IYTA 1E4EA 1M8PA 1WF6A 1BXKA 2V9ZA 3DZDA 2YKGA 3G5MA 1Z17A 3QM1A 2H7YA 2PBZA 2PXCA 2RONA 3UN1A 2IHYA 2VYVA 4LYYA 5CB8A 5IJXA 221PA 1VIVA 3JQ9A 5C5IA 2NVOA 2YZGA 3BEDA 4XR4A 1GAXA 1OBCA 2PUTA 5FPYA 3FE2A 1SU8A 1P1CA 2DU8A 2IYXA 2QZPA 3KEQA 3HGMA 4N3CA 3V6MA 3UV7A 3GLTA 2OAQ1 3VAAA 3ROPA 3T5PA 1UKEA 3F5MA 3N8DA 4AMYA 2F62A 3EH1A 5M7EA 4A10A 4ZHQB 1HI9A 5AK0A 1HDRA 2Q6LA 2AG6A 2GVZC 5IBRA 4LJSA 5CMLA 3HO1A 1JQ5A 1T3HA 4AJ1A 2XDQA 1WBBA 4KR2A 2P62A 6Q21A 3FDZA 2H59A 3V00A 2WA2A 3QELB 2GO7A 4K46A 5G2OA 3C3KA 4L9SA 2ZIWB 1MENA 2CCJA 2E49A 5IKOA 4I1SA 1W96A 4F5ZA 4DUYB 3GLGE 1PDWA 1RC1A 1Z4PX 3LXMA 4IG9A 5J4KA 2JHAA 1KYYA 2QJWA 1QWOA 1SU6A 4P81A 1DC3A 3F5DA 4FBGA 4ME6A 4NHEA 5TQ2A 5DTIA 3PQ7A 5BW4A 3V6LA 2OV6A 4QOIA 1ZGCA 5BN5A 1DJPA 3COJA 1GUYA 3LUHA 1ZS9A 4KN6A 1TE2A 4JUBA 4X90A 5IAKA 4DG5A 5EN4A 2ZYGA 1GVNB 3ZHRA 4FUTA 3L6RA 1I01A 1ECFA 4H3SA 5EWMB 3U5TA 1FA9A 1KMHA 5CAEB 1ZNXA 1ODSA 5BMVA 3MOSA 1KO8A 2TMYA 4BVKA 1ULBA 1GNSA 1CZUA 2IHUA 5FFNA 2Z2YA 5IEJA 1HRDA 2NSYA 3OIDA 2Q5CA 2VK1A 3A6GA 1T91A 4FFOA 1FNBA 4HV4A 1JHMA 4FOPA 4P35A 2J0UA 1J5XA 4QBGB 3UXMA 5FL7D 3F98A 3BH6A 4TOIA 3L7DA 1ZOSA 2DR3A 2HJWA 2X0RA 4CMBA 4MPTA 4DEXA 2QRJA 1ZM9A 4ZQIA 1J5EB 1P0PA 4C7OA 2I6UA 2PGIA 2G1KA 4QXRA 4ARZB 3LM8A 4KB5A 3ONEA 2WVHA 3BFKA 1JVNA 3FTQA 2X4GA 4OQEA 3ZJ5A 1WAMA 3RYHB 2Q3LA 3DWGA 1K7EB 2B1JA 3X1WA 2YOHA 1K7XB 1U1FA 3EWIA 3RT7A 5HIJA 1PEDA 5JAZA 1E6WA 1L4FA 1MEEA 2P9TA 4RTSA 2J7PD 1Y9JA 3B85A 4FINA 1QIGA 1OTXA 5ALHA 2GEKA 3VNRA 4RIFA 3L8YA 1CIJA 2JIZA 4C04A 1S01A 4DIOA 4YDHB 3LX4A 4FC6A 4GMKA 2PMBA 1YB6A 3OCWA 4J0FA 1T9HA 1J8QA 4C0XA 3BRWA 4I2VA 1I14A 3QE0A 1RYFA 4KPGA 3SEQA 1DT3A 5DLDA 3GFOA 3UT6A 4Q3OA 5G53C 4DM7A 3Q85A 4UXHA 3HS3A 3TNDA 3LUKA 2O3TA 1CF2O 1GNPA 5GJVC 4JI8B 5JJIA 5DULA 1L7BA 2Z09A 2DH5A 2HLHA 4GBGA 1QGAA 3G7NA 1ZEMA 3SP1A 3C15C 3WHIA 3A2MA 1IY9A 3JD0A 1XI2A 1QJ4A 3DSRA 4CG2A 1QTNA 4J2TA 2HA3A 5AI8A 2V54A 2I8AA 1KSHA 2C03A 3QOXA 4OQFA 2BE7A 3WG9A 3Q1LA 1ARZA 1N7JA 4CT0A 4LF9B 1C8LA 5ECDA 4EQZA 4FDTA 5CGQB 1RYNA 5LMNB 1DAIA 1H93A 1QIEA 1TF7A 4NARA 3GUCA 4BOYA 1W47A 1AMOA 5HQ3B 1C81A 2FPOA 4JJIA 4YASA 4EBBA 3ER8A 1TC2A 2ABWA 1T5IA 2HN9A 4ZCSA 2EJWA 3LY9A 1YJ8A 4KLAA 3GFGA 3HJUA 1KDRA 3G1WA 4OHPA 2JGNA 3STYA 1PR2A 1CV2A 4QLAA 4CI9A 4D9IA 2V7PA 4TSKA 3GMSA 1DKQA 3KVYA 3G8CA 4OBBA 4HX2A 4U6SA 3I37X 4PX5A 4X1IB 5M2QA 2GTHA 4DCVA 3IJPA 4KQFA 2G8LA 4L28A 5LPNA 1E58A 3MWLA 3HB0A 2DUUA 2MMCA 4XI9A 1L3CA 1ZIOA 2IA5A 5CYOA 1Y81A 2QM0A 5JAPA 1E5VA 3GRUA 3CVJA 4ZQBA 4EGJA 4CN9A 1L1QA 4YBRA 1UINA 3EGXB 4ZO6A 4M60A 1E1YA 4YO7A 1A3CA 5I4KA 3PA6A 4MRVA 2ZBEA 5JYEA 2IZOA 2DPMA 1V6CA 3QFRA 3BE8A 3EGDB 2C5SA 1DIHA 2XWPA 3ORSA 1OFVA 3LS2A 4WZBE 1NNSA 2AXNA 2PVPA 2ZIFA 3CLKA 3F9RA 4HNHA 1X80A 4PU0A 3AM5A 5I9SA 3DEFA 1TQHA 1V8PA 1XKXA 2GWRA 3IA2A 1TKCA 3IAS1 3OPNA 5JWHA 3ZG6A 4PGGA 4WXRA 1UKAA 3D1JA 1N1GA 5D3MA 2VZ0A 3D7LA 1ZOIA 1U1DA 3E1KA 2BCJQ 3P26A 5FNVA 2UZ4A 1ZIPA 3H13A 4JBWA 4KNVA 3WIOA 1N8TA 1XZCA 3PHHA 4BFLA 3HB7A 5BV1A 3C3XA 3DOFA 4MHSA 3RK4A 2VS1A 1PW5A 1VQ1A 1EZ4A 3PPYA 3QVGB 4FONA 4NU6A 5CNKA 3R76A 2WVAA 3C98A 1LRKA 2B4RO 2JGEA 1UJBA 2NUPB 2PANA 2WWTA 4G97A 1Y8CA 4Q3KA 2P75A 2X6QA 3IAHA 1EJ2A 3JQAB 3S2SA 2AGVA 2BEVB 2PS0A 4K8RB 4OP3A 1QPZA 2ZETA 1GRQA 4B35A 3AG5A 3IAAA 3ICEA 4D26A 1RBZA 3IIMA 3DMPA 3T9AA 2ALJA 1P33A 1VLVA 4Y1GA 1ADJA 1HY3A 1YQGA 1ISSA 5COQA 4MW2A 2PUCA 1XNJA 1XZPA 1R0KA 3PFWO 2HF7A 3Q9UA 4JBXA 4KVZA 2C61A 3O4FA 3PR3A 4YP6A 3HA3A 1AKRA 4EFKA 1G55A 2QN6A 1B43A 1XQXA 2IS2A 2HEGA 4HB3A 2Q6KA 4HYYA 4B7CA 3IPAA 3ONVA 2F64A 2J31A 3HI6A 4EP1A 4OFZA 5EPEA 1SAYA 2PXAA 4F86A 1S7GA 2QSUA 1UOPA 3UOAB 1RLMA 5HK9A 1QE5A 3FETA 5IJ0B 2O5EA 1F8FA 4D8TA 4F9FA 4QT4A 3B3AA 4OIFA 2PQ0A 4NCKA 3IJ5A 2Y2VA 4N01A 1G21E 4B0PA 4ZWNA 2QRMA 4OX9B 3ZCUA 1C0PA 2HA0A 3ROEA 2PFGA 7GPBA 2HT6A 5JAUA 1JB9A 3EVNA 3GPCA 4H7PA 4R6XA 4JDPA 1NGSA 3OF2A 2WIKA 2GN8A 5JIBA 1EWQA 1FS6A 1QDLB 1CU1A 4M21A 4FZVA 1IG0A 3BGVA 4YJ3A 3Q8WA 1A8HA 5P21A 4CYMA 2PQ2A 1IM2A 3KHTA 1Y63A 3ASVA 2BGTA 3MWGA 1FFXA 3DOEA 4Y2GA 5DGHA 4QOJA 1WXGA 4CEHB 2EWWA 3LC0A 4K1XA 1SKQA 3DAPA 3ZV7A 4L7QA 4YCSA 1OFTA 5AH0A 1JKFA 5FLKA 4H27A 1KP9A 5KNDH 2OG2A 3K9NA 4KXLA 2VJNA 1ZR4A 4ETWA 1KEWA 2X14A 2XRYA 3K31A 1XIVA 3K4PA 4H7EA 4X00A 3BTOA 3L4KA 3WYBA 1UKZA 4TS4A 2I4TA 5HFAA 3B89A 3WGOA 3LW8A 3TW8A 3LRPA 4U2EA 4JJ8A 2OB1A 1VXOA 4OHCA 4NXMB 2B7CA 3H9BA 4CGYA 3P9NA 5KKNB 4KWIA 4G0NA 4JI2B 4PO8A 3RM3A 5J2UA 1LQTA 4QIHA 2AFHB 1K6XA 4QZVA 3TMAA 4NKRA 1K98A 1M8JA 2KJQA 1SK8A 3CNQS 1CVRA 1MZPA 2R62A 1NI4A 1C1XB 1R88A 4JFRA 2AFHE 3QLJA 4RJLA 4KO1S 2H17A 3SE7A 4D43A 4AKSA 4DA6A 3PTLA 4E88A 1JLRA 2PMWB 4L5IA 5AW4A 3EG5A 4MRNA 5I9MA 4KQEA 1YWGO 1NQ5A 4DRYA 2NQ8A 3S2FA 2GXAA 4PBSA 1RTKA 1UM9A 2AYZA 3L1IA 2YQZA 1T5TA 2PFKA 3IP7A 5BNIA 3O90A 2JW5A 2GZ3A 4KQ9A 4ECAA 4ENVA 4MKIA 3RAJA 2PBLA 1I3NA 4V0SA 5KYKA 5LLTA 2VK8A 4MUKA 2Z1MA 2XDWA 4L9RA 5DCLA 4ZPXA 3V2HA 5I8PA 1YGYA 5JFOA 3J80A 1ACJA 1E1CA 1QO0D 4I19A 1LK7A 1SOAA 5J3JA 1VRCA 5E9AA 5BN4A 2FSUA 4MJLA 4RO0A 4ZJZA 1TCVA 2WU8A 2J3QA 4A1OA 4IJQA 1VL2A 3G8DA 1EUCB 3S1AB 4LC1A 1KQ3A 2XBUA 5JJ5A 1E2JA 4RSRA 2OM6A 4GZ6A 4ZARA 2GXSA 3UMCA 1CY7A 2ARKA 5FWNA 5LQRA 1OLUA 5GWXA 4O0MA 5B1IA 1JQLB 1MJNA 1Z6ZA 3BIJA 3ZGVA 4XPZA 4BQQA 1H22A 1WUIS 2CLEB 3FPSA 1NQXA 3DHEA 4RTPA 3E9MA 5REQA 3CRVA 3ILHA 4DQDA 5L4LA 1QKJA 1D0IA 5BWMA 2P6PA 3ZDEA 1T5DX 3PC8A 4IBOA 5J1TB 4D5GA 1L2TA 1DXOA 1Q7TA 1MH9A 3V4ZA 4B0OA 2HJGA 2HWKA 4R5MA 1N78A 3SE0A 1IULA 2FA9A 3IERA 5A4MS 2CBGA 1QP8A 2I91A 1W4LA 4N49A 2PA0A 1SCUB 4OHUA 2NUTA 2PN1A 1KF0A 3BG5A 4DADA 2WF8A 4ZCQA 2HTEA 3ZV4A 3WGVA 5M04A 2P4UA 5JMTA 1Z0UA 3FJOA 4M49A 5K8TA 2D06A 3BKXA 4Q24A 1UWVA 2DJ5A 1JR3D 1PO7A 1SVWA 4LZJA 3SF0A 4D97A 1U8EA 1TYZA 1OV4A 4F46A 1UP6A 1A0OA 3TLXA 3ZDYB 4AMGA 1GUBA 3NEJA 4K86A 5ES3A 4RADA 2NOAA 4GT1A 2GT1A 2VUTA 3QLUA 5E6RB 1XROA 3TLCA 3ZWOA 3GJRA 5IC6A 2ZRCA 5IDYA 5BN1A 3U1BA 2X8BA 4M0UA 4U9UA 4OYRA 1ZM2A 3T1YB 2Q3JA 3A0RB 4GPEA 5EIWA 3SQMA 3W2HA 1IWOA 4E03A 2XT6A 1SKYE 4BO8A 4G1EB 5B37A 1V11A 4KREA 1AKMA 2AWOA 2O2ZA 2H5EA 3CLTD 1ZXBA 1XVLA 1YI0A 1VPEA 1ULTA 4OFBA 1FRZA 3AEQB 3V33A 2XTJA 5B6IA 1GGJA 3ANNA 2WICA 5DWVA 3TRFA 1AUQA 1GPJA 1Z4NA 1NDUA 2XXBA 2XHEA 3BK1A 3DDZX 2X9NA 2C58A 4MB0A 5BT9A 2NNWB 2IPOA 5T8KA 5BOSA 1RXWA 1L5OA 4YRMA 1Q77A 3GHYA 3ZTWA 5JAOA 2AH5A 4B7XA 1RXCA 2K6GA 5JPIA 2XDYA 2WUFA 4UTOA 5FLEX 4BRZA 5HRAA 2UUBB 2QM7A 4J4BA 1J9GA 2DBRA 4PZ9A 4AT1A 4G85A 2GFHA 5T41A 4BLSA 4MRMA 3ZHOA 2WSIA 4WX2B 4GZMA 1W9HA 4QXQA 4TMKA 4PAGA 1LPOA 2V7GA 4ZGBA 2IYVA 2CLFB 1VBMA 1G5PA 3LCCA 3M6WA 2HA2A 5HBGA 5J59A 4DYVA 3AL0C 3HKCA 3PRYA 3TRHA 4MIOA 1BGWA 2RHBA 3NHPA 2C42A 1VPVA 1FFBA 2J08A 2H1HA 1N1MA 1CBUA 5DXFA 3BH0A 4KGZA 3BFJA 1CUIA 1E60A 4D6PA 4QDJA 4N7MA 2ST1A 4L1KA 4EPYA 1V8BA 3OTGA 1K5GA 4OJYA 3ENKA 4RVDA 3ZLJA 1JEYB 3AHCA 2IS6A 5EVCA 1QNLA 3MRTA 1T0JB 1U6JA 5DM1A 4JQYA 1EKXA 1NDHA 3M6VA 4MS4A 4GX5A 3OQ1A 3RIXA 1KPGA 2BELA 4IMJB 4U5QA 2Y71A 3QBTA 1VKNA 1Z63A 1ZITA 4BE4A 2TYSB 4WCFC 2QTCA 2JAWA 2ZKLA 3ETJA 3SEZA 5EJ9A 4IH4A 1H94A 4MGIR 5E6UA 2OORC 4HPJB 3TXXA 1B1AA 5B5SA 2RD2A 4JI5B 1YS7A 2VRWA 4IV0A 5JNVA 1X7YB 2CK3A 2X5XA 3O4HA 4QBKA 4BQIA 3A0UA 4L0QA 1US8A 4Y9SA 5HMLA 2XMPA 1H6DA 2RC6A 2JFWA 2QRNA 1J2EA 3D6AA 4JC4A 4RKYA 4EGCB 2QG6A 4M3NA 4YJHB 4G8DA 4U63A 1J4AA 4OSEA 2G17A 1SKMA 2HK8A 1D1PA 3EFEA 1H6BA 2CJYA 2QMHA 2BGMA 1N5DA 2HXYA 1I5OA 2XCIA 3N0WA 4LXGA 4QLOA 4CG3A 1ZJ4A 4FW8A 2DSTA 3I5AA 1CZHA 3IDQA 3GNSA 1ZRNA 4OREX 1XWIA 3LSYA 1FPMA 3JD1A 4ATNA 4QGAA 2FP3A 4POAA 4HLDA 2ZKIA 4MWSA 1PL6A 4JEIA 1FUKA 4AXXA 2DBQA 3CVWA 3UKJA 2OFOA 4U3JB 1BS1A 4Z0TA 4A0QA 2H4HA 4H17A 4TLAA 3G88A 4FHFA 1KYXA 4JP1A 3FHCB 4Z2YA 2O0MA 3RREA 1KQNA 4G24A 3OEEA 4CT5A 4OBXA 4QUAA 5IH7A 4JEHA 1YACA 2NO4A 1NFFA 1W4BA 3EISA 3UJNA 2XZLA 3PR1A 1Q20A 4NBUA 4PPYA 4XB1A 2ZRIA 1COZA 1EQUA 3O0DA 3TQCA 1WBDA 5KTKA 4XX1A 5FR1A 1M83A 1V1RA 2DQYA 2H9IA 3I58A 3STHA 4B9AA 3B6JA 4G23A 1V35A 2YRXA 4JU8A 3CJTA 4PHHA 4RK6A 3DDNA 2W48A 4WUVA 4X9XA 4CKBB 4DLBA 2C7OA 5IZ4A 3RS5A 1EQ2A 3LFUA 5LQMA 1TXGA 2EZUA 3CLUD 2F9LA 2IIQA 1FBTA 4TWRA 5EUMA 5K3BA 1UZAA 2A9QA 4YRAA 1A8SA 1IE3A 2BCEA 3Q6IA 3ZGYA 2NXNA 3A2NA 4GBED 4UZSA 4ZI7A 4Z7JA 4B4OA 3WBJA 1IPFA 1G3MA 2HL6A 3H7AA 1M34B 5IF9A 1KAGA 5FIUA 3P97A 4C9BA 1JBKA 4EUEA 1R3DA 1SBCA 3GGSA 3SS8A 4V1CB 3H84A 4BO4A 2VHXA 1LPAB 3FBTA 4N3AA 5LNK6 4X7MA 1EFRD 1E1DA 2CZQA 3IAXA 3K9BA 3Q3CA 3L1UA 3LHSA 1G2IA 4QJBA 2VHYA 3PT9A 4RCVA 4KE9A 1H0KA 2VF8A 2Y68A 4YFYA 5FPPA 1NNUA 4LF8B 3UHAA 1PR9A 4ARUA 5F1KA 1IZ8A 4IMIB 3AFHA 3V1KA 4R3NA 1R00A 1R16A 1W36D 1BA2A 1Z0ZA 3DBOB 4Y2XA 5F3RA 5JD4A 4CLEA 4DSAA 1RZVA 2ZAIA 2X6TA 4YJFB 2JH8A 2WWHA 4CQLA 5HWSA 3K72B 4RMGA 1FF9A 1ESMA 1VTKA 4P3KA 4FJ0A 4TLCA 4UMDA 4IGEA 1LLFA 3P9PA 4M83A 2JKVA 3H17A 5C1IA 4ZYTA 4NWIA 1O89A 4Z4QA 3F0TA 2AI1A 3PPIA 4ALLA 5KDLA 3R6WA 5H80A 3DVAA 3HY3A 1BWQA 4XQGA 1F2TB 2QN7A 2WZDA 4GSLA 1TDJA 1R74A 1SBQA 3UA0A 2OFPA 4CKXA 1SUEA 3GP8A 1W5SA 3EIOA 1QVVA 2VZ9A 2O48X 2P5UA 5GZ6A 3DJYA 5C8XA 4FDLA 2HQOA 3ZKWB 1IHUA 1RQ7A 2ZWIA 1FJ2A 1U11A 1C29B 1JGTA 2WOJA 4MJXA 3GFBA 4NBVA 2VZ8A 4G07A 4YRFA 1T8UA 2ZUWA 3PC4A 3IMFA 4FBMA 5ER9A 4Z53A 5C80A 1C5KA 4N76A 3W05A 1R6VA 2WKSA 4BQNA 1DAFA 4FNAA 1GRVA 3Q3HA 3ZDBA 4V0ME 3DFFA 3HVJA 3IJRA 3ZTYA 2EKBA 4QDXA 4F4JA 3IODA 1RWPA 4IRXA 5ABPA 3QX7A 3KAQA 4Z99A 5BUZA 2JAPA 3K0BA 1PGOA 3OWXA 3QUCA 1EINA 1NUUA 3AHGA 4FE4A 4UUAA 3ZEAA 4YT4A 5I7FA 4JI4B 2YRWA 4O4HF 5LOVB 5L7YA 1W87A 4LHVA 1PYOA 5TARA 2Q5LA 1UC8A 4XVHA 1OC4A 4D9JA 5IVPA 1BD4A 3G0BA 1G5TA 3Q98A 3VTAA 2CXUA 3GNLA 3NXSA 4DQUA 1UDAA 1U4OA 3EEYA 5T4BA 1RWBA 4B33A 1L3IA 2JARA 2NIPA 3V8RA 1Z8FA 1UJ4A 2FH5B 1ZK4A 4F91B 4LOKA 2WP8J 1M1XB 4R51A 4DPKA 1Y33E 1JMYA 1MN6A 2B6NA 2RI1A 3TFQA 3ZHCA 2XBMA 1JHUA 3E2MA 3GUZA 2P8SA 4HF7A 1Q0LA 2G9QA 1F1BA 2V6MA 3KKLA 1Z34A 1EIWA 1COWD 4BFSA 4M55A 1JPUA 2O8DA 1KORA 3TEFA 3A28A 3DXFA 4JN6B 4A92A 5TRTA 5IBQA 3MTIA 3ROTA 5F21A 3DFIA 4PAQA 2YFYA 3BPSA 3L07A 2NVUB 5BSRA 4K6MA 4CXMA 1R6UA 3VR5A 4JLNA 4BMYA 2IP1A 3IUJA 2PE5A 2B5WA 2FQ1A 4QJIA 4W9MC 2QG9A 1MU0A 4CEJB 2C4HA 1RFLA 1X7XA 1L7EA 2WJWA 4ZAGA 4XD2A 2HHHB 3HDJA 5IPFA 3HZRA 1U5AA 4LHZA 4HNRA 4MR9A 1WDLA 3L7KA 1RXEA 4XSGA 3S27A 3GXBA 3I9NA 1R37A 1M6WA 3M34A 2ZM5A 4AO6A 1OF1A 4AJNA 3K1JA 3E23A 4UHCA 4HQOA 2YJ5A 3D7SA 3PE4A 1VIAA 4FJ1A 3H1EA 4F4HA 4MYTA 1C9JA 3I1FA 1EBUA 1NUSA 4X24A 3AUXA 2C4MA 2Q2NA 3UAXA 2FP4B 4HWOA 2W42A 2WDPA 5HF6A 3ZHBA 3GL9A 5DYIA 4YRNA 1H3NA 1U3WA 3BWBA 3ESZA 4J0QA 4KDCA 4Q9DA 4E2ZA 1VXRA 5AQEA 3UWSA 3QE2A 2D7DA 4BLTA 3GCZA 2H29A 4OK5A 3ZW7A 1U9CA 1SZCA 3O8DA 3K9GA 2F90A 1K8XB 3C3YA 3HBAA 1SCBA 5AW8A 4PGMA 4YTEA 1UXJA 3ME5A 1G60A 1KERA 2CD7A 1MJHA 2ONKA 4Q3DA 5LLDA 1W88A 2YASA 1Q84A 1X0XA 3GPBA 5HHTA 2AJLI 4ZK2A 1C9YA 5IH3A 4YJGB 5A1JA 4QRHA 1UPBA 1UDRA 2FPPA 3CUWA 3MMSA 1PJAA 2WSMA 1WDWB 3FD8A 3KEOA 2NXJA 3WJAA 2V6IA 4MQ6A 3QKSB 4CT4B 1IUOA 3DL4A 4JQSA 3VHXB 4H15A 4M1WA 5DYNA 1VG9B 3QQ5A 5JNLA 2ZXUA 1W5EA 2QN3A 1U8YA 3OZAA 3JQGB 4L6IA 3DFUA 1IMOA 3HDGA 4ESOA 1QS0B 1XZBA 1WUKS 3LA8A 3OLCX 3OKPA 4F8EA 4BX8A 1GILA 2AF3C 5JCPA 4FEYA 4G36A 5H4HA 1LZKA 1RACA 2RCYA 2AN4A 2YIDA 3MTAA 5SV2A 4YUYA 4HK4A 2AFIA 1E94E 2D1FA 5BOVA 4FZRA 4A36A 3J81A 4NULA 3I6IA 4RH0A 5KNDD 1I36A 4NU5A 2W2XA 2V8OA 4GZ5A 1A5ZA 4V02A 1NPDA 1TUGA 4HNAB 4U2KA 1AKTA 3MIIA 3NH9A 4G26A 3CT6A 1FXUA 4NG5A 2R0QC 2B8NA 2P6MA 4X7BA 3H86A 4B48A 3JD3A 3OZBA 4MGKR 5F4ZA 3SLKA 3AUTA 3KXLA 1X9IA 3EW7A 4P54A 4NYJR 1JHOA 2OAGA 4V3BA 4Z51A 1J0XO 4LV5B 2OAEA 1ZD3A 5KU7A 1GGEA 4MRRA 3AKZA 1RJEA 1XZ8A 2FHSA 3LG2A 2VUUA 3QSGA 4TVKA 3W7VA 3BGOS 4RDIA 1WZ2A 1QDEA 4I1IA 2O05A 2ECFA 2G8NA 2LGJA 2ZIZA 2P78A 3FWPA 3Q12A 4QJ5A 3FYTA 1K4MA 4XQ0A 5EP3A 5FTJA 4INPA 3T0FA 1BYUA 2JGDA 3DNPA 3H8SA 3THSA 2RE8A 1XTUA 3JCZA 1ORWA 2D0DA 4UM8B 2M9MA 3L0PA 1XPRA 2XH8A 3E9DA 2XCTB 3HXOA 1J2RA 1OOEA 2E37A 3C0KA 2FEAA 5JSZB 4IGIA 5KPJA 5IZCC 3BXOA 2PS1A 5A9RA 4N41A 2I62A 2EU8A 1ZLYA 1XUOA 2HREA 4HNTA 2FPUA 3L6UA 3RFFA 2XE8A 1TECE 1EHCA 2JBHA 1JQAA 4CM4A 1RYMA 2CLIB 5DCUA 3CRNA 4REQB 4ZMRA 4ZOBA 1H2AS 2EW8A 1EZZA 4BAGA 4QREA 5LWQA 1VB5A 4EKDA 1UBKS 2EIXA 5I9BA 2PXXA 2JBAA 1CJTC 1YJXA 3NDPA 1U7UA 3LFHA 1ZEJA 3IOEA 2WUVA 5FWXB 1U31A 2FY8A 4IIJB 3F6EX 3OZGA 5TMBA 5I7RA 4YS6A 3W4JA 2HA6A 2TS1A 1CC1S 3G23A 3AF5A 4RS4A 1ADGA 4IFTA 1ST2A 2C4VA 1HLDA 2YDXA 1UP4A 2C1ZA 2EFGA 2JFPA 2ZBUA 3CF4A 2PGOA 4YYZA 3DR3A 1H8HA 3OJFA 5CBPB 5AW2A 1HETA 2EP5A 4RYLA 4K05A 4NJMB 5TE9A 3AY0A 4EBFA 2Y6VA 3KWLA 2ZIGA 4XVUA 1QQTA 4HDCA 4NBNA 1VG1A 1M2VA 1PT8A 3E6AA 1NBEA 1QYWA 3Q5DA 1TX4B 1B15A 2WBLC 3KQOA 1LFDB 1E9EA 3C1OA 1F60A 4AX8A 1TUBB 1EX7A 1SUBA 3W5HA 4K0KB 2IHBA 4LRYA 3ZY3A 3PF9A 4Y2YA 1JV2B 5ICGA 2PPVA 3F8SA 4KDFA 4Q4LA 2E6UX 5HJ7A 4TYPA 5IVIA 1DAKA 2BMAA 2GEBA 4H3KB 3LX5A 1B14A 3E9ZA 3R6GA 4I50B 4NOJA 3AF4A 1ZK0A 4UHJA 3WZMA 1SURA 3K0AA 5TQVA 5JUWA 2BZSA 2OBMA 2WYVA 5C4GB 2AMJA 2HJHA 2J9XB 3GT3A 5G1PA 5L3ZA 3ILVA 3AQ4A 1R0SA 2A9JA 1YZTA 5ESXA 5B3AA 521PA 3GCDA 4UE2A 3TWOA 4AYTA 4D25A 3OOWA 4GE3A 4C43A 4YDSA 3K70B 2IEBA 2RHHA 1EVLA 2WWYA 4IXWA 3UOWA 4R2XA 4F2HA 3UAZA 4PX3A 2WJZB 3L4EA 2Q1TA 3M82A 2ORVA 1USIA 3C7DB 2DETA 3GA5A 1QZXA 5AW7A 3B70A 1N7IA 1O95A 2Z6VA 1YB1A 2KLBA 2MIIA 2VHZA 4PY2A 4R05A 1NQWA 4RFLA 3KXIA 1L3BA 4OUDA 3VHQA 2ZBDA 2HMAA 5DNCA 5JNSA 3DM9B 4CWAA 4DZZA 2HJRA 4QDOA 1CB7A 2EZ4A 4R4JA 4GPIB 3FY4A 1X8LA 5EXEA 3ZVMA 4AJPA 1CK4A 1XD2A 4HS4A 1DBVO 1A1VA 2VNAA 3GJ6A 3VYUB 1P39A 2OP0A 1N2CA 1TJ4A 2C20A 1J8YF 1KEZA 4KPFC 1NULA 3RHSA 5TLSA 4Q4HA 1YHYA 3A7DA 4J3JA 3TGWA 4IXJA 5D84A 1V3QE 3OT5A 1XQVA 1MGPA 1PFKA 3RI3A 1A50B 3UV6A 2B9EA 4ZDIA 3NORA 2W2MA 1UQTA 1U2QA 1G59A 4QAJA 4HAOA 5K5EA 5JNUA 3OJ0A 2OHHA 3FYUB 3L0DA 1R8JA 4E15A 3S1SA 1I3OA 3GMTA 4IZIA 5LQDA 1E96A 2HGZA 2PKWA 2MT9A 2Q4EA 1DDIA 3IE1A 1TCBA 2PZAA 1KO7A 3ORQA 2VQ6A 1Q0UA 1IHPA 1EAMA 4YALA 5ALXA 4QPNA 4EJ6A 4DXAA 3R0JA 5LQKA 2BM9A 1JDPA 1A27A 3K9CA 1QF6A 1W75A 2D2IA 2GX6A 4KV7A 1K5HA 4GPD1 2ZB8A 5BWLA 5MN5A 4JCCA 5I47A 2UYQA 2HZBA 1Q6YA 3JVVA 4FN4A 4MUYA 1TK2A 4XOUA 2Q46A 3QPVA 4A5SA 2BEUB 2OV1A 4EA8A 5CDTA 4QDKA 2DFVA 2VSFA 1NNI1 3WADA 3SZRA 3UMMA 1NF9A 1R0WA 1UWCA 3GUYA 4KLNA 3U7HB 1UK6A 3LGSA 1TT5B 3KEGA 4RHUA 2AA3A 1EFVA 4ADSG 1JL3A 2FZ4A 3MLBA 3DZKA 3GP3A 1ZRMA 3LKVA 4P7JA 1INLA 1P1RA 4KXQA 3X2SA 3B7GA 1EDDA 2WDZA 3CFFL 1ZH0A 5IW8A 5F51A 4B6EA 1J25A 1L4GA 1TF2A 3OOHA 1VA5A 3IP6A 3HV0A 2WU4A 1JA9A 3U4CA 3SHQA 2O8CA 1DWOA 4BVGA 3ZVNA 1U2ZA 5A4AA 2OD2A 1YVUA 3DE0X 1FU7A 4AN1A 3FZQA 1C0KA 4GWLA 2YVQA 3DW1X 4JENA 2DKNA 4ID3A 3JVDA 4UZFA 2NVBA 3PE3A 5LQSA 1DIOB 3EVZA 4KGDA 4YECA 4MHTA 1JN0A 4UPVA 3IPCA 3H9UA 5J9FA 4YAIA 4UOZA 1Z0KA 1MC5A 3NH6A 2PGJA 2NU7A 2ZRBA 3EDRA 1JDTA 3HJRA 1UC5B 1Z88A 5EHXA 2LIPA 3WFJA 2Y1GA 3WNVA 2HMYB 4YV2A 1EWVA 2HPHA 2O6HA 1T26A 3RF7A 1LI4A 3RYTC 1KIMA 3B3FA 3PZRA 4WK2B 4BFTA 4F3YA 2IHNA 3OSUA 2BBOA 4K9OA 1U2EA 2P9FA 1R0ZA 2C9CA 2IELA 3E7WA 4YRIA 2X0JA 2IGTA 1A4UA 5FOSA 1L8QA 2QJOA 4OLBA 1FZQA 5FJIA 3OT1B 5CT4A 4NEGA 1O94A 4RKFA 4YAWA 1AA9A 2XAAA 2JVJA 3IEVA 4IMPA 5FPSA 2M1XA 2ISSD 3DE3X 3LY8A 4LHWA 1BQEA 3F1LA 1CDZA 4LXQA 3ZN2A 2Z5LA 4WERA 5EZQA 4ER5A 3PNLA 4N03A 2P2DA 1ZHFA 2O3UA 1U0EA 5HIIA 3MMXA 1NUHA 4UDOA 3ANSA 3T7SA 5DYYA 1Z2OX 1GKIA 3NBZC 4Z4HA 1W29A 1RJWA 1SIOA 2XVAA 1UXGA 4LSGA 4JYPA 2V1XA 4ZYVA 1AB5A 1ZYUA 4Q1EA 3SYMA 3C8UA 3OFVA 4KWTA 4BB6A 5C5DA 4A6XA 5CLJA 2ZJ3A 4LJYA 1YBAA 3TAHA 3AERA 3JARA 4C0LA 2H2FA 2VWPA 3WBFA 4I3GA 3LUDA 4TWBA 4ZT4A 4GMXA 3RSQA 1ZCAA 4MMYB 2PWBA 1P5JA 1FEZA 4PZLA 3HCEA 4GQBA 3WYGA 2CZCA 3MVEA 3R5XA 4FR5A 4Y6RA 2BFEB 1M0SA 3EQ7A 3O4GA 5DKFA 2JEOA 1HO3A 3U9TA 2NP7A 3GJZA 5BNTA 5CDUA 2CXOA 2W0MA 4HDAA 5CA1B 3CPJB 3HEBA 4OL9A 4TZKA 1TM7E 4X61A 4D81A 1QZ3A 1GZ7A 4ND8B 2E5LB 2WUDA 3UMYA 3ZZ0A 1EDOA 1JBQA 3CX6A 3JZMA 3KBBA 4JB0A 3DAGA 1PFWA 4G5XA 4MQEB 1SKUA 3TSOA 4MZDA 3A9UA 4EAAA 1GFWA 3HBFA 2BHSA 1O7JA 1E1RD 1T4CB 4KEAA 2GM5A 3JYLA 4FNOA 4J7UA 1L5HA 2QTHA 3ZBQA 2IHTA 3C4VA 1U7XA 4Y1RB 1OZAA 1H0RA 4CZ2A 4RORA 2ORWA 1ZXXA 4O5AA 3A14A 3UXYA 3R9IA 3AW9A 4OL0A 5AHXA 3HUUA 1GDHA 3HJNA 2I7VA 4M1KA 2HSJA 4TROA 4ACAA 3SKYA 1XAJA 2G83A 4AK9A 3ELUA 2BFCB 3I2YX 3DHVA 3GVPA 4AZ3A 3RYCA 4FZ5A 1IB6A 1ZSYA 1ISMA 4MEBA 3X1XA 4C2BA 3H2IA 1H9CA 2EEPA 3F3KA 2OBFA 2LV8A 4RESA 1PNQA 4M0CA 1GV1A 2AKEA 5AI5A 3GYBA 2WZQA 1GPYA 3MS4A 3QU2A 3RHFA 5JWOA 1QLHA 2EKQA 1CUYA 3T3EA 5B55A 3EB9A 2I3GA 3E27A 2BEWB 4M8NE 5K9ZA 3GLHE 1UJ6A 4ZJUA 4PPFA 3BD7A 4GUDA 5BQOA 4YXWD 2G28A 4QYIA 2YJ3A 1NBMD 1F48A 3F2IA 4P3NA 5KPDA 3D8BA 1MDFA 5DW0A 2WJ3A 2J9RA 3HSSA 3IV6A 1U2DA 1N5KA 4MYUA 1RIIA 3F67A 3TR0A 1ANKA 1QLWA 3DEIA 2HMSA 2GQ0A 1N36B 4DA7A 3O8QA 1IN6A 1R4MB 1Z29A 4MW0A 3WFIA 1PR3A 4L4ZA 3ZLVA 5BQXA 3G2LA 1IXRC 3PZBA 4K9LA 1J00A 2I2XB 4KQHA 4L74A 5HZMA 3JALB 2PX6A 1NU6A 2RGWA 3EGEA 1CUDA 3VGJA 3U44A 2I2FA 3I9MA 1X0VA 2QRKA 3O91A 3EA0A 1Q7RA 2Q45A 2POQX 3PRKE 5DTQA 2B8JA 5DXJA 3UMGA 3C6QA 2RH4A 3AP2A 2FU5C 3FF4A 4IUDS 5F2EA 3UV3A 4LOLA 3WLLA 2VYNA 2ZRKA 3AVUA 2V55B 4WKBA 4ZC1A 2QTBA 3TW4A 1UOQA 3GN2A 1OIVA 3LDFA 4MP8A 3WDLA 2NYVA 4BZXA 2FF5A 1F06A 4B71A 4S05A 1JPNA 2FMXA 4D9CA 3H5TA 4RQAA 3DTVD 1FS5A 2WG0A 3BB3A 4C22A 2OKCA 2FSGA 3AQIA 1EZ1A 3T7RA 2D1RA 3NKVA 1X2BA 3EFHA 4MB6A 1XNGA 3Q7SA 3OURA 3AG6A 1AGXA 5LBUA 2GKOA 3SDSA 1WBJB 1I4WA 3EYAA 4YAKA 3U7QB 1E7WA 4NABA 3GK3A 4GI7A 4L22A 4RV5A 3B6EA 4B3XA 3KPJA 5B30A 3A05A 3TKLA 4DV5B 2ZZMA 2YHIA 1JSZA 3HKDA 2DWCA 3CUSA 4PRKA 1XNQB 4AURA 1CZLA 2GA9A 3U5ZB 2WPDD 1PZHA 2GOYA 2ID8A 3DGFC 4WXPA 4OJTA 4B83A 3EA4A 3PVCA 1H2RS 2OVFA 3DBRA 3K09A 3CJQA 3LLVA 4UUQA 5DNWA 3H18A 2OUIA 5T7BA 5FA8A 1XALA 3DO6A 3TL6A 4QPCA 3QKRB 1E2LA 4D3DA 5B6JA 4YC7A 4DT1A 3OOJA 4EATA 2GBLA 2P9EA 1QRAA 1SCKA 1JR3E 1FMJA 1V5WA 2W2TA 2ZATA 3WLRA 4BE9A 5F73A 2QF7A 4MS1B 3EMOA 1U6IA 2WSYB 3JU3A 1PZEA 2PKQO 4U39A 2HXGA 4B46A 1X19A 1B1CA 2ZAYA 5ITSA 4R0MA 3P9QA 3WHKA 4BNKA 1E3SA