3COYA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 2.05 ang resolution- in complex with sulphonamide inhibitor 3
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
288
structure length
280
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Pantothenate synthetase
publication title Inhibition of Mycobacterium tuberculosis pantothenate synthetase by analogues of the reaction intermediate.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 93
structure length 280
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2008-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3coyA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3coyA01
1GPMA 3IH5A 5DB4A 1WXFA 1MJHA 1OWPA 3FETA 1KP2A 2QJOA 4HJXA 1QJCA 5HUJA 4ZT5A 1WQ4A 2V0CA 3P52A 5J5AA 3IUEA 3TQIA 1J1UA 2WB2A 3PNVA 1F7UA 4YP7A 5KCMA 3A4IA 1PFWA 1QRTA 1WQ3A 2IJGX 3Q4GA 4PBRA 2DR2A 1M8KA 2QUKA 3AFHA 3GUZA 1U3CA 5K0TA 4MUNA 1ZH6A 1N77A 1T9GR 3ZXSA 3RFFA 1EFVA 1O97C 1G8FA 4U7JA 3ISJA 5DASA 2QJTA 5J59A 2J07A 1BS2A 3RBAA 4ZCRA 1EFPB 2CV1A 3UY4A 3MMXA 1EUQA 4MQ6A 1JEEA 1TYCA 1JIKA 5LM3A 3ND5A 5TS2A 3QE4A 1JEDA 4EG5A 3JXEA 3IOBA 4MW9A 4MUFA 3C8ZA 2YWBA 4G6ZA 3INNA 1VBKA 4ZCTA 3CLUC 3SDBA 4DE5A 2O8VA 1JECA 3H9CA 3CVVA 2V0GA 3N05A 2D13A 4ZT6A 5K0SA 1K4KA 3MLAA 3CLSD 4UZFA 1T6YA 1G8GA 2ZUEA 1NUPA 3FDXA 1G59A 3P0IA 1N2BA 1COZA 3BL5A 5FO1A 1IRXA 2D5BA 1QU3A 1Q11A 3OP1A 4F3RA 2OQ2A 1WY5A 4UZEA 1R6UA 3AG6A 4ND6A 1KAMA 4KR6A 2OV4A 2XRZA 4YMIA 1Q15A 1M8PA 3K9WA 1KQNA 2PXHA 1MBZA 3FY4A 4DDHA 3KT6A 4L2IB 1ZH0A 4MW4A 1FFYA 1N3LA 1N75A 2ZUFA 1PG0A 2JA2A 1H3EA 1QQTA 1VBMA 2E0IA 4QRDA 1MAUA 3SZ3A 3P0HA 2WQ6A 1N1DA 2VTBA 1WXHA 3TQOA 4EG6A 1WXIA 3IMEA 3PXUA 4S1OA 4XSVA 1O95C 3UK2A 1J20A 4OUDA 4EG7A 4NX2A 1UFVA 3QTTA 2RE8A 1XJQA 1M8FA 1O0BA 3FH0A 1S4MA 1N2EA 2CYCA 4NZPA 4ZT3A 2GKSA 1PFYA 1EE1A 2A84A 4RPIA 1U0BB 1IFXA 2ZP1A 2CV2A 3ND7A 5LFAA 5J58A 1J1ZA 3N2YA 2JAXA 4WSOA 5IHXA 1NUTA 4MUHA 1ZUNA 3D6UA 3CA8A 3IOEA 1PG2A 2R5WA 1KORA 1MRZA 3TNJA 4U63A 1DNPA 4ZCSA 3PRHA 4G5FA 1XNHA 3FHJA 3COWA 1N2GA 1M8JA 3PNYA 4XFDA 4CQNA 1N2HA 3FI0A 4MW1A 1WKBA 5DK4A 1FYDA 2E89A 3H05A 4ARCA 2WQ7A 1JZSA 1OD6A 1Q77A 2QUHA 2X1MA 2A88A 4MAFA 1R6TA 3ILVA 4MUGA 3ZUGA 3CVWA 2CSXA 3Q12A 3CLTC 3COVA 2PZBA 2PZ8A 1I6MA 4MWBA 1KQPA 1NUUA 3OTWA 1IQ0A 4AS1A 1KH1A 1EUYA 3HGMA 3H97A 4H3SA 3A2KA 5JBNA 3K32A 1N2OA 2RD2A 1VBNA 4G5YA 2J09A 2TS1A 1F7VA 3MLBA 1EFVB 3TZEA 2AZXA 4OJMX 3CVUA 3KT8A 2O5RA 1WJGA 3VGJA 4F4HA 1V47A 2CYAA 1EXDA 1SURA 3P0JA 2YWCA 1XNJA 4MWDA 4I6EA 3FNRA 2JANA 4I6JA 4Q16A 4BWVA 1M8GA 1JGTA 2HZ7A 1KQOA 1JZQA 1XNGA 1OWOA 2AKEA 4EG4A 1U3DA 1JIJA 4R0NA 1QTQA 3HZRA 1G8HA 1TYAE 1Q19A 3M5WA 2A1UA 2A1UB 2DEUA 1H3NA 3SEQA 2A4MA 3UC5A 2J4DA 1P7PA 3IVCA 1O97D 3I05A 4ZCPA 5TGTA 4DDMA 3DV2A 1H3FA 2XRYA 4A91A 2E21A 1WOYA 2BTEA 4MLPA 3TZLA 3VRHA 1HYBA 4KPUA 4K0RA 3IMGA 4DNXA 3COZA 1EJ2A 3UOWA 1Y42X 2VXOA 1NUQA 3S3TA 4NATA 2AG6A 3AIIA 4ND7A 2A1TS 3CLUD 4TS1A 4HK4A 1J21A 2DPLA 1GTRA 3GMIA 3ZGZA 1JIIA 2QTNA 4CDNA 2QTMA 3HV0A 4EFKA 2J5BA 3D6VA 4P2BA 2DXIA 4ZCQA 2VTBB 1X8XA 2H29A 3NV7A 3IVXA 1CT9A 1T6ZA 3N9IA 4Q93A 5F23A 5HG0A 4MUJA 2QUIA 4AQ7A 1J70A 4U8HA 1I6KA 3RK1A 4ZT4A 1QU2A 2A86A 2GM3A 4OUDB 1N78A 1MC1A 1VLHA 3NBKA 1IQUA 1JHDA 4ZT7A 3IODA 3LOQA 1JILA 1YULA 4QREA 3N8HA 1MB2A 2QTRA 4CDMA 1MB9A 3CVXA 1O0CA 2CT8A 4EG8A 3CLRC 1H1TA 3DO8A 1NZJA 1YIAA 1PFVA 3E27A 4ARIA 4R2LA 2CYBA 1GN8A 1F9AA 1GZUA 2WSIA 1IHOA 4KR7A 2E18A 3X1KA 2H2AA 4J76A 4MVWA 1NURA 2EL7A 4MVYA 2X3FA 3RJZA 4MUKA 1O95D 3KT0A 3CR8A 2CV0A 2IELA 3G59A 1YIDA 1T6XA 3ELBA 1GAXA 4HJRA 3TS1A 5H7XA 5FNZA 1V8FA 1O96A 1K97A 2A7XA 4EF6A 3HMQA 4QBTA 4YBRA 4JXZA 3ZJUA 1QNFA 1LI5A 1NUSA 1F4LA 3ZXIA 1TYBE 1O94D 1IVSA 1OWNA 2YXNA 2A1TR 3X1MA 2YY5A 4X0EA 4JFAA 3UMVA 1K4MA 1U7DA 2D54A 2X0KA 1TEZA 1KH3A 4KR9A 3ZJVA 1U7XA 3COYA 4PY2A 4MWCA 4K03A 4MVXA 1OWLA 2CUZA 3CLSC 2X1LA 4MULA 2GOYA 3CLTD 1O5TA 3LE8A 3RK0A 1B6TA 4DJAA 1EFPA 4HPWA 2NSYA 4YP5A 1WXGA 1TFUA 4DLPA 2PG3A 5TEVA 1ZJWA 4YP6A 5AHWA 5H16A 1LI7A 2PIDA 1O6BA 4KPUB 2PFSA 3DLAA 1M1ZA 4MW6A 3GLVA 1YUMA 3FOCA 1KH2A 4CT0A 1RQGA 4JZYA 4JYZA 5BNZA 1LW7A 3IVGA 3QTBA 3ZIUA 2EJCA 2DERA 1KAQA 4EG3A 5TEWA 4E1AA 3AG5A 3SYTA 3KFLA 3F3MA 2B7LA 1IH8A 1M83A 1KP3A 3FIUA 1X6VA 4ZT2A 4WNYA 4GU5A 3A05A 3IMCA 4KKVA 5EKDA 1WZ2A 1K92A 2DUMA 2Z09A 3SP1A 4DDKA 3FWKA 3AL0C 1KR2A 3VU8A 3G6KA 3H99A 2QJFA 3Q10A 4L2IA 3IDFA 1GTSA 4FZJA 2J08A 4J75A 5KHAA 2PZAA 1MAWA 4RUKA 4MW2A 1J09A 3ZJTA 1T9GS 2IP1A 4MUIA 4MWEA 3PNBA 1PFUA 3ND6A 1YI8A 3U1VA 1KKUA 4NAUA 5IJXA 3A04A 4GRIA 2CFOA 3G5AA 1OBHA 4XFJA 2DLCX 3HFJA 3LCJA 2Z08A 5DEOA 4EG1A 3NBAA 4MW0A 1OWMA 2G36A 5LLTA 3FG9A 2BYTA 4PBSA 2C5SA 3X1JA 1NI5A 1ILEA 4MUEA 4PBTA 1NP7A 1JMVA 1D2RA 1ULHA 4EGAA 3AKZA 1QRSA 3H9BA 3IUBA 3HL4A 1QRUA 4I6GA 2Z3VA 3CVYA 2QUJA 2HGZA 1A8HA 1I2DA 1OBCA 2DETA 4MW7A 5FO0A 1TYDE 1NYLA 1IQRA 1TQ8A 1GLNA 1MOPA 1O94C 4NAHA 3L93A 3L92A 1NSYA 4JXXA 4MW5A 1O96B 3KT3A 2I1LA 5KWVA 4MVCA 3DPIA 1N2JA 1VL2A 2NZ2A 3CLRD 1WXEA 3RHSA 3SEZA 4NDAA 5HUHA 1R6XA 3IOCA 1YUNA 3MUEA 2HMAA 1N2IA 4R2MA 1I6LA 3SZGA 3MXTA
chains in the Genus database with same CATH superfamily
2Q29A 5JJIA 3LC7O 4FLMA 1OWPA 3KAPA 1SBNE 2P30A 2FWNA 1WM1A 4RPKA 2CHFA 4JWTA 2C97A 1FRZA 2BEVA 3GIWA 4HJXA 4X1OA 2UUOA 3DXFA 2CNLA 2P9BA 4X1IB 1VSTA 3GYBA 3ZXXA 1H0HA 3IYLW 1WDKA 1UXOA 2C99A 2KYRA 2WAAA 3E8MA 4JOBA 4PSKA 5TDHA 1XJCA 3W8EA 4DWWA 2FSSA 2N1MA 1S6YA 5AW3A 5DNCA 3B7GA 2IYPA 1B6GA 4KFRA 1JZTA 1RABA 4XDGA 4YJHA 3PF8A 1WVIA 2VH1A 1VB5A 1GY8A 1Z37A 4E15A 1G2PA 5CEJA 1VRWA 1L8LA 4XUCA 3UK0A 2QLMA 1LX6A 3ZCPA 1Z18A 2GTHA 3OF5A 1E6MA 4CMJA 2PYZA 4MKFA 3SHTA 4EUFA 1EFVA 1F8GA 1YHNA 4P34A 1D3AA 1LWOA 3OQHA 2DULA 2WBLC 4LMPA 4J7UA 2Q4OA 4M0UA 4N48A 2XMPA 4L27A 4OSEA 5AQEA 3OZUA 2AYZA 1UBTS 2J07A 4CQMB 1EFPB 1W1IA 2FR1A 3NVKI 3U4AA 2Y0DA 3OCUA 1D4AA 1XTPA 5C9ZA 1KEPA 3NDJA 5FOXA 5KVQA 4BMVA 4JLUA 2VYNA 2ADMA 4A8JB 2VJOA 1TKRA 4G1MB 2QXYA 2X0EA 4YCBA 1RVDA 2ZU6A 5FLYA 4B6RA 3GVXA 1PEAA 1WLYA 1H0KA 2ANBA 1BH6A 2OXRA 3CYFA 3AHCA 3FNBA 1X1SA 3Q72A 4YAIA 5B4UA 5DTRA 3C1AA 3ZGYA 1FPMA 1Z0IA 2PGIA 2QZ9A 3CLUC 3HA5A 2XMBA 1LSSA 3OJXA 3SDBA 3TW6A 1YQQA 5D3MA 3VXKA 3LS2A 3K6SB 1FP4B 4HTFB 4MA0A 4XM1A 4L57A 5IKXA 1LW6E 1XNRB 2J4CA 5AVWA 3U3DA 4QUKA 5K45A 3MWEA 4TKVA 4YPOA 3FDXA 3OUTA 2FPRA 2P5SA 3EZLA 5G3YA 2YX1A 3COSA 3F2VA 4C3OB 1JDTA 2D2FA 7MHTA 5TQ2A 2XH8A 3EXEA 2J9YB 1C9EA 3TKAA 5BSWA 2Z5LA 3MMZA 4UTOA 2G17A 3WICA 4RSGA 2CBGA 4DDHA 1CETA 4B43A 5D84A 3D7LA 3DNPA 2XUQA 3KAKA 4FC6A 4UMVA 5BNTA 4LY0A 1IM5A 1Y4AE 3C85A 4EPXA 5CXUA 4NXNB 2YRWA 3ZCQA 1G21E 1K66A 2FEPA 3FOBA 2WM9B 3FVVA 3Q5GA 2ZIZA 4Z1MD 2Z4TA 3GEHA 4HLNA 4B4VA 1V4BA 2YZNA 3T5MA 3P0HA 4P3YA 4N8DA 2Z3WA 2EQBA 2GBIA 4WLEA 1IVYA 4DPLA 2FR8A 3ESYA 3FDZB 5CVJA 3V5NA 2QD3A 5K8TA 1QG4A 5KHOC 1AHPA 4M98A 2JFXA 3LMKA 5LNK1 1OTHA 3B89A 4MCIA 4V0QA 4DBLC 1UEIA 1NR1A 5AW6A 4NG5A 4ENWA 4NBWA 1SUBA 3OM8A 1YVDA 1MX5A 1T43A 2J9FA 3U60B 4NMWA 2CXXA 4YLGA 4DB2A 1S4MA 5EMKA 1FYWA 1TA4A 1DS6A 2ZYWX 4HNQA 4Y6RA 3W4KA 1RWOA 4CQJA 4F5EA 1VE9A 1ZVQA 3ENVA 1GRRA 4YI3A 1FJGB 3AR4A 4Q03A 4ZAYA 3WGIA 1U0BB 4L4RA 5C51B 5KMGA 3EE6A 2NYRA 1UBMS 1GJRA 1ULAA 2FZVA 5EIXA 3NYRA 4Y3UA 2QG6A 2ECPA 2ZXEA 1CJSA 4L9WA 4EO7A 1DTWA 1AHIA 2GAAA 3OEED 4CTJA 1L7QA 3KYCB 5SZJA 1JDUA 4U63A 3WQSB 1C1DB 3Q40A 3MMPA 4ZCSA 3K0SA 1TT5B 1UP6A 3QUCA 1KEUA 2CLKB 2PVCA 3CUUA 1CJMA 4OFXA 1C8VB 3VR3A 1KEEA 1BVHA 1M8JA 4EA7A 5JVDA 1LRJA 3N2NA 4G67A 2PJZA 1HFWA 2A9QA 3PUIA 4LYYA 4S2UA 2VDQB 1H5UA 4BLSA 4BP9A 2WKWA 4A36A 4R9RA 4GVPA 1HE8B 4HQRA 4H08A 1RHKA 1UBCA 1JTEA 3DGFC 4B6QA 2YV1A 2HHAA 3MRVA 1E2DA 3EVBA 3H6GA 3EFOB 1R6DA 2SKEA 4O1IA 5EXDA 3D2AA 1JBQA 3ZV3A 4YI5A 2IOHA 2FEAA 4YCAA 2VP2A 2VDOB 3TCKA 2C82A 5DJ5A 3C1OA 1HQKA 1N6RA 3ILVA 3IUPA 1UZNA 2OHVA 1PJZA 1GGHA 4IDOA 2DPHA 1Z35A 2J5QA 3FDFA 2HA2A 4WGFA 3J81A 2I4MA 2P75A 3GD5A 3KZOA 3HGMA 3RQSA 8ADHA 2AHOA 3MT9A 3A2KA 3NDPA 2KPOA 4R1NA 3OPNA 4P4SB 2VDLB 3DUFB 4K6KA 1RKVA 2HIAA 4IHQA 2YS7A 3R2JA 1J0EA 1JJIA 4LY6A 2NSDA 3FZEA 3ME5A 4V38A 3K96A 5EQFA 3I5UA 1AKRA 1V1MA 1C9JA 5L3VA 4BO1A 1NRJB 1J9ZA 3S99A 1GL7A 1NRXA 4E5SA 4JC0A 3Q3IA 3R77A 5HQ3B 1AKWA 3D2LA 2CYAA 3TTYA 1B0ZA 1Q84A 3L07A 1COWA 2VNIA 4NVRA 4TZ6A 4GXRA 4FN4A 4XR9A 2EKDA 3FPKA 3O4GA 1VMEA 2OAQ1 1OREA 3HCAA 3P5SA 1J5XA 2I99A 1FTNA 2E37A 1UK9A 1XYYA 2GESA 2R66A 3O8OA 3IALA 4PWYA 4JMPA 4KOEC 2OM6A 4K9OA 1G3MA 1D4FA 2XT0A 4GUAA 4NIMA 1JG2A 1VP3A 3DZGA 4OIFA 1FFXA 1PSZA 2J3EA 4NZYA 5LA6A 1SUIA 2CNNA 4I5EA 1U3DA 2ZUSA 2JKYA 4EGSA 2GR7A 5DTMA 1NOKA 4BO0A 1V3TA 1PK9A 2R85A 2GD1O 3HZRA 3K0KA 4GMDA 2A1UA 3V4LA 3KQVA 3VNBA 2WJJA 3AB3A 5D51S 4TRNA 2DEUA 3OUUA 721PA 4I4NA 1BCRA 2FZCA 4BO6A 2EIHA 3GD7A 2Q5EA 1O89A 4ZU1X 3U1TA 4P36A 4D9IA 4IQGA 1E9FA 3VU9B 3OESA 2QLBA 1HYBA 2QMEA 1SUAA 4HNHA 2OFOA 3BMOA 2WWRA 4N9WA 2FNAA 3ZW8A 3RSSA 3JZAA 1FNMA 4PGGA 5IVPA 4TV8B 4M8SA 4Q02A 4E09A 3GNTA 1Y89A 1VE5A 1Z62A 2IYVA 1MHPA 4GMKA 2I2CA 1P61B 3ESZA 3PR2B 2W43A 4IIVA 4JVMA 5PGMA 3REGA 4TXNA 2Y4NA 3M34A 1ORDA 3CKLA 3FMIA 3WWEA 4YMSA 3AETA 2P90A 2Q2NA 3C7CB 4MGHA 3A36A 1RD4A 4BVGA 2RGEA 4D80A 1V1RB 2XZTA 3LY7A 3V4PB 1JBEA 2IZ1A 1QZXA 3N8DA 5ALDA 1SG0A 2NQTA 1NF9A 4N3BA 2X76A 3RLFA 4LRYA 5FPSA 3HU2A 5G0WA 2BM0A 2I54A 1Z39A 2OPHA 4MS1A 4F11A 3HDQA 2Z4SA 5BUCA 1T6ZA 3NT4A 3QVXA 3STTA 5FNVB 4B7ZA 1XBTA 2JIDA 3S70A 3TINA 3E4CA 4RQAA 1QH0A 2VBCA 3NEPX 4ZT4A 3LBHA 4K1XA 1NMZA 2FR0A 3DE6X 4Y9TA 2VTVA 4X44A 1LK7A 3K0BA 1EUZA 1XRSB 1Z5ZA 1Q1GA 2WJGA 2Y1LA 3KETA 1L6IA 2B3TA 1VGRA 4YDRA 3HBNA 3MRSA 3O74A 3QEMB 2F7SA 3QFHA 5JOQA 1VPVA 5EMLA 4FVTA 4DY4A 4L15A 5IK2D 2PS3A 1YULA 2R6DA 3WYAA 1FS6A 4KVGA 3EYAA 3UUFA 4LDRA 3THYB 2F1IA 4DR4B 1VDZA 2CB0A 4IVPA 1Q0SA 4JDUA 4TT8A 1GADO 4PRYA 4F91B 3FFXA 2FFBA 4DCGA 3U3MA 3DAFA 2VCHA 4AJJA 1A4UA 1TEVA 1DFGA 1F2UB 1F9AA 4F7DA 2HK6A 2VPZA 1MAHA 4PZZA 3CONA 3BFJA 3PKJA 3LSTA 3VR5D 4CTNA 4YYZA 1TCVA 4MVWA 5GGXA 4ZYXA 1B0AA 2JBHA 2QN8A 5A4IS 3GELA 3NJRA 1NJFA 3BFXA 2O6HA 2NVUB 4UMEA 1O95D 4AJIA 1XTQA 1R12A 1RXYA 3G59A 6ADHA 2XCIA 2FFHA 1XJ0A 2PQ2A 1T2VA 4TTSA 2OMEA 1LKZA 4MO9A 2V59A 4GKJB 4FONA 1VPEA 4HH4A 5J1TB 1GZ4A 1P9LA 4EHBA 3LUDA 2QVXX 1Y3AA 4B2PA 2I9KA 1Z3CA 4M87A 4M49A 1CY7A 1TM3E 1E2HA 4YBRA 4CT5A 2ZAOA 4IUCS 2HLDD 5EKUA 5B1EA 3CCCA 5KQRA 4D1YA 1MG0A 4MRAA 4CR8A 3ZXYA 1T5DX 1TYBE 3CUTA 4JCCA 4Q7KA 4ECAA 2CLFB 4LDJA 3QUAA 4WLVA 2X42A 1BS1A 1NQTA 4HQ6A 4J7XA 4B2IA 4JITA 1HLPA 5L53A 2I2WA 5EGSA 2C7QA 4TT3D 1TA9A 3DYBA 2ZJ3A 1EK6A 2H1WA 2UUPA 4I19A 1EBFA 4KP7A 3DHEA 3CO0S 4NSNA 4TL7A 5ELLA 5FTLA 3SEFA 3FWZA 1ECCA 1EVQA 2D54A 3FSEA 5IM4A 4DZRA 5LMUB 4ZI5A 3QYJA 4QAQA 2ZI6A 1Y6RA 3CE6A 2OGWA 1DJNA 5ESXA 1Y1TA 1QONA 2ZTUA 2XRFA 2QAGB 2EX1A 2NSJA 1NXOA 1UC9A 2J30A 3HVHA 4MWCA 4TTIA 3SXUB 1ZR2A 3TR0A 3PD0A 2PMEA 4YV7A 1G6HA 3ICWA 2NU9B 4IP0A 2SCUA 4WY8A 5IJZA 4R31A 1A9ZA 1H85A 1OOEA 3WHIA 1A3CA 3S8YA 2OKGA 3VNAA 4LZLA 3SBXA 2I4IA 4ZD6A 2BH9A 2WYUA 4FCWA 1C7JA 5B2ZA 1H9BA 3AZOA 2BHTA 2PG3A 3V34A 1ZJWA 3IL2A 2PAFA 2QW8A 1U0SY 3R0ZA 3BD9A 2BBWA 3T9BA 4WZBB 1XKTA 3LCUA 2E85A 1SVKA 4LKRA 1V8ZA 4UUAA 2BKAA 2GO1A 1CVIA 2KMLA 5FV4A 2PIDA 1O6BA 4YRKA 3FPFA 3P7MA 2WFAA 4BMNA 1LBTA 4S0ZA 4DR1B 4WBNB 3RVNA 3I62A 1DFHA 4QQRA 3AILA 4CCWA 1U0RA 2C1XA 2ZUCA 5JPIA 3R44A 4JQOA 4KMMA 2IPXA 2Q3BA 4HEQA 2P2YA 4BLPA 1G2QA 4LXHA 1THZA 4MV0A 3TRKA 3KSZO 3GEBA 2AEJA 1G5QA 4E1AA 2QUZA 1L5HB 4TUYA 3QJYA 1ZOIA 5TVGA 1IXSB 3SYTA 3C3BA 1UDAA 2B7LA 4RTNA 3IE1A 3R6LA 2IIBA 3QY0A 1C8LA 2QL5A 1X6VA 3AJRA 4WCFC 4IIUA 1TX4B 4GU5A 5G41A 4A03A 3DQZA 5ER6A 2V7GA 1E9DA 1QFSA 1XKQA 2B2XA 2V65A 3O4JA 2ADFA 2P6OA 3AY6A 4LXUA 3W9UA 2GA9A 2XGSA 1D6MA 1BD4A 1QIEA 4DDKA 2PD4A 4GNRA 4LBWA 3A70A 3GRUA 1H8ED 1SVLA 4A8HA 1UXHA 4GRDA 3K8ZA 4R6WA 4DABA 3DE5X 1GTSA 2B6NA 3H1FA 4J75A 4QUJA 1TD1A 3EAQA 5L7WA 2MSWA 1YA8A 1J09A 2GEUA 4G0PA 2X3UA 1Z8NA 4MUIA 2REOA 4KWCA 4EG0A 2V6BA 1RLOA 3BEOA 1FUEA 3RG8A 4JT8A 1ZA1A 4BNIA 1P18A 1QB8A 2PL3A 1GPAA 2EFDB 1IMJA 3H2GA 5K3AA 4PF1A 5KZMB 2AMFA 1USIA 1IBKB 2QK4A 4H1VA 2PLWA 1ZH8A 2JC3A 3KHKA 1YRYE 2F3UA 5LKRA 3LBYA 2FRDC 4UREA 1HQDA 4NYMR 3F6EX 1NI5A 1TAHA 2ZPAA 4MUEA 1ULHA 3WLSA 4I4IA 3GA5A 2VHCA 1JYEA 1C80A 1NJ5A 4O2BA 3IUBA 4NJOA 5EZ6B 4TL6A 3MS7A 5DULA 2IOFK 3DV9A 3LO5A 6LDHA 4UEJA 3K5WA 1OBOA 2QUJA 3FOFC 4Y6LA 1I2ZA 4BVHA 5E4TA 3QPVA 2RHOA 2GEFA 1CUJA 4IXTA 1HTTA 3HXQA 4QDOA 4MS3A 1QMGA 4Y30A 2GAOA 1HORA 2A57A 3ESDA 1NSYA 4D4MA 1BOOA 2BGKA 1QM5A 2R2AA 1L4GA 1QFZA 2CEKA 2POQX 2QTGA 2X1VA 3QW4B 4CKWB 1TZCA 4JP5A 1JX6A 4JNCA 1BEUB 2D6FA 1QK3A 3CQ9A 4G09A 2GN6A 1WSDA 1LH0A 1PFGA 1UXJA 4C05A 4LX0A 3WL8A 2X58A 1HSOA 1PNQA 3T12A 2JIOA 4YMGA 1GPMA 4FEGA 2QE6A 1WXFA 4ZYYA 4NDZA 1WIWA 3FETA 5IUNC 3KLBA 1KP2A 3T1VA 3EVGA 3NBFA 4UDNA 1G8KA 4L6IA 3ZGXA 5AKEA 3EFHA 2ZFUA 3GV0A 1SAYA 4FD3A 1HZJA 1WQ4A 1PJSA 1CWUA 1SVOA 5HF8A 2V7WA 2V4UA 4QJBA 5F52A 4EHNA 4UM9B 2H2HA 4RD6A 5HKLA 3B70A 2J5RA 2FSVA 3ICQB 3VOAA 1DI0A 1PW5A 2AXPA 2IHVA 2XD9A 1GRCA 1EXMA 1YSCA 4PG5A 4UNNA 2X19A 5DX1A 1VXOA 4QYXA 1KK0A 2DY1A 1O8CA 2G8NA 1KU6A 2YC2C 2P9TA 3B6EA 4RHXA 5FA8A 5TF0A 4W6ZA 1W0KD 4LOLA 5B1SA 4PSUA 3SYNA 5IC4A 4RSMA 3OJOA 1A9OA 3L0DA 1EFCA 3CX3A 2B4AA 3P5BA 3OSZA 3QU9A 4MUMA 4P7FA 4PG6A 1FRVA 4Q05A 4U7JA 5EZ5A 4US2R 3ETDA 4D3SA 1EI9A 2G6BA 1QF9A 1OKKA 5C4GB 1DLJA 4GDFA 3WLAA 1YFZA 3F3KA 1LBQA 2RGNC 3C70A 4O33A 5JCOC 2CHUA 4G1EB 3K4PA 1HEYA 3QHPA 4REMA 2W70A 1JHOA 4RC9A 1BXGA 1GCUA 4GT1A 4O02B 3BWMA 5EZSA 5AJWA 3EVNA 4A2CA 3NH9A 1W5FA 3L0IB 4BFCA 4YLYA 2JJ2D 4KTTE 5HFNA 1BYUA 1KMHB 1GRQA 2EKLA 2BTQA 2NZUG 3NEAA 4GX1A 4LCJA 4YDHB 4R0MA 1NT4A 4K9MA 4M37A 4KRGA 2CXQA 1KYQA 1PJBA 4TQUS 1PZGA 2MR6A 4ZPJA 1FDTA 3KYDA 5EE1A 3UAGA 4A73A 3QLEA 3OPXA 2ENUA 4BOYA 4DCUA 4P0PB 1G8GA 3G9QA 3N58A 4NU6A 2A9VA 5BORA 3TIVA 3RO7A 1JPUA 1W6RA 5K3FB 3V1TC 4FYYA 3V7WA 3ZHRA 1WB6A 3RAEC 3CEMA 4CODB 4DA8A 4BNVA 2GERA 3KR9A 4NULA 3IPAA 4P3KA 1P5JA 4WUVA 3S4YA 1D1SA 2DOKA 3OFSA 4HDSA 2F9LA 2B37A 5EWJA 1TPZA 2HIHA 2I29A 3IURA 5AM0A 4KR6A 1CQPA 3IIKA 2XRZA 5H3CA 2Q3CA 4EGQA 2A0FA 2JARA 3SOZA 4AF7A 2Y0CA 2VTKA 1ORRA 3WAGA 4E2ZA 5FEMA 2JFPA 3PUXA 3HB0A 4MW4A 1G20A 3U4QA 3KEMA 2CL0X 2VEDA 3O75A 1GCAA 4G5OA 3O84A 1WV1A 3NW9A 3GGCA 4V24A 4FS3A 2DPXA 1RWWA 2JHFA 1FVXA 4PCLA 1KO5A 3DLBA 2F48A 1E8MA 1H2WA 2B83A 2Z8YM 3UNXA 1AE1A 5EZYF 2W0SA 3Q9UA 5E4JA 1JHPA 2EZTA 3HEBA 3PQFA 3ZU2A 3KQYA 4BTLA 2PKQO 4O2AB 1NBME 1TUIA 4IXDA 5GJWC 2X0DA 3SICE 1DAGA 5JWHA 3SR3A 4QYTA 5D00A 1SVNA 2QX9A 2PX0A 3CEPB 1GOTA 1D2CA 1X42A 4FB4A 2FW9A 3X43A 4Y18A 4KXXA 2EERA 3AEQA 5MF6A 4GXTA 3PRKE 2PUVA 4NZZA 5A7GA 5DHTA 1XZHA 3DZCA 1XZKA 1FFSA 2DF8A 2IHZA 2PWZA 4L4UA 5B1HA 3BXFA 2RCYA 7YASA 3O0TA 5CFZA 4YS6A 5MFPA 2QM3A 3D4LA 3FR8A 4B2YA 3R9XA 1WWKA 3RSOA 1JHYA 2HL6A 2JBAA 5LFAA 2DR0A 2RGDA 2JDIA 3UJNA 1N33B 1OJ7A 3QVGA 4R98A 2C2KA 1NULA 3F6CA 1ZI9A 2Q9UA 1PG2A 4LCBA 4DLWA 2H6EA 4QKQA 4ZZIA 4OIMA 4Y2RA 5C80A 3GLGE 1FFGA 1RWKA 1DIOB 3L43A 1JEYB 4KJXA 5HMMA 2R8RA 3I76A 4RJTA 5ES4B 3MZ0A 3WLMA 2XV1A 1FX1A 4E2FA 1ZX1A 4DQUA 4EJSB 3PNYA 1OI4A 2PUWA 2BF4A 3TL6A 4MW1A 4OHVA 2WMYA 2ZS8A 3MVEA 3C43A 1UKYA 5B12A 5C3MA 1MRSA 5D86A 2WUDA 2E89A 3JSXA 4L5BA 4RPLA 1L5OA 1P33A 3SZRA 4RY0A 4YXWD 2FR8C 3EFBA 3A4MA 4ZQGA 1WKVA 5DNUA 1JBKA 2A88A 2R84A 1PHRA 1T1RA 5E4YA 1R6TA 3DWGA 4MUGA 1EK1A 4A2WA 1UBUS 4EA9A 1Z4OA 2WSLA 5JAQA 1M1YB 4HAWA 2HLHA 4WE3A 3Q85A 4XB6B 3TBFA 1SZJG 1E62A 1I13A 3OTWA 3TNDA 3I0MA 4CNQA 3T7IA 4NBUA 1OXXK 4YRIA 5LP6A 2O8BB 4QGGA 2XW6A 3QOWA 4UDYX 3WGNA 5KJCA 1V3QE 2O8FB 2V7BA 5E3HA 4QECA 4LF4B 3UWMA 1JXAA 3RSGA 4L08A 4TTTS 2CE7A 3OFND 1F7VA 1DQRA 3K72B 1IZZA 1PKEA 2GK6A 3CF6R 3P2OA 4IEFB 4N18A 5HJ7A 5JAHA 3NDRA 2PZKA 3M81A 5JWRA 3KV1A 2J7KA 3RVRA 3RVQA 1GR0A 4QM7A 2YVQA 4LBZA 2RJOA 4J4BA 1E7SA 1ND5A 1Z06A 3G0DA 2IT1A 3PG5A 3S1SA 1G7RA 1VE1A 1AZSC 4HQOA 4Z9AA 5F1PA 4DIFA 5A3QA 1UMBB 3A8TA 3H5VA 3FDJA 5KB3A 4BWVA 4GMGA 4K3UA 3WC4A 1SCKA 4LYGA 1JZQA 4MI1A 1JHUA 1G9TA 2H5EA 4ZQFA 3SG0A 2IU4A 4JD5A 3SNKA 3FKJA 4S24A 2CC2A 4EIWA 5AVRA 5IJAA 1YRHA 5JQGB 3THWA 1YZYA 4EMTA 2A53A 5CJ2A 2FUNB 3EC2A 3TUIC 3FVTA 1KC3A 5KJ1A 4KWEA 1XFDA 2OLEA 3QKUA 1TVCA 4PLZA 1E3TA 3EIEA 4QYSA 3QXCA 2DU8A 3O21A 2PUDA 3T3MB 1HNXB 1H3FA 5DGHA 1U28A 5LBTA 3VBCA 3ONVA 3TVTA 4H4EA 4TMKA 2X5OA 4MHTA 3CSUA 4CJXA 3FE2A 1XZAA 1X8KA 4GKVA 4GR9A 3G8CA 1Q6ZA 2VLBA 3JAMA 3E7PA 3PUHA 5ALUA 2ZWOA 4TX1A 2V7TA 3GP3A 3MTAA 1NBOA 1YQUA 5CT9A 1XTJA 4MLCA 2ZWVA 1RKXA 3T38A 2ZIGA 4G4GA 2BEKA 4QX6A 1ISSA 3ZE0B 3U7FB 2DHQA 3CE9A 5IM5A 4BLOA 3JQEA 3Q9SA 4PVCA 4R1QA 5F2NA 4XYLA 4GYKA 1DZ3A 3DXYA 2OM2A 5J2UF 3KQNA 2GB4A 3I34X 1M1NA 4H6VA 4LJYA 3DO5A 4IH4A 2AX3A 2BMWA 3LFUA 4A23A 1V2HE 3TZBA 4B5KA 3OD5A 3C2QA 4QXQA 2OXTA 5MDHA 3L1JA 4LX8A 1KO4A 3ORQA 3TTSA 2UYHA 1UMKA 4I8DA 1R9JA 3TD6A 2IUEA 1O5OA 2P2GA 4AQ7A 1XK6A 5ALZA 1JS1X 1Z2EA 3IQIX 5AOCA 3TZCA 3WYBA 3ZVRA 3DBHA 1PK8A 4JUBA 3DLIA 4WD3A 3UA4A 4TZ0A 2BZ1A 1DIBA 3K94A 4HYYA 2IEBA 1UBKS 3C3PA 2CMGA 1J49A 3DZKA 3RS5A 3FNQA 3WKEA 1M0SA 1VCOA 2ZATA 4D57A 3KQLA 3UAVA 2ZJ8A 3EBLA 1EFUA 4G97A 2R96A 1VI5A 4I5DA 3CRZA 1BEEA 1YGPA 3WZ2A 5I3CA 3O3NB 2MTBA 2RAFA 4YONB 5FDFA 5FLEX 3OMWA 5JBQA 2IYUA 1N3YA 2A7QA 4MQUA 3HDVA 3VHXA 3BMNB 1TCCA 1E0DA 2CDBA 1L7VC 2WSIA 1KNXA 5KSOA 3KLMX 4KR7A 3DP7A 2F67A 2EL7A 1MIOA 1EFRA 4MV4A 3VVLA 2BFEB 2IPNA 4QA9A 4A5SA 2RG1A 2O3QA 3AH8A 3ZHYA 3S7ZA 4F5DA 1P7ZA 1CLUA 1XMJA 3PNLA 5CHYA 4WXPA 1LBEA 2Q45A 1G64A 1P62B 4L22A 3HK2A 4FYPA 3P1JA 1R4MA 5A0FA 4MYUA 4MRMA 2ZT5A 3LQYA 1GAXA 1PJ4A 3ILXA 5ENVA 5FNZA 1G17A 3HB7A 1ZGGA 2P6RA 4MQLA 1AT1A 2D2VA 2A7XA 2INGX 2XSZA 4FZ3A 4UHEA 2O7QA 2EKQA 2O1XA 3IFSA 1EUCA 1NI4A 4FOSA 2X0FA 4CMKA 4D8VA 1R4NA 3AVVA 1JJVA 4CV0A 1ODKA 2I91A 4QPCA 1Z2AA 3K15A 5TGDA 1QKKA 1M2FA 3BB1A 3BHIA 5AHXA 1ZM2A 4CR7A 1J0XO 2JJ1D 1J9GA 1OWNA 1U02A 3A1SA 3TQQA 5B3LA 3DDWA 2VZ0A 3U4CA 4RYDA 3BB4A 5JATA 4JBWA 2M6KA 1ZKDA 3EIUA 1E5XA 5JLAA 1BDMA 2DYKA 3AIOA 1U9CA 4LCEA 5TMDA 5L45A 1CKEA 1SC3A 4R3UC 1MCZA 2GDZA 4M1YA 4RE5A 3BRSA 4Q4DA 1T5OA 3OY7A 3HB5X 1NBMD 4YJ3B 2ZXFA 4RXMA 1A2OA 3ZD9A 1DEHA 2EIXA 3M3PA 3OE5A 2FGJA 2V54A 3NONA 1Y5MA 3R6WA 3QXXA 2IXEA 3IVMA 4EHAA 1R6VA 5KREA 1P7YA 3CGGA 2OP0A 4NMLA 3JWEA 4GX0A 2DFPA 1QH1B 4BKMA 1KFBB 1UPUA 1JDVA 2AOTA 2RH4A 3L7JA 3RYFA 2GZMA 1Q3KA 4EA8A 1QWSA 2YWGA 5DBIA 2V74B 4I4TF 1BMFD 3ML1A 4V39A 1Y9EA 1VFNA 3STWA 2SHKA 2RI0A 2VHVA 4P3OA 1KAOA 3FOAA 2WJYA 2FAXA 1OVGA 4FW9A 4HAIA 4AYXA 1OIWA 3L6OO 4QAJA 1WXGA 1BHQ1 3PYXA 2DX7A 4B8ZA 2E1RA 2BCEA 5CXQA 2I03A 5KYWA 4M0MA 4QDTA 4DMUB 5CLGA 3KG2A 2ZR7A 5GVRA 2GN1A 2GX6A 2GDJA 5H16A 4NYJR 4G85A 3KRTA 3F7MA 4LGMA 3R3UA 2PFSA 1ZI6A 3DLAA 4G86A 4GX2A 3DBLA 1JE0A 4DNOA 5TQVA 3PXBA 5HQTA 1J8VA 1JNXX 4V3CA 2Y99A 3EXAA 1YHYA 1F2TB 2W98A 1FTWA 1QLWA 4PYQA 1L0BA 1YB6A 3LCVB 1JIQA 3TK1A 1KIMA 1C3OB 3LQ2A 4EENA 3LDAA 1TYZA 3FVQA 2EJCA 1QDLB 2IYNA 4OMDA 2FFAA 1M33A 5FKJA 4AN1A 2HA4A 1ABBA 1SIBE 4CYMA 4U2DA 3O94A 3Q5EA 2FG7C 1YJCA 2WG1A 1MO3A 4RZQA 5G40A 1P3JA 3DZBA 3LWZA 2E55A 1L5WA 2Y9MB 3PQ2A 2OBNA 3SZUA 1Q7CA 3PEFA 3P8ZA 4RTRA 3L4EA 5KUTA 4AKSA 2VH2A 2ZREA 3U7QB 3UIEA 1FW6A 4ZRMA 2QLJA 1ORWA 2VAPA 2ZBGA 1NMYA 4IRXA 1CJTC 1C9DB 2IYAA 4I1OA 2FQQA 4MLZA 1K92A 1QGYA 1C8BA 2Z09A 3EZ9A 4LQLA 2VF5X 1KJJA 3BJRA 1JFRA 4HDRB 3Q10A 4R69A 1GZDA 4WBXC 2QTCA 4D6XA 2WAMA 3EYWA 3H2HA 2WYVA 3JALB 3RT9A 5KHAA 1SZDA 3QNUA 1ESMA 2NO6A 3AESB 5KWEA 4PEVA 1RP7A 1XCGB 5IUJC 4ZQIA 4FHFA 4OQDA 3F73A 4K2HA 3TBKA 1SG9A 4DSAA 4CI0B 1L1RA 2PBRA 2AUNA 2JGMA 3A2LA 1CF2O 1RIIA 4FOPA 2J8ZA 4IJWA 5A7HA 1OY1A 2D8MA 1T4DA 4LECA 3LOPA 1YOVB 3ELWA 3QGMA 3P2YA 2IIVA 2O2SA 3WS7A 4A8TA 3QFFA 3LCJA 5EY5B 1M2OA 5DEOA 4ZTUB 2YV3A 3W6OA 5A4MS 3GK3A 1Q17A 4OQFA 1ILEA 4JMLA 2EKBA 3FPHA 1UDXA 2CXSA 2VJBA 3D3WA 2E6UX 3KHTA 1DDOA 2GUWA 3AHFA 3DF7A 3WDMA 2RHDA 3A3NA 2ZDGA 2CKMA 3CUWA 3UPTA 3DD5A 1AQYA 3R4CA 4FI3C 2C92A 2G76A 1NQVA 4D9JA 1LF5A 2B0JA 4A0GA 4DLXA 3A6DA 2OGUA 2PS9A 5HM8A 4TS4A 5KEIA 2JD1A 2JEYA 4UUOA 4X92A 4MITA 4AJNA 2Z8YA 5AW7A 4KMRA 2H7XA 1TYDE 3SQOA 5JDCA 5LQDA 1U98A 1P6QA 1ZG3A 3DR5A 3CI0K 3SHFA 4EJMA 4JBXA 2IZ0A 5FPHA 3BXOA 3ZW7A 2HADA 3RADC 4C1BA 4JYCA 1EWYA 2C2XA 2I8CA 3U7EB 2OHJA 2GBPA 5HUHA 3EZFA 5J4LA 4PGAA 3IOCA 1L7PA 3H9UA 4W1RA 1A9XB 1JXMA 4Z1MA 2R79A 2M6SA 2ZIWB 1YH3A 3QPAA 4H7EA 3IKVA 4HF7A 4JKIA 5IC6A 5EHZA 5I4BA 5L40A 1D5CA 1JVNA 4RPHA 5JS2A 3UA3A 3M8KA 2I34A 4URHA 4I1YA 3FTCA 2O20A 5DXAA 5HUJA 1TK2A 4DMFA 4EAAA 5B3JC 5B58C 5LQKA 4GOKA 3P52A 3V1UA 3C7AA 3GFSA 5CPFA 2XQGA 1MZPA 1XTIA 4J7CA 2G9NA 3LLMA 3L6UA 3AERA 1T3HA 1P5HA 1IXRC 1WQ3A 2YR0A 2D3WA 4NCIA 4MPDA 4PBRA 2GQ0A 4JBHA 4JBNA 3C16C 3WTBA 2QI9F 1MX3A 2CZQA 2VRCA 1C0KA 3HDGA 2X6QA 4HEJA 4HHEA 4KN5A 5AWFC 1G1MA 1D2MA 3LCRA 1HFKA 1VHTA 1EP1B 3KKMA 2Q6KA 4FFRA 1ZK0A 2NO7A 2QSYA 4KDRA 4KXUA 5IKPA 1KEWA 4LMRA 1K0FA 1X7ZB 3RW9A 4CMGA 1QVVA 4C0WA 3V8NA 3KXIA 2C88A 4YUWA 4HSGA 5ALHA 4ZKEA 3SJZA 3X44A 4P0QB 1RMQA 3LP8A 1KJZA 4C14A 1JFFA 2MINA 3BSSA 1K6EA 3IIIA 2C61A 4PZEA 2JD0A 4CM4B 4WBNF 1XZIA 1W8IA 5AUPB 2I4LA 5CFLA 3EEIA 3HL0A 2QTVB 1J07A 1NY6A 2ECOA 3H8VA 4OI4A 1CQZA 1X92A 5FPTA 2H31A 5EOVA 3UJBA 2AR9A 4E4YA 3IAS6 3WRXA 2PPLA 1Z7WA 4WN3A 4AY6A 4B3SB 5IBQA 3ROZA 1I1HA 3QVUA 5A3SA 2BOVA 4MRPA 1E1YA 3QWFA 1KPIA 2QQ0A 2WG2A 1OMOA 1Q1EA 4QWMA 1QP0A 1QPBA 3E5NA 3F4BA 2YN0A 2GN2A 3ZWNA 5K0SA 1Z56C 4KFSA 1M5UA 4CEJA 1UK7A 2CK3D 2H5IA 2Q5JA 3WLRA 1DELA 2MU1A 3M70A 3QTLA 1Z82A 5TNXA 4WCDA 1NA5A 3KZMA 4ZJPA 3KHSA 4GZ3A 4LHEA 3EDRA 3BL5A 4NOJA 2GRAA 4RPJA 3HR8A 2YVUA 1IATA 1F5NA 2W4QA 4DA4A 4F3RA 4IINA 3MIIA 1AS3A 3INGA 4E51A 3VYSB 3EFEA 3DVLA 3M9XA 5EI5A 1U3FA 1YR6A 4CM3A 3GT3A 5IKMA 5FUQA 4ITRC 1KMMA 4NCHA 5K2OA 1I7PA 4RA6B 1M8PA 1Y6JA 5B5SA 2GCEA 3MHTA 3T1HB 4PZDA 2GEKA 2M6LA 2A6PA 2A58A 4GZMA 1QRRA 3X1ZA 4Z7QB 1QH8B 1L5ZA 3DEZA 4H0FA 2JFFA 2B4RO 4URZR 3AL3A 4N5IX 4FFVA 2XAAA 4EZIA 3AUYA 3PX2A 2OO3A 3FX2A 3K8QA 3AYZB 3KPJA 2ID8A 2R48A 1XA3A 1AQJA 2WY2D 4XWOA 4YIKA 3FYTA 1I2CA 4OJTA 2H48A 4MHOA 3R75A 2OQIA 1VGVA 2JZCA 4U3JB 4U7WA 1ZMXA 1DOHA 4RF2A 2Q2OA 4I5FA 4EHJA 5K8LA 1K3UB 2VTBA 1ZCZA 5TT0A 2ANCA 1A98A 3D2BA 2YHIA 3DEHA 4KSBA 1WVGA 1T9BA 4D25A 1K8RA 1USUA 2DHDA 5DI3A 2OCLA 3TOSA 3B5EA 4QLBA 5C8VA 3I5MA 1CZOA 3GGDA 5E2AA 3UCFA 1JIUA 5D1NA 1R27A 5FOQA 1VYTA 2J6IA 2F3TA 2F3QA 5JE8A 3RIHA 3KDSE 2G88A 3QTTA 1J8QA 5DWDA 3LT1A 1SRRA 3DXZA 2W2KB 4BDTA 3VPFA 4B6OA 1FVOA 3KYIB 1QPZA 3Q1KA 4KBFA 3HKDB 3OE7D 4LXYA 3QVVA 1TIKA 3VVBA 6Q21A 3KZKA 3CNQS 1YE8A 2G04A 4WV3A 3WGUA 5DT9A 5BN4A 1C3XA 5G3ZA 1FFEA 4E5YA 3GLRA 1LLFA 3L1VA 5D85A 1NUTA 3NHYA 2J7PD 4KXMA 5HF9A 2QU7A 4QOFA 4TVBA 1Y3BE 5IULC 4UVGA 2AYYA 2FFRA 2WA2A 3L49A 1D1PA 1GG2A 2PHZA 2R5WA 3A10A 3UMGA 3NH6A 3FWPA 1DJMA 2Q7XA 4Q4AB 2CMHA 3ABOB 3EIQA 5C31A 4KPYA 3P2KA 4FHEA 1JKJB 2LUOA 3HN7A 3VO9A 1ZINA 1Y33E 4IIJF 4X1KA 4LGYA 3DEJA 1ZOPA 1C9KA 5LPNA 5KTNA 1O0SA 3ZDCA 3P94A 1IM2A 4EZBA 4YT4A 4Q9JA 2YWDA 3NKLA 2VI5A 2WLSA 1WCIB 5DTIA 4LZWA 5J4VA 1F0YA 3I64A 2HIGA 4NFLA 2E48A 3N0XA 2WRZA 4Q00A 4BLTA 5BV1A 3SYRA 2VP9A 4GOJA 1XYGA 1QYWA 3BRWD 4F04A 1XVLA 3FMFA 2DWQA 6REQB 1HQYE 2Y71A 2AI1A 1KHHA 1RAHA 5ERXA 1RJ9A 1GYPA 3ZK7A 2P27A 3CPJB 4Z4CA 4AX4A 1OHHA 3DE7X 4QYIA 3STHA 4PAOA 3ZWKA 2Z2XA 4ND2A 5JC1A 1U8EA 4GE0A 2O5EA 3EQ6A 1GPLA 1KJQA 2JA1A 3DWIA 5FTMA 1OFVA 4KPGA 5I9SA 3TPCA 1DXQA 2LR0A 2C4WA 1X1BA 2NN3C 1QHNA 3K53A 2V8OA 2H08A 3T3DA 3VO8A 5FADA 4BQPA 2RD2A 1NVVQ 1XN4A 3QKWA 5IK2A 1ZJ6A 1MQAA 2I67A 2ZYUX 1LFAA 1ORTA 3VU1A 4E0BA 1QHSA 1QVZA 4OXNA 4JBGA 3T9FA 3L79A 3NRCA 3AR5A 3KCNA 4J9VA 1L5RA 1QF7A 3EHDA 1CUIA 1W0JA 3NASA 3BQMB 3I4CA 4AMUA 5JRJA 1GFZA 3F7TA 2P8SA 2J67A 1EK2A 4NE2A 3TG2A 3R7DA 2R751 4ETNA 1GA1A 1GEEA 3DZDA 4P83A 2WKQA 3ZHCA 5CDUA 2BEUB 5KYKA 4R68A 1KO8A 4FIZA 3U7HB 2OFWA 5I7VA 1TJ5A 1U6JA 4ISBA 2JGAA 4OA5A 1O95A 1C0LA 4JKYA 1SVIA 2AK2A 2ZRIA 4RY9A 2ONKA 4CUZA 2ZYIA 1ZRMA 1PX2A 4JX8A 3MERA 5LIRA 2JGRA 3PV0A 3Q3EA 2JH8A 2YHSA 4ZMSA 1TMKA 3ESBA 4IXWA 2I6UA 2NX2A 4J0QA 5BV0A 2B1RA 2HWKA 3NHWA 1OXUA 3GNLA 4X3PA 4J4TA 1KERA 2JHGA 4X20A 1YZQA 2Z5FA 3AZQA 3CZAA 3R1IA 2GKOA 2P69A 3QXGA 4M7RA 4DXAA 1URPA 4KG7A 4MLPA 4I3HA 2PKYX 5KYUB 3WNDA 2BUBA 3VAAA 5LP6C 1P77A 2GN8A 3BXPA 1RHUA 1IHDA 1IU9A 1G21A 1GSHA 3D6MA 4DR6B 5IBCA 1SCQA 4ZAFA 5ELMA 2XLBA 2WIJA 1W4RA 4TT3A 3LM8A 3OZTA 4WT7A 1CCWA 3ZV4A 3PHJA 3FNFA 1QYDA 4NZ9A 2ZBEA 1P7VA 3N39C 2PQ0A 4I4LA 2ILVA 1UR5A 1JNYA 1SD5A 3KP1A 3MB8A 3GFTA 4DGQA 5C7YA 3D02A 3BE4A 1NW3A 5DP2A 3CRW1 3GWGA 3GZJA 1Z3IX 2A5FA 4UC0A 3QPWA 3WK9A 5A5EA 3HJBA 4LI3X 4CKCB 3ICEA 4JHLA 3R8FA 5JTTA 1CUGA 2ZWPA 1KYTA 1I3LA 3WGZA 4EITA 2AV6A 3D5QA 4P5PA 2C2YA 5EE5B 3PXXA 4PHFA 1S4QA 1QIHA 2VSQA 2PZLA 3WGJA 4WUTA 2RARA 2VJLA 4N5DA 1I30A 4P33A 4OFWA 3DLCA 1BU8A 3KFXA 3JZFA 2AHRA 4ZRDA 4MP3A 2P1RA 4UHHA 4BAZA 4MQFA 3X3HA 5JCXA 2QRQA 4RU1A 4KQKA 4DKJA 3LKDA 1Q7BA 2K6GA 5T4HA 5JHHB 1M2KA 3I6YA 521PA 3UQYS 1XROA 2JHCA 4MJ3A 1SA0B 2HIMA 4QREA 5CH3A 3EARA 4RMHA 4KREA 3N8HA 4QPDA 1NFFA 1PF7E 3R5TA 5FD8A 4DYDA 1U28C 4I9FA 1EVYA 1I3KA 3K0CA 1HL7A 4M9ZA 4XM0A 3L2OB 2Q1TA 3PCRB 3ELYA 3R0XA 5LB4A 5KVVA 3SS8A 2HQRA 2CNBA 4R9NA 1K5DA 3K6JA 5CK4A 1YU6A 2HRZA 4DHEA 1WU7A 4CMIB 2ZM6B 3PC7A 3X1KA 2AD5A 2XZLA 2PT9A 1AUXA 1QGUA 1RFGE 2J87A 2PMBA 3VSEA 1ZGAA 4C4RA 2O8EB 1YCDA 1Z2DA 2C5HA 4HZUA 1G291 1IOVA 4ZC8A 5CDHA 1W35A 5FIUA 4JJAA 1NXXA 1S3FA 3OZGA 4M1QA 2OFFA 2NACA 5KKCA 1WBJB 2H1FA 1JI0A 2IELA 4JQYA 5EHNA 5LQSA 3DM5A 3RT1A 1JFSA 1T6XA 1CE8B 5ALVA 3TMAA 3F90A 1O08A 4FWIB 2ODNA 2XDYA 4HJRA 4RTJA 4YRQA 4UTVA 4ABYA 3WGGA 2IDKA 5M2QA 5GTDA 1RZVA 3NC4A 3OLXA 1KKMA 3ISVA 4QOEA 3MA0A 2EGUA 5FI0B 4L7QA 2CDAA 2B21A 1TJ4A 2GTPA 3WQBA 5H83A 1E0KA 4X90A 4W5TA 2HA0A 1EEHA 2PGXA 4FFBB 3QX8A 4DLLA 2Z43A 5AM1A 1JJAA 2AQIA 5E2BA 1T91A 3UWSA 3VTAA 3MTQA 4DQKA 2VT6A 2OFPA 4BZWA 4IKOA 5D7BA 1V11A 5T41A 2BKEA 5GOTA 4CU2A 4JEIA 4PQYA 3UMVA 3R9KA 3L6EA 1YR1A 2FF5A 1U7DA 1CEXA 1UAAA 4B75A 1QHIA 4P32A 1CVLA 1XZNA 4KXWA 3ILHA 4IF6A 2FZ4A 2QM0A 2QXTA 2WWXA 1DBRA 1YZFA 1GR1A 1H66A 3ZHXA 1Y8RA 4HVCA 1LWNA 1XZLA 1J25A 4UHFA 4QICA 5IMSA 1SXIA 2D3TA 2GILA 2O1EA 1Z6YA 2PA3A 3LJKA 2CMDA 4PYLA 5G02A 3I9JA 4OGWA 1J8MF 1TJYA 4WKOA 4W5RA 1Z4QA 3KSUA 2GHIA 4TXMA 3ZHTA 5JNRA 5DK6A 4UHDA 5KQLA 5DI9A 3B6IA 4TM7A 5EMJA 1PJLA 4M8KA 4ROTA 4CTOA 3Q0EA 3A9WA 4QGFA 3F46A 2J0UB 2WHRA 3U44A 2RAPA 3WXBA 4AURA 1N4DA 1Z0UA 1W93A 2IDMA 4ZI2A 2OG2A 4LFCB 4FFOA 3L3BA 1L7RA 1YONA 3KXLA 4KBGA 1O57A 1SXJB 4FJ0A 1RW4A 1Y1RA 4MQEB 4WOPA 1GA6A 3BD7A 4UJ3A 5TR9A 3RV4A 3TTVA 3NUGA 2FSFA 3PHIA 4J4HA 3LVFO 2ODTX 4PQFA 5AVKA 1B8PA 2WVGA 3N7AA 1TGYA 4U7DA 5HNKA 5A9SB 2ZVJA 5KOIA 2G0TA 2RC6A 1GNVA 5KO2A 1T9CA 1NV9A 4K6GA 3ZTTA 1JLLB 2VTDA 2QTFA 5DIZA 1MR3F 3WADA 1W25A 4MW6A 1QLJA 1DEOA 3FOCA 2BLNA 3GPBA 4IDAA 3RFCA 2WILA 4HDMA 4ZEMA 1HEIA 2XZOA 2NV2B 3OX2A 4Y1GA 3SZMA 2MJLA 4CR6A 3ZE2B 5BNZA 3H5AA 1ULUA 2OECA 1KE2A 2DUNA 3LT5A 5AOBA 3UHJA 3K0HA 4RTLA 4Q82A 3WQRA 1GPYA 2FCAA 1ZCBA 3E7WA 3BWVA 4L1KA 1KWGA 2CXTA 1XLTA 4NZNA 5IAEA 1RC8A 1DAOA 1QHXA 5CBPA 2ACEA 4CPDA 1D1QA 2FW6A 3I1FA 1ESZA 3DE4X 5K7SA 4RVGA 2O0LA 3KQKA 2J9RA 4KNVA 5F77A 2UZ4A 2FWIA 3PR1A 2EHJA 1WNTA 1OROA 2ZVQX 5AO9A 5AW8A 2PUAA 2J5KA 4XUEA 2I6GA 1OLXA 2FX3A 2XHEA 3GMDA 5TX7A 4B35A 4B76A 1QC5B 1YR7A 4C0QC 3BDIA 3FKSD 2ZT7A 3QH4A 4OSOA 2EX4A 4MWGA 2IODA 4IVNA 5I9IA 1MAWA 4JT2A 2BR5A 1G7TA 4R9UC 1Q22A 1F0KA 4U0JA 2QTLA 3PNBA 2WMNB 1JLRA 5F5NA 3ND6A 4DCMA 4K1LA 3IJEB 1SD2A 4DZTA 4V02A 1Z7BA 1R5OA 4WASA 3WJAA 1A71A 2RGUA 3N0WA 2PM8A 4M60A 1ESCA 4C4YA 4MR7B 3N0VA 5A6SB 3NBAA 3GN2A 2ZYVX 4V0SA 1EGVB 2I71A 1EGAA 1FMLA 1SWVA 3B52X 4CKBB 4JYPA 1IEXA 1X2BA 2BGUA 1MT3A 1P1BA 4EO4A 1PDWA 1HURA 1N6PA 3K0EA 2OE2A 3IPLA 4IMPA 4F3YA 5BP7A 2QRVA 5IT5A 1MRNA 1SWWA 3M4YA 5K3DA 2PUFA 4Q3KA 1R0RE 3B7PA 5J2UB 4YACA 5K8IA 2JFYA 4Z3OA 5AW1A 4XIJA 1Z12A 4CMHA 1P17A 3LHKA 5TE9A 4QT0A 3EY4A 2BSAA 2W2LA 3HWWA 2AQKA 3VH4A 4RKFA 4AT1A 2XECA 1MAVA 3PIRA 5T7BA 1WHTB 4RAOA 1KEZA 3OJWA 5ADUS 4LPKA 3W5SA 4YRNA 2L18A 3FMOB 1T4CB 3ADDA 5JD3A 3TNYA 3JRWA 5U1PA 1P1RA 2O2ZA 2WJ4A 1AURA 1G3UA 4MO2A 3DLPX 4FPXA 3RHSA 4BQOA 1BFDA 1JXQA 2WF8A 2QRJA 4MV7A 4NYIR 1IN6A 1Z15A 3GLFE 3EBPA 2QR2A 4NCNA 3ZCVA 2J9ZB 2G9RA 2YJ6A 5FF9A 2Q0SA 1WP4A 4C7BA 3V4OA 4DNFA 2Q0QA 3K9QO 1QDEA 2IIQA 5FOSA 3CFHL 2QJOA 3EPPA 3PA6A 5FTWA 4FR5A 5A03A 4WOKA 3HSKA 5TLSA 5AHKA 1XDUA 4YCMA 2ENWA 5CCBA 3WMFA 1V26A 1QG0A 4Q12A 1N2CA 3LVRE 4ZEXA 4IXJA 1UT5A 2WUEA 1K5PA 5CIYA 2UXBB 4QTTB 2JVJA 3WWYA 4KH1A 3VHQA 1XVAA 5IAAA 2GKGA 5L3SB 1TM1E 2QGFA 4FYWA 1IEQA 4MINA 2IZ5A 3NTUA 4PZ0A 4RIIA 4PIPA 4WQMA 5CAEB 4CIDA 4LEIA 1T1EA 3I42A 2ZKLA 2WIAA 1SCUA 1BWRA 3C3EA 1CDEA 3AJDA 4UUMA 3NAZA 2NMVA 4HTAA 1AS2A 1BDHA 1A8SA 1XAJA 3PD7A 3TM4A 3BMQB 4BJHB 1D2GA 1NMEA 4C78A 1WDTA 4EHIA 4BEVA 5DYWA 2A2ZA 2W2VA 1YDGA 3QF4A 3G02A 2YTZA 4CKEB 1Y1QA 1KQFA 3AGPA 1P4SA 3I0ZA 4J8PA 2CDNA 5C81A 1LC0A 2OKCA 1JAZA 3W5IA 2FCRA 2HOQA 2GTIA 4R1MA 3H19A 2XKBA 3IUMA 3JYOA 1A88A 2QGNA 4RSRA 5KAPA 4CM8A 1BMQA 1QO0D 3M6LA 1DKOA 1SBCA 1CRZA 3IOBA 2PVPA 221PA 3I6MA 4HYTA 4MW9A 3BCUA 2H1IA 1VBKA 3LTEA 1RZRA 4LWZA 4OBBA 3G49A 1EU1A 4I99A 4M99A 4BEWA 3ONWA 1RBQA 1VB3A 4DV1B 2C5LA 2P2ZA 2DFTA 5AW5A 3MJSA 1BN6A 1JEQA 4LFBB 3ENZA 3FB1A 2R7LA 2RHBA 3QHQA 1NHGA 1T6YA 3FHTA 1PFKA 5EAIA 4PLYA 1QHGA 1CYEA 1L9KA 2PLAA 4LF6B 2QHXA 4HWOA 5IJ0A 1CUCA 1PGNA 1G98A 4FEYA 4RCVA 3ILYA 2PT7A 421PA 4CEHA 1DAEA 1E20A 1GLVA 3EXIB 4P3XA 1YR9A 3P2IA 3C8UA 4GNKA 1RTTA 2JJMA 3D6FA 4DEYA 1N5KA 2IHJA 3EJ6A 3LYAA 4KDCA 1REQB 2F64A 2OCXA 2JIQA 3IHKA 4MUBA 5CURA 2F8MA 3DXXA 3AR6A 1XLUA 3KT6A 3W6UA 4ZYLA 3GT4A 1FFYA 1M34B 4Q3CA 4O2RA 3O4FA 4OSPA 5FOUA 4IWXA 2XGJA 3LP5A 4JXZA 3M4ZA 2XT9A 3LT4A 1UMCB 1BKSB 2HF7A 4NBRA 4EKEA 4A9AA 1TAQA 4X7RA 2GPSA 2MMCA 3IBYA 4X6XA 1NQAO 2ZIXB 3C48A 1E3WB 4E70A 3U3JA 1PS0A 3SJAA 2Q4EA 2VOJA 3WRXC 4E22A 3EVFA 1CD5A 3GJRA 1I3OA 2P4QA 1V8PA 4KODA 5JAOA 3V7UA 1PTJC 2BFFA 1T0PA 2PQ6A 1CEYA 2CL6X 1GSIA 3UK2A 3EJWA 2I78A 2X7HA 2ZGVA 4HWSA 1UKBA 2GPAA 4NX2A 2WMOB 4NNJA 3MJEA 3U48A 2OC9A 1O9GA 3VM6A 1CS0A 1S7GA 4PGFA 2O8NA 2CCKA 2PMFA 2X8JA 3FPBA 3KOOA 4J0JA 5D8DA 3W1EA 4EWLA 4W7IA 3H9GA 3L6RA 3VDQA 2CW5A 1QRAA 1YZ3A 1NM5C 2V6MA 3BZWA 3FHLA 3ZDBA 3IE2A 5FFNA 1Z4KA 2QVYX 2ZE7A 3MCAA 1ST2A 1PWXA 2CL5A 4KO1S 3IP9A 3EEQA 5JASA 4CQMD 4FE7A 2X5NA 4GR5A 3V8QA 2WDPA 4KRFA 2BEWB 4FYHA 4C4PA 3NPMA 5T3YA 5JEEA 5IVHA 1ZUNA 2PBFA 1YMQA 3IOEA 2R7AA 3MJVA 3MS4A 2VZ8A 2B99A 2IPMA 3LPNA 3NBZC 4RHUA 2ODPA 5L6LB 3M6XA 4AZ3B 1BWQA 1U3UA 2ISQA 1Y9DA 2DC1A 4KQGA 1QOQB 1X80B 1SCNE 5A62A 5F33A 1EHYA 2CZGA 1KK3A 2FZKA 3MWFA 3CNNA 4MYDA 5D01A 1OFGA 2C3MA 3R3ZA 3TKLA 4G1BA 3FI0A 4W9RA 1M1XB 4DR5B 5AKIA 1JDPA 3U5TA 1S3GA 4W1QA 3RABA 2HSJA 2SKDA 5LA6F 2I6QA 1IRIA 1HLDA 2ACKA 3LT0A 4Y0AA 5KWIA 1NC1A 3BZUA 2ISSD 3CXRA 3I9FA 3LY8A 3NHPA 3MRXA 4IDHA 4O0LA 4Z9XA 5HFAA 3A1VA 4AAYA 4D46A 4K05A 1NJGA 3H9JA 2O3SA 2PL5A 3NR2A 3Q11A 2XYRA 4KIWA 5CIWA 1NIPA 4M38A 4D9EA 4Z3KA 1J9EA 2XE7A 3DDHA 5E2IA 3ETGA 2OXIA 3JU3A 2Y6UA 3QW2A 4MUAA 1ZAYA 2D74A 4HB4A 2CZCA 1WPQA 3RVDA 5DYIA 3KKEA 4BNNA 1FQWA 1A95A 1ETUA 1DXOA 3DAPA 2H1VA 2C3YA 5JJCA 2ISCA 4FGUA 3QLJA 4OKIA 2Q5IA 3MLBA 3TZEA 2AZXA 1ORHA 1P5ZB 4LGVA 2GNAA 1VSBA 2JIMA 3OU2A 3WWOA 4ARIA 4YRZA 3BA1A 4U2CA 3P0RA 3TSWA 4DJJA 1YFLA 3TW0A 1GTG1 1KPHA 5REQA 1M2VA 1PUIA 3DMHA 1XZCA 4DAEA 5LSAA 3PEWA 1EXDA 1SURA 3OOJA 4WBSA 5LBIA 4ENRA 3WDKA 1JA9A 4YMHA 1ZA2A 1G7SA 1MW9X 2OVBA 3IVRA 1AA9A 3ZIAD 2AWOA 4O8CA 1ITZA 3D6HA 1QSGA 5CB8A 4P6VF 5JXJA 3KYBA 1XTSA 4XDZA 2QQ5A 4PPYA 1PBTA 5KOYA 2MHCA 1BU5A 2ABWA 2FI1A 5GONA 4UPEA 4ZOAA 1XNGA 3OZRA 5FHQA 1ELOA 1JR3E 1KMQA 1DAFA 4EG4A 1SZCA 4R0NA 1J1IA 4IX9A 1UBHS 4CFYA 1U9ZA 1BGVA 4ADSG 3LBIA 2EVWX 3V1LA 2R9VA 4RELA 2ZVDA 1N0UA 1QE5A 3ZIDA 1O1YA 2WE8A 2AG0A 2XNKA 1HX7A 3IX7A 4HEA1 1NLFA 2XTZA 4G0MA 1JSCA 4KACA 4OYHA 5ICGA 3IVCA 1L1QA 2WWWA 2YJZA 2AK3A 3Q9LA 1E3LA 1FW8A 1VYUA 3TLJA 3VZSA 4OXIA 2B94A 2HRDA 2PNJA 3RAGA 4EHHA 2BTEA 1HLGA 1C7IA 1P3DA 1E4EB 1H6CA 2G71A 4JLOA 2K2WA 1Y5IA 2X22A 3T1YB 1GTMA 5JTUA 2ONJA 4GLJA 1T2UA 1JP7A 1P0MA 4ERNA 2O2GA 2PV7A 2YRFA 3S2FA 2C7OA 2OWEA 1QUEA 4AJ9A 1E2KA 3Q8WA 2XBUA 1IG0A 2G5PA 1OZHA 3A27A 3CSSA 3HZHA 3KV3O 1AV6A 1T36B 3VKFA 2JFWA 3QBTA 5F9MA 4ND7A 1RRVA 3T4EA 4MUYA 4NENB 3RBZA 2DPLA 4A2QA 4N76A 1T5HX 2JAPA 3E84A 3N8GA 3W8RA 1NBMA 4WKBA 1PIWA 1T8WA 3PDIB 1ZVVA 4EFKA 1XZFA 3D6VA 3DV0A 2WFZA 2GZ1A 5E1OA 3BL6A 3ZD7A 2OP1A 3IEUA 1SCJA 4RA9A 4E32A 4GOXA 2CJYA 3FROA 5BN3B 4IEEA 1EGQA 5L3QA 3KHUA 3E3AA 3P9KA 3I3SR 4Q93A 1WW8A 3HNPA 2I66A 1K2WA 4RKQA 4Q9HA 3S0JA 5JISA 4FKZA 1SIOA 3MPUA 4BX9A 2OK7A 5BURA 5YASA 4EGJA 2Q8NA 2A30A 3U80A 5SY9A 1MC1A 2QQGA 5EXTA 1L4BA 5F7JA 1F4PA 5KYYA 1Z4MA 2YJTD 5FT9A 4BGVA 2PCJA 5KS2A 1FXWA 3SMVA 5C8DA 1E6UA 3EB9A 4G0VA 5HKOA 3T4XA 1XLVA 3ID6C 4JGIA 3SR4A 2FOIA 2IYWA 3P4YA 4L73A 4NU8X 3GLGA 4BFWA 4INPA 1NZJA 4J0CA 1X15A 4OTZA 3RYCA 1F2VA 1F6BA 4TVOA 5FR2A 5IM4F 1QQ5A 2IX3A 4IJUA 2LIVA 1DKQA 3RFUA 2CFTA 1C3JA 5HF6A 2M1ZA 1V6CA 1X9HA 1O9HA 1DKLA 2C9BA 1YE5A 1VC2A 4PVDA 2UAGA 3RTBA 1WSAA 4EQ6B 1RWMA 1E2JA 2B4YA 3ABRB 4IOKA 3FZNA 1VCIA 4DJDC 2A5YB 3Q6IA 2VC2B 4J2TA 1J00A 3CR8A 2X9LA 2CV0A 2HBYA 4DILA 3OQJA 4HL6A 4JDPA 3KTOA 2G83A 2RGCA 3TSAA 3TUZC 3WK8A 4F9GA 3GEGA 5GAJA 1R6BX 1WAMA 3HFRA 4P7GA 5HTKA 1K7FB 5EWLA 3C0KA 3HCRA 1V8FA 1W85B 1RHJA 1ZMTA 4PG4A 1FSSA 2VHZA 3PJFA 4FYJA 4DRYA 3N6XA 4PRKA 2ZBUA 1ZNZA 4ZVVA 5KC8A 4KGDA 2HA7A 3IKTA 3KSDO 4C4ZA 3CUYA 3ZJUA 3BOSA 1X94A 2QROA 2QW0X 3LWDA 3UPDA 5SYMA 3LDFA 3J7AC 1CZRA 3IIEA 3V4RA 3EK2A 1GGNA 1SQ0A 1U9IC 2YASA 2YXNA 3QVSA 3DEYX 4OYRA 5K3CA 2XODA 2FX5A 4F71A 1QS0B 4B3MB 3U26A 3DKPA 1K3TA 1BYIA 1CJVC 2ZBDA 3I45A 2FKAA 4OHUA 3Q7IA 3F97A 5I01A 2J3IA 3C7DB 3U7IA 3B6ZA 3C45A 1HETA 5BV2P 2ZSEA 2ZJYA 5J4HA 3K0CC 5CLIA 4A92A 5IH7A 1MUUA 3KE9A 4XWGA 3TOVA 3GNQA 3ISTA 4C04A 1L5VA 2RGGA 4DYVA 1P0PA 3COYA 2E4XA 2NUPA 3M4XA 4TUYF 1A9TA 2ATCA 2PLNA 3WLIA 4RTQA 1K6IA 3MJDA 3SX4A 5THQA 4BQSA 1QCCA 2C8LA 4IQ4A 4IIJB 4JLMA 4JR2A 4K03A 2Y0PA 5JJ5A 5JUWA 4DA7A 4HBGA 4W8HA 4Q5IA 3NBXX 4Q4HB 4RZHA 2C2GA 2AOUB 2QPTA 4LSMA 1HEUA 3MS2A 4QTYA 2OGSA 1PBNA 4BWFB 2O4UX 2WHPB 4JLSA 1DAHA 1W96A 1XWWA 1B6TA 3L18A 1DHTA 3LQRA 3LT2A 2R4TA 4QDJA 1B76A 2K87A 2P7HA 1L4YA 1DCKA 1O6CA 2ZK7A 4JQZA 4EVSA 1M54A 2GF9A 4HUQB 1ISRA 1ODSA 1T15A 1ZIXA 3CNLA 1B26A 4HYEA 1J42A 2O0KA 5IG2A 3VJKA 2HSEA 3O0DA 4BLUA 3OZEA 5AICA 4QDZA 3PB3A 1Z22A 3QSYA 4NOKA 4UAUA 3ESRA 4QGSA 1LF0A 3OTHA 1S3SA 5I7EA 2OT3B 1JU3A 5KX5A 2PXAA 3CKKA 3AM3A 2IY7A 3F6PA 1DMRA 1J2RA 2FQYA 1NUAA 4MGIR 3PZRA 2CNDA 2P3LA 3G0CA 3NOQA 5K3BA 3G23A 4K28A 1KXJA 2NXJA 2OZEA 3PQ3A 3IVGA 2R8OA 2GBCA 1NASA 2L0XA 3CX7A 4WLOA 4ND8B 1V43A 3NJ8A 4WKGA 3PRJA 1AHHA 5H5JA 3H8JA 3TSZA 3PDUA 2B0CA 3I37X 2YV4A 2HI0A 3AI7A 2ZB7A 1AF7A 1YHZA 2PS1A 5B58T 1XDZA 4O2BF 1RE1A 4NJMA 1M83A 5T5QA 2OHOA 1XALA 4ZT2A 1Z6ZA 2WM8A 3JWHA 5J43A 4EA6A 4KLNA 5THKA 3IAM1 4C87A 1UUFA 4G9BA 4EPYA 2FMUA 1NVFA 1PJ3A 3PC8A 4HRAA 2PSEA 3UJPA 2XWSA 3N2GB 4O4HA 2ZWMA 1M6YA 3VUFA 4ETWA 1BROA 4D9KA 3VR6A 3E22B 3VPXA 3T94A 2CNWD 1TU4A 2W6IA 5TIIA 4R41A 4YREA 3QBVA 4OHXA 5GMOA 2FXIA 2GT1A 4LQDA 3FW1A 5EJ8A 5IWAB 1AH2A 1E92A 2HKIA 4WPGA 1PFUA 3AGQA 1MA0A 1OILA 1YI8A 1TC1A 2DWOA 3U1VA 2HPAA 3PL1A 2RH5A 1LZLA 4PW0A 1E4YA 4H4CA 1T0BA 5K0EA 1E6EA 1Z73A 1I7NA 2OCKA 3PJDA 3A04A 4I9HA 4NBSA 5AJHA 1BSVA 1CXZA 4NFHA 4OK5A 1V1JA 3CN7A 5J40A 4H16A 1CR6A 2B5OA 5IXJA 2O6LA 3QBJA 4PM4A 2ZBQA 1ADJA 4U7GA 2G36A 4UDOA 5SV2A 4DNPA 1JR3D 1MF7A 1YB4A 2KM1A 2WTAA 2W6CX 3H5LA 4C7XA 2V3VA 1K7XB 4LPSA 4LY9A 4GQAA 4AKEA 5EJ7A 2HH9A 4REQA 3REFA 2VHUA 1MB3A 2I0FA 3I2KA 3OWHA 2P4HX 3ZDFA 2X86A 3UW1A 2IU3A 3PT5A 3REQB 4DC9A 2MSCB 5KTKA 1YT5A 3QE9Y 1WMEA 4EB6A 3PWTA 4XD7D 3I9NA 4MRSA 5EC8A 1WW3A 3KYJB 1ONOA 1TQ8A 1XDBA 3ZUPA 4DDVA 4NAHA 2G28A 4NU0A 4V0NA 5EUQB 2VJQA 3FYUC 1GKIA 1EWKA 2PLRA 1IUOA 2NZXA 1BRMA 1DEXA 2VPTA 3LCCA 4FBGA 3DAOA 1WBDA 4QNRA 4EYSA 2CXOA 5F64A 2X77A 3ICPA 3BGSA 4B7CA 3U37A 2GCIA 4YJGB 3LC2O 2VWHA 3B78A 2ZJFA 1CRWG 2YVLA 3QY9A 4R2MA 4YJDA 1BVRA 3ZN2A 3D0OA 3PEEA 1Y37A 4INOA 5CX1A 4ZMBA 1VMDA 1WB9A 5LNK6 2ZT6A 4HV4A 4P98A 4RFSA 1G8SA 1PWZA 1NU8A 1T29A 2AG8A 2O0MA 5CTAA 5KVCA 4H6WA 4OF4A 1R9NA 1U7ZA 1YAJA 5C2JB 3UGTA 4DLUA 1FNSA 2FUCA 2WIGA 3BKWA 5F51A 4I36A 3ZI7A 4X1YB 2D4HA 3K6KA 1Y6FA 1J1UA 5KAMA 4OHCA 3I1YA 2ZCJA 3C3KA 1HGXA 5CHEA 3ROTA 1XPJA 3SC3A 4KZKA 1OZ0A 1U2DA 5JALA 2GXQA 5K8VA 1M8KA 3CLHA 3SSOA 3EAGA 3AFHA 3FD8A 5ALOA 2NUTA 1V8DA 3GUHA 1P0IA 3O03A 4KQFA 3VSBA 5K0TA 2YY7A 1NPYA 4XYEA 1SOWA 5A5DA 3A1NA 4ZVUA 3ESQA 3E2MA 4EYOA 3N28A 3RFFA 3FMGA 3TNFA 2DPYA 3OE7A 3E23A 1VL6A 1MH9A 1W48A 2BRUC 5HS6A 4BJ1A 4GE3A 4QU0A 3SR0A 2IYYA 2G6TA 4CHGA 4LMAA 4AKIA 5AW9A 1LLQA 2ESRA 4WXMA 3LVBA 2G5TA 4B44A 1EWVA 4D81A 4K9SA 2RHGB 1F2DA 1HKHA 3JR3A 4NTZA 1NT2A 3T52A 1RXVA 1JIKA 3UENA 5DO9A 5EJGA 4XJXA 4EI7A 5KI6A 4NDNE 2OCGA 4P4UA 4EY6A 3C8ZA 1GL9B 1MH1A 3I9LA 4LZZA 1UL1X 4LF8B 4NK5A 3W2EA 5FUXA 1DO2A 5A6VA 3STXA 4LOIA 1GPUA 2HT6A 2OAEA 4MNTA 4CNBA 1K8YB 3KLNA 3CKMA 5EPOA 1KJIA 3E0QA 3CUKA 4LJSA 2R60A 3PFIA 3BRWA 1F12A 3WKAA 3NTXA 2V1UA 4M3NA 4U6QA 5JIBA 1KJ9A 5SYNA 2I1WA 4FFSA 1TRKA 4EPTA 3PHCA 2W90A 3OZIA 5B7GA 3PNSA 2F4VB 1DEKA 3QYAA 1WY5A 1I4DD 4LRSB 4PFKA 3VPBA 5LB2A 2AW3A 1VJDA 2NYAA 1AY0A 2HA5A 2O07A 1IMOA 4OU5A 3FPSA 1EFKA 2WYWA 2BAGA 3L05A 1CUWA 2QTWB 4F5WA 1AB5A 4OLFA 2JLYA 2D7CA 4KSYA 2ZRAA 5F2OA 3BK1A 3NM6B 4L2IB 3KKZA 4KYIB 3TW8A 1KI6A 1EINA 3QKSB 1OFUX 4BQFA 5INTA 4ZODA 1A50B 2Z6QA 2Z30A 3ETEA 4M0DA 3W05A 2V7UA 1C4XA 1V45E 2N1BA 1XFAA 3CZQA 2CBXA 4QRDA 5K99A 2B1JA 3AF3A 3IJPA 1WMBA 4G0ZA 3HEAA 5LQJA 3I52A 4ACAA 3IBSA 3TQOA 5LQRA 4UM9D 1OBFO 1XEWX 1BHSA 1OYYA 3IEXA 4Z4FA 1J2TA 1N9ZA 2MT9A 1LSOA 2FMXA 4KN9S 3MJTA 4JA0A 4FU0A 4RORA 4BVEA 3TECE 2V6GA 1PZXA 4CCYA 2XCSB 5E6UB 4YWJA 3GA0A 4XEUA 2BGTA 5KQPA 4OLAA 1U8FO 3E9RA 5FR1A 2VYQA 1NRIA 4XEHA 3SVLA 3ZY5A 1N2EA 3HQ4O 1RRGA 1K63A 2G5GX 1H2XA 1KI8A 3ED5A 4IHAA 3WL4A 1OI2A 2PEZA 2XDQA 2ZS9A 5ITVA 4PFQA 5HKKA 5EP4A 3URMA 2C8JA 2LDXA 5FOVA 5FBHA 4HAXA 4YRDA 2PGAA 1ZL2A 3EW9A 4ROSA 4RVCA 3GBVA 1GU1A 3CA8A 2PGDA 3FMPB 3OQ6A 1SEPA 1U3WA 2RGWA 3R09A 5GZ3A 3NVMB 3OPQA 4W9MC 1DNPA 3AI1A 4UCQA 3UT6A 3QNMA 3ADBA 4ZYTA 1UOEA 2QR3A 4DLVA 5EHXA 5DKFA 2E5LB 2Q3LA 3GRRA 3A6EA 1G0OA 4EW1A 4CQNA 2JEZA 4IDFA 5CVUA 1J0AA 1KFEB 2C42A 2Z8XA 3D3JA 3IP7A 3KVNA 3JQ8B 2V7VA 1SNYA 4GS5A 1ZD5A 2BFDB 4PQRA 3RREA 3WGVA 1FYDA 3WV4A 5A06A 1NVEA 2BEVB 4QHSA 3JRXA 5TARA 4RL4A 1CUXA 3L1KA 1OAOA 1HT3A 2Q4DA 4QO7A 1ZK4A 2EFGA 3ZUGA 4EPRA 2QZ4A 1N3IA 4NV0A 1PT6A 1SXGA 2BFBB 4RF5A 5DF1A 3COVA 1WA5A 4Q1BA 3KAJA 2OO5A 2G1PA 1N9GA 5AVYA 2VNAA 3BTUA 3AT1A 3ETLA 3L7MA 1YDEA 1JKFA 2VDWA 4MVJH 3MWLA 5F98A 2ZETA 2F00A 3OLCX 1EHCA 4DKXA 3QXJA 2B8WA 3KWFA 3OP4A 3ZWVA 3NB0A 1DDIA 1XIVA 2IYQA 5HK9A 3FUXA 3O2QB 3ZLJA 4KQ6A 4DMKA 4GLLA 1KSFX 3A1EA 2CB9A 1EFVB 4NBNA 4O5OA 5AW2A 1ADFA 1ODJA 1U9JA 5EIBD 3UWPA 3N2KA 8LDHA 1L4NA 1RQXA 2WF7A 4L4XA 4F4HA 3GPLA 1NKSA 4RIFA 3U4MA 2REXB 1ZL0A 2J6BA 2FPMA 2A0UA 1L5MA 3A3OA 1YFKA 3E70C 5IJWA 1QCDA 3ST7A 4MMZB 3PKIA 2GSDA 4OQMA 4P31A 1QOZA 3VZRA 3ZOKA 2FPPB 1JSLA 1OT3A 5FWNA 3H1BA 2VNHA 1A69A 4GX5A 1YQWA 5J3JA 3MJ4A 2QYHA 4EJ0A 3ZJ5A 1TJNA 2Q3EA 3QPCA 3SQMA 2NADA 4Q3OA 3VNVA 3B1ZA 4EKYA 2XE6A 4MDFA 1PR2A 1A8QA 1IHUA 3W2IA 2ZAIA 2P9ZA 1GTVA 3LC1O 3LUFA 4NK4A 4TKVB 3ZU5A 1DSSG 3L4BA 3PFHA 3VVMA 4CDGA 1YQ9A 4Z53A 1GQRA 3R7LA 5K3OA 4EECA 1W0CA 3S7TA 5DCWA 1QK5A 3I1JA 3G9UA 4ND1A 3WSWA 3B9PA 3FCUB 4QUEA 4AMZA 3DKRA 3VRHA 9GPBA 1NW4A 3M0EA 3ANYB 4XTRA 4XGKA 5TQ2B 2KX7A 3U56A 3NM5A 4BO9A 3EXEB 4G65A 4JBLA 1W7AA 4IV8A 3EASA 1KRHA 3PIDA 1RR6A 4QBHA 4D4LA 2O57A 3FGNA 3TGLA 2BCGY 1TEXA 3KD3A 1ZW1A 4I08A 4FDVA 5E9QA 2HLPA 4D99A 4MVJP 3AFGA 4ITUA 4KH0A 1D4ZA 1FEZA 4N8SA 5AI8A 5DYTA 4EYQA 2JRLA 3KEGA 2AA3A 3R0QA 4C6RA 3NETA 2ON6A 1IY2A 2F90A 5DGXA 4BB9A 1IXYA 1F0PA 4CN8A 2FDRA 4LOJA 4O29A 3HCBA 1RWVA 4ALLA 5A1JA 4R2WA 1HUQA 1OTYA 3KJGA 3IVXA 4JOSA 2XEDA 2AQ8A 1I7SB 1M5RA 1WMAA 1CRPA 3KUDA 4CMCA 2QLNA 1I6KA 2Q5HA 2EX0A 1FRNA 1FYEA 3L8CA 3MMNA 4PZUA 4I9UA 4F38A 1JFLA 1P4HA 2J9FB 2EAUA 1IQUA 1ZEMA 3HCNA 3T7TA 3Q7QA 3WB0A 3USCS 1A82A 1O77A 1P5RA 3L8YA 5JAPA 1O4WA 2I2AA 1GDTA 3IODA 1TQHA 2JGLA 2FMHA 5BNWA 3GQBB 5GGYA 1KDYA 4BMSA 3PXCX 1CRQA 4HPJB 1AMOA 5IDVA 5IRCD 5KMGB 3PPYA 3FHCB 3F2IA 3RTGA 1SKYE 1ZM9A 4GGOA 1WDMA 4ZQBA 1YIAA 3Q1LA 3P9YA 4IXNA 4XXHA 3UC9A 4PG8A 3DNFA 5LU9A 1FFHA 1PR9A 1UPAA 4EP1A 3TF5A 1EPUA 1DTWB 3BRQA 1VIMA 3A9RA 4PNEA 3VQTA 1FP2A 1GZUA 4IZ6A 1L7OA 4AXXA 4W5OA 1J56A 2H2AA 4RGBA 2CJWA 4P35A 4WZ6A 1F3OA 5BMVF 2RI1A 3I5YA 3I32A 4I3GA 4XPIB 1LBIA 1LI4A 2B8TA 1KEEB 2YFKA 3FWNA 1YL7A 4MUKA 1Y4ZA 3I04M 4JROA 4XGRA 1U4SA 5JVDB 4COOA 4L6AA 1I4EB 1DPGA 1CZUA 4IDCA 2XQKA 4MLDA 2A52A 4S12A 2CD9A 1KSGA 1NNEA 4PFJA 3L0SA 3ELBA 4UVEA 3RUCA 4QJ5A 2JLRA 2E4VA 2J3LA 5GOZA 4EY4A 4IIGA 3FMVA 1JLKA 5BUZA 1Q21A 1NZDA 1YBMA 3H5NA 5E3IA 1JVBA 3TIFA 4CV3A 3GEEA 4DV4B 3ASZA 4JN6B 1D2NA 4MJXA 4B74A 1T8UA 3DHNA 1XZQA 5AM4A