3ISJA

Crystal structure of pantothenate synthetase from mycobacterium tuberculosis in complex with 5-methoxy-n-(methylsulfonyl)-1h-indole-2-carboxamide
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
287
structure length
287
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Pantothenate synthetase
publication title Application of fragment growing and fragment linking to the discovery of inhibitors of Mycobacterium tuberculosis pantothenate synthetase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 88
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3isjA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3isjA01
1T6YA 4MWDA 3E27A 3TQIA 2GM3A 2O5RA 3ZUGA 3IVCA 3FI0A 4QREA 1GTRA 1IQUA 4MUHA 1CT9A 2YXNA 4PBSA 4MVCA 4KKVA 1O97D 1KR2A 4MUKA 3NBKA 5KCMA 5HG0A 4YP7A 2VTBB 1QRSA 4NAHA 1JGTA 1WXEA 4KR6A 1WQ3A 3C8ZA 4MW0A 3TQOA 4CT0A 4MUIA 4EGAA 4ND6A 5EKDA 2Z09A 4MW2A 5IHXA 5J58A 1ZH0A 3BL5A 3P0IA 1WKBA 3X1KA 1JZSA 1JIKA 3CVVA 1IH8A 3SDBA 3ZJVA 4MW6A 5HUHA 2XRZA 3OP1A 2AG6A 1MB2A 1KORA 3IDFA 3RK0A 3TNJA 3K9WA 4F3RA 2I1LA 3H05A 2O8VA 1EE1A 3FH0A 4FZJA 4UZEA 5K0SA 4A91A 4AQ7A 5TGTA 2QJFA 1J09A 1IRXA 1NUPA 5DEOA 2A7XA 1QQTA 2DEUA 1O94C 1KAQA 4PY2A 2CFOA 2VTBA 1O0CA 1M8PA 4DDMA 3CLUC 1M83A 3D6VA 4ARCA 4DE5A 5BNZA 1GN8A 1P7PA 4JFAA 4ZT2A 2NSYA 1MC1A 3UK2A 3PRHA 2DLCX 2E21A 2PXHA 2QJTA 5LLTA 1NZJA 2G36A 3AG6A 4MWEA 3CLSD 3IUEA 1WXHA 1WXFA 5TEWA 1VBMA 1MAWA 1O94D 2EJCA 1LW7A 3N9IA 1IHOA 3CVYA 3CLUD 3AFHA 1EFPB 4K0RA 1N2EA 1NSYA 4WNYA 2AKEA 1B6TA 1M8FA 1TQ8A 1LI5A 1OBHA 2A4MA 2PG3A 3ZGZA 1IQ0A 3SZGA 4ZCPA 4EG1A 1VBNA 3N05A 4G5FA 3CA8A 5FNZA 4NZPA 3IVGA 3HGMA 1Q15A 1R6UA 2D13A 2X0KA 5LM3A 1KH3A 1EFVB 4U7JA 1N3LA 1MB9A 3KFLA 2GKSA 2IP1A 3G5AA 3NV7A 3LE8A 1YULA 1IQRA 4R0NA 5KWVA 2RE8A 3HFJA 1N2OA 2QTRA 1JHDA 3TS1A 2PZBA 1A8HA 4MVWA 1X8XA 3A4IA 4ZCSA 3ZXSA 4XSVA 1F9AA 1N78A 4ARIA 4MUFA 3SZ3A 1WQ4A 3DPIA 1O96B 3MLAA 1JECA 4S1OA 3COZA 3RHSA 1M8GA 1J1ZA 4K03A 1EFPA 2D54A 3ND5A 3ND6A 4HJXA 1KKUA 1OWLA 5TS2A 2Z3VA 4J75A 4PBRA 3FDXA 2QUKA 1NUSA 2CV2A 1R6XA 2CSXA 4QBTA 1KP2A 1J21A 1O95C 4U63A 2V0GA 1VLHA 1FYDA 1KP3A 3ZJTA 1T9GS 4G6ZA 2BYTA 1GLNA 1EJ2A 2J5BA 3AG5A 1N77A 1J20A 1I6KA 2HMAA 1OD6A 3MXTA 4CDNA 4MW5A 4Q93A 2D5BA 2BTEA 2E0IA 1U3CA 1PFYA 3IMEA 4YP5A 1MOPA 4ZT6A 3ZXIA 4MULA 2J09A 1QNFA 2ZUFA 1F4LA 3ILVA 3QTTA 2X3FA 1H1TA 2CYAA 2OQ2A 3COWA 1NUUA 3FY4A 3P52A 1QTQA 1EUQA 4MW9A 1O95D 4E1AA 1PFUA 3ELBA 5DASA 4ZCQA 4I6EA 1M8JA 1WXGA 4U8HA 2DETA 3K32A 2DPLA 4XFDA 2DR2A 3AL0C 1XJQA 4EG8A 2WQ7A 4EG4A 1G8HA 3H97A 1UFVA 3SP1A 2GOYA 4DDHA 3GMIA 2CT8A 4P2BA 4YBRA 4MAFA 2IELA 3CLSC 4HPWA 1I6LA 4EG7A 1H3NA 3TZLA 2HGZA 4WSOA 4MUNA 2C5SA 4I6GA 4ND7A 1OWNA 1NUQA 4MW7A 2QJOA 3MLBA 4ZT4A 1WY5A 2J08A 1YUMA 3X1MA 3H99A 1MRZA 1QJCA 3I05A 4MQ6A 3SEQA 1MAUA 2NZ2A 3PNBA 3F3MA 1NURA 4EF6A 1K4KA 3DO8A 4UZFA 2H29A 3CVXA 1OBCA 2AZXA 1G8FA 4MW1A 4QRDA 3SEZA 4KR7A 4EG6A 3OTWA 4X0EA 3KT8A 3CLTC 1T6XA 4ZCRA 1XNHA 5LFAA 1R6TA 2V0CA 2B7LA 2H2AA 1V8FA 3VGJA 4EFKA 1O6BA 1V47A 1PFWA 1YIDA 1JIIA 1JZQA 3Q10A 2A1UB 1T9GR 1U7DA 4NAUA 3KT6A 3X1JA 3INNA 4G5YA 3DV2A 1WJGA 3G6KA 4GU5A 2DUMA 3COVA 1KAMA 4GRIA 3M5WA 5JBNA 4NX2A 1XNGA 1HYBA 1ZUNA 4OJMX 1COZA 4JYZA 1N2GA 5H16A 3CLTD 1DNPA 1KQPA 3Q4GA 4AS1A 1IVSA 1O5TA 5IJXA 3U1VA 5DB4A 4KR9A 4L2IB 2CUZA 3FHJA 3FIUA 2X1LA 1Q11A 1MJHA 4RPIA 1GAXA 1T6ZA 4JXZA 1U7XA 2CYBA 1F7UA 1Q77A 3MMXA 3RBAA 1F7VA 4EG3A 1NP7A 1JEDA 5FO1A 1ZH6A 2XRYA 4MVYA 3LCJA 1NUTA 3JXEA 3PNYA 2A1TR 4MVXA 2A1UA 1TEZA 1I6MA 3VU8A 1K92A 4I6JA 4MLPA 1M1ZA 4JZYA 3IUBA 3RK1A 2IJGX 4YP6A 3KT0A 1QU3A 3GUZA 1GZUA 4BWVA 3FG9A 1EFVA 1BS2A 3A05A 3SYTA 4ZCTA 4MUGA 3H9CA 4Q16A 1NYLA 2J07A 1IFXA 4HK4A 4L2IA 3HL4A 1H3FA 1O0BA 2WQ6A 3HZRA 2PFSA 3TZEA 1G8GA 5KHAA 3RFFA 1O96A 5F23A 3D6UA 3CLRC 3S3TA 1MBZA 2A88A 1Q19A 1U3DA 5K0TA 3UC5A 3IMGA 1LI7A 2R5WA 1EUYA 2PIDA 5DK4A 1X6VA 1YIAA 2JA2A 4JXXA 1N2HA 1WOYA 1N2BA 1TFUA 3P0JA 1QU2A 2A1TS 1Y42X 4ZT3A 2RD2A 5HUJA 4DDKA 1PG2A 5J59A 2DERA 2Z08A 2QTMA 2YWCA 3G59A 3ZIUA 1WZ2A 3IODA 4F4HA 3CVUA 3L92A 3QTBA 1J70A 5AHWA 2QTNA 3PXUA 4DNXA 2J4DA 3ND7A 3CLRD 1ULHA 5J5AA 2YY5A 1ILEA 1EXDA 1N2IA 3NBAA 4MW4A 1GTSA 1S4MA 3LOQA 4RUKA 3ZJUA 1D2RA 4NATA 1VBKA 2HZ7A 3DLAA 2ZUEA 2A86A 3H9BA 5H7XA 4TS1A 1PFVA 4DJAA 1N1DA 2PZ8A 1TYDE 2E18A 2DXIA 3FETA 2WSIA 1WXIA 3COYA 3VRHA 4HJRA 1ZJWA 1K4MA 3RJZA 3N2YA 4OUDB 4CDMA 1KH2A 3GLVA 5TEVA 1OWPA 2WB2A 3MUEA 1K97A 4KPUB 3AKZA 2JANA 3KT3A 1H3EA 1FFYA 1QRTA 3HV0A 1JMVA 2JAXA 4DLPA 3IOCA 3IOBA 4MUJA 3FOCA 1TYAE 2PZAA 3UMVA 1JILA 1KQNA 2CV1A 1JIJA 3IH5A 3A04A 3IMCA 3ISJA 2EL7A 3HMQA 3L93A 1TYCA 1OWMA 1RQGA 3QE4A 2YWBA 2VXOA 1PG0A 5FO0A 1YI8A 1I2DA 1YUNA 1G59A 4MUEA 2TS1A 3FNRA 4H3SA 4R2MA 3IVXA 2ZP1A 4R2LA 4MWBA 3CVWA 1VL2A 1KH1A 3CR8A 4ZT7A 2OV4A 4XFJA 3UY4A 4YMIA 1N75A 4NDAA 3AIIA 2X1MA 3A2KA 2A84A 2QUJA 3IOEA 1KQOA 1JEEA 4J76A 1J1UA 1GPMA 4ZT5A 2QUIA 3P0HA 4PBTA 4OUDA 3FWKA 1O97C 3Q12A 2E89A 1TYBE 4KPUA 4MWCA 3N8HA 2CYCA 3UOWA 1QRUA 1SURA 3PNVA 1U0BB 1XNJA 1OWOA 1NI5A 4CQNA 1N2JA 4EG5A 1M8KA 2CV0A 2QUHA
chains in the Genus database with same CATH superfamily
5A03A 1P33A 3THWB 2Y66A 3K35A 2HV9A 4OTZA 4WNAB 3MYRA 3H5VA 1NONA 2P41A 1GUBA 2OGWA 4B46A 4L08A 5BXQC 1B14A 2RHOA 2VZ0A 2OZLB 1PR4A 1YB7A 1D4ZA 2QF7A 3GB9A 4M36A 3TI7A 3DT9A 2XLBA 4DS3A 3MBIA 4I99A 2X5NA 1WNFA 4KQWA 7ADHA 2OSVA 3NBKA 2BMFA 2NV6A 2YNMC 4XUDA 4YS6A 1Q21A 1VIYA 2GQ0A 3DD5A 1BHQ1 4F84A 3A6EA 3WOHA 1AQUA 1X14A 1YRAA 2G8NA 4PIVA 4Q7KA 5E8JA 3RIYA 4L9RA 4I46A 5BYAA 2A56A 1N6LA 4LCEA 1U1EA 3H5TA 2VLBA 4PSUA 4RGBA 4B76A 5FOTA 2GBIA 3P0IA 2CLFB 9LDTA 4D0LB 4OSOA 4L3WA 2CXNA 1Q44A 2E4YA 2XBMA 4FEGA 1DL5A 4QATA 3MG9A 5KMGA 3VX3A 3ST7A 5BSFA 4C0WA 3ABSB 1CNMA 2DRIA 2R11A 4DGSA 1DJPA 1MB2A 2Q2OA 3KUKA 3O8OB 1VLLA 3TAHA 4YNBA 4B7CA 4C4SA 4JYBA 4FHGA 1O6FA 1YZKA 2JHCA 1MAAA 1UWKA 4WN9A 1F9EA 5HW0A 4RTSA 3EYWA 4FOLA 5BSHA 2UYQA 3EQ9A 3EGOA 3KD3A 4G97A 1ZNQO 4GPD1 3SX4A 4I4IA 4COOA 2IBTA 3F74A 4EY4A 4PTYA 5LYJF 3GJXC 5DEOA 4F3TA 4BLWA 4DDWA 3PI7A 2CMDA 3RB8A 5I7SA 3H5RA 3OPVA 1AZTA 3PEVA 1N5KA 1SULA 2ZFUA 1TGYA 2KPOA 3QUAA 1T0HB 1L1FA 3QFHA 5LYJA 3A1TA 5D3ZA 1QO7A 2CF6A 3MYYA 3D6VA 1PT8A 2QKYA 2YRWA 1JJAA 3BVPA 1XEWY 5LMNB 2YRFA 1U9JA 1A27A 2W90A 2Z9BA 1G8AA 5EWMB 4N48A 1UANA 3UB2A 3ZHTA 1OXTA 1YFJA 1Y98A 3NZEA 2FFAA 4KUEA 1GZHB 5BP7A 3DAGA 2C83A 2IEDA 1M1YA 4NBWA 4YCBA 2J3JA 5HJ7A 1EIZA 3IUYA 2V58A 2ZITA 1HG1A 5D01A 4BEJA 1RJEA 2YBDA 3AG6A 1XZEA 1EVEA 3EASA 3N70A 4JEIA 5KQPA 3ND9A 3W5UA 1R0ZA 4WERA 5I7RA 3DBLB 3RVRA 5SYMA 4ZMBA 3MMNA 1RWMA 5B2EA 2BFDA 3TSOA 3EIFA 2IL1A 1UXKA 2HNBA 3L8ZA 4BNXA 5IWAB 3I6MA 1VJ1A 3LUKA 2AF3C 3QF7A 1GRCA 4NE2A 4PANA 5EKSA 1M8FA 5H9VA 1XN4A 1UWVA 3ZGZA 5CDGA 3AZPA 5AKHA 1EJBA 4BE9A 2JBAA 3NFYA 5LWHA 2XWPA 1TD9A 3DTVA 3HR7A 4XVHA 4CM8A 1DBRA 1KFEB 2VHCA 2XOKA 5F5LA 3KZMA 4C7VA 2QBYA 2V59A 1MKYA 3HUTA 3KLNA 1RD4A 1SC3A 5ALNA 1C7FA 2ZBRA 2CFSA 4R0VA 3KWJA 3PUYA 4D0GA 3QBVA 5K3CA 2H00A 2QS9A 1XP8A 4M8SA 3X44A 4LYDA 5CG1A 4LF4B 4PM4A 1H2HA 3HWX1 2BCJQ 1WETA 1SKMA 3JYOA 4EKNB 2HMVA 2H1HA 5KWVA 3S5UA 3P0FA 2PT9A 1XZQA 1ZUHA 1NNLA 1J0DA 3HFJA 4NYMQ 3PUJA 1W49A 4KE8A 4X1KA 5CLGA 3TZKA 3ZWCA 3FKSA 1KI8A 4HQ0A 2VLIA 4NPAA 1RBMA 2O3UA 3F7OA 4B33A 4DRXA 3BBPA 4UKDA 4OFWA 4DNPA 1K2WA 1DEXA 2CVQA 2YQZA 3L6UA 2F3UA 2M6SA 2FFRA 4GXNA 4WQMA 2OPHA 1X7WB 5BUSA 3KQOA 1D2HA 2Z43A 1O96B 3K94A 4QPJC 1E69A 3WHLA 5B36A 3NAGA 2BUBA 1FX1A 4DRYA 3IT1A 1CP2A 2D54A 2QVYX 3K1TA 3DOHA 3M3PA 4N3AA 2ZI7A 3VO8A 4ZYLA 1RI1A 2FWJA 3H9EO 1GU1A 4RHCA 1L3IA 5C37A 2R4TA 3PICA 1N6IA 4ZXFA 5AVXA 5L7WA 3J7AC 1VPVA 1A1VA 4F3CA 4WT7A 1ZK2A 3E9DA 2NW6A 3I6YA 2OG1A 1LSUA 2V0GA 2XVMA 2ECOA 4DJEC 1L7DA 3O1IC 1FXUA 2WSBA 3GJYA 4QUAA 1CERA 2N75A 3TG2A 1P2DA 2X8LA 3IEKA 3KSDO 2GHTA 3TOSA 5SZKB 1I7SB 3RAFC 1M34B 1WBDA 1HZJA 4ARBA 3ADKA 2VYCA 3EVTA 4WFIA 1V5IA 4OATA 1PFYA 3WDKA 3NYWA 5BORA 5KI6A 1IZZA 4C7KA 2B4RO 2G82A 4MIOA 3ZXIA 1S3FA 4Z9BA 2HCJB 3JRWA 1QHNA 4MI6A 4X71A 3QTTA 4P7BA 1QAOA 2OQ2A 2PMDA 3QBJA 2F17A 4OBXA 1H66A 3BSFA 1J9GA 2G9ZA 2JI6A 3EB9A 3K0AA 1G291 3C3PA 4ZU1X 4ED9A 1GKYA 3TMKA 5CYOA 2H1SA 3C7CB 2QR5A 4M38A 4S0ZA 1R0RE 4LBWA 4B81A 3WBBA 1P7VA 4PX2A 4DWJA 3EXFB 2RHBA 2OORA 3OCYA 4QULA 1JXQA 4O25A 4I66A 5A3JA 3B9QA 1F2UB 1QOZA 2X8AA 1BMFD 2R8PA 1CZHA 1EG7A 2FF5A 3M5DA 4JLJA 4XLTA 4GWGA 5BWBA 2GOYA 3WAGA 1EU1A 3V7FA 4GI7A 4MWOA 2ZJYA 3SHWA 1RAHA 2QU8A 3Q5EA 2FX3A 5CB4F 3EVCA 4H35A 1RYHA 2BP7A 2XUFA 4K3UA 4EG7A 1OAOC 3MOSA 4H6WA 4CL3A 2DKNA 1FK8A 2COEA 1JFFB 4H3KB 1DBQA 1NLZA 2E9SA 3A3NA 3NIGB 3ZZ0A 5CB4A 1AXGA 4IEIA 3ZBTA 3DM9B 4KQ2A 1QH1A 2ISSD 4WVFA 1A7KA 2V6IA 4QGSA 2IW3A 1QP0A 2F7SA 4Q0MA 4BP1A 5IEBA 1ORVA 3BSYA 4MW7A 8GPBA 1XXHB 4DLAA 3HDGA 3K09A 3KZVA 4CM3A 4DCMA 3KP1A 1UMCA 4EG0A 3MJ4A 2JD1A 1AKNA 2C54A 3BMQB 3F3MA 3UTCA 1QHFA 1XMJA 1TVKB 2I9PA 2WJZB 1CE8B 3ZEAA 1N5OX 5DLQC 1Z4LA 5A4FS 4YYEA 2Q28A 4EG6A 1VXRA 3EA5A 1PYOA 2QZZA 3WDMA 1EK2A 3FOAA 5DV9A 3UFXB 3A28A 4D3XA 5KJCA 4JCCA 2WWWA 4H1VA 2V7BA 4X7BA 2XDYA 1E2EA 5H1YA 5ITZB 4K8RB 1EVJA 1Z36A 2HW8A 1AH2A 1IPHA 3B5EA 2FPIB 2EATA 1MB3A 4C4TA 3KYDA 1CNEA 4X3CA 4OMFG 4MTCA 1WMEA 2A1UB 2XE7A 3LWZA 3TW4A 1T5OA 1Z4OA 1YO6A 4R69A 2R87A 3I83A 4UCXA 5D7NA 1EJ0A 4BGIA 3W3AH 3PLNA 4PO1A 4JLDA 1OI3A 1YE8A 1B74A 3KAPA 2J0EA 5EQFA 1ZJ5A 2LTAA 1COZA 1HT2E 1C8VB 2W4QA 2WKRA 2X8JA 2ZJFA 4WA7A 2QRLA 5AHRA 4AN0A 4C4RA 1CS0A 3MJRA 1PGQA 3MWGA 4RWZA 2O8BB 4BO9A 3JQ8B 1WSWA 4QBIA 1SKYB 2P7IA 1NBMA 4IMRA 4KO3S 4ERXA 3LBAA 2OBNA 2VH1A 3N8NA 2QLLA 8ATCA 3LDHA 2I7TA 3H6GA 4LYGA 5I6DA 1DJLA 3ET5A 3ZKWB 3LT0A 2VJMA 2ORVA 1QQAA 4N47A 3NWBA 1AKYA 3G8DA 1SHJA 2XDAA 1D4OA 3ZBUA 5CYGA 3IRVA 4WGGA 3EDCA 5KVQA 3ECSA 4OQFA 4MYDA 2PWYA 3L6RA 5BSGA 2A52A 3ZR4B 3OX4A 1EZ1A 1HYEA 4DMLA 1ZMXA 4MX8A 1RJ9A 2JIDA 3OE5A 2VYFA 2X0JA 2HSZA 3VPGA 4AZ3B 1WABA 3EZXA 4JJ8A 3V3KA 3ZQJA 4BLRA 4FGLA 4BKMA 1NG9A 2GHQA 4GZMA 4RH1A 4NICA 3RJMA 3K9BA 4XW2A 3AY6A 4LJKA 5JYBA 2EZ4A 1OAAA 3BB3A 1HF3A 3H2GA 4MKRA 2XDWA 3N07A 4PTZA 3LDFA 4MUGA 1USUA 2LW7A 2N1MA 4WECA 3S44A 1DE0A 1AMNA 2JZNA 3KXIA 1DKPA 2LR0A 2W98A 4HWRA 4H6XA 1QRRA 3AJEA 3AHEA 5BWMA 4BFYA 2VJKA 4DQDA 2YMMA 3K73O 1XYYA 3KEOA 3H75A 2A0KA 3NANA 1ECLA 4WIAA 4ZREA 1DKMA 1LVHA 2VYNA 3GT4A 1HZZC 3QVVA 2NVOA 4ZOCA 3UGQA 4B5LA 3E70C 3T5TA 1YRQA 1BVHA 2MSKA 1JHMA 2O0JA 3IV9A 3NYQA 3TG8A 1JS1X 1XJ0A 3HG7A 3NEPX 3MWLA 4TM8A 1PK7A 4D9GA 4AKHA 1VHDA 4BVBA 1DO0A 2JL1A 3FVVA 4D42A 3CI0I 3K9QO 4CEIB 1CDDA 1IBRA 3L0ZA 3ZY5A 2WE7A 4LI0A 4IQFA 4I8DA 4WCFC 3TZQA 3L0DA 2GEBA 3HO8A 1Z4MA 5K99A 2WV9A 1DMRA 3U5TA 4WY2A 4DDKA 1M5UA 3KBBA 5ILGA 1V1MA 1LY1A 3UCXA 2MSLA 2B0JA 3FMPB 3KQUA 1Z7GA 4L4ZA 3L8DA 3AFMA 2J32A 2B2CA 3IDAA 3VR2D 4OI4A 3GT3A 3OEED 3OOYA 4KNYA 4PC6A 1QQ5A 3GPCA 1VFPA 3NBAA 3CSSA 3L05A 1OBFO 3CGGA 3CTPA 4CUZA 2HMYB 3BREA 2G72A 4F6CA 1NDQA 1D2RA 1XF9A 4ZAXA 1II0A 1GZ3A 3L0PA 5AHXA 4TKVA 2CXQA 1D8TA 3E15A 5CW2A 4NXMB 2ATIA 2H2FA 3PR2B 4LQLA 4W5QA 3H9BA 5BOSA 4DLLA 1HLFA 3AF4A 3G9XA 4WXMA 5ALMA 4ZAYA 5CLHA 3WC4A 5JRJA 4J0GA 4RTPA 1E4VA 3HI4A 1Y80A 4HAYA 2LMEA 1V26A 3NAZA 3G2IA 1NW4A 2AJTA 4FIDA 1GR0A 1O4VA 3BT7A 4ZCLA 2XB9A 2JLCA 3HCRA 1EP3B 4ND1A 4ZAFA 4UM8B 1NMXA 3RVJA 4ZJYA 4BJ3A 1DC8A 3NDRA 2Q8QA 1YQTA 2EL9A 3U16A 4RMHA 1FBNA 1HM5A 1GFWA 1I3LA 2H7VA 5EZYB 3TVTA 2HY7A 4IP0A 2J7PD 3SF8B 4TZKA 4ZGGA 1LEHA 1P7WA 3G0OA 3PNSA 3NMUF 2ZAYA 1K97A 2X1HA 4LTNA 1VXOA 3KT3A 1FVOA 3R8XA 1OIWA 2QNIA 3JALB 4N8SA 4IJ5A 4BC0A 4K0KB 4HL6A 3JZMA 1MH9A 3TRFA 2XCRB 3K0CC 3LSTA 4GYJA 4ZYYA 2JKZA 2OLEA 4EKIA 1ZN2A 3T4PA 3IMCA 4R98A 1XTBA 2EL7A 1X9HA 4Y2GA 1MTZA 2CLOB 1ZPDA 1A4RA 3OD5A 4GLOA 2HJWA 1J8DA 4QOSA 1KETA 4BPRA 5B7PA 4HI0E 4G5GA 3HE3A 4JWTA 1AGNA 3DTTA 1MQ9A 3BHNA 4LZLA 5IAAA 4WHMA 4X95A 1FLAA 2ODPA 3WGKA 1G59A 1EWTA 4UMDA 3W7AA 1UEJA 3RJTA 4Q39A 4GM1A 1XZNA 1S2IA 1PG5A 5JY1A 1MW8X 3SU8A 1P6QA 1T2FA 2AJLI 3MOGA 3MTQA 2D5CA 3G8BA 1PR1A 1PVVA 3PYMA 4YIKA 2DYKA 2VTKA 3Q8LA 2HWUA 4AB1A 4CQJA 4W1SA 4X6LA 1BWPA 1OH6A 5LQUA 1X77A 3WVNA 3EMOA 4NDAA 3H2KA 4OQEA 3RYCB 2UZ1B 3NBFA 3IBYA 1W5BA 1JFLA 3N0VA 3QFSA 5G3ZA 3PI6A 5DM70 3LKZA 5EHQA 3OE1A 2B8WA 3SD7A 1U11A 3HJTA 2PUEA 2IYPA 3WAKA 1NJ5A 1RMQA 2BFFA 3ZZMA 4EMTA 4HSEA 4XOUA 5IAEA 4NS4A 3L8MA 3BJZA 2QPLA 3IKMB 4XCXA 1ATZA 1VMDA 1Z29A 1XNJA 1M34E 2VI5A 1L4GA 1SEPA 3HS3A 3YASA 3H7AA 3VPBA 1BDBA 5HF6A 4ES6A 2QX8A 4RKFA 4TV8F 1Z2EA 3MM4A 4F2PA 1GHTA 2ID8A 2L2QA 3RVNA 1HGXA 3KQSA 3OURA 4YQEA 1MMFB 1ETUA 2B92A 3CN9A 2AD5A 1US8B 4LJRA 4R3WA 4IDAA 3AXTA 3MJCA 2ZXEA 4JHXA 1HE8B 4TV8A 4U2KA 2XQJA 3DXFA 4HB2A 4LBVA 1P5ZB 4RSGA 3AVTA 2O3RA 3H9JA 3BWBA 4IX1A 5GMOA 4EKGA 3AR6A 4UBIA 5JCJD 3DDHA 4QM6A 4ZOQI 3P2KA 4MUKA 2ZBDA 4N0QA 4R0MA 3WB0A 4XYLA 3Q5GA 1JGTA 1GPNA 1XRQA 4ND2A 5EZ6B 3P20A 2EU8A 2AX4A 3QVGB 4G63A 2WIJA 4MW0A 2EX4A 4UU7A 2BFCA 1IE3A 4UNPA 1NDHA 2O8EB 4ZJUA 5FCDA 1R00A 2MR6A 1PSZA 4PR0A 5JPIA 5B57C 1JQ5A 2DF8A 3DKIA 3ETNA 2AFIE 2HA3A 5ARCA 5CD9A 1IH8A 1W25A 1OF1A 4L74A 5KB3A 4GOOD 5AVWA 4Q9DA 5DGCA 1IOLA 2P6NA 5IRCD 4JBLA 4YMUA 1H2WA 3H4VA 3AFNA 4WNCA 1Q0PA 4BEVA 2QL7A 1R74A 2G1AA 421PA 1Y7LA 3KUCA 3O6VA 3BWXA 4MMZB 2VCHA 4TWJA 1JDPA 2HA7A 1AK2A 2QJFA 3UAVA 4XVCA 5T6MA 2OCKA 4WXHA 1BZYA 4DLKA 3R76A 5KVAA 1BD3A 4BQFA 5FL3A 3LL7A 5TE9A 3WLEA 1O94C 2P6PA 3FI9A 1NLMA 4KX3A 1FA9A 3VR4D 2O14A 4DDMA 1W581 2EW2A 3A6HA 4I5GA 4KLAA 4H2DA 4KN5A 5CT5A 3TUJC 1AZWA 2FPOA 3LECA 4CXMA 3UCEA 2QRJA 1JSXA 1HTTA 5LXTB 2AQIA 1UEIA 3T5DA 1ORTA 2GBLA 5CD1A 1OKKA 4MYCA 2BHRA 1RZRD 5GOZA 1R9GA 4NHEA 2C0CA 2R79A 4WY5A 1KIAA 1KPIA 2EERA 3ANLA 4L22A 1NBOA 4FHDA 4RTJA 4FHZA 3Q7QA 3ONVA 4C29A 1G21E 2J0VA 3GJ5A 3K72B 3L84A 4POAA 4YRRA 2IXAA 3L4BA 4QQRA 4RD3A 1S1CA 3KQNA 3NIFB 1E63A 1TQ4A 4MYUA 3RQSA 4EI8A 4UQLA 4B7UA 1XD8A 1YR7A 2HMTA 3PQ3A 3RROA 7AT1A 4HAIA 3ICCA 4BMYA 2B99A 2Q9AA 3HDYA 1O94D 3I04M 1HC7A 2PGAA 4PS1A 1TGVA 1XU9A 2W2MA 1SKYE 4YQZA 3HVUA 5F1OA 2YINC 4K0RA 1DC7A 3FPSA 2JI8A 4C5AA 2HLNA 1WXWA 4NBVA 3HI6A 1GRRA 4JJKA 3M6LA 1ZGAA 2OBMA 1W8IA 2FMUA 4AWAA 1E5XA 4BCBA 5TQ2B 2VYVD 2HIGA 3EHDA 3D2BA 2ZBUA 2XKAA 3QU7A 4Z4EA 1ZGJA 2JJMA 4HNVA 3L04A 3DLPX 4FU0A 1RS0A 4L75A 1R6UA 2G9NA 3STUA 3ROXA 1XLWA 3K31A 1USWA 2ECQA 4YN3A 2G63A 4YT2A 4A6DA 3E48A 1RXSA 3FTQA 3U6KA 3LE8A 1FTQA 3T4EA 4GECA 2WIFA 4B3CA 4AYXA 1LRKA 2FNAA 1JPVA 3DHEA 1U0FA 4LKRA 4JBYA 1R0BA 1EUZA 2BUCA 2H4FA 4N8DA 5IK2A 4IIYA 1KIFA 2VHEA 4XSVA 5G0TA 4YRJA 4LHYA 4WKBA 1YRWA 1TUIA 2F8LA 2XKJE 2Y9MB 3TLGA 3UO8B 3ZWWA 4CQLB 3ANTA 4Z2YA 4Q1EA 2I6FA 4RA6A 4WWHA 3K0FB 3SXPA 3U6BA 1N2CA 1OREA 2J9FA 1JECA 2ZR7A 3R3YA 4G9BA 5F12A 2DG2A 5F7ZA 5ADVA 1VB5A 3IUPA 5IC4A 1ZEMA 5AW3A 1IOWA 2OB1A 4XDGA 4AJLA 5J2UA 3V8VA 5C5CA 1TM4E 2HJVA 3PD1A 1JDTA 1HEIA 3PJGA 3GG2A 1SXQA 3BRWA 1G66A 3BRCA 3WA7A 1P3JA 2QUKA 1E2BA 5TR9A 3D5TA 2IX3A 1NRWA 1GZ4A 3HY4A 2Z2ZA 5FQNA 4DCOA 3EODA 3QKUA 1NULA 1DQZA 3GMSA 1ZIYA 2RI0A 3AQ4A 3IE1A 1KHTA 3I2GA 1EBBA 3L77A 1KP3A 2R86A 3LWNA 1E9FA 3HRKA 1ZVKA 3MJDA 1RRGA 5KEIA 1T1JA 4B74A 3MRSA 4QPZA 3GNTA 4Q9LA 3ROQA 4ZZ3A 2WSYB 4E4TA 1WCIA 1ZOLA 1K9VF 3VKFA 3GCDA 3OEHA 1W5FA 4P0TA 1P1RA 3AR3A 4Z2AA 1OYOA 2XB4A 2ZPUA 3MTJA 4EAAA 1Z6TA 4QE3A 5GJCA 3PLRA 3VNSA 1PQPA 4CBVA 1YZQA 3BK2A 4M0KA 4C87A 2Q6KA 1XCJA 1L5QA 2W6JA 2W93A 1UINA 3QUSA 1QNFA 4H59A 1F4LA 4WXRA 1BCRB 1NIJA 2PX6A 3NNNA 1L5VA 3QOFA 5HKBA 2W6PA 3AKYA 2C82A 1E7WA 4A15A 2ZS9A 1NUUA 4I7EA 3R0IA 2ZYGA 1Z0ZA 2XA2A 3FY4A 3KOUA 4J7AA 4MYSA 4O4IF 3WLJA 1G4HA 3EEIA 3L4KA 1EP9A 1F4VA 2JRCA 3KAJA 1JR6A 1CZOA 4NNPA 1JDJA 2Y2UA 2NUAA 2H1WA 4O4IA 4BNHA 3G0HA 1YHNA 3GNQA 2G80A 1FS6A 1OTXA 1VC2A 1PGOA 3D4NA 1G8HA 2AB0A 4K1XA 3OZRA 1L4BA 5DGHA 5IN5A 3ZD8A 3ZVKA 1R6VA 1VMIA 1NFQA 1L5HA 1BEZA 3FRIA 1B8OA 3AEKA 3HCAA 4JI0B 1WL8A 2IELA 5CLQA 3IPAA 4L16A 5DTIA 1EDOA 4PWYA 4XGRA 3LOPA 3S6JA 4ETMA 1W1UA 1QVZA 2AXNA 4U2FA 2CLSA 4M3NA 1JEOA 1PIWA 1QONA 2QG6A 2PRJA 4IJWA 1TRKA 4PCLA 4D8TA 1LRJA 3LVBA 1XRSB 1ZCFA 2ZSFA 1ZKDA 5FI3A 1FFCA 2J9YB 4FMBB 3GLIA 3KR1A 3ZI7A 3VU1A 3WQHA 4MGHA 2JGJA 3ADPA 4ROSA 1N7JA 1BROA 3O3OB 4JC5A 4TWAA 3N8DA 3WJ7A 2ZBGA 4B87A 4BNNA 3F71A 2J08A 2P9HA 3GRVA 1HMYA 2Z2JA 4YT8A 2A33A 3ML1A 1LSSA 2YZMA 3IC5A 4LRUA 2HRRA 2QPOA 2R97A 1E1MA 2IECA 1CU1A 2ZJOA 4FIZA 4L51A 1N6RA 4OYYA 2NVUB 4CMIB 5CU7A 3DO8A 3W5CA 2WHPB 2AD1A 1OBCA 2AFHB 4QPNA 5JIBA 3ITNA 1Y3DE 2GVDC 5KU7A 2ZLBA 3MB8A 3QNUA 1C3XA 5K01A 1G20A 3Q9LA 1JN0A 2IW1A 2WUDA 3BFPA 4TMWA 1A97A 1LK5A 1NRIA 5DHFA 3L0BA 1T8PA 2ORYA 3CLTC 4W9NC 5F2KA 1AC5A 3UA0A 1R6TA 5JO9A 4YLEA 2B7LA 4V0NA 2ZSBA 1T43A 5C3UA 1HNWB 1U3GA 3AEQB 3RVQA 3PRKE 1ZAYA 3ORRA 2IHNA 4E4RA 3C43A 2CDAA 4ZD6A 1JZQA 4ARZA 3K8OE 4RZIA 3WICA 3ZDAA 4C9BA 1IBCA 4DV7B 2AN4A 4GMDA 5AWFC 3AHDA 3CFFL 4M0MA 4WFQA 5JDIA 1G60A 5KHOC 4E5KA 1Z5WA 1K27A 3CRQA 3AWIA 1BE0A 2O52A 3D4BA 3FPEA 3GLHB 3OZTA 4GU5A 4IDBA 3HYSA 4G1EB 4IVRA 3GAZA 4Q4LA 2GBFA 2E82A 4NX2A 2Q9BA 4MB6A 4BKQA 2ZI3A 4B8WA 1TTQB 5KNLA 3CTMA 1LPNA 3CLTD 1ZK0A 1KQPA 3D3NA 1EK1A 3C97A 2YJNA 5KX5B 4RKWA 2BFEB 4NCBA 1L5LA 1UBTS 2P4UA 4MJ3A 5AHOA 2J3KA 3OQ6A 4N8EA 4UEOA 2HQ1A 4EUKA 1XRJA 3IGFA 4KSBA 4XH9B 1Y8ZA 1ZDMA 3D3EA 4IGAA 3QG5A 1O08A 3A4NA 3D1LA 3LUFA 4O4JF 3ZVLA 1R8XA 4KVZA 4O2BF 4WZBA 1A9ZA 3E22A 4DLNA 2ZRLA 4TMTA 3ZV5A 2FRVA 4EGSA 4E7PA 5KTKA 2C3UA 3KVNA 2QU7A 3OIDA 4FFNA 4O4JA 3CISA 4RK1A 4O2BA 1GNQA 2H1CA 5DBEX 3MQFA 4TLCA 1EFLA 4XR4A 4EQ6A 1E9DA 2CLEB 3I32A 5DYIA 3KAQA 4ZZ1A 4D26A 4EDHA 2OCXA 2ZIAA 3PG5A 1O8BA 3TIXB 1UC4B 2R4QA 1J2EA 4I6JA 1NPDA 3TOCA 2AW3A 4L7VA 2UDPA 1FY2A 2VSXA 3FRHA 2VJAA 2IYUA 3L79A 4RIFA 5AVJA 2YTZA 3QVLA 5ECGC 1R0XA 1UZMA 2X9VA 1FXWA 4OXQA 2QXYA 3E0QA 3QY9A 4MIYA 4YCJA 2C96A 2Y76A 4ZEMA 1Q83A 5KJFA 1XZIA 2UVPB 3R0JA 4ABTA 3TW8B 3C3WA 1AKTA 3R5TA 1W5AA 3GI1A 1UDAA 4ZRDA 3DOJA 4D25A 4ZOAA 5IPFA 3WKBA 1U3FA 2YZ2A 2HJSA 2V0NA 1VI2A 3MT8A 2HWXA 3L8YA 1ZGHA 2RAFA 3NPMA 5EUQB 3FTEA 4YAWA 1VYTA 2Q4BA 2ZE5A 4HWOA 4ROTA 1P5JA 2A2ZA 1ZD8A 2BJVA 1OMOA 4M37A 4PGFA 1A0OA 1E3JA 1NMZA 5LC1A 3P9SA 4HLDA 2Q45A 2BM9A 4A82A 2H4WA 1NAIA 2FWRA 1PAUA 4YIHA 4U7TB 4KPEC 1PZXA 5BN3A 1RWKA 3PL5A 3ADBA 2Q29A 2GFQA 2DJIA 1DQNA 4DL9A 3OVMA 3PXEA 2AUNA 2PWAA 3V8RA 1REQB 3QWIA 3UC5A 1SBHA 2BDEA 2YMPA 4B2YA 5K0FA 1E7YA 2UZAA 2YN2A 5I9NA 2GSWA 2I91A 1L6IA 1XBTA 1Z88A 3SS9X 2Z83A 3NTVA 3UUFA 3D3JA 2Y1FA 4JQSA 2VP2A 4LZOA 1OZGA 4EELA 4RTLA 3FNIA 4BO5A 2H31A 2YJ3A 4X1OA 2GAAA 2Z08A 2OXIA 3C7AA 5G0UA 3THXA 2B7CA 2BSAA 4E2YA 1WZ2A 5IJ9A 4F3YA 2GA8A 3TOXA 1RWXA 4H08A 5HKOA 3CVUA 2ZAGA 4BKPA 1WPXA 3G2NA 4C2TA 5E6SB 3RIGA 4BNDA 2GO1A 4DFDA 1V3VA 4XVUA 1MF7A 2RB4A 1UADA 2QTWB 2YWJA 5I8PA 2YY5A 2VDNB 2CY0A 2DHEA 1OFVA 2G17A 5TJHA 4D2IA 1TTPB 4MCAA 3FJ1A 4AY2A 1IHXA 1B0ZA 2XXJA 3IFSA 5CIWA 4AP6A 4QTYA 4UAGA 2JJ1D 4MA0A 3GVCA 4JUDX 1NWCA 5TMEA 3V97A 3QPCA 2WZCA 4Q9NA 5KNBA 1DDIA 3RSSA 1WG8A 1FRNA 3CZ5A 4LF7B 3FYUB 3WIDA 1OA0A 3EIWA 4OK5A 2IZ5A 1MB0A 4LZAA 2ZUEA 3H0KA 1DXQA 2I2XB 2H65A 1FQJA 1ONPA 2X15A 3QPWA 4WL0A 1S96A 1WD5A 1VJTA 2AW5A 4RGVA 1DAEA 3S0JA 1JAXA 1CG6A 1D6JA 1ORRA 5K5EA 4UVEA 1WSAA 1OTHA 2ZZMA 1DUIA 1F4PA 3LY7A 5CDHA 5DNYB 1U8EA 2F4VB 2PS9A 4FONA 4DPLA 2PZ8A 3KVRA 2LDBA 1WMBA 3FFBA 1FQOA 1G5TA 1K7EB 1NBWB 2PBLA 3OTIA 3PXAA 4YI5A 2MMCA 4GWKA 2C2OA 3FETA 4Q7MB 5E4JA 1BTOA 3COYA 3W34A 2DP4E 4H7DA 3NWPA 1FFDA 3GNSA 4GNKA 1AQYA 2IXDA 1NJFA 1JNXX 2J30A 4PTLA 1UAAA 2IHYA 3N2KB 2IZ6A 1MAHA 4OX9Y 4RV5A 1TMYA 3TDKA 3A6KA 3LQ2A 3WMFA 5IX8A 1CRQA 1LFAA 4NU6A 1G4UR 3HDHA 2DR3A 5JBIA 3G82C 4MROA 4PYKA 2V97A 3BF7A 5KDDA 1OILA 4KO4S 1LCIA 3H8WA 4GE0A 3ISJA 3WLNA 1ADGA 1CJTC 5EE9A 3QLVC 1XVTA 4XUCA 1YB5A 3DMYA 3T7KA 1RQGA 4CG2A 2ZR0A 4ITUA 2V8OA 1FP4B 1TADA 5AK3A 1BXZA 3GFFA 1T3HA 3C3KA 1MEJA 1UZAA 2VL7A 1PJ3A 4HX2A 5EJEA 3G5UA 1R3UA 2HCTA 3I45A 3JRNA 3LW8A 1FDVA 3D8NA 1EYZA 4ITRC 1TU4A 2AX3A 4MA4A 4MI9A 3VX4A 2OWEA 1RRVA 1T24A 3PFGA 1R37A 1GSHA 4G3XA 3DZKA 1RMYA 3ZCTA 4YUYA 3I1IA 4CODB 3IE0A 4RL4A 1A8IA 3UAYA 4LS3A 4JSYA 2ZTVA 4AURA 4OUDA 1N7GA 2R6DA 4GNRA 4NE9A 1SRQA 4XASA 4LXUA 3W8RA 3QFFA 1TYBE 4MVJM 3S2GA 4AJOA 4AUMA 1NN0A 4NG4A 1NC1A 1V7ZA 2GR7A 1PP4A 2JHFA 3OY7A 2YOFA 5DCLA 5C31A 4TZ0A 3SC2A 4AQDA 1XA3A 1H0SA 3FZYA 3OT5A 5AO9A 3W5AA 1DLJA 1SUCA 4Q6WA 4N6NA 3L7IA 3FDFA 4OYRA 4AKTA 4GDFA 2ID7A 3VJMA 2AWOA 2R2AA 3CIFA 1CRLA 2QMEA 4YRPA 2FLVA 4KLCA 3R3JA 3I5YA 1V5EA 3AEXA 3LCMA 4KV9A 3NS7A 4PZAA 5EVCA 1EFRD 2DFLA 4OSEA 4YMWA 3RUFA 2XOKD 3T7CA 1OLSA 1SOUA 3D0KA 3IKLA 2HADA 3GLGA 3RYHA 1B0AA 1IQUA 1QIGA 4L8FA 1QF7A 2AWNA 2DM6A 3FIJA 2ONYA 5C2JB 2YXNA 2IVFA 4DLRA 3FB4A 3B7PA 2JJQA 2IBSA 1ISIA 1H0HA 2C59A 5KCZA 1R4NA 1CJUC 1YDWA 1MIHA 2QSUA 3O9MA 2WZDA 3VO9A 4YRZA 4D80A 2BEVA 3OSUA 3ORFA 2J0SA 4BTLA 1RRMA 1JKJB 2Q5HA 1D5CA 4UBJA 4ND6A 4MW2A 4H7JA 3T4XA 1YUBA 1JIVA 1FFXA 2XRFA 2C3OA 3HBMA 4DBLE 1JEQB 1PBNA 4JI3B 1X7GA 3ASUA 3T8YA 1T15A 1E9AA 1R0YA 1MDBA 1T8SA 3R5HA 2EP8A 1IZ7A 1DTWA 3AUSA 4BIIA 3VO1A 3CX3A 5LQSA 2XTNA 1MZVA 3JATA 2C7QA 3N75A 5HDBB 1KI6B 1WU7A 1ORDA 2IDMA 3RUIA 4A27A 1KY3A 2JAHA 1BX1A 1ZC4A 1ZIXA 1JG3A 8ADHA 2MMGA 1TF5A 3I8SA 4LXQA 1JH9A 3E6AA 1T0BA 3CH4B 4RS3A 2JFYA 1SBTA 2AFHE 2Q62A 2IEZA 4L8LA 4L5YA 1POXA 2A3NA 4B2IA 1CEYA 3BHIA 2VPQA 3AP1A 3L7KA 3Q7SA 2DX7A 1MOSA 4HGNA 1FW8A 3VNQA 4PYJA 1F8GA 4NZYA 2EDCA 4WZAA 2L69A 4FQ7A 4JU9A 4MRAA 5GJVC 4LQ4A 4Y6PA 5FOVA 1B16A 5GZ6A 2CFOA 2ZUUA 4DV0B 4KC0A 2EWVA 4AJHA 1PEAA 2HO5A 1X9GA 2Q6TA 3T5BA 4CFYA 4ZI7F 3C7TA 4Z0PA 2XZLA 2OUKA 4Q02A 5EXTA 1CYDA 1HDOA 2P9GA 1Z0IA 2JIRA 3EDMA 4ARCA 3PUVA 2FW0A 4Y0NA 3IOMA 3GVHA 4YAKA 3PWSA 2NVWA 2H11A 1RWVA 2V6BA 1EBFA 1E6LA 2PX4A 1GL9B 3LX6A 1CXZA 4ZI7A 3M82A 3DEAA 5HWSA 1ZR4A 2CMFA 5ALTA 9MHTA 4RY2A 3GLHE 3D4OA 3L7MA 4OYHA 5FYQA 4G25A 1YA8A 4CR7A 1UKZA 3N58A 5KBYA 2ECFA 1CQJB 3HO1A 3DL0A 7GPBA 2RGXA 1DO2A 1WXHA 4Z51A 2I3DA 4JN6B 5E9JA 2QD5A 3K09C 1URPA 3W6NA 4RH0A 4QXMA 4CNQA 4UUOA 4FDTA 4N1AA 1WR8A 4Q4AA 2Z1NA 4QICA 5LUBA 1L8AA 4J2OA 3P9CA 1B6TA 5DSXA 2YJZA 3I2YX 2ZW9A 3RUDA 2EW1A 3H5AA 1XD2B 5BNTA 5AP9A 2ZDGA 1G17A 1AUPA 4WADA 2J59A 4X61A 5AOCA 3OIUA 4X7RA 4S1VA 4AF8A 4RMIA 2OXTA 2Q9CA 4MS3A 4C76A 2O0HA 1RXEA 1E2UA 1VG1A 1WLSA 2O3JA 3CBGA 3PVCA 1E3DA 1BQ3A 1DJNA 1Q15A 3EWIA 1S6YA 4CM6A 3U81A 1NI4A 1P9LA 5DE3A 5T41A 5EQJB 4G5QA 4U7JA 4FQ8A 3RNLA 2BJWA 4XX1A 4I4CA 4P8RA 3NV7A 3BZWA 2XCTB 1D07A 2OCIA 2LPMA 1TAUA 4HMOA 3JYQA 1WV0A 1RE1A 4HQRA 5JW6A 1OB2A 1RKBA 1P3DA 2ORIA 2O8CA 3QU9A 1P39A 3K5PA 1Q1GA 4UM5A 4CV2A 2J41A 3A4IA 5BSMA 3C6QA 1YDMA 4ARIA 1N78A 1QIDA 1FUKA 1SCDA 3FFXA 4H60A 2RMKA 2ZI9A 4EVSA 2LP4Y 2QLJA 4HCJA 2DECA 1IB6A 4PGMA 5I8ZA 1HMPA 3SI7A 4NONA 2I2CA 2QI9F 1J07A 1RJWA 3NIDB 1EEHA 4RD1A 3UMBA 2RHDA 3EOZA 2IYEA 4MI3A 2NTNA 3HJRA 2OD9A 1YAHA 1RQXA 4FMCF 1MG5A 4EEKA 1EGMB 9ATCA 4XX0A 3C39A 3Q3GE 2W4MA 3LC1O 1DKOA 1AM4D 2FOIA 3C45A 4JOQA 3LT1A 3NTRA 4QGHA 1YDEA 5EIBC 1XOIA 1VDMA 2JCVA 3DONA 3HXTA 4BC1A 1JDNA 2P4QA 4MKXA 4QUEA 1Z8DA 1EM8B 2YOHA 4F91B 5I7FA 5CM2Z 1B0UA 1A2KC 5AESA 3I23A 4Q12A 4Z54A 2MT9A 1T9GS 1R0WA 1G8KA 5ENDA 5EOVA 1ZUWA 1X7ZB 3OJLA 4CTJA 3AI3A 4D4GA 2C2WA 1J20A 2E6UX 3IURA 3K5IA 2VDUE 4F71A 2ZEJA 5DXJA 3TUZC 5AUNB 4M9QA 1QMGA 1ODTC 1V45E 5IYZB 3RU3A 4UUBA 4YV1A 3UMMA 2J85A 3G0BA 1NBMD 1U3CA 5IBQA 2OCAA 4YWJA 4TLEA 1D6SA 3AWDA 4BNVA 1AS3A 3RTAA 3P45A 1RYZA 2GF9A 1BXKA 4GMXA 4TVOA 3ZY6A 2JHPA 2Q46A 4RU1A 4CG1A 1TB4A 2IXGA 1H8EA 5TT0A 1ZH8A 2CVOA 3STTA 3BGDA 4BX8A 2DTDA 4KQIA 4E5UA 2ZUWA 1VI6A 1VYHA 2IYFA 4HO1X 2C92A 5H3HA 2DHCA 2IS6A 2WJJA 5THQA 3FRJA 5DGXA 3CE9A 1T2DA 4MQMA 2A5FA 1GRQA 4FHCA 4TM7A 5DASA 4H1UA 2X7HA 5EEGA 1WXGA 5IDXA 3R0QA 5EHZA 2POCA 1XJQA 2H2IA 4PC3A 1F2DA 2OL4A 3GC6A 2BZ1A 1NIPA 5E4FA 1LQTA 1JBKA 1NXPA 3GMIA 1E7QA 621PA 4Q4CA 2J33A 3OT1A 4X84A 3RE1A 1ZN9A 4KIJA 4KI7A 3V2GA 4HT3B 4B2LA 4F1WA 2W2KA 2GEFA 2E4UA 3ENQA 4XIGS 1CHDA 3R6LA 1TCVA 4FDVA 2F8SA 1XAHA 2NXNA 2QLMA 4XB6B 1FBTA 2ODQA 4YT4A 2MSEB 1Z28A 3QPVA 3NHFA 4Z49A 1QDEA 2SECE 4F11A 4G01B 1JUDA 1G19A 4EJ6A 2VG8A 5LB2A 1XA4A 2CZCA 3O3MB 2HYIC 4CF5A 4XGQA 3STXA 2R7MA 4J90A 4LC0A 4LHXA 4JMPA 4L5JA 3WK9A 2O05A 1TW2A 3H99A 3DQZA 4G37A 4H4CA 4AY6A 4F8YA 2H92A 3SE7A 2YFYA 4OXYA 1J49A 4M4SA 3BGVA 1E7SA 1ZP6A 4WKGA 4LQDA 5ALIA 3U37A 1UJ2A 1YONA 2I3AA 1A5SB 3AHHA 3BTOA 2O59A 4HEA6 1W35A 3MCTA 3SHOA 5I5EA 5KTSA 4RKYA 1RYBA 5IT5A 1FU4A 3NCTA 3ETDA 1QHIA 1YHZA 2A78A 2BR5A 3DDSA 3GMTA 3NC4A 1WDMA 3ZJYA 1HL3A 3IE2A 3NP9A 3QW4B 3RGWS 1H6AA 4CV0A 2REQA 4MQEA 1L8OA 1WE2A 1ZNWA 4KJXA 3N59A 4EFKA 2B61A 3IEXA 2QQ0A 2Z57A 1PK8A 1CY1A 4Y98A 2XYHA 1PFWA 4CG0A 5J4LA 4ND8A 3WRXA 2Q3LA 3AGQA 5CDSA 5CH8A 1YA4A 1IYZA 3CX7A 4PAGA 1T9GR 2WILA 5JAUA 2ALJA 4MS4A 4FYIA 1TKCA 1ZXBA 4BB9A 5HNKA 3FSRA 3NNSA 1LPSA 1VLZA 2UZ4A 2LCIA 3ANXA 4KDRA 1DEOA 4NU5A 2XZPA 3HXKA 4TXMA 4RJJA 3SYNA 2IHBA 4XIJA 3HYLA 4G1CA 3LX8A 2CL7X 3BJEA 2BRUA 3PZBA 2BSQA 3I0NA 4JITA 2G2SA 1R4ZA 2IYXA 3QX8A 4QUIA 1P80A 3VYTB 3WWZA 4ZHQF 4ISCA 4R8VA 1SVSA 3A11A 4L2IB 2GASA 4LVOA 1G41A 3IVRA 1DAHA 2BJHA 4DNOA 2AQHA 3CKLA 3K0HA 4INJA 4DV5B 3QEMB 4ZHQA 4YAIA 5LD2C 4UCWA 3CNNA 1P31A 1DQSA 1OPXA 1ZJYA 4UDNA 3TEMA 1Z0JA 2JG3A 2GA9A 4RFSB 4KNWA 2YC4C 2ZAOA 4AXBA 5KQSA 4RJLA 2O3TA 5HFNA 2H06A 1Y81A 3DCJA 3DBOB 1R5BA 2F62A 4INAA 5CP8A 4DANA 4FCCA 1ZI8A 3JD0A 3NDBB 4O3FA 4YLGA 2NO5A 3OO1A 2WKWA 4DMUB 1K3FA 3LPCA 4BV2A 3UJBA 4JP5A 2WU0A 5T4FA 2MSWA 1HT0A 4KZKA 2G70A 1QYVA 2OGTA 1GTG1 1K92A 3AIOA 3OQ1A 1IIBA 3WWEA 3IUBA 1ZVVA 4Z5XA 1ZG3A 3MERA 5IJAA 3F7NA 3Q8MA 4LXIA 4L4RA 3GGGA 2GN9A 3UJPA 4RTQA 1S2NA 1EFVA 2RIPA 1H42A 3BWMA 2PBZA 2PZMA 3DKKA 1IZ0A 1G4AE 1BHJA 3H9QA 4PLCA 4QVKA 4XGIA 2G88A 5ALFA 3OU7A 2I2WA 2IXTA 1KZHA 1C0EA 4W7HA 4ZCTA 3TX2A 2GM9A 1MHPA 2A53A 5SZHB 3GZJA 1VSUA 4FYPA 1K5HA 1NW5A 1UIRA 2W6ZA 2O7RA 1PZMA 4NK5A 2A7QA 3TQTA 1J9EA 3UWPA 1I80A 1SVMA 2ETVA 4TMFA 4U7GA 1E1KA 1XPUA 1XZAA 3LHIA 2PGDA 3BCUA 2IPOA 2VNSA 2AFVA 2PKEA 4JI6B 3TAXA 3M5CA 4M76B 3P97A 2BI8A 4KJZA 2CMGA 2VNKA 5B7QA 1Z2PX 3PXGA 1Z4KA 4FFWA 2AXQA 1NYQA 3QVSA 1K5GA 4YUZA 3R23A 2QE7D 4QPDA 1JI3A 2HYDA 2DULA 3E9RA 2VRBA 2F1HA 4IPTA 4LE1A 4UARA 4N7RA 1E6EA 3NIBA 4KVAA 4EARA 3AVVA 2PV0A 2JA2A 1MO3A 1C1DA 2WMDA 1JXOA 4FYXA 3R5XA 4F4UA 3EXIA 1H2XA 1ZESA 3HKEB 6GPBA 2QROA 2CFRA 4LOLA 1ZCAA 4ZT3A 3NASA 2G40A 2DFPA 3GA5A 5J59A 4QGBA 1RVV1 3NHUA 1GILA 3PENA 1DWUA 3RLFA 2R6HA 4ZTUB 1Q0TA 4R7ZA 5FIUA 2ZK7A 5FTMA 1QGUB 2ZE8A 3WSWA 1U2QA 1N8KA 3FE2A 5EKTA 1E5VA 2ZYTX 4LV6A 2A59A 2R8XA 1ZBDA 4HGPA 3RGGA 1XLTA 1Y8QB 2NXCA 2ZSUA 3F9IA 3GOHA 4OAPA 2ASVA 2CSUA 2PSFA 9GPBA 2YVKA 1GTSA 2H4JA 1PLLA 3FOZA 3TWOA 2XT0A 3MT7A 2VCEA 3KQVA 4IIBA 1E0KA 4CMHA 4KK4A 3ZJUA 1HDXA 2IF2A 5ITWA 5L3SB 3V1NA 4QVIA 3FLMA 3OM9A 4XCQA 4Y9DA 1XYGA 5FP0A 5AVRA 1L4NA 1BHO1 4S1WA 2GN2A 2PX5A 3GGJA 1HYQA 2DAPA 1T5DX 3KPUA 4K81B 5FUMA 1PDOA 1E4YA 4C4PA 3QMWA 4X65B 3VR3D 4B4OA 4EAQA 4RY8A 1Z16A 1P74A 4YUXA 4EHFA 4KBGA 3ZWAA 3FOEC 2D1YA 4AJ9A 5KINB 2HSDA 1WPQA 3L1VA 3HKDA 3WDLA 4MHTA 5P8WA 5A7GA 2ZB3A 3AHGA 1PT7A 1ULUA 2KYRA 3A2MA 4D82A 4I9HA 4EPXA 2XZOA 2Q4OA 5AOAA 4LRWA 2PMWB 2F8MA 3DZFA 2OHIA 7REQB 5IUJC 2PWBA 3BGOS 1BO6A 2MU1A 3D3QA 4NHOA 2IQ5A 1OWPA 5BT9A 4Z3DA 4KPUB 2GBLC 3L7YA 3SGLA 1FEZA 4QC2A 4C7MA 1V16A 2YMLA 2A0WA 4B75A 3AEYA 4D8VA 5KSZA 4CKCA 1MPTA 4US0R 2X86A 3L4BC 3DHYA 4XA8A 5G3YA 4MYRA 5I7WA 2ODTX 5G1OA 1KHHA 5FLYA 5JG7A 1Q7BA 2WRZA 10MHA 4C05A 1V0JA 2QOEA 5F5NA 2OBLA 4NJMB 1X87A 3USES 2ERXA 1SCQA 1GGVA 2XH8A 1TFRA 3IVXA 2PS3A 3BSSA 3GEDA 3HY6A 3IQXA 3IDZA 3OIGA 3PS9A 5DT2A 1NMYA 2PXCA 2PNFA 3KHSA 3MMPA 4RVUA 3HRIA 3D6HA 5HRAA 5BUQA 1FZTA 4BNWA 1JF8A 4FJ0A 1U2RA 2AN5A 2ZG6A 3DR3A 4DHWA 1E0DA 1GTMA 2NUTA 1MO6A 3M70A 1PQWA 1N75A 1Z3CA 1EDDA 1ADCA 3EG9A 2IYVA 5SZIA 3QE0A 5REQA 5JCZA 2R66A 1E8NA 3A6PC 3VJRA 1FMTA 2VDWA 4TT3D 1VIAA 4V0KA 1JEEA 2P27A 5CB0A 3E58A 3TXXA 5KYKA 1JI0A 3OECA 5DYNA 4MTLA 4YXWD 4ZYXA 1ZFNA 4N0DA 3FA2A 3A70A 1TC1A 1LBSA 2G5TA 1HUQA 1GTL1 3C3BA 2PJZA 3FWZA 3DMGA 4BBJA 1UBCA 3I58A 3VPFA 3ZXXA 5C1DA 3HTXA 3IHTA 4J7CA 1N2JA 1JZTA 1P2UA 2P9YA 3B1ZA 4MR7B 4MQ4A 2P2SA 3LVRE 4PYQA 3U4MA 2CW5A 5CH5A 3E7FA 4E5SA 1BX3A 2QTTA 5GJBA 3RW9A 2HSJA 1TO1E 3FCOA 3GFBA 2IEYA 3EVFA 1TCBA 2HLHA 3V4SA 4F7WA 2R84A 2IU6A 4NWIA 1U94A 2P0EA 2YV4A 3FI0A 4C43A 4TUYB 4WJLA 1TKRA 4YY3B 5DK6A 4KPYA 3FVQA 2XB6A 4NG5A 5ER9A 3TQFA 1XJ5A 4JC4A 2BM0A 3VVCA 5KNCA 3SXJA 1NXTA 4L73A 2ZJ6A 1FRVA 3BRQA 4HQOA 2FVXA 3HY3A 4F2GA 5AM2A 3E9NA 1G5IA 8ABPA 4RFLA 5BV0A 1PQUA 1X7YA 4X6UA 1YJXA 2FWAA 2V7VA 1J0XO 1RP7A 2WYVA 3H11A 3B60A 5DX0A 4B3HA 2RGNA 3FHLA 1BDJA 5K6TA 2DBRA 4MA5A 2V98A 4IIJB 4ZAGA 1VMEA 4Z7QB 3RT7A 3I76A 5BVHA 2G1UA 3GEHA 5IK2D 1EPUA 1U7WA 1Z15A 4TL8A 1O9GA 3W9SA 5IHXA 4TQGA 3L8GA 3MWDB 3ZZTA 3MGBA 5LOVF 1IJEA 2VWGA 4NOKA 1XD9A 1GWNA 4KIGA 3P2OA 3QKRA 3EFOA 2JK0A 4FS8A 3TR0A 2JEYA 4X9XA 3WGJA 5LOVA 1EKXA 5IMSA 3OP1A 1ZCZA 4WACA 4PYOA 3SFTA 2JJ8A 2ZSDA 3KZNA 2ZRAA 3ISVA 2I1LA 4ZOLB 5K3DA 3U39A 3NVKI 5MFPA 1DAGA 5KJ1A 4WNAA 4RWEA 5HTKA 2JARA 4OB7A 5L51A 2XGOA 1DOAA 4OFZA 1Y34E 1DVRA 1UP4A 2GPAA 3MK31 2OZLA 4X8LA 1QRAA 4M98A 2UXDB 1IXZA 3LP6A 3O5AA 3FNEA 3E4DA 3TW0A 1Z5PA 3D54D 1LC0A 1Z4JA 1G64A 3CV3A 5K0ZA 4II2A 4NOJA 2XODA 1NQOA 2VWQA 3NLLA 1U2DC 1JLSA 3OE4A 3PQDA 1HLPA 3QEJA 2W48A 1JR3E 4M8KA 2PRZA 3N8GA 1IHYA 5M2QA 2ZYVX 2Z8YA 4YC7A 1U1DA 4P36A 5LU8A 3H16A 3RC9A 4J94A 3ZV3A 1C7JA 1TVMA 1A5BB 1P45A 1UMKA 2G1PA 1QAQA 2PANA 2W6JD 4BMOB 4EVRA 2VP0A 4Z1OA 2XUAA 1EWRA 4TLMB 1P18A 3O1JC 1O0CA 3VMMA 2YZ7A 4ASUD 3NRBA 3QNMA 4GI3A 4IV5A 1VTKA 4P6VF 4BU0A 1U9YA 2JF0A 3BDVA 1H6DA 3CRVA 1DFGA 3ISTA 2GT1A 4J4HA 4UUAA 3B1VA 4TKUB 3TQRA 2PN1A 4BQNA 1T5TA 4URVR 1YZLA 3X3HA 3TINA 3ZZUA 4ZKEA 4PZZA 1U04A 3KKZA 2X42A 4XM0A 2ZUSA 1YTLA 1LW7A 2HNKA 2OMKA 4FFDA 1OH5A 1A3CA 5C4GB 2NQ2C 3ENNA 3S1LA 1X7XB 4UTNA 1E2GA 1NSYA 1XCMA 4U2GA 3AVXA 4MLZA 2IOFK 5EPUA 4BB0A 1BAPA 1JDVA 3PJFA 2PUGA 3D1VA 1JJVA 4I1UA 1A4IA 3LY5A 3T52A 5DBIA 2GEVA 2GLUA 2IYYA 4P32A 2BF4A 4KN6A 4RX1A 1RLTA 1ESCA 2IFTA 3VUEA 4BNMA 2I4MA 5DEIA 5FT9A 2AE1A 1OTYA 3OA2A 1HKUA 4JVLA 1E9BA 5CFMA 3QH4A 3HQ4O 1YK1A 3DHNA 3ENWA 3HWWA 4CUJA 1BC5A 5EWMA 2JLYA 1IQRA 2GJ8A 3O3NB 4HGQA 1OVGA 5EMKA 1AK9A 2H8GA 4J3NA 3ZK8A 2X23A 5CNJA 3GLRA 3OWXA 5L4NA 1DRUA 1JHDA 4KSCA 2HD4A 5EYPB 1CIJA 1MEOA 1EK0A 3UF0A 4B3BA 5J4YA 4FFOA 4MO9A 1DELA 3OLYA 1X8XA 3UJ8A 2C99A 2W6CX 4FFBB 2BI4A 4DUGA 5JWOA 3TRKA 1DHRA 4YJHA 3WIBA 1JHYA 2IP2A 4FMPA 3DBLA 4LVNA 1WQ4A 5IABA 2OGFA 1M2HA 2A5GA 4RIHA 3PBKA 3OQIB 4Y6GB 3TKYA 1B6RA 3I1FA 4JQZA 5D6NA 5GADl 4M54A 4W9MC 5DCUA 3KYBA 1THTA 3DR5A 1PJLA 3IDOA 5LDGA 1YJCA 1TPZA 1E61A 5AM5A 3A9SA 5M29A 1WXXA 2WTMA 1KYWA 1XTQA 4RSMA 5HKLA 5CXQA 3PYLA 4A03A 2ZB8A 1THZA 3N87A 1HBJA 3G68A 4I3GA 4Z8XA 5TJ9A 3OIFA 4OQPA 5KOJA 1PL6A 2W37A 4U1RA 1QPZA 1LDNA 2VAWA 5DNEA 2F43A 2IA5A 4MRVA 2QV0A 1W4AA 3BH6A 3ICQB 1NT2A 3HMKA 5EN4A 1Y7TA 3CE6A 1I6KA 5A0TA 2GDJA 4ZOBA 2CLHB 2P67A 1TVEA 5F51A 3DEJA 2E49A 3B1KA 3DS8A 4W99A 5DO9A 5JFOA 2F55A 3SNHA 2YWHA 4LJAA 3BJMA 1R9JA 1XG5A 3DEZA 3JQBA 4FLEA 1T0UA 4YK7A 4QLOA 2H85A 4A1OA 2G67A 3SJUA 4QEKA 1TT5B 4FYWA 4MINA 3AQIA 4C3ZA 4DG8A 3O8CA 3Q3EA 1RAFA 1MENA 1X7WA 2O2DA 4E5YA 1X1RA 5SV2A 1E4EB 4IQGA 4M7OA 1X8LA 3ELBA 3EH2A 3NWOA 1N57A 2G16A 2XJ9A 3C7DB 2GXQA 4MKFA 4RV9A 4YAFA 2FAXA 5DYGA 4KVFA 1NPYA 4IEFB 1SC6A 4WLUA 1L5YA 3IQIX 3NBUA 1QG4A 5AKGA 1N1GA 2DPHA 4IRMA 4QIHA 1Y8AA 2JLBA 7YASA 5JASA 2ZR9A 5L4LA 3GJRA 4C0AC 3U4QA 1PEYA 1XTIA 2BMVA 3PEEA 4QZVA 1SWVA 2CT8A 2OVBA 1NN3A 4P4UA 1MJFA 2BKXA 3MEQA 4RPCA 3WNDA 1GDDA 1QANA 1PYDA 4GL4A 3NVMB 2POQX 3Q2KA 3WK5A 1KK0A 1BCSB 1JLLB 2NQTA 4IOKA 4CEJA 4KV7A 1GQQA 2D06A 1GUAA 1WZNA 3A1VA 3TIIA 3TZCA 1IXYA 2UUCB 1EBUA 4PLPA 3S2SA 4CF4A 2GZSA 1M34A 1CK4A 1SXJC 2I78A 4HLCA 4N5NA 4ZT4A 2JGLA 4DKXA 2HCRA 4ENVA 4BN5A 3BMOA 5IXJA 1PZHA 4FGZA 4KGVA 5E9AA 2DC1A 3AR8A 2I3ZA 3G9ZA 1U4NA 3O82A 1DFHA 4LRSB 5AKKA 4F9FA 1M0EA 1J2RA 1NURA 1RHQA 2FRDA 2Q1UA 4U0JA 1ZKMA 5CNKA 5DXFA 3SX0A 3ZWQA 2NSJA 1OQAA 5I47A 4OHKA 1MRSA 2VRNA 4AKGA 3NT2A 1J97A 4RAQA 1Z06A 3ADOA 5TSDA 4ZI3A 5BW4A 4WOPA 1S8NA 4U9IS 3EXFA 1Z33A 4X1YB 4TMYA 2PHZA 4D4KA 5J9FA 3MTGA 5E2BA 1F2UA 1GU0A 1NVKA 1YOVA 2L18A 2WPNA 2W6IA 4W9RA 3TZBA 5BVGB 1RBQA 5BW8A 2GZHA 3C8DA 2ZBVA 2O1XA 1SXJD 3N6VA 1JNYA 1O6BA 2PU7A 3NHPA 3T1NA 3VGJA 3ZE2B 1FTGA 1R64A 2D5AA 4DR2B 5LIPA 4WD3A 4RKQA 1MUUA 3Q41A 1GPJA 4KUHA 4X91A 1DKQA 4RYLA 1Z2CA 1JFFA 3LA8A 1FP6A 4RQTA 1ZONA 3FYTA 4DM7A 2AFIA 2R3SA 2INGX 2J5QA 3LDGA 4HH4A 4JGGA 4P80A 3WLTA 2P4EA 1GA1A 1PR9A 2G77B 3CW9A 3CN7A 2HK6A 5I9BA 4WOBA 1XDWA 4LMAA 1RWPA 2SKDA 5JRDS 1TZCA 2ZSKA 1ZM9A 1VL0A 1Z9BA 1FNDA 4R9UC 1XKQA 4KK3A 3ZWMA 2CDNA 2E87A 4JWKA 4KYIB 4H7IA 3W8EA 4C6HA 5KNBD 4OQZA 4RDIA 3U1VA 2HLDA 3BMQA 3TR5A 1FUYB 2ZPTX 2AN9A 2CUZA 5BSUA 4EI7A 1A5TA 1CE8A 4MR8A 1ZGCA 4DLTA 4QLBA 5JNLA 1RXCA 3WWDA 5IDVA 2XY4A 1XCOA 5IBPA 4DVJA 1T8YA 1GGNA 1VP9A 2Q0XA 2BFAA 3KM0A 3PRYA 3RBAA 3RARA 5YASA 1UBMS 2G6TA 2ORED 2ZIUB 3HN2A 5JVDB 3UFXA 5FA6A 4O2LA 3VPSA 2XUGA 4K8OA 3WNQA 2AA3A 5ITZA 2YV3A 2ZJAA 4J8PA 3S8MA 3N1UA 4KQ1A 4JKIA 1HA3A 4PLYA 4Y2XA 2FPIA 3BEDA 5LN1A 3ER6A 3OAAD 4QAQA 1QCDA 2BKVA 5CVDA 3VZQA 1AA9A 2QG4A 2R2GA 2BOVA 3ORSA 2A1UA 1I6MA 3L46A 1LRLA 2Q6IA 5FUBA 3VPDA 5FD8A 4DDUA 1BEUB 3OI7A 4HFMA 4BX9A 1G21A 2DWUA 5JANA 3TLYA 5KMGB 1GY8A 1QLHA 4K86A 1VIDA 1X15A 2JDIA 4QYTA 1H2AS 1LF0A 1XRMA 4L3OA 3R5FA 4D5GA 3EAGA 4S3MA 2Q6VA 2WWFA 2O8BA 5FADA 4OI0A 1FVHA 3A26A 3JQ8A 5AW9A 5FQOA 3CR3C 1QKKA 1OR8A 1YQQA 3OY2A 4WN9B 3Q9NA 4C3OB 1HFEL 2BAGA 3QEAZ 3LQKA 2JB9A 5HBRA 4GLLA 4E5MA 2C9ZA 4WJZA 2PWPA 3K1ZA 4GP9A 1QG2A 3TGPA 2GEDA 4JYPA 1KOLA 2GYUA 2X77A 3WQRA 3ZKWA 4Q66C 4FOOA 1ZC3A 4FP9A 2R1VB 3PGLA 1PT5A 2FCAA 1TKAA 2OAEA 4JOCA 4CNBA 2PZGA 2WYIA 2P9BA 5JEDA 4GKAA 5LYJB 4LKOA 1GADO 1DQPA 1T25A 1BMDA 1JDUA 1X6VA 3DDCA 2JNWA 2IDKA 4R1LA 9LDBA 1BD4A 3ZNOA 3KTAB 1JHAA 4ZO9A 2HSGA 2FE1A 5E6UB 4NABA 1NXOA 4PIMA 3Q88A 3BL8A 4Q1FA 4BZWA 3O47A 3OIYA 2FP4B 2A1TS 4WCDA 3R7SA 4AZ3A 2R47A 3QLTA 4CKBA 2J48A 2VK1A 1M1YB 2ZQZA 4XAQA 3HCPA 3BHJA 1M3SA 2YWCA 3U9TA 1IBKB 4XSGA 4U39A 4C07A 2M2IA 3ACCA 1FRZA 1U9CA 2MSCB 3D81A 3A4YA 2VUUA 5AT1A 3UV7A 1MIOB 5DSZA 5DW3A 4AG5A 2BFDB 4M1TA 2C20A 1GGKA 1ACJA 3IIMA 4ZVRA 1CQXA 1CQZA 4DCCA 4GLBA 3DEYX 1NW3A 1UXJA 5EJ8A 2Y6UA 4NATA 3GDFA 3A1FA 1SJ9A 5HF8A 3AW9A 5F78A 1SHUX 2C1XA 4N7BA 4OB8A 3WYEA 4DPMA 4Z4HA 1RAAA 1POWA 3DTVB 4UOEA 1N33B 4DLVA 4J0JA 4UD2A 4BVHA 3JQFA 3UPUA 1PKXA 1GKIA 2F67A 4B34A 4QGFA 5ALJA 2ZYHA 5E0OA 1LNQA 4A9AA 4CKWB 2V6FA 5LA6B 1CJVC 5GTDA 2YVLA 3LQFA 4CEIA 3ZX5A 3KFVA 5INTA 2HRDA 2TYSB 4UHKA 3TGWA 2HK7A 3BWEA 5COBA 2KS6A 2CDBA 1M2VA 4RHUA 2CFTA 4DQ0A 4R5MA 4CRWB 1V39A 2VDOB 3LH5A 1BGXT 3CWCA 4A6EA 5EIWA 1YRYE 3AHJA 1PJQA 1QVRA 1YI1A 3NTXA 4J29A 4L4UA 4UMFA 3QQ5A 2QTAA 4LUCA 2PGIA 4ACBA 4DRXB 4ZPXA 1XZBA 2M6LA 4LC1A 1Z4NA 4AMUA 4DR1B 3R3HA 1ZGBA 3GJTA 5I5GA 3TLAA 4JI7B 3WNZA 2Q1XA 1R9MA 4XPIA 3M81A 3WIOA 3CSDA 2I7XA 4ZVMA 2ZWOA 5ALQA 1ATIA 2RHGB 2VJBA 5FTWA 4OCZA 2IUSA 2CZGA 4LCJA 1XDUA 3NGMA 1M7GA 3WYBA 1FF9A 2VK8A 1Z26A 1EDEA 2C9CA 2H57A 2I4OA 3ELYA 4N18A 4S1TA 4ZVTA 1WZUA 1QHYA 4RHXA 1I2DA 2DE0X 1ZU5A 4MUEA 1DS6A 2TS1A 2WLSA 3U44B 1PJ8A 2UYOA 3RVPA 3KOWA 5AIAA 3UV6A 1WHSB 5L9AA 1UT8A 3WR5A 3CVWA 1NRXA 2PL3A 2V7WA 5FBQB 5DNWA 3EULA 3PC6A 1T9HA 3EXHA 1UBHS 3P2MA 3UY4A 5EZYF 3WGMA 3QV1A 4DSZA 4NXNB 1Q0SA 1YJ5A 3TB4A 2QD2A 5COAA 2TMYA 1TJ3A 3MTDA 2QW0X 5PNTA 5EZYA 2VWPA 1P2GA 4I55B 3FWKA 1N7HA 1YB2A 1SUSA 2FLWA 3G9QA 3SF8A 3T54A 1L1EA 2OD7A 1M0SA 1XDBA 4PPGA 4QDUA 1NFFA 1UJCA 5IDYA 3TTWA 3PYXA 3PNVA 3RT1A 1U0BB 1D2EA 2FZ4A 2GN6A 4L72A 3K0AB 3PA8A 1TK3A 2VHUA 4C5BA 5HYVA 5TV2A 3DVLA 2IV3A 1PTJA 1JJIA 4JROA 4IOJA 2PQ6A 4KLNA 4C03A 3VUFA 5JNTA 4GGOA 2VAPA 3LHKA 3GMDA 3H9UA 2GM3A 1U8XX 1VE5A 4WV3A 5BQ5A 1WCXA 4R68A 3OMWA 4H0CA 3RANA 1U7UA 3FSGA 2APJA 4OXIA 5KNDA 1DEAA 4YRSA 3HA7A 4XFKA 1RWWA 1MZPA 2EIXA 4OIMA 1FX0A 5AK4A 4TYMA 3PHGA 3LBYA 4I4LA 5DBGA 4X6YA 5CDFE 1PTKA 1TMKA 1TC2A 2I8LA 5U4XA 3ZCSA 1SMKA 2J3QA 4UTXA 5AUPB 9ABPA 1QH1B 3P96A 2UZ1A 4E08A 2PAAA 4CM7A 2Q3CA 3FTNA 2ZTSA 4HR7A 4EGAA 4LHSA 4UC0A 4RV4A 2VZ9A 5D3KA 4CE6A 3AIKA 4ZEVA 4Z1MA 4MGZR 4KMSA 1P3Y1 3H2ZA 2K2WA 3HXOA 3HP4A 3RIEA 3PR1A 2QAGC 1WEKA 1VG9B 1Z5GA 3ROMA 5C7OO 1J0EA 1YBFA 3O92A 1NOIA 1NZDA 3BQ9A 3SDBA 2QD3A 4M7RA 4G4JA 5DLEA 1VKZA 3MJEA 5EJ5A 4OREX 4PFSA 2CKDA 2FLKA 2X5KO 5ES3A 3N0WA 3JWJA 4IHQA 5I48A 4TVBA 3MTIA 3BCRA 3MT9A 1UKCA 2I2DA 3PFWO 1JV2B 1TKBA 1US8A 2WM9B 2YX1A 4QVGA 2Y1DA 1Q1AA 5L53A 4JBHA 3WLLA 1R66A 1IC6A 3H2HA 2X8BA 4RTMA 1JE0A 5EHXA 1Z56C 4B0PA 1LS1A 2V5VA 3BD6A 4IIFA 4L95C 2Z2YA 4AP9A 1F60A 1ENPA 4Y7DA 2ECPA 2UYHA 1ZR2A 1GNPA 5K6AA 1KQGA 4XRRA 5ALSA 2R5FA 3CWZA 2WKQA 1K7XB 3QVGA 4PVCA 4CW7A 1D6NA 4UDXX 1TM5E 1R8QA 2O2XA 3KOZA 2OHFA 3V1KA 2H08A 1QP8A 2O8EA 2LVBA 5F9FA 1N2ZA 3M9XA 1CS0B 1UC8A 1OXMA 4Q1CA 4EI9A 3OC6A 3V6LA 1Y9EA 4GBJA 5CVJA 1TK9A 4P5DA 2VR1A 3TLZA 3WWOA 5FPKA 3K70C 3LF2A 3ZC3A 2R6FA 3KX2A 3OKPA 2IQIA 4W5WA 5H83A 3GFQA 4OO3A 2H4YA 1VMKA 5FWXB 3AO0B 2PRIA 1I14A 1FTSA 1GRVA 2D1QA 2VAXA 4MIEA 4W6QA 1SQ6A 4DG9A 4P5PA 3AV3A 1EG2A 1XDDA 5JMWA 4D8WA 1YDHA 3NBXX 1M2OA 1PX0A 3SX2A 1C30B 5DF1A 4GGPA 1U9ZA 1UOPA 3RC1A 1M74A 4K40A 2A0FA 3FOWA 1DAKA 3BILA 1SN7A 3ZHXA 3MVEA 1KMQA 4MRNA 2IUYA 3CA8A 2DPMA 2BL4A 5LXTF 3DL4A 1LUAA 2X2EA 3FMVA 3PDJA 4OL9A 3W04A 3D6FA 3K70D 5DNVA 2PE5A 3MIIA 1EWYA 2QN9A 2XYQA 5EHIA 5JD3A 1UKVY 4KEAA 2OECA 1KO8A 1ENZA 1KH3A 3Q15C 5LXTA 1ISRA 4F5EA 1KZ4A 3WRXC 4R1SA 5H3LA 1TPYA 2UUAB 1TECE 2X6TA 4J0KA 2HHLA 3FF4A 1IAVA 1G2IA 1PUJA 2MINB 2R62A 3KLOA 4RAOA 3OPNA 3KQHA 1Z5NA 5E95A 3V4RA 4Z0TA 3SYMA 4BUCA 1JQKA 1WF6A 2B5WA 3G2OA 2B1RA 2PKCA 4F60A 5JFTA 4C3UA 1M76A 1SUBA 1VL8A 4WNIA 1OX4A 4XB2A 5DN6A 3ZDEA 4XB1A 4HKTA 3EC1A 4K9KA 3RWMB 5D5PA 1G3RA 2DEUA 5CYFA 4UBOA 4TROA 1NDUA 5ALWA 4IIEA 1P4RA 4L0CA 1Q22A 2R7AA 4HNGA 3ORHA 3PPIA 4HDNB 4U3JB 5EXXA 1KSFX 4FYVA 4M9SA 3U3OA 5J1SB 3SG0A 2BGNA 4CM1A 5K05A 5C8VA 1ST3A 2KMLA 1QFSA 5ENZA 3MJVA 4J75A 4F46A 3VU3A 4LMRA 4E1BA 1ZOIA 2QM0A 5TQ2A 3AC0A 1ZGGA 1BA3A 2IYLD 3N0RA 4O1IA 3DMTA 2J5RA 1RKQA 4RC9A 1UJ4A 5LP6A 1OC2A 2ERYA 2IXBA 1P1HA 2QN2A 2OOKA 1V1MB 3T7IA 1B0PA 2QR2A 2BMEA 3DC7A 2JJ2A 3DH0A 3Q7TA 5TX7A 3CFHL 1B8VA 2HHCA 2XOXA 1ECPA 1UQTA 4FBGA 1U8CB 3IA7A 3JZDA 1N36B 2QMQA 2C2ZA 3LQRA 2RGCA 4O02B 1GTZA 3E8XA 2ZAIA 4KBYA 1PJ4A 3FOBA 1MRNA 4YRIA 4K05A 4YX9A 5KDLA 2DT5A 3PNKA 3CEPB 3VI4B 3F5FA 2J09A 3AL2A 4NBUA 2X4GA 3TSAA 1L5FA 1NZFA 4BBZA 1RLUA 4FILA 4TKVB 4G8BA 3COWA 3DVQX 3ZLTA 2O9JA 3OUZA 3K0FA 3ZJVA 1V9SA 1FNCA 4JLKA 3RODA 2ZIXA 5D87A 3W8FA 3ENKA 4E1AA 1U2ZA 5E6RA 3ZDZB 1DO8A 4G4SO 3AFGA 4GPZA 4B3XA 2DR2A 3MSXA 4FLFA 3WO0A 4IDHA 1C1YA 1D4FA 3EVDA 1ZL2A 3CPEA 1JU9A 2VDKB 1UFVA 4D4JA 3JV7A 5FKJA 4YAGA 2O5CA 3SPXA 4MI1A 2BGRA 2I4TA 3HJFA 3EOBI 5C4MA 1L3BA 3B89A 2Q50A 3H1BA 4RF4A 1H3NA 1X0VA 3AI1A 1V4NA 2GRJA 4YHHB 4BXOA 2YBEA 2VT2A 3TZ6A 3C1TA 4PC2A 4Z9AA 5CA1B 3BXHA 1GA4A 1KRHA 2BMJA 3AUJB 3AM1A 1A7JA 1GEEA 1EX9A 4J16C 4QBHA 1JXAA 5TMBA 3TPZA 5HX7A 3OQOA 3UATA 4JQYA 3IHKA 3PHJA 2GPYA 1JDSA 3VZDA 1SXPA 1IJBA 3RVSA 4ESVA 1WXDA 2QPTA 2B83A 1G63A 2N0SA 2ZB7A 3TPCA 3EG5A 5MHTA 1XTTA 1BCRA 2CXTA 3I05A 4FDLA 1YBAA 4LYJA 2QVLA 3PNBA 4RJIA 2C4KA 5K2MA 2VEOA 5EC8A 5LMCA 2J8ZA 2P75A 3T99A 4BQEA 4TYWA 4FOSA 4CYMA 3KVOA 5DLPA 1XZDA 1C3OA 2J9GA 5HSGA 1RTTA 4I2VA 2X0NA 4CMCA 3G0DA 3FTFA 3NAQA 4HPXB 3ZZ1A 3ZDFA 1QWOA 5HQTA 3AR9A 2P30A 1DI0A 3C5WP 5K9ZA 3ER9A 4FJ2A 4HBZA 3VDXA 3WDSA 3EW9A 1FQKA 4D6XA 2RHMA 1T8RA 1BA2A 3S8YA 1SVUA 4B3JA 1K0UA 1YIDA 3KZCA 1U7HA 3A9VA 4Y2QA 4CI9A 2FETA 1HDZA 1HO3A 1QR2A 2OK7A 3GJ6A 3WYAA 1AV6A 3P9RA 4Z4CA 2O4UX 2RONA 2XAAA 4KQGA 3QX3A 2NX2A 3LA6A 1IB0A 2DUMA 1ESZA 2EKPA 1VCHA 2GJ9A 3MJSA 4P1ZA 5GPBA 3VC3A 4INZA 3ZGXA 4CIVA 3AH8A 4PHTA 1HYBA 1Z7WA 2VPIA 3BK1A 3M6XA 3PDCA 4HGOA 2Y67A 3FNFA 1B00A 1PZFA 2HL6A 3PWZA 2OO7A 1O5OA 1U6IA 1M1NA 3VH3A 4F3KA 5D1NA 3TDMA 1A82A 3Q4GA 2PMCA 2YVAA 5TB5A 1LB1B 3AESB 4JX9A 4HH1A 1YDGA 4CMIA 3O8RA 1OLOA 4KIUA 2VNJA 1XVLA 2AFHA 2WHPA 4ZTZB 3FIUA 4CMGA 3NYRA 1K7CA 1W88A 3I9V1 3EXG2 1X1SA 1TNDA 4GW3A 2IPXA 1VECA 1UMDA 1I2AA 1C9NA 3M9LA 3QIAA 2CJWB 3VH2A 2JLXA 1IN5A 1PFGA 3WLKX 2EYQA 5EP1A 3HM2A 3UN1A 3SIRA 5TMDA 1XMVA 3ZWNA 1XTJA 1HT1E 2JK1A 4UQOA 1T4DA 4ARAA 4BQIA 1G6Q1 4K6OA 4JBNA 4O1MA 4LSWA 4FM9A 1JIUA 3X2FA 1RQLA 1UAGA 2BFCB 3MPOA 3DE3X 2QW8A 2GH1A 4E3ZA 2X5XA 5HILA 3DBVO 3A6DA 2YFQA 2E3JA 1ZWLA 3DMNA 1M2EA 4MLPA 2ZRKA 5CB6A 5EE5B 1E2PA 2NZXA 3GLHA 3RK1A 2VWHA 3QYJA 4MVJE 4L4XA 1V1RB 2HWWA 3DKVA 3UB4A 3KHUA 1F8FA 1HE4A 3VVLA 1Y1LA 1M6VA 3LUDA 3P27A 5EJFA 5B3KA 1Z4PX 5JMOA 3LNTA 4H4DA 3PDIA 4KPGA 4CLEA 1ORWA 4FYJA 1U28C 4UE2A 5KSPA 1W85B 2RKBA 3Q3JB 4LFBB 1UJBA 1R4MB 2NPOA 4KWIA 1BWQA 2GFHA 4FMDB 3DWEX 1CEQA 4HK4A 4CKZA 3HA3A 3N7TA 2V9CA 3PB3A 4B82A 2PFSA 1XF1A 1RABA 2H5LA 1W4ZA 5ELLA 4I5DA 2WW8A 3ZJ5A 1HI9A 1SOVA 1AB5A 4TX1A 3VNAA 2W2TA 3WRWA 2VUTA 821PA 3SLGA 5LUAA 4OD0A 3K9GA 1Y48E 3ASVA 5EFOA 4TWZA 1U3DA 4QDOA 1E9CA 1XU4A 2PT7A 5FORA 3CCFA 2NXEA 2PIDA 1NJSA 3LY9A 4F97A 1THMA 4HV4A 3SBDA 1NATA