4MUJA

Crystal structure of pantothenate synthetase in complex with 2-(2-(benzylsulfonylcarbamoyl)-5-methoxy-1h-indol-1-yl)acetic acid
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
288
structure length
288
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Pantothenate synthetase
total genus 96
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4mujA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mujA01
4ZCPA 4E1AA 3TS1A 2QJOA 3ZIUA 4NAUA 3H05A 1EFPB 4UZEA 3MUEA 1KQOA 3NBKA 3IOCA 3UMVA 5HUJA 4G5FA 3K32A 4ZCSA 5DB4A 3G5AA 2IP1A 1NZJA 4EG7A 3IOEA 1O97C 5H7XA 4KPUB 3L93A 3CR8A 5FNZA 1GN8A 2YY5A 3RK0A 3H9BA 1N2JA 1IH8A 1O5TA 4MLPA 1ULHA 5TEVA 4ZT7A 3CLRC 4EG8A 2Z08A 3AL0C 4MUKA 3AIIA 1I6LA 2QUKA 4DDHA 4CT0A 1K92A 1EE1A 3OTWA 4DLPA 3Q12A 1JEDA 4I6JA 4NDAA 4KR7A 4MW2A 4EF6A 1XNGA 1OWNA 2DUMA 4ZCTA 1Q11A 2A1UA 3MLAA 2ZUEA 1WXFA 3Q10A 1IFXA 4ZT6A 3TQIA 1F9AA 1ZJWA 3KT6A 1J1UA 4MVCA 2PZ8A 2VXOA 2WSIA 2RE8A 2G36A 1PFYA 4MW5A 1WXIA 1M8GA 3G59A 1EJ2A 4L2IA 4S1OA 3FNRA 2X0KA 1R6UA 1U7XA 4ZT3A 1WZ2A 1QNFA 2AZXA 4HPWA 5HG0A 2BTEA 3VGJA 1Q77A 1MB2A 4EG6A 1JIIA 3FWKA 3H9CA 1N3LA 1QU2A 4YP7A 3QE4A 2JA2A 3RFFA 1F7VA 4ND6A 1LW7A 3OP1A 2PFSA 2E0IA 3RBAA 4CQNA 1EFVB 1OWPA 3ZXIA 5KHAA 2DLCX 1KP2A 1N2HA 3FH0A 4PBTA 3SZGA 2TS1A 4A91A 2JANA 1DNPA 2A86A 2B7LA 3DPIA 3CA8A 1VBNA 2NSYA 4F3RA 4MWBA 4EGAA 1PG2A 3LOQA 1TQ8A 2DERA 3ILVA 3ELBA 2J4DA 4OUDB 1KKUA 1D2RA 4MVWA 3U1VA 3S3TA 4XFJA 1OWLA 3HL4A 1HYBA 1H3NA 3D6VA 5KWVA 1MB9A 4QREA 2AG6A 3IOBA 1H3FA 2D5BA 4EG1A 1O94C 2C5SA 4PY2A 2E18A 2O5RA 3QTTA 1VBKA 1QJCA 4MAFA 3RK1A 3CVUA 2VTBB 2AKEA 5DASA 2QJFA 1JZQA 2X1LA 3L92A 1KH2A 1F7UA 2YWCA 2YWBA 1I2DA 4ARCA 2H2AA 2DETA 1WQ4A 3IODA 4ZCRA 2A1TR 3IVGA 4DDKA 1N2IA 3SEZA 3X1MA 1XJQA 1WJGA 3N9IA 4GRIA 3ISJA 4MW1A 4P2BA 4MW0A 2A7XA 2O8VA 1GPMA 3H99A 1U3DA 4ND7A 2CT8A 2CYAA 3A4IA 3TNJA 5K0TA 3UK2A 1EUQA 5FO0A 4WNYA 3UC5A 1PFUA 1KP3A 1NSYA 2JAXA 1R6TA 3CLSC 3P0IA 5H16A 1X8XA 1JECA 3QTBA 1IRXA 3ND7A 5IHXA 4MWCA 2BYTA 1YI8A 1XNHA 1FFYA 1IHOA 3AKZA 4NAHA 4MUEA 4PBRA 1JIKA 1O94D 3FY4A 1H3EA 1MOPA 4H3SA 3CVVA 3COYA 2V0CA 1QQTA 2OV4A 2ZP1A 1K4MA 4RUKA 1YIDA 4Q93A 1NUTA 2DPLA 4JZYA 3INNA 1U0BB 3NV7A 3HZRA 1QTQA 1M8JA 1S4MA 3I05A 2A1TS 2CSXA 1ZUNA 1IQRA 5IJXA 5JBNA 1EXDA 1O96A 4MQ6A 2E89A 2XRZA 2QUHA 1PFVA 1X6VA 3MMXA 3CVYA 1GTSA 1CT9A 2QTMA 4R0NA 1YULA 2I1LA 1O97D 4QBTA 5KCMA 5LLTA 1ILEA 1WXHA 4UZFA 3FI0A 4MUGA 1I6KA 3IMCA 1IQ0A 2R5WA 1MJHA 2YXNA 1OWOA 1NURA 1JHDA 2CYBA 2PIDA 3CLSD 3X1KA 1J20A 2QTRA 3X1JA 1N77A 1WQ3A 1VLHA 3NBAA 1JIJA 5LFAA 1JEEA 1M8KA 2VTBA 1O96B 2GM3A 4NZPA 3BL5A 4MWEA 3GMIA 1WKBA 2A1UB 4MUJA 4J76A 2QUIA 4MUFA 1KH1A 3MLBA 2WB2A 3IH5A 4R2LA 4I6EA 1U3CA 4K0RA 1BS2A 1Q15A 1WOYA 4MUNA 1G8HA 1XNJA 3ZGZA 3GLVA 4BWVA 3FOCA 2DXIA 3PNVA 4CDMA 2H29A 4DDMA 2PG3A 4ZT4A 2RD2A 1ZH0A 3P0JA 4DJAA 1O95C 1U7DA 5J5AA 4MVXA 4MVYA 1IQUA 1JMVA 1KAMA 1EFVA 4NATA 4EFKA 3LE8A 1LI7A 3GUZA 3RHSA 1T6YA 1EFPA 3IUBA 3A04A 1N75A 5TGTA 2EL7A 4R2MA 1QRTA 2EJCA 4JYZA 2CV1A 3DLAA 1FYDA 3ZJUA 2A88A 5HUHA 4MWDA 3ZJTA 5LM3A 1IVSA 1N2EA 4GU5A 1QRUA 5FO1A 3HFJA 2ZUFA 4F4HA 1MAWA 3CLTC 3COZA 1O0CA 3A05A 4WSOA 3SDBA 3KFLA 3ZUGA 4ZCQA 3IVXA 5AHWA 2IJGX 1YUMA 1K4KA 4PBSA 4MW6A 2PXHA 3UY4A 1NUQA 1MBZA 1NI5A 4YP5A 2XRYA 4HJRA 5DEOA 3SZ3A 4MW4A 4FZJA 4YP6A 3IMGA 4EG4A 1GAXA 1T9GS 3TQOA 4X0EA 1T6XA 1G59A 2D13A 3FIUA 4Q16A 3DV2A 4KR9A 3SP1A 3ND6A 1R6XA 1V8FA 1NYLA 5J59A 1OBHA 1B6TA 1Y42X 1KORA 1EUYA 3RJZA 1GTRA 4XSVA 4MUHA 2V0GA 3AFHA 1N2OA 3P52A 2QTNA 2E21A 4K03A 4DE5A 3C8ZA 1O95D 1KQNA 1K97A 2Z3VA 4AQ7A 1TFUA 1M8FA 1WY5A 3HV0A 4NX2A 1KH3A 4G6ZA 3G6KA 2CV0A 1V47A 1YUNA 3TZEA 1M1ZA 3CLUD 3AG6A 4RPIA 3SEQA 4YMIA 3IDFA 1PG0A 1NUPA 2J08A 3K9WA 1YIAA 5BNZA 2QUJA 5TS2A 3IMEA 3PNBA 4G5YA 1TYAE 1NUSA 1M83A 3VU8A 1NP7A 2OQ2A 5F23A 5EKDA 1G8GA 3FDXA 3H97A 3A2KA 2J07A 4HK4A 4MW9A 3ZXSA 3VRHA 1N2GA 1P7PA 1ZH6A 3N8HA 3PRHA 4JFAA 1COZA 3FG9A 3KT8A 4MW7A 4TS1A 3CLTD 1H1TA 4CDNA 4U7JA 1KQPA 1KAQA 1M8PA 1T6ZA 5K0SA 3CVWA 4DNXA 1KR2A 3M5WA 2WQ6A 3AG5A 1JILA 1QRSA 2CV2A 4KKVA 1T9GR 5TEWA 1MAUA 3N2YA 1O6BA 3LCJA 4J75A 4ZT5A 1GZUA 3IVCA 1I6MA 2J09A 2X3FA 3PXUA 4ARIA 3JXEA 3N05A 4JXXA 2DR2A 3E27A 3CLUC 2A84A 4AS1A 2PZAA 4KPUA 3MXTA 2CUZA 4EG5A 1MRZA 1NUUA 3FETA 2HGZA 4OUDA 1LI5A 1TYDE 1OBCA 2CFOA 2GOYA 3HMQA 3TZLA 4MUIA 3ZJVA 1QU3A 2GKSA 3D6UA 2PZBA 1GLNA 4KR6A 2QJTA 1Q19A 2HMAA 4I6GA 1J09A 5J58A 3KT3A 2D54A 4U8HA 3IUEA 1F4LA 3CLRD 2A4MA 1J70A 1TYCA 4HJXA 2WQ7A 4YBRA 2Z09A 3COVA 2IELA 2X1MA 4U63A 4XFDA 1OD6A 3UOWA 3CVXA 1JGTA 4MULA 1MC1A 4JXZA 1SURA 3ND5A 3DO8A 5DK4A 3COWA 3F3MA 1WXEA 3Q4GA 2NZ2A 2J5BA 2HZ7A 1J1ZA 3FHJA 1N78A 1N1DA 2DEUA 1N2BA 1VBMA 1PFWA 1WXGA 1RQGA 1A8HA 4ZT2A 4QRDA 1TYBE 4EG3A 1OWMA 3PNYA 1VL2A 1TEZA 4OJMX 2CYCA 1O0BA 3HGMA 1J21A 1JZSA 3P0HA 1UFVA 3SYTA 3KT0A 4L2IB 1G8FA
chains in the Genus database with same CATH superfamily
2ZJYA 1ZN2A 4TWIA 1VZ2A 3VX4A 3COJA 5HOQA 2OTCA 3VUFA 4QNNA 2ZRGA 5AHRA 2F9MA 2G0NA 1CR0A 2XKAA 3E58A 3MGCA 4HGZA 4Z1MD 1GIAA 1WB6A 1D4FA 5L3SA 1O6FA 4P32A 3RUFA 1HURA 1NZJA 2OXCA 1LX7A 1Y9AA 2D1TA 2R4UA 3HXLA 3NHUA 3IOEA 4JJFA 3AKDA 5FV7A 3U2QA 5F7XA 4I1VA 1PX0A 5D3MA 2WJ6A 2ZZKA 4LWZA 3GLTA 3I92A 3HSSA 3NWPA 4YRRA 1T1SA 2ZIXB 2BIFA 2X2FA 4JNCA 4M0PA 4ZQHA 3UMBA 3KX2A 1A69A 2H4FA 1OA0A 3L1IA 2O3TA 2J3QA 4BNFA 4D4LA 1M6VB 2VI5A 2I3GA 1RS0A 1SHKA 2QE7D 3LA8A 3NDRA 2JIOA 5DYGA 5ILQA 1P0QA 2WYWA 2ZW9A 2OORC 1ISMA 5I4IA 1U0HC 2WSSA 1NASA 5MFPA 5EKTA 4IS3A 2ZDGA 1EE1A 3IDQA 3O94A 3RSSA 1DMSA 3A11A 4QUBA 5IARA 1RYYA 1I3OA 1JUDA 3OJEA 4MKGA 1WMEA 2R751 3LW8A 1ECLA 1Y6JA 4WY8A 5TQ0B 3BL8A 1UPUA 4WOKA 3SFTA 1E0SA 5D87A 5KWIA 1DIBA 1LJLA 1Q11A 4KZPA 4MLDA 5DLPA 4N1AA 4U7HA 3OE1A 2H1VA 3MLAA 1PRYA 4EY5A 3A4VA 1GZ7A 1M33A 1U7TA 3RM3A 3T94A 3VDXA 4MJ7A 4W8GA 4E5YA 1BNCA 3G7NA 4RIHA 2B34A 3SHVA 3DR3A 2Y1OA 1A4XA 3GWZA 4HLUA 5FUYA 4Q1VA 4TMXA 4DV4B 4AY4A 1HKUA 1NMEA 2PZ8A 3K2BA 2D5AA 3OHSX 3TDMA 2PQ0A 4TTAA 1XMSA 1JKFA 1EVLA 2G36A 2O2HA 3JSAA 1PFYA 4NP6A 4Q05A 4RSMA 4WERA 3ZHVA 5JNTA 5J2TB 3C1AA 4UQPA 3T3NA 4N12A 2XQIA 3DV0A 5BYJA 3RVNA 1Y4AE 2JZOA 5LXTA 3FBWA 3I6YA 4HPWA 4JY7A 4DPKA 2WJHA 2FSVA 2NU9B 5C1DA 4G5OA 3D1JA 1P0IA 3PEYA 2RJOA 1I8TA 1J0DA 3L40A 5SY4A 1NVXQ 3G5MA 3QVGB 4R5HA 1SKMA 2IXTA 4IEEA 4HWRA 3UPDA 4V3BA 3L8ZA 3LT0A 1XDWA 1RLJA 4DEYA 2E5WA 1TMKA 3AEXA 2H1SA 3M9LA 2JGDB 4NV0A 2B3TA 3IYLW 4CQNA 1U8FO 3F47A 5EJ2A 4AD8A 3K0BA 3P32A 3IE1A 1VCIA 2WMOB 2FF5A 2OLKA 4O4LB 4WXMA 4PG5A 3ZH2A 3UYKA 3FAZA 4PPFA 4QYTA 3RABA 1GZ3A 3UHJA 2IEGA 5ITWA 2DG2A 1ZLXA 5DP2A 1JPVA 1IEWA 2EHJA 2VPWA 2B7LA 2O3SA 2WUGA 4CPDA 4P3KA 1VBNA 4WN9B 1ITZA 4QC2A 4QE3A 4Z7OB 2G77B 2GDZA 3L82B 2J9FA 2F6RA 2X4LA 1QAQA 2D1YA 1VECA 4RMIA 5AW6A 2W2VA 4TQGA 1UOPA 2RGYA 1SIOA 2HV9A 3AWIA 4ECAA 1JKJB 1ZH8A 3B1WA 3K05A 3QFHA 4I46A 4MVJI 4CMGA 4CETA 4M49A 4XVHA 1GCOA 4ZPJA 1HYBA 1UXGA 1H1DA 1YR2A 3II6X 4DCPA 1FJXA 1U7PA 4N6GA 4E5NA 2FMXA 4FOSA 1C1DA 1QGDA 2HCRA 3L77A 3VV3A 2OCKA 1XA4A 1Z6TA 5IXYA 1ONSA 3QTTA 2XNJA 3M89A 5TQJA 1Z5OA 3HN7A 4N3NA 1KDTA 1WPXA 3OD5A 4N7RA 3ZWDA 4REQA 1R0SA 5JNUA 5F7JA 4F06A 3MMNA 1NJFA 1SUPA 4QODA 2A5LA 1YR8A 4LJRA 3L92A 4YONB 1F6DA 3R5JA 1L8QA 1K63A 2XITA 4IFBA 3SHQA 2H2AA 5P8WA 2WFLA 5IFLA 2DETA 5AMXA 4QATA 4EKYA 4N76A 1IN4A 3O3MB 4BXOB 3NHAA 3T0FA 1XQ6A 1ZRHA 1I7LA 2Y0BA 4PCLA 4UE6A 2VAWA 2ZTUA 3FGOA 5DM0A 5DSTA 4NK5A 3V2UA 4E07A 4DMLA 2R1VA 3A70A 1F1BA 1RPNA 4JJ7A 3TLKA 4MX8A 3BREA 4Z3DA 3VC3A 8ADHA 3GUUA 3TEFA 1XAIA 1XWFA 2ERCA 3R5XA 3T3HA 4MRSA 1LLCA 5GJCA 3P0EA 3HG7A 3R24A 2Y3IA 3QP9A 3QXHA 5H16A 3V4FA 1Q3HA 3GBSA 1WA5A 1UKCA 5B7GA 2EJUA 1OLUB 2QTWB 1SKYB 2AT1A 3KDPA 2IP4A 3MWDB 3R5SA 2XXJA 5FUMA 2HHAA 1X87A 2EFDB 2JCSA 4YPFA 4R16A 5JT1A 4CKWB 1VHQA 3VJRA 1CUGA 2ZLBA 2AVDA 2GTPA 4NJOA 2CHVA 4KYVA 1QFSA 1JSCA 2AXEA 3CN7A 5ERXA 5HKOA 2A9KA 5I48A 5KQLA 4D26A 1F2UB 4GECA 2FWAA 3BIWA 2FTKE 4J7AA 2JEZA 3LKDA 4V03A 1ISSA 3UGKA 1MEJA 3PPWA 3ZKWB 2GEDA 4YUAA 3H2IA 1Z33A 2JFGA 2VHTA 5EPUA 3WLRA 1YAJA 1EWKA 4L4RA 5LQKA 2WWGA 1OFTA 2J1LA 2RBGA 3K09C 5AD1A 3HZRA 4UHFA 4DLBA 4ZEXA 2LP4Y 2R25B 3SLRA 2Z56A 4L50A 5AFSA 5LU9A 1JHVA 1FTSA 1YR1A 1ZUNA 2V7TA 3PQ4A 1D2HA 3SQXA 1B2RA 3DTVB 1YMUA 3D54D 4QOHA 5CW1A 3HHPA 4B1FA 4CMEC 4IG9A 3D1LA 2A35A 2WJYA 3IERA 2OO7A 1JFSA 4MPRA 5AO9A 2QUHA 2ZRJA 5JSKA 5IWCA 3IPYA 2QM8A 5EZYA 2JIRA 3KPJA 3MINB 1I01A 2J3DA 2O0HA 1DS6A 2I1LA 4GD3Q 4KB5A 4QBTA 5IK2A 3ZK9A 5KQSA 1E3IA 1V95A 2IFTA 1PLJA 2VYFA 5LA6F 3NHPA 1VE1A 2PX8A 3L7OA 4JUBA 3MTEA 3LF4A 3I1JA 5IC5A 4EY4A 3M4NA 3BDIA 2O4CA 2YXPX 4FQ5A 3R6LA 3ODGA 1BWSA 5JS6A 2AH5A 2JJ2D 3ANXA 2ZU6A 3B9BA 5LJLA 1B00A 1JVNA 3O4RA 4YJKA 4QT4A 4M53A 3L7NA 3QVJA 4KWCA 3VXKA 1M8KA 2AUNA 2MU1A 1Z4NA 1Z47A 2X5KO 2ZSHA 3D0OA 2OGSA 3F6CA 4KTVE 2Q9AA 3CS3A 2OZLA 4CTJA 3EY4A 3B82A 1WKBA 4V38A 4L8YA 1CX9B 3VSDA 3TD6A 1NPYA 4JIGA 3ESAA 5CEFA 1XF9A 3LGXA 2O59A 1JYEA 4NS1A 3WO0A 2OORA 3CNBA 5FUVA 4IHAA 1XSEA 1Y1LA 1ZGBA 3MTJA 4TMWA 2AI2A 2XOKA 3OMWA 4DLWA 2AR7A 2UXBB 4TLMB 1UT8A 1KRXA 1TT5A 2GPNA 5B1YA 1D8TA 2C9OA 4KX3A 1MZPA 2COEA 3K53A 2FQWA 5M34A 2BFOA 1XFAA 5FUQA 4DSNA 3ZWPA 3GFTA 5HHTA 1P61B 4X95A 2XE7A 3BTSA 3E7XA 2Y2UA 4S1PA 4C3ZA 4QXQA 1Q0SA 2H29A 3CBQA 4XDZA 4CN8A 2R66A 4LXQA 2WSSD 3D7KA 5FBZA 2BC9A 3R1IA 4S1WA 3ZH9B 3P0JA 2C07A 1O95C 3MD9A 2QN2A 3S99A 3UHPA 3TW6A 1A5AB 2RK6A 2Z5VA 3FRHA 4ID9A 4I81A 1THTA 4AX8A 1OB2A 2R7NA 3EA5A 3AERA 4A6PA 4CQLA 1DIAA 2BUBA 1ZD8A 3S8YA 3RHSA 1IPEA 3ZE0B 2B4AA 2J67A 3SOZA 5IWAB 3U44A 4MV1A 4D8YA 3W7VA 1RWBA 4E4TA 4YRDA 3T9CA 2EJCA 4KNYA 1IBRA 3EF1A 5F1PA 2O2YA 4W5NA 4M9CA 2CJWB 2QI9C 3D64A 4B4WA 4Z6KA 5JSUA 4XSGA 5DNYB 2H1OA 3GRRA 4FHCA 2TMYA 5K8UA 3M1IA 4HDNB 3ESYA 5IJAA 3RAPR 2OGTA 5BOVA 1T8PA 3WNBA 1KJYA 4DR5B 1T3TA 4KQEA 2OMKA 3WI7A 3OFVA 1DJNA 3ROKA 1R4NB 2IITA 4XUCA 5HF9A 4D4MA 1J97A 1H85A 3DDOA 3W78A 3A4MA 4LYGA 5E3HA 1K8XB 4Y7DA 1DIRA 1MBZA 1J49A 3AV0B 3K2EA 3FDZB 4AIRA 1DTWB 1EP9A 3I1YA 3E3OA 3AKEA 3KKPA 4JYMA 4NFHA 3VU3A 5FBVB 1OUMA 5JWHA 1GAXA 4KREA 2H85A 1DUVG 4YBZA 1G5QA 3EYAA 2ACWA 3OX2A 1CQJB 3UJ7A 4AKEA 3U1BA 2IEIA 4TSFA 4YN3A 3QU4A 5IP5A 2QIOA 3QBJA 4YIKA 1KL7A 2ZQZA 4RF2A 1HT0A 3DV2A 4WHMA 2QP9X 4FC6A 4MCAA 3HWRA 1OLSA 1ZYUA 4Q3DA 4GX2A 5FADA 1RMTA 4K9KA 3FPAA 1E9SA 5KJ1A 2C7VA 3COPA 5TQ2A 1I2BA 3HSKA 4IDOA 4WNCA 3IP6A 3LUJA 1RC1A 3Q5DA 4TLLB 4MPPA 5LUAA 4AJ1A 1U7UA 2ATEA 4QTXA 1Q74A 1YA4A 3P52A 1KFJB 2X14A 2YFYA 1O95D 4C6TA 1WCIB 2HCBA 2Z3VA 3QHPA 4PPGA 4AQ7A 1W5EA 3ILHA 4TL8A 4C7JA 3JCZA 1PBNA 3OO1A 1IBSA 1E58A 1ORVA 2DWCA 2HEGA 3HC7A 3TJRA 2AOTB 1WSBA 1KH3A 3BHNA 2H57A 1NPDA 1GO2A 3GA5A 5HKLA 1T4CA 4NESA 1AGNA 4A27A 3DM5A 4A0HA 1IOWA 3RS9A 4FHFA 4FZ3A 1TZMA 4DIOA 4AKGA 1CWUA 5AW5A 1TK9A 2I6GA 3EG9A 1TRKA 1AZLA 1DPFA 1VHWA 2C9ZA 4KRXA 3H1AA 4M9XA 4YMIA 2HT1A 3FTNA 4FCTA 3WL3A 1AT1A 2EBHX 3QELB 5K99A 2JJ1D 4CNBA 3AI2A 4R3UC 2QUJA 2IDKA 1ORIA 2DWOA 2J4FA 4XGQA 3HM2A 2RGWA 3PQ8A 4IGKA 4GM1A 3WSWA 2FR0A 3T3PB 3NANA 1W36B 2FW8A 4FU0A 1PL6A 5FYDA 4P7KA 3OEHA 2O3RA 5KBYA 3DXFA 2QEQA 4DWWA 4TLBA 5CNMA 1TADA 5SY6A 3WGJA 1BCSA 2R9VA 3SR0A 1Z35A 5IW8A 1M7GA 3G89A 1FL9A 1O57A 4UJ3A 1Y6QA 5CYGA 3UOAB 2BZGA 2EFYA 2H5LA 4JFAA 4OQDA 3E18A 3HFSA 4FFRA 1O3YA 4FQ8A 1SKYE 4RZUA 2YV1A 4YEDA 1SBZA 1WEKA 3UV3A 2B0JA 4Q1EA 5ALWA 4DJEC 3FW1A 2OE2A 4IVQA 1JTEA 1R12A 2PR7A 2ACKA 1MAUA 2W2PA 1AS3A 1LBHA 2BM9A 3HFRA 4NU6A 4AMGA 1AG9A 4WNAA 4EZEA 2CCGA 1RXCA 5A1JA 1FW8A 4ZAZA 1QNLA 2EOAA 1IBLB 2WUWE 4M9SA 2QTZA 2X0EA 1UOOA 4N18A 2OHHA 3PXUA 1MHPA 5FA5A 3WRVA 3RI3A 1TA9A 4ZOLB 5I5EA 4LJ4A 1U9JA 1FLDA 2HHLA 2PZAA 3V8NA 3ZTTA 5KUTA 4RZ2A 3UJ6A 3DLHA 1IM5A 4MRRA 4L6IA 4FXPA 3UA3A 4BU0A 2EGUA 1CKEA 5ALPA 2CNLA 1L5HB 4JVLA 4OVKA 3UGQA 2ZRCA 3OM1A 2V96A 3GUVA 3O8NA 3OKCA 3RVOA 1TQHA 4AJJA 3Q1KA 2IS1A 1SEVA 1O8BA 1K6MA 2A14A 2CXXA 4K87A 4UUOA 1YB1A 1QH1B 3IP8A 3MWEB 4OGWA 5LA6B 3ZHRA 3IXLA 2CJYA 2AIRA 4B47A 1ZFNA 2XA9A 2PJRA 4RE5A 3K2QA 3COVA 3H5LA 1ZQ9A 2GARA 2GEJA 1TCVA 3B78A 1XHLA 1C4KA 2ZVDA 3ANSA 1UDAA 3L6CA 3OPXA 4PYLA 4QBHA 4M87A 3IV6A 3CNQS 4BVBA 1UBTS 3F3MA 1GHTA 2IV7A 2GO7A 1W0JA 1TW2A 4N03A 1RXUA 4P5EA 1JQ5A 4AUKA 1YASA 3TQHA 3PUXA 3WXBA 4C14A 4OXIA 4Y7CA 5HKBA 2Z5GA 5JD3A 2GLXA 1R0YA 3AHEA 2ZI7A 1U8UA 1U65A 5IAGA 1IE3A 2RI0A 3B2EA 1G8JA 3OHPA 1W96A 4MLZA 6REQB 3T5PA 1G8FA 4I1UA 4I6EA 4XQCA 1R8XA 2AEJA 4UZSA 4DLYA 1YQ9A 4ZDIA 1HZZA 1X74A 1Y3FE 4QGBA 1FF9A 4KK3A 1NXTA 3BEOA 4OOEA 1ESMA 1E3WB 1KK2A 3GJYA 1C3OA 2PHZA 3K32A 1C9MA 3KQQA 1OLUA 5JSZB 2D06A 4MEJA 1WW2A 2G40A 3R23A 2EW8A 2RC6A 3I73A 4ZZ2A 5H8WA 1CUFA 2P2NA 3KPVA 5ESWA 2C5FA 1GN8A 1HMYA 3ONFA 2ALJA 4HRAA 4RFSB 2O23A 2H5EA 3H9BA 1OQAA 3F7NA 3PDUA 1JL3A 4KP7A 3IPXA 4MI3A 3EFOA 3SK0A 1BFUA 4C4TA 8ATCA 4BQQA 3K15A 4QUJA 5DXJA 2C94A 2AVNA 2HWYA 4WFIA 1CUCA 5DKFA 5LBIA 5BUCA 2J3MA 1XTTA 3DDWA 4DRZA 3O03A 4ZT7A 4DA9A 1JA9A 3UKDA 3T9FA 1EA7A 5GQSA 3WRYA 3SLGA 5FI0B 4N5NA 2BKUA 2C2GA 3RJMA 1K27A 2Q3EA 1K92A 5G2OA 2PVSA 4G2TA 4JCCA 2I2FA 5KNBA 2V55B 2Y1EA 5CVDA 4PPNA 3R41A 1GPUA 4FFMA 4NDAA 1E9BA 3DE1X 3A6PC 2AR0A 4XD7A 3P9XA 1A77A 2NO9A 4GOMD 1I7SB 1MTZA 2HK9A 4L4ZA 4Z86A 4IDFA 1QHEA 4L8FA 3TMYA 4EHFA 5A03A 1MGOA 3BSYA 4MRMA 2ZTSA 4OCZA 3C8HA 2XZDA 1USGA 2DTEA 2C4MA 3EFHA 3I01A 2FSGA 3OUUA 2ORWA 3QJGA 4XPIB 4DLZA 2C31A 2MDTA 2VP6A 2Q6IA 5FAKA 3CEPB 1XNRB 3GLHE 3V4VB 1F4VA 4L9RA 1C3OB 3EIQA 1IEQA 1IY1A 1U8ZA 1UFOA 1ZGHA 3GRVA 3LUPA 3KAPA 4ZVSA 4IMJB 3RS4A 5I9NA 3ENZA 5DGCA 2WSIA 4TXMA 1PS9A 3I23A 2PQ6A 1HETA 1L5HA 1JG1A 4C2TA 1FTQA 3ILXA 2XZTA 3DMFA 5LJIA 4GM0A 3K1TA 3GEGA 4DMHA 2Q3MA 1E3LA 3T7DA 4UVEA 3JVIA 1LZLA 4UVHA 1CUHA 2I78A 3QM1A 3IT2A 5TIIA 1DKUA 1T6NA 3LYAA 5ICGA 2PGIA 2XGOA 1JIIA 4MKHA 3NRJA 4NJMA 5ALHA 4RULA 1WVIA 2BRUA 5JQWA 4F8JA 4C3OB 3NHYA 3BH7A 3D8SA 3UV6A 1DT5A 3QE4A 8AT1A 2QL6A 3KB2A 3RFFA 4FFBA 4YAOA 3ZZMA 3Q6IA 2YC4C 3AC0A 1JSXA 3BWVA 2FXIA 2P40A 3F5SA 1DELA 1KS9A 4M86A 3VPDA 5JAPA 1QS0B 5JASA 1EK1A 4DR7B 3U5TA 1Z4LA 4AJIA 3PSAA 4B6RA 3NETA 5BWNA 3H2BA 1OH8A 5JJKA 3T1YB 3PPIA 2HU7A 1KTVA 4OQPA 4DT1A 1J0AA 1MVNA 1QGUB 4IR7A 3AQ4A 1HH4A 1CPYA 1J2EA 1V16B 2IYTA 3I28A 3OIDA 2PBZA 3ICPA 1PFKA 1C8LA 4O2AF 2IZ0A 2PY6A 3PHLA 1UP7A 3IJPA 2B36A 2P9CA 2IHYA 4L57A 4DCNA 2CKMA 3LOQA 3QRWA 2GD6A 4DMUB 1M0SA 3ELBA 2I22A 2KPOA 2WU1A 1Z4OA 3G5UA 5DTEA 5ADWA 4YRAA 2PJZA 1D2RA 3CBGA 1RXYA 2Y0EA 3EZ7A 4LC1A 4OI2A 5DRYA 2YYYA 4H4CA 1P4HA 2MSWA 3HL4A 3PXBA 5EMJA 4C5AA 4EO4A 1PSWA 5LN1A 1CIPA 1KIFA 3W5JA 4QOIA 3LJKA 2O54A 3MIZA 3RIEA 3UUWA 1CW2B 4GIBA 1SWWA 2VUTA 2A0YA 2Q6LA 4ZQGA 4XA8A 2V8BA 3RK1A 1E2FA 3T9BA 3KJIA 4O2BB 2JGNA 4DQUA 4JBIA 5ICSA 1UBMS 3HFGA 1JZQA 4ZJYA 1Q7GA 1XZNA 3GW8A 2XXAB 1Z3CA 3B1FA 3CNEA 2XADA 1BKSB 3DUFB 2EQAA 4I7EA 3SNKA 3EXEA 4BJ5A 5C1OA 3AHHA 1WCIA 3LECA 1FNNA 4LKOA 4BZPA 2WVJA 2A1TR 2B8JA 2ESRA 1RI1A 2FGJA 2PUVA 3CB4A 3IAS1 3L1HA 3OX1A 3SEZA 2K4MA 3RFTA 3IEVA 2FSSA 3Q7SA 5E4TA 2FDRA 1VYVA 3C39A 1H5NA 2W93A 4MW1A 1M6VA 1C7EA 3LFTA 4B7ZA 1RKXA 1S8AA 3HRHA 4ND7A 3GNTA 2HC9A 2PGXA 1NBHA 1VOTA 1XN4A 5B1IA 2P8JA 3F5FA 1WHSA 1A4UA 3CLSC 4WJLA 4MQLA 1QO7A 1U7WA 2WTAA 3ABSB 4MHOA 1QKKA 5BN5A 4ZAVA 2GJ9A 3RB8A 1CS0B 2CCJA 2DULA 3R3YA 1E79A 1KZ7B 2JHPA 4MWCA 4OP3A 4M98A 4Q3NA 1NWCA 2A33A 3EBPA 1UWLA 5A0TA 4MUEA 1XRNA 4YUYA 1ND6A 3QLUC 4J7XA 4BE7B 4M1SA 1MOSA 4DCOA 4D42A 2BM8A 1EFLA 4K9PA 4XRGA 1JLRA 5K05A 5CK5A 3H1FA 2ZJ1A 3RS3A 4P3PA 1L7RA 3K0KA 4URHA 1SCBA 2VPTA 3PU6A 5FTLA 4I3HA 2R6ZA 1XB2A 4JOCA 4EPWA 3H86A 3IR6A 3W8NA 3OQVA 1EAMA 5IVDA 5AUNB 3T7RA 1ZONA 3U4DA 3VR5A 4URUR 4EATA 2DTDA 1EP3B 3NH9A 4JZYA 5G0UA 3F6EX 3HLTA 4J6EA 4LRUA 5IDWA 2NXNA 2IBMA 1WZUA 1S4MA 1CLEA 1PDOA 3GVHA 1QYDA 3ICWA 3UH1A 5LD2B 2BM0A 2A1TS 1QVVA 4XLTA 1I4TD 3ED5A 4OSEA 3PI6A 3GNQA 4RHCA 2IXFA 5EIXA 4QVKA 1WTCA 2A54A 4KDEA 1ZL2A 3HEAA 3ZE1B 3RYHB 2KBEA 1CY4A 5JNVA 1W93A 3MCAA 1LI4A 4HGQA 4QPZA 4BUZA 1WMFA 1LNZA 3KQMA 1XO1A 3TQSA 3H1GA 5JAUA 1RHRA 3SMVA 3BMOB 1JR3E 2ZE7A 1GFSA 3IV7A 4PPQA 3U26A 3WGVA 5JZ9A 4J0HA 3VGPA 3DMRA 4PXSA 1FQKA 4KRFA 4B76A 2Z8YM 4MUGA 1RP7A 3B9RA 3IMCA 3IIJA 1OTHA 4XIJA 2R44A 2PUWA 4O4JF 4TWZA 5TX7A 1GFZA 4RAQA 5G4KB 3RT9A 3AVXA 2QE6A 1JHDA 3SICE 4TVSA 2GF9A 4DREA 1U5BA 1WY7A 3L7DA 2PSJA 2W42A 3N6RA 4C01A 2AOUA 1GG8A 2ERYA 4NPCA 2VDLB 4QT0A 2WPNA 2PFGA 3KSDO 5C2JB 2G9RA 2Q1XA 1XRPA 3NBAA 3I37X 4DMMA 2JEOA 1ZC3A 1UIMA 1A4IA 4LHXA 4R71A 3R3HA 3BL5A 3CO0S 1ABFA 4E5PA 1J8MF 5DSXA 3U7QB 3CO5A 2GHRA 1NJ5A 3SX0A 4KPFC 5JADA 4AG3A 1U3FA 4INAA 4L8VA 3RF7A 3ZE7A 1T4BA 3JD2A 3ZI4A 1XCOA 2IYXA 3LD9A 2Y0DA 1G2QA 4XYLA 4YLGA 4RXMA 5ITZA 2W00A 2ZCUA 3A1SA 3KSMA 4UNIA 1M66A 4EYKA 3IUPA 5DTMA 4JI8B 2WU8A 1DDOA 4OD0A 4PZ9A 3PFGA 4GBED 3T1TA 2G1KA 2ZSFA 3MJEA 1EB8A 5BNIA 3H83A 1YQWA 3E2PA 1QZUA 4P3NA 3T3OA 1XNJA 2CLFB 1EFUA 2B69A 1GT6A 2IF2A 5SYMA 2RI1A 1NVFA 3HXQA 2GS9A 1VL0A 3PJDA 2XYGA 3CF4A 3RGWS 1MR3F 2PTGA 4FE4A 4RTQA 1JWBB 2EZUA 3DT6A 3HVUA 2PG3A 4ZT4A 4XVRA 5TMDA 5JW6A 3IS3A 2G1JA 5LYJA 3SKYA 1N4DA 4PIPA 4Z3KA 3AL2A 4HGRA 4UHEA 2Z9CA 2LVBA 4IIJA 1RKUA 3U4MA 1BEUB 2C9BA 2P69A 3Q7PA 4NATA 1ZGCA 4PV7A 1GGNA 2JIQA 5AUQA 4C0BA 3NR2A 1NBEA 2HSJA 3CRVA 3G1WA 2CFCA 3HB5X 1BJRE 4L15A 1RPTA 5KJCA 3CUWA 4DV1B 4IUCS 2WIKA 2A5DA 4N8EA 3FPLA 4YRJA 1W59A 1Z22A 4FBMA 1YJ8A 3KQHA 4JYZA 4HB3A 3LY7A 1H8ED 3AU8A 1QP4A 1RI3A 4G0WA 3Q9NA 1V26A 2YV3A 1GU7A 4UBNA 1RLOA 4PG4A 5FBQB 1UFRA 4Q39A 3AESB 4HQNA 2PMBA 1AGRA 3IHKA 1NLYA 3TL2A 3UJ3X 5FO1A 3UT5B 3NYIA 2QX7A 3LP5A 1XTZA 4LDJA 2ZUFA 1DZ3A 1N8NA 3GLGA 3JYNA 1V7ZA 5CMLA 3STUA 3JQFA 4CEIB 4W9NA 1JP7A 2GZDA 1T9ZA 4O8CA 1A5TA 2AFVA 4LZJA 4LNUB 2OZLB 1NI5A 3CH6A 2EATA 1C1HA 5EVJA 4ZMRA 4GKBA 4MK4A 2IVFA 3SC2B 4GAEA 3BCUA 3OQ1A 4QOSA 1ZCAA 4DUYB 4NK4A 2VQ6A 3GDWA 1K7YA 3O21A 4HXGA 3ZVLA 1UDCA 1VYUA 4GOND 4LHYA 2IEDA 4YQYA 4NDNE 4FYMA 4PYIA 5DVZA 2X8BA 2XB6A 4WGGA 3GDGA 1U7ZA 2VDUE 4GXTA 2VPZA 1BJTA 3BWXA 4HG2A 3RCBA 1NVVR 4QU0A 4YAJA 1WCYA 2I0FA 2HWWA 1WZCA 4LVOA 4BL5A 2GCOB 1SG0A 1T5BA 4QDUA 2MJLA 1O08A 3T3IA 1AVTA 5J2UF 3W5VA 3FX2A 2P65A 2ZAGA 3MINA 1BRTA 1ESEA 1PQUA 2JAOA 2Q5LA 1PJ4A 5DZSA 1HDGO 1PNQA 2KHZA 2Z6QA 3FTCA 1I0IA 1NT2A 4OK6A 3AF3A 4C06A 3PJRA 1LLFA 1QBKC 2OCYC 2P5SA 4C88A 2C92A 3WLFA 4EKDA 1P2GA 3T41A 3KZMA 4DE5A 1Z7EA 1BE1A 1CR1A 1HDXA 2VWPA 3GLUA 1D09A 3OEHD 1SHUX 2WLSA 1PNOA 3EIOA 4HXYA 4ZMBA 2I2AA 3OZ7A 4DLXA 5CA0F 2F17A 4RJIA 4K6FA 4D45A 5F12A 1WY5A 2Z2IA 3OEED 3VDQA 4ADSG 1KXZA 4NX2A 4PNEA 2PSDA 5IAAA 4ND8A 3KQKA 4L02A 2GZAA 2VSQA 4REQB 3AUJB 3BE8A 4OPMA 3NDJA 3NKFA 4IDBA 4OAOA 2D7DA 1V47A 1YUNA 3A3YA 4HZIA 1LW6E 5C51B 2XCTB 1U28C 4XB1A 5F7OA 4AF6A 4C6RA 2XNDA 3GEPA 2GVZC 2XZLA 3OCJA 3O73A 3NEYA 2Q2VA 3FVVA 3DBRA 1BZYA 2O8EA 1RTTA 1VTKA 4HRYA 1GTZA 2DHCA 2BFNA 4RO0A 1BQEA 3WLEA 1D1TA 3O8OA 1AY0A 1GKIA 5A4DA 1H4VB 2OFPA 2OHIA 4QWWA 1FJ2A 4BJHB 2PSSA 4L73A 4MGZR 1VLMA 3A6HA 2O0LA 3DF7A 3E9YA 1VCMA 4MKIA 1EVZA 1WBDA 3NNSA 3TX2A 1AB6A 3FHLA 3PRHA 3PE4A 1I5EA 4BNXA 4IYRA 2WHPA 3LLVA 1P17A 1JEAA 5K0SA 1VKNA 3C3AA 1QC5B 4Q12A 3FPKA 5HQJA 1L5FA 1ORRA 1FPMA 1KAGA 4QYMA 2F8MA 3LZ6A 1DJOA 4DPLA 1V2HE 2HFKA 1GQFA 3LCRA 1NAHA 1GZ5A 3MQ2A 3N0XA 3AF1A 4DTCA 2EFEB 1PGJA 4C78A 1GZHB 3GFQA 5DNDA 3I1FA 1XAGA 3B5EA 1DOZA 4I5FA 5FPPA 1AZWA 2C98A 1I32A 1MFPA 2WT9A 3GEBA 4MYTA 2NNLD 2GJ4A 2WUVA 1I3NA 3TAUA 2BJWA 3UZUA 5KOIA 1KYYA 1NDQA 1HE1C 1DCMA 3DV0B 1GSAA 4KQGA 4OMUA 4QPCA 4ZI5A 3RYCB 3W5CA 1LGYA 1P33A 4EG5A 4HNTA 2XUJA 3INYA 1Q1ZA 5DHUA 3FKQA 2HREA 3VSAA 3K70D 3WZ2A 2O0KA 2B4YA 3HJUA 2Y68A 2ZUBA 1Y6RA 1P62B 1CUJA 4DKJA 2JGIA 3D43A 3R0XA 4M7OA 3A32A 4TMKA 1Q19A 1Q84A 2QY9A 3DXZA 4OY3A 2YMLA 4QTZA 4RVNA 2ZS7A 1H65A 2C4UA 1DQZA 2VK1A 3F8WA 4NEHB 1XKLA 4XQ0A 5AKLA 5B55A 4TMYA 2ZVPX 1MTOA 2FEAA 2OILA 4AO6A 4B2YA 2B2NA 5TQ0A 1K0FA 1T2AA 3HYTA 4QYSA 4B6PA 2L42A 3P26A 4CKEA 1JLLA 1YQEA 1U0SY 1X1TA 3V8VA 3R40A 3FHJA 3ZS9A 1XMXA 1YA6A 1XZMA 1Y9JA 2JLSA 7MDHA 3T9EA 3LG2A 1L4MA 4V0MA 3Q3EA 4UVGA 3WAKA 1XUOA 3AFIA 2GHQA 1XD2B 1Y7IA 3MWFA 3IEPA 1L7PA 2ANBA 4IIFA 1EWVA 1Z28A 3Q15C 3BTOA 4PVCA 2C0QA 2Z2KA 4IIJF 4O4IB 4YMUA 1K8YB 4UQOA 4CTNA 4KWIA 3KVYA 3ZBPA 5F2NA 4DYHA 1WAMA 2FX2A 1FX1A 1D5WA 5DNAA 3V9AA 4P54A 2OAGA 3QXGA 4AWBA 3JS5A 1EDZA 1HMPA 3C7TA 3TS1A 2X4GA 3ZCPA 5CFZA 1MNAA 5LP1A 3BPSA 2J9YB 3HBJA 3NBKA 3K1ZA 4LV6A 1EP1B 1SM4A 4WXRA 2A67A 4KFTA 4ZCSA 3STXA 1BWPA 4B4KA 2IP1A 2HX1A 4IOJA 1LKZA 2GJKA 2WIDA 3AUFA 4V0OA 3ZLUA 1V3TA 2ZSKA 5FLKA 3BJEA 1BVYF 1SHJA 2Q6KA 2YVLA 4HAIA 3M49A 2FPRA 3AR2A 2KS6A 1RBYA 2QENA 3V00A 3UPTA 2WJGA 1Y4ZA 2NPFA 2Y1LA 1I4LD 4MLPA 5AP9A 5FPSA 3ROFA 1A76A 3R8FA 5GJWC 4V0LA 2VAMA 2XYRA 1SRQA 5KKAA 1HBJA 2FFRA 2FCAA 2NM0A 1U8YA 3A28A 1ZXBA 4F7DA 3UGTA 3OJCA 3C5CA 2CEAA 4D9FA 1P6XA 3UICA 4EL0A 4UCQA 2G7MC 3QYFA 1CERA 1OHHA 3WDKA 4JP3A 3TWOA 3RUIA 3KQVA 5AXCA 1GJRA 1P4SA 2WF9A 1OWNA 3UENA 4AN4A 1IN1A 3I5MA 4G23A 4BVLA 2QI9F 4A4DA 1SKAA 2CLEB 2CVZA 2OM2A 3BMNB 5ADHA 1CNEA 5CM9C 5B12A 1UBCA 2PSEA 2WG0A 3ILYA 1ZVQA 2HMUA 4CU2A 3KLNA 1G20E 2CNNA 1G4UR 3R4CA 2VDQB 1C7FA 2YXDA 3ZQ6A 1WV1A 5JHHB 1IPHA 5EP1A 4BPRA 4EKIA 4WE3A 1VIDA 1E3SA 1OOEA 3EQ6A 1V7CA 5A1TA 1NZFA 2DYKA 1XLVA 5DM4A 4KQXA 5E3IA 3S8MA 4G8BA 3UQZA 2P41A 3C8MA 3GVIA 3LKBA 2DOKA 3QU2A 4WOJA 2HRBA 2GI4A 1GSIA 5IEBA 3TBKA 3ZCRA 4DEXA 5F98A 4M8NE 4M88A 5CR9A 4QTYA 1QGZA 4AMZA 5JNLA 4BS9A 2PRJA 3NAGA 5JAQA 2CE2X 2ZI4A 5CFMA 1KZYC 3GG9A 1GUBA 2PIAA 4BOYA 2JFZA 3N0VA 4LVCA 3DL7A 2FV8A 2NMVA 4RJ2A 3HJBA 2XWJI 4EELA 4KE7A 1MP0A 3QW2A 3ZLJA 4X61A 4YAIA 1RQNA 1QU2A 1QCYA 5FWNA 5A4AA 3M33A 1U3VA 1O89A 3M2TA 2XKBA 4FYKA 4CMIA 3HPRA 421PA 1YRYE 2YIMA 1MPTA 1TK2A 5E0KB 3WGOA 2YV4A 3E6AA 1SU8A 2C20A 5GPBA 4CM6A 4RSRA 2XYVA 2ZXUA 2XUAA 3IJ5A 4YROA 2VRCA 4KWTA 2DLCX 4FDVA 3TMKA 1NBIA 4PAGA 3IHLA 4R2WA 3UBMA 2IUYA 4EECA 1XZQA 1JFTA 1V8BA 2VAVA 4MGYR 4S2UA 4D6PA 3RTAA 2HLDD 1PK7A 5CG2A 2CVPA 2ZBDA 1GPYA 1KI3A 1RHMA 3M6LA 2PAFA 4REMA 4DC0A 3DMGA 4B3GA 1FNDA 2BFDA 1E63A 2NV2B 3SJZA 5AICA 4PLVA 3TE6A 1LBQA 4EGAA 1IZYA 3TZ6A 4U6QA 3BUSA 4KXQA 3VTAA 4GXRA 1H93A 1YE8A 1QUEA 4XFJA 1JR2A 3E0QA 3R74A 1PJAA 1S1CA 1KFCB 5LZ5A 2QMUA 1DXYA 2OXRA 2JGLA 3NDBB 4F45A 2J0EA 1O94C 5AM3A 4F8EA 1F0KA 3TGPA 1LJ8A 2R68A 1E3WA 3S2IA 5HXAA 3DW3X 5JSZA 1UJBA 2VTBB 4HV4A 1U3WA 4RVSA 4RHXA 2I3AA 5EXCA 2HI0A 3U37A 2GETA 2NTEA 4BX9A 4Y1FA 1GCAA 1GXSB 1RMQA 2IK8A 5ECYA 1XU9A 1P60A 1UPBA 1QO9A 3ZWQA 2ZPUA 3S1AB 3DMPA 3GRZA 2C97A 4GPD1 4FR5A 4PTLA 2Q0SA 4QKQA 2A0WA 4N8DA 5KJFA 3CH7A 2GPTA 5JWRA 2WWYA 1D1SA 3SVLA 1CRQA 4M0FA 4X8LA 1N2IA 2E1RA 2PQMA 3EVDA 2V8OA 1M1NA 2IEBA 3BN3A 2XDYA 3USZA 4AO8A 4J4BA 2AUTA 3ISJA 4P2BA 1GRCA 4QPJC 5FWXA 2PRKA 5BV1A 5EJ9A 1TU3A 2R6R1 1Z6YA 3IJEB 4HS9A 4I1RA 2XKKA 3ADKA 1NMQA 2O6LA 5E7MA 3TLBA 5TT0A 1M1XB 3MERA 1Z39A 2K5UA 3D8UA 1R6TA 5FPKA 1W19A 2A59A 2REXB 3OQPA 1JECA 4G07A 3LO8A 4NIMA 3TX6A 4X6UA 4IMRA 5CT4A 1C9YA 1KMMA 3SBOA 3W1WA 2DP4E 3DQPA 3SC4A 5IMBA 3NI2A 1UJ6A 5H70A 4NAHA 5D5PA 2ZGVA 3GU3A 4K86A 2C04A 4N7MA 4EMBA 3ZPXA 2YWHA 3ZU5A 3LQ1A 3VHXA 1KSHA 5TMPA 3O38A 2P1RA 3DZ8A 1UEXC 3BWYA 3VDRA 1ECJA 5B7PA 5L4NA 3N59A 1RW4A 3ZD9A 3DWEX 1LDEA 1XU4A 2VN8A 3GD5A 4DR3B 4JD5A 4MUAA 1NLFA 1NFQA 3I3OA 4UD2A 3ZNOA 1TAHA 5K0EA 1V96A 2AHOA 2ODTX 2UAGA 3NXKA 3P2IA 4PTZA 5E9QA 2ONCA 5TB5A 3TLEA 5DBFA 1E96A 1FTYA 2CNDA 4H7DA 4D9KA 4CEHA 2H1RA 4X20B 4PTYA 1NUTA 2R84A 3S2UA 3VYTB 3FCCA 4I9NA 1KQGA 1D8AA 3INNA 1I2MA 4LDQA 3EE6A 1YB7A 2WZBA 1CF4A 4F12A 4K05A 5K8CA 3FUXA 4EMUA 2HF7A 4MYRA 1UZNA 5KOJA 4TLAA 1LWOA 1XDBA 4Y6OA 4Q4JA 4UFPA 4IHKA 1J2JA 3OE5A 1AGXA 1FDOA 4O3FA 3TCXB 5MN4A 1FP4A 1S2NA 5BOSB 2H9YA 2AOWA 4DUGA 2P3LA 3Q0TA 1IDOA 2V7GA 2ZIAA 1S2MA 5JCPA 2O8NA 1OW3B 3M3HA 5DGTA 3UYLA 1XZDA 4GI7A 2BGKA 1AN9A 1TAGA 5CVUA 4F93B 2VHZA 2ZRQA 1NNEA 2XEDA 2DBVO 2Q50A 4MWSA 2JATA 3FI0A 4X66B 2PNFA 2X77A 4RHUA 3AZQA 2XXBA 1MJHA 1WO8A 4M89A 2V7VA 3RTDA 2CYBA 4QRHA 5AXBA 5YASA 3M9XA 1PBTA 1E6WA 1E62A 2Y6UA 4GPBA 4I1PA 1RM3A 1VP9A 3M6WA 4A7PA 4NBUA 1FFXA 1Z3IX 3HGQA 3JQ8B 5EJEA 3LRTA 4KO1S 4Y1GA 3TLZA 4BNWA 2QU7A 5E2IA 3T5MA 1TGVA 4IPTA 4MWEA 1WVMA 4UU0A 1A71A 1HLFA 4MRAA 5CNJA 3GIDA 1W8DA 3OI7A 1EK0A 3LSYA 3S28A 4JEMA 2ECQA 3NWEA 2HCTA 5GZ6A 5JOQA 4MI6A 1ZK4A 4RD1A 5LVAA 2JAQA 1E9EA 2E6UX 5C9ZA 3FHTA 1BN7A 4A2PA 3OZUA 5CHEA 3HSYA 7ABPA 3KV1A 5T8KC 3PNKA 5ELLA 5JH7F 3SFZA 1G20A 1V7PC 4F9TA 3RUPA 3U9LA 1KYQA 3SSOA 2ZITA 4KXMA 5K0NA 5AK0A 4H18A 3HCWA 5CW2A 5ILOA 3FOBA 1QB7A 1SVNA 3AR9A 3LM8A 4LCJA 3C43A 3WZMA 4V0ME 3DYVA 1PJRA 1XI2A 4JKOA 1WP9A 4YV1A 2XYHA 3NNNA 3HCAA 4ISCA 2DFKB 1D6NA 4R01A 2ZT5A 3OQ6A 2AE1A 4RZHA 4X71A 4DNFA 1SVIA 5IT5A 1E2BA 3M2PA 4NNOA 4FJ2A 2QQ5A 4QAQA 2XCUA 3WYBA 2WJWA 1HL3A 4P5PA 3GCWA 3GVPA 5EG5A 3GJZA 3CKLA 4BWFB 1OX4B 2GPWA 1A5ZA 4LQ4A 4Q3EA 2Y27A 2XOEA 3GUZA 3AM3A 2WAMA 1GR0A 3DMYA 2DVMA 5IAEA 2QRQA 3IUBA 2BT4A 2Q9CA 3HY6A 5EA2A 2XGSA 2EL7A 2BSQA 2IP2A 1NW7A 4R2MA 1Z5GA 3HB1A 3UCXA 1WZEA 1P5HA 3FPCA 1PNTA 1T2CA 4WGFA 3WYAA 3BYZA 1SFRA 3I8OA 1Y7LA 3R76A 2CLCX 3HKCB 1FUUA 1ETHA 3O7MA 1JJ7A 5EC8A 3RGGA 3DDSA 1CEQA 1U4NA 2X4IA 4RMJA 2G5ZA 3VC1A 3JQ8A 1RIIA 2C4HA 4I9HA 1QRUA 5E2BA 2F00A 1U9IA 3I6QA 2OV6A 5HKKA 1W76A 3OETA 1IVNA 2JK0A 2ZUDA 3PNOA 4LPSA 4R5MA 3SSAA 5LZ4A 1TF2A 2H7XA 2RDMA 4LBYA 2KB0A 4ZCQA 4A16A 5FQNA 3I2YX 4B3HA 4DIUA 1CDEA 1DTWA 3BD6A 3HXPA 1T0PA 1AK9A 3QVLA 1T5TA 3AF5A 5K2OA 2FB9A 4M1MA 1SA0B 3KJFA 1J0EA 4YP6A 3UWSA 3EXEB 3QG1A 3QLVA 3ER8A 1N2XA 5EAIA 1CJUC 2AQHA 5C1PA 3UEOA 4BP3A 1WXQA 1N0WA 2WIAA 1GVHA 4O1MA 4O2BA 4ZICA 4AXBA 4KGVA 4Q03A 1V5EA 3DO6A 4HH3C 4B87A 1APBA 4UUBA 4N6OA 3CUUA 4KN5A 2LD4A 1CUYA 1V1JA 2YJ3A 1W7AA 2WDPA 4OI0A 3AVVA 5ALNA 1OXSC 4JUIA 1T2EA 1TZBA 1RZUA 4DYVA 5KNCA 4BMNA 3F5MA 4R41A 4UVIA 3VSCA 4ZVLA 2HO4A 2G9VA 4KE9A 3TRDA 4B6OA 4QSMA 2E55A 3EPKA 1MV8A 3FWNA 3QKTA 2V0GA 3AFHA 3DH0A 2B4RO 3HH8A 1SUSA 3NO4A 4X65B 3MG9A 3U4QA 5LD2C 5HP4A 2O52A 5E1BA 4CW7A 2VPIA 3SZUA 3T4UA 2ZQYA 3PNPA 2BPOA 3DHNA 4BFUA 1JHYA 2RG7A 2VNIA 3FOFC 4C7OB 4BKRA 2QD3A 1IJBA 3NKVA 4LYDA 2PL1A 5GV7A 4E2YA 1SR8A 4P58A 4IIBA 2J3EA 3OICA 3TD2A 4TKMA 3WGTA 2QHXA 3CLUD 4RPIA 3L0PA 4ARZA 3SEQA 4BO2A 2ZBEA 4LYYA 4YK7A 1RRFA 4FEAA 1PFGA 3E9DA 4ZOBA 3TRKA 3VVMA 4I55A 4EPVA 1JNXX 1ZJJA 2F90A 5H1YA 4YWJA 2BFWA 3G9XA 3OAAD 1LPPA 2AF4C 3PDIA 4JEHA 3D0RA 1GG2A 3IQGX 4Z9YA 5CD9A 4AZ3B 2E7ZA 5AVWA 2D2XA 5EIOA 3HU2A 1TZJA 4OTZA 2KW5A 3EMKA 1U94A 2XA1A 4LHSA 4LG1A 1ONPA 5HUQA 4ODIA 1BEEA 4A03A 3ZDFA 3RHZA 3QNUA 1C2TA 1TC2A 4S24A 3OE4A 3PTLA 4MGIR 2GR7A 5B58C 2WYVA 1T91A 3OU2A 4XUDA 5GIOE 3K16A 4ZJPA 2FI1A 4MQ4A 4KJXA 2AI3A 5B1HA 2CMFA 3CJTA 4U7JA 5C7LO 1JIXA 4ARAA 4B33A 1FLAA 3ISVA 1ZBQA 4DNXA 5KNCH 4BQEA 3CVWA 3EVFA 1CUIA 3KE8A 1ZN9A 2VSNA 3F2VA 5EJIA 4BASA 1MMFB 1RCFA 3RC1A 1UDXA 2PS1A 1PVVA 3AVPA 3NBYC 4J4TA 4WXPA 4G0UA 3RRYA 1MJFA 3SN6A 4D9NA 1F8XA 1TM2A 3MVEA 1Q92A 3T12A 4WECA 1QM5A 3GC6A 3OCZA 1Y9DA 4GWKA 1J39A 2G9QA 5ALTA 4BNLA 1Q0TA 4WT7A 1X1DA 5I7OA 1D2NA 1F2TA 1B26A 4YJFA 3C4QA 3L04A 4RM3A 2X3FA 3TLGB 2V3VA 2JCYA 3WNVA 4R6XA 1UBEA 3A2NA 3EVNA 3EUWA 1K1EA 3JQAD 5AW3A 2NW6A 1XZFA 4TMFA 3VOTA 4KI7A 3BB3A 1T0HB 1WVGA 3EGOA 4EKEA 3PLAE 4L5YA 2HCFA 1MRZA 2G82A 1ZPDA 5KPJA 1TO2E 2V4ZA 5AJUA 3PGMA 1DBWA 3TZLA 1E1CB 4D6YA 4LJ6A 1P3DA 2Q3CA 2X8LA 5THKA 3OTQA 4M0MA 3TAXA 4B81A 4J0KA 2JLZA 1XZIA 2LKDA 3FZYA 2PRYA 3JYHA 3I6IA 4U8HA 3SPXA 2QX9A 3CIFA 2C9CA 3VKWA 1XZGA 4EZBA 1V7QA 1Z4JA 5KNCD 2JC3A 5KTMA 2BONA 2WWWA 2HZBA 1X1SA 5A5DA 4F38A 5FP0A 4KE6A 1H6DA 4PNPA 4IS2A 5A6VA 4Y8VA 2HIMA 5BT8A 4JFRA 1KARA 2I2WA 4H6WA 3L6OO 3SJ7A 2FK8A 3STTA 2PT7A 4Y6SA 1Z5PA 1U8XX 1WABA 2FJ0A 3ZHTA 3P9CA 3TM5A 3ZLVA 1XD9A 4Y6QA 2DFLA 1U80A 3AUAA 3ZQJA 2OLEA 3P0FA 5LYJF 2G83A 1LTHR 1UC4B 2DCUA 4M1QA 5HFAA 3KC2A 1C7JA 2WE8A 1P2VA 1OJ7A 1YNSA 2J3LA 1NVVQ 2FGKA 6ADHA 1MNQA 4IRXA 2CMKA 1X8JA 1QF9A 1U8EA 2Z8XA 4KC0A 1PTJC 3OPQA 1RLMA 3IEKA 1IUNA 3RD5A 2BTOA 3CUSA 3ZW7A 2A9OA 1N5MA 2VWGA 2O3JA 1GGJA 5BPHA 1OV4A 3L7YA 5F35A 1DV2A 1HZZC 4J0DA 1XL1A 4YRKA 1V5IA 5HUJA 4YI5A 3IVMA 5KYXB 4OHFA 2ZYHA 4US2R 4YJ3A 2VSYA 3E2MA 3KHSA 2X0RA 1BU5A 5KTSA 1EEXB 1GLGA 1S2LA 2PEYA 2ONKA 4HGYA 5FNZA 2WUDA 4J0FA 3RNOA 4LXYA 3EVZA 3G9ZA 4QDOA 2HU8A 1OAOA 3H04A 1XHFA 1L7XA 2RHRA 2ZRMA 1KE1A 4JBHA 4PU0A 3SF8B 3CLVA 3S2SA 3VPSA 3LTNC 4D97A 3D2AA 2Z04A 2OYSA 2XNCA 4MWGA 4YGXB 3OKAA 3ANLA 1Q3TA 3DZIA 3W3ZB 2QT0A 3OFSA 1XR3A 5ARBA 4NJEB 1JU4A 3M1LA 2Q49A 4EF6A 2AQIA 2XWQA 3A3KA 2PUTA 1BIFA 2BI7A 1NFFA 3QX7A 4G0MA 3AEKB 2YTZA 3I2KA 1WW3A 4ZARA 5B3AA 2IDMA 2QMEA 2Q5CA 3IURA 4PAMA 821PA 2UZ1A 4YCLA 2IOFA 2Y0CA 3K6JA 4HFNA 4C4PA 3LYHA 4JIMA 4RH0A 2GEVA 3EA4A 4BQNA 3F96A 4O4HF 3WYCA 3KOYA 2XD4A 2P9GA 5GIPE 3Q10A 1W85A 1FYFA 5B6PA 4FN5A 3ZYCA 3RRZA 5CLLA 3NUZA 4XQ9A 4DCTA 1ECFA 3KOXA 2COKA 1P5FA 1I3KA 2GAJA 3BGOS 4NMXB 2B7BA 4QQKA 3RPEA 4MR7A 3SQNA 4CQJA 1WXIA 1JWLA 4DNQA 4NFSA 3DOJA 2EW2A 4HB4A 1VZ3A 1LF0A 5JCJA 1AOXA 3BBPA 4L2IA 3I39X 1K6IA 5FH9A 1X80B 3IELA 4MB6A 5MN5A 1NG9A 2PUFA 1U3TA 1U7XA 1Z13A 4R1LA 2Q5HA 5EOVA 3S27A 2ZXFA 4Z2AA 2XECA 1PT8A 3OKPA 3G49A 4YMSA 4B34A 1GNTA 1N5DA 2XBMA 2Y1KA 2O4UX 1YOVA 3Q6NA 5DOZA 3N3AC 4BQIA 4DOMA 1ZG3A 3RW9A 4EIWA 1TCUA 3FWKA 3K73O 3BE6A 3U6KA 3KBBA 1OX4A 5JAIA 4UOZA 3NORA 4F3KA 1N25A 2B4QA 3GAMA 3U7HB 3ABRB 3OA0A 3H6GA 1HQYE 3FRJA 2NXJA 4CHGA 5EVCA 1Z6XA 5T6BA 2ROQA 3FTPA 4DLTA 3PP8A 2MINB 2VYQA 4DUGD 1EKXA 4A0QA 2QL7A 3EWIA 4PRZA 4O5AA 4AG6A 3M83A 1WSDA 1DL5A 1MD9A 3OUTA 2JBAB 4UEKA 2AHRA 1AKEA 1E4EB 5F77A 4AXXA 1LSOA 3JYLA 1IC6A 4QOJA 3J7AC 2XZPA 2DR0A 1AC5A 4HTAA 1AQ6A 2PZKA 1Y8QA 1Y4DE 5FFFA 4DY6A 1JMKC 1M9NA 1KMIY 2GNAA 2I5PO 2C4TA 5HRAA 3W4KA 3OMLA 1HT3A 3OE7A 2Z4TA 3Q5GA 4FKZA 4ZTZB 3IBGA 4UE2A 2V6MA 1JPJA 5G02A 1PV4A 3VYUB 3TH5A 2RGNA 4P4TA 3W5BA 4CLHA 1FS6A 1ZNZA 3ZTYA 1SPXA 3QEOA 2XI4A 4OG2A 5CGQB 3AR3A 2W6QA 3CRMA 4CTOA 4ETNA 4LOIA 4RZXA 5L3VA 4M99A 1AO0A 3WZLA 4J6FA 1ABEA 3OLQA 3D6VA 1UXHA 1MB9A 2XUKA 4K5QA 4ZODA 5E1DA 3WISA 4CCWA 4ZYTA 5BVHA 2C1EA 1H2HA 1QJCA 3PQEA 4RIFA 3R7BA 3T7SA 1JDBB 3EDCA 3UAZA 4COOA 2PKWA 4X8MA 1I30A 1DADA 2YW9A 4W5QA 3GUHA 1T10A 4UDXX 1DJLA 4GLJA 2ZBFA 2ONJA 4EA7A 1ACLA 3CGWA 2QUAA 3R7DA 2JG3A 1FLVA 1XRQA 2CXQA 3T34A 2OGWA 3I0ZA 5KMGB 2VDWA 5IRCD 2GFQA 3ZCXA 1XA0A 3PWTA 2YHBA 1I2AA 3CZ4A 4W1QA 3X1WA 1DP4A 5EUCA 5LMUB 5A0VA 2BKAA 4IDQA 4UEOA 2GKGA 2QPLA 1X39A 3NBMA 3CX6A 4RS4A 3N3BC 4BMOB 1HO3A 2GGSA 3K4PA 5EWLA 2O8EB 3FMOB 1OE0A 1TE2A 1LK0A 1WLSA 5TGZA 2R8OA 1EUQA 4EH1A 2IW1A 4IXDA 4GYKA 4HNSA 2VJOA 3WIDA 3ZWAA 5KOJB 4Q4HB 3G0DA 4RYDA 4B3SB 3MTIA 4MH0R 2FR8A 2QRKA 3PFNA 1FP4B 1RM4A 1G17A 2EP5A 3A1UA 5JVDA 4CV1A 2CGEA 2PZLA 2CJWA 1U0GA 2WF8A 2Q27A 1DO2A 1OI3A 1NX9A 1VP3A 2PYDA 3ACBA 1Z12A 4HAVA 4WCFC 3TKLA 1SZCA 1DC5A 5BP7A 2QXYA 2NUPB 3DP9A 4Y2JA 4HB2A 2PK3A 4KDRA 2WYUA 5FL7D 1V11B 2W98A 4NBLA 1TJ5A 4TPKA 4X20A 4ZJZA 4WXHA 1U1GA 1X9IA 3EGDA 4HYQA 2W5UA 2Q3HA 5AUPB 3ZHCA 1O94D 1XCGB 2I6UA 4MKXA 4DIKA 1TEHA 4J3NA 1SN7A 2TECE 1IG3A 4HVCA 3EOZA 3WLAA 1TU4A 3RAFC 4Y2TA 4AZ0B 3U7FB 1IMOA 1JDNA 1SUAA 2Y77A 4DUZB 2JD1A 4ZIRA 2A3NA 1OREA 2RHTA 1II8A 1J0BA 1O9GA 4H08A 5KVQA 4PLWA 4BZXA 4MV7A 2EGHA 2FRXA 2LE0A 4MV9A 4CLRA 1Y1RA 1S9HA 1GAQA 1LY1A 1UKZA 1U31A 2XSZA 3GYBA 4L8LA 4ZD6A 1U4OA 5CXUA 2BHNA 2XRZA 2BEWA 3MPUA 2Y67A 1T36A 1X6VA 4RH3A 5IKMA 4FYVA 2JGEA 3NRBA 5DHFA 3FYTA 4N6NA 4R0NA 3F6YA 4ZQCB 1UK8A 3MQ4A 1M72A 4EMSA 2QU8A 5J9FA 5KDOA 4XWGA 1O97D 1AQIA 1KA9H 3QOYA 1NYRA 1P9RA 3EQ2A 1DOAA 1BW9B 1I6KA 2WG1A 2ID8A 1M1NB 1HYHA 3B1KA 3F5QA 2R5WA 4GLLA 1ZISA 1QH8A 3QF4A 1P1IA 1XP8A 3RRBA 2PV7A 4UDOA 3ZOZA 2ID7A 3JTEA 4MRNA 1NC3A 1L5GB 2GR8A 1FDUA 3KR1A 1L1QA 2B4TO 3PXDA 1WQ3A 4FCWA 4UJ5A 5F4ZA 2P67A 4IVRA 3RU2A 3QVVA 4P5DA 1TB4A 3JAWB 1SXQA 4ZI7B 5D1NA 4MRMB 4A73A 4NOLA 1PS8A 5CJJA 3DE0X 2Z6AA 4B7XA 1YJBA 1Z6ZA 2PEZA 3QSYA 3H0EA 3F7OA 1VPDA 3BICA 3D6JA 3RTEA 1MB4A 3AP3A 1KH1A 1UODA 2D8AA 4KFRA 4B48A 8LDHA 4BGEA 1QZZA 1HYEA 5E8JA 2I6QA 2OG2A 1KDOA 2QN1A 3DAFA 3NQ41 1IK4A 1Q83A 4RJKA 1G5FA 1Z0ZA 3Q3VA 2WWTA 3K0AB 5F78A 1I5OA 3QLEA 3MGBA 4WZAA 4P83A 1F17A 5IJZA 1OLOA 2BGLA 2HBZA 3D3QA 3MJDA 4XB2A 1QFYA 1F2TB 4R51A 3R7NA 1X8KA 2JHCA 5HKAA 1HWYA 4Q9JA 3FOCA 1TQ6A 4CGZA 4IDEA 4D0LB 4BTLA 3RWBA 3ZVMA 1JB9A 1NI3A 4A8JC 3O84A 3F6SA 2FU5C 1GZ4A 1XEAA 2QSUA 1TKAA 4H31A 4QRIA 3D3NA 4AG5A 4GSYA 2FNAA 1TF7A 4YLEA 5AW7A 3AY3A 1V37A 4BAGA 1HSZA 2NAPA 2QYTA 4Q7QA 1REQB 1UOQA 4OQNA 2Y1CA 3UK1A 3ZDZB 5C8XA 3ONNA 1BKDR 2AFHA 2XIJA 3GHYA 2DPHA 4L4SA 4P81A 4JI4B 1N75A 3QVXA 2O5CA 1ZSVA 3NHKA 2CK3D 3A6GA 4NZ9A 3PRYA 2VKTA 2O2SA 2Y8EA 1FYDA 1WB4A 4FGLA 3TXXA 5IC6A 4COKA 1JQEA 3IQZA 3N8KA 2P6RA 3SSNA 1QHHA 1IIRA 3HADA 3TOZA 4IF4A 5KAMA 2ZUWA 2ODBA 1J42A 3F1KA 4DXHA 2C95A 5A4FS 4UM7A 2ZR7A 2J6BA 3H1TA 2GWHA 3CY6A 3PG5A 3UHAA 2Y0PA 2VQEB 5G4KA 3P4XA 1C80A 2OBNA 1DBIA 1YFKA 3HA5A 3M6UA 1ID1A 4PSKA 3SZ3A 2HADA 5KHOC 3FVTA 3EZFA 4C7OA 4I5IA 4BP9A 2ISQA 3G82C 3I32A 2ZJAA 3EVTA 4OBWA 1CUZA 4RPLA 2EKDA 1AS2A 1ICEA 2FVYA 2C58A 3AP1A 4NL4H 4O8ZA 1EM8B 4ZOEA 3UJAA 3V7YA 4D4IA 1G59A 1KAHA 2WZDA 4AU1A 2BISA 1Y3CE 4ZZ0A 1ILWA 1Z29A 4BLRA 4DZRA 2HXSA 1WW8A 4JEIA 1GARA 1ZKMA 3B1JA 4EJ0A 3E82A 1GDHA 1KEPA 1WPQA 1R6XA 1SQ5A 4B44A 4DQKA 1D9ZA 3UFBA 2EKZA 4KLAA 2PT9A 2J3IA 2YBDA 3IUQA 1MOZA 1XKTA 2D4HA 3LGSA 1XTRA 2R47A 3FFBA 5MN6A 4AJOA 3FLBA 1ZW6A 1UK7A 3IULA 4YV7A 5AVXA 2ZANA 4MS4A 3LPAA 3O3CA 2GAIA 2CW5A 2VATA 1XFDA 3N1UA 2V59A 1CFZA 2VBCA 4ZYXA 3CEAA 4OHWA 3WQHA 1H05A 1K97A 4X6LA 2ZE5A 4UU7A 3MSXA 5IMSA 1TUGA 2BE7A 3OU6A 3IAEA 5ALSA 4MQFA 4EVQA 4EYOA 4KFCA 1F9EA 3FF1A 4H7EA 3HI6A 3VO8A 3BD7A 5AW2A 6AT1A 4EI8A 2FUEA 3NHRA 3I4LA 3SZRA 3T1OA 4K28A 2IXEA 3I12A 1M1ZA 4GZ5A 1QIKA 4ENWA 4XRRA 4IRMA 1N36B 2FZ5A 1DX9A 3IDFA 5AVJA 1HC7A 2Z98A 3K1AB 4OJYA 3X2SA 3AB3A 3TLCA 3KEOA 3LUFA 4JI0B 5BNZA 5E4YA 3D3EA 1N1GA 1EVQA 1AXGA 2ATVA 2PH5A 3D6TB 4LOHA 3RG8A 4LF8B 3LTEA 3JPYA 2AB0A 3HKCA 1JLLB 2OZVA 3BHMA 2XUIA 3NOQA 4BVFA 2BW0A 4O02B 3GRPA 2A0XA 5K3SA 4YMGA 3MAJA 4UAGA 4LIPD 1YC2A 3G2KA 3L4EA 4FFVA 4H4DA 4GPEA 3GMTA 4UKDA 5FORA 1ZH6A 1ZOSA 4E88A 2P0EA 3FJ1A 1O5OA 3Q87B 4A8PA 4S04A 4YFVA 2PUBA 3KT8A 2O8FB 3GROA 1FRVA 1W2HA 3DJFA 1F3LA 2CF6A 4DKXA 1HOTA 4QGSA 5A4KA 3ZCTA 3LUHA 1CB0A 1D2GA 2AOTA 4FT4A 4RHEA 4NZMA 3N2YA 2MMCA 1G9SA 3DEIA 4U5QA 2QBYB 1XRLA 3HXOA 1ZRNA 4QECA 5H02A 4DCSA 3EOBI 3H2YA 4Y0AA 5KYUA 5ALXA 3AETA 1K6JA 1D5CA 1RI5A 4X3CA 3FAKA 5HGJA 2FMUA 2J09A 3LCMA 2GJSA 1HL7A 3WRXA 3PVCA 4B40A 4CL3A 5BPFA 3VZBA 2DR2A 1EJ6A 3KWMA 3CLUC 4R3NA 1KZ1A 1OB5A 2YQ4A 2ST1A 1ONOA 2FN8A 1WXWA 3MWGA 4LFAB 1VCHA 1W4AA 4J49A 1SZPA 1J7KA 4IDPA 3LLSA 4E33A 2ZT8A 2BHTA 3CCFA 3ADDA 4Q3CA 2NWQA 4ML3A 1HGXA 1PJSA 3EUFA 1KEUA 3GZ4A 3DA8A 3WDMA 2PWBA 3X1ZA 2FN9A 4YY3B 3DD1A 1KEEB 1MO5A 2C1XA 2P9EA 3LX8A 1RM5A 4WLNA 1N4AA 4NAVA 4F85A 1GCGA 3ZBQA 1G8YA 3C7DB 3LDHA 3EZNA 2RGXA 1YKFA 4YMLA 5JUWA 3T5GA 3BTVA 3DZDA 5AIAA 3D6AA 5EMNA 2CB0A 3EPPA 3D5TA 1A5SB 3MT0A 721PA 4JVOA 5BW6B 3S70A 1T4GA 2EEZA 2WYOA 2Z9BA 1VB5A 2NAFA 5AW9A 2X5XA 1XTQA 1J1ZA 1TFRA 1NXXA 2WHEA 1P9OA 3KDAA 3UMCA 1Z6AA 4PONA 5AI5A 2XCIA 2IE0A 3GN1A 4TWBA 4G1UC 1G7SA 1Z8DA 3DFIA 3I5AA 3QEMA 2A57A 4W7SA 1AIPA 1NF9A 1P3Y1 3THWB 2NU7A 4F5EA 3QYPA 4RX1A 4OJMX 4Y6PA 3DVQX 3D2BA 3K0HA 1J21A 1JBQA 5TF4A 5JVDF 1QHSA 1ZNQO 5EGSA 3TGWA 3ZJUA 2FOLA 4NMHA 3N76A 2YRFA 4L22A 3T6KA 4GNRA 3WFZA 3I01M 2W70A 4D5EA 1REQA 3W77A 2QDXA 3IEXA 3AWDA 3GLHA 2C5LA 2N46A 4C0AC 3ZIUA 1EBBA 1OYYA 2NSJA 1DWOA 3DCNA 1YBFA 3OWXA 2MTBA 3SJAA 4KXWA 3V34A 3FLAA 1SK8A 4OLAA 1KFBB 2FRVA 3ZV6A 5K0BA 2CJFA 5IT9A 3IAM6 4EO9A 1E2KA 4G26A 4AECA 1C3VA 5J4KA 2IYNA 3CX8A 3VO9A 2YWDA 3FR8A 3WV4A 1W4ZA 1QDLB 4N47A 1DT3A 4M76B 2OHJA 1LV7A 3KAQA 4Q37A 1NSFA 3X44A 3EXHB 3O1JC 4AVYA 3KCQA 4ZOAA 1O5TA 4E70A 3E9RA 1HE8B 1KI9A 2YOHA 1OFUA 2L19A 4TV9F 3WGYA 2FDXA 4RV5A 1YKSA 5GADl 5EUBA 5BW0B 4JT8A 4BBPA 3PFWO 4J07A 4A8JA 1CQXA 2R1TB 1A27A 4A36A 4CT0A 4EB0A 4KX5A 4JA2A 4L5AA 5IAKA 1H66A 3KXPA 5FCDA 4G1EB 2QN9A 1SBHA 4G65A 2JCBA 4MVJH 4JC5A 2EF0A 2HWUA 3AO0B 3L01A 4MMXB 2QQ0A 5K3OA 2YDXA 1DKRA 4F2GA 4RKEA 1VE3A 2RK3A 2CK3A 3E5MA 1R37A 2ZB2A 3F6BX 2WMYA 4N5DA 3VPBA 1L3IA 1XCJA 1II0A 1ZCZA 2VQ3A 3NTQA 4IILA 5ALRA 3VZCA 2YZNA 3KUDA 4YUXA 1TD1A 4JBXA 5CVJA 3WMXA 3OJ0A 3I72A 1ZWLA 5CYFA 4DDTA 4M46A 5JSQA 5JSFA 2WTBA 3PZBA 4WZBA 1ZJWA 3D8RA 3G23A 2VR1A 2GZRA 3ZWXA 2FETA 2ZIFA 3F6RA 2IHZA 3H8JA 1USUA 3IJRA 3PYXA 4JXJA 3U3JA 4WDQA 4DG5A 1KJJA 3G59A 5CLJA 4F1JA 4UBMA 2PRSA 2WKRA 2GZSA 3ORHA 3QE9Y 3KV3O 4IZIA 3T1VA 4DARA 4XEHA 2BTEA 2NOAA 3UMYA 1RJ9A 3KVNA 2JFWA 2KYRA 1RYNA 1U2DC 1XVUA 3PNSA 4ZXFA 4BNUA 4BWGA 2B1JA 4KRGA 3VNUA 4CUKA 1NBMA 2H2IA 3RUCA 2MHCA 2V1UA 1OROA 2W6ZA 3OE7D 5EHZA 2FYTA 1TKBA 1UMDB 3DSRA 1BHO1 5LYJB 2JRLA 1C50A 2C7GA 3OX3A 2FR8C 1E6UA 2QLNA 5DWVA 3VX3A 4AZ0A 1KYIA 3KKNA 1ZO8A 1UK9A 3DO5A 3PR2B 5HJ5A 2PZMA 3AJRA 3JAMA 3K92A 1CF9A 1JYFA 2P77A 3O4FA 4XDHA 2IYVA 2PGLA 3H1BA 3TW4A 2C3YA 3TJZA 5K0JA 3LL4A 4BE9A 4I2VA 1AKUA 3HNRA 3AL3A 4PCVA 5JALA 3LX6A 3FH0A 3IA2A 2Y9MB 3AIOA 4PINA 5E6UA 3ZHXA 4D46A 3NYRA 4I19A 1P19A 5L6MB 3NAQA 3K31A 4B09A 2LTAA 2O5VA 1A82A 2O8BB 3GJ4A 2V65A 2NUPA 1L5ZA 4FW9A 1XVTA 2VHCA 1U0NA 2NSYA 4KXFB 5DGDA 3P19A 3NHSA 4Q4HA 1DC4A 1CY2A 3HP7A 4K8RB 5FA6A 4C2UA 4JUAA 3CLHA 1ZSYA 4PZLA 3TCNA 5KNLA 3RARA 3BRCA 4JB0A 5CPBA 2H0AA 4EKNB 3E48A 1W1IA 3R3JA 3L07A 5DF1A 4BECA 5LMCA 5CFLA 3G0CA 4C4RA 5FBLB 3SNHA 2BR4A 1VPVA 4L4XA 3NVKI 5AVRA 1Z6QA 3IOBA 1AQNA 3P2YA 5G1PA 3RV3A 1NJSA 2PKQO 1Q7CA 2QYOA 1KDPA 1YR9A 2O5RA 3QIVA 3V4OA 3ZCQA 4NXNB 3S81A 4BEBA 4IZHA 1JA0A 1KY2A 4Y2GA 2H3EA 3TYXA 3W3AD 4DV7B 2PLNA 5TSDA 4H3VA 4H7PA 2AWOA 2V6FA 2TSYB 5KX5F 2GK7A 2W83A 3O3OB 1YB4A 2A4KA 2WAAA 4ARCA 5E7QA 1KVTA 1K0UA 4TRJA 3U31A 3IODA 2C2MA 3ZU2A 2PWPA 4HT3B 3MK31 4EGCB 4TMTA 4IXJA 1PJLA 2X7JA 4UTXA 3GJQA 1U2QA 1JHOA 4PYQA 4FBLA 5E6RB 4I5GA 1KRWA 1NW5A 1UBRS 2ZFUA 4G89A 5T6MA 2JLUA 1UMCB 4RKQA 3QPDA 4YJGA 3WBBA 1JBEA 2CWWA 1JAHA 1W9MA 4OM8A 1UC9A 5ALLA 4AJEA 2KM1A 4IICA 3RRXA 1K88A 2G71A 3ZUPA 1JR3A 4F3TA 1QFJA 4GRAA 5KWSA 1P4AA 2BBWA 4IIGA 2G0AA 1N2SA 3FFAA 1LC0A 2C29D 3TKAA 2CDAA 5ES4B 3CC8A 3L7IA 4BMXA 4EUHA 1O6ZA 3AZPA 3SFVA 4JHLA 1RWMA 2VKQA 3AETB 3OIFA 3UT6A 4TYNA 1AF7A 3QU7A 3A9WA 4RV9A 3ZI0A 3U4HA 1COWA 4YYEA 4DLLA 1H2EA 4FFOA 1JDTA 3OTOB 2W8ZA 4MEBA 1PEDA 1ECCA 2Q3JA 4O2LA 3MBIA 2IBTA 3FY4A 2PH3A 4H3SA 4JLKA 5DBHX 4M4SA 2BCGY 1Y4UA 1FDVA 3EGXB 2AW5A 2O8FA 1A9PA 1L4UA 1UBLS 4X8OA 4N8SA 1YOVB 4BEVA 4S0XA 2WJAA 4LRSB 5B2ZA 2FKNA 5CBPB 3HKEB 4FZRA 1M2NA 3CINA 1Q1QA 3EMBA 3EXIB 4YAFA 1OAAA 2LPMA 2ZZNA 3HMKA 4EUNA 2JW5A 1IDN1 4D9GA 1D0SA 1Y34E 2ENWA 1WU8A 2HB6A 4X64B 4CM9A 1DPGA 1QCCA 1IHUA 4GMKA 2XMCA 5FIUA 3WIVA 1YTUA 1DIGA 1SXJD 2B92A 5C81A 1I7PA 3ES9A 3D59A 3MMXA 1ZMTA 4RPKA 1K3TA 3B6JA 5KSZA 4AICA 1MO6A 3W7BA 3AVTA 3X0DA 2FH5B 1N6LA 2PX0A 3AY0A 1E2LA 2GZHA 2GEFA 3LRXA 3CVUA 1Y6GA 4IEFB 1UPXA 3D81A 2JI6A 3ENQA 3FROA 3OZTA 3PZRA 4MV8A 1A0OA 3ZWNA 1Z73A 3OCCA 4WLUA 4EG0A 5A4MS 3FBGA 2IKQA 2PIDA 1OWOA 2HRQA 3M6XA 1VCNA 2NVUA 1GPWB 3PF8A 5FUXA 5FJJA 3VISA 2MSLA 2Z1MA 1RFLA 3IDOA 4KIFA 3WMWA 2YJGA 3NTLA 5CDFA 4D4HA 3SIWA 4Q7KA 4OFXA 2DKOA 4GHWA 1KYTA 1PD1A 1RYMA 2H1WA 2R11A 2WMDA 4G4IA 1UUFA 2HSEA 3QVKA 5JYCA 3ZHYA 4QHTA 3KSBC 2E9SA 2JAWA 5BSHA 4C6SA 1UXIA 1JALA 1TPZA 1K75A 5JV5A 5ICEA 5JBIA 1PUIA 4J76A 4IDGA 1ZY2A 4CF4A 2NT3A 2BGIA 4ZYYA 4EPYA 4X7RA 2SHKA 3A06A 2GF0A 4C4SA 3HWWA 1JJAA 3O75A 4M1WA 4J43A 1V25A 2R8ZA 5HF5A 3QNWA 2WWVD 2GCGA 1SJ9A 4J8PA 2PU7A 3EDOA 4UXHA 5E6UB 1YVRA 2JF0A 2PX6A 4PX2A 4R2LA 4OXNA 4DM3A 3CSSA 2ZAMA 1WOYA 1J06A 4HGPA 4O4JB 2ZAOA 2P0AA 1QGOA 4RS3A 5LZ8A 4CTKA 5CPFA 3WAJA 2FFJA 4EP1A 4BO8A 2F67A 2O7QA 4PZAA 1WMAA 3BDAA 4NE2A 2R48A 3B1XA 3OLYA 3OY7A 4J91A 4QIHA 3ZD8A 5EWJB 1Y1PA 1PW7A 2RHJA 3ACCA 1JSRA 4ZZ1A 5JBQA 3CVOA 1SUWA 1CG6A 4H0CA 4UUQA 5D3MB 2X2OA 1BC5A 3FKJA 2ZIZA 2GXSA 4FS3A 2B7CA 2C9MA 3H2KA 4YR9A 4GC5A 5CD1A 1DC8A 3HY4A 3UJ9A 5J5AA 3O4GA 1HX7A 4HH0A 4B3MB 1A7JA 5I01A 4ABTA 2FEPA 2JPDA 4J2OA 1ZNWA 3RVBA 2PMWB 2JVKA 4E6PA 2F2TA 5C8YA 4H3HB 2QLJA 4TT3D 3RODA 3GGCA 2REQB 4HAWA 5TGTA 3OIGA 2XMQA 4BV9A 4G8CA 4JC0A 1X1CA 3USES 2RGGA 2J0SA 3JD1A 3OM8A 3DLAA 2HDOA 2Z8ZA 4MWDA 2DQSA 4HI0E 5COAA 5CURA 3ZJTA 4DMKA 1LBEA 1PR3A 3QLVC 3UF0A 4S1VA 5SY9A 4OQYA 2PZFA 5DI9A 3AR8A 2B5WA 4JASB 2Z2JA 1XVVA 1YZHA 1LVGA 4KQCA 2GHTA 1RKBA 4X7MA 3QBTA 1WZ2A 4R83A 1XVIA 5LQRA 3A05A 3ZZNA 4WSOA 1EVYA 1PCXA 4HSEA 2Q9BA 2YWRA 3PUYA 4Z54A 4L9AA 5EQJB 4Q4LA 1SIBE 1SVWA 4KMRA 1Y81A 2OUKA 3CH5A 1QWSA 1Q22A 4I50F 3W3AA 1AN0A 3AUSA 4OYYA 1R4ZA 3QPWA 1XZLA 3RT7A 5DEOA 1CJTC 4RF3A 3ZNQA 4ALJA 1B14A 4UAUA 3DHYA 3I45A 5AKJA 1E9CA 2OHVA 4IWYA 4EG4A 4H6VA 1ZM7A 5AVVA 4URYR 2HU5A 3G8CA 5A5EA 3OPYB 3A7DA 1OTXA 3WP0A 4CV3A 2ETVA 1NBAA 2FPPB 2G09A 4GBJA 4CM8B 2IYAA 5E7JA 3K0AA 4HC4A 1ZM9A 4DJ5X 1V8FA 1NYLA 4QLBA 5KYTA 1LDYA 1ZGZA 2BGTA 3V33A 1NJ6A