4FZJA

Pantothenate synthetase in complex with 1,3-dimethyl-1h-thieno[2,3-c]pyrazole-5-carboxylic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
287
structure length
287
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Integrated biophysical approach to fragment screening and validation for fragment-based lead discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 98
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4fzjA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4fzjA01
4MUNA 3TS1A 4ZCTA 2PIDA 1VBMA 5FO0A 4MUJA 5K0TA 1Q77A 3H97A 4MWEA 4HPWA 2E89A 3HGMA 2CV0A 1NUQA 4MAFA 4MVWA 3RK0A 2V0GA 2CUZA 3SEQA 1G59A 2IJGX 3CVWA 1O5TA 1N2EA 1N2BA 1NP7A 1QRUA 3ISJA 5F23A 4ND7A 1Q15A 3MLAA 3RFFA 2X0KA 1QU3A 4QRDA 3PRHA 1B6TA 1JGTA 2CSXA 1FFYA 4PBSA 1N2IA 3AIIA 3ZJVA 3F3MA 1Y42X 1J09A 1K4MA 3SZGA 2Z08A 3N9IA 3ND5A 3DV2A 2A4MA 1QJCA 3LOQA 2BTEA 3DLAA 1JIIA 3Q12A 1EUYA 2QJTA 5K0SA 1N77A 2QTRA 1EUQA 1PFWA 2E18A 1H1TA 1R6UA 4I6GA 4KPUB 4EG5A 3ZJUA 3IMEA 1M8KA 2E0IA 4F4HA 3QTBA 1GTSA 1ZH6A 4U8HA 4DDKA 1ILEA 2A1UB 1NYLA 3CLUD 1IQ0A 2DERA 2A1TS 4CQNA 4ZCSA 3FNRA 4F3RA 1DNPA 1IH8A 1NURA 3A04A 4ZT4A 2CT8A 1JIJA 3IOEA 1N2JA 2J5BA 1I2DA 1QTQA 3TZLA 3N8HA 2V0CA 3KT0A 5EKDA 2C5SA 4PY2A 3INNA 4DLPA 1V8FA 1WQ3A 4YP7A 1MB2A 4X0EA 4EG7A 1N3LA 3UMVA 5TS2A 3ND7A 4MVYA 1IFXA 3CLRD 4ND6A 2CYAA 4DDMA 4YMIA 4NAUA 3FETA 1KH2A 4R2LA 3FWKA 3ILVA 4MVXA 3HFJA 4EG1A 2X3FA 2QTMA 3D6UA 2X1LA 2O5RA 3E27A 4MW9A 3ZUGA 1O97D 2AG6A 2DLCX 3IVGA 3SYTA 4L2IB 1T9GS 1Q19A 5KCMA 1JIKA 3PXUA 3X1JA 4QREA 2RE8A 2VXOA 4OUDB 2CV2A 5HG0A 3AKZA 1IRXA 1D2RA 3IUBA 2HGZA 3HV0A 1TYDE 3X1KA 1I6LA 1H3EA 3FIUA 1R6TA 4DJAA 3KT3A 3CR8A 4QBTA 4PBTA 1S4MA 2VTBB 3VGJA 3IODA 3CLSC 2DEUA 4K03A 3FG9A 4MW1A 3TZEA 1WXFA 2WQ6A 4P2BA 1U0BB 3AL0C 2A1UA 1GTRA 4EFKA 3COWA 3OP1A 4HJXA 2DPLA 1QNFA 2ZUEA 1XNJA 3P0JA 3A2KA 4MUEA 1JILA 2CYBA 4MLPA 1VBNA 2PG3A 2D5BA 4NX2A 2D13A 1M8PA 1G8GA 3SDBA 2XRZA 1RQGA 1WOYA 4ZT6A 4ZCQA 1O96A 2J09A 2ZP1A 1GZUA 3MLBA 3P52A 4UZEA 3DO8A 1F7UA 1QRTA 2O8VA 1UFVA 4YBRA 2NSYA 4MUFA 1YIAA 5IJXA 1J20A 3GUZA 4FZJA 2DXIA 5LM3A 2BYTA 1OWMA 4ZCRA 3ZIUA 3CA8A 3L93A 4JFAA 2H29A 4U63A 3QE4A 4MUKA 3AFHA 4JXZA 1NZJA 4PBRA 3HL4A 3UY4A 4L2IA 1JHDA 1F4LA 3L92A 1O95C 4XFJA 5FO1A 1EFPA 1GLNA 1X8XA 4MUHA 2PXHA 3ND6A 3PNBA 1ZUNA 3S3TA 1M83A 3FHJA 3GMIA 4ZCPA 2PFSA 3SZ3A 1M1ZA 2G36A 1K92A 1LW7A 1U7DA 2QUHA 5J58A 4KKVA 2HMAA 3IUEA 1BS2A 1PG0A 1TQ8A 3UC5A 2QTNA 1EFVB 1ZJWA 5DASA 4G6ZA 5KHAA 4MULA 4MWDA 5TEVA 1TEZA 3UK2A 2QJOA 2WSIA 2A7XA 5DEOA 3ZGZA 1N2OA 1H3FA 3CVUA 2WB2A 1O6BA 1MC1A 3NBAA 1NUSA 3IMGA 2IELA 5TGTA 1SURA 1IHOA 1MBZA 2JANA 4NDAA 2JA2A 1NSYA 5DK4A 3G59A 2DUMA 3IDFA 1KKUA 2R5WA 3VU8A 1KR2A 1K4KA 3KFLA 4DNXA 4EG3A 3RBAA 1F9AA 4JXXA 2AKEA 3IVXA 3LCJA 2YWBA 2A84A 1JEDA 1I6KA 1KQOA 1ULHA 4MW7A 1F7VA 4EF6A 1KH1A 4DE5A 1M8FA 1IQUA 3D6VA 3ELBA 1T6XA 4AQ7A 2GKSA 4DDHA 4I6EA 3ZXIA 3IMCA 2ZUFA 3FH0A 4G5YA 1YUMA 1GN8A 1WY5A 3TQIA 1IQRA 4WSOA 1VBKA 3H9CA 4CDMA 3IOBA 4KPUA 1WXHA 4GU5A 3I05A 1WJGA 4MWCA 1OBHA 1YI8A 1N2GA 3ZJTA 1COZA 1GAXA 1ZH0A 3COYA 3CLSD 4EGAA 5IHXA 4BWVA 1EFVA 5FNZA 4J75A 3IH5A 4OJMX 4KR9A 4KR6A 1WQ4A 1KP3A 1IVSA 3P0HA 3RK1A 3QTTA 1U7XA 1TYCA 3ZXSA 1XNHA 1GPMA 3C8ZA 4MUGA 3TNJA 2DR2A 1HYBA 1G8FA 2YWCA 1LI5A 4U7JA 1OWLA 1H3NA 1KORA 4XFDA 4MW4A 2B7LA 4EG8A 3CLTC 4KR7A 1LI7A 1NUTA 1QQTA 4XSVA 4I6JA 2A86A 3TQOA 4RPIA 3CVXA 1JECA 3FDXA 2J07A 4CT0A 5LFAA 3IVCA 4EG4A 4R0NA 1KAMA 1MRZA 2J4DA 1KQNA 1KP2A 1J1UA 1QU2A 1OWNA 1M8JA 3FOCA 1J70A 5TEWA 4RUKA 2J08A 5H7XA 1M8GA 1PFVA 3KT8A 3IOCA 5DB4A 1QRSA 1EJ2A 1WXEA 1KH3A 4MQ6A 4OUDA 1J1ZA 1YIDA 1N75A 1P7PA 3Q4GA 2E21A 1XJQA 1O95D 1R6XA 1T6YA 4MUIA 1WXIA 1TFUA 2JAXA 5AHWA 1N78A 2EL7A 4MW5A 1T6ZA 2VTBA 3AG5A 3VRHA 2RD2A 4MW2A 1OBCA 4Q16A 3K9WA 1U3CA 2QUIA 2Z09A 4YP5A 2XRYA 1JZSA 2QUJA 3NBKA 5J59A 1MB9A 4H3SA 3JXEA 1O94C 2TS1A 3CVVA 1WXGA 3UOWA 4J76A 3MXTA 3CVYA 2AZXA 3SP1A 1J21A 1JMVA 4Q93A 1O94D 1MAUA 1X6VA 2CFOA 2NZ2A 4JYZA 3N2YA 4MW0A 4HJRA 2A1TR 2IP1A 3CLUC 1A8HA 2GOYA 5JBNA 2YXNA 1FYDA 1JZQA 2PZBA 4ZT2A 4ARCA 1KQPA 2OQ2A 1NUUA 4K0RA 4R2MA 1Q11A 4CDNA 3N05A 4MVCA 3SEZA 3GLVA 3P0IA 5J5AA 3K32A 5HUHA 1KAQA 2YY5A 3COVA 3Q10A 1JEEA 2H2AA 4ZT5A 1MAWA 3NV7A 3H05A 5BNZA 1PFYA 2PZ8A 3KT6A 1NUPA 2PZAA 1WZ2A 1MOPA 4EG6A 1O96B 3PNVA 2WQ7A 3CLRC 3PNYA 1N2HA 3G6KA 4ZT3A 3A4IA 1PFUA 1PG2A 1TYBE 3BL5A 4GRIA 4AS1A 4MWBA 1CT9A 1VL2A 1MJHA 1NI5A 2HZ7A 4NZPA 3FY4A 1VLHA 3HZRA 5LLTA 1N1DA 4G5FA 3H9BA 1T9GR 3A05A 4WNYA 3H99A 1O97C 3U1VA 2QUKA 5H16A 2OV4A 3FI0A 3X1MA 1O0BA 4JZYA 1V47A 2A88A 3HMQA 1EXDA 1WKBA 4E1AA 2Z3VA 1YUNA 2CYCA 4YP6A 4TS1A 1XNGA 1G8HA 1EE1A 1EFPB 3LE8A 3OTWA 4MW6A 1K97A 4NATA 4S1OA 3G5AA 3MMXA 3AG6A 4A91A 4ZT7A 2X1MA 1TYAE 4UZFA 2QJFA 1OWPA 3MUEA 3RJZA 1OWOA 3M5WA 2CV1A 1I6MA 2EJCA 1OD6A 1YULA 5HUJA 2D54A 2DETA 1U3DA 3RHSA 3COZA 5KWVA 2I1LA 4ARIA 4HK4A 4NAHA 3DPIA 3CLTD 2GM3A 1O0CA
chains in the Genus database with same CATH superfamily
1FLNA 1MCZA 3IAM6 4Q4LA 4N8SA 4QODA 3UCFA 3VZCA 2AHOA 4DCJA 1UZUA 1KOJA 2FSVC 4C0AC 4WLNA 3IQDB 5TJHA 2NU6A 2ZXEA 3EGIA 3MCTA 2GSDA 1TPZA 1RJGA 4X3CA 3FOBA 2HTEA 3HO6A 1E99A 1JN0A 5F1PA 1SVWA 2EBFX 2QAIA 3HXQA 4IO1A 1IEQA 3SC4A 1GQ2A 1Z74A 2RHBA 1MVLA 4W5HA 1UBGA 5JCPA 1XD2A 1TCCA 4OMCA 4MYDA 4Q3EA 3T35A 2PUGA 1O03A 1VPTA 2CXHA 3M9XA 3W2TA 2P9GA 2IEAA 4HT3B 3CO0S 1XLTA 3MCWA 1RYFA 2A9KA 2B5OA 1Y3FE 1R50A 2VSXA 3HVHA 3I12A 2NTEA 4QRDA 4IUCS 4BMSA 5CA1F 1T0HB 4RZUA 3ILSA 3V2GA 4JR2A 2J1LA 4QM6A 2GPNA 1WXXA 1LK7A 3DQQA 3L8DA 1JQAA 4GLOA 5JPIA 3SZGA 4GLBA 5CFNA 1VLZA 2V65A 2I6TA 3DV2A 4WKNA 3UEOA 4ZK6A 5F98A 1ZJYA 4I4TB 2GCNA 2K5UA 3WGUA 2C9BA 3HYNA 2YZKA 3O74A 4FIZA 1D2MA 4U00A 4ZAYA 3V8QA 3SVTA 2FW1A 4LG1A 2O19A 5G02A 2E37A 1H1TA 2HPVA 1QGYA 1NFRA 1U5BA 2RGBA 3PRJA 2VAVA 5ERGB 3S70A 2LNDA 3ZLTA 4B82A 2IOFK 4M86A 2FN9A 1ZKMA 2YV5A 5J1TB 4ACBA 4NICA 4FE4A 3A1UA 3DMTC 5B55A 1U9ZA 4Y2HA 2FLVA 4IIFA 1J49A 4LZZA 4NPCA 3DVAB 4AICA 2CFCA 4OQLA 5LQSA 3DMNA 3LTEA 1V41E 2JCGA 3CWCA 3O83A 4U5QA 4C14A 4JY7A 4JKIA 2A1TS 3IUYA 1GPUA 1I4LD 1L3IA 2ZCUA 3HQ4O 5D51S 3HYSA 5IKXA 1G20E 2Z57A 1MD9A 3TD6A 4CW7A 4V0NA 3GT7A 5EPOA 4RYDA 3A9RA 4ZT4A 3SR4A 1KEUA 2XUFA 1I5OA 2FPKA 2QRUA 2B4QA 4M0KA 4ZKEA 4DLNA 1AUQA 1E9FA 1SIOA 2ZUWA 4LFCB 1E5QA 3INRA 3OHPA 4ZOEA 1IJBA 2BFAA 1J2JA 16PKA 2I1VB 3GDHA 3CISA 4PRYA 4R41A 4PE5B 5DLEA 1Z7YA 3NHYA 4KZPA 4BVFA 1ZGAA 4G5RA 1GPWB 4B75A 4B4UA 3E7PA 2GN0A 2I6FA 3UCEA 3ROMA 2V7UA 4QHYA 2EF1A 1QDEA 1AKRA 4Z9YA 3LMKA 2ZYHA 1Y37A 3WXMA 3VJRA 2HQBA 3FFTA 4EY8A 5FI0B 3DZKA 2ZIXB 1XLVA 3DR3A 3IA2A 3QOYA 1AHHA 5A9RA 3I4CA 1F8FA 2LIPA 1EKXA 3ETNA 2PO5A 3U4CA 1NLFA 5AVJA 5DTMA 2NVBA 2HW8A 4P3PA 4ZGGA 5JTUA 1IULA 2O2SA 1QHSA 1JFVA 3RIGA 3T7SA 2FWJA 1QIHA 4KXVA 2AE1A 3LT1A 2RE8A 3FMOB 3UK7A 4OUDB 3WYCA 3OWXA 4HQLA 4RLQA 3WO1A 3AKZA 2XD4A 3T15A 4B35A 4C5BA 1HTBA 2ATXA 4QXMA 3X1KA 4AZ0B 3DEJA 4L6AA 5I5EA 5I7HA 3FIUA 2X8LA 4LBWA 2VXBA 3FF4A 4PLCA 1JI0A 2DQZA 1QZXA 2PGIA 2HFKA 3A2NA 3GZ4A 2ORWA 4TTAA 3TIGA 3WL5A 1VHWA 5DTQA 3T38A 5ALQA 4KAJA 2DHQA 3C48A 4IM7A 3GEMA 3DV0B 3V34A 4E6EA 1HQYE 3N2KB 2N0SA 1F6WA 2JKYA 3U09A 1SVOA 3H86A 4E5YA 1EP3B 1JBQA 2ICAA 1LS6A 3DMFA 2OXFA 5BSMA 4Q21A 3L40A 2RG1A 1YBHA 2RHWA 2XWJI 4W5JA 5EZSA 3ZQ6A 2HRBA 4MLZA 3KZVA 2NYVA 3GI1A 3KYDB 1A2KC 1RKXA 2ZIZA 5EXPA 4BB6A 4DNOA 2GCOB 1YONA 1B6RA 1JI3A 2FPMA 3FLAA 2A0FA 3GU3A 3UJCA 2Z5LA 1X7ZA 1O96A 4INPA 4NECA 3JALA 3GAZA 4BFYA 1JJAA 1U9JA 2P2ZA 2AYYA 3E03A 3HU2A 3G0DA 4WASA 4ZDIA 4YJ2A 1G2QA 2IS2A 2OQRA 2X7XA 1I94B 3TLJA 2X86A 3R9WA 2IYNA 2ECOA 1MPTA 4X3PA 4BNWA 2QW0X 3N70A 1KDZA 4E30A 1ZWLA 3L18A 4YJ3B 1J39A 5T6BA 2D0IA 4NMMA 3HB5X 2QTWB 3RS5A 2V7BA 4DR7B 2PQMA 2RHMA 4FCCA 5AVZA 1VLLA 4P4SA 2C5FA 3PC8C 1W35A 3ZHRA 5BY2A 1C8LA 1TT5B 4FN5A 2PUBA 3IDAA 5HRUA 5DN9A 4ITVA 4K8OA 2I3BA 2GD6A 1OI4A 2BGRA 4IG9A 3VDQA 4LF9B 1O5OA 1KQGA 1RYNA 4MEJA 1O87A 4KN6A 1S8FA 5K0CA 1J00A 4RULA 3OZAA 3V3TA 4RGYA 5ENVA 2OO5A 3V4SA 3PB3A 3VU3A 4EELA 2ZUDA 2PUJA 2QM0A 3BZBA 5BT9A 2VEOA 2PGAA 5J58A 1WKVA 3WLKX 5FULA 2HMAA 3F1KA 2CLOB 2JFQA 4RLSA 1J6UA 1BS2A 4MRAA 4F84A 3CG4A 3BWYA 1QJ4A 1E4EB 4K3VA 5AK3A 2JH9A 3IBTA 1JDSA 2ZJBA 5EE0A 2CVOA 1DQYA 1JDBC 2Z2KA 4DLBA 5ALGA 1CNFA 3LSTA 1M7HA 1ZLXA 3AXTA 3DE4X 1ZY2A 3CRW1 3PFHA 1OV6A 3NEAA 1U6IA 3B38A 4J2OA 1B7GO 1FVFA 2OCAA 5JG7A 1A9SA 1G8AA 1GTG1 1T24A 3D8BA 3ZS9A 4CM3A 1PBNA 1X7WA 1CJUC 2HNKA 5BR8B 3HA3A 4EK9A 3PICA 4MP3A 2GN9A 3PWTA 5JNTA 2ZAMA 1XEFA 1H3FA 3ORRA 4IHKA 4M22A 4JP1A 1NJ2A 2DP4E 4E09A 1JHXA 1GO2A 4M7RA 5K3OA 3AVXA 1RJWA 3OH8A 1ZK4A 4FW9A 1PX2A 5CVUA 4FJ1A 1G41A 1GKYA 2YNMD 3AETB 4FMCF 4KQJA 4NOKA 3W5AA 2A9PA 3LNCA 3OF2A 3RKSA 1QG4A 1GV0A 5FH9A 2FSFA 1FUYB 3M8KA 1EMDA 4IZOA 2G72A 3CJQA 4K6CA 3K53A 4KMRA 5BMVA 4BFZA 1E1QD 1N1GA 2OHXA 4E5SA 1JPJA 2EDAA 3JVVA 5HJ7A 4FHEA 1ZUWA 2WIBA 4PU0A 2VQSA 4PZUA 1VHLA 5LU9A 1LWOA 5J40A 3ZWDA 5LD2B 4CCYB 3SE0A 3OKFA 4F2WA 4TLCA 2ANBA 2P8SA 4NAVA 2O59A 1D0SA 3ZH2A 2QRNA 1IQUA 2ZYAA 4YXWA 3I42A 2FDCA 3GLTA 5H3CA 2MMCA 4LV5B 4DIUA 4Q4HB 1S2DA 3GLIE 2Y67A 5IM4F 2R85A 3ESCA 3DZHA 2GPWA 1P4JA 3LNTA 3MILA 4PIVA 1G5HA 2W6PA 4G5YA 1WY5A 3ZE9A 3T7CA 3ZLUA 2CB0A 1WD5A 2AI2A 3CLKA 3JQ8A 5DBEX 2GD1O 2ZBUA 4S0ZA 4F1WA 1D2NA 5ESXA 2JAUA 4L8LA 2PYIA 1Z35A 1HLDA 1YT5A 2BSXA 2W71A 3VHXB 4ASUA 4DBZA 2UVDA 4Z3KA 1SQSA 2VT6A 3AJ9A 1N5DA 3TQSA 1LBIA 2AN9A 2VSFA 2ECQA 1KIAA 1CERA 1M34E 2FJPA 3NVAA 3LVQE 1FNSA 4JLNA 4ZAVA 3VI3B 4LBVA 1QRRA 4BNYA 3LX8A 1XFDA 2NXJA 2HF9A 4O4IB 2A94A 3EG9B 2QGZA 2ISQA 2WMNB 2A0UA 3BSFA 2Q3HA 1B6SA 3U26A 3TW0A 1RLMA 5B1SA 2FE1A 4BE9A 4CDGA 3P0FA 1BFKA 1KO1A 1QYXA 4U2EA 1KFEB 1UJCA 1BSVA 1T3LA 1BYIA 1E6EA 1TLFA 2EYUA 2VLIA 3KLPX 1RBQA 4MW4A 5G40A 2BLNA 3OO1A 4K86A 1DT5A 3I9OA 5ARDA 1L7EA 3MQ4A 2GK7A 1HKHA 4B6OA 1N92A 2N47A 3OZ7A 4UBOA 4DUGD 4TKMA 3JD3A 4YRNA 3L0CA 2FEXA 3HSYA 1RKUA 3QSYA 3WJAA 4C89A 3HJUA 2QW8A 4DT1B 3DOHA 2H4FA 3NV9A 1JECA 3C8MA 3OPQA 3OSZA 4TMVA 3DE6X 3I6YA 3SS7X 2P9YA 1X8JA 3QE3A 4RL6A 3F4LA 4EHIA 1PR5A 1SBTA 1TK3A 2EIXA 4NFSA 2I2FA 4Q7EA 4PAQA 2ADFA 4WADA 2AF3C 3FOCA 2BR4A 2FPIA 3S5JA 3GEHA 4EAAA 3A32A 5TEWA 1U8FO 2FR8A 1GZVA 1A72A 1TC1A 2ZBQA 3LS2A 4A8TA 4B46A 2FWIA 1KSGA 3RRFA 1Q6YA 2B5WA 1EGVB 3VDMA 1SC6A 2XNDD 3PCTA 1DG1G 3V8RA 1WZIA 3G49A 1EX6A 1NBOA 4WA7A 4Q9KA 2XI4A 2ZI5A 3BIFA 3Q4GA 4X90A 2XMDA 4YAFA 3WGKA 5C5EA 2CXPA 2VNKA 2W11A 3NHPA 4BQOA 3L49A 5FQOA 1EXMA 3GP8A 2COKA 3RI3A 1SRQA 1CU1A 4K6GA 5IZCA 3W3ZB 2NO7A 2R7KA 3KE8A 3Q7TA 3AG5A 4U9HS 2RD2A 1IY2A 3QVKA 4UDOA 3H87A 4B71A 1K7XB 3IE0A 2VP9A 2ADOA 4FBMA 4E07A 1PFQA 4BV2A 5M04A 2POQX 1Q1NA 2ON6A 1GGKA 2ZSAA 4TZKA 3EVAA 2A3RA 2FFAA 5C35A 1WXGA 2RONA 3WMEA 4FTWA 1GRRA 4BNUA 5B4VA 4B3BA 2ZE7A 1KK3A 2R6R1 3LCVB 2C0PA 4QFMA 3TRHA 4A2WA 3ZCSA 1CR2A 1ZBQA 2MWMA 2R6DA 1SOMA 2Z43A 3QVOA 2Q41A 4MGIR 1ZA1A 1VJCA 4OQZA 1WMFA 3R6GA 4HJRA 2QN1A 2JJ1A 4MJ7A 1OXUA 1E79A 1S8AA 5ALTA 3PS9A 4ZT2A 1KQPA 3AF1A 4E70A 3OJLA 3S2GA 5KKCA 2XX3A 1SQ5A 1CRWG 2UAGA 2CJYA 5FIUA 1GKLA 4TVBA 2L18A 5HCIA 5I9SA 1OJ7A 1NT4A 3GNSA 1BE6A 2G0TA 5A2QA 3UT5A 3H8VA 1BCRA 1BS9A 3AEKB 2NPFA 1AO0A 3WLHA 1U2ZA 2Y05A 2BFBA 4JGIA 5SZKB 4DLZA 4CYMA 1P0IA 5HGJA 3OPXA 2C5EA 2P62A 5KSPA 1PQPA 3LCMA 1MOPA 2NQ2C 3UH1A 2DFNA 1AD2A 2UVPA 1TYBE 1AUOA 1ZH4A 2YWDA 3JPWA 4DLYA 2XMGA 2BR3A 1WXDA 2D5AA 1M6YA 3EDRA 3DMGA 1TEVA 4IHJA 3EPHA 1HUQA 3CXRA 1J0DA 5LMNB 2GAJA 3Q9NA 4R69A 4JL6A 4UM7A 4QGAA 1JEQA 4AP6A 1QB7A 3TWOA 3ADKA 3V80A 3WSWA 1SCUA 2RGGA 3DUFA 2OMKA 3CNEA 4WY8A 2BHSA 3IEVA 2DKOA 1UK7A 3T54A 1J24A 1PL8A 4MPTA 4XWYA 3ROPA 1MJGM 2M6SA 4KGZA 3ZHCA 1RPZA 3WV5A 2JIQA 3AR9A 4OQ4A 3L6BA 1V47A 4RXMA 1U9CA 1K1EA 1R10A 2ZTUA 4JBYA 2JD1A 1BD4A 2QR3A 1QWSA 4TQ9A 4O4HA 3T9EA 3RHTA 5E4YA 3PF9A 3H2IA 4AF7A 1GNQA 1XNGA 1ULTA 2J9RA 1L4UA 3H4TA 2VHTA 3OTWA 4PSVA 1DXHA 1YL5A 2EKLA 2VYCA 1QHIA 3OJFA 5LNK1 3DA8A 4WZBA 3L82B 3AG6A 2XGMA 3N76A 5KAMA 3W4IA 1CZHA 3WLOA 4DWVA 4OCZA 3G1TA 4HVLA 1HTTA 2JD2A 1TO2E 2G40A 5HJ2A 3SF8B 3C6KA 1SVIA 1QHNA 2PQ6A 3FCEA 3T9DA 3PA8A 2CK3D 4D7AA 1U2SA 1TI7A 3BRQA 4FZ3A 3I9KA 3O4IA 4V1CB 2SKDA 3TN7A 3NR2A 2LVBA 2J6BA 3G82C 3SOPA 2JGLA 1XA4A 3BMQB 1EIZA 1VDZA 4WH0A 3RODA 3D0OA 2P30A 5KWVA 1CP3A 1MIOA 2P7IA 2G0NA 2VYND 1DWOA 2FPGB 2X7HA 5BRJA 1RHRA 4KHZA 4PIPA 5AJXA 3EH1A 2PRYA 3CS3A 4QECA 3WFIA 5GZ3A 1T2VA 1XZMA 2HF2A 4ZCTA 2VBGA 1UJBA 3L2OB 3JRXA 1Q0UA 2RKBA 1D6MA 2Y9MB 4FGUA 1D09A 2H4XA 1EX7A 3ANYB 4G97A 4QLAA 3WIEA 4C01A 4ER6A 3DBVO 4HRAA 5ILQA 5FOUA 4F3KA 3UJ3X 4DWJA 5EXCA 4KXYA 5JQWA 3AUSA 5ALPA 3OMXA 4EM6A 1U1IA 1IY8A 1JTFA 3C39A 2DHDA 4HUQB 3SHWA 4CMGA 2YRXA 1V1RA 2HBRA 2ZYIA 1G8YA 3CNBA 5BV1A 2ZR8A 4GX2A 1L7OA 2WIFA 3AH8A 5F5XA 3RYHB 3MGCA 4QBHA 4BP1A 4FT4A 2C96A 3CZMA 2HJRA 1HG0A 2JFZA 1QE0A 3CRQA 4QO7A 1ZVJA 4IGEA 1MQSA 4P3NA 4H3KB 1XTKA 5GGYA 3ZI0A 3I3SR 4GC5A 4R8SA 1SXJA 2B8NA 3SBXA 3D4LA 3KZNA 1ZUIA 3I1JA 4WLVA 3OIVA 1CUIA 2I4OA 4RJLA 2APJA 1V4VA 2RHRA 4HNSA 1K2WA 3UPDA 4Y2GA 4B3DA 2FMHA 3MTAA 2WB4A 5KREA 1GXSA 2P0YA 4BEWA 1IWPB 3IR5A 2FP4B 4JZKA 1V3VA 2BTEA 1NMEA 2Z8XA 4GI3A 1PNVA 1Q3KA 3FDZA 3EXEA 1T2DA 4Z1MA 4F04A 1G9SA 1A9QA 1QYCA 5AJWA 1IXRC 2HK8A 1M6VA 5DE3A 1CUJA 4JBWA 4KPUB 3E4DA 4J0GA 1R0YA 1W19A 4L5CA 4A03A 2A9FA 4C20A 3DXXA 1BXZA 5EUBA 5AW9A 4ETWA 2H5IA 4DQXA 3K5IA 1ETUA 2J4FA 3A4VA 3UZUA 2D8MA 2OHJA 4NJEB 2OSVA 1FE8A 4B47A 5NULA 1M2GA 4DSOA 2WMDA 3S1AB 4WFQA 4FUQA 3O8RA 2XY4A 4G81A 1PT5A 3L8MA 3U39A 4B6GA 2BD0A 1YK0A 4PLTA 4YJ2F 1ANKA 3LWDA 4MROA 1II8B 1IH8A 2FX2A 5AHKA 5L3VA 4N3BA 3O4RA 4IQGA 4FR2A 1SHZA 4EEKA 1UXOA 3CPEA 2VQ3A 1WMEA 4OHYA 3N39C 3DLCA 3N8HA 4N41A 1ZVVA 2ZROA 1GTMA 4H7PA 1G2OA 3KG2A 2ATEA 3ZE8A 2RHDA 3T7DA 4OK6A 5IUKC 1W75A 4M0MA 5AVQA 4FHCA 1W88B 4ZYZA 5CK4A 1J9GA 1TLLA 3AP2A 2F1JA 4KFCA 1NE7A 2O3UA 1LTQA 5IXJA 1IYZA 13PKA 3IELA 3BGDA 4G25A 3HKBA 3PTAA 2HZBA 4FSHA 4GMGA 4YUYA 4RV9A 2AOUA 3VR3A 2B8WA 1B0PA 1YQUA 3GEGA 4PEVA 3B9RA 3VNUA 1E3TA 4BEVA 1DBWA 2AMVA 5JMOA 1B42A 1O97D 2YJNA 3K94A 3FYDA 5EA2A 4C3OB 3EMVA 4LNUA 3GROA 3ITEA 2GYYA 1T9GS 2Q2QA 1QVZA 2QVXX 3ES9A 3F6EX 4H77A 1TL7C 4BO2A 3NBFA 5HIJA 5CBPB 3ID6C 4YASA 2FG6C 5KCMA 3BIOA 3F96A 1N9GB 1MQ9A 3ZY5A 4TL9A 4DM4A 3BERA 2YINC 4QTXA 4Y1RB 2VPQA 2X6TA 1N4DA 1WV0A 1JB9A 3I8OA 4LRYA 5J9FA 3RWMB 3JAKA 5CNIA 4E2WA 6REQA 4RTPA 3E3MA 3HZZA 1T34A 4FFSA 1H3EA 4CLEA 3ER8A 3NUZA 3STUA 3UA4A 4LAFA 3IX7A 2JBAA 1XTBA 2OC4A 4QBTA 4N7BA 4UBLA 3RC7A 2XZOA 4KFSA 1BMDA 3OX4A 3U3RA 4MXDA 1FP6A 4ENTA 2XCUA 4IHAA 2X3UA 2IUSA 2BF7A 4AJ9A 4KL8S 1BJRE 3TZEA 3IQWA 3UCXA 1AB6A 2FVXA 1YS4A 3U13A 1LPAB 3LCCA 3UWDA 1PWHA 2I34A 2I2AA 3PENA 1SUAA 3EEBA 3OIDA 4DWWA 5C32A 3COWA 4UQLA 3GQBA 5HKAA 4X97A 1XNJA 1JHPA 4BV9A 1AURA 1AGPA 2XODA 4Y1EA 3VR2D 5JATA 3THXA 4YGYA 5FP0A 2CBZA 4QULA 4EY3A 5A1TA 1M8PA 3MW8A 4F6LA 3PPVA 4ZOLA 4HCJA 3QXJA 2XRZA 1M7GA 1XZPA 1P7VA 3D3WB 2ZSJA 4C29A 3KX2A 4RVCA 5T6MA 3ENKA 5DISB 5T4EA 1GZUA 1QFXA 3DO8A 4R1QA 3Q8XB 1QRTA 2AK2A 4Q48A 2PX0A 4IFEA 2J7PA 3RAEC 1VJTA 4NV0A 4KITB 5JDCA 1H2HA 4BNGA 1C0LA 1A8SA 4ERXA 5G0WA 4KMMA 3VTZA 2O20A 1PJ2A 1VPLA 1UM8A 5CH3A 4YS6A 1U94A 5KJCA 3ZBTA 1NJ6A 2PYDA 4H7IA 4JI5B 3CJRA 3PD0A 4JQZA 2O2JA 5BOSB 5JH7B 4JP5A 4Q66C 1A27A 4PAGA 3NFRA 2CHVA 3QE4A 3R23A 3E1KA 5DWDA 3ZD6A 2AXPA 3T3HA 7MHTA 1OOEA 4S04A 3G2PA 2X8BA 3LXMA 1T8UA 5T4HA 1UMDB 4KEAA 3V4PB 3A6DA 3BWEA 3MSCA 1UFQA 5IABA 3HK2A 1AS0A 1EFPA 1GLNA 1CFJA 2XDWA 2IHZA 4BQQA 3OZGA 5CGZA 1L7NA 4JB3A 3VU0A 4DC1A 1BMTA 4W7IA 3LT0A 2NOAA 4BRZA 3AVWA 5BNWA 1M74A 4LZOA 2VP4A 3WWCA 1NULA 1MDBA 1FMJA 2AGVA 1FW8A 2HH9A 2AR0A 2Y4OA 4MCIA 2CY0A 3SS9X 2JLVA 3R5JA 4IHQA 2NZVG 1SB9A 4Z8YA 1DAEA 1QHFA 2P4SA 2P40A 3K0CA 4P92A 4Y2SA 1YVEI 4R1OA 3W2HA 4E03A 2IVFA 4N3NA 1V6AA 4L6CA 1NIPA 5DASA 1FMCA 5LQNA 2H2IA 1N6KA 4ZVPA 2BEJA 1US8B 4AJKA 1OPRA 3GLFE 2H2FA 4AVYA 1EGHA 3U2QA 2AFVA 4FFMA 1RQRA 3OMWA 1T3GA 2E4UA 5CAEB 4BFVA 5HZHA 1FJGB 1GZ5A 5KNDD 3RYCB 5BVHA 2OWEA 3LF1A 1L4LA 1MEJA 3JZAA 2LMEA 2R8RA 1JR3E 3KEGA 4NBSA 4IRUB 4WZAE 3GQVA 4D74A 1P5FA 1YQ9A 1Z3IX 2UYHA 4BIMA 1PIWA 3G6WA 5K4HA 1L4YA 3B7PA 3F4BA 3ZUPA 4R84A 4JBHA 1IMOA 4GYWA 1Z5ZA 4HO1X 3B8HA 1V3QE 3DE0X 1DRUA 1QB8A 3K73O 4DRXB 4Y9SA 3ZI4A 1E2UA 3OOJA 2XT6A 1QH0A 1XO1A 1ZHHA 3LFTA 3TX2A 3OJCA 1JIQA 2AL7A 3IQEA 4HB2A 3HKCA 4O4JB 1ISGA 3OQMA 2GNOA 4ISCA 2QK4A 1P5HA 4JCCA 4TKLA 3X1YA 2PK3A 3CVJA 2GVDC 4RE5A 3K0SA 4PG5A 4OXXA 2I3AA 1OXXK 1SUEA 3C16C 1XLUA 4G1VA 3G2IA 4OHKA 1ELOA 1M2EA 2QD1A 4X44A 1L5HA 2QQGA 4XWOA 3UK0A 3OQOA 3SXUA 1Z6QA 3DZFA 1KI1A 4U1RA 5HK8A 3GDOA 1R5JA 1Y8QB 1QNLA 4GBED 3K8ZA 3TBHA 1EB9A 1I6WA 3ELBA 3L41A 3OPVA 4BQFA 3GGPA 3HZHA 2WVJA 3C1TA 3DM9B 3FJYA 3HA2A 1WG8A 4IF6A 6Q21A 4QQKA 3IMCA 4CKWA 1PJCA 1PGPA 2LP4Y 2SNIE 3PIDA 2XMZA 1E7WA 1K4YA 4Q19A 1KMHA 2F3PA 5MN6A 3BB1A 2KQUA 4XGNA 1ZM4A 2Q4OA 3D8SA 4AAYA 1H1LA 2ZAGA 4TM8A 3EGWA 4J0IA 2QVBA 4YRJA 4XASA 3K4HA 3COJA 1NNSA 3WWYA 2HHLA 1H5QA 3R0XA 2DFPA 4RJ2A 3KVYA 1M1YB 2XRMA 4IGFA 5E38A 3ZS8A 2H07A 2CNNA 5MFPA 4DV3B 1W44A 5L95A 5CDSA 3KHUA 2B98A 4OJMX 1YQGA 1JBEA 1QH8B 2IK8A 1K3UB 1T8SA 4DYVA 5DNDA 4Z4EA 2GK6A 2WLTA 3G2MA 4GLJA 2HXYA 2MT9A 4IDPA 1FFSA 1TKCA 1XNHA 4MPJA 4FFPA 4PHFA 3GFBA 3CHYA 1EFDN 2BF4A 1G20B 2YWCA 1QIIA 1OWLA 3PE3A 3ZZ1A 1WD7A 1BCSB 4B81A 3FIJA 2ORIA 4GKJB 4G5SA 3CH4B 1PK9A 3ACDA 1R9JA 3ZIAA 4EHAA 5B57C 2B6NA 3LAWA 4PGGA 3WICA 4DZTA 2G07A 3W8EA 4JB2A 2REOA 2RJNA 4CQMD 3BCSA 3R20A 3C3DA 1E2HA 2HWUA 1PN3A 2ORED 2PGJA 3OFND 1NQ5A 5J1SB 5BRNA 1Q12A 5A4MS 2FWNA 3PU6A 5TF4A 1SZPA 2Q0QA 4DW8A 4Q1DA 5IAAA 4JYAB 3M4NA 3RYFB 3ZQUA 2CFRA 3IT3A 3M6UA 5ILGA 3GPLA 2ZTHA 5DK6A 2XTJA 1D6SA 1Z8FA 2O0KA 5LNK6 1D5CA 1WULS 3T4XA 1E0AA 3NWPA 2DAPA 2MINA 4D4GA 2ONKA 2D5IA 2YV2A 4P3OA 1GRVA 4XIIA 4BP3A 3LZ6A 3MWEA 2PMBA 1Y8RB 3TNYA 4U7FA 4XEUA 4B4VA 5DB4A 2JLZA 3M83A 2DTXA 3JVUA 1T10A 3D3NA 4KQ9A 5LJIA 1RYBA 3F9CA 1EEXB 3KC2A 1E2IA 1VJ0A 1YIDA 4IV5A 3AU8A 4KQCA 4LJYA 3R7WB 1R6XA 4ZVQA 2O3SA 3GK3A 2MSDB 1N9KA 1UBLS 1T8YA 3FUXA 1U9IC 3OTIA 1LX7A 4R2IA 4BWYA 2VK2A 1W85A 4Z86A 1MABB 2NSHA 2YX1A 1UBEA 2IUUA 3SLGA 5L9AA 1DBPA 2M6LA 4EB8A 4F4DA 2VTBA 3VRHA 2XAUA 2Q50A 4DPLA 3TCNA 1ZU4A 2XNKA 3W06A 2CDNA 1H6CA 2UZ0A 1DG3A 4G1BA 3PHHA 1RRFA 3KQLA 2V3WA 3A1TA 4XIFA 1D4AA 4V0RA 3GA5A 2BAGA 2XZDA 3Q2OA 1FNDA 1CIPA 4X20A 5C5CA 2EW8A 3M4XA 3OCXA 1K9SA 1Z7BA 3LC1O 1XTPA 4XYLA 4QQ8A 4V2IA 1JQLB 3CW9A 3BQNB 1QUEA 4YYEA 4CMHA 1YAHA 1PSWA 2JLAA 5HK9A 4JYZA 5IT4A 3ZY6A 1QYRA 1XDZA 4X7PA 5BR4A 3WO0A 3TRIA 2IXFA 3O3NB 4P80A 1PVOA 4E6PA 2GOYA 4KRYA 5T5QA 1E9SA 1FZTA 1T2AA 3HJCA 3GDFA 4C7JA 1JZQA 4DA9A 3KQYA 1DT3A 1P9WA 1Q6ZA 1ZIXA 2LTAA 3H2KA 3OEHA 1SU8A 4HHEA 4LOJA 4NRDA 1RXCA 5DHQA 3K30A 2AX3A 3ET5A 4GXTA 3EPLA 2BMFA 5ER6A 1LC0A 3D6AA 3GLRA 1C80A 4WFJA 4D4HA 4I4CA 5LR6A 2GLXA 4HFRA 1G7SA 5FWDA 3CRNA 4FQ5A 1WX1A 1W4LA 1G17A 1YDHA 3AP3A 1RWKA 3R7BA 5K3SA 5JQGB 5JXGA 1MC5A 2EWMA 4PVDA 2ZZKA 1D8TA 2PZ8A 3U49A 3F6CA 4JUBA 4EG6A 2N75A 4HLCA 3Q11A 2AMFA 1SHTX 3O8BA 2PS9A 3HKEB 3HWRA 4OJQA 2RC6A 4C4PA 1G2PA 1VL2A 4DGSA 1W8IA 1ONNA 2RGNC 2G83A 3B1VA 2GKOA 1E4YA 3HJRA 1PX0A 4QXPA 2F48A 3MCAA 2IHNA 3P96A 2H9YA 3OJOA 1Q74A 1ZM7A 4PHTA 3UPTA 3G0IA 2ZWIA 1ENOA 3G1UA 2YOHA 5A4KA 1YA4A 3NVMB 3ASZA 3H99A 3WRXA 4YAWA 4OG2A 2OV4A 3B78A 3GRRA 3RC1A 4ZI2A 4ZI7A 3QEBZ 4RFLA 4BX0A 2WE8A 2ZOSA 3H1TA 3RGWS 4RSHA 3QRWA 2A3NA 2C5GA 1RYEA 1EXDA 1XPUA 4NF2A 4V24A 2V5UA 2JIBA 2GNAA 2ZREA 2OB2A 3RJ5A 1JYSA 2IWHA 4GSYA 4QFCA 2OPHA 4QPZA 4D3XA 4D9CA 2PXCA 4MVJD 4TROA 1HT2E 2GEKA 5ALDA 5FLXA 3QMWA 3LE8A 2A58A 1U0GA 4TMXA 1AQLA 2HI0A 1U65A 2IGBA 5BMOA 3HM9A 3MWYW 2OESA 1KJNA 1TEHA 1EK1A 3TQTA 1GZ6A 4H1WA 2F1IA 1IN4A 1UMBB 2P91A 1XF1A 1OE0A 1GPDG 3FJOA 1Z08A 3SQOA 4JLWA 4EYOA 2QROA 4PC3A 3KDSE 1U8UA 1CHNA 1KI7A 5IPFA 3BT7A 3NIBA 3HNPA 2ZRJA 1QQ6A 4A7PA 1C30A 3A11A 4JNKA 3R3VA 3W9SA 1NPTO 2JFGA 2Q7DA 2EKPA 2E4XA 1CVIA 2PEZA 4AMBA 1HPLA 3AY0A 4QFDA 3VKUA 1EVJA 1UWLA 4PZAA 2GEBA 3ZQKA 3CZAA 3K5WA 3O8OB 5H80A 3WGIA 1XRPA 1A76A 3G17A 5AVTA 5HF5A 3WR5A 1CF4A 2H2GA 4A0QA 2IF0A 2JGNA 2QN2A 2UUPA 4FD3A 3K31A 1KTIA 2WZDA 2GBLA 1Q2UA 1SZDA 4BNNA 1LNSA 4HWOA 5LUBA 2GTPA 5GADl 1FUIA 2I1WA 2OTCA 3DLTA 1RHMA 1NQOA 4MVWA 4UVGA 4J4BA 1WUKS 5CU7A 1TXGA 2HIHA 1H4QA 1X9GA 4HLUA 1I7PA 2IS4A 3PWZA 3RD5A 2IBTA 1XZBA 4FJ2A 4G56A 4F0JA 2X8WA 2BTQA 2WJGA 4UMFA 4Y6PA 5AI6A 1MFZA 5DW0A 5K6RA 1S01A 2ZWOA 2J7KA 3S7ZA 4DLXA 3NDJA 4F9FA 1CY4A 5M5BA 1QRUA 2WPDD 5EG5A 3QENA 2X6QA 1PKXA 1LPNA 3TQQA 5LVAA 4J03A 5DHSA 3LUPA 3OM9A 3ORHA 3L6CA 2I8CA 3WB9A 2PLRA 3DFZA 5JOQA 5E3IA 3T0GA 2B6HA 1QGDA 3H11A 3JQBC 3GRPA 3PC3A 3MNFA 4JJAA 3ZU6A 1LW6E 3ER6A 1F12A 1DHRA 3W5UA 5GTDA 2EFGA 4OP2A 2CW5A 3ZGXA 4EKIA 1D3AA 5JWRA 1RTKA 1EESA 3GP3A 3PVCA 4KQMA 1G66A 1ULAA 2FZEA 2P4UA 5H9VA 3NFYA 2YZMA 4FMDF 3WLRA 3G5LA 4J91A 2QG9A 4CETA 4KLAA 3UMMA 3TNFA 1BHQ1 1NFFA 2P75A 2PA3A 1JP7A 4YT2A 4H7FA 5BQPA 4LQDA 1PGJA 5IAJA 5BSGA 5H59A 3DEIA 3B3GA 4E12A 4BVLA 4CL0A 5CLGA 2JZCA 3ZQ4A 1JQ3A 5KPDA 3DWEX 3OZBA 3DMRA 3I01M 4RESA 3ZXYA 3N0WA 1DKRA 4CMKA 3K9FC 3WB1A 4ITRC 2B34A 4EI2A 1ISHA 1QRDA 1ZSVA 5C8DA 3MWDB 1EDZA 5IJWA 4Y7CA 3LC0A 1GDDA 3Q1LA 4NZYA 2I6GA 4P4LA 2RHOA 5A05A 3V00A 1N5JA 3DW1X 3RJ9A 1GGHA 2JLXA 3FNRA 3VC7A 1SK9A 3THYB 4PZLA 2X77A 3TX6A 4PG4A 1VRCA 3U3JA 4L08A 2JFVA 2WM8A 2G4CA 3W8RA 3TZLA 1H1DA 1UKBA 1CR6A 4MB6A 1ZICA 5E7MA 3VNVA 3K92A 3E9ZA 1J99A 1UC9A 1MB4A 3ZV5A 3DFIA 2EV9A 3FKJA 4MAAA 3IJEB 1C2YA 2V7WA 1DIHA 2GCPA 2ZRBA 2NAFA 3EIXA 3HY6A 4RHYA 1Y8CA 3EDMA 2P1RA 4JC5A 4WY5A 1PUIA 1U80A 2OK8A 2OGZA 3L7OA 5LWQA 1KH2A 4MYRA 3SFVA 3ZWOA 2XTZA 5D3QA 3A36A 4EYKA 1YI1A 1KSFX 1GR0A 1KETA 2TSYB 3B3AA 3IPLA 3E0QA 2B4RO 3D6UA 2QTMA 2V9CA 4UOQA 5BQ5A 1ZUD1 3A4MA 2X1LA 3OFJA 4G09A 3PITA 4YRAA 2OOSA 2X5KO 5HCUA 4C7VA 1JR6A 1A9ZA 3LOPA 1Z0JA 2NMVA 5KJ1A 4LGCA 4XQGA 5TSDA 1EUDA 4XD2A 5L6MB 4UAGA 5KYWB 1E0JA 4KNVA 1KMCA 4NHEA 4UCXA 1S1MA 3NO4A 4AWAA 1F2TB 5EPUA 2GRUA 3BQ9A 1J33A 1IHYA 2VXOA 4KBFA 4U2DA 3L7LA 4I4TA 5EHXA 4B4WA 1B76A 5KTSA 4EJ2A 3MJSA 4GR9A 4KQGA 2HGZA 4TWAA 1Z5PA 2GCIA 1TYDE 4HDQB 3SI7A 2CVPA 4CUJA 1GARA 4KXMA 2H54A 2J9YB 4DTCA 3CH5A 4LI3X 4XQEA 2LD4A 1T8RA 4M49A 2P6OA 1HDZA 1R5OA 3KT3A 4BGUA 1S4MA 1U0TA 2R5FA 1ZQ9A 4IZ6A 4O29A 3OU6A 3MXOA 1QS0B 2YS7A 1XKLA 4EAQA 5FL7A 3MYRA 4QPNA 4XEHA 1RR6A 4ZYVA 5THXA 1ISIA 1JQEA 1IZYA 2GZMA 3DVAA 1PL7A 2JHAA 4EFKA 3JS5A 3T0IA 4HJXA 3WDKA 2V7PA 4HZGA 1TIKA 1UMCB 5KTTA 1XOIA 4DVGA 4F5YA 2PY6A 2VZ8A 2EZ8A 2D1TA 1E1YA 3KZMA 4PCVA 5JMTA 4B4OA 5T4FA 2VYVA 4EW2A 2FZKA 3VKVA 3RE1A 1KYQA 2UV8A 3JYOA 4EQ6B 2ZSIA 4QOJA 1D4OA 1KVTA 1KP9A 3G0BA 1AK9A 3UKOA 4Z6KA 4C2AA 3T99A 1JE1A 4HFNA 3TE6A 1WHSB 5KEIA 3PRYA 2EZUA 3OETA 3HBNA 1X3LA 4HC4A 1RMYA 3W79A 2EFJA 2LV8A 1FX1A 4G01B 3VKFA 4UNRA 3L0IB 1YAJA 4PYLA 5TPZD 2DBVO 1V11A 1B1CA 3SC6A 2EFCB 3F9RA 3ZI7A 3O4GA 5I3ZA 1ODJA 1PFGA 1W5FA 1G3UA 2WD8A 5JS7A 3WLJA 2HK7A 3PA6A 3AHIA 3HP4A 4M54A 4WUTA 1M5UA 1Y63A 1MNQA 3CA8A 2YQ5A 3TRJA 3SDZA 2XDQA 4WN9B 4AG6A 1HSZA 2GN2A 2WWVD 4NNOA 1PFKA 4L0DA 1NZJA 4UPEA 4N3CA 1YQEA 5I51A 3GDGA 1Z8HA 4UZSA 1MNAA 4ZHQB 2ZXUA 3UY4A 1UXIA 3ACBA 1GUAA 1FRVA 2YYAA 5LKRA 1WDLA 5U4QA 5KB3A 2C1ZA 4TVKA 4P53A 4X24A 5BVGB 2GFHA 4HN9A 2DJ5A 1HL7A 4OMFG 1ZSYA 3OZXA 5IDXA 4GLLA 4G4IA 2GBFA 4X6YA 1UPUA 1Z33A 2J67A 3DNMA 2PFSA 3MYYA 5IH3A 3SMQA 4AZ0A 4LVUA 4EYGA 4MAMA 2ZT7A 4KKVA 3E3AA 4UAJA 1YB2A 4YP0A 5CLFA 2RK4A 1Q92A 3L9XA 3R40A 3RW9A 1EK2A 1P44A 2D2IA 3N2KA 4P3YA 5IX8A 3B85A 3AEUB 3D4PA 3U7QB 5ENDA 3RBVA 4L7QA 1NM5C 4L6IA 5A4FS 3SHOA 5EMJA 4EGFA 5FBHA 1FUUA 2PZLA 3AWIA 1AXEA 4FGSA 4TT8A 2OKGA 1Z18A 1U1CA 2P1ZA 4TTVA 2OZKA 2WSIA 5LOVF 1BDBA 4GIBA 3I2IA 4ND2A 2BJWA 5ECGC 3KYDA 1N2OA 3J81k 1E2DA 5TDHA 1VIMA 4QA9A 2GCOA 4OY3A 4KIFA 1KPHA 2C2MA 1KPGA 3CQ9A 3D02A 4AJ2A 4C2UA 1JXAA 1QIFA 2R7AA 2Z4RA 2HPAA 4C4YA 2EVWX 2ETVA 5EHNA 3RUHA 1T43A 2EFYA 3BICA 4IDCA 4GKVA 3FVRA 1G5IA 1TAQA 2AS0A 3LA8A 3YASA 1THZA 2GERA 2M9MA 2V96A 1P1RA 5DYTA 4DL9A 1DE0A 3C3WA 1YTUA 4AJIA 1WBBA 1I3OA 1V8OA 2G04A 5HIIA 4G67A 4MH0R 3TM4A 3B36A 1BEZA 2R5WA 4YJ3A 2BJVA 4QO8A 4W9MC 2PDAA 3A28A 3DNPA 4QPDA 2P3LA 5T4BA 3I76A 3ZK8A 2O2GA 3F6PA 1BX1A 2OOKA 4GMHA 4NH0A 2O3JA 2DT5A 1EFCA 3W9YA 4ERNA 1TT5A 5B7GA 4N49A 3DMYA 3EQ8A 3EEQA 4AN0A 1D7AA 1NDQA 1E7RA 3O95A 2FRVA 4G86A 1F7VA 3VPXA 2K2WA 1F1JA 4MTLA 4DLLA 2ZE5A 4HNUA 4HDSB 1B8OA 4MVJH 4AP5A 1YS9A 4F86A 4XVUA 3T9BA 1UUFA 1SXIA 4RMIA 1EX9A 1IBRA 1OH5A 2IPXA 2QLBA 4GT1A 2IKQA 8GPBA 5CT6A 3GCZA 4BWGA 4ESEA 1GN8A 2WICA 4MV7A 4S3MA 5C51B 2WLSA 3H9CA 4OHBA 2QB5A 4Q4DA 4EYEA 1LDEA 1LUAA 2XDAA 4Z51A 5HUQA 5E0KB 5LZ2A 1QONA 5EIAA 1JL3A 1F38A 1SBZA 4N12A 3I05A 3CFIA 2ZQ5A 4AECA 1LDMA 2HQRA 4XQ9A 5FI3A 1R0ZA 4CR6A 1E4EA 2EIHA 1TGVA 2GAFA 4EUFA 3AK4A 4BNDB 2B1IA 1R3UA 1UF9A 1P3DA 2DLNA 2ZKLA 3MGBA 4HDRB 4BNZA 5I7WA 3CEHA 2P90A 1EEHA 2HLDA 1QCDA 1C7IA 1R4NB 1WQ4A 4BGIA 1C9YA 3E5NA 3B20A 1GFSA 1QVRA 1QP8A 4PHGA 2JPDA 1DC4A 2CKMA 2VTVA 2WTEA 5F7ZA 1XGKA 1PL6A 2X3YA 4N48A 2B25A 3ZU5A 1ZAKA 3PSAA 4J7CA 4M1TA 4U2BA 5DM0A 4N5DA 3BFXA 3BD9A 1GZHB 3CWQA 3SHVA 2EGUA 1H3NA 3HH8A 5E9JA 5EC8A 4CKCB 4GO1A 4IIYA 4IIBA 4GVXA 4XJVA 2NP6A 3CLTC 4URUR 4DYHA 4KR7A 1YZQA 2PD4A 2QS9A 1FMTA 4TYMA 2CHQA 3AETA 4PS0A 1RQNA 4LV6A 3UAOA 2B5VA 1VJDA 2L2QA 1I7QB 3JVEA 3QUQA 4Z53A 5JSKA 3OTOB 1GPNA 3PGLA 5AKXA 4GYKA 3TZKA 3ETCA 1WDMA 2XITA 1P5ZB 3N7TA 3WB2A 3T4UA 3L5KA 1E2GA 4R0VA 4JB0A 1MVNA 1VYTA 1MJGA 4HSGA 3UWSA 4BDSA 4KN5A 3HUDA 3LU1A 3QH4A 4J0DA 1ZGHA 2IP2A 3ZNPA 2WJJA 5H7XA 1OX5A 2D0OB 1RU3A 1NF8A 4JR1A 4PXSA 1PI3A 4WN3A 5EYPB 3U6KA 3R9XB 1DOAA 3I34X 3PCXA 2DBRA 3GRZA 1Q16A 2GK4A 2YJ4A 3EEIA 3PLNA 3UT6A 4HAVA 4MTCA 4YQFA 5ED4A 3TUZC 5E9QA 2PUWA 1IVYA 3I8XA 3N8NA 2KM1A 1XVIA 3KKNA 2Z98A 1T6YA 4A8PA 3CPHA 4R7ZA 1OKKA 3D0KA 1ZD5A 2R8YA 3QFSA 1S3IA 4HD8A 4NNPA 5CYOA 5LXTB 5MHTA 3IQZA 3A6LA 1OH6A 4B3XA 3D4OA 1YQDA 3JR7A 2Z09A 4BO9A 4RKWA 4G8BA 4NZMA 2WDPA 3SPXA 4AY3A 5MFZA 2BHRA 3FTQA 5J2TF 4MUXA 2BEUA 4RFVA 5KSZA 4BJ1A 4UHEA 4K9MA 3UF0A 4OMUA 3CVYA 2RGXA 3G8CA 3WAKA 3NOVA 1XDUA 2G08A 1JMVA 1I4EB 3GLGE 3DXZA 1MAUA 1V8BA 2EOAA 3ABZA 4JIMA 5DZSA 1GDHA 4AX8A 1QYDA 1V3UA 3EG9A 3KEMA 2H1IA 1XLTC 3AONB 3H1FA 2IIQA 5IRCD 2W00A 2VJOA 1VQ1A 4UFPA 2BFDA 2C94A 3OX3A 2NZUG 2PUDA 3FTPA 1C0EA 3WQQA 3EWAA 4U8GA 4GVLA 4X1YB 1QO0A 1D9XA 1ZCBA 4XX1A 5EIXA 1A5AB 3W7AA 1SHKA 4E1BA 1UZNA 1UPBA 3C5HA 4XCXA 1OREA 3TL2A 2ZZNA 1OI3A 3COVA 1DWUA 5DP2A 4QT4A 3EASA 5AHRA 5IARA 5IZ4A 2IQIA 2O5VA 4MUMA 5BWBA 1NUPA 1NZDA 3DDOA 5T3UA 3UN1A 2DSNA 5E8JA 2VWHA 4ZA2A 1ND5A 4M21A 1PFUA 2I67A 1CVLA 1PG2A 3EVDA 3P9RA 5HTOA 2ZWAA 3PQ2A 3A6EA 1EVZA 3SSAA 3D6FA 3D7LA 3HI6A 4J0EA 3ZV3A 4D42A 1T6NA 1G8MA 2YH2A 3EFHA 1VLHA 1QLHA 4PZYA 3ZKWA 4ENWA 2ILTA 2Q8PA 3H9BA 3AP1A 5EXTA 1L5ZA 3HXKA 1ZYUA 3WLTA 4I1PA 3HL0A 5EIEA 3B82A 3GMSA 4UPDA 1UJMA 4L9AA 3Q85A 3RSFA 3H5RA 1G42A 1OBFO 5A9TA 1M2OA 1IWBB 2IZ6A 4LJ4A 3Q41A 2FZWA 1XMOB 2QMHA 3F90A 5I7RA 3R8XA 1CUYA 4C0QC 2NPOA 4AL4A 1DP4A 2PL3A 3LO8A 4O2BA 3V3KA 1BE1A 2QVYX 4GBJA 5CFLA 4WOKA 3I9V1 4OIFA 4HDMB 4RQBA 5BYBA 4H08A 4IQ0A 4OYRA 4XJSA 1HORA 4UZFA 2GPJA 4CM6A 3L1UA 3L0DA 4FC7A 4H59A 4YI5A 3FBTA 4LE2A 4GI7A 3H9GA 1QAMA 4F8EA 3UENA 1VLQA 2PH7A 3CKKA 2R5NA 3GLFB 1JH8A 2C29D 3IAAA 1GZ4A 2BSAA 2WTAA 1OD6A 2Y6VA 5DTEA 4ZZ3A 5JC8A 4AB1A 2IZOA 2QM8A 2WYHA 1JPUA 2FR1A 5BR7A 3T7RA 3K1JA 4RGBA 3C7DB 4KWEA 1F4PA 2IYOA 2Q0SA 1SC9A 4N3GA 2Y1KA 1MN6A 3R2JA 4ER0A 3AEKA 1DBVO 2PKYX 3PUJA 3M4JA 5F3RA 2NO5A 5KHOC 1MC4A 3O9VA 3DE2X 2Y6UA 2JGDA 4LVNA 1YS1X 3RUDA 3FCSB 3U4QA 4Z4FA 2IYTA 3VNSA 3RT9A 1F2UB 1MKYA 3AJ8A 4PC1A 1Q22A 2O2IA 3LUAA 4OFWA 1L4BA 3MJHA 1G60A 3QY0A 5ALZA 3F1LA 2BEVA 3DE7X 1A96A 1R9GA 4PO3X 2ZJOA 5F4BA 1NJ1A 3GYBA 4BL5A 4R71A 1RXUA 4BRUA 2WD9A 2BR5A 4IICA 2HO5A 5F2EA 4A0RA 5L53A 4I5IA 3OZVA 3T95A 5E6UB 3ETDA 3S2IA 1FRFS 3NETA 1AK1A 2B1RA 3FHCB 1TJYA 4KVAA 4MRVA 3QE9Y 1AQIA 4EY6A 2AQIA 3T52A 1GVNB 1ZRSA 4OJYA 4F4UA 3HRIA 5HFAA 4A2QA 1XJCA 4X8LA 4KX3A 4G4JA 5K09A 5JWHA 1TM4E 3RF6A 5CYGA 2Z5GA 1QU3A 4J6EA 3RRNA 1JAZA 1NW7A 2WUFA 3I5MA 3JARB 4RH1A 4BO6A 4C5AA 4F56A 2G9RA 3UJ6A 1U04A 4M7PA 1E64A 1L1QA 1PEKE 3R6WA 3RRXA 2VZLA 1L7XA 1I3CA 1NU8A 5F33A 5IP5A 4ESHA 3Q3CA 2NYRA 2VPYA 2ZJAA 3CX4A 3N74A 3ND5A 1Y5LA 1QJCA 2LKCA 3RR2A 2JFBA 3VMFA 3D2BA 2DU8A 3K6SA 1DC5A 2CLCX 2REQB 3KS9A 4TWJA 3MQ2A 4KREA 3AY3A 1XG5A 4CGYA 5G1NA 4MR8A 2DHEA 4V38A 1JJIA 2MYTA 2C7PA 1DADA 2VVTA 3A1CA 3B51X 3TCKA 2PH5A 1OIWA 4QHSA 1V39A 3QBVA 2XUDA 4HWGA 1ESMA 4HQKA 5AOCA 3FUTA 4IH9A 3RG8A 1GDTA 4V1CA 4MIYA 4ZIRB 1ILEA 4NKRA 2WFAA 4U3JB 1DXYA 2YHAA 1B74A 2I29A 3EDQA 4JLMA 1YS2X 2Q21A 4TMFA 1OLUA 4YT5A 1LI4A 3UGKA 2ECKA 2WSSA 4PWYA 4ZCSA 4NEHB 2FPGA 2HDWA 3GW8A 5HVNA 2OBLA 3DV9A 3PRKE 2OO5C 2J5BA 3WP1B 4ZPXA 1D2AA 4MMYB 3CVXA 2HO4A 4C4RA 5HW0A 1JFTA 4IDOA 4QGBA 5FTMA 5THQA 3GLHE 5AVXA 1KDTA 1CZNA 2GO1A 2PANA 3AILA 1RM4A 1QG0A 2V97A 1EQ2A 4JU8A 4UD6A 5JI3E 1T1JA 4FWTA 2WUEA 4YALA 5EZQA 3M49A 1XL0A 1J2UA 2JK1A 2QW1A 3KLOA 1FFHA 1P2SA 1PT6A 1YRYE 2CYAA 2G8NA 3EVCA 4G37A 3LX5A 1VFNA 2SCUB 4KJXA 3V4ZA 3UFXB 4C78A 4HUQA 1CNMA 3N8KA 5ELMA 2O5CA 3HFJA 5DBFA 1KC1A 2OGSA 1HYHA 1NBEA 4Q4AB 5K0GA 3EGEA 1G0NA 2WM2A 3B2NA 3JATB 4RANA 4ROTA 2IY8A 2O5RA 3E5MA 1ONOA 1R18A 2WHRA 2DLCX 1ZMRA 3H84A 3KKMA 4MKIA 4A0GA 4DM7A 1WSAA 2JHGA 3EMKA 3HDQA 3FMPB 3NTVA 4L2IB 1KYIA 1C5KA 4MB0A 5D2CA 4ZC1A 3T61A 2GZDA 2OV1A 3BK2A 2FSPA 5FNVA 5IMBA 4TXJA 4RTKA 1E7MA 1UZMA 4HRYA 4ABYA 1NXTA 2R11A 4QREA 3T9AA 1DJPA 1IY1A 4AIIA 2WHPA 4BVJA 5HG0A 1E8MA 2C4MA 2QE6A 1IRXA 3DF7A 3PDCA 3WLAA 4B3HA 4ZZ0A 3FOWA 1C7QA 1T36A 1O7JA 4H6XA 5HIAA 1U7ZA 1PJ8A 3L7YA 1YV9A 2D1SA 2J9FB 4D3DA 4R31A 1DIAA 1VYVA 1LBHA 4PBTA 4EHNA 4EKEA 2A9RA 1Q0LA 2QLMA 4N65A 1P0MA 3L8ZA 4LJ8A 4UHCA 1T3SA 4K03A 5ALRA 3S1SA 1N5KA 4O8ZA 2C98A 4UQPA 2Z4TA 1U0BB 2Q49A 3DZJA 3GUUA 1W36D 2HT1A 1A88A 3L07A 4WINA 4KPFC 1G6KA 3RU3A 3S1AA 3VSDA 3JAMA 5DN6A 4G0VA 5E2BA 1QNFA 4MV3A 3JZIA 3MUNA 4UNSA 5LC1A 4YRZA 2ATCA 2OPBA 3A2KA 3ONVA 3RYIA 2WWIA 4ZJPA 2I6QA 2EBHX 3CKMA 1B43A 1KVQA 1CDDA 2D5BA 2WTXA 3EZLA 1DTSA 1KY2A 3PR2B 5JE8A 5TE9A 4B5KA 3NXKA 1RRMA 4O6VA 3D7SA 1A1VA 4LTNA 4ZCQA 3UMFA 2IUEA 4N5MA 3HPRA 4O2AB 5KYXB 3OC0A 1M2WA 1U3TA 4X91A 2QIPA 4UZEA 4AP9A 2JAHA 4FEGA 1RZRD 1AC5A 2DGDA 1Q1ZA 1PSDA 1EU1A 3LLMA 3T5GA 3ZG6A 5CCBA 1K8XB 3G0CA 3HWSA 4AX4A 1A98A 5DLPA 4BE7B 1Z36A 2HA5A 3GUZA 3LDUA 4G1FA 3EBOA 2PKRA 2JFFA 3KOYA 1TA0A 2W22A 1VCHA 4HWPA 1V7CA 1JH9A 4P35A 4R1TA 2QM7A 3IUMA 5K03A 4KRXA 4QFBA 4UNIA 1NJ8A 1NBIA 3EY9A 4JFAA 4QQNA 2QKYA 5F1YA 2W8BB 2B7CA 3AFHA 1C9DB 5T8KC 3MOSA 4WECA 4Z4CA 5LIRA 1VXOA 2W8ZA 4CN8A 4KFUA 3BVPA 1W6RA 1LSOA 1TM7E 2PM8A 2R96A 2XCLA 2ZAOA 3OCZA 4RHUA 4RELA 5CBPA 4XFJA 2VSOA 1N9GA 2B1GA 3S2FA 1PJRA 4PNHA 3OLQA 3VTKA 1R9MA 2CCGA 5IDQA 3F8WA 5LBIA 3KOXA 3GMIA 4JLBA 4YPFA 5KYUA 1LK0A 1KJYA 2R44A 4LF6B 4EHLA 4FR5A 1ISFA 4QTTB 3F74A 2J33A 5A9SA 6LDHA 5A0TA 2WI8A 4GZMA 1Y82A 2JI9A 4XLZA 3PL5A 2WFZA 4YJFA 3SM3A 1U4OA 2YJ5A 4LCBA 3QXCA 3GWZA 2F64A 3SX0A 2O06A 4B84A 3CNOA 4EIWA 1RXVA 2O8FA 2BCEA 2Q2VA 2FR8C 4RNCA 2R79A 1SVMA 4WKCA 4KVZA 4WGGA 3PVZA 3B3QA 2NGRA 3K9LA 4GWLA 1RHUA 1Y3AA 3L01A 3GZNB 1ADYA 5HS6A 2A7XA 4WESB 1TIPA 3GLSA 1C9NA 1OFGA 4G1UC 2OYCA 5CB8A 2XBMA 3EMBA 5FBRB 4Z0NA 3H18A 2I76A 3DL7A 1UP6A 2CNOA 1EA5A 4WA8A 5KVAA 2GPBA 1UC4B 4N8DA 1T4BA 3EXG1 4GL4A 3D3WA 2JI6A 1L7VC 5DXFA 1AH2A 3TEFA 2CLLB 4ARSA 3MD0A 3BRCA 4RFSB 1ORWA 3CWZA 4MVJE 1CULC 5JNLA 4PYNA 4F8JA 2GSWA 4RA6B 1IU9A 4XWAA 3Q40A 4Q9NA 5KNCA 1JHVA 5K8LA 1AMNA 2HA4A 2JI4A 1GP2A 3W5JA 5B36A 3PXGA 3BBPA 5GM2A 2I9PA 4IX1A 1X1TA 2QAGB 2WM9B 3KJIA 1ZOOA 1P7CA 4BUCA 3G5TA 1UBFA 1JAIA 1IG3A 4OEHA 4JI4B 3FNQA 1OAOA 2QVCA 4MOWA 2O1WA 3EA4A 5FYDA 4IJMA 2P2SA 3UXMA 5BOSA 2ZJ3A 3H9QA 2AFHE 4MVJI 4M53A 1OFVA 4L8VA 2XYPA 5DIFA 3WBBA 5KX5B 4P4TA 1A7AA 3M4ZA 4NYMR 5LA6B 3JAWB 3B48A 1UMDA 1X0VA 2Y1OA 5EXXA 4G5QA 5HGXA 3BEOA 3HVIA 4QIHA 4YMIA 3WG9A 5IC5A 3RSQA 1UEIA 3SZOA 1FVOA 1MGPA 1TAGA 2NT4A 4F5WA 1UQUA 2PQ2A 3GH3A 5I47A 3OIFA 4ALIA 2JGRA 4LDJA 4EW3A 2VDQB 1L7AA 1HK7A 4FEAA 8MHTA 5DNAA 1Z4PX 2QTHA 4RLHA 4PZ0A 2C7VA 2W2QA 5D5HA 4HH1A 4WOCA 2YVKA 2HSDA 2Q1TA 4PZ9A 4LJ7A 2FG5A 2HBZA 5C1OA 2O6HA 1KF0A 1ECJA 3PUKA 1KU0A 2XJ4A 3MRXA 1AOXA 3JSXA 5BSTA 3DZIA 1G3QA 4BKUA 1T0JB 4PYMA 2H85A 5ANRB 4FZVA 2EQAA 1UADA 4AT1A 2JJYA 4LK3A 1US8A 1RE0A 1NBMA 2ZIAA 5F3WB 4IDFA 4B76A 3C8ZA 1Z63A 3IHTA 1FU7A 4DMUB 5AJTA 2Q28A 1WMBA 2W2OA 4U7JA 5GOZA 3U7GA 4GKBA 4OHCA 1W0JD 2VDLB 3MWLA 4MKXA 1XD8A 2B0CA 5DGIA 2L69A 2YHIB 1OSNA 1ZIPA 3C7AA 3Q5EA 4I55F 1ZC4A 1J56A 2XADA 3TTSA 4B87A 5KJ6A 2G88A 5F51A 1C4OA 3EXG2 2X0FA 3TQOA 2L17A 5F12A 4ZYYA 3OQ1A 2AHRA 1H66A 1XMPA 2CSUA 2LKDA 3FLBA 3RLIA 2NT3A 4X9XA 1M6NA 2C0CA 1XKTA 3IIKA 3IVMA 4PHCA 3UYKA 3VV3A 1VA4A 4PG6A 3U40A 4C0XA 3S2EA 2YQ4A 4HLQB 1JA0A 2JFPA 1CX9B 1RI1A 2X7JA 3I9V6 4KPGA 4WERA 4DPMA 1QU2A 3T5DA 4GSKA 1PHRA 4U2FA 1GAWA 1H0KA 2LZ0A 4DG8A 5JZMA 3BK1A 1AS2A 2XVXA 4RADA 4FFBB 3KIPA 4RUKA 1JXOA 2JFWA 4A1FA 3E9YA 1Y8QA 2P9JA 1FJ2A 1PHPA 4JWKA 3ABRB 1CNEA 1RAHA 5ILOA 4IIUA 4O2BF 3DULA 3G5UA 1T4MA 5H3LA 4D6PA 1N2XA 5ICCA 4GDFA 1QH1B 3NWJA 3WGLA 3C6BA 4RTJA 1K8ZB 1CRZA 1XAIA 2BIFA 3GLQA 2ZJ7A 3OZIA 3P2OA 3PIIA 4ICIA 3FI9A 4YDSA 1PGNA 2X9QA 5D85A 3U44B 1N6LA 3AYZB 3GXOA 5JD5A 5DXAA 4FHGA 1TKAA 2FQQA 4AKSA 2Y27A 1MR3F 5LKAA 2Q3BA 3ZHTA 3RB8A 2WWWA 2VF8A 3HCRA 1YQQA 2ZPTX 1OFUX 4QELA 4ZC8A 3N53A 4WKGA 3V8EA 4QRIA 3VSCA 4RIFA 3A6PC 2GCGA 2SICE 1KNQA 1EP1B 1MB9A 1MZVA 1U2DA 4OB8A 1M1YA 4KNWA 3UMSA 4D41A 5CA1B 4IUYA 2W6OA 1QK3A 4HKTA 4M89A 4EY7A 3O26A 1QH8A 1HFJA 2TMDA 1N5LA 4I9GA 4DDUA 2Y99A 4OQEA 5AUNB 2BGUA 4MI9A 4C7KA 4E4RA 3R7NA 4DBLC 5D5QA 2FW9A 5IMSA 4QOIA 5IVHA 2ZQYA 2ORVA 3DTTA 1H4TA 1KJWA 1KEEB 2YXNA 4D4KA 5JIBA 1G20A 1T8PA 2O2DA 3NMUF 3BYZA 1V9LA 1V3TA 4XM1A 3TW4A 4GMXA 3ZOKA 2QBYB 2WU3A 5EMNA 2FDRA 4OJNA 3EC7A 3RVRA 1Q11A 4HPJB 3LLCA 4CKBB 4RY9A 4Y6RA 1GQYA 2QHXA 1WKCA 4KX5A 1XAGA 4UBIA 5IN5A 1VZ3A 2VAMA 3IEIA 2WRZA 1YF3A 2BUCA 2FP3A 1FJHA 1U8AA 1Z4JA 3A1FA 4FWIB 1XEAA 2HCRA 4TTSA 3S2UA 4ZQHA 1GRNA 4OHFA 3CT4A 3X1ZA 2XMCA 4PZCA 5E1BA 2RJOA 3V2HA 4MGHA 2P0AA 3RYFA 5K8JB 1NZFA 5KQRA 1N5RA 4TX1A 3VZBA 3N2LA 4B73A 4GRIA 3S81A 5G53C 2P9BA 5M7EA 1L5QA 2XMSA 4OKIA 2BZSA 2V6MA 2Z58A 4TTRA 1ZW1A 4P33A 1NLZA 1HI9A 2BMJA 4XR9A 3F6SA 4AZ3B 1EHCA 4YR7A 4RYLA 4PLHA 3RIXA 3WIVA 1QE5A 1DFGA 2QN7A 3UHOA 3GFFA 5BSVA 1TF5A 2O52A 1VMKA 3DOJA 2DWOA 3WGOA 5JCZA 3NONA 5IVIA 1T5DX 2R48A 3DO6A 5BSHA 4BO5A 2A88A 3HBMA 4NFYA 4YN3A 4LF8B 1ZJ6A 1Z2CA 2CE2X 5E2IA 5BW8A 1XDDA 3ANLA 5AIBA 1MABA 4R1LA 5ESDA 5C81A 5C5IA 1VMIA 2PVSA 4M8SA 2PZGA 1AZTA 4NWIA 5FUYA 1RZ3A 1IXKA 2VEDA 2ZVQX 4HAXA 3ZWYA 4KGXA 2FFHA 2ZDQA 1VG9B 1CIVA 3I01A 3LSYA 1RKVA 3EJ6A 4UFOA 5SY6A 2W6JA 4OHVA 4G5HA 2V7GA 1KSJA 3G5AA 3TFQA 3IDSA 1TZJA 4QTUB 1P9OA 4R1SA 1ZH2A 3NGMA 4B4KA 1V5IA 1SVNA 2QQFA 1WXQA 3PP8A 4H9GA 4O59O 3ZY2A 2Z9DA 2BBWA 4G85A 2ZRCA 5I5GA 1L7MA 4IIDA 4U6SA 3R0JA 4B09A 2JLWA 4W63A 3NJRA 1PNOA 3ZOZA 3HJNA 5ADWA 7ABPA 2C4VA 4BO7A 3IDQA 3PFFA 1F0PA 4XLLA 2WYWA 2O1SA 3KSRA 4IIHA 5CX1A 3EOZA 4J1TA 4DCMA 5IS2A 2K87A 3EBLA 3TMAA 3HE3A 3TR6A 2J32A 3CLTD 1YMUA 3EGXA 3OOYA 4JA0A 4EMUA 2AV6A 1WO8A 4Z9FA 5AW3A 1OI2A 1P3Y1 3WAJA 3W5HA 4E2YA 2JHCA 1PR4A 3FHOA 1I51A 3D2AA 5LDDC 3H97A 3PEVA 3KUXA 2G2SA 1IZ7A 1TA9A 3GVHA 1BXKA 3P9QA 2XB8A 5JZSA 1WY7A 1RADA 4L0QA 1Z5VA 1SKQA 1O94A 3OCYA 5A5FA 5JXWA 4TT3D 2V0GA 1QORA 5L7TA 4N7JA 2O8EA 3LZDA 4BC0A 1X86B 3L9WA 4KODA 4Y9RA 4YRDA 1OGIA 2BZ0A 2GEUA 5FNVF 3TKAA 4LXIA 3ZDFA 2LGJA 5JCJD 4D8VA 1EDBA 4W5TA 2OCXA 4RXTA 5K6AC 3B60A 2VHUA 1NIJA 2H2WA 3GB9A 1XT6A 3T0FA 4PXYA 2OCIA 2HPHA 1OUMA 2WJ4A 1Y81A 2ZSDA 3RANA 4DJFC 4UOZA 3VR5D 4HDNA 3AR5A 1DO0A 2Q9UA 2PCJA 4HATA 1YD7A 3FVWA 5U4XA 2ZRDA 5A4JA 2WF7A 2Q3FA 4XRGA 5FBKA 1Y4DE 4DUPA 2A52A 3IILA 4E46A 3CF4A 4K8RB 5I7UA 1T2UA 1KZYC 9LDBA 5SICE 5CEJA 2P41A 3EAGA 4QBIA 4XOIA 4O5AA 1W4BA 3P2JA 3ODGA 2HXGA 1XXHB 4UBMA 1E63A 1P9NA 1QXSA 4FU0A 3ZR4B 3AUAA 2FH5B 4ENVA 1MA0A 1UKZA 4HDKB 1MU0A 4UJ5A 5L6LB 2IPLA 4G41A 2DUNA 2CVZA 1L5WA 3AUFA 4NQZA 1ZHOA 1U1EA 2A5GA 2ZUTA 2BI7A 2ANCA 3BKWA 1Z16A 5TX7A 3P5SA 3COSA 3WMWA 3W5DA 4H1HA 2PJRA 3WRWA 1S89A 5DX0A 4U2KA 2A1UB 4IEIA 3WS7A 4ZCIA 5I7FA 4AY6A 2B21A 5EQTA 1HDGO 3WK9A 3KSDO 4YAIA 4EH1A 2VWGA 1YU9A 4QOGA 1NKTA 4YDHB 1C7EA 1VPVA 1YR8A 2G7ZA 4MWZA 4RVGA 4TMZA 4WFIA 4FINA 4WZ6A 4ALKA 2QR5A 1N8TA 5JAZA 3O8OA 2Q6VA 1N2JA 3RBXA 2P9CA 1I2DA 2G9NA 5M34A 2H0AA 3N8DA 3VUFA 3IV9A 2HA0A 1E20A 2B0JA 4TLDA 1WTCA 4MV8A 1PRYA 2PYZA 4ENUA 1EP2B 3DO5A 4BASA 1GQFA 3ESYA 4I66A 3VNBA 1XKQA 2A9QA 2V5VA 5CB4B 3R44A 4HN2A 1BQEA 1YHZA 3QJGA 2GN8A 4IBOA 1XRSB 4DDMA 2C8KA 4ND6A 3ICOA 5BWLA 2PUTA 5HBRA 2B69A 2G9QA 3K0CC 3T1QA 4GOOD 1FSPA 3FWKA 1VB5A 3E9QA 3ILVA 4PRLA 2QYTA 3VC2A 1U98A 1C41A 4WOBA 1QPGA 1V5GA 1EBFA 2CJPA 2ZYDA 2CDRA 3BZUA 3I4LA 4HL6A 3TOZA 3TXYA 3VPDA 4JL5A 3JASA 3FPFA 1RMTA 4BLOA 5EIWA 3TRFA 4FMCB 1VIYA 4RZQA 5DWVA 4QUKA 1T91A 5EWJB 4DV7B 5G2FA 3FTDA 4BJHB 1VOTA 3EAQA 3U4HA 4DV1B 1L4HA 3GLIA 5K9ZA 3PHJA 3PXUA 4W8HA 4B44A 3VPSA 2YJ6A 5H02A 4PPYA 3HBLA 1FFDA 5E6RB 2Z56A 3ZE1B 3NOOA 1J8VA 2YMMA 1KZ1A 4QXAA 1FA9A 2Q1SA 1KMNA 4RENA 4J2TA 2DSTA 1ODKA 2VNIA 3NBMA 3K72B 3ZD8A 1R6TA 5I9MA 1PVVA 4OL9A 4RA9B 2V6BA 4TTIA 2F8TA 2X15A 1V35A 2HKIA 2CZGA 4K6FA 4Z0HO 5FFNA 1M34A 2PWAA 2SKCA 2X1VA 4ZWNA 5CDYA 3SWWA 5JD3A 3QF7A 1ZOLA 2ZBDA 3FYCA 5A04A 2VZ0A 1TQ4A 2PH3A 2X41A 4B31A 2D62A 5EIFA 3FTFA 1A9XB 2DH5A 1JW9B 3CU5A 3G9ZA 4KYIB 1BHJA 2W4IA 3MWDA 3L02A 1NVBA 3C6QA 4G1CA 5CLHA 3GJYA 2WC1A 3PGVA 4RJTA 4BMCA 3VNQA 1E2JA 3TGWA 1YDWA 1IWOA 2OCGA 3L1JA 1FUKA 3CVOA 3ND8A 1GKUB 4EPTA 1SBYA 5TGZA 3UMGA 1NQUA 2ZI3A 4Q7KA 4KUGA 5HQTA 3ZK9A 1MT0A 3FPCA 1RPAA 1ISRA 3LYAA 3MS7A 3CUYA 4XWWA 3FOFC 1CFZA 3CCBA 3HEBA 4NY1A 3SLRA 4EJSB 4W1PA 4K9LA 5IJXA 1W1UA 2W43A 3L06A 3THOA 4P7FA 4YUZA 1TVEA 4WBXC 1R6VA 5CVDA 5M3BA 3HVRA 1Z7EA 3UMCA 2N9UA 3HNOA 3WTCA 5IKPA 3I73A 2AG8A 2DTDA 3GVXA 3U61B 3ZWWA 1NXXA 3P8ZA 1O6ZA 4YB8A 3L93A 1AVTA 4JMPA 4II3A 4MUKA 1ORTA 2AE2A 2ZCVA 4LV8B 4R2XA 5TT1A 5ICMA 4JXZA 3PD7A 2PMCA 2G71A 5KSWB 1YFJA 4QUDA 3VO2A 2J3EA 1P1KA 4G4GA 4MQEA 1RRGA 2AA3A 5JISA 2HCFA 2C9CA 1O95C 1VL8A 4XTCS 3O8CA 1JX6A 2B92A 4UUAA 4Q7QA 3QBTA 4TLLB 1F2TA 1SIUA 3CYFA 1NOKA 3LKDA 4BNLA 1CY2A 1E0SA 2YJZA 4XYMA 4B79A 3S2YA 3EISA 4ZVSA 2VCYA 3OIYA 1Z17A 2NU7B 2AN1A 3GJQA 1XHEA 1JFFA 2GK3A 4R54A 4S1TA 1LW7A 2XKBA 5CG2A 2EU8A 4FHZA 4GD3Q 4Z4GA 4PAMA 4ND3A 3NEYA 4HB3A 2PSHA 1Z8NA 3UG7A 1WBDA 4U02A 3IXQA 3R6LA 4QYXA 3NASA 3ICWA 3O4JA 2F3SA 1A8IA 3NT4A 1QS0A 3ZJ4A 4P4NA 3RFXA 2OHOA 3UC5A 2J9ZB 3DDZX 4Y98A 4K9RA 4W8GA 1ZX1A 3RVBA 2GZ3A 1ZJWA 4AYXA 1P33A 3NI2A 3D43A 3VMMA 4ZD6A 2GZ2A 3LFUA 2GRAA 3W4KA 2I7TA 1UMCA 3RYTC 2AQ8A 3H2BA 2AW5A 2YZ7A 4QGSA 2OLEA 521PA 3V4FA 1XBTA 4OQNA 1K08A 4FLMA 4TKUA 3A3KA 2UZAA 1Q21A 3UXYA 3IB3A 3VTAA 2I33A 2COUA 2O48X 3ESDA 3P94A 4UNNA 2WKSA 4KXWA 3CN9A 3KBOA 3NBAA 4FJ0A 5D8DA 5JJBA 4LJ5A 5IBRA 1MFPA 1WHSA 3C87A 2AJDA 5EP1A 1E3WB 5DM70 1SR8A 2W6QA 5J47A 2NAPA 2BEKA 1G5TA 2YQZA 3F7NA 1EUCB 2WV9A 3F7OA 3KAQA 3Q0EA 4KZKA 4N0EA 1UK8A 2D5CA 4DG9A 5BSEA 3DAFA 4DV0B 1KHTA 2C2KA 2DUMA 1A2OA 3CBQA 3O4FA 2P9TA 4X6UA 5EKXA 3DBIA 3RNOA 3TVTA 4RS3A 4Z4IA 4GX0A 3EVEA 1CQZA 2YIVX 4AXBA 3IE1A 1KVRA 4D97A 4DNXA 2AZMA 2OHHA 4EY4A 1HEUA 1IDOA 3K96A 4KGDA 3FNEA 4DCCA 3U1TA 3IVXA 3H83A 3HGQA 3I9FA 4WN9A 3O7MA 4JC4A 2G4VA 1TM5E 1YKGA 1ULHA 1T9AA 3I8SA 1BEEA 3NHWA 1SGWA 3KOOA 4WK6A 2XB2A 3PJDA 2NU8A 1Y98A 5BVGA 4M60A 1OTXA 4F2GA 1P1FA 1MIHA 3LCUA 4I6EA 1FSFA 4W9RA 5AUQA 3TZ6A 4JK3A 5DVZA 2WT9A 1B3BA 3C14C 1NONA 1H65A 2QTGA 1PS9A 2NZYA 4DR5B 1TPYA 3L8YA 2GD2A 5IVPA 3AQIA 2QT0A 1NR1A 3M9LA 3PUIA 3VJMA 1U2EA 1YK1A 2J3KA 4FUTA 5U1PA 4CMEC 4U9IS 5LYYA 1CUSA 3KHTA 4YMVA 1ECCA 2CLFB 3H6HA 1AO3A 3UV3A 1OBHA 1G9XA 1N2GA 3ZJTA 5KTPA 2HQ1A 2QI9F 4KYUA 3QBDA 3TB6A 1J90A 1SUPA 3COYA 2DPXA 3W8NA 2BFMA 2IHJA 3PI6A 4C87A 4DA0A 1U8YA 3RS2A 1YMVA 2UZ4A 5G0SA 3BRWD 4A10A 2FMXA 2B82A 2AOVA 4Z2AA 4RPHA 3WRXC 1OJLA 5K8IA 2IY7A 2X8JA 3CRRA 2H1SA 2Y3IA 2ZS8A 4YXWD 1GPJA 1Y1LA 1P6UA 3UW1A 1CRQA 1ETHA 1H5UA 1B16A 1U1DA 3CFHL 1NVTA 2FSIA 3AJDA 3FYUB 3GY0A 1C3VA 1ZA2A 2WPNA 2AOWA 2X19A 2C58A 3FSRA 3GD5A 1RQ7A 2PU5A 3QXGA 1H9AA 1SU6A 4NCNA 1QQTA 4WCDA 5DP1A 2GEJA 2QZ9A 3IKJA 1LVHA 1EXVA 1QQ7A 3OM8A 4OI1A 2ZBGA 3U9LA 3ZWPA 3NG1A 5DBGA 4BAGA 3DDUA 3T1OA 2ZJZA 4UCQA 3MA0A 4H4EA 3BXZA 3F73A 1Z75A 1ZAYA 1E6CA 1MRZA 2A9VA 5EWLA 5COQA 3VPBA 5C1DA 2QRPA 3FAKA 3CT6A 1WUTA 1S9DA 3W9UA 3GRYA 2OE2A 4JFRA 3VI4B 3S5UA 2I22A 4IDNA 3VR5H 3AX6A 4NYIR 1HFEL 1N8KA 4AN1A 2J08A 3ICQB 4MV0A 2HK6A 3ZEIA 5JAOA 4AYTA 4R2JA 5ALWA 1X0XA 1PL0A 1TO1E 4KAFA 3WV4A 3LV8A 2HMYB 5GONA 4LXTA 2AFRA 1NHWA 2FKNA 3CG0A 4HDSA 4KLCA 3GFVA 2AF4C 3UJBA 5K2OA 2JHPA 1O8BA 1EVQA 3EK2A 3FKSD 5CITA 2LDBA 1DC6A 3GVPA 5E7JA 3BWDD 1EAYA 2Y1EA 3FDJA