3COYA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 2.05 ang resolution- in complex with sulphonamide inhibitor 3
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
288
structure length
280
Chain Sequence
b'IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMNGSGRLLVAARLGTTRLLDNIAIEIGTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Inhibition of Mycobacterium tuberculosis pantothenate synthetase by analogues of the reaction intermediate.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 93
structure length 280
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2008-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3coyA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3coyA01
3MMXA 2CUZA 3IMEA 2PZBA 3LE8A 1NYLA 3MUEA 4PBSA 4QBTA 3N2YA 3AIIA 2PZAA 1YI8A 1EUYA 1X8XA 1YIDA 3COZA 2CYCA 3IODA 1IQRA 3UC5A 3TS1A 4DDMA 4MWEA 3NBAA 3SZ3A 4OJMX 3A2KA 4MUGA 1TQ8A 1M8FA 1OWNA 1GN8A 1RQGA 2PFSA 3CLSC 3OTWA 1U0BB 1N2EA 4I6JA 2JA2A 2CV0A 1PG0A 1N75A 1T9GS 1KH3A 2E21A 3ZJUA 4RUKA 4EGAA 5DK4A 1HYBA 2PG3A 2A88A 2DLCX 3DPIA 3U1VA 3RJZA 4WSOA 3FY4A 3P52A 3H97A 3FOCA 4R0NA 4ND7A 3FDXA 1J1ZA 3CLRD 3SYTA 2DERA 2H2AA 2GM3A 3NBKA 3COVA 1LI7A 4MUJA 3ND7A 3H9BA 2JAXA 4KPUA 4R2MA 1KH2A 2BTEA 1TYCA 2CYBA 4DNXA 4XFJA 1U3DA 4GU5A 1JZQA 1XNGA 3G59A 1NSYA 3P0JA 2J09A 4MLPA 1PFWA 4NDAA 2QTNA 4ZT3A 2O8VA 1NP7A 3SEQA 2RE8A 1EJ2A 4MUNA 1TYBE 3N9IA 3SDBA 3CLUD 4NX2A 3MLAA 2X3FA 5J5AA 4ZCRA 2CT8A 1H3FA 2DPLA 1R6TA 2VXOA 4JXXA 4JZYA 1PFUA 1EUQA 4MW6A 3I05A 2V0CA 2E89A 3ZXIA 2XRYA 1N2OA 2IELA 1J21A 1WXFA 4U7JA 4EG3A 1QQTA 2IP1A 1J1UA 2A7XA 5FO0A 4I6EA 1KP2A 5H16A 1M8KA 1N2HA 1COZA 2Z08A 2AG6A 2A86A 1JHDA 4HJRA 4MW1A 1N2JA 4NAHA 4DE5A 3H9CA 3ZIUA 1T9GR 4ZCSA 3H05A 2A1UA 3L92A 3UOWA 1H3NA 1WOYA 4MVXA 2RD2A 4RPIA 3GUZA 1F9AA 3P0IA 1WY5A 3CLTD 5K0TA 4X0EA 5J59A 4CQNA 1U7DA 4MWBA 1TEZA 4MVCA 4XSVA 4UZEA 1WQ4A 3VGJA 3RHSA 1KQPA 3A4IA 3L93A 1JIIA 3NV7A 1G8GA 2B7LA 3HFJA 2O5RA 1OWMA 2PXHA 4YP7A 3H99A 2A1UB 5J58A 5EKDA 1EFPB 1I2DA 2NSYA 1KAMA 1Q19A 4MW9A 4MUHA 1K92A 4BWVA 3G5AA 3KT6A 1ULHA 1KP3A 3TNJA 1PFVA 1G59A 4U8HA 1O94C 3ND6A 3IMCA 2XRZA 1WXIA 4EF6A 2A4MA 5TEWA 1O5TA 3IOCA 1Q77A 4S1OA 3IMGA 2HGZA 4Q16A 2AZXA 4G5FA 1WZ2A 1QRTA 3CLSD 4ARIA 1WXGA 1SURA 2HZ7A 1MB9A 1BS2A 3PNYA 3FHJA 3RK0A 1QU3A 4JYZA 1LW7A 1GTSA 1R6XA 1N2GA 4EG4A 3DO8A 4ARCA 1EXDA 3M5WA 1Q11A 5FNZA 1O6BA 1MOPA 3UY4A 2GKSA 4EG6A 4G5YA 4MUKA 2X1LA 5TGTA 3P0HA 4DDHA 5FO1A 4ND6A 5TS2A 4L2IA 4ZT7A 1MRZA 1B6TA 2YXNA 3DV2A 4DJAA 1FFYA 1S4MA 4MW0A 5IHXA 3DLAA 2VTBA 1EE1A 1VBMA 3Q12A 1G8HA 2QTRA 3FNRA 2QTMA 2IJGX 3CVWA 3OP1A 1MAWA 1O97C 1O95D 1OD6A 1M83A 1XNHA 1DNPA 1U7XA 1F4LA 1YUNA 1QNFA 1XNJA 2R5WA 3LCJA 1NUSA 3LOQA 3AL0C 4KR9A 3INNA 3AG5A 3MLBA 2C5SA 2CV2A 1I6KA 3FWKA 4EG5A 1T6ZA 5DB4A 2WQ6A 1I6MA 3GLVA 4L2IB 1GLNA 3IUEA 3D6UA 1QTQA 1VBKA 1J09A 5K0SA 3RBAA 2VTBB 1MAUA 3AFHA 1LI5A 1X6VA 1NUQA 2G36A 1MB2A 3ZUGA 2NZ2A 3FG9A 4MW7A 3KT3A 1T6YA 1N78A 4MQ6A 1KQNA 4ZCTA 3HV0A 3Q10A 4J75A 4QREA 3ZJTA 3HZRA 3ZJVA 5KCMA 1ZJWA 5H7XA 4YP5A 4DDKA 4K0RA 1J20A 3UK2A 2J08A 1WKBA 4CT0A 2GOYA 4QRDA 2ZUFA 2QJOA 4HJXA 1OWLA 2EJCA 5HG0A 1JILA 2DEUA 1EFPA 2E0IA 4PBRA 3ZXSA 2QUJA 5DEOA 1QU2A 1GPMA 3CVUA 2OV4A 1N1DA 3COWA 3KT8A 2DXIA 4HK4A 3CVXA 1OBCA 1D2RA 2D13A 1QRSA 3K9WA 4Q93A 1N3LA 1WQ3A 1ZUNA 1JEEA 4H3SA 3HMQA 1EFVB 1H1TA 3QTBA 4ZT4A 2QUKA 2PIDA 4MVWA 4K03A 2DUMA 3K32A 1YUMA 3E27A 3TZLA 1IVSA 1KH1A 4AS1A 1JGTA 1MC1A 4PY2A 3SZGA 4KR6A 4ZT6A 3UMVA 3PNBA 1N77A 2EL7A 2X0KA 2ZUEA 1OWOA 3VU8A 3A05A 1NUPA 1O94D 1OWPA 3PXUA 5TEVA 3VRHA 4EG7A 1M8PA 3N8HA 4F4HA 5F23A 1K97A 3SP1A 1ILEA 3HGMA 1IRXA 4EFKA 1VBNA 1WJGA 3IUBA 2HMAA 3FIUA 2QUIA 2WB2A 1YULA 1WXHA 1U3CA 1T6XA 4WNYA 5KHAA 4J76A 1R6UA 1NI5A 2YWBA 1KR2A 3SEZA 4G6ZA 1OBHA 4DLPA 4MULA 1MJHA 4GRIA 4HPWA 2WQ7A 1UFVA 1N2BA 1NURA 2J4DA 3D6VA 3GMIA 4E1AA 1QJCA 1V8FA 3X1MA 3FH0A 1JIKA 3HL4A 4JFAA 4MAFA 1JEDA 1P7PA 1F7UA 5KWVA 4XFDA 1TYDE 4MW4A 2H29A 2A1TS 4A91A 1O0CA 3PRHA 1O97D 3KFLA 4MUIA 1FYDA 4I6GA 4MW5A 4U63A 1M8JA 1IH8A 1V47A 2WSIA 1NUUA 1A8HA 3A04A 3G6KA 5AHWA 1PFYA 4MWCA 4EG8A 1IFXA 5IJXA 1TFUA 1M1ZA 2TS1A 4PBTA 3TQIA 1KQOA 1GZUA 2V0GA 1K4KA 1YIAA 2QJTA 3IVCA 4NAUA 5LM3A 1GTRA 4ZCPA 1I6LA 1KAQA 3Q4GA 2DETA 1IQ0A 2CFOA 1VL2A 2E18A 3CLRC 2QUHA 1IHOA 4CDMA 3AG6A 1TYAE 1PG2A 4MWDA 3BL5A 4NZPA 3COYA 4MUEA 1Y42X 1O96A 2J5BA 3ILVA 3IH5A 3TQOA 1O95C 3ND5A 3ELBA 3JXEA 4F3RA 3N05A 4CDNA 5BNZA 4NATA 3QTTA 5LLTA 3C8ZA 4ZCQA 1G8FA 3ZGZA 3ISJA 5HUHA 2CV1A 1EFVA 3KT0A 1Q15A 3X1KA 3IOEA 1F7VA 1VLHA 3CLUC 3FETA 3X1JA 3CVVA 2BYTA 1NZJA 3RK1A 2J07A 1M8GA 2I1LA 2QJFA 3F3MA 2D5BA 2Z09A 1NUTA 3AKZA 3IOBA 4YP6A 1JECA 4KPUB 1N2IA 1KORA 4JXZA 3MXTA 1O96B 2CYAA 1H3EA 3TZEA 2YY5A 3CR8A 2PZ8A 3CA8A 5JBNA 2A1TR 4ZT5A 1XJQA 4P2BA 4KKVA 3IVGA 4R2LA 3PNVA 5LFAA 1JZSA 3FI0A 4YBRA 1QRUA 4OUDA 2YWCA 4KR7A 3S3TA 4MUFA 2X1MA 1GAXA 3CVYA 2JANA 4TS1A 1MBZA 2D54A 1ZH0A 1KKUA 5HUJA 4MW2A 4ZT2A 2DR2A 4YMIA 1J70A 1O0BA 4MVYA 3IVXA 2CSXA 2A84A 1IQUA 2Z3VA 2ZP1A 3CLTC 1JMVA 4EG1A 1K4MA 3RFFA 1JIJA 5DASA 4AQ7A 3QE4A 3IDFA 1ZH6A 4OUDB 2AKEA 2OQ2A 1CT9A 1WXEA 4FZJA 4UZFA
chains in the Genus database with same CATH superfamily
3P2IA 1UFQA 3QTLA 4OF4A 1WEHA 2G2SA 1YI0A 2PZBA 5HMLA 2JJ8A 3HZZA 4TRJA 1P4SA 3ROQA 4L02A 3L6EA 1KDRA 1DARA 1XRJA 5G41A 1QR6A 2AXNA 1Y8QA 3FGOA 4B3IA 1A2KC 1C2TA 1X8XA 2XYRA 5DLDA 4HFJA 3PXEA 1LA2A 4JU9A 4KZKA 4BEJA 4DG8A 3EVGA 5EQDA 4C4YA 1HNNA 3HA2A 3JZMA 2JLUA 3X2EA 1SXHA 2DECA 1CUSA 2WC1A 5JO9A 1X7GA 1SKQA 2CLCX 2ZFUA 3HBMA 3MPOA 1R0WA 4TMXA 3EFOA 1NBOA 4L76A 5IAGA 3KETA 4ZK6A 3CPJB 4CBVA 2PFSA 1CZHA 2VKQA 4QLOA 3NAZA 3GL9A 4Q3EA 3T9AA 2NUTA 3TKLA 4M0FA 2OCIA 3KX2A 5JEEA 5GVRA 1OFUA 4R31A 3V8BA 2C5GA 3ZDQA 4TKUA 2I7DA 5FLXA 1D2AA 2FFJA 4EGAA 1V25A 3N6RA 1QAMA 1YZHA 2YC4C 1OX5A 2CZCA 4HB0A 5TV2A 4CL8A 1NXOA 1AV6A 2I2BA 2OAEA 4MRSA 3QE0A 1CRLA 2J67A 3OPYI 4GP7A 4F2DA 5B7PA 2BM1A 3F5FA 1R15A 1FDWA 3FDXA 2JGDB 4QNRA 4AO8A 4D9MA 1N2SA 3DEAA 3PKJA 4LX8A 4U7TB 3PFCA 1W94A 3F6BX 3COSA 4F4CA 2H2AA 2Y3IA 2QLMA 5CBPB 1YE3A 4O08A 4EATA 2CKDA 5KWIA 1XZDA 5BORA 3SBEA 1DT5A 1PK8A 1Q5PA 4OK6A 4TLMB 4P08A 4AJ9A 5E7IA 2BTQB 4Z7JA 1RYEA 1Z6ZA 3PIRA 5ICEA 2IS6A 2JAHA 2TSYB 3PICA 3G59A 2BM0A 3ZWYA 3A58B 3CFFL 3NKLA 1QIEA 1DAMA 4H3HB 4J0FA 4RK6A 1UZNA 3B53X 1BD3A 1UKAA 3BYZA 1JJ7A 5JLJA 5LUAA 2AN1A 4G9GA 5CR9A 1S9HA 1K7XB 2JH3A 3ESYA 4Q0MA 1DAPA 1T8RA 4GVLA 5A9TA 3MJEA 5HW0A 2C54A 3C3BA 4JUBA 1KXJA 5PGMA 2PBRA 4KE8A 4Q4DA 4OBXA 2QL7A 1L3BA 1C9KA 5A62A 5KMGA 1FPMA 1HKHA 1YV9A 3HLTA 2YHIA 3PIIA 1I2AA 2PAFA 2Z1MA 3OIVA 4MUXA 1N6RA 2JJMA 5A5VA 4WEOA 1AO0A 2IP1A 2A94A 2HDNB 2OSBA 1F8UA 4Y2RA 4GBED 2EDAA 2WVHA 1NTRA 1RI2A 1KP2A 3KOZA 3B9RA 5I9BA 5C31A 5CB4B 4XPZA 1KHTA 2Z08A 4K3VA 4URYR 2GX6A 1NDUA 1JDBC 4AUMA 9MHTA 1ICIA 2OEPA 1JP7A 3JR3A 3P9YA 4V02A 3RG8A 3ZWAA 3QI7A 2YMLA 3PDJA 3LDHA 3OPNA 2VXYA 1PVVA 4V0RA 4DA0A 1ESDA 2Z8ZA 4XVCA 5DYWA 2YHUA 1DQNA 4KRFA 3PC3A 3FPCA 4B6RA 1EVQA 1KL7A 4OXIA 2ZR7A 5KTKA 1CDZA 1KZYC 1EEHA 4PC1A 3GLGB 3WNDA 1QG2A 1KJ9A 2GEFA 4EZIA 4YRIA 4LV8B 2XD4A 3ADPA 2J0SA 4XWTA 3OEED 2IOHA 5AFSA 1IATA 3P0IA 3QLUC 4PGMA 1XVIA 4CIDA 2GH1A 4D25A 3VNVA 2CJWA 2IUUA 3M3DA 4DIBA 1RXSA 4PPFA 3AVQA 1A7UA 3CRQA 1WZEA 1Q0HA 4PPNA 1ZZEA 1EM8A 4CQNA 3F96A 4TTIA 5IF9A 1DWOA 2AEJA 3LLCA 3B2EA 4XUDA 4B79A 1QYWA 2OAQ1 4GP6A 4PONA 2YWEA 4WNIA 3HP1A 5EMLA 2QRMA 5FWYA 4RPHA 5IKEA 1IVYA 4UU7A 1QP8A 5L51A 3AFIA 3M6LA 2XXAA 4FX5A 3DF7A 1JIIA 1XALA 3I8OA 5JRZA 4Z4IA 1G8GA 3W5BA 3CX3A 4NCXA 4XQCA 5LQRA 4AZVA 2UYCA 1UM9A 2KS6A 3DDWA 4RKFA 5CBKA 2Y05A 5E9AA 5J58A 2YUTA 1BN7A 2OXFA 2C1EA 4WFKA 4DA8A 4A36A 5G0SA 2XE7A 2NSYA 1TA9A 1LQTA 3WY9A 4N4AA 4TLBA 2JEZA 1PGJA 2FWRA 4DQXA 3TW0A 2FZ5A 1FFGA 2XF8A 2FEAA 3H83A 4G0MA 3TNJA 3ED1A 3U49A 3AJEA 1CQXA 4P54A 3H2SA 3ND6A 3ORHA 4OBBA 4MWGA 4R1LA 3Q2OA 1ZN9A 1SVMA 3PHBE 3RVPA 3WL3A 2BGTA 1G6OA 4LPKA 1L5VA 1O5TA 3MMZA 3IOCA 4W8HA 1P4RA 2HSWA 4YROA 1AVTA 2QGFA 3OX4A 3GJ6A 1BVRA 5FUWA 3VNRA 3FHTA 2B6HA 4NC9A 1H2WA 5LCXA 1SKMA 3NUQA 1QX4A 1NFFA 1P0MA 5AOAA 4LRYA 3LDUA 1QRAA 3LHDA 1WXGA 2WYVA 3FRIA 4QU5A 4Y67A 1P6XA 4LJKA 2RAPA 4E33A 4F7DA 2X2FA 3E8XA 2DWQA 3ZW9A 1QU3A 1V7ZA 3NONA 3V1KA 4EA7A 4IBOA 2K7FA 2W0SA 3JQFC 2AR9A 4ZZ0A 3WMGA 1S7CA 3LA6A 3IQEA 1G7TA 3CJQA 2H7VA 2QYHA 2WVGA 3SC4A 4B7XA 2UXCB 3S29A 2CVZA 2QT1A 1SHZA 3WLJA 4EHNA 7MHTA 2XBLA 3GRAA 1TQ2A 1Z34A 2R8ZA 3HU3A 5E95A 4YREA 3R5HA 4F96A 2DTDA 3N59A 4FMBB 3JVEA 4FW9A 2GHIA 1CQJB 3B1KA 3L84A 1T2AA 3D5QA 3HLYA 3I5AA 3KAKA 4BRUA 3V34A 2GASA 2QTRA 4FEEA 5KHLB 3JTEA 3OZEA 1BN6A 1A50B 4K1XA 3AM5A 2GJ9A 2HHCA 1MAWA 1EP9A 2ONJA 1I7PA 2HXSA 4B73A 1QCCA 4EELA 3MILA 1EBBA 1B43A 1XNJA 1ZO8A 2R5WA 4YV2A 1VE1A 2ZT7A 5AVYA 3RIYA 3RS8A 2M6LA 5J47A 4LYEA 4KODA 4NPHA 3X1WA 3GEMA 1E2DA 1YRWA 1P6UA 3MLBA 4F8EA 2WTAA 4GI1A 3HUTA 5A3RA 4P84A 2DFDA 3CT4A 2FSUA 3G5MA 4EG5A 4KR2A 3NETA 3PQ3A 4H6VA 1KEPA 3MJ4A 2GJAA 2DHEA 3B51X 4I55B 2GYYA 2R66A 4WUTA 3LT1A 4DEYA 4LHYA 5IWAB 1P81A 4L2IB 2BI7A 3AQIA 4QWWA 4UBLA 4ZI7F 1CJKC 5KDOA 3I6MA 1KR5A 1NW9B 2AE1A 3BIWA 3I9JA 4F7WA 4P38A 3PFBA 3FLBA 3ORQA 1N5RA 2P75A 3ETLA 5CLJA 3PP8A 2Y4OA 5EA2A 5BMVB 4LMRA 4I4CA 1YS4A 2Z30A 3ZY4A 2A0KA 3R3YA 4JCCA 4RCYA 1SBQA 1E3MA 1PS9A 5CVUA 4JI5B 1QHHA 1SOMA 2BFFA 3KB1A 3U9TA 4D74A 1ZHHA 2FV8A 3NRBA 1CZOA 4JSYA 5I7RA 3GFBA 3TZCA 1YS9A 4J75A 3GLFA 2H4XA 1SJ9A 1YS1X 5KCMA 3QWFA 1IOVA 2K6GA 2V3WA 5H7XA 2N1BA 4BC1A 2VCHA 2XOKD 4K0RA 4JY7A 5AXAA 5JOQA 1GPNA 2F1IA 5JFGA 2O5EA 4IM7A 1WP4A 5JSZB 1ESNA 2RHDA 4NBKA 1UK8A 2YFQA 3G1UA 4FOSA 3KSDO 2Y27A 5LDGA 3UMJA 3EZ2A 4LDQA 4LDAA 5KVQA 1FXWA 5JT1A 2R8YA 3SBXA 3FOEC 1ZD8A 3UW1A 4FILA 3CO5A 1DMRA 5JS6A 3O92A 3EIEA 3JS5A 1EKXA 1E3JA 3BHJA 1JFLA 3GA7A 2ZETA 2D1YA 3BH0A 3MSCA 5AKLA 3B8HA 2AMJA 2MHCA 1BDBA 4RDHA 4ZEWA 3IRUA 3R7FA 3SMVA 1OBCA 2QN8A 5MDHA 4LTDA 3NRJA 5TPWB 4AZWA 1XKQA 2GAOA 1VC2A 3I2GA 3PITA 4FFRA 3UUFA 4HHEA 5AW0A 3OEHA 5MGNA 4LYDA 1OYOA 2B1GA 5B2ZA 4BNTA 3QTBA 3O38A 2Q45A 3IUJA 3AJRA 4ZVPA 2ZSDA 2ZOSA 4CMKA 1OLOA 2C3YA 1GFWA 3K0SA 3F7OA 2QLTA 2IS4A 4EVSA 3IAS1 4RHEA 3VYVA 2W8BB 4OSEA 5D00A 3DC2A 4ZANA 3HA5A 1IG3A 1U98A 2REXB 3TLZA 2CXTA 4KR6A 4BMZA 3LPLA 4PLPA 1OI7A 1RZUA 1ZBQA 1U4NA 2HDOA 2G09A 3TVYA 1NUPA 5TEVA 4ND4A 3VRHA 1GUYA 3N8HA 1T2EA 4GL2A 4NK5A 4RACA 1KRWA 2UZIR 3L0ZA 4IP0A 2FP4A 1QQ5A 1GPWB 4PX2A 3ZR4B 2GN9A 4LMBA 5LZ9A 4BLTA 1BTOA 5ENDA 2FJPA 2Q7DA 1PF7E 1TUBA 1ZGCA 5ALYA 8OHMA 3SZRA 3S7TA 3P2JA 4WNYA 2FVXA 2PWPA 2H85A 4HVCA 3BWMA 4D9HA 5ADWA 1JDBB 1TC2A 2Q0HA 1R0RE 3STHA 3G68A 4ZVRA 1AURA 4PYKA 3ZTTA 2Q5LA 1W85B 1DXQA 4E2ZA 4R8RA 2AT1A 1MJHA 4CEIA 3H7IA 2QMOA 3NIWA 4LY0A 4MKZA 4DSOA 5JAZA 4F6RB 5IU6A 1FXSA 4M60A 2P11A 3AI2A 1PI3A 1ODKA 1Q1EA 1QZZA 3G3EA 3I73A 2YYZA 1DOZA 3BWEA 2NYUA 5JASA 4RY9A 3AUKA 4NONA 4CV3A 2PMKA 1D8TA 4O2AF 1EHIA 4HLNA 2VT2A 2P9GA 3V1TC 4Q18A 4HAXA 1RI3A 3A3OA 5BNFA 1CY2A 1HMPA 3JVVA 3K9FC 4AYXA 4RVSA 1WDKA 3LUHA 221PA 3I5YA 4FNGA 1GSOA 4L28A 2WV9A 1PFYA 1WBJB 5SYAA 3T1OA 4EW3A 3FPKA 1HDZA 4KH0A 1ZUIA 2I2XB 1YDWA 2VTEA 4GLLA 3HABA 3VHXA 1Y6GA 1JS1X 5DLPA 2C4UA 1DIBA 2SKCA 1O6CA 1U8TA 5E4YA 1X92A 4J1NA 3OFND 1L1QA 4S2EA 3X1XA 3RUFA 2XSZA 1FMLA 2APJA 3P4YA 3MJVA 4YCBA 2C2WA 4CN9A 2ZSAA 3FFTA 4YQEA 1Z16A 1EJBA 4PGAA 5KYWB 2QTCA 1KY5A 5AM4A 4QJIA 2X13A 1UEIA 3DZKA 3K5IA 4R7GA 4HFMA 5ISMA 4OLAA 2X7XA 3IP1A 1PG2A 3RVNA 1RD4A 2FSIA 1HTWA 5HWSA 1KFEB 1JQEA 4AM8A 2R7NA 5CB8A 2WWYA 1AQJA 4ACBA 4EO4A 1GCGA 2CBGA 4GWLA 4R8KA 1C30B 5FTKA 4KUHA 3N05A 3OOWA 4NEHB 3MWLA 4LE1A 4MRPA 4XXHA 3PL1A 4YN3A 5KYUA 5KU7A 1LI4A 3HG7A 2R79A 1H1LB 3B3GA 3KUCA 4KQFA 5EEGA 1FMJA 3FTDA 3GDFA 3LBHA 1UXIA 3HL0A 3BSSA 3K9QO 3PQFA 2WJYA 3Q7EA 4QATA 3E9ZA 4CEHB 1UOOA 1Z2OX 2AEFA 4OGLA 1NP3A 2XWJI 2CV1A 3IQHX 4II7A 3I39X 3TSOA 2YWRA 1W19A 3PS9A 4MI6A 3NORA 1N2XA 3HBAA 2PVSA 1UPBA 1UK9A 3CI0K 5KJCA 3VO1A 1EVYA 1QHIA 5CJ2A 2QJFA 3E2IA 5TIIA 3A2LA 2HA6A 2GCGA 1JE1A 4PLFA 1EK2A 5CNMA 3W6NA 5IT5A 1X1RA 3HFSA 3AKZA 1CQIA 2GEDA 3RREA 3DHYA 3IBFA 2PJRA 4PWZA 3T3HA 4ND3A 4CIXA 4DQVA 1DTSA 2B9EA 2C04A 2NWQA 1IZ9A 3OAAD 3F47A 1IHPA 1XCJA 1AKUA 2PMWB 1IY8A 1ITZA 1KRXA 1Z9BA 3MFQA 4FXPA 3T38A 2FDXA 3GPBA 4A92A 1YTUA 3PBKA 4I14A 5JLAA 2AVDA 5BYAA 3LGAA 1J9EA 1PSWA 4FZ3A 2TYSB 1A76A 3IC5A 2OV2A 2G9NA 2X8LA 4UCWA 4G25A 3OE7A 2VSFA 3WWPA 1V8PA 1T1IA 2ZXUA 1AU9A 5EL0A 2X7HA 3H4IA 2Q4TA 3BMNB 5F7OA 5IZCC 2VPPA 2QG4A 1YQUA 3EQ8A 4OPMA 1RI5A 5B1HA 4JKIA 3GGGA 4L8LA 5CEFA 3LNTA 3GA0A 3T7JA 2C84A 3WB2A 3K73O 4G4SO 3ZKWB 1EP2B 4NQRA 4CG3A 1XRPA 2OB2A 5FI3A 2P2LA 1N9GB 2Q8PA 3RS0A 4XSHA 4HQRA 1MO6A 2Q9BA 2V74B 2HV8A 3W3AH 4EMTA 2RGRA 3T34A 4YRCA 2A52A 4M1MA 4KK3A 3TTTA 4DWVA 5B2EA 4PX9A 1HR0B 3C7TA 1E2JA 1PK7A 1WHTB 3FROA 3KP1A 4K8OA 1EFTA 1IN4A 2MR6A 1GQYA 2JHGA 3FGNA 3MAJA 4QU0A 4N18A 2YIJA 1C8VB 1LPBB 3HJFA 1IU9A 3CEMA 3IAHA 3QKWA 1UL1X 4JQOA 3TFWA 3ZCPA 3NHLA 2LCIA 1NVGA 1QIMA 1CDDA 4XWAA 4PQFA 5AMXA 2PLAA 4OJQA 2QRGA 4B0OA 4G26A 1GWNA 2PCJA 3A1VA 4QBTA 5CD1A 3UW3A 1UBUS 4BQFA 3KC2A 4QKQA 4TV9A 1J99A 1MOQA 4LTMA 3EWNA 3LQRA 4DDMA 2PZFA 4H9GA 2YHSA 1TDJA 3PUWA 3SZ3A 4AF6A 4DAOA 4DZRA 1IUKA 5K3FA 2NW6A 4QU8A 4YRFA 2UZ1B 2XAUA 2IEBA 1RXYA 1QUFA 3GZJA 3BJZA 1QJ4A 1UIMA 2BGLA 5AW8A 4DWJA 5AW3A 4DM7A 1IN6A 3L40A 2QV7A 2VF7A 5EMMA 2DHQA 5A6VA 1W2WB 2GM9A 4NULA 5FI5A 4YUXA 4NFLA 1Y5LA 1V1MA 2HF7A 2JIOA 4AS2A 2IGBA 4UE3S 4M1QA 5D86A 4O4LB 1UDAA 4MCAA 5KOIA 1CX9B 4IRUB 2R4TA 3HHPA 4Q15A 3VR5H 4W5RA 5AOCA 3GARA 2OBBA 2IP4A 1ORVA 3PSAA 4FN5A 2C31A 1Y8AA 1UWVA 2Q0SA 2XCQA 3OHMA 4FYVA 4GRDA 3ZI7A 3LTNC 1X80A 2A35A 2C4VA 1B76A 1A8IA 3G82C 1RLOA 2FW0A 2FMTA 2BWJA 3CH7A 5DISB 1VMIA 1KS2A 1YJCA 3LLUA 2FFRA 4GE0A 2JBWA 5DK6A 1XEXB 2H0AA 4KO8A 1GZHB 4E70A 1LK0A 1A8SA 1XU7A 1IL0A 2PXCA 1WOMA 3E15A 4IDPA 1H2XA 1VP9A 1HQCA 1FDIA 2YN0A 3DMHA 4I50F 4MLPA 1I3OA 1W2GA 2Q07A 1BZYA 3AFMA 3KHSA 5D3QA 4DWOA 2PGJA 2PT9A 4ZTZB 3DYIA 2AGVA 2D0IA 3DHNA 2Y71A 4UOZA 1NVVQ 4F45A 3HYTA 2VDJA 3SWWA 3E03A 3VKUA 4IJUA 4C6TA 5I7FA 2BFNA 3K4HA 1V9LA 3F9CA 5IDXA 5EP4A 1G19A 3OC0A 4E5DA 1QAQA 1S8FA 3K9GA 1D5WA 4NBRA 2VYNA 4LNHA 4XGNA 1FCJA 2IUYA 4NS1A 1OGYA 4QD3A 1TRKA 2OFWA 3UAOA 3MGAA 3QF4A 1K3TA 4Q39A 4P33A 5LP6C 1H0HA 2EP7A 2I66A 3BGDA 3OTGA 4L8VA 1Z4QA 3FWNA 3QPAA 5H3LA 3HFGA 4D3FA 1VBFA 3ETJA 3UVEA 2OL4A 3TLJA 1NSTA 1I7SB 3B9PA 1DEKA 2P90A 4OSPA 2C5HA 3VJMA 1YACA 2EJTA 2PA0A 4OQ4A 4ZICA 2BMWA 4H60A 4I36A 5AW6A 1U0FA 3GVXA 5DJ5A 3FDIA 2ATXA 4RO0A 2VQFB 2HYIC 2PS9A 4AT1A 3KEFA 3RROA 4PCLA 1AUOA 1Z0JA 4M36A 4YAIA 5JY1A 3O21A 2JIDA 4F4JA 3ZTWA 3UCFA 4AIIA 2QP4A 4MH0R 2AXQA 2Y68A 4RPJA 4RGBA 5C3MA 3A8TA 2Q4DA 2C4TA 4K9NA 4ALNA 1BGWA 5BW5A 3KEOA 2Y77A 1NBME 3LS2A 5BR8B 4X0EA 4HT3B 3K0KA 2OFXA 4RH3A 1J90A 1GKUB 1ELOA 1ZISA 2KMLA 3QBJA 3WYFA 2Q3HA 3PYLA 3R3SA 1B4DA 1DPGA 4C5BA 3DOEA 4FOOA 3RNOA 3NV7A 2XDQB 1SC9A 1TIBA 2JDID 2PHZA 2NT4A 3EXHC 3QLVA 4JUIA 1K6XA 1AB6A 4ZKDA 4TSFD 4TPKA 1EFRD 3Q40A 5NLLA 3AHEA 1JFFB 1VKJA 4FKBA 4Y9TA 3DVAA 2ZIFA 4B7UA 5IBCA 1N5MA 2V7XA 3NTLA 4HQLA 3H2BA 1SPXA 2PRYA 2C9MA 2C2XA 2XB9A 5K8CA 2QL5A 3P26A 4HUQB 3RYHA 2E4ZA 1WPXA 4QNNA 3TK1A 1EK0A 4Z9YA 1NBMA 5J43A 2D00A 2IGTA 3EWIA 4OXRA 4A2CA 4EJSA 1CEQA 3WG9A 3Q8MA 3IPAA 7REQB 2YZNA 3L8EA 3SF8A 4DGQA 5HS4A 2YDXA 1YTLA 3HM2A 1Q77A 2ZJ0A 3GW8A 3KVYA 1GITA 4HNAB 2DT5A 3KHTA 4RPLA 4CT5A 1NIPA 2AZXA 3NWOA 3BJIC 1QFYA 4LGCA 3P2OA 2NUAB 5CX4A 3W8EA 2L17A 4XWYA 1UKEA 2O52A 1MIOB 2YQ5A 1S9DA 2CL0X 4BX3A 4DCVA 2HZ7A 1GQRA 2IFTA 2PSFA 3UC9A 3G5UA 3O3MB 3FHJA 5EJIA 4DF3A 2ZULA 3FIJA 3OPVA 4JI2B 3CCCA 5BN1A 5BSVA 1OTHA 2X4IA 3CMCO 3RDPA 1NX9A 5IH7A 4F4FA 4GPBA 5IUNC 4D6PA 5K8LA 3CU5A 1ZSYA 2FWBA 2OXCA 1QFXA 4FHZA 3LPNA 5CXXA 2WV7A 2EL9A 1Y3IA 2ZT8A 4G5YA 3FWPA 3GGPA 1MVNA 1NRJB 2VK1A 2VP6A 3GLTA 3KB8A 3PPVA 3CPHA 4PLWA 4S12A 5HCIA 1TW3A 3EGDA 4YMLA 1CEYA 3JAWA 4Y9DA 3GUHA 4RM2A 1BW9B 1CHNA 2PZMA 3GPIA 2RARA 2BD0A 3PUXA 3PX3A 4I81A 1Y4SA 5HKLA 2FWPA 3T5DA 1HG1A 3DCNA 4D9BA 1IUPA 4EB6A 3RYTC 2B5WA 2IZ7A 2ZIVB 3SD7A 2AN5A 5K6RA 1P7YA 1QH1A 5KSWB 4C7OA 1J0DA 3JWIA 1QNLA 4MI9A 1EVJA 2JEYA 3JQ9C 4IYJA 5C1BA 1YR1A 3PZRA 4OP3A 2XUPA 3AY6A 1PN3A 2Z58A 3ICOA 2BEWB 3DOHA 4CCYA 4QLBA 5JSKA 2RI0A 3K9HA 4R68A 2AV6A 1T0IA 1CUXA 1ZJYA 1FFHA 3EMKA 3ML1A 3KQYA 1JIXA 3PUVA 2OY0A 4OIMA 2DE0X 1X7ZB 2GPWA 3L8DA 5DNWA 4YV7A 1AUPA 3D1VA 3KKOA 2VN8A 1TGVA 3KD2A 1R10A 3GG9A 3PFNA 3GP3A 4EHJA 3ETEA 4ZDIA 3IB3A 3MPUA 1RLIA 4EUEA 4I9GA 2QYSA 4X1OA 3T7IA 4BIMA 1Z17A 2HL6A 1O8BA 5E6UA 5IJ0A 5SZKB 4G0OA 4U3JB 3AW8A 1FYXA 3QIVA 4PTYA 5HXAA 5K05A 2F3RA 2OENG 3OKCA 1PL0A 1ZOIA 4LFBB 5BOSA 3UH0A 1XPRA 2Y92A 1Q2XA 4BVHA 3TG8A 4HWGA 1E8MA 3FBTA 2AG8A 5SY9A 2ZYAA 2C2YA 2DVMA 2FUEA 1NRIA 3L7LA 3JATA 4JJ6A 5H1YA 3R3JA 1AS2A 1LVHA 2QQFA 4DY6A 4RTMA 2XCIA 3I09A 1KPHA 2HI0A 3GEPA 1PZEA 4CF5A 4BGUA 4QREA 4OX9Y 3T0IA 4JV5B 3E8MA 1XLTA 5IFKA 1NY6A 1OHHD 3NV9A 4YP5A 5DLEA 1DV1A 2IY7A 2JZCA 1H0SA 1MNQA 1PK9A 2YQ4A 2EX1A 3C3WA 3GLUA 5IJ9B 4RTPA 3JSXA 3ZD7A 3E6AA 2G40A 4DLUA 2SICE 1RACA 1H85A 1BKDR 3OO0A 2Q1WA 5C34B 3R44A 1ISIA 1J00A 1LFAA 2A5YB 3THRA 1PGOA 3M9LA 3SIRA 4YYEA 3DPSA 4IIUA 1P7ZA 2AX3A 4WKNA 3UV3A 2FEKA 4MEBA 4BOYA 4FZ5A 3ZXSA 3LX5A 2KX7A 3JPWA 4YECA 1QU2A 1SAYA 3I0MA 4DR2B 1JPVA 1W29A 1NTOA 3RRXA 5HRUA 1B14A 4RLQA 2B99A 2ZPUA 4HEA6 4IFIA 4UTRA 5K3CA 3TTXA 1QXSA 3ND8A 3O95A 5AJHA 3FYDA 1QTIA 1V6CA 3L7JA 1WBBA 4JLBA 1D2HA 4G86A 3ZD9A 1EVIA 2EF1A 3GMDA 4XGQA 1GUBA 2C5BA 2UVPB 4OB6A 4XFKA 5EGSA 5C4MA 2OG2A 2DR3A 3S2EA 1WF3A 4XDZA 2ZUCA 3BMXA 5LA6F 4HF7A 1QGUA 1XL1A 1NN0A 2G3YA 4RA6A 4YEDA 1AKRA 2CNDA 2VA8A 3FMGA 3IDSA 3H9GA 1MORA 1RCTE 1Z22A 4HAYA 4A2WA 1I1OA 1S2GA 3MJHA 5IVPA 1GNTA 2IYTA 2W2TA 3X1DA 2V98A 4HAWA 3TH5A 5C37A 3AIMA 2Y9PB 5D3KA 3KOYA 2C7QA 1T36A 1V7PC 2ZGVA 4Q9AA 4RANA 2QZ9A 1ZIOA 1UC8A 2OHXA 1QDLB 4YPFA 1KSGA 1DCFA 4JT8A 2EDCA 1GKYA 2G04A 1JBEA 1M67A 3H0EA 3VNBA 1OJLA 4CFSA 1WP9A 3CPEA 1ZGGA 6CHYA 5CDGA 4PRKA 4UM7A 3TPFA 1Q84A 3O1LA 5LP6B 3K70C 1I94B 2OOKA 4LHWA 1G5HA 3Q3JB 1X3SA 3HCCA 1GZSA 3JZDA 4BQNA 1T6XA 3V5NA 4BWFB 2UZ4A 3VU1A 3A1SA 4AZ3B 4XRGA 1C4KA 1ACJA 1MCZA 4MVJD 1GPAA 4W9MC 2OXTA 1P5HA 4O4HB 4DLPA 5EE0A 2VRWA 5BPFA 2AR7A 2VK2A 2J4FA 4W6QA 1GNPA 5EJ2A 5JXHA 5A06A 4WK2B 3U3RA 3OEYA 4LNUB 4Y6RA 2ZWPA 2X86A 1E7SA 1C14A 2C9ZA 1SBTA 3DCJA 2OSVA 1BHSA 1ZN8A 3D4IA 4V3CA 4PWYA 4DT1B 2LW7A 2IS1A 2EP8A 2ZRLA 1FY2A 3EZ6A 3HDTA 1J5EB 1F7UA 2Q6TA 1E6CA 2V7TA 1ADBA 3QVKA 2AMYA 621PA 4I9FA 3NDIA 2AJ8A 4P4SB 3GV0A 1NC3A 4N65A 1IPFA 1FVOA 4UHEA 1KIFA 1T0BA 4BGVA 2ZJZA 3PTAA 1WKVA 2R7AA 4Q3CA 3DMFA 5KCZA 1VJRA 1XX6A 4H17A 2G16A 4YAFA 3GVHA 4XUCA 3G9ZA 4G23A 3C7AA 3IAM6 4JLNA 5IJXA 5IEBA 1HTBA 1C9YA 4AN4A 3EXHB 4GKJB 4QDZA 3TW4A 4IS2A 3L0CA 3DEJA 4JXKA 4KE6A 4RZXA 3VHRA 4D5GA 1MVOA 1FMFA 1PJAA 4MS3A 2PMFA 1GG2A 2C82A 3D7SA 5JVDA 2UXDB 5HVNA 5JC1A 3BIOA 2HMSA 1RYBA 4XRRA 4IDBA 1Q3HA 1T15A 1MA3A 2ZTUA 3RUPA 4P98A 3OTOB 1XROA 5JZSA 3VSEA 3ZHSA 3D81A 1AQLA 2PTGA 4X6LA 1CYDA 3QXCA 1EXNA 4X3PA 5KEIA 1Y1QA 4GMGA 3GJSA 3GMTA 4ASUA 2H57A 5COBA 2EGHA 2H1VA 3LT0A 3TLKA 2VQDA 2ZLBA 4OXNA 1O95C 5CNJA 4EGFA 5K20A 1XPOA 2AYYA 1BE1A 2VJBA 2WMNB 1CUVA 3BRWD 4NABA 3ZE7A 3TB4A 5HGXA 1BROA 4OI0A 3RC8A 3PI7A 5FR1A 3KSRA 5K45A 2VQ3A 2F1JA 3O03A 1G8FA 2A8YA 2OAGA 2P9JA 3O2NA 2YZMA 5AR1A 1Q15A 3X1KA 3UICA 3OQJA 4HGZA 1N6LA 4EY5A 4I9UA 2CCJA 1KFCB 3RF7A 4OQZA 3X1JA 2VHWA 3E0QA 3G8CA 4N5DA 3MCVA 2ALJA 2WZQA 1NDHA 2CHVA 4B45A 2OPHA 3W3AA 2GN4A 2A57A 3OZAA 3KYJB 4NENA 3JD3A 2CFRA 2OO5C 4PGGA 4DDUA 1CJTC 1CS4C 3U4IA 4P53A 1NUTA 3WBFA 4S2UA 5INTA 4FPXA 2W4QA 3FKSA 3NM5A 4LBYA 2HQRA 4GPZA 4OAOA 4TMWA 4BQSA 1X8KA 2V97A 3N0VA 4JJKA 4B80A 3MTAA 3RTEA 4EAQA 2JIQA 1GCIA 2XWPA 4U7GA 4X1KB 1J0XO 1LK7A 4B6FA 2R4QA 1WMEA 1WCIB 4QLAA 3TZEA 4ER3A 4YUWA 3OIWA 4TQ9A 3URMA 1TU4A 4KKVA 1W34A 2M98A 2WRZA 4KQGA 2DWUA 5KOJA 1J2YA 2J9RA 1CC1S 3H1TA 3IA2A 2EFGA 3ASVA 3DE0X 3LUJA 2XHEA 3GJ0A 2YWCA 4WNAB 5LZ2A 5LL6P 1UBMS 4JDPA 3TEFA 1M2KA 1N2ZA 1N8KA 3C6KA 2CLKB 4F85A 4V1CB 2H5EA 3L07A 1CP2A 2JANA 1SCJA 4JLMA 5IM5A 2JGIA 1RM4A 1E9SA 1PTJC 1Q17A 4Y7DA 4JI3B 3ANNA 1F5SA 1KKUA 3B20A 1Z0DA 1NVVR 4M9XA 4PG7A 4K6MA 4DMGA 1ID8A 2JASA 4Y2HA 4ARZB 4A1OA 4ARBA 4CI0B 2HO4A 2VPQA 4Q7MB 1QPGA 4TKLA 1J2JA 5K0JA 4M7PA 2HK9A 2Z3VA 5DNUA 1ZONA 3TSWA 1M2EA 3HS3A 3K70D 1KETA 4UASA 1LNQA 4WI1A 1YGPA 4BAZA 3G88A 5JSHA 1GGKA 3G9QA 3MELA 1P0PA 4QAQA 4BNNA 1EYZA 1OROA 1XZIA 2YFKA 4KXUA 3MB8A 4HB3A 4MQEB 2O2GA 4PTLA 3NOOA 2V6GA 3O2QB 1K4YA 1YR3A 3VR5A 1Y8RB 2PJZA 4FKZA 4P93A 3MC1A 3N2KA 5FYDA 1O9GA 4R05A 2OBNA 3PVSA 4FZJA 4PGFA 3FPLA 5EXDA 2JEOA 4F8JA 2WU1A 2RGDA 3O82A 2OK8A 2RAFA 1DC4A 3Q1KA 5AK0A 2WFZA 1EVKA 1EI9A 1NYLA 2GAJA 1CJMA 4PFQA 1PE0A 4OHVA 3KELA 1IJEA 4FIZA 3AEQA 3KTAB 4W1PA 2P62A 3U4HA 3T9DA 3M33A 2OP0A 4U2CA 1R4AA 3EQ9A 2AMFA 3WSTA 1TE2A 3ZWWA 4E94A 4GOMD 4XGIA 3HYRA 1DKPA 1RFGE 2FOIA 3K0EA 1KSHA 3DBLB 3ILXA 2AG0A 3ZCQA 3PUJA 5I4IA 5KIAA 3C4QA 3U4MA 3TINA 1JLMA 1XD8A 3VNQA 2A4KA 2X5JO 3QLJA 2OR3A 3V7WA 2H52A 2CLMB 4BUJA 1RQGA 4WTOA 4X6YA 3ZBQA 4IOLA 4Z4CA 3E3NA 5ERXA 3QVLA 4YRPA 1RAEA 4MKGA 4Z86A 2AQHA 1H4VB 3DS8A 5AOBA 1DC3A 5AIBA 2JA2A 2WMYA 2E1RA 3PKZA 4TYMA 2RETA 1TM3E 1GTG1 2QP9X 3AV0B 5FYQA 1T9GS 4C29A 1VA5A 1NN5A 4PYOA 5DYNA 5H8WA 5FUVA 1U2ZA 4CFZA 1MIHA 4LJ5A 3FOFC 3Q7SA 1XNRB 3E05A 3R40A 1KKLA 1UP4A 4FEAA 3QOYA 3LGXA 3ONDA 2NUBA 4NJOA 4N9QA 1ZC4A 4IHQA 4M9CA 3QY0A 1Z2DA 1SXJE 2HYDA 5JFOA 1KYWA 2Z5VA 1ZH2A 4G97A 3DMGA 4GE3A 3RKSA 4M0UA 4S1VA 16PKA 3HYLA 3DM5A 3RANA 4KPUA 4MKRA 3X3HA 3O3NB 4O29A 1OIWA 3H8WA 1RRMA 4A10A 5IK2D 2HHJA 3LSTA 4MVJP 2VOJA 4XFJA 3K70B 1OT3A 1N25A 4GU5A 4P0PB 4BZQA 4QOIA 3P0JA 5F73A 2PUFA 4RY8A 4RYLA 3Q7QA 4MP6A 1P8AA 3ZQJA 5AM1A 2BIFA 4E46A 2PMEA 1E8NA 3FVRA 1B6SA 1NOJA 4YLGA 1TXGA 1N9ZA 1G3RA 2AYXA 4NHOA 4CR7A 5DT9A 3GU3A 3VVBA 2IW1A 4ND5A 5J5AA 2QDKA 2QR5A 1ZA2A 1QK3A 2WBLC 1VKNA 3N2ZB 3E18A 1YQ9A 3LI2A 4NV3A 4UAVA 4CKEA 2QQGA 4BCDA 4CI9A 4UJ3A 3ZV5A 1I1HA 1Z33A 4PG4A 1NBHA 2DUNA 2G72A 3GHHA 4MGKR 5EIFA 2IV2X 5BWNA 1DCKA 2JLRA 4UMFA 1HRDA 2OHHA 2YV1A 3AI3A 4OLJA 2IELA 5E9QA 1WE2A 1AKQA 5A2QA 1VHTA 2HLDD 5K7SA 3ETHA 4I1PA 3BN3A 1YHYA 4GFDA 5HOEA 3TLXA 2ODTX 2H9AA 2OUKA 3GRPA 4JBLA 4V3BA 2C57A 4M2LA 4MIYA 3RT1A 4RIIA 1LPNA 2WWHA 3DZIA 2QNRA 5KU1A 1YQXA 1SOUA 4DCGA 3EIHA 1FFXB 4I4IA 3A4MA 2YHAA 3DKPA 3OT1A 2Q0QA 5CVTA 2IH5A 4XVQA 3VUFA 4C89A 2JFQA 1QHNA 1PYGA 2WW8A 4KRGA 2R6CA 4A2PA 4OKNA 1DAKA 1G291 3JQDA 3DBIA 1B6GA 1VPEA 3HCNA 4DS3A 2VT6A 4KPFC 1CVLA 2WZCA 3HVRA 1BEEA 1YZVA 4HWOA 1C8LA 1W5TA 4QTYA 5JH7F 3ZYCA 3BGSA 1XJWA 3HTXA 1NAHA 1CY8A 4Q9DA 1XQ1A 3GYGA 3AETB 1LUAA 4MJXA 1E1QA 2FZCA 2Q9CA 5DMXA 2NSLA 1W44A 3NWEA 4NMXB 1TECE 2H5JA 3C3XA 1KDZA 3MTEA 1N2CE 2PWZA 5JFTA 5JAOA 3D6MA 3QU7A 4RHXA 3LP5A 5BO5A 3SBDA 3ZV6A 3ZCXA 5CITA 2PU7A 1G21B 3VGJA 2A5DA 3AUXA 4FEGA 1NRWA 2CHEA 2HQSA 3PQDA 2UYOA 4IIJF 2YASA 1LZKA 2IYPA 4IDQA 2NQTA 2REQA 3QPVA 4Y2VA 2NU8A 2PGXA 5JD3A 1VXRA 2PK3A 3NBXX 4YP7A 3H99A 4DCOA 4D5EA 2FEWB 4ZJUA 2LCFA 3K72B 1DV2A 3QKIA 4URFA 3T3GA 3TL6A 4TX1A 4D96A 2EFCB 1G6HA 2G4LA 1ODTC 1QIHA 1YIOA 3TM5A 2DOKA 4UNQA 1R9GA 1U9YA 1W96A 3CWZA 4BO9A 1AK2A 2W70A 1O94C 3IMCA 4NK4A 3ZUPA 1ULTA 2XE6A 2LPMA 2WTBA 3RO7A 5LQKA 3KLPX 1N2CA 2FPGA 1E79A 1NZFA 2XYQA 4YJ3B 3I32A 1U5AA 3HCWA 1VGRA 1A4IA 1DQYA 1ZX1A 2Z4SA 4YMTA 1WZ2A 4GGPA 1ISHA 2UKDA 4BX9A 2DC1A 3I4LA 1C7ZA 4F21A 2GEBA 1W4ZA 5CCDA 1BS2A 1PWEA 1B93A 3M4YA 4YJ2F 1Z62A 4L8GA 1S8AA 2DBQA 2Q99A 3AZQA 3ESXA 4DLXA 5TE9A 1K5HA 3AOEA 3NR2A 3FCCA 2RC5A 5JSUA 3S1AB 4RM3A 1O6BA 3ENNA 4AG3A 2JGAA 5ECYA 5GVSA 3TMAA 1RBZA 1J07A 4BO6A 2O8EB 5I8ZA 1ULUA 2D06A 3KDAA 4DARA 3BA1A 3QNMA 4LJ7A 3OMXA 1U80A 4BO0A 1VLZA 4MR8A 1CJCA 1JKMA 1NR7A 2IC5A 3P9RA 4J8PA 4MW0A 4N47A 4LISA 1VDZA 1AS0A 2LE0A 3LECA 4KXXA 4J91A 2G76A 5BSGA 1J0EA 3IS3A 4NV0A 4JOSA 1Z7WA 2NU6A 4GLJA 2AZTA 2AIRA 3WLHA 4WMLA 1KOGA 3AI7A 4QQ8A 2FUKA 4XGRA 3GJ8A 4MS1A 3L1JA 4C4RA 2VUTA 2P5TB 4HVTA 4CKCB 3AVVA 2J7PD 2WSYB 3P8ZA 4O1IA 3T3DA 4DIOA 4QXAA 2IYSA 4UBJA 3INGA 1U65A 2C5SA 2WUGA 1KI4A 2XRMA 4NS4A 3L9XA 2NTVA 3H75A 2WHPA 1WEKA 3FTPA 1AHPA 2QRVB 5REQA 1Z47A 5CA0A 1Y80A 3GLVA 1AY0A 2BE7A 2KWIA 2X4LA 3FKQA 3NALA 4AWAA 2A5LA 3SQLA 3M1IA 4J16C 1E1NA 2VSQA 1U3FA 2OD2A 1XJ5A 2XUKA 2ZUBA 3NYIA 2CWWA 5B37A 2YWJA 3L8ZA 4JU8A 1E1CA 2EXXA 3ABZA 4JBHA 3RYFA 2VHUA 4BQRA 5JCXA 3N0TA 3NXKA 5TX7A 1P61B 1J56A 1R4MB 4QUIA 5M34A 4L73A 2KM1A 4G4IA 1QFZA 1ESEA 1VYVA 5IN5A 1W581 2WJVA 3FOZA 1W0JD 3N07A 3WFJA 2DFVA 3ZGYA 3LG2A 1R5OA 2RH9B 1OFTA 1U1DA 1YZTA 2RGNC 2W71A 3LQKA 1E3QA 1PJSA 3IAUA 4F3NA 4NZ9A 3TBHA 4E0BA 2QGZA 2BR4A 3H11A 4KRXA 4ZYVA 3ZDBA 5EHGA 1P7WA 1W8IA 2E9SA 1DRUA 2EFDB 3AR5A 1G6KA 3H1AA 4R5HA 3VR1A 1MH9A 1CE8B 2J08A 3DEKA 4YRGA 1CFJA 1QIKA 2PJDA 3K0AA 4MI1A 2J9FB 3EUWA 3BWBA 1UINA 2QRHA 4H08A 4TM7A 3CEHA 2DT8A 1X3LA 3M6MD 1LLQA 1Z83A 1ZMBA 3GH1A 2Y67A 4JBXA 1XMPA 4OGWA 4PBRA 3JD0A 2QP3A 5HDQA 5DEOA 5HHTA 1J2EA 1I32A 2PL1A 3H2ZA 3IELA 4BEWA 4L6IA 5A3QA 3H3FA 2X4GA 1KZGB 1K06A 3KVNA 5ALUA 1KZHA 1VI5A 2BVNA 2D13A 5JDIA 4XVUA 3R0ZA 1QGDA 5FJIA 4C7VA 1GL3A 2Y0PA 3K2EA 4RY0A 2P4HX 4H3SA 1BS9A 2IVZA 1EFVB 2JC3A 3MK31 3SC2A 3SLGA 4C43A 1ST2A 1DJOA 1X14A 4DUGA 1AXEA 3EBPA 4E2WA 1W1IA 2WKQA 4H0FA 3IKLA 4Q01A 1AZLA 3F4KA 4H7IA 4K9SA 5F64A 4ZVTA 1LB1B 3L0IB 1A1SA 1Z2NX 4D9IA 2FRDC 1V16B 3DBRA 4N3AA 5JTUA 2AW3A 1E4EB 5L3ZA 2PS3A 3PNBA 2O4UX 1EBFA 3ANTA 2EBUA 1O94D 4L07A 3IAXA 4H0NA 2JZNA 3KM0A 2Y0BA 4PZEA 3LUAA 1IEQA 3A9WA 4LYAA 5B55A 4I4TF 2H92A 3K6JA 5K03A 2HBYA 3OM8A 4EUNA 4PE5B 4EFKA 4IF6A 4YMVA 2V1UA 2O54A 1ORDA 4X91A 8GPBA 4O4IF 1YA6A 2GJ8A 1LSUA 2LCQA 4L5YA 4FDMA 3ZWVA 1I5OA 1JH9A 3LZ6A 4ENSA 4XYEA 2CXOA 2I0FA 3CRZA 2CLDX 3PF8A 3SN6A 3STWA 5HSGA 4U7DA 2D5CA 4CKWA 1CIVA 3DVSX 4Q4AA 5GJBA 5M5BA 3E61A 2ZI3A 3RUEA 5JQGF 2V9PA 2QRKA 4U2DA 13PKA 4G65A 1PJTA 4ESOA 3DP7A 4ZGGA 1CERA 2J4DA 3LTEA 3FFWA 1R3UA 3WLRA 3NMUF 1EWKA 3ZW7A 4C87A 4M1YA 1SVSA 2ORIA 3EUEA 4JITA 4LHVA 4P81A 2CXXA 3SXUB 4RD3A 1YCDA 1WSAA 1Y5MA 1KJWA 1JG2A 1SB8A 1XAGA 1QE3A 1TYDE 2VBCA 3CUUA 5K8TA 2A1TS 2XRFA 5KREA 1WABA 1Z0FA 1A71A 3EHEA 1FYDA 5G2FA 2OV3A 3BDIA 3EVCA 4KXLA 4YCCA 4BY9E 4GYKA 3HDGA 4JJZA 1XTQA 1QIJA 2A6PA 2AMVA 5H9VA 4QUKA 1M2GA 1KY4A 3A04A 3IP8A 4C05A 4YXFA 4XYLA 1QQ6A 2P9ZA 3EY9A 3OZCA 4DC1A 3L8HA 1K3UB 4MWCA 3KPJA 4RSRA 4Q3LA 1ONNA 5ELMA 4L9AA 4KJZA 2XAAA 3SPXA 2B2XA 3NO4A 1BEUB 1GTL1 1V5EA 1YIAA 4Y6PA 5KNDH 4YCNA 4HDSB 4R2XA 4CGZA 4WZAB 2EEPA 4BN0A 1QF6A 1XRNA 2IX3A 1OLXA 3HI4A 5AI9A 4ZCPA 5LBUA 4EQ6A 1LBIA 2E18A 4DSUA 3OQVA 4O8ZA 5K0CA 4EYOA 1RYNA 1FX0B 2HXGA 4N8DA 3R9KA 2H54A 5AOVA 4MA0A 1JG7A 3PLNA 4NZPA 3KFVA 3VR2A 4G0VA 1HDYA 3EZLA 3G79A 4GAEA 2QBYB 1A9RA 4CG2A 4M6WA 2GEJA 4LYHA 3WQQA 4UBNA 1U5CA 1FMTA 1KI9A 2EBFX 5LLTA 4YJGA 1R1DA 3QE3A 2HD4A 5ITSA 3ISJA 1GV1A 2XB2A 5FEUA 1E77A 1SR8A 3MMNA 4NBUA 3N8DA 1WU8A 3EZXA 3H5IA 2OBFA 4ITRC 4IEIA 2GCPA 3SFZA 3ZE8A 5FNVB 3SG0A 2NX2A 3ZV7A 1I2MA 1O58A 2IE0A 5AK6A 5K0LA 4KDEA 4II2A 4Q24A 2AUMA 5BSUA 5IULC 3U26A 4UXIA 3IT1A 1NVAA 1GDHA 2GUGA 4JC4A 1T1RA 4Z1MA 1DDOA 4GC5A 3AEUA 3A1UA 3CF6R 1KORA 5EXTA 1KVTA 1P44A 4CZ2A 1OREA 2GRJA 4EK9A 4GBMA 2IECA 2X9QA 4R6XA 1Y9ZA 1A1VA 4R1QA 1GKLA 4MV5A 1A9ZA 3D3WA 3M6UA 3REQA 3C39A 3I6YA 3V4VB 2XTZA 4C06A 3KWMA 1U28C 2EGUA 2JS7A 1DRKA 2CUKA 5T4BA 1VE9A 4QUHA 1IWOA 3A25A 3ZNQA 3KKEA 3OJCA 4LS3A 1P5ZB 1XZQA 4YBRA 4JLDA 5DFAA 2UAGA 2YV2A 5HMMA 1B42A 4KN5A 3BQMB 1HORA 2ZBEA 4KR7A 3QE9Y 3OD1A 2MINA 1V96A 3PRJA 2IOFA 3HCDA 5KTSA 1T1GA 1U8AA 1CTQA 2EQAA 1R8XA 3L8FA 3LUKA 1C1HA 3W6OA 4GX2A 4DDVA 2VJLA 5J4LA 1K5DA 3GRKA 3IDAA 3IV7A 3S2UA 4ZT2A 1KQFA 1PNVA 2YHIB 4A4DA 4M55A 4BB0A 2IBSA 4C7KA 5FL7D 1TUEA 2VDKB 3CW9A 1DAHA 4EBBA 4NOLA 4Q12A 5A5DA 4BMXA 4O02B 2GZDA 4EG1A 4CEHA 3KJNA 3UCXA 2AFHE 1PEYA 3CF2A 5EUQB 1FW8A 4PS1A 4YRDA 1N5LA 2C7GA 2GI4A 3M6FA 1Z2EA 4EY6A 2IYVA 2ZVQX 4ZALA 5G0WA 1LRJA 3GBSA 2J0UA 1NKVA 4GX5A 5DASA 3A4LA 4MKIA 2N46A 2A9QA 3DMDA 4OKSA 5FIUA 4NBNA 1RAGA 1SQFA 4J2TA 4OLFA 4MGEA 4IL5A 3G8DA 4TYWA 4PLZA 3UBMA 3B1JA 3CUVA 2BGJA 3KTFA 2KLHA 1UBNA 5EP3A 3AERA 2R96A 4EFMA 5JI3E 1ZD5A 4GDMA 3ZDDA 1HQYE 3L8GA 3ZQ6A 3QW2A 4D9NA 1E5VA 1W88B 4QX6A 3GEIA 5KNBH 1O08A 1QBKC 1VMEA 1YZNA 2BUAA 2CJWB 2X0IA 3I5MA 3IV9A 1IM8A 1I5RA 2ID4A 1EM8B 3COZA 1H2ZA 4XIJA 1E2EA 1R5BA 3FB4A 3TRFA 4CQMA 4RA9B 2AFHA 4Z99A 3WGUA 5C52B 1C1XB 3NBAA 1ISSA 2UDPA 5LQDA 3GDHA 5E1MA 3PQ5A 3ZWKA 1P2GA 2J3KA 1OAAA 5B3JA 1VJ0A 3K9BA 2P2SA 1YA8A 1KQ3A 1W7AA 1IJBA 2CXQA 2H9IA 2XXAB 3CUTA 4OAQA 4K40A 2GLTA 3QU2A 1PVOA 3NBZC 1KYXA 2ZYGA 3CLSC 3FFXA 3BD6A 1ENOA 2BR3A 2W6CX 3R4CA 5FHRA 1P33A 3L7YA 3PT5A 4KXVA 1BXGB 2J59A 1ADCA 3O90A 4I4NA 1I2ZA 1TLFA 2H4YA 2OT3B 4U1RA 1VSUA 1EM6A 3UJ9A 5B7QA 1K5PA 3L1UA 2FQ1A 1Y3HA 3TOSA 3K09A 5A4KA 2X8JB 4RUKA 2B4TO 5LWQA 4P9NA 1JNYA 1R6BX 1FX1A 2PNFA 3IKMB 4MKHA 3AYZB 1FBNA 1CR6A 1FTSA 2FKNA 1XTZA 5T4EA 4DR5B 1T8SA 2Z98A 4YMSA 2W6PA 3WB0A 1Z39A 2AX4A 4CLHA 1YMUA 4B3SB 4DR4B 2IEAA 1E6UA 4G1FA 1N0IA 4EOGA 5DTEA 1ZNWA 3NHRA 4XPIA 4DQUA 1W36D 3GCXA 3GP8A 3NNNA 4LVOA 2CYBA 1M6NA 1A5ZA 1TVEA 4ZQGA 3QOFA 4IGEA 4RZIA 2C7RA 2HNBA 2ZR9A 2J09A 2PUHA 3BX1A 3OZRA 4ZT3A 5CYOA 5KAPA 2ZBDA 4TWRA 1J8QA 3GEEA 3ERCA 1F1BA 3GLHB 1DFHA 2VCEA 2AKYA 2G07A 3N9IA 4KYUA 2WI8A 3DG9A 5L3SB 5F1OA 3HY4A 2W2MA 1KOJA 3FTFA 2PZKA 4QTTB 3I12A 4YDHB 3RHFA 4FQ8A 1R74A 4HNGA 1KVUA 1PFUA 1NFRA 5JS1A 3NHSA 1NVDA 2V0CA 3OF5A 4LGYA 1PWZA 1QUEA 1TT5A 1K9SA 1XVTA 2VHQA 1FTQA 1SWWA 2YC2C 3BAZA 3CKKA 3CNLA 3OECA 4FWBA 2Z43A 1Z6XA 4DCMA 3WMRA 1BO6A 3HKCB 2KBEA 2GVZC 5JDCC 4DSTA 1W0KD 1I0IA 2C8KA 1RYDA 3RIMA 2ADMA 2X5KO 3RQIA 3TG2A 1E0AA 4Q3AA 1USVA 1M8KA 4H27A 4Y98A 5TQ2A 1Q7GA 1A5BB 1K27A 5AI6A 3CISA 1A5TA 1INLA 3V7UA 3PEWA 2GXAA 1QGED 2A58A 1P4GA 4ZCIA 5I3CA 3QELA 5LQSA 2JFVA 4XWKA 1FLNA 2F43B 3I1IA 3ZLUA 3FMOB 1F9EA 1M34E 2OAP1 2VZ0A 5F33A 4RVOA 5BQPA 3W06A 3ZIUA 1FUEA 2WTNA 1E96A 5EHQA 4G4SP 1PZGA 4IGKA 3LPCA 4R84A 3FN4A 4EGCB 5EXCA 1EP3B 4HAOA 4I1RA 1U2PA 2JGNA 1J8DA 4UUNA 5E3HA 1NJ1A 3EFHA 5E6SA 4D9JA 1PQWA 1WY5A 3HVUA 3MD0A 4URXR 3RRFA 5LYJB 1U9IA 2IZ5A 3NHWA 1E66A 2WPDA 1QMGA 4RIHA 2BDTA 2G17A 2J5XA 2JCGA 4RS3A 4UUQA 1QF9A 2QZSA 4EW1A 3UO8B 3A4YA 4W7HA 4QQRA 5JG7A 5C3UA 3SQOA 1VMAA 1NY5A 5C51B 1XEAA 1JEQA 1YQWA 2P9TA 2QL6A 3HJRA 3LYAA 4G0QA 4PHTA 3VR3D 1KBZA 3AVWA 3GJXC 3L7OA 1U1CA 4JYBA 3SI7A 3V8VA 5FI1B 5EE1A 1F1JA 4HP8A 1M34A 1MVLA 2JGRA 1Z6PA 4NCJA 3SGLA 2CLFB 4OP2A 5DV9A 4AF8A 3G0OA 2FPIA 3NG1A 4GZMA 4J7UA 1L4MA 1RQXA 1E2LA 2B69A 4MV8A 2JD0A 3QX8A 3CEAA 1PZNA 3IIKA 2OCDA 2E5LB 2Q27A 4EHKA 1JLKA 1QS0A 3KT6A 5K5EA 2VNHA 1JG3A 1OI2A 2LUOA 3OIYA 4LSGA 4JUDX 4Q1FA 5FL3A 3V3KA 2VA9A 1V8OA 5H68A 1TJ3A 1AH2A 1WULS 2XZTA 5K09A 2OLJA 2WIGA 3QKRB 4GR5A 1L7BA 3H1BA 3FVVA 1UZLA 2HN9A 5DNDA 3GNSA 2AKAB 3U80A 5LSAA 3D2LA 3FBWA 2ZPTX 3CLSD 1YUBA 5AKJA 2DBRA 3ICCA 4N3BA 5KDLA 2CNWD 5KOYA 3PX7A 4ARIA 1ZGBA 4Y2UA 4Z0NA 2JFPA 4GICA 2L19A 2Z9BA 1J8MF 2HQ1A 4GECA 4WCDA 1GUZA 4N0DA 1E7WA 2VP5A 3T7CA 5J1SB 1RLMA 1FFAA 3DWGA 3PVZA 5AJVB 2DBZA 1OV4A 3NYRA 5T4FA 2Z6QA 1Z2CA 3N5KA 1ODIA 2H2HA 2B1IA 5EKSA 4DZZA 4GX1A 2HU7A 1Z37A 2GKSA 4MUKA 4IUBS 2AXPA 3LVBA 3ZCSA 2HJRA 1W49A 1PGQA 4G0NA 2WTEA 4EO7A 1EXMA 3OCZA 3COJA 3DO6A 2V55B 4G0WA 5ADUS 2VPIA 2X1VA 5L95A 1U2DA 3KEQA 2I6GA 1L5ZA 2F67A 4MR9B 3LQ4A 1HEIA 3TVDA 5IMSA 1CLUA 1DUSA 1QLWA 2PLRA 3E9DA 3IR7A 4HDCA 3ZGVA 5KBYA 3UJNA 2FFAA 4B5LA 3Q3GE 1OXVA 3EQ6A 5D01A 3I6IA 1VYHA 3OZIA 2I99A 2KPOA 4NYMQ 4PLHA 3D59A 1PKEA 2ET6A 2GKOA 1OGJA 3BJEA 5DWQA 4KLAA 1YS2X 1TM2A 2RI6A 3VI4B 5LQMA 1VSVA 4KFCA 1N0UA 2BGMA 2WFLA 2ZI5A 3ETGA 3BG5A 3D0RA 3K96A 1UQRA 4M0DA 5DZSA 3SKVA 3DZGA 3TGWA 4DOMA 2AUTA 2HWKA 4EYKA 2IV7A 4D9CA 3BKWA 2CE2X 3D3KA 3M1YA 4FHEA 4JD5A 4MZDA 4OL0A 4UW9A 3B6IA 1RJFA 1L4KA 1OBOA 2Y0EA 1SD1A 5H5JA 1MO5A 4EUHA 3DM9B 4OLHA 1SD2A 2RGGA 3EA5A 1G8AA 3GZNA 5LD2C 1IXSB 5A4JA 4OO3A 4UTZA 4A6XA 3G2MA 3L1VA 4DHEA 5K0SA 4D9GA 3VYRB 5AWFC 2VTBB 5CK4A 1SIBE 2GO1A 3DV0B 1GKKA 3OU6A 2HNAA 4WESB 1ZAKA 1NUQA 3KQQA 1Z2AA 3JQCA 2OE2A 3PF9A 4JWKA 5GMOA 3ROKA 4YRSA 2I2CA 5HR5A 2QY6A 1MB2A 2P3SA 1P4HA 4MVJG 1B8PA 1X38A 5EWJB 4KB5A 3R9XB 1JVBA 1U3VA 2PWAA 1JXOA 2PYZA 2AWNA 3VHXB 4ZYYA 4K7JA 1D9XA 4P7KA 2Q8QA 3H5NA 4P35A 1LC0A 4BEBA 1FYWA 3BORA 3IXLA 3OMLA 4RF2A 5KPDA 1L7AA 4TT3A 1KA9H 4CT0A 1UPUA 4R3NA 2P9EA 3UXHA 3ON5A 1ZKMA 4OQMA 3H19A 4YI3A 1NOKA 3O1JC 1B8NA 2NTEA 1MX9A 3OX3A 1CNEA 1PV1A 3ENWA 5B64A 4QTUB 2WTXA 1DUIA 2AG1A 2R84A 1GSHA 1UBRS 4GKKB 2G82A 2P6MA 1R6DA 2PO7A 4UD2A 4YJHA 2PUJA 4EECA 2CNNA 2Z1DA 1LDMA 3FCUB 5EKUA 3U09A 3ZVMA 4X92A 1QRSA 3Q11A 2YICA 1P29A 4JENA 4B3FX 4HATA 3RYCA 1TD9A 1TKAA 3W9YA 3KEMA 1NVBA 3T5GA 4OQQA 4AMVA 3I1JA 1MC4A 4B4UA 4ZEXA 2PIDA 1AQYA 3T3EA 4RVHA 2RGWA 5EZ5A 5AQ1A 4Q00A 2HSEA 2WUFA 2PGOA 2VJMB 1Z15A 3L6DA 3OH8A 1CVRA 3TR0A 2HKIA 2A30A 2V7EA 4TUYA 3GLRA 1NMYA 3ASZA 3WRXC 1FRVA 1I4LD 2I33A 4KTVE 3UB4A 4Q66C 1FQWA 3KSUA 3D31A 4FSXA 1XD2B 2ZUEA 2EL7A 2XDWA 3AHDA 3FE2A 1SC1A 3NUGA 3PFIA 3SICE 5LMZA 1P0FA 4FBMA 4BFYA 3S5JA 2H11A 1YRQA 2VHVA 4J29A 4G5QA 2ZSEA 4OQXA 4F4UA 5JALA 3FNQA 1EESA 2WHRA 3GXBA 1K63A 3LBAA 9LDTA 3HNRA 2VWHA 1ZUNB 1KC1A 2RGUA 2WINI 3K2IA 5CDSA 1W4AA 2EZ9A 1R6UA 4J76A 4MDHA 4MJ3A 5KNDA 4LOAA 5C32A 1R9MA 3FCXA 3GUYA 3KS9A 4PVDA 5LXTA 1UT6A 4DM3A 5JU6A 4GNKA 4W5TA 5E9WA 2GEKA 3V4LA 1TIKA 2I7CA 4ZVUA 1A77A 5AVSA 2GCOB 1FLDA 2Q29A 5J4KA 3B2QA 2XIQA 2ZBQA 2WQ7A 2E4UA 1G8MA 2QA5A 2ZRNA 5K6TA 2E1PA 4D81A 1OH7A 2HIAA 3DWEX 3QMVA 8LDHA 2BTOA 5FPQA 4L51A 4N40A 2XZLA 2IVFA 3T06B 4JMPA 3HL4A 4V0ME 5IS2A 3V4SA 1CBUA 1B1CA 1DO0A 3ESRA 3ITEA 4IX9A 2ZIAA 4MLCA 1M3SA 1WV0A 4X8HA 4DQ0A 2REOA 3VNAA 1KFKB 4EI8A 1NR5A 1F2TB 3HLKA 3H0CA 4QXPA 4RKQA 1QO0D 1SU7A 5K01A 3UMYA 3BZBA 4KP7A 1NW8A 4Y2SA 5G3YA 1M8JA 3LKBA 2JG3A 2WSIA 2RAVA 3MRSA 2PRZA 3I04A 2I52A 2ZUVA 3P2MA 1QQAA 1SA0A 1QKIA 2VSYA 2XMRA 3EXG2 1SCAA 1YBHA 5FORA 4CMAA 2RAUA 2XTNA 1TAHA 1KQOA 4NBWA 5BN5A 2VQSA 3LYHA 1PUJA 3LXRA 2V0GA 3KSZO 5H3HA 4XWOA 1NNUA 4ZI2A 3TW6A 1YCHA 2W2VA 4HXFB 4YNBA 4LNAA 4BUCA 1JR4A 2Q1TA 3G0CA 2B8WA 2OMKA 4V0MA 3THWA 2ZTLA 4UREA 5L3VA 3P5BA 2CFOA 1GPBA 4X7MA 3SYLA 2QUHA 4EPRA 1ST3A 4RH0A 3KVOA 3TLAA 5KYYA 2Q4RA 4EJFA 1TM5E 2QT9A 5T7BA 3MWGA 3BSYA 3ND5A 5DGCA 1U7HA 2JIMA 1U8ZA 3C7KA 3K9LA 1H4QA 3WDLA 4MV9A 3MUOA 2IQIA 1M5TA 2B21A 4ARSA 5AESA 1Y6JA 2FG5A 3W8RA 3X44A 1NFQA 4HNRA 4KGVA 3QTTA 3MWEB 1SOVA 4FIDA 5BQ5A 3GNQA 4WBNB 4JBWA 4GR9A 3INTA 4WA7A 3KJIA 4EKDA 3HCPA 3VOBA 4ID9A 1RVDA 3A3YA 3WV5A 1KZ9A 1OILA 1VL5A 4OMCA 4CCAA 1F7VA 3KXDA 1GU7A 4ILKA 2DAPA 1E0SA 2WWFA 2HA0A 2J07A 2OGZA 3ISVA 4FJ1A 2H48A 4GSYA 3I28A 4DXAA 5ERYA 3WYDA 3TCXB 1JJFA 4G5HA 3DZFA 4MEAA 4P3OA 4Q3KA 3U3KA 3SIPA 3WRVA 4DIDA 3GZTB 4JLVA 1GGHA 3MXOA 2YJGA 1EUDB 5FOQA 3REGA 2GLXA 1NW5A 1ZM9A 4QSMA 4YRKA 1SZPA 1VZ3A 5LQNA 1OC2A 2BMEA 3AESB 2BMVA 2NGRA 3TDKA 4KXMA 1XJQA 5KQSA 3F78A 4IHJF 3R24A 1L5WA 3B60A 1MOSA 4X7BA 5KNBA 1NBIA 1RAIA 1DS6A 4FCTA 4GP9A 1W1UA 1IHDA 4KDRA 5L4NA 2QVXX 3PJRA 1H5UA 5LB4A 3WWYA 3JR7A 3MB5A 5LJLA 1FMCA 3NIGB 3JPYA 4U6QA 3DJFA 3FSEA 1E9RA 4C6TB 2A14A 4WCVA 1H8HD 3MJTA 3SHWA 4LECA 1MTZA 1T9CA 2IF0A 3WRYC 4OHMA 5E6RA 2H1IA 4I0WB 4WK0B 5AVZA 4MW2A 3I92A 4EKIA 2R8BA 4OJNA 4OOEA 2IHJA 3DXYA 4WFJA 5LD2B 2DCMA 4AQDA 1QPBA 2FK8A 2PSEA 4F97A 1NW7A 3OWHA 2B4RO 2P5SA 2XMDA 3HJUA 5T6MA 2WM9B 3OM1A 3CTPA 4JR2A 5HDBB 2KW5A 3WL8A 5BW8A 3RRNA 1GPUA 3DMRA 5FV4A 3RADC 3QRWA 4WLNA 3GN1A 1S7GA 1S01A 3KO8A 3MINA 3NU1A 4JB0A 3B9QA 2H7CA 1DLIA 2JJ1D 1N8NA 1W5SA 3KZVA 2DFKB 3OF2A 4IIGA 1C4WA 4ME6A 3ZI0A 3ZY3A 1YSCA 1ZN2A 4X24A 5FPPA 2F1HA 1TZJA 1RZRA 1Z8HA 3MUEA 4IWNA 4AY5A 1J97A 2FX3A 5AP9A 4LOLA 2XQKA 2ONCA 2ZANA 1C1DB 1E7RA 1PS8A 2MU1A 4RGQA 4WPGA 3AZPA 2JGDA 1A69A 3BE8A 4KQ1A 4PQGA 4BMOB 4P7FA 4R71A 1I7QB 2P2YA 4A5SA 4E13A 1BJKA 3ZWXA 2A78A 4ZYWA 1TQ8A 3KSBC 1M8FA 4H3KB 1GN8A 5CT6A 2P7HA 2QD3A 3CM0A 3KJFA 4O2LA 1WU7A 2X23A 4YXWA 1L8QA 1GCOA 2BCGY 2W11A 1SBYA 3AP3A 1XYGA 1AKNA 3MCUA 1PDVA 1QHYA 2P2ZA 1SKAA 1OPRA 3VU3A 1SHJA 3M1LA 2Q1UA 4DJTA 1M76A 2ODBA 5AVKA 4PQYA 3X2FA 1ZXLA 2RFLA 1XZJA 3ADBA 3ROFA 3O8CA 5EIXA 2DLCX 3LU1A 4PZLA 1MV5A 1VE5A 2HPVA 1VIMA 3FD8A 3EMOA 3W5IA 1Y1PA 4HH3C 4ND7A 3GLGE 3SF8B 1SY7A 1WRBA 1VMDA 3D0KA 1I0ZA 2I67A 3GRUA 5ALXA 3KKMA 3H13A 1QG0A 1NE2A 1Y1SA 3AR8A 3IDQA 1IOZA 3E9NA 1V4NA 3F9RA 3PR1A 4HGYA 2BM8A 2XMQA 4UULA 3U13A 4BLOA 5EC8A 1TYCA 4BTEA 1GQFA 3LUDA 4RVGA 1NI3A 3WK9A 3EGIA 4CN8A 3WNBA 2VQEB 1KZ6A 1MJGA 2DQ4A 1LPAB 4NDAA 5AH0A 3AQ4A 3EEYA 3RARA 3R9WA 5B12A 2C4MA 3OIUA 3N53A 2X0EA 3BULA 1GLVA 4QEZA 4JI7B 1UPCA 2HCRA 4Q7EA 1TIPA 4Q3NA 2RH8A 4D44A 4WY8A 4BHRA 3MN1A 1SFRA 2DPLA 2NZUG 3H7AA 3ZBTA 4EKEA 4O8CA 3PA8A 3GLGA 3T9FA 4JODA 4KL8S 2E89A 3ZXIA 4XB1A 5EJ7A 1NQVA 3DTVD 1Y98A 1QQ7A 3L0OA 4QHTA 2NU9B 4IW3B 4KDFA 1PCXA 1RWNA 1HFJA 4QFDA 3RSLA 3ZD8A 4B6OA 4C76A 1XLWA 3E4CA 4CCYB 1NT4A 3F6YA 4XOUA 1DB3A 5CYPA 1RHJA 2CNLA 4OJKA 3L4EA 5FO0A 1G98A 3L7KA 4W6ZA 1G64A 3PHHA 3WZLA 4E4RA 1N2HA 3G8AA 2DQSA 4UQLA 4ZQHA 2BELA 2DZDA 5ES4B 3VU9A 2EX4A 1ECLA 3UHJA 3UMBA 2EWMA 1JHDA 4NYMR 3QQ5A 3OOEA 1DINA 3ZC3A 2QSJA 2EGGA 2QKYA 3FPAA 3WIVA 5JZBA 2W37A 5KUTA 5FFNA 2Y66A 4J0QA 3MGKA 1E6MA 4OGGA 5BVGB 3SZUA 4F4IA 3IQIX 2P1RA 1Z5PA 3U1BA 3K7EA 1GYQA 1RI4A 2NPIA 1V3TA 2G5TA 5J4YA 3T1NA 4AECA 5BOSB 2PKXA 3C5EA 5CNKA 4J7AA 3V8EA 1MGOA 1YKSA 2LR0A 4GLBA 3P71T 3BCHA 1NNLA 4F4DA 4BQQA 3SQXA 1PJCA 1U8FO 4XR9A 4DIEA 3D4PA 1A9TA 3JATB 5MFPA 1IUOA 1W93A 3KWFA 4GGMX 3SQNA 1JA0A 5EJ8A 4WOBA 1C7JA 3MS2A 1EJ0A 1DIAA 3U9SA 3UAGA 4OBEA 2GK3A 4RTJA 3AU8A 4ZOAA 3T1YB 3RHSA 3WGLA 4DUYB 1ADJA 1NMEA 2W58A 4LOKA 3QEKA 4LXTA 3RVKA 4F5YA 5HKOA 2WJZB 3AUJB 2NSHA 1HTTA 3UMSA 1UXKA 2XUFA 3HBFA 1KC3A 2O1WA 1MRSA 1XDBA 3CI0I 2OQIA 3HFJA 4G1BA 4MHOA 5FHQA 3S8YA 3TCKA 4RTOA 4BMDA 2GN1A 3TF5A 2HOQA 2HRBA 2ZK7A 3RS4A 4NNJA 4UPEA 5DH9A 5EKDA 3TRDA 4TTJA 3HB5X 5BSTA 2KJQA 1KEVA 4FFDA 1P1KA 5LBTA 4LYGA 1ZYUA 3P0RA 1YWGO 2A5GA 4YRRA 4U8HA 5EIBC 3TQFA 3MG9A 2OCPA 4BN5A 1G59A 1R0YA 3LJKA 2I5PO 3FZNA 5FOWA 2DB3A 1VSTA 3DTVB 1CQJA 2QDXA 3OEEA 4UNNA 4S3MA 3V1NA 2QXYA 3IUSA 3T7KA 1AMNA 1ANKA 3OE5A 4L0DA 3GWZA 3M7IA 1U8CB 4KIFA 1JJBA 4LF6B 3DD5A 3I2JA 4IWXA 5TC4A 2ZYIA 4QRHA 3N39C 4Q6WA 5FFMA 1X0XA 3QOXA 1NJGA 1NULA 3FB1A 4NMLA 1UMDB 4RA6B 3A27A 1ZJJA 3JARB 5E4TA 1OY1A 5B57C 3T0GA 3VAAA 4F6CA 2P68A 3EGCA 3O91A 4LDRA 4WY5A 1S2OA 1S2MA 3KNZA 5BPHA 2Y0DA 5HGJA 3RBVA 2LGJA 2J3LA 3DOIA 3KWJA 1MOPA 1CETA 1PLJA 2DTXA 3A0RB 3OWOA 2WNSA 1U0EA 3T7EA 4E32A 4ZDJA 5B6IA 5M7EA 3ZVRA 3G7UA 3A2NA 1NJ6A 4L2IA 4G5XA 2H07A 3BF8A 4RK1A 4NCAA 1CLEA 1EU1A 2NPFA 2H1LA 4OQPA 1XDDA 2XUQA 1TM1E 3U4AA 1Y33E 1ZSNA 1XGKA 2FPSA 3WVNA 1QE0A 3C1AA 1LU9A 2II6A 4LKRA 2XCRB 5FOXA 1JJAA 4F8YA 3BXOA 5BMVA 3COPA 1JAYA 2QORA 1BX3A 3N6VA 4KBGA 5DLQC 2XLCA 2IEZA 4K05A 1IM5A 4IJ5A 4FXOA 1ZXBA 3KLOA 1GTZA 3ND9A 1PT6A 1PR4A 4ZAXA 3UGKA 3VSBA 2ZQYA 1G0OA 5CGQB 1VYUA 3WLKX 1VPTA 2G8LA 4R2JA 4GH5A 2H2FA 3KKLA 3AL0C 4H7PA 4NSNA 1PSZA 2P91A 3HO6A 1QZTA 1HRKA 3PNLA 4KNVA 4LDZA 4Q4JB 3VYWA 1DX6A 1QBGA 2CV2A 3AUYA 2PR2A 2WJWA 1VG0B 1X87A 1SXJC 3D8HA 4LOIA 4BP1A 4E1VA 4EUKA 3WGIA 4HRXA 2FEMA 4IZ6A 5C7OO 5FXMA 2JI6A 3H2YA 2QEQA 2B1QA 5JSZA 3GGDA 4QVIA 2P8SA 4H2DA 5ALDA 2QT0A 4MO9A 3REFA 5FAKA 2FPPB 3T9EA 1HLFA 2H4FA 5C7YA 4EYGA 5JRJA 5LQCA 1GPYA 2QN6A 1KAOA 1VKHA 1AG9A 1YRLA 2HWWA 2W93A 3I9MA 1N3IA 3LCUA 1NKTA 1QV9A 3CQ9A 2VPZA 4V0SA 3CS3A 5K3OA 3L4KA 2NPOA 1U7WA 1WXQA 4TMTA 5TPWA 2FZGA 2FMHA 3EF1A 4NCHA 4OJYA 4RQUA 3ZLVA 3A31A 1CZKA 2ZSJA 2NUPB 3MRXA 1JN0A 1HO3A 3O0TA 4ZO7A 2B30A 4Q03A 2Y1EA 4C01A 4ZCTA 2PYDA 2ZM6B 2JJQA 3DT6A 2J85A 3AFGA 5TJ9A 5L6LB 4OFZA 4DDKA 4G2TA 1LY1A 2JCYA 4ZI7B 3DDZX 1MUUA 5JVDB 3ZZ1A 4BNFA 3QLTA 1ENYA 3OEWA 2QJOA 2W90A 2W8BA 2EFYA 5EXPA 5IYZF 4B4DA 4EDFA 4J0CA 4P1ZA 3V8RA 3D7NA 4WOCA 4C2BA 1QDEA 3DF9A 4TKZA 5I7AA 4C6RA 1L4EA 1Q16A 2D2IA 2P2GA 4WXRA 5TMBA 3UUGA 1NLFA 3EAFA 3V8NA 9ABPA 1ADGA 3EFEA 3GVPA 1C3OB 3TI9A 2HJHA 3E84A 1KYYA 2ZBUA 3DEIA 3VI3B 1RQRA 5L40A 4R1SA 1XRLA 2YXLA 3AJ9A 3GN2A 3T0FA 3RC1A 2WHXA 2I62A 3IPRA 2HBZA 2WK1A 3GB9A 4QUGA 1MP0A 1C7RA 4KMSA 2XNKA 1V26A 3NGMA 3DFIA 3RODA 4K03A 4PO9A 4ZO6A 1OB2A 4AY2A 1IAQA 2XIJA 2YBDA 5AXCA 1SQGA 1AGYA 1F20A 1NA5A 3F3YA 1JTVA 2C2MA 1W85A 2D5AA 4Y18A 5CH8A 1JSXA 1P4JA 2R8XA 2XOKA 3PEFA 3VNSA 2VNSA 3A6KA 3AM4A 4J9VA 1RMQA 3Q5EA 3VPAA 1U3TA 1DQSA 2J3JA 4F6RA 2X0KA 2ZVDA 2HPAA 1FU8A 5EIBD 2JI4A 3F1KA 4YTEA 2BHTA 2VF2A 2FCRA 3JCZA 5DBFA 2GPAA 2W6QA 1CDEA 4Z51A 2XYPA 1Y5RA 4GXQA 1ZU4A 4Q34A 4XB6B 1ILEA 1MQAA 1YZ3A 2BKVA 1RQ2A 2Q3JA 3HADA 3HWX1 3KZ1E 3Q72A 1VBNA 4JYCA 4EKYA 1WJGA 2HMAA 4YPOA 1E9CA 1XZHA 2Q5JA 4BFTA 4O5AA 1U3CA 1BFDA 2VVTA 4Y1FA 5J2UF 5LU8A 1XZEA 2G70A 1JAZA 3BK7A 1KR2A 2P79A 4LDNA 3HRHA 2VLIA 4IOJA 4PO8A 1KEZA 1L6RA 4RIEA 1PJLA 1HURA 3FSRA 4U9HS 3P7MA 3UN1A 4ITUA 4B2PA 6LDHA 1D04A 4XQEA 1BE6A 4GBGA 1FS5A 5DE3A 4WINA 1AQ6A 2CL5A 4UAUA 3SZLA 2PS1A 4IV0A 4PAGA 1X8JA 1NF8A 1SOWA 1YHZA 2HA5A 3BBLA 1JXMA 4L4SA 3IUYA 4BX8A 2C9BA 1ORTA 3JYQA 5KYWA 2GBPA 2QD5A 1T5OA 1WDTA 3WMXA 1GGFA