3COYA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 2.05 ang resolution- in complex with sulphonamide inhibitor 3
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
288
structure length
280
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Inhibition of Mycobacterium tuberculosis pantothenate synthetase by analogues of the reaction intermediate.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 93
structure length 280
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2008-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3coyA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3coyA01
4OJMX 3N9IA 3P52A 2D5BA 1R6TA 3IODA 3IOEA 4MUKA 3P0IA 1T6YA 3AG6A 4H3SA 1WXIA 3IOCA 3KT8A 3N2YA 3TS1A 1M83A 4OUDA 4JZYA 1GN8A 1DNPA 3A4IA 3IVCA 3H9BA 4ZCQA 4U63A 1N2JA 4UZEA 1F4LA 1T9GR 1M8PA 4KKVA 3ZJUA 2NSYA 3C8ZA 4JYZA 1M8FA 3CVYA 1N75A 3D6VA 3FETA 1J70A 2IELA 1MB2A 1XJQA 2OQ2A 3ZUGA 2CT8A 3KFLA 3DV2A 2QUHA 2HZ7A 2WQ7A 5FNZA 1WY5A 1F7UA 3UK2A 3CA8A 3NBAA 1F9AA 4MW7A 1NUTA 4MW6A 4NDAA 1O0BA 2DXIA 4BWVA 3K9WA 1ZUNA 3ZXSA 4MVCA 3MLAA 1KP2A 4FZJA 1U7DA 1D2RA 4A91A 4I6GA 1K4MA 4MWDA 3MLBA 1KQNA 1EUYA 1N1DA 4I6JA 3IMGA 4AQ7A 1IFXA 2JANA 4ARIA 1GAXA 1IQ0A 3CLRC 3MUEA 4E1AA 1FFYA 3PNVA 4MAFA 1G8FA 4DNXA 3IVGA 4HJXA 4F4HA 1JZQA 2NZ2A 1OBHA 4L2IA 1IHOA 1ZH0A 1K97A 1PG0A 1G59A 3FIUA 1T9GS 2CFOA 3CLRD 1NUQA 2J08A 1M1ZA 3FI0A 1U3DA 1MB9A 1RQGA 4U8HA 1N2IA 4ZCRA 3LOQA 2HMAA 2B7LA 3CVVA 3HZRA 1XNGA 3G59A 1YI8A 2A4MA 2QTRA 4MWEA 5DASA 2QTMA 2A86A 2R5WA 4RUKA 1O94D 2A84A 2QJOA 2EJCA 3SP1A 1KORA 4HK4A 1N2GA 4Q93A 1EFVA 1OWPA 1QRUA 1WXEA 1X8XA 4NAHA 3M5WA 4MUFA 4YP7A 1MJHA 5JBNA 5J5AA 2A88A 4JXXA 3KT3A 3ZXIA 1UFVA 2BTEA 5DK4A 2DERA 1GLNA 1V47A 4ZCSA 3ZIUA 1KQOA 1NZJA 1F7VA 1KH3A 3TZLA 3TQIA 1OWMA 4EG4A 1QNFA 4YMIA 3A05A 1KH2A 3K32A 4J75A 3U1VA 3AFHA 4XFDA 3AG5A 1WQ3A 4ND7A 1GTRA 5EKDA 4HJRA 2J4DA 4K03A 3OP1A 1PFUA 3GLVA 3PNBA 5FO1A 3COWA 1JECA 3ND6A 2X0KA 1JEDA 4U7JA 4NX2A 1G8HA 1O95C 4MW2A 1WOYA 2EL7A 1JIJA 4WNYA 4ZT5A 3NBKA 3SZGA 4WSOA 1OD6A 2QJTA 4DDKA 1QRSA 1JZSA 4Q16A 5TS2A 3FWKA 3AKZA 3CVXA 1O95D 1QTQA 2ZUEA 1YIDA 2PZ8A 2V0GA 4MWCA 1O97D 2E89A 1QU2A 1I6LA 4QRDA 1J1ZA 4DDMA 3H9CA 4MUJA 4PBTA 4EF6A 2RD2A 1U3CA 3KT6A 1X6VA 5KHAA 1JIIA 5KCMA 4MUGA 2I1LA 1J1UA 4G5YA 2XRZA 1WXFA 2DR2A 3P0JA 4EG8A 3L93A 2YXNA 4KR6A 2AZXA 1PG2A 1JIKA 1MRZA 4DE5A 3X1MA 2DUMA 3IMCA 2CYCA 4MVWA 1TYDE 3ILVA 3F3MA 3HV0A 2G36A 1QU3A 4NAUA 5H7XA 5LM3A 2QUJA 4J76A 2X3FA 3QTBA 4MW9A 2YWCA 1IH8A 3ZJTA 4ZCTA 1N2OA 2J5BA 4EG6A 1S4MA 3VGJA 3CVUA 2GOYA 3TZEA 3DO8A 1TYCA 3QTTA 3NV7A 4L2IB 4EG1A 4EGAA 5IJXA 1NURA 4R2LA 1N2EA 5TEVA 3CVWA 1A8HA 3COVA 3RBAA 2VTBB 4NATA 5HG0A 3GMIA 1YUMA 3X1KA 1EFPB 1JEEA 1WQ4A 4MUEA 2CUZA 1MAUA 3RHSA 5K0SA 3JXEA 4EG5A 1WJGA 4MW5A 5HUJA 3RK1A 1NSYA 1U7XA 2QTNA 3S3TA 1N77A 2DLCX 4ND6A 4MLPA 1WXGA 3OTWA 2VTBA 2C5SA 2A1UB 2TS1A 1O96A 1EFPA 3HGMA 4AS1A 1ULHA 3CLSC 4MULA 1J21A 1Q77A 2O5RA 2A1TR 3Q12A 1EFVB 3COYA 3FNRA 1M8KA 2A1UA 3IUEA 2E18A 4X0EA 4MVYA 4YBRA 1OBCA 1I2DA 2GKSA 2Z3VA 4P2BA 3IMEA 4YP6A 2Z09A 4EFKA 4ZT2A 4KPUB 3UY4A 2E21A 3N05A 1H3EA 1R6UA 3TQOA 1EE1A 3AL0C 5J58A 1U0BB 4MWBA 4MW4A 1M8JA 3ND7A 2AG6A 2PIDA 3DLAA 4KPUA 1PFWA 3RK0A 1GPMA 1T6XA 4CT0A 2X1LA 3FH0A 5DEOA 2X1MA 2RE8A 3PXUA 3TNJA 1MAWA 5BNZA 1EXDA 5H16A 4TS1A 1WXHA 2A1TS 3Q4GA 1KR2A 1KAQA 1COZA 3SDBA 1PFVA 3UC5A 5J59A 1EJ2A 1MBZA 1VBMA 2DEUA 3COZA 4R0NA 3CLUC 3FOCA 2J07A 1IVSA 2J09A 4MW1A 3Q10A 4R2MA 1NUUA 1NUPA 3H05A 2YY5A 3CLTC 1GTSA 1TYBE 2D13A 3AIIA 1QJCA 3VU8A 3FHJA 3ZGZA 1Y42X 3N8HA 1VBKA 1R6XA 3KT0A 2PFSA 3BL5A 1O0CA 1P7PA 2O8VA 2DETA 4MUHA 3LE8A 1IRXA 5K0TA 4RPIA 2QUIA 5LLTA 1KAMA 4KR7A 1VBNA 4MW0A 4CDMA 5IHXA 1M8GA 1WKBA 3I05A 2CV1A 1MOPA 1LI5A 1TFUA 4MUNA 1Q11A 3CR8A 3MMXA 4PY2A 2JAXA 5TEWA 4QREA 1VL2A 2QJFA 3L92A 5DB4A 1XNJA 3HMQA 4CQNA 3H99A 2A7XA 1K92A 5TGTA 3HFJA 2PZBA 3A04A 2BYTA 1NUSA 1JMVA 2WQ6A 1B6TA 3HL4A 5F23A 3GUZA 3LCJA 5HUHA 3ZJVA 1PFYA 4EG3A 1O5TA 1IQUA 4ZT3A 1OWLA 4ZT6A 4XSVA 1O96B 2ZUFA 1H3FA 1EUQA 2CV0A 3PNYA 1KP3A 5KWVA 3IUBA 1J09A 2WSIA 4ZT7A 3FDXA 1T6ZA 4DDHA 1H1TA 5LFAA 1TEZA 1N78A 4G5FA 4G6ZA 3ISJA 1JILA 3FY4A 3FG9A 1ZJWA 4MUIA 1LI7A 4QBTA 1Q19A 3H97A 3CLSD 4GU5A 3IOBA 4NZPA 3RJZA 1XNHA 1K4KA 3MXTA 1V8FA 1FYDA 3DPIA 4S1OA 2CV2A 1NP7A 1QQTA 3SEZA 3SYTA 1O94C 1N3LA 4F3RA 1KH1A 1G8GA 1H3NA 2QUKA 3E27A 3SZ3A 4MQ6A 4JXZA 4PBSA 3RFFA 3ND5A 2CYAA 1YUNA 2XRYA 3UOWA 1YULA 2VXOA 2WB2A 1VLHA 4HPWA 5AHWA 2YWBA 1I6KA 2JA2A 4GRIA 4PBRA 1ILEA 2AKEA 4MVXA 1LW7A 4ZT4A 4UZFA 1SURA 1O6BA 1BS2A 1OWNA 2CYBA 2GM3A 4OUDB 1YIAA 1IQRA 1KKUA 1NYLA 4EG7A 4XFJA 3G5AA 1JGTA 1NI5A 1N2BA 3PRHA 1QRTA 3UMVA 3X1JA 2IP1A 3IVXA 2E0IA 2PXHA 2ZP1A 3VRHA 1JHDA 2CSXA 3P0HA 2V0CA 1OWOA 3ELBA 3A2KA 2D54A 2DPLA 1ZH6A 2IJGX 2HGZA 1Q15A 3G6KA 4DJAA 3IDFA 4YP5A 1GZUA 3IH5A 1N2HA 3CLUD 4I6EA 1MC1A 2PZAA 2H29A 2H2AA 3QE4A 5FO0A 1TYAE 3CLTD 3INNA 2OV4A 1CT9A 1O97C 4K0RA 4DLPA 4CDNA 1I6MA 4KR9A 1TQ8A 1HYBA 2PG3A 3SEQA 1J20A 3D6UA 4ZCPA 2Z08A 4JFAA 4ARCA 1WZ2A 1KQPA
chains in the Genus database with same CATH superfamily
2OLKA 3BWBA 4KFTA 2BMDA 2Z5FA 2QW1A 2YYYA 1EVYA 3E8MA 1N9GB 2VAMA 4AD8A 3IOEA 2R60A 4KTTE 4DIDA 2JI7A 3G5MA 3L1UA 3KYDB 3THRA 4KOAA 1JG2A 1LBHA 4LXUA 2XNHA 3AH8A 4QG3A 2I4MA 3IOCA 3GFSA 3EMKA 2HAEA 3Q2KA 2CSUA 2ZIEA 1XCJA 3ZJ4A 1FLDA 2Y6VA 4ZGBA 4YCNA 2JK1A 1GFZA 1PEAA 4IDFA 4C0WA 5EZSA 2W83A 3NMUF 3S81A 4YXWD 5KMGB 3Q8KA 4KKVA 4E11A 1K86A 3C8ZA 3I3SR 4CEIB 5FR1A 4NLLA 5FI3A 1W29A 2GYYA 5A3VA 4BLSA 2BAGA 4Z86A 2R7MA 4IDNA 2IELA 2OQ2A 3II6X 3WL4A 2I8AA 2V7PA 3R6LA 4JYPA 4M9ZA 4N7MA 4YAJA 4ZQFA 1TQ6A 5AP9A 3TUJC 3UTCA 5DLDA 3F73A 4DS3A 5LMNB 3BFJA 2C8VA 4HDKA 4ARAA 3RTBA 1XRMA 3BZBA 3MT8A 2O59A 1NXPA 1HG1A 1ZIYA 3B8EA 4UBIA 4YAIA 5K8VA 1Z18A 1P72A 1YAHA 2G04A 4YRLA 2OG1A 1XXHB 1P73A 4I1IA 4PFSA 5LUBA 2AXPA 1TU3A 1C80A 3ELUA 3QELB 4NY1A 5FFMA 5ITVA 4QVKA 3L02A 2UXCB 1GITA 3O9MA 3X1YA 4LISA 4JX8A 1QH8B 3BSSA 3DEKA 4GO1A 4MWDA 3RBZA 4RM3A 1Z5GA 3S28A 2LKDA 3O8RA 3R9XA 3UT5B 1YDHA 3I2KA 3CQ9A 4HAUA 3TCNA 1A9QA 1FUIA 1KU0A 5JEDA 3K1AB 2EEZA 3LA6A 1FFYA 1XHLA 1S1MA 2C42A 4IQ0A 3C70A 4MV9A 3ZW8A 1FY2A 4CG2A 4O2BA 2YN4A 1SXJB 2J7PD 1YKSA 2OCDA 2PXCA 4KL8S 4X3PA 3S5JA 1XVLA 2R8BA 2WP8J 3P4YA 4NOJA 5ER6A 3RUHA 4LI3X 4IHJA 4IIUA 3W34A 1T2DA 2AKAB 5AJTA 4B4OA 4QUKA 3Q6IA 3HDYA 2JB9A 3BXPA 3H11B 3VBCA 2PL1A 3IT0A 3HI4A 3ROGA 3HO6A 5KTYA 4AZTA 1TZBA 2J0UB 3K3PA 3HZRA 4PSVA 1FS5A 2WHEA 1EKXA 1ZSYA 1Z8FA 2WJ3A 2I52A 1QIMA 5MGNA 4GX0A 5FTLA 3JZAA 4HGPA 3GV0A 3CSDA 3GAFA 5FQOA 3LP8A 2HZBA 4Z9FA 4B43A 2PGAA 4DA0A 5AUQA 3WC4A 4BV2A 2AOTB 3SP1A 1P2DA 2ORED 3RAJA 2F55A 2XTNA 3GXBA 4QBHA 4XW2A 2PYZA 1N2GA 6REQB 3NT5A 2D1FA 5LDDC 1U5BB 5CEJA 1Q0SA 4Q4HA 5FR2A 3NVMB 1E79D 4BQNA 1TGYA 4HZUA 2Q1SA 5JZOA 5JBNA 1X7XA 2OAEA 2GA8A 3JATB 5DX0A 3SXJA 3VKFA 4N5DA 4HLUC 4K40A 5EYPA 4DNQA 4L4ZA 4EEXA 3B6JA 1UH5A 2BWJA 2HRDA 3ECCA 1LFDB 1U1GA 1O5IA 2WP0A 3I34X 3OO1A 4WLUA 4ZAVA 1J33A 4G4JA 1J2JA 2Q1WA 1WMEA 1QQ6A 3ZKWB 3BK2A 3U09A 3UA0A 3ZIUA 1QYCA 2PE5A 4OXXA 2V3CC 5JISA 3U3KA 1L7QA 1PIWA 1ULTA 1GIAA 4MQ5A 4R1MA 4M7WA 2ODWA 3U7JA 4DBVO 2JI6A 2VP4A 1DRUA 1QE3A 2VK2A 1US8B 1B2LA 1NPYA 1QHXA 2XA1A 3LQKA 3NTLA 3VPGA 3KLNA 3P5BA 1SVMA 3QSYA 2QTHA 1OLUB 1WCIB 4WCDA 1NR7A 1ZC4A 2X0KA 3P2EA 1W46A 4U7JA 4D8WA 3EVTA 3IKTA 4HXFB 1NMQA 2PX2A 2ZVQX 4F9TA 1Q2UA 1FP1D 3MWEB 1FFBA 2WV7A 2VDPB 2HLDD 2YJZA 3V4PB 4US2R 2IZ7A 4JJIA 4ENTA 1GT6A 1K08A 1AKTA 2KW5A 4GMGA 3RRFA 2WDPA 2XF8A 3LLMA 2AA3A 3IP6A 3SKXA 3WMXA 2GESA 1QZ3A 2GRUA 3EGWA 5GV7A 1WY7A 3CE9A 2LCIA 4IUDS 1UT5A 2VOJA 2XYHA 4II3A 4M1MA 4PYMA 4JGGA 1L4KA 4YWJA 1JDNA 3RS3A 4CR7A 2VF7A 3RH0A 5AKGA 5ALVA 1AM4D 1GCUA 3FNHA 4TKZA 5I4BA 3RTCA 3V6LA 2Y76A 3CGWA 1B16A 2XOEA 1JDVA 5FTKA 1NBAA 3ZK9A 3HYNA 4NG5A 1L9KA 3SDSA 4RPKA 1UBMS 1I30A 2VA9A 4IDAA 4LVOA 1NDUA 2C29D 4Y2XA 4OI0A 2PKQO 2I7DA 4M1SA 4U2DA 5CEEA 3IRUA 2XF2A 1RYNA 4WA8A 5COQA 3SVLA 3ELYA 2RGNA 3F2VA 2VZ0A 4JVSB 5FT9A 3OFKA 1MDBA 4HF7A 2HO5A 3S6JA 5JFTA 2B92A 2ORVA 2Y0CA 3H2SA 5A3SA 4NDNE 2WWVD 1P6UA 2DR2A 3UB3A 3X1MA 1TK2A 1NF3A 1J2RA 1UDRA 3B1KA 3EZNA 4G09A 2CYCA 2IGBA 5LA6A 1QHIA 2RC5A 3HU3A 3LBFA 1YFLA 1MZVA 2AW3A 1YQUA 1ZH2A 2VPZA 1KSFX 2H31A 2C4WA 4J8PA 4NCKA 3H13A 3N87A 1TAGA 2FETA 4WGFA 5KJEA 5BYBA 4ZV4A 3B89A 1P4HA 3D8TA 4NAUA 5JY1A 1J23A 2K6GA 2QUJA 2GM9A 1SK9A 4GIBA 1A5TA 4V02A 1U0HC 3DP7A 5DZSA 5K3DA 3RRZA 3WP1B 3F9RA 5DNUA 4F6RA 2ZAYA 3FPJA 1M6EX 1KYIA 5CDTA 5HQ3A 1JG6A 1NOKA 1K8QA 1RAGA 2VDWB 4WY8A 5FBHA 2XLBA 1KRXA 2OBBA 2OHGA 2IDJA 2J31A 4B9AA 4G9GA 2GPYA 2O7RA 3JQFA 4B3JA 2GZDA 5LYJF 3A1FA 1D2CA 3GBVA 4FHGA 4HVLA 4NYJQ 3M5CA 1Z06A 3RRXA 2BGUA 1WF6A 1B8UA 1JEEA 2ZS7A 2ZSIA 3BMQA 4FLMA 3D8UA 4P6VF 1NNSA 4N8SA 1IDOA 3L4SO 5FLXA 3KIPA 2O05A 2HU7A 4FTWA 2B2CA 2CHFA 2P41A 4PNHA 1F06A 3EG9B 3EFOA 1E7MA 4JKYA 1U8EA 1Z5UA 1X8LA 4FMCF 2G9VA 3L04A 4AS1A 1UKBA 5HOQA 1QIEA 1IPFA 2OZPA 1C3EA 3REFA 2DSTA 1SUEA 3R4CA 3HFSA 4CFSA 3G82C 3I73A 1NF9A 2PIAA 1UM9A 2OXIA 3I9KA 4LJ4A 1M8KA 3QHQA 4OG2A 3RJ9A 4F1KA 3SEFA 4ENUA 3EGXB 1TLLA 1GV1A 3FD8A 3VPDA 4EMSA 1G16A 2GEJA 1G2QA 3V34A 1KY2A 3A11A 3DXXA 1A5ZA 3QVSA 4CLOB 5CU7A 1Q3KA 2CL7X 4XUCA 4RTQA 4UDOA 2QQGA 1PKEA 1WUJS 4KV9A 4BKQA 2IITA 6ADHA 2JAQA 1UC4B 4QEDA 2O2DA 1HQCA 2PUTA 3A70A 3IT3A 4A0SA 3G2IA 3ETHA 4GGMX 1XZQA 1AGNA 1JEOA 1ITZA 4J2TA 4MQFB 3CXRA 4XWWA 1BWRA 4ZXFA 2WJVA 3BD7A 3RK0A 3UK1A 1BWSA 4FJ2A 5JYCA 2IHYA 3A9UA 2JBAB 2Q21A 1GR1A 1VJ0A 3RSZA 4GX2A 2IEAA 3H2JA 4PLWA 2RE8A 4HB4A 3NGMA 4KUGA 4DT1B 5LQAA 2WUFA 4LDAA 1N57A 4YLGA 5FOWA 1A27A 4YRAA 4QWWA 5I9MA 5INTA 1YB2A 3NYQA 5DIFA 3EQ6A 3RU9A 2IUUA 3WIOA 2D5CA 4M37A 1D7OA 2WE7A 4JK3A 1YBHA 5TR9A 4C6TB 1NIPA 3MTJA 2XGGA 4Q82A 1PJ2A 1WHTB 3RS7A 1NPTO 5CT5A 2WKSA 2GBPA 3PYXA 3GEDA 2ZRJA 2ZS9A 4GZ3A 3LT4A 4F92B 3IQIX 4NPCA 3AF6A 2JLRA 5CGZA 5G2FA 2J3IA 1CRLA 1JU9A 3V4LA 1UJCA 4P0PB 4GZ6A 4KN9S 1KVQA 4JLUA 4RKEA 2IUYA 4GWGA 3VYTB 5AO9A 4GHWA 5LQNA 5GOTA 2ZBPA 3TN7A 3V2UA 4ONEA 2FSGA 2IU6A 1M2OA 3SFTA 4BB6A 3KQWA 2HJ9A 4R5MA 3RS4A 3H19A 3BG5A 4BZPA 2OVFA 3QMWA 3D2CA 1HYGA 2W7TA 4P33A 1B3BA 2HPVA 5BSFA 2OP0A 2YOHA 5T41A 2Y1KA 2IYAA 4C05A 1I94B 1YVUA 2AG8A 4UARA 4QWMA 3S68A 1YXMA 2C8KA 2IKSA 4XGQA 5AK6A 4Z3OA 4UM8B 3DFUA 4WOJA 3R9IA 5BNTA 3G6WA 2QL5A 5GGYA 2F1KA 1GTJ1 2FWRA 4PO3X 2QPAA 3NANA 2B5OA 3DZIA 1COWA 2B1QA 5IHXA 1JIVA 1WKBA 1Y0BA 3DFFA 1HC7A 3QVGA 5I01A 3WYNA 4PYJA 1Q11A 1RRVA 1WMFA 1RZVA 1ZBQA 3MM4A 3MMXA 2A3NA 1TMYA 3G0CA 1M1NA 4RHFA 4JBGA 4BVGA 1XVVA 4B3GA 3PGKA 2P2CA 1PGPA 4UHDA 1C1XB 2P40A 5TGDA 3DAPA 1RKVA 3PJDA 5TF0A 4Q7EA 2XKBA 3GCWA 3DDNA 3WOHA 4OP3A 5HGXA 3K6KA 2PUEA 4AIRA 4F4IA 3JAKB 1NVWQ 1WHSA 3I6ZA 3NWEA 4V39A 1D6JA 2OTCA 1NJ1A 4TMVA 3ZN2A 1EFUA 2EERA 3LHDA 4I1UA 5HUHA 1DDOA 2GZRA 1FTYA 1PFYA 3MILA 3ZXUB 3QGMA 3NC4A 3WK9A 4O29A 2P4SA 4MLDA 4MPRA 4X1KB 1XTQA 1BMFD 4IBOA 3Q8WA 5I9BA 3V7WA 4DR6B 1D3AA 3B1WA 3K20A 3UWKA 1AURA 3E84A 5IVPA 1KJZA 1UADA 5IMBA 4RELA 4FGSA 3PC6A 3BHIA 3WMGA 5AVUA 5ALOA 5L6MB 1SXJC 3QU5A 5AI0A 5HFAA 4L0DA 3HABA 1MGOA 1XEAA 3DCNA 4RGYA 4UVEA 1H1TA 3MBOA 3ZHSA 1GA1A 1TJ5A 5CITA 5CJPA 1ZHOA 2V97A 1KRHA 1ZIPA 3EGCA 3GCXA 4XAQA 3RJMA 3K70D 1V2GA 5FJJA 1RQPA 5TGZA 1LWOA 1DC5A 5M34A 5C8YB 2OCPA 2W58A 3HJBA 4LXYA 3P94A 3SZOA 1VG1A 4NZPA 3GY0A 2EIHA 3R5SA 5U4QA 4BLUA 1KO5A 2BMAA 3BGOS 3RSHA 2W6PA 3QUQA 4ZPJA 1T0BA 1Z6QA 1EUDB 1FMCA 3E3NA 3NHJA 3AW8A 3BWVA 2DPGA 2HXGA 4O5OA 3NVDA 1VCOA 2XKJE 4G0YA 4TXJA 2NO0A 4W99A 4ZAZA 3A0RB 3VHQA 2C9YA 3KKNA 3HR7A 4RV4A 1Z5ZA 2WM2A 2QNRA 2KSQA 4LZJA 4DEYA 3D4LA 3E27A 1C30B 3PLAE 4HNAB 1QP4A 5FYQA 2XUZA 4KVFA 5FTNA 2R8OA 4IOLA 2YH2A 2JL1A 2VWQA 3NHKA 1X8KA 2RSLA 4P38A 3Q8MA 5GJWC 5K6AC 4RVDA 3TLYA 2J5KA 1BD3A 2VXOA 3AI7A 3UAXA 3KYBA 4CZ2A 2WB2A 2X8LA 4MIEA 5LZ7A 3HCWA 3L18A 1XTVA 4FDMA 4NZZA 1RAAA 1ILEA 4GX5A 1S01A 3BD8A 3FF1A 3M1YA 5PGMA 3M3HA 1E9AA 4OB7A 3UEOA 4AJKA 4BVEA 5HM8A 1JQBA 2C04A 4PAMA 4WHMA 1BS2A 2BW0A 3ICPA 3B1JA 3SJAA 4BB9A 5BRAA 5EIEA 5JY6A 2W42A 4TUYB 3KVOA 4NP6A 3HCBA 3EPRA 1E1NA 4C2BA 2WJPA 1DQYA 2FTKE 5E6UA 4ZVUA 1CJMA 5TDHA 4PNPA 2ZSUA 4GPBA 2FY8A 4BNDB 1HFKA 1VCHA 3QRWA 4J2OA 4B0PA 5BVGA 5AW0A 5A06A 1FFWA 1JWAB 5HS4A 1DWUA 2HPHA 3GFVA 3KHSA 3W2TA 3ZDBA 2R66A 1GUFA 4FP9A 2G4VA 1ZI6A 4ZDKA 3NFRA 4HBZA 3G89A 1E2DA 2OILA 4TTVA 3ORHA 4QOJA 4KPEC 2R1ZA 1YNSA 3K2IA 4JD5A 3NCHA 4WNIA 5ETJA 5IAGA 4N3BA 1FMJA 4V0NA 2QN6A 2C78A 1FDSA 2FSPA 4NJMA 1QLJA 4REOA 5H68A 3VJKA 4IWYA 4E5YA 4ZMRA 2PMDA 4RKYA 4MHTA 2OZLA 4HSGA 1X38A 1KU6A 5I7SA 4YJDA 2ZAIA 5JH7F 4WIAA 3BUSA 3ST7A 1YQQA 1XQYA 2H1WA 2PWBA 1XO1A 2YJ6A 4GX1A 1E58A 3KQUA 4MS3A 4B34A 2PO7A 1Z0JA 4PS0A 4K6GA 4FOPA 4HDRB 3W79A 3R20A 3CVOA 3IPLA 2O8CB 3ZGXA 4D4JA 2XMPA 1U8UA 2E5WA 4OQXA 4ARCA 3CF0A 1NC1A 3EGIA 1GAQA 3A7DA 3Q7IA 3UAVA 4Z4HA 5KQPA 1XELA 2Q6KA 4GKKB 1PL8A 1B3RA 3P52A 3BL6A 1GLGA 4X45A 4XKJA 4H0NA 3MGAA 1VC2A 4BP1A 1I3LA 4QFBA 4P82A 4LI0A 2BOVA 5JO0A 4LFAB 3E22B 4AX4A 1SK8A 1M34B 4ZAXA 3TW8B 1E1QA 1M83A 2NO7A 4R9NA 1SKMA 2FEPA 2XOKD 4UZEA 1T34A 1U7TA 4BLTA 5LSAA 3QJ5A 4JENA 1GQRA 1T9GR 2IXEA 3EEIA 5EZYF 5A6SB 3RC1A 4H18A 2HW8A 1FFGA 2A5DA 3GIWA 1U2PA 2VLIA 5C46F 4W5TA 1A9TA 3NOXA 3TTXA 3WLNA 5KNCA 4RVCA 4RDXA 3E8XA 1I5RA 1ULUA 5E7QA 1R88A 3QE0A 4QBFA 2Q5JA 1LRKA 4QLAA 5E8JA 2J30A 4JI4B 2ZJ1A 2IYNA 3F6PA 4RZHA 1TF2A 3A58B 4R9SA 3TBHA 4ZCIA 1L5WA 3HBFA 3IUMA 1O03A 3TVTA 3UNXA 4TLDA 1DRKA 1PV2A 5ABPA 1SUWA 1XSEA 3JASB 4MW7A 2DXIA 4JIMA 5A05A 3IJRA 3W7VA 5C3MA 4F8EA 3EEQA 3K9WA 3H87A 1H05A 3NWJA 4EW3A 1UKAA 2VCHA 2XA2A 3DCIA 5CW1A 3STWA 3ESBA 2EFGA 3L4BA 1G6OA 1D2RA 4GG1A 4ZV9A 3OEHD 3N0RA 3J7TA 1O87A 2WNSA 3BJIC 3GIDA 1IATA 2ZRAA 5C31A 1IIRA 4YT2A 5KQMA 3ILYA 3DXZA 2NQ2C 5EVCA 2NU6A 1MX5A 3RKUA 1IU9A 3FGPA 1GAXA 4XGIA 1D4AA 4EHKA 4OM7A 2HLHA 2QMOA 3R9WA 1ZD2P 3V48A 3C6MA 2NO1A 3QYJA 2Q7DA 2COKA 3W4IA 1EVKA 4FLEA 2ZRMA 2QVXX 2W4QA 5FPKA 2H1VA 3QUTA 1X1AA 3JWEA 3LGAA 1MTZA 3NNDA 5CJ2A 5K8LA 4A26A 3FCUB 2FK8A 1U0OC 3H8JA 4JT4A 5A0VA 3U4QB 2BUCA 5BUCA 2Z2YA 3GT0A 1RWBA 2ZXEA 1R9NA 3BIFA 4PICA 1MB9A 3OUUA 4WOCA 1WTAA 4ZQGA 3USZA 2LIPA 4QC2A 4ZCRA 2REOA 2BELA 1R3DA 2VSOA 2CEAA 4M60A 4OH1A 3A1SA 3TIGA 1LJUA 1F8XA 3A25A 2EX4A 1CY6A 1OXMA 3N59A 4Q7KA 2HYIC 5IYZF 1NWHA 1CUBA 2J45A 2ZTUA 3EGDB 3HXPA 4GR4A 2R5WA 5J63A 1V71A 3ADKA 2DM6A 2XKAA 3PPVA 4D4HA 3S5UA 4GOLD 5LIRA 5JNLA 3OPNA 5E7IA 5BSUA 4UM5A 1ZOIA 2VP0A 4MARA 4V1CB 3CR3C 1EFRD 3R1IA 4J7UA 4Q66C 2AR9A 4UCQA 3S2FA 3WAJA 4K5QA 4IQGA 4AZ3A 4MVJI 3O82A 5CTJA 2UKDA 2VSXA 1GARA 5HRUA 3LY5A 1JQEA 1KRWA 4YJ2A 2ZVDA 4JLSA 1PT9A 3PWKA 5DSTA 3SQNA 4IJUA 1NJ2A 2PVSA 5EP3A 2X2EA 2HHJA 5JCJD 1HE2A 2HK9A 1MENA 5EIOA 2GHRA 3DFZA 5EWLA 3TZHA 3HCPA 3QE3A 4PM4A 3UMCA 1GRQA 2I87A 1OC4A 1TT5A 4E2ZA 4NYIR 4CM8B 1OB2A 3UM9A 4CM4A 1C81A 4ZCSA 1ZFNA 2Z2IA 1UOPA 1IYZA 3NB0A 5BN3B 2GCPA 4LN1A 4PYLA 1ZESA 1LPPA 4DMUB 4OAQA 3TM5A 5CVEA 2ZIVB 4ANFA 1EAMA 2PN1A 4JBXA 4YV1A 3BC1A 2VK8A 1BQEA 3BFVA 2Z8YA 3I12A 5D01A 2F1OA 3GJ6A 4TVOA 1X39A 3V4OA 5KQRA 2R6DA 1Y4ZA 4QXAA 5C32A 5AW9A 2LD4A 4AG6A 4AN4A 3GLIA 1LDEA 1G8MA 1OFHA 4W6ZA 5EQJB 3SQOA 6Q21A 2D7DA 2C2YA 3COWA 3TG2A 3VNUA 4DM3A 2FZGA 2YZGA 1FMTA 1O9GA 4Z9BA 2ZDQA 1LW6E 2YDYA 4TGLA 2Q0XA 2XV1A 4B6JA 3JSXA 4LMBA 4ZT5A 2XXBA 2Q3CA 3HKEB 4WSOA 1JPNA 2CL0X 2IIVA 4CDGA 3TTYA 2QJTA 4G5SA 1HFJA 1JZSA 3OLVA 3PKZA 3P0FA 2PCLA 4TQAA 3JWGA 4YQEA 1WQ1R 3PRYA 2FSVC 3KQVA 5GQSA 3UATA 5AVYA 3RF7A 3L6DA 4D92A 3PVCA 1YIDA 2PS9A 2O0JA 2QAGB 4LG1A 4B85A 3G7UA 4HB0A 2F9FA 5I8ZA 2E89A 1CP2A 4N12A 1GILA 4LTDA 4MZXA 2FPSA 1WW2A 3T15A 1XZGA 4D96A 3OPVA 2BZGA 2EHDA 3KWFA 1Z4PX 2SCUA 3CNLA 3A3OA 4JASB 3N5KA 4MUJA 4U2GA 4YASA 3T0IA 1G38A 3PX3A 1AF4A 4EEKA 3PWTA 1TZKA 4DXDA 1DAGA 2I1LA 1XEXB 1V6CA 2PK3A 3NQ41 3TAUA 5HHTA 1UDAA 3B36A 4JLAA 2X4GA 2P9BA 4MVJF 2AZXA 1XMPA 4O25A 5L53A 3CW2A 1W73A 1ZH4A 4HQNA 4NU6A 1NAIA 4RHTA 4ZANA 4K88A 4RD0A 2FR8C 4IFEA 3LGXA 1HX7A 1AKEA 3IJ5A 2GPNA 1DO8A 2V5VA 4JT2A 2NZUG 4HAWA 2G36A 1SZJG 4OHCA 4WZAA 3MWYW 3C6KA 5JDCC 5I7EA 3DAFA 3WHIA 5CBKA 4Y67A 3RIHA 1N2OA 4NNPA 3EQ9A 4L28A 1GPUA 2WIFA 4XCQA 1WUKS 1PTJC 1GXSB 3TZEA 3V3TA 4JB8A 3HUFA 4XPZA 5ILGA 2ISCA 3GVHA 1LRLA 5K2OA 2FLKA 3LCUA 5LKRA 5JJBA 3C6ZA 4MGKR 1QOPB 1SHZA 5TEVA 2PH3A 4OGGA 2V7EA 4KE9A 3NGLA 4HB3A 4M9CA 3EXHA 3VR1A 4L73A 1CUZA 2H51A 4RA9A 4DB4A 4RL6A 4QDOA 2CUZA 1MAUA 2Z4SA 3QPAA 4LYAA 4PIMA 4JL6A 4N48A 2Z95A 2DPMA 3TX6A 2CEKA 3PQ6A 1QAMA 4MW5A 4CM9A 4DUGA 1I51A 5BQ5A 2BGWA 5HIJA 1XR3A 3QE2A 4YRIA 2GCGA 1UBCA 7ADHA 3I4CA 3VPBA 1YJBA 1WPGA 3SVTA 4NABA 2ALJA 3FTNA 1YAJA 2DE0X 3B2EA 3CR7A 3K09C 4Z9AA 4QXRA 3AUUA 5F51A 3F47A 3FCSB 1V5EA 3CW9A 5HK8A 2NTYC 3MB5A 3OZAA 4MULA 2WU0A 3MMNA 2QRHA 3P9QA 4KQ6A 1SHUX 4GGOA 4NOKA 5CM8B 1DAEA 5IK2A 4JWKA 5AW8A 3ESQA 5C5CA 1MX3A 1XAJA 4KVGA 4ZVRA 1QHFA 2GEUA 1CR1A 5AK0A 4BFXA 3NM5A 4P3PA 2QNBA 5HA5A 3H2IA 1V5GA 2RK6A 5DK6A 1YTUA 3W9BA 2ZBUA 4M87A 4UHBA 4ZVTA 1L5GB 4WLVA 4DV5B 3WDLA 4NMLA 2P69A 3VR5H 3ZGOA 1GG8A 5JMPA 4KPUB 5DTQA 1QORA 4WCFB 5KAPA 5JAIA 1H3EA 1FVOA 3RRNA 2UYGA 2EKLA 2V3VA 2W6ZA 5DHTA 3VDMA 5LP1A 1SUCA 3BGIA 2YUIA 4RVUA 4G86A 1Y8CA 2Z58A 1EB9A 1ZLYA 4XSGA 4QOIA 2FFQA 4EFLA 3KTAB 4KAFA 3OP4A 2AC2A 3LY9A 3BGDA 1GPMA 1DTSA 5E4FA 2FPPB 2BBSA 1XB2A 5ECYA 2V5AA 5JD3A 4F8JA 1X9HA 2X7XA 1UK7A 2WE8A 2ACWA 2Q3EA 1W581 1WPQA 1OUMA 4OKIA 1G18A 2OENG 2JG3A 5BWBA 1DQSA 2QD1A 5ULLA 1UIRA 5JS1A 2FU5C 2G9RA 1ENOA 1ODLA 1SU8A 3VU9B 3MC1A 1Q16A 4ACAA 2ZPTX 5B4VA 4HCJA 3A6PC 2XE4A 2OWEA 3OQPA 2IRWA 4UHFA 1LA2A 2QAIA 3SDBA 4KH0A 3AVYA 4RWZA 5J59A 2EKPA 3S8EA 2C3UA 3NTRA 2JLCA 2R44A 2QP4A 3ZE1B 3RPEA 4B84A 2HWWA 3ASZA 4WFIA 3FOCA 3DHEA 1DPFA 3H1FA 2DYKA 4YJFA 3NHZA 4QUGA 3RHFA 3T7EA 4X5OA 3ZPXA 4D42A 1AG9A 2XPCA 5EKUA 4RZSA 3LVRE 4ALMA 1ML4A 1NX9A 3EYAA 1NKVA 3G9XA 3JYNA 4H9GA 3QKRA 4JC4A 3ZD6A 4EOGA 2MSEB 3SF8A 2R1TA 1YJCA 3GLFA 1ICIA 2GTPA 1Y3AA 2AJDA 2Q07A 4Y30A 4XEHA 4ZI3A 1QYDA 1QF7A 1JL3A 2JFWA 3B9PA 1HE3A 1PR3A 1NWCA 2Y66A 3LX5A 4INPA 4FZRA 1QOZA 3TB6A 3TLBA 5CD9A 3MHTA 1J8FA 3IUJA 2H92A 4MUYA 3MFYA 4CLEA 5JCXA 3E2IA 4EMTA 1OI3A 4NL4H 3N8HA 4IDGA 4Z4QA 2QX4A 2O6HA 5REQB 1BE6A 1KK2A 4ZO6A 2IU4A 3DO6A 4EX6A 4PN7A 2ONKA 1UKZA 2Q8NA 1U1IA 3MJDA 2ZSBA 3TQHA 2IYQA 2QMUA 1FQWA 4ECEA 3FKSA 2I6SA 3FDJA 2YYAA 3VDNB 4C20A 4HP8A 1USGA 1YFZA 2BV3A 3BRWA 3L0IB 5HIMA 1DBWA 5L9AA 4RPGA 5JAQA 2QIPA 4UHCA 3T7JA 1GOTA 1ZIDA 1SOUA 2XEXA 3EJWA 1R37A 1R27A 3DH0A 5DYNA 2VXCA 1DXOA 4G89A 4S1WA 4B0OA 4MLCA 3CPHA 1VSVA 3WYBA 1QKIA 4MP3A 4CQNA 4GSLA 1XCGB 2BJWA 2A7XA 2HO4A 4C3VA 4A03A 3RSLA 3F90A 1MH9A 4Z1MD 3B5EA 2PLNA 2WSSD 1W85B 1RHQA 1NUSA 3B7GA 1IY8A 4FB4A 3H5OA 4MQBA 2JH3A 2SKCA 4HYQA 4CGZA 1L2TA 3LKDA 3FVVA 1BS9A 3QEJA 4QOHA 2JFFA 4WCVA 3YASA 4EY7A 2HEIA 3ZJVA 4UM9B 3HM9A 4LJAA 1YB6A 1M5RA 1IQUA 1PJ4A 1UBGA 1B42A 1YACA 2YRXA 3GC6A 3ZZ1A 5J4KA 1K9VF 4CGYA 1H4SA 521PA 1TA9A 2P62A 2P1RA 3HP7A 2H1LA 4CL8A 2Y8EA 5A7HA 1JWBB 4C89A 1OSNA 3N2ZB 1EUCB 3F3YA 3DR3A 1GCGA 2J3LA 4J9VA 3VMMA 4BNGA 3I9OA 1BFUA 1Z4NA 3MT7A 4CR6A 2BGTA 3GLGB 4Q4LA 1NOIA 4O33A 3QKSB 1T6ZA 4DDHA 1TJ3A 2ZK7A 3VX4A 2W11A 5J40A 4I55B 1UJBA 4Z4FA 5L8VA 1SOAA 3MCTA 4HLQB 2PQMA 1T1SA 4IKEA 3B1FA 1H5NA 3ZXXA 4TZTA 4EARA 2NT4A 1OPXA 2ONZA 1CCWA 2BVNA 3E9CA 3OICA 3PITA 2WTMA 4P22A 2Y93A 2Z9CA 3NUZA 4G0NA 5GPBA 1AUVA 1E3MA 1QZXA 3WMEA 2NQ8A 1DIRA 3KCNA 1E6EA 4ML3A 2O2IA 3RYIB 1U8XX 1K6MA 2GVDC 3F5SA 3MWDA 4RVGA 1KAHA 2VJCA 3M3PA 4ARUA 3OKFA 4UCXA 4R2JA 4AUKA 2BMWA 2W0MA 4M54A 2P6NA 5CXSA 1TC2A 4KFUA 1G8GA 2H59A 4W5OA 3D3QA 1N6HA 2J6IA 4TQUS 1C4XA 4JXZA 1Z0IA 2HMTA 4LWPA 3QV2A 4YRNA 3R0JA 3ND5A 4K86A 3ZWXA 3CX6A 1DB3A 4YPOA 4BAGA 3TLGA 3EBLA 3TW4A 2C5AA 5BQXA 1N0VC 4AW9A 4WT7A 1VLHA 2CK3A 3AR9A 1QTRA 1I6KA 1FDVA 3ABSB 1U9CA 3OI7A 2QTCA 2H9AA 3K71B 1ONBA 4BVHA 1KXJA 2O20A 1E7SA 3IAEA 1QP7A 1OV4A 1UDXA 3NP9A 1ZAYA 1SVSA 4D98A 1AHPA 2GM3A 3QPVA 4H1VA 1GRVA 3QLTA 2ZANA 5GAJA 1E59A 3UJNA 3T9EA 4UUMA 1P2BA 3ZIDA 1VM6A 2OL4A 2VP2A 3HVUA 4NENA 1TAUA 1GL3A 1NNUA 4BVBA 4QJBA 4DMRA 2B30A 1I1NA 3COJA 2BEVA 3RFXA 3RS9A 3QNWA 5L4LA 5IVKA 3HGQA 1D9ZA 1TEHA 2IQ5A 5KX5B 2VN8A 1ZAKA 2V0CA 5TJHA 1BMTA 1CHDA 3Q5GA 4JJEA 5FNVB 2ZFUA 3U3DA 1RXIA 2BFMA 1R3UA 4UAGA 1DUIA 3U7RA 3BIJA 3LC7O 5H9VA 4EBFA 2OBXA 5AICA 3WK6A 3THOA 4I6EA 1PT5A 1ZXLA 1P1CA 1NJSA 1SOVA 2PV0A 3HUEA 3TPCA 3VHRA 4C7JA 4JCOA 2GFQA 2H29A 4PVDA 3VJLA 5BMVA 1CNMA 1QONA 4HI0E 5CK5A 4AJ4A 2QAGC 4EB3A 2BGMA 2DKNA 1XKTA 2JJ2A 4MV4A 4RVSA 4G0OA 4L07A 1NZDA 4RK6A 5JSZB 2Q3MA 1IM2A 1QHGA 2OZKA 1EJ6A 2FMHA 5E4TA 4LXIA 4K0RA 3EDCA 1GSOA 1RDFA 4OI2A 4LF4B 3HZHA 2PAAA 1CFJA 4HH1A 1QG4A 3W7AA 4MGEA 1FXWA 1KDTA 1H9BA 1S3GA 2OCYC 2W8BA 3HACA 3NHPA 3PUKA 4JFAA 4B5KA 4OJMX 2C7QA 1M1YB 1U2ZA 1HA3A 5J1TB 1CIJA 5I6DA 1ZL0A 1J8MF 4ICIA 1T9BA 4QGAA 1Z74A 2LV8A 3BIOA 3L84A 4HLDA 4FVTA 3U44B 1JHYA 3OKAA 4P5DA 3MRVA 3ZI4A 2HD4A 1CKEA 5B7QA 1G21B 3IVCA 5KVQA 5ALHA 4R05A 3UJBA 5E95A 2DUNA 4F2WA 1IHPA 2BM0A 2PSHA 1ZOSA 2WYHA 3LBNA 5CM9C 1MOZA 4CQJA 5K45A 1D2MA 1X0VA 4NU5A 3FLAA 2GXSA 4I1PA 4Z4IA 4NU8X 1QH1B 5CVJA 5LOVB 1Y9ZA 4JIGA 1FNNA 2H4XA 4XGNA 1T5LA 2X0DA 2XMRA 4MYSA 4EH1A 1YS7A 2I8CA 3NNNA 4WNAB 3CO5A 5BNIA 1Q7CA 2HZ7A 2ZPAA 2P65A 3ZVMA 1U9JA 2HF8A 2PZFA 1W5EA 2CDNA 2O3QA 4LHZA 3A3YA 3IQDB 4CVNA 3IEXA 3MS4A 2X5NA 4ENPA 4C4OA 2P2NA 1U3TA 2AX3A 4TLAA 1SA0A 3ECSA 4GLLA 4W82A 2AXNA 2GD2A 4EYQA 4PAOA 2J3HA 3WBFA 2JGEA 3WV4A 4XTRA 1MT3A 3MLAA 5F7ZA 1FP4B 5FWXB 4J1NA 2ODQA 2WFLB 1XPRA 5DBGA 3F8SA 2GN1A 4I6GA 4OYRA 4X54A 3RYHA 3PQDA 4YXFA 3RAFC 1H66A 2FPRA 3ZZMA 4X93A 2PH1A 1NIJA 2DLNA 2KBEA 1AKMA 1KJ8A 1N2SA 4H31A 3PNMA 4KAJA 1JBEA 5CAEB 1GDTA 1IQ0A 2OORA 4GOMD 2IPLA 4JLMA 2GFHA 1D0IA 1ZPDA 4D4GA 3T7TA 2D5AA 2P4HX 3GA7A 2R0QC 1BXKA 1BCRA 4KFRA 1TA4A 4C78A 2R9VA 3VPFA 4G9BA 3C15C 5TMDA 1CUWA 1WX1A 2HF9A 2UUOA 1MXHA 3LAWA 1K97A 3O1HB 5AM5A 5FOXA 4A0QA 1JS1X 5KS2A 4HXEB 3CISA 1C7RA 4N5IX 3FIUA 1TIPA 4NBSA 5LDHA 2Z6QA 5E9QA 3QPBA 5LLDA 3DZDA 4OHOA 4M46A 2O8FB 1W4ZA 3BSFA 1K7EB 1TDJA 3I32A 2BFFB 3KAKA 3QVKA 1CYDA 1OT3A 1VG0B 5ESXA 1N6IA 4GOND 4P7FA 4UXIA 2G76A 3EISA 1PUJA 1EQUA 3QH4A 4LK2A 4TKLA 1H2XA 3NWOA 4QOFA 4WCFC 2WJGA 4M9UA 5CX1A 4CQLA 1UOEA 1DKUA 3OTOB 3P4XA 2FPXA 3O91A 5B1EA 2QLNA 5FLEX 1EWQA 4OB8A 3K73O 3HN7A 3HCOA 4DBLC 1G3QA 1V7ZA 4B3RB 3LSYA 3U1TA 3BPSA 2ZSDA 5EIFA 3LFHA 5JV5A 1PE0A 1JBQA 3CFYA 1ONPA 2QJWA 1IZZA 4H1UA 4S0XA 4E51A 3MGGA 3N53A 2OFPA 4M2LA 1OPRA 1XEFA 3AF0A 1MJHA 2Q2OA 5T3UA 5J5AA 3N2IA 3UPDA 4JV5B 3U5ZB 2C7RA 2VT6A 4IO1A 3KAJA 3C3WA 3HR8A 4S3MA 1CK4A 5JCPA 4QJIA 1VE9A 4Z54A 4M0PA 1L8LA 1CUJA 1USIA 4HWOA 2VF5X 4TYMA 3VM6A 2P9JA 1A9PA 1YV9A 2P68A 3NBMA 4R1LA 4XRRA 3RREA 3WSVA 1NZJA 1IJEA 3ROMA 5AVRA 3WLLA 5BSGA 1PWYE 1EYZA 5KYWA 3DT9A 2HA6A 1PNTA 5KJCA 4D8UA 1CPYA 1T10A 2FG5A 2PL3A 3AFHA 2WWGA 5K7SA 3PQCA 4NMWA 2OO5C 3QOFA 3NTUA 3PFWO 3HCCA 1OX4A 1USVA 1WQ3A 3NORA 4I99A 5K0NA 1TD9A 2J4DA 1K9SA 2J46A 1RC1A 2IGTA 3GFTA 3L05A 5C8YF 5JXHA 5FEMA 1ACMA 2GVNA 1U2RA 5B7PA 1I3OA 2Y9MB 1B8OA 1HEUA 3LC2O 4LMRA 4X7PA 2I2XB 4FYHA 2H2HA 3T6KA 1X14A 3THWA 4DMHA 3BWYA 4Q16A 3P97A 4DEXA 4JYAB 1CS0A 1FFXA 5FCDA 421PA 1VYUA 1ZXBA 1U7WA 1O95D 2HFKA 1V11B 2LIVA 2VRCD 2ZSAA 3AKEA 3PGA1 3W9SA 3GLIE 1UC9A 4WXRA 2ERXA 2BH9A 2IC5A 1CSEE 5ED4A 1MABB 1ENPA 3K8ZA 4GGPA 3NRJA 5FKJA 1X77A 3MD9A 4OB6A 1LLFA 3AV3A 3BZUA 3MJHA 3OTQA 2N46A 4LXTA 4ZA2A 4CEHA 4QRDA 2DR3A 4RHEA 5C3UA 1M2VA 4GM0A 2QRJA 4D0SA 2V7GA 3F9CA 2J0VA 1H2RS 2O0KA 2VZ8A 5KC9A 1N2ZA 3BX1A 1A8IA 4BRZA 1JSXA 5KOJA 1TU4A 4RY8A 3ACDA 3HA7A 1GPWB 4F46A 4BMDA 4DDWA 1WCXA 4UMVA 1U4NA 4I8XA 3NONA 2B25A 4XDHA 2WHPA 4Y98A 5B2ZA 4CLRB 5KWSA 5BR7A 2ZAGA 4LVUA 3GQBA 3VYSB 4C4SA 1GR0A 1P2SA 2DWQA 4TUYF 5EQTA 3IV6A 1JQLB 1BXGB 1FXUA 2F59A 4WQMA 1TCCA 2XB4A 3PGJA 3G5TA 3THYB 1UJ4A 3KJEA 4K9NA 3HDGA 3AMVA 1G3UA 4Q9LA 3RVPA 3RIMA 3TSAA 5FDFA 3OCWA 1YRLA 4JITA 3TDNA 2WSBA 2VP3A 3HSSA 4LJ6A 5CDUA 5LXTA 3Q7SA 3JPWA 3PVZA 4Z7NB 2HSGA 1M1UA 3WAGA 2O7NA 2ZZKA 3IPRA 4BPRA 2H7YA 5GMOA 3KVRA 4DY6A 3D4OA 3HCEA 5CT4A 3D7RA 4DM4A 5CVUA 5LC1A 1JR3A 4NC9A 3ZY2A 3STUA 2R6CA 2YIDA 4ZMBA 3B13B 4B4KA 5BW0B 3A3NA 2PX5A 1YGYA 2YCLA 3T5MA 4QTUB 2JH8A 3UT0A 3K53A 3O4JA 1YUMA 2V6IA 3H1GA 3Q11A 4FMDB 4RWEA 2PBLA 1E8NA 1WQ4A 5D7BA 2PD4A 4A23A 4ZZIA 3L1KA 2FFHA 4XYLA 4E03A 1DJNA 1M54A 2BDTA 2PWPA 1ZNWA 3GLQA 3R6TA 2NIPA 1Z0FA 5H3LA 3NIGB 4J1TC 3IULA 3PJEA 4LE0A 4ND6A 3UJPA 1WXGA 3OTWA 5H4HA 3JD3A 3PHJA 1R6VA 2AOUB 1EA7A 1JHUA 4B33A 3DEHA 2REBA 3PWZA 1KBOA 4C0XA 1U5CA 5IZ4A 1DC3A 1JI3A 3JWJA 2IOFK 3LKBA 5LLSA 4CMJA 1T2NA 1EXVA 1Z68A 4C7OB 2BLNA 4D79A 3V33A 4O8CA 2ZXUA 5EXDA 4RFSA 4QHYA 4Q19A 1PVOA 4HXYA 1N5OX 3B1VA 3G2OA 3I52A 1Q74A 2VF4X 4G8JA 4MRMA 4MS1A 4MVYA 4OQPA 2BFNA 4HDAA 4AJIA 4BNYA 2Q5HA 3WOVA 1YMUA 4TKVA 2Z09A 2ZR8A 4GKJB 4RX1A 4ZT2A 3C16C 4EVSA 5KHLB 4QFMA 5KAMA 3JS5A 3O31A 4G4SP 3BCUA 1GYQA 2AUTA 5G4LA 3UFXB 2KPOA 2NYAA 4MWBA 2KQUA 2Q62A 1SQ6A 4C0LA 1F51E 3O3NB 4ATNA 3A0UA 5EIWA 3N2GA 3P0EA 1KOGA 2FXVA 1SKQA 4WK2B 1D9XA 2R00C 3CTMA 2WKPA 2ZSFA 3I45A 3LHKA 1P19A 1Z2PX 2PGNA 3AHIA 1YRHA 4M9RA 4PTLA 4PPGA 3WLFA 4KWTA 1IUNA 1TIBA 2JI4A 2RBKA 4P0TA 1Y81A 2Q4BA 3B1XA 4B6QA 4KR3A 4TXHA 4C07A 1BEEA 3QVWA 4XASA 3KEMA 3IKLA 1ZLXA 2ZJZA 4ILKA 5EHXA 2D2EA 3EXAA 2ZR0A 2VYVA 3HB1A 1U0GA 2I34A 1PEDA 3O84A 4XOUA 2O8BB 1XTPA 2R85A 3Q4GA 3QLVC 2EWVA 2JLAA 2WTXA 3RT7A 3SFVA 2HCFA 3BB1A 4KHPB 4QM6A 3I92A 4RORA 3M6LA 1PG5A 1TB4A 1HZZA 3X2FA 3ESDA 5DGTA 3H4TA 4D26A 1IXRC 1AN9A 4JP1A 4J0QA 4BO0A 1CULC 1QCZA 4QU5A 3DOCA 1IVSA 3DC7A 4KN8A 4DQUA 2VQFB 3S1AA 2Z1NA 2ACVA 2OUKA 4OPMA 4PW0A 2GXAA 3NXSA 2A8YA 4ZO7A 3RV3A 5FV7A 3MCUA 1DADA 1T0JB 3MERA 1KZHA 3J80A 2VXYA 1A2BA 3UGJA 3ZQ4A 4X65B 3B6EA 3OQNA 1PO7A 4KIJA 1G2OA 4OF4A 1LDMA 3R5TA 4E7OA 2AF4C 5HE9A 3MCZA 4QE3A 3TM4A 2CHEA 5DOZA 2FGKA 1KEEA 2W43A 3SC4A 4BNZA 2E55A 4R5HA 4DR3B 2H7XA 4MJLA 1QX3A 4M76B 3MRXA 4ZO8A 4CMHA 3DD5A 3USCS 3GU3A 4RTSA 1F2TB 1W87A 1O0CA 4IIJA 4DNPA 1H2ZA 3ZHOA 3GJTA 4DSOA 2C96A 2OXFA 1P5HA 4EK9A 3RJ5A 1AMNA 1RVDA 3A6FA 1LY1A 1KAMA 4KR7A 4QUAA 2WHRA 5TMPA 3AEKA 1T5SA 5AVOA 4W5RA 5CH8A 1RMYA 1SQ5A 3LXXA 4MCJA 2ATVA 1OC2A 4JUCA 3CNBA 1Z5PA 5B3AA 4MUNA 2JS7A 2H0QA 4TKUA 1CE8A 3A9CA 3HBNA 1WSDA 1N5JA 1ETUA 4FE4A 1PZXA 3Q87B 4OYLA 4D44A 4EI7A 1RQ2A 4YX9A 3GJ7A 5KIAA 4D74A 3SJUA 4M7PA 4D4IA 4S1VA 1T15A 1XPJA 3WE7A 2B99A 3GJSA 4ZQCB 1IWPB 3QW4B 3DV9A 3OQ1A 1M7BA 4L95C 1PYGA 1SBCA 1XVTA 2W6NA 3BE8A 4RJ2A 4G65A 3LKZA 5K05A 1CEYA 2AK2A 5FOVA 3S8YA 1MN6A 4TV9A 3TLZA 2IYXA 4ZOBA 2YOFA 1L4YA 4BFUA 1CX9B 4ZT3A 4ENRA 1DKQA 1X7GA 2ZUFA 4DLLA 1P75A 3EC2A 3L7IA 3AHCA 3B1ZA 1AN0A 5AI5A 4EG0A 2CNDA 1SRQA 4G37A 1EFTA 3WNVA 1HF3A 1RFGE 1SBHA 1XQ1A 1XYYA 4HBGA 2EDCA 5JLJA 1TZ2A 4QDTA 3L6OO 4QU9A 1U7OA 2M6RA 2YMQA 1C7EA 3WRXA 2X5OA 2J3QA 1NBEA 4MINA 2WEKA 2GAAA 1NP6A 1OAOA 2ZYIA 3ISJA 3KQMA 4G6ZA 4H7KA 3WZ2A 5ISMA 2IOFA 2AFHB 1MO4A 3AVPA 3N8GA 3DBOB 2D1TA 3LCCA 4LRTB 5F5LA 2HI0A 4BO2A 4NPAA 1YWGO 3U4AA 1OFIA 3NWBA 1X80B 4LPSA 3KV3O 3IOBA 2H00A 4YJHB 5LQKA 1UWCA 4OBWA 1FBTA 3CX8A 4DPLA 1RABA 2M1ZA 2Y9PB 2ZG6A 3WQRA 5CLJA 5THKA 2XUJA 5ALEA 1VSUA 3H2BA 4HAYA 3CFAL 1QGED 3RYTC 2WF6A 1XA0A 3SEZA 1WSAA 1WSBA 2PNJA 1NN5A 3MUOA 3RFVA 1O94C 4GMHA 4YV0A 1BJTA 2AC4A 2FP3A 3CCCA 3T0FA 5IT0A 1RLUA 2GW4A 1IG3A 3KU1A 4Z4GA 4CF5A 4CMIA 1L6IA 3TJMA 3SZ3A 1SIWA 3C97A 4JYCA 1B8NA 5IS2A 3IUQA 1BE1A 3QUAA 1X2EA 5FH9A 2Q2NA 3C1TA 4CTNA 2JDIA 1B26A 4GBED 1YUNA 3WQQA 1PNOA 2XDQA 3EVNA 4E14A 1QYVA 1V5IA 1CUFA 4PBRA 3L7DA 5A0TA 1OLOA 4FFBA 1ZNXA 4O4JB 3VPHA 4CI0B 1NBWB 3KDSE 1PZHA 2I6FA 1XZMA 4UZFA 2WAXA 3GRYA 3AETB 4WFJA 5HF6A 4ZEMA 4ZI7A 2MYPA 2H0AA 2WMDA 3SE7A 3ZCRA 1K3TA 1X1RA 3DV0A 3KZNA 1Z28A 2O7QA 3EUWA 3CN9A 1HDIA 3VKHA 5JS8A 4KXNA 1NI5A 3H1EA 5IBPA 1WB5A 4P35A 3UH1A 2BR5A 3BBPA 1BW9B 3I01M 4Q3LA 3R7DA 2D3WA 1JLKA 2E0IA 3INRA 2Q6IA 2W2OA 4AO6A 2XWPA 1MO5A 1OXTA 1T1GA 4LV6A 1GSHA 5E2BA 4RY0A 3UXEA 4PR0A 1ULZA 2HN9A 1OXSC 3A4MA 1XJ0A 4U0JA 4N6GA 2EZ9A 3R7LA 3WO1A 2IJGX 4LGVA 4ZU1X 4G1EB 3TUIC 4NSNA 1RM0A 5LZ8A 2PT5A 3RKRA 3ZY3A 3QOWA 2I29A 5I4KA 3HM2A 1LNZA 3IDFA 4YP5A 1FUEA 4UVHA 3PDJA 3MQ2A 3NAQA 4ZIRB 3BEDA 2GD6A 1X15A 1GQOA 4D9BA 4JUFA 2JFOA 4ZHQB 1R8YA 3LU1A 4L7VA 2FUKA 3K6SB 2XWQA 4KVZA 2VG8A 2XUDA 4R6WA 4R8MA 1YE8A 1NJ8A 3L7KA 4G0QA 4UKDA 3ZWQA 1UBJS 2PHZA 1QIJA 5EJIA 3KSDO 3L79A 5F5NA 3O2SB 4URYR 4EJFA 4N01A 4TWBA 3IBSA 1HYBA 2V45A 4H0FA 3WWPA 3GCZA 2JJYA 2F8TA 2PSJA 4A1OA 1AZSC 3NXKA 2G09A 4XDGA 3GLKA 3M82A 5F1KA 3VNQA 3GYBA 3ZCVA 1YVRA 3A3PA 3EFEA 1R6TA 2C0CA 4MV7A 4AULA 4MUKA 2DULA 2KWIA 3GOHA 2H7CA 5J5VA 3NDIA 1QWSA 2GK3A 2D1QA 1IE3A 3KT8A 4KRXA 3GHHA 4BEJA 4OUDA 5CLQA 1YOVA 1X3SA 1E6WA 1GPDG 1P1FA 1SEVA 3A4IA 3GMDA 3ND8A 4JBHA 4BUJA 3JQ7A 2PUAA 2NVWA 3IR5A 2EV9A 1P1IA 5DYWA 5I48A 3OE1A 2LUOA 4OQLA 4GEGA 4N3GA 3ZYCA 4BJ5A 5LP6B 2DHRA 1QZUA 1UXJA 1R9JA 4I5IA 3UWPA 4OGWA 4WBNA 1Y6RA 2PBZA 1RM5A 5AVJA 3BTUA 1Z16A 4GR9A 4CM7A 3MMSA 5BRNA 1GTG1 3D3WA 3I58A 3ZE0B 1VDZA 5ICSA 4NCAA 1JF8A 2A53A 2GRAA 4OAOA 2P77A 2ERCA 2AFRA 4WASA 5E1OA 5KDOA 4J0EA 4NU0A 1XA4A 3ER8A 1TM2A 1PVVA 1D09A 2H1HA 4OQYA 2QVBA 1X2BA 3QHPA 2FUNB 4J0JA 2ZVJA 3RRJA 3VR5A 10MHA 3U6BA 4MVCA 4A6EA 5K6AA 4MTCA 3QUSA 3RFTA 4LYFA 5JPCA 3LDUA 3N6RA 2ZYUX 3SFZA 3I1JA 1R4NA 2WB4A 3IHKA 4LJSA 4XM1A 4AROA 1XAHA 1HV8A 4OQ4A 3UICA 2G8NA 1J5PA 1UMKA 2WMYA 2NACA 3CWQA 2JFQA 2XCLA 4U2KA 3G2NA 2IOHA 4KJZA 1NBHA 2XOXA 3DLTA 2AWNA 3AP2A 3M81A 2O3JA 1DXHA 4BO6A 1SHTX 2GTHA 1VHTA 1P8JA 2ATEA 4H7DA 4P5PA 4Z5XA 1G59A 1KYQA 2DP4E 3EVEA 4P8RA 3CLRD 2V65A 1LK0A 4KO1S 3OESA 4KE6A 3AF4A 5E8RA 1REQB 2R8YA 1U3DA 3FNQA 2I99A 3CT4A 2Z83A 4E7PA 1FVFA 1ZJ6A 3GAMA 1MC5A 1YS4A 1F8GA 1D4OA 3CVVA 3DOJA 4HWTA 1U28C 3TRIA 3ZWDA 2L82A 3ER9A 1U3WA 3SJBA 2X77A 2A30A 2J3JA 1NR5A 4YROA 4DMCA 1FSZA 4NIMA 1GN9A 1G7RA 3C7AA 4EATA 4CIXA 4DV7B 2A84A 3IO5A 2HUPA 5K4HA 8ATCA 3U1BA 2HX1A 1Y5RA 1MJNA 4ZRNA 1R6DA 2A50A 1PEKE 4IRUB 4LJYA 5G3YA 4ZOLB 2R6JA 3WGIA 4FBLA 3U26A 1XD2B 1E61A 1EFVA 2HF2A 5GONB 3R7WB 3C3KA 4NAHA 5EZ6B 4E4YA 5LWHA 1HFEL 3C1AA 1NRXA 3LBYA 4KXFB 4FZ5A 3QEOA 3WMRA 5F9HA 1L8XA 3HB4X 3W78A 5KVCA 1GUAA 1XZEA 3EZGA 3H8VA 3NHWA 3OM0A 5HF8A 1L5RA 4LK3A 2A0YA 1RYYA 4P3YA 1MJGM 3KTDA 4KRFA 2E5FA 1UFVA 1Y4SA 1JEQB 2WQZA 4E5UA 2DC1A 4MRSA 5MDHA 4F72A 1SKUA 4UTZA 4RETA 4Q6BA 4KWIA 2P0EA 6NULA 4XLLA 4FFNA 2V54A 4F85A 1LH0A 3DB1A 3JARB 2XMZA 4C1BA 5LQMA 3K32A 5DCWA 1F2VA 2CBZA 1FDIA 2BHTA 1JA9A 2A0UA 4HQFA 2XBUA 1W88A 1A9XB 5H80A 4B2IA 4A10A 4GS5A 4YO8A 1YB5A 1DFHA 2GM5A 3N0XA 4Q0MA 5C80A 3FUWA 3R9KA 4BN4A 3BE6A 4HTFA 3BH0A 1P33A 5CCXA 1KJQA 2FSHA 4H16A 1BVUA 2YS7A 2AFVA 1E1MA 1O95C 1W6RA 1NYQA 4KMRA 4UVIA 4X6XA 3ZCQA 2HIAA 4AY2A 3D3KA 4JJAA 1AQNA 3ZEAA 2Q9BA 1U63A 3HUUA 4Z4CA 1TNDA 5B6PA 5ER9A 2JVIA 4ESVA 3IA7A 3FLEA 3CYFA 5NULA 3AKZA 1PFGA 4E1VA 1RNLA 4RLHA 1QTQA 3DMHA 3GH3A 4GYKA 721PA 3JALB 1X1TA 3Q40A 1PS0A 3EUEA 1ILWA 3NETA 4J03A 2XYGA 1W30A 4RXTA 3VGPA 5C18A 2XUPA 4DLXA 4DR5B 1Z0KA 4A2CA 3DNMA 3LVBA 4FEGA 4G5GA 4F4JA 4HUTA 1I0LA 3ISVA 4F7WA 1INLA 4NZOA 4O0MA 3UK7A 3VO9A 3HCFA 1GWNA 1XTKA 2GZSA 1OH8A 1PP4A 3AXTA 2QTBA 2R4TA 3G8YA 5FHQA 1L4GA 4M83A 2OEPA 1V4VA 1EM8A 1PG2A 4C1NA 3WGOA 3Q88A 1WM1A 3T5CA 1CETA 3C41J 3HWRA 4WACA 4DMGA 2J8ZA 4MVWA 3M5PA 3RGGA 4EA9A 1YQ9A 3WICA 4A73A 3SF0A 4EJSA 1V1JA 3THXB 1CZNA 1KIFA 2YXLA 3F49S 1SQ0A 3PEVA 3NDPA 4KNWA 1HDXA 3ABRB 5F1PA 3TSCA 3VKUA 3OX4A 3WK5A 3G9QA 3X2SA 1TVKB 2BMVA 3E9EA 5KX5F 3G49A 4MW9A 4KP7A 2YWCA 1LJ8A 1BQ3A 1KFCB 3KR0A 4HYTA 4GMFA 1EBUA 2M6KA 4XPIB 2NUTA 1E2FA 2J5BA 3ODPA 4G41A 4JBIA 5FNVF 3W8RA 1E5VA 4LNHA 3AR2A 1L5NA 1C0KA 1EWTA 2QYOA 4NWIA 5CHYA 4BAUA 1TAQA 3OD5A 4NEGA 1N25A 1TUBA 3NV7A 3UMBA 3EIOA 3QFSA 5FRDA 2FOXA 2IYEA 1DO0A 3T3OA 3NJRA 3VHXA 5DOVA 1PR6A 3DBHA 2HTEA 2DMRA 4A1FA 1CJCA 1QSGA 4HQRA 1KEVA 1EUQA 4QQ8A 2X2OA 2XT9A 5CXQA 3SOPA 3C0KA 3GWZA 1SPXA 4DLWA 4EGSA 3KQQA 3MHPA 4QDUA 3DCYA 1FE8A 2CXHA 1TGVA 3HVIA 4LCBA 2WABA 2FOLA 4NARA 4BO5A 2OFWA 4HOYA 3FPLA 3B3FA 4IFTA 4DZZA 4ZYYA 1F14A 3QXSA 3VPCA 1EDBA 1PR5A 1WIWA 1JDBC 2TS1A 1OGIA 1FRFS 4KK4A 3D7NA 1MFZA 3QZUA 3KKEA 3PEUA 1Z5OA 4ALNA 4EENA 2G70A 4E46A 1MVNA 2VPIA 3DWIA 5CURA 5I4IA 2A57A 5BW8A 1X1CA 2DKFA 2Q7OE 4Q4HB 4FFRA 3RKSA 4P3NA 1C7JA 4B4VA 5IAJA 3EWIA 1X7XB 3A4LA 3ZU4A 1E0KA 5EMHA 4HH3C 3FHTA 2AH5A 3JZFA 2GRJA 2ZYAA 4WKCA 4EFKA 3NHSA 4MYHA 3WLEA 5FUBA 1LEHA 1JKFA 3KB8A 1RMTA 4JUDX 5AOVA 3QEMB 5LOVF 1TPZA 4F2GA 4D3FA 3TQOA 1JH8A 1DE0A 1DBIA 1E89A 1G0OA 3DTVD 1WP9A 4GYYA 1T2CA 3O21A 3FA2A 3IYLW 1B6RA 4MW4A 4YUZA 5BWOA 2IYFA 3OMLA 1Y8QA 3VJMA 1NG1A 1MHPA 4MYUA 1WS6A 2N42A 3M9WA 4ZQHA 1E9SA 1JPUA 1ODKA 2O19A 5K1ZA 4XB6B 3STYA 4O4IA 3URKA 3C3CA 2V1XA 4L4XA 4OIFA 4B6EA 4MR9B 2X42A 2XRMA 3DMGA 4GF5A 3TEJA 2I4OA 4GOJA 8ADHA 4S0ZA 3WKBA 2JFNA 1A72A 3ML1A 4Z99A 2VT3A 2VJMA 4HATA 4PQRA 3FYTA 5B57C 3FMIA 1WETA 1U8AA 4IG9A 3IIIA 3N2KA 1C3XA 5BNZA 1O5OA 1QFZA 1X7DA 1MTOA 1TCAA 1YDWA 5H16A 1CERA 4UDYX 5UKDA 3SYRA 3JV7A 1MVLA 4H7EA 2D7CA 3W3AH 4FT4A 4EB0A 4WAUA 1L1QA 3TH5A 4EW1A 1VJCA 1VIMA 3KSAC 2AVNA 2O0HA 2IEBA 2P9GA 2GM4A 1IZ8A 2BGIA 3NT2A 1DEOA 1L7RA 3ZLBA 3OKPA 1RXWA 4RTOA 5TQ0A 2X1VA 3G1TA 2I1VB 4DSTA 3C45A 4QX6A 2VR1A 3H7IA 2B4KA 4MW1A 3DKRA 5IMSA 4TPKA 3RVSA 1PJRA 2FMIA 5E2IA 3KPYA 4F9EA 3H05A 1Y89A 2XQFA 3HNRA 3JYQA 3LLUA 3PJGA 3Q9UA 3C5CA 2BHRA 2R6FA 2R8PA 1HK7A 3G68A 1UJ2A 5G0VA 1EVEA 1G7CA 4ALJA 2O8DA 1COWD 1E3TA 4LAFA 1KZ1A 1Q1EA 2CXOA 4RPJA 3RASA 1EQAA 2VPTA 3K96A 1G4UR 3BMNA 1R6XA 3R77A 3ZEIA 5BR4A 3DZBA 5B58C 5T5QA 1XZKA 1D2GA 4NMHA 4X20B 5I51A 5A04A 1Y98A 1V1MA 3DE6X 5SZIA 4F06A 1LSJA 1C3VA 1GT91 2B4TO 1CF2O 2LWIA 3LUHA 3LQ2A 1DMRA 1XA3A 4BZXA 3IBYA 4UDXX 4Y2QA 4MWGA 1NNLA 4QG7A 4FC6A 4XD7A 3G9UA 3E3AA 1EWRA 1JXMA 3CR8A 1Q17A 5EXEA 3V8VA 2A33A 3IHWA 5HQ3B 5JJKA 3OTHA 4MA4A 1W59A 3ETDA 4BQFA 2PGLA 2BRUC 3O8OA 5MN4A 5DB4A 3HMQA 4TWIA 3H99A 4A27A 1FRZA 4HGOA 4NV1A 1JYFA 2AJ8A 2JRCA 2C2WA 2EX0A 3HB7A 3HBAA 4HAIA 1PT6A 3K9CA 3ZCTA 3D02A 1M10A 2J9FB 5JAUA 2REQB 3HNPA 5ES3A 1TQ4A 4BHRA 2VHVA 3KYCB 3RUDA 4Z7OB 1KAOA 1LDNA 3R74A 1RT9A 3ZE7A 2NUBA 2CLIB 3AGPA 1VMAA 3JZMA 3TXAA 4D9MA 2G3DA 3FE2A 3RADC 4LF5B 3D4IA 3WTBA 5AVQA 5CB4B 2QMHA 3WL8A 1FBNA 2D0OB 3D9QX 1RS0A 3I9FA 3R41A 5TSDA 3UG7A 3W6NA 3GB9A 1DDIA 4KU4A 1XX6A 5AI6A 1GCAA 2N3ZA 1HBJA 2Q4RA 3PNYA 5DCYA 1F2DA 1WAMA 1YB1A 1ZD1A 4MWOA 3O75A 2OD9A 3PFKA 2P2SA 2QE7A 3B6KA 3FTCA 5B12A 2DB3A 3FI9A 4OMFG 3NDRA 2FPMA 2YYSA 5DBOA 5B1DA 3ZNQA 3CSSA 2NWQA 2DQZA 2ZYDA 3RSSA 5EJ7A 3F1LA 4DCPA 5FWYA 2PMCA 1KK3A 1WCWA 4NNJA 3R3YA 3DMTC 1ZJWA 1SC6A 2VT7A 3HVKA 4FYWA 1A71A 1NV9A 1OJ7A 2CLOB 2W00A 3E53A 4DJJA 7MHTA 1BE0A 1OT5A 5BV0A 2EAUA 4KSCA 3K8YA 4NHOA 2CV2A 1UF9A 1NBOA 3E0XA 1FU4A 2PZMA 4JNCA 4G0WA 3IIMA 3EA0A 3H9GA 3WR5A 1QQTA 3MBIA 4MR7B 1F60A 3RVDA 2QV7A 5I5EA 2EP7A 3AQ4A 5DBHX 4CG3A 5C7YA 5H8WA 1H3NA 1SVNA 1DV2A 3L1JA 1M72A 4G5OA 4G1MB 5JNRA 1L7OA 1MRSA 4RXMA 1FS4A 3HYSA 4RV5A 2P6MA 2VJNA 3MJCA 4YLYA 4QXMA 1U9ZA 3CNNA 1XLWA 3JRWA 1S02A 1Z4KA 2GR9A 2ZTSA 1UMBA 1XOIA 4PLCA 2FMXA 2FZ5A 2FF7A 3EWSA 3HZZA 1L3BA 1Q44A 2BFDA 3CRNA 4KLZA 1YI1A 2VNJA 2AMLA 5ITZB 1YI0A 4MDYA 3LT5A 1O6BA 4V0QA 5KWIA 4NYMQ 3B8HA 2KLBA 3ETCA 4COOA 4L8GA 4ZEOA 1KTIA 1WCYA 4QUBA 4FD3A 5J1SB 1NONA 1QP8A 3EVBA 3IQXA 2FPIB 4WD3A 5FB3A 4FMDF 1TL7C 1J0CA 2ERYA 3EA4A 4OSOA 2XZTA 4H7HA 1EWYA 3RQIA 1Y5IA 4DCNA 4ASUD 1NF2A 2WAYA 1GGVA 3F7NA 4O8ZA 2WT4A 3P0HA 3ELBA 5AXCA 1CZKA 3W8EA 5B55A 4C6RA 3F6YA 3B78A 1T9ZA 4KXWA 4EFMA 4CUKA 4JI2B 3LRXA 3OO0A 3T9DA 3WRVA 1WUIS 2QYSA 5CDFA 3WK7A 4BO9A 2BMFA 2CWDA 1P3JA 3WV5A 4C3OB 5JZSA 1N2HA 4K9DA 2VDKB 2MTBA 2ZIXA 1QAOA 2WYIA 3OPMA 5ELMA 4KW7A 1QG0A 5FUVA 4JI6B 1KNQA 3ZQJA 1SHJA 1BFDA 4RVHA 5HKAA 1OE0A 4XLTA 4D9EA 3UANA 2BY4A 2FWJA 3KEOA 4XB2A 3VH2A 1RJFA 5CH3A 4ER0A 3Q5EA 5SV2A 4NICA 4OFZA 1C7FA 1SIUA 3VTKA 4J7CA 1KETA 4IF4A 4ZOQI 4GKVA 1H42A 1WLYA 3NEPX 4KR9A 5TS3A 3WO0A 5K3OA 1M0WA 1E1QD 1U0TA 2D00A 2WICA 4B4UA 2V6BA 3AX6A 2AK3A 3WKAA 1RZUA 2PRYA 4L0QA 2DBRA 4P80A 3FTPA 5DNCA 5HKKA 4NCNA 4IIDA 3Q9LA 3K4QA 2FPKA 4K26A 4G25A 3A6JA 3KR1A 1ZCFA 3GGCA 4ZVLA 1CXZA 2GK7A 4A8PA 5KNCD 3KKQA 1N1EA 1Y37A 2HJSA 2BEUA 1KTVA 2IHZA 4GMXA 1WHSB 5KPDA 1G1MA 5G41A 1GFIA 2FWNA 2RHMA 3K8OE 4OFXA 3ZU3A 5A4AA 5AW2A 1XQXA 1E63A 1QJ4A 1DKLA 4RYDA 2VIIA 3CUUA 4TRJA 1N2JA 2X1HA 2DF8A 1C4OA 2P27A 3K92A 3QPCA 4TZKA 4X8LA 3EF1A 3U7QA 4X85A 1Y4UA 1A76A 2RK4A 1WMBA 1Q0ZA 1Q7GA 2FI1A 1M8FA 3OF3A 4KR2A 4FKMA 2O8NA 1PL7A 3H8WA 5EUQB 5AYVA 3EA5A 4LC1A 3QVVA 4QYMA 4EUKA 2MU1A 3P45A 1RRKA 5KYKA 4DC9A 4BVAA 2E1PA 2WZCA 3NATA 2I7TA 3EEFA 5KYTA 5KI6A 4DV4B 3ZW9A 1MIHA 4I4NA 5EPOA 1V26A 3DQQA 3R6WA 2C2HA 2ZUTA 3RNLA 3GEGA 4N03A 4EUSA 1AE1A 4TT3A 3L5KA 1UDCA 1G5IA 2PS0A 4RLFA 2DH5A 3EHEA 3DWGA 3HK2A 4XCVA 4UM7A 1DAIA 3VO1A 3TFOA 2A5LA 3T9CA 2RBGA 2AN9A 2AMJA 1PZGA 1XWWA 3CLRC 2CUNA 4PGGA 3ZU6A 1T3TA 3MUEA 1XJWA 2CHQA 4V0ME 3T5DA 4E1AA 1MA0A 5KPJA 4HN2A 2AIRA 4RTRA 1F0KA 2YHSA 3EODA 1P5RA 4BNNA 4F4HA 5KVAA 1AF7A 1LVHA 4EP1A 4LOKA 2ZOSA 1EU1A 1M6WA 3G0DA 2I55A 4YPFA 1RQLA 2BEJA 2P35A 3ZKAA 1E1YA 4RA6B 2EFJA 2IV3A 4M1EA 2AN5A 4HFJA 1NPDA 4WBXC 1M74A 1V9CA 1F2UB 4ZVSA 5JC8A 2XAUA 2CCGA 2AVDA 1JR4A 3DT6A 4EABA 2RB5A 3KBBA 5ALGA 3AVOA 2XXAA 5FBLB 1ODIA 1XTTA 5HTOA 3AR7A 1Q50A 2IOQA 1V3TA 1ZCBA 4RUKA 1FRVA 2AOWA 2XUIA 1XQWA 2O1WA 4ZHSA 4YDQA 5U9CA 4H08A 4Y2TA 2EJCA 2VKTA 2YWEA 4BUZA 2XTJA 1QIKA 3L0YA 1UIMA 2E4ZA 3TTSA 1C9KA 2AQ8A 2EKQA 1CUUA 2QTVB 1Y8AA 3ZNPA 1N0IA 1TKCA 1ZK0A 4NBUA 4NYJR 5E6UB 2R6R1 3BKWA 4IJKA 2CXSA 4M0FA 5K8JB 3A32A 2Q1TA 3AERA 3NC0C 4WKOA 3DLHA 5T8KA 4BLQA 5D86A 3I9JA 1QFYA 3IV7A 5C5DA 5CFQA 4JXXA 1J39A 5TY0A 4F6CA 5JWHA 1MNQA 4M1QA 3BEOA 3NFYA 1G1AA 2F7SA 3R76A 1CY2A 5JTTA 3H6GA 2PX8A 5A71A 4BGDA 4RS4A 1MRNA 2GPAA 5LBIA 4NI5A 4BNIA 5EMKA 3AU8A 3UA4A 4CYMA 3BE4A 1XI2A 1SVWA 4YRFA 4N49A 1AGPA 1VL1A 4QGGA 2R79A 4JJGA 4NJMB 2YFQA 3AJAA 4QTTB 5AKIA 4QXOA 1QCYA 3IAFA 4PLZA 1OX6A 1G6KA 2R1UA 1MO6A 4UTOA 4AK9A 4ESHA 5B2FA 5EJ4A 2K2WA 2OQVA 1KS2A 3HY3A 3ZHBA 1L7PA 5ALWA 1AQJA 2R8EA 3EDMA 3EG5A 3CKYA 4MS3B 4AX8A 1I24A 1YRQA 3N28A 3QYAA 5E3JA 3UAZA 4YMTA 3D0QA 1QV7A 4PYIA 3LFUA 3PNBA 3ZH9B 1E7YA 1JMKC 1H85A 2HBRA 3ENVA 3KPWA 4M6WA 1P1KA 2UDPA 2ZIZA 1W4BA 1XVUA 1DCFA 2BN4A 3HVJA 1WUTA 3ZHCA 1ZJJA 3X1WA 1O77A 2I3BA 1QC5B 4FU0A 1DIBA 4JI3B 1IG0A 3RTDA 3X1ZA 4DDKA 3SY8A 1VJDA 4ZZ3A 4I9NA 1IXZA 3DVAA 3UWDA 1Z6ZA 3WVNA 1SCUA 3ETJA 3EQ2A 5KNLA 1PJCA 1GVNB 3VZPA 1Z6AA 3LPNA 3P9PA 4J43A 621PA 2QZZA 1TRKA 4U7GA 5GIPE 4PO8A 2O2SA 1RRFA 1ZBDA 2EFCB 4ROTA 2X14A 3OZDA 3PGMA 2EBUA 1MD9A 2ZPUA 1EX7A 1J0DA 3NBYC 4MVJH 5CJJA 3T3IA 3WL6A 2JFYA 3GZJA 4OREX 4QYIA 4X44A 5KCMA 2KHZA 3UMMA 4MUGA 4FE7A 3KE8A 2MYNA 2CWWA 3UZUA 4YUWA 1AV7A 4N18A 3AB3A 1C8VB 3JQFC 4BX3A 4M53A 3PJRA 3REQA 1S9HA 1QVWA 1Y9AA 5JIBA 1QMPA 4IV0A 4FYYA 4B3FX 1FU8A 1PNQA 2GZ3A 1VPWA 2JEZA 3BVPA 2QQ5A 1ZD5A 3N7TA 3OURA 1CEQA 1FNBA 1IJFA 2HRCA 3ILVA 4IV8A 4K1XA 1R5JA 1T6NA 4UAVA 5H5JA 5HVNA 4R81A 4DLUA 2AZMA 5TX7A 4OMCA 5P21A 1SBIA 3DO5A 3F78A 4WJKB 3QLUA 2QSYA 1BEZA 3TCXB 2HY7A 2R96A 2NZVG 4PRYA 1S2MA 2JZOA 2CUTA 3MCVA 2PFKA 1DAKA 2DKOA 3EQ8A 5AKXA 3GLSA 1SUSA 1ZNYA 1UUFA 4R9UC 4CM9D 4KYVA 4O2LA 3E05A 1U9YA 1PQYA 5ADVA 2ES4A 2EJVA 2Q1YA 2CVPA 2Z2ZA 3E61A 4ZHQF 1ZD8A 3GZTB 1O08A 3IXLA 5BN4A 1QQBA 4X1YA 2XW6A 2FFJA 3O2NA 1EFPB 3K9BA 4DFDA 2QBYB 3IVRA 5JC1A 4Q4AB 3IAUA 3G3EA 4MEAA 4R16A 4CODB 4TZ0A 1AQIA 1VMEA 2FZWA 4YQZA 1G9SA 2HSDA 3LF1A 1YZ3A 1X7YB 2DLCX 1BG6A 2ASEA 4KXXA 2IH4A 1PDWA 2C5SA 1QK4A 4ZAFA 1O96A 4I19A 4ERNA 1L7EA 2CCKA 5EKXA 1J21A 1NMXA 2YY7A 1YR6A 2PGXA 3KDPA 3TNFA 1Z29A 4ZRDA 5AVKA 5K09A 3A9TA 2IHTA 1BTOA 2C2MA 4OEHA 5CLIA 3FNRA 5ADWA 2A1UA 2IYUA 3MG9A 1NZFA 4C7MA 2GBLA 1YCHA 5EXXA 4F5ZA 2EP5A 4P4LA 5I8PA 5HP4A 4ZKEA 3DXYA 4PCLA 1IPHA 1LWNA 2HU5A 4ALIA 4H27A 2MCFA 5CMLA 1FNCA 4DR1B 1VFNA 1JDTA 2C2ZA 4P92A 3TW6A 1C0PA 2KLHA 4IQ8A 1BDJA 4L51A 1C2TA 3R3UA 4TYWA 2JH9A 5LP6F 1OCEA 2C77A 3GFGA 1IY9A 3DBVO 3H0CA 3UF0A 4DYHA 3H4VA 3GGPA 3U60B 1YZHA 1FTSA 5LZ5A 3UGKA 4CWAA 1G5RA 5GGXA 4CG0A 3V00A 4FNMA 4LX8A 1Z75A 2Z1DA 1LXCA 1YC5A 4GMKA 3CF4G 4CMBA 2YFYA 1CJBA 2Z8ZA 3OZWA 1KI8A 5C1OA 4E33A 16PKA 1QHNA 1JV2B 3IEPA 1WOMA 3DF9A 3KWJA 2WU8A 1DKMA 4II2A 1XQ9A 1ICEA 2VPXA 3E4CA 3GLIB 2JFZA 1RAFA 4MV1A 4B7UA 1N2CE 3HXQA 1WMDA 1TYZA 3K0AA 4PSKA 5ICCA 2B1IA 1NFRA 2EZUA 3K05A 4FNAA 4HG2A 2C20A 3UBTA 1UMCB 2NX2A 2A1TS 4CKCA 2R4UA 5CXXA 1UAAA 4KRGA 3DOHA 4CLHA 1E2PA 5JECA 4KIFA 3KOWA 5EI5A 5BSHA 4BIIA 4IJVA 5FI0B 4O2RA 2GD0A 2GN4A 3TSZA 4BO4A 5KTTA 3L7LA 3LCMA 3ERCA 5ALJA 4R0NA 1DGQA 2PGOA 4MRPA 1UBKS 2J07A 2JLBA 3UJ6A 1UANA 2RJNA 5AR1A 3BWMA 1RYDA 4C5CA 1E4EB 1SHLA 2PRJA 1PK9A 2H4HA 2P5YA 3WJAA 1BQ4A 3NHAA 1G5HA 3NZEA 4GM1A 1C2YA 1W2WB 2I4NA 2HU2A 2W37A 1Q5PA 3D6NB 2Y71A 1TO6A 2VP6A 3FKSD 5F3WB 1XZAA 2GD1O 3M49A 3G13A 4R1OA 2B98A 5FL7A 3BRWD 3ZDRA 1S6YA 2PX6A 2HH9A 4FXOA 2PYIA 4TYNA 1E0SA 3AY7A 3TRFA 3KT0A 3EZXA 1AC5A 2EEPA 2X15A 3EARA 5IJAA