4MUJA

Crystal structure of pantothenate synthetase in complex with 2-(2-(benzylsulfonylcarbamoyl)-5-methoxy-1h-indol-1-yl)acetic acid
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
288
structure length
288
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Pantothenate synthetase
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 96
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4mujA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mujA01
1B6TA 3U1VA 1MB2A 1N2IA 2R5WA 4ZT3A 4ZT7A 4KKVA 3K32A 2GOYA 3PXUA 3AKZA 2J09A 3A2KA 1GPMA 1EFPA 2X1LA 3CLRD 3CLSD 5DASA 5DEOA 3I05A 1J1UA 2JANA 1WQ4A 1WQ3A 4MWBA 4MW2A 2JAXA 4YP7A 4WNYA 1U3DA 1UFVA 1K4MA 1WXEA 1XNHA 1EUQA 1WZ2A 4MW6A 2E0IA 2XRYA 1QRSA 1QTQA 1X8XA 1ZUNA 1MJHA 1T9GR 2QUJA 2OV4A 1JZQA 1G8FA 1KP3A 4DDHA 3SEQA 3MXTA 2X1MA 4MVWA 2E21A 2QUKA 1N2OA 4QBTA 3P0IA 5IJXA 2D54A 3KT3A 1IQRA 5HUHA 4RPIA 4DNXA 2D13A 3UK2A 1G8HA 1WOYA 4U63A 4ZT6A 2B7LA 3G6KA 1TYDE 4MVCA 1YUMA 1IHOA 3CLRC 3CLSC 3FHJA 3PNYA 2V0GA 3AFHA 1MRZA 3ZXIA 3IH5A 2XRZA 1A8HA 4AQ7A 2A86A 1V8FA 3TS1A 3M5WA 1IVSA 3UMVA 1YULA 4R0NA 2QTMA 5LLTA 2CV1A 2CYCA 4KPUB 2CYAA 3IVGA 2QJTA 1X6VA 3ZIUA 3FG9A 3ND6A 1FFYA 4U7JA 1KORA 4MWEA 4EG4A 2A88A 1T6ZA 5LFAA 4QREA 3LE8A 1O5TA 4G6ZA 3SEZA 5KHAA 5TGTA 1H1TA 2YWBA 4JXZA 1MAWA 1O96B 4MW4A 4EFKA 3N9IA 1VBNA 2IELA 5FNZA 5H7XA 3CVUA 4R2LA 1KH1A 4DJAA 2DXIA 4L2IA 3AG6A 3RFFA 4QRDA 4MUHA 2ZP1A 3BL5A 4U8HA 1I6KA 5H16A 1XNJA 3IOEA 3VU8A 5HG0A 1PG2A 3ZXSA 1NUTA 1J70A 4EG8A 4PY2A 1U3CA 3F3MA 4HPWA 1NP7A 4NDAA 1MOPA 1N78A 3CA8A 3FH0A 3PNBA 1OWNA 2Z09A 2IJGX 3MMXA 4ND7A 3AL0C 2PG3A 4OUDA 4ZCSA 5KWVA 3FIUA 1KP2A 1N3LA 3NBAA 3K9WA 5DK4A 3CVXA 1JEEA 1KR2A 1M8GA 1XNGA 2QUHA 3H97A 1JMVA 3INNA 1TQ8A 2GM3A 1ZH6A 3H9BA 3PRHA 1GLNA 2PZBA 2CV2A 1IQ0A 2I1LA 5AHWA 1COZA 4F4HA 1QQTA 3RHSA 3DLAA 4K03A 4X0EA 1J21A 1T9GS 2CFOA 4DLPA 2CYBA 1ILEA 3P0HA 1BS2A 4EG5A 4EG3A 1WXIA 3G5AA 1M8FA 4ZT4A 2DETA 1TYBE 3A05A 1H3FA 1NUUA 2WQ7A 4XFDA 1KQOA 1MC1A 2PFSA 1R6TA 3H99A 1EFVA 4YP5A 5FO1A 1QRTA 3FETA 4AS1A 2IP1A 1KAQA 2BYTA 2E89A 2H29A 1K4KA 2EJCA 3QTTA 2CSXA 1NZJA 5IHXA 2NZ2A 2WQ6A 3IOCA 4MQ6A 2V0CA 1I6LA 1N1DA 1N2GA 1F4LA 1EE1A 1JGTA 3ND5A 5LM3A 4ZCQA 3IMEA 1JILA 1NYLA 4I6JA 3RK1A 1NI5A 4P2BA 1JECA 1JIIA 1WJGA 1NURA 1JIKA 3KT6A 1IH8A 4R2MA 1WXFA 1LI5A 1IFXA 1KKUA 1EUYA 3MLBA 2ZUEA 3X1KA 2QUIA 4CQNA 1D2RA 1N77A 1M1ZA 1M8PA 2RD2A 1OBCA 1N2BA 3NBKA 1Q77A 3MLAA 3TNJA 3Q4GA 3IMGA 3H9CA 3RJZA 4NAUA 3Q12A 1QU2A 3COZA 1MAUA 3KFLA 3CR8A 3KT0A 1GTSA 3UY4A 1O0CA 4MUJA 3S3TA 1U0BB 3N2YA 3IVXA 1O97D 1VBKA 3FNRA 4BWVA 5FO0A 1EXDA 3LCJA 1V47A 5J58A 3X1JA 1H3NA 4ARIA 1QNFA 3KT8A 4H3SA 1N2EA 1VBMA 1KQNA 4MUNA 1LW7A 3IVCA 4ZT2A 1I6MA 1YUNA 3CLTD 3PNVA 1OWLA 1Y42X 3P0JA 3JXEA 1YIAA 3SYTA 1JEDA 1PG0A 4KR7A 2A1UB 2VTBB 4OJMX 1O94D 1HYBA 4HJXA 1NUSA 4A91A 1QU3A 3D6UA 4NATA 4MW5A 2TS1A 1J09A 1YI8A 1JHDA 3ELBA 4MW7A 2H2AA 1FYDA 2CV0A 4KPUA 5TEVA 3VRHA 1O97C 3GMIA 4DE5A 4NZPA 3L92A 1NUPA 2G36A 1GZUA 3FY4A 1F7VA 4CDMA 4MW0A 2NSYA 2YY5A 2BTEA 3IMCA 1QRUA 5BNZA 2AKEA 3ZJTA 1O96A 2A84A 1EFPB 2X0KA 1KH2A 4EG1A 2GKSA 2HGZA 3COVA 3QTBA 2J08A 1WXGA 3ILVA 3AG5A 3CLTC 1M8JA 1M83A 1OWPA 2DEUA 4Q16A 4JFAA 2PXHA 4EG7A 3VGJA 4UZFA 4KR6A 3OP1A 3AIIA 4MULA 1GN8A 4JZYA 2ZUFA 2A1TR 1F9AA 2YWCA 1NSYA 1O94C 1G59A 1XJQA 1TFUA 2DPLA 2QTRA 1G8GA 2CUZA 3TQIA 4CDNA 3X1MA 4HJRA 4MWDA 4MW1A 1EJ2A 4ZCPA 2YXNA 4UZEA 1MBZA 5TEWA 3L93A 3TQOA 3N8HA 2PIDA 5K0SA 4J75A 1K92A 4MUIA 1U7DA 2HMAA 4S1OA 1O0BA 1DNPA 1TEZA 3ZGZA 2O8VA 1CT9A 1PFUA 4DDMA 3HMQA 4XSVA 1ZJWA 4NAHA 4FZJA 1N75A 1IQUA 2J5BA 5K0TA 3A04A 1SURA 2AZXA 5J59A 3C8ZA 5JBNA 3RBAA 3DPIA 3ZJUA 3CVYA 5J5AA 3HL4A 1PFWA 1LI7A 3SDBA 3FWKA 1N2HA 4MUEA 3E27A 4NX2A 1TYAE 3HFJA 4MUGA 4EGAA 3ISJA 4ZCRA 4MAFA 2WB2A 2RE8A 1OD6A 3CVWA 4F3RA 2HZ7A 2O5RA 3LOQA 2DERA 1VLHA 3ND7A 3IDFA 3IOBA 1NUQA 2Z08A 2QTNA 3GUZA 4MWCA 1QJCA 2E18A 4GRIA 1P7PA 3P52A 4HK4A 3D6VA 2A4MA 4J76A 1M8KA 1WY5A 4MVXA 4JYZA 1ULHA 4EF6A 2D5BA 2X3FA 1J20A 3CLUD 4L2IB 1O95D 5KCMA 2EL7A 1KH3A 1TYCA 3DO8A 5TS2A 4DDKA 1MB9A 4MVYA 4E1AA 4EG6A 4ARCA 1T6YA 3TZLA 4YMIA 3GLVA 3SZ3A 3N05A 1OWOA 3TZEA 1IRXA 2DLCX 3COWA 4OUDB 1PFYA 1S4MA 4I6EA 3OTWA 1GTRA 1WXHA 1Q11A 1OBHA 4YP6A 1Q15A 2AG6A 1I2DA 2DR2A 1F7UA 3ZJVA 4YBRA 5EKDA 1ZH0A 3HZRA 4PBSA 4TS1A 5DB4A 3IODA 4KR9A 1N2JA 1KAMA 3UOWA 4I6GA 3CVVA 3IUBA 1JZSA 1VL2A 2Z3VA 1YIDA 5HUJA 1JIJA 1K97A 2QJFA 2JA2A 4MW9A 2A1TS 1KQPA 2J4DA 3FOCA 3CLUC 5F23A 1O95C 1R6UA 4XFJA 4MLPA 3HGMA 4ND6A 3UC5A 3SZGA 1T6XA 3DV2A 1H3EA 4K0RA 2CT8A 4Q93A 1OWMA 4GU5A 3RK0A 3FDXA 3FI0A 3G59A 2OQ2A 4G5YA 1O6BA 4JXXA 2A7XA 3QE4A 3H05A 3NV7A 1R6XA 1PFVA 2WSIA 2QJOA 1EFVB 4ZT5A 4MUKA 2PZAA 1GAXA 2J07A 1U7XA 2DUMA 4PBTA 2A1UA 2VTBA 1RQGA 4PBRA 3ZUGA 1WKBA 4RUKA 3IUEA 4G5FA 2C5SA 3Q10A 2VXOA 2PZ8A 3HV0A 1Q19A 4ZCTA 4MUFA 4CT0A 3COYA 4WSOA 3A4IA 3MUEA 3SP1A 1J1ZA
chains in the Genus database with same CATH superfamily
3L77A 1QIEA 4IKEA 2XXAA 1KAGA 2GKGA 3K0FB 4OJYA 5CK4A 1GV0A 1N2ZA 1DEOA 2EF0A 3PXUA 4Q66C 5FEUA 2X9QA 3DP7A 3MJTA 4MS1B 1RPNA 4E3WA 5BQXA 2XTMA 4C76A 4NABA 2XVZA 3D31A 4PIVA 1K7FB 1ULBA 2XMGA 5H8WA 4R9NA 2I6TA 3S2UA 5TMPA 4N18A 3P94A 4CV0A 4LTMA 5BSHA 1VYVA 2OB1A 4PZAA 3UK7A 4JEHA 4LZZA 4XCVA 4XTRA 1INLA 5ENZA 1LBEA 1WZ2A 3BMNB 3LRXA 3T9BA 2ZDQA 3AI3A 5U4XA 1V4VA 2UXCB 1NZFA 1OXUA 3GEEA 1Z82A 1BD4A 4KSCA 1PV1A 3MT9A 3WLPA 3W6ZA 3MXTA 3U39A 4DZTA 4TM7A 2GS9A 4X93A 4I1UA 2WIDA 1EDZA 3C4JA 3PENA 3O83A 4E5UA 1KEKA 5EE5B 1YDFA 2J33A 4PGHA 3TTXA 2ATEA 3ENVA 4RV9A 5JXGA 2Y2UA 1EDEA 3TD2A 1P2UA 3MQ2A 2QNBA 5JNSA 4UNPA 1Q3HA 2JGNA 2RH9B 4M37A 2WWFA 2IYOA 2KBEA 1J56A 2BF4A 3CKYA 3EF1A 4FDAA 3SHFA 3D8HA 1XDUA 2B7LA 2NN3C 4KFTA 3ULKA 3CUYA 5IXSA 4OL0A 2EWVA 1UPTA 3BGVA 3GPCA 3PE6A 3UQZA 1N0IA 2QYHA 2AFVA 4C4TA 4CMAA 4DM3A 2PS3A 4EJSA 1JIVA 1JTFA 5DKFA 2Z1MA 3ZXIA 2QW8A 1V8BA 4KN5A 1ONPA 3DLTA 4J0EA 4KIGA 4MV4A 4BVKA 3WWCA 4RPHA 1BROA 4ND3A 2BP7B 5I4CA 2WE7A 4A03A 1NQVA 2JAWA 4UUAA 3M5WA 1DCMA 1UWCA 3H3XA 4IDCA 4J1TA 2R1UA 3D02A 3G8CA 1LU9A 4PQGA 1GFZA 4JLWA 3WY9A 1NFRA 2G6BA 2GZHA 1RPTA 5CVDA 3IVGA 4LVCA 1KSHA 4GYJA 4W8OA 3P7MA 3ZIUA 1FMTA 3V3TA 5EJGA 2RONA 1JQEA 5ALYA 3A6LA 1XDZA 1KMQA 4EG4A 1MGPA 2X4IA 3GCXA 4D1YA 1BZYA 1ZGHA 3SWWA 3BRSA 1H1TA 2QUZA 3PX2A 2GR8A 3C48A 4RV4A 1PEDA 1LDNA 1OZAA 3LDUA 1XU7A 1XZDA 2VCHA 3BWDD 3RKUA 4CWAA 2HRCA 3QFHA 5JUWA 1Z35A 2DFPA 5IVIA 2DB3A 3MUFA 1ACLA 4B3RB 4M1SA 4XGKA 3SBXA 2HSDA 1R5NA 2IBSA 4AURA 3RVOA 3GJRA 1L5ZA 1HFWA 3PCTA 4MP3A 2G70A 3CX6A 4IR7A 4M7PA 4C7KA 1MP0A 2A9PA 5TIIA 1DBRA 2PBLA 4HDSB 3BWYA 4A1OA 3IAS1 5ICSA 1MB3A 1NUTA 1UMCB 4O08A 4L5JA 1J70A 4OI4A 4QO7A 1SG0A 4KU4A 1IN1A 3U56A 4EDFA 1U3CA 1LV8A 3O1LA 4NXMB 1GXSB 3VI4B 2HHCA 4NDAA 1GU1A 4DR5B 4YCSA 1GRVA 3CRMA 4MQFA 1IEXA 2XHZA 1ZA2A 2QXTA 3HLTA 4LE1A 3JAMA 1UMKA 2OCLA 2WM8A 1K8YB 1EDBA 2D2VA 3BS4A 3JWHA 4ND7A 2PG3A 3C5HA 3K2IA 4Y67A 4MVJP 1II8B 2P30A 3EFOA 2B5WA 4JBXA 4L7QA 3DL2A 4OD0A 3SIWA 3R0QA 1P0IA 3K9WA 5IU6A 3CWZA 4TMKA 1SHLA 3RHFA 3RSOA 4O1IA 5CD9A 1EBFA 4XQGA 5DK4A 1Q16A 3G0HA 3QPCA 5A3SA 1L3IA 1L4KA 1PL6A 3EPPA 3IXQA 2C84A 3GFGA 5DEIA 5ALKA 1HY3A 1UODA 3INNA 5KYGA 3HSKA 3CONA 2WAOA 4IH9A 3IERA 4PSDA 2UZ0A 4IH4A 4PSCA 3TNLA 2Q2OA 3W4JA 3HZHA 4HTFB 3GQBA 5IUNC 3JARB 1EZ1A 3NHBA 4MYUA 5FWAA 2WAXA 1WZIA 3ZWDA 1RLUA 4F4HA 4CQJA 1EX7A 1V1MB 3EF0A 4M54A 1PX0A 3IHTA 2NU6A 1E4EB 2VEDA 2CYBA 1GGFA 1FTQA 3K09A 3P0HA 4HAIA 4RANA 4R8SA 1ILEA 1H2ZA 5AW2A 4Y2VA 3EZGA 3KKZA 5F73A 3WLIA 4IOMA 2CL7X 3SOZA 4DDVA 3V5NA 3ROFA 5I7HA 3MWEB 2OUKA 121PA 3EQ2A 4J0KA 2PFSA 1BG6A 4M2LA 5BQOA 2XA9A 3VU9A 1U3FA 3IUPA 1GL6A 1P45A 1SHJA 2FXIA 3OZSA 4ON9A 1L4YA 3OLVA 1GTZA 5EQDA 1XWIA 1LY1A 4PPGA 3PS9A 2WKSA 2BYTA 3NCHA 4P3PA 1SXJD 1BGWA 1WXXA 1YR2A 3WLSA 4J8PA 1BE8A 4DR4B 4BGEA 3FMFA 1DRVA 4FQ7A 1CVRA 5CX1B 3SS9X 1SJ9A 3I12A 4CTNA 1GGJA 1E0KA 1I30A 1PD0A 3CZ4A 4OLBA 4GP9A 4GQAA 1KJZA 2OCXA 2V6GA 4O8CA 3TTYA 3JQBA 2GFIA 5JCPA 3EDQA 3E15A 4OKIA 3AB7A 4BQEA 1YJ5A 2CXHA 4WZ6A 2FR8A 1IBRA 3GAAA 4BP8A 1KNQA 4Z5XA 5DGIA 1BD3A 1I3LA 4O59O 5BORA 4D0GA 2IEGA 1KO4A 5F64A 2BMEA 4NOKA 1HFKA 3WRYC 1V8ZA 2A33A 3OLXA 4DCCA 3NEYA 1NSFA 3B12A 2IGBA 2ZCUA 2QMHA 4GG1A 4YUXA 4X20B 1VYUA 2J45A 4QGHA 4QJ4A 4KOAA 3RV4A 2YYYA 7ABPA 3F6RA 4EPYA 4K6OA 2C5FA 2G5TA 1DBWA 4W82A 4CLXA 3FUXA 2QTLA 3PA8A 3O8QB 4XD2A 1GCUA 3CW2A 5ANRB 3ZTWA 1JT2A 2GK4A 3L7BA 3OMLA 2BCJQ 4KAAA 3V4PB 2UXBB 3I9V1 4XRRA 5CXSA 4XGRA 1OXKB 3BEDA 4RHYA 1B6RA 3C5EA 3OCJA 1WPRA 2ZWIA 1YE5A 2VTDA 3RRFA 1JDUA 1Z5PA 2EJBA 3AI1A 2CE2X 1SGWA 5FD8A 4J0JA 2AZ4A 4QFDA 4CGYA 3PB3A 4GW3A 1RWOA 2YRWA 3MVEA 3NHZA 2ILVA 4KEAA 3QUAA 4Z0HO 3DMYA 3LLMA 1XMVA 3I2FA 3HPRA 2Q5HA 4L5IA 4Y6PA 1ZCFA 3ZVKA 3EAFA 4IKPA 2WAAA 1LW7A 3I2JA 3WIBA 4F3CA 2FW0A 2DU8A 5BMVA 1TUIA 2BSAA 3D8RA 1W6UA 1YIAA 3L1JA 3MT7A 4DSAA 5EJ8A 1JEDA 1PG0A 1SIUA 2ID4A 5CU7A 1ZK0A 4WZBB 4Z0PA 3UFXB 5IKXA 2WF9A 3HSSA 4CLDA 4ZYVA 1WCIA 3CWCA 3CH7A 3JWGA 3CJQA 5JQGB 3IE0A 4G09A 4HZIA 1RADA 2FXVA 1OX4B 1SQ0A 3DAPA 4U1RA 2VRCD 1O9GA 4Y6SA 4ZXPA 2HMWA 3JR7A 3TRDA 3E5RA 3M83A 1QTNA 3AF5A 4Y9TA 3IQFA 1YC5A 1Y8RB 1CETA 4N0DA 2PA0A 1YQ9A 3WWYA 2AFHB 4DARA 2QS9A 3MRTA 1HDXA 3INRA 3ML1A 3VV2A 1N6LA 3BK2A 4LZLA 3K7EA 2JCGA 3PG5A 2JLZA 3EEQA 4J0QA 1X2EA 5BW0B 2DM6A 3R8FA 1O97C 2E48A 3F47A 1QQBA 1Z4QA 5M2QA 3W9BA 1XTRA 3EVBA 1F7VA 4BWGA 4JELA 5L7TA 5KC8A 1QHGA 2P9ZA 5AW6A 5JS8A 1ZIPA 3SQWA 3OPYA 5FV7A 1ABEA 4Z8XA 3VYSB 4RULA 1XTKA 4RFSB 5B57C 2X0KA 3BTOA 1BIFA 4OGLA 3SG0A 4DNOA 2PUWA 2XIJA 3LDHA 1SUBA 4RA9A 4E1BA 4J4TA 2NU7A 5BMVF 3ICOA 2RHGB 3EA5A 3G1UA 4KR6A 3G9ZA 2A6PA 2FDXA 3AIIA 1WCV1 2FUKA 3I92A 5SY4A 3LYAA 1F9AA 5TF4A 3K70C 2Z1NA 1RYEA 3H2HA 4K0KB 2DT8A 2DYKA 1RYYA 1ZUNB 2QP3A 1AN0A 3MJRA 2DLNA 1OR8A 2DPLA 2VOJA 4IFTA 3K4QA 4LYDA 4NZYA 5DW3A 3VC1A 1ZD8A 1KF0A 2ODPA 1KPHA 4Q4JB 4X71A 3WKBA 3MRSA 3IXMA 5GVSA 2QVLA 4OLHA 2WMYA 1QYVA 3PEEA 1GFIA 2GEDA 2PPVA 5TPZD 3L93A 1XRNA 4MPTA 5C7IO 5MDHA 3E9YA 2VZEA 1S9HA 3NPAA 5JANA 5JVDB 3K73O 2CWWA 4FYHA 4FYWA 3RWMB 4TL9A 3PWTA 3S55A 5IWCA 2CVQA 1C7FA 3I0ZA 1RM4A 4ILKA 3FPSA 4J4HA 3WGJA 4RIIA 5E7IA 4DR1B 3L04A 3SYMA 3AZPA 3IP5A 3UO8B 4IXTA 3J81A 4GX0A 5EJ2A 3WWPA 3DHWC 2A58A 2WP0A 4OM7A 5M7EA 2CJXA 2RG7A 4G1CA 3PLNA 3OPNA 5KB3A 3A06A 4WE3A 2V7QD 1K2VN 4MCHA 5EJ9A 3NDPA 4M49A 2OCAA 4QXOA 4OQMA 1JVSA 3DBVO 4KLRA 4EMUA 4OMDA 3ZJUA 2C77A 2NO0A 4RKYA 1Q91A 3L01A 2YWEA 2QZJA 1FF9A 4DOMA 3K0FA 4CGZA 1TUBB 4YRJA 1OI3A 5FAKA 2CHGA 2VDKB 5KTNA 3LYUA 3G13A 5BQ3A 1QLWA 5EJ5A 2AJCA 1PVOA 2VSFA 2O2JA 3TIFA 4D0LB 3C3YA 4EOGA 4P38A 2P6OA 1WA5A 3L8EA 4HV4A 6ADHA 1AO3A 2Z1DA 4R41A 1LRJA 1YCDA 3DFMA 3WSVA 5FUBA 3V4LA 4LI3X 5EJFA 1NOJA 3AHIA 3DE4X 1XU4A 3GLSA 3RUIA 2FQQA 5TC4A 5H0IA 3R9IA 5HR5A 1I14A 3K6KA 1ZA1A 4Y2TA 1EHIA 1VE5A 2YWFA 3F5QA 3N2NA 3G5LA 3WLQA 5IAOA 5JDIA 5A7GA 4DWJA 4F6LA 1IK6A 1Z2PX 3CPHA 4G1MB 1EWYA 4PZLA 5AUPB 1TYEB 2HM7A 1OIWA 3BXGA 1QGUA 4G0ZA 4QRHA 1JAYA 4UREA 2WHRA 5IEBA 1GKIA 4YPVA 1XCMA 2B2XA 4PS0A 5E2BA 3Q3VA 5A6SB 2GETA 3SF8B 3UBMA 1W73A 3EXHB 3KJFA 3UMCA 1S5PA 2X14A 1R0KA 5DV9A 3TZLA 1YV9A 5CEEA 2BSQA 1AKWA 1Y7TA 2B6NA 5I9BA 4WDQA 3AWDA 4QWMA 2DWQA 2QL6A 2FZGA 4XWOA 5J3JA 3G2PA 1PLJA 1TRKA 3K5IA 2F1KA 3W5DA 2J0SA 3QEJA 1YJBA 1SKUA 2J5XA 2D4HA 4IJVA 1DBSA 4LVNA 2HFKA 3OPMA 2I8CA 1OBHA 2ZR8A 2QJWA 3IPAA 4PX3A 1E1YA 2P4EA 5IJAA 2YBDA 2I8AA 3FYHA 5EKDA 3K0HA 5I51A 2GMWA 5DB4A 2UKDA 2PUBA 1SCDA 4N39A 5DP2A 3FPAA 1AKEA 3OTIA 3SVZA 4IRXA 2DC1A 3AF2A 2HU5A 4B6OA 2DQKA 5CVEA 4J2TA 4UMFA 2VF8A 1OU4A 3AC0A 4QVKA 3R40A 3BBPA 4CUKA 3G2OA 4YDRA 4H2DA 4KQMA 4YMGA 3UC5A 4LOKA 4Y9RA 2ZIXB 1Q22A 2JGRA 4LQLA 1IN6A 2BH9A 4GIBA 3UMMA 3TPFA 5KZMB 1XLUA 3OP4A 5FBRB 2PRIA 1G3QA 4R3UC 5HE8A 3PP8A 4FR2A 3A6JA 3F3YA 2DOKA 4MGZR 4V1CI 1Y63A 2OQ2A 3UCXA 3UAOA 3ZHCA 1G5QA 2Q2VA 1PHRA 2B7CA 3HZZA 3R5HA 4E4TA 2XUOA 3CG4A 1CUDA 1QONA 3MAGA 2C5HA 4Q7QA 4KR3A 3F97A 3Q9NA 3D8NA 4PGGA 3T7SA 3O8RA 1RXCA 3T0GA 3NX4A 2ZR9A 3SHVA 2REBA 3R74A 1A7KA 4YB8A 1PLKA 1CUSA 1P4SA 1SVSA 1XJ0A 2VHVA 4UU0A 2XBMA 2O2GA 2R9VA 1HGXA 3HEMA 3IUEA 2Z3ZA 1L7DA 2EHDA 3FMIA 4BE9A 4UE2A 4AW9A 4OMUA 4OX9B 4PYQA 3GRRA 3SYLA 1GARA 2CUNA 2GESA 1NQ5A 4RCYA 3RODA 3RVPA 5CDHA 1EFCA 4LKOA 5L4NA 4WSOA 4TLEA 1OT3A 3QITA 3A1CA 2ZTLA 4KPGA 4B84A 4G84A 3W5VA 3EEIA 3G23A 3OX4A 1RXEA 2Z0MA 4WIAA 1NPYA 5CYFA 3HCFA 1NKSA 3SHOA 1MN6A 1P29A 3AOEC 4F2HA 4FOSA 4MI6A 5EE0A 3ZCTA 4IIHA 2HNAA 1I7SB 4U0JA 4MGIR 1SVKA 2Y8EA 4B0PA 2C88A 4M0CA 2IZZA 3M6XA 2ROQA 5LB2A 4HTFA 5IWAB 3IO5A 4PPYA 4PIMA 1GITA 1E7QA 2JANA 3BRWA 4BE7B 7MDHA 2H54A 1Z17A 1WQ3A 1NVDA 2W22A 3OCCA 2JZOA 5DT2A 3FTFA 4UU1A 2FSVA 3ROZA 1C3JA 4QPZA 4RNDB 2FSIA 1E4EA 3GRPA 2ZAMA 3BQ9A 2ORWA 3D0RA 4UJ3A 2YMQA 4BEBA 3AFNA 3EOBI 3MCUA 4AF8A 3K6SA 2A30A 1EA7A 1W88A 2K2QB 5ALLA 2HQSA 1ADFA 1BX1A 1ZN9A 1SN7A 4CMHA 1JJBA 1W2HA 3Q3HA 1NLFA 5EQFA 4IKOA 4RM3A 1TT5A 2VJPA 3ZDZB 2QUKA 2F8MA 1ISFA 1QCDA 3IEPA 4GBGA 4KLAA 5EXEA 1QUFA 3VPDA 2WSSD 1E2NA 3A1DA 1KU6A 2E1PA 3E58A 4PQFA 3KT3A 3ZY5A 3GZJA 4RY2A 2HDNB 4FM9A 1DLJA 5HQ3B 5B1HA 1FMJA 5HUHA 5DI3A 4UVIA 1TM2A 1L4BA 5K0FA 4KE9A 5AHOA 2WPNA 5FWNA 1HE3A 3AYXB 5DH9A 1W5SA 3SMQA 4ER5A 7MHTA 2FNAA 2X4DA 4FGWA 2R47A 3IR6A 1K4YA 4HXEB 5DGDA 4BPRA 4WUTA 2G09A 5T7BA 4GWKA 4YRSA 3B5EA 2HXYA 1VXRA 3CNEA 1T1EA 5JCOA 1YZGA 4MQ5A 3WJAA 2C7QA 5AI9A 4P86A 2O7VA 5EC8A 2FEWB 4P33A 4OK6A 1GG2A 2E4YA 3KKLA 3WYDA 1PKEA 2ERYA 4KXFB 3P2KA 2R65A 4IEIA 1MJNA 1NVGA 1QSGA 2FMXA 1R64A 1TK2A 2R6DA 5EYPA 2ZITA 4IV0A 3PQ4A 4RBNA 1SC3A 1QPBA 1RYMA 1NTOA 1PUIA 1BKDR 3L1VA 3CT4A 3A9RA 1JDZA 2GYYA 3N74A 2C4HA 3DMPA 4ER0A 5THXA 5L3SA 1SZPA 1I3MA 1O4WA 2YXPX 3M49A 3WYCA 2JAOA 3C1AA 5FOUA 5ES4B 5HKAA 3E3MA 2Z6UA 2WTAA 4JQSA 4YVFA 4YRAA 2EBFX 5LP6F 3M82A 3LZDA 2P78A 1MH1A 3PSAA 1DE0A 4JD5A 4YAOA 5KKCA 4EG8A 1K2WA 4Z2YA 2Q0HA 2WTUA 2JRLA 1WVMA 3FTCA 4PHCA 1E3EA 4N40A 2VWPA 3VHXB 4ZOLB 5C7YA 2IS6A 1NRIA 1HEIA 2GH1A 4OVKA 4XIJA 5JBQA 3CA8A 4CU2A 1FNDA 1M3SA 2A9VA 5D1NA 3FUWA 1JKMA 1YU6A 3VKWA 4FHGA 3RFCA 1V2HE 4BEJA 2ZI3A 2A5GA 2V7WA 1CZHA 4PYRA 3SC2B 1IZ7A 4P4UA 2HJRA 1VJRA 2FUG6 1CZLA 3NBAA 3QBVA 4QYIB 1C4OA 1P4JA 3FDIA 1JWAB 3CJRA 3T7KA 1QG4A 3PDHA 2GM4A 1YHZA 3ADKA 1IAQA 2ZT6A 5GZ3A 3CVXA 3EXIB 2M6KA 3DC7A 2P5UA 4Z4IA 4DXHA 1H8EA 2Q3JA 2ZQZA 5AQEA 1OFVA 2J5QA 3DE5X 3FHLA 1KVTA 2FZCA 1HRDA 1XX6A 1V9SA 3SM3A 1KMHB 3LPCA 3WHIA 2O19A 2C3MA 3MJCA 1RU3A 3PL5A 1N2SA 1NY5A 1AG9A 4I14A 4BUZA 4NYJR 1F1JA 3M4NA 1T3ZA 4C43A 4D4LA 2LTAA 1QK3A 3TG2A 4Q9IA 2DLDA 2RGEA 3AJ8A 3R3HA 1MDFA 3P4YA 1F2TB 1T9GS 1U2GA 3HV2A 4PR0A 4XZ3A 4N0PA 5F1OA 1KBQA 3EGVA 4B5KA 2QA5A 5BR1A 5IJ9A 5JLJA 2P65A 1ZK4A 4OHXA 1EQUA 2EFYA 1GY8A 2WJJA 3KV1A 4H7DA 4WERA 4BWYA 1P0PA 3PUKA 3NXSA 5LMZA 4OYRA 3AZQA 2J6IA 2R8BA 3B53X 3KSMA 3LY5A 1YASA 1I3CA 1PGPA 5CIWA 2B34A 3NQ41 5FWDA 3SYRA 3TIGA 4GFDA 5LZ9A 2WYWA 2C2GA 3U44A 3WK6A 1L4HA 2P2CA 2QV7A 1LF5A 3N76A 1PR9A 5ADHA 4DBLE 1XQXA 3I9FA 3Q2OA 5ERYA 2GAFA 1FUIA 5I9MA 5FPSA 1NZJA 3KVVA 1FSGA 4MEJA 3ZOKA 3ZZ1A 5AW1A 2GKOA 4MQ6A 5AUNB 1KI2A 1LRKA 3JTMA 1PV4A 1YRQA 3UA0A 2PYIA 2ZUBA 3HYRA 3CUWA 3UB4A 3QI7A 4TKVB 3TNFA 5BWCA 2QLTA 2GWRA 5EY5B 1XRSB 5GIOE 4F5YA 5I4KA 4INJA 1NURA 4X94A 3O9ZA 3BWMA 1AOXA 1UF9A 1UBSB 2JFFA 2D74A 1IH8A 4CMGA 4HB0A 4X6UA 1UMBA 4BL5A 1Z26A 3KUDA 4N3CA 3D5TA 5FUXA 2OXIA 5EKSA 1LEHA 4B4KA 1DXQA 2B1JA 1XK6A 2EL9A 2QUIA 1B3RA 3KTDA 2IU6A 1QX3A 3P9SA 4QUBA 2DSTA 4UXJA 3QHAA 4TLLB 3U31A 5BO5A 1OTYA 4E94A 3C6MA 3NTVA 1K0UA 1XZPA 1ZISA 3K1AA 4FTWA 3TXYA 3HJCA 2VK1A 1KK1A 3HKBB 5B3KA 1F5SA 2PT7A 1WSAA 3RC3A 1F2VA 2GN9A 1EB9A 3C3JA 1J2UA 4EW1A 1Y6JA 1D4FA 4MQ4A 2HRRA 2OXCA 1QO0A 2I2BA 4MIOA 3G79A 4OP1A 4PYNA 3H8JA 3ECSA 4MUJA 4RCZA 5BOVA 2B98A 5AO9A 5L4SA 3N2YA 5JJIA 3C7CB 3ND8A 4OATA 3EOZA 1U4SA 3OECA 3VH1A 3P9KA 5H3CA 2C9YA 4O0MA 1PD1A 2UZ1B 3GJ8A 5EP4A 4XPZA 2CMKA 4WESA 3UMBA 3AKEA 4YRLA 5HF5A 3KCQA 3EBOA 3ABOB 3K5WA 4ZVPA 3BWXA 1FNNA 2B1QA 3U62A 3T1TA 2PGDA 1D1TA 1ADCA 1QK5A 1IMOA 1XTBA 1E79A 2A4KA 4MGKR 1EWKA 4ZT2A 3VISA 1W1UA 4FT4A 1JBKA 4NS4A 5D7NA 1FUEA 3UJNA 1G64A 3CINA 2QGFA 3CQ9A 5ALIA 1NW5A 1CF9A 2FW9A 3G0BA 5IMBA 2XNDA 4A2CA 5FFNA 4KDRA 4P0QB 4D0NA 2JFOA 4PRKA 4JLBA 3ZE2B 1A7AA 1C8KA 1UWLA 5AXCA 3THSA 1H9BA 2JBAB 5G1OA 1CIVA 1D6JA 4XWAA 4KRFA 4OH1A 4WK4B 4OLAA 5JHHB 3NTUA 1TQDA 4C5AA 1E6CA 2WABA 1QWOA 4ZEOA 2PKWA 1IXZA 4BATA 2C99A 1AGXA 1MO5A 4ZK2A 5E9WA 4GMXA 2GUWA 2Q9CA 2WJVA 3IQWA 4F1KA 2XUPA 1OAOA 1DQSA 1DRWA 4MTCA 5HRUA 1TO2E 3KQYA 1KQGA 3QUQA 3F71A 1L5NA 1B0PA 3K0CC 4N12A 1W25A 2DF8A 2BISA 3E3OA 3EVDA 3EXFB 5B6PA 3L0YA 3OO1A 3OHSX 4CU5A 1KMIY 4MRSA 3TAHA 1NUAA 2PWAA 4CMEA 5F77A 4WLFA 2GTIA 1DS6A 4II7A 2HT6A 4DUYB 1SK8A 3JY6A 1MFZA 1WW2A 3VH2A 3QOWA 1WXGA 2C7BA 2P4SA 1R15A 2DEUA 1T5TA 4BVFA 3H11A 5EIXA 5CXXA 3SYNA 1JRLA 4R0VA 1O5IA 1DUVG 3NU1A 3RAPR 4XYGA 2BGLA 1MC4A 2A0XA 3OQPA 3R3UA 1WHTA 5K6TA 4CG0A 1U1DA 1YR6A 4MS4B 4DVJA 2RGDA 3M1IA 3OJLA 5HX7A 1DJOA 1N7JA 1X9GA 2PMDA 3E6AA 3OY2A 1JDTA 5F7XA 2Y67A 2QY6A 4EX7A 1T24A 2XAAA 4KMRA 3E0QA 2BFFA 4BFSA 4N5HX 1V4NA 2NO4A 4RF2A 1YQWA 5C51B 5HQJA 1EJ2A 5LQSA 4OO3A 2C0QA 1ZUHA 4AZSA 3IR7A 5SZKB 3B89A 2D0OB 4KWIA 5EIEA 3GVHA 2LRHA 4NYMQ 1XZ8A 2UUAB 3NDRA 3D9QX 3D54D 4DRYA 5CVCA 4MUIA 1UXOA 1WUYA 4YH1A 5AJYA 1W7AA 4XEHA 1G5TA 2GPNA 2IHUA 3PUHA 1L2TA 3QMVA 4LYHA 2DBRA 1IY1A 4Z4EA 2MU1A 1X8KA 1GZ4A 1KJ9A 1E6UA 2EW2A 1VJ5A 3AF6A 3HMQA 3WFIA 2EKDA 5FHRA 3AVXA 1A71A 2XPCA 3NW9A 4WW0A 2BCGY 1IQUA 4UU7A 4JH0A 5A3VA 4YQEA 3E7XA 3PT9A 3A0UA 3GGGA 2A2ZA 4NYIR 5U4QA 4D9GA 1NF2A 5ALHA 5LBUA 4YRNA 3ILXA 5EKTA 5DE3A 3ZE0B 1VRCA 4FIDA 2QR5A 1PS8A 1C0PA 5LDGA 1NFFA 4ATNA 5ITWA 1YL5A 4D9BA 2P41A 2VOEA 5HQTA 1FE8A 1N2HA 1AQIA 1N92A 3QK7A 3QMMA 2YQ5A 4R6XA 4WY2A 4P3OA 3JD1A 4C05A 3T3EA 4TSFA 2ZWMA 2RE8A 1QPZA 1U11A 4CCSA 5BN5B 1T3SA 1QMGA 5F78A 2HXSA 2RGWA 3ET5A 3MJHA 2AG5A 2D1FA 3H0EA 4BNWA 4MWCA 4C6HA 4O63O 4RK0A 3EQ8A 1ZC3A 4WDRA 1Z63A 3GLUA 5FBHA 3BH7A 1X3SA 4LK3A 1P7PA 4M1YA 2JL1A 3SNHA 4HDCA 1EYZA 4M89A 1C7RA 4XWWA 2XVYA 3G9XA 1FYWA 3WRWA 3EUEA 1UBTS 2C2YA 2X3FA 1KDPA 2DP4E 5ECYA 1J0CA 3LWDA 2ZQ5A 2C9MA 2VP6A 1I7PA 1HSZA 1T2UA 4YRDA 2AI3A 5GMOA 2QX6A 1PT7A 5TS2A 3HKDA 4PE5B 4ZVLA 1B26A 1QIDA 4TXMA 2OYCA 4XIGS 3OU7A 3MM4A 1FRZA 4N7RA 1EXWA 2I7VA 1BQ4A 1C9EA 1K6XA 2ZIFA 2WZBA 3NYRA 3QQ5A 4NQRA 2P4UA 2YC4C 4R1OA 2FE1A 2AHOA 3ENNA 3O94A 3VX3A 2XBUA 4JKYA 1CG6A 1BN6A 2I87A 1YCGA 2FWAA 3C45A 1M1YB 1SOVA 1WY7A 3H84A 3KL4A 4L4ZA 2WWVD 1U8FO 2AOUA 3K96A 4WINA 4LFBB 4GAEA 1Z4KA 4RTPA 2GN6A 1A8IA 1KFJB 1WDMA 3RKRA 1ABBA 5EPOA 1O9HA 2HQ1A 4YT4A 2C42A 4C89A 3UOWA 4UM5A 3AILA 1JDBC 3O73A 5H02A 5KNLA 4DT1B 4ZARA 1JZSA 5AKYA 1WWKA 4QYMA 4UUBA 1YIDA 2W4QA 3LWZA 4OH7A 5EI5A 4V2IA 2CDAA 2JA2A 4NESA 3BIWA 1L7BA 2JFWA 4DTCA 2OAEA 2XDQB 3L8YA 4Y6LA 5J4YA 1C0LA 3KSZO 3S1AB 4O33A 2VDMB 1H9CA 2PKQP 1U5BB 4RK1A 3RRZA 3ZS9A 1E0SA 2CT8A 5K99A 1ZK2A 4D0RA 4GU5A 1WBDA 1WCWA 2GPJA 4XYLA 4Z0TA 3FVWA 4TSKA 3CEJA 4JUAA 4NPHA 5FBKA 2BKLA 2R5NA 1KOFA 3G59A 4G5YA 2REQB 1YKFA 3ZHXA 3P9NA 2GCGA 1P91A 3BVPA 2OV1A 2DKNA 2E3JA 2OK7A 4KI7A 1C30B 2H07A 2I4LA 3HB5X 1RRGA 2I4OA 1QC5A 4RD4A 1HNWB 1XXHA 2BEUB 4AMZA 2OESA 3E9ZA 1CQJA 1VECA 3I9LA 4Q4HB 5FUWA 1U1EA 2DUMA 1Z15A 3DWFA 4ITVA 3IE2A 5AI5A 3AR2A 3FJOA 3TRJA 1DMSA 1L9KA 1LW6E 2ODWA 3ODPA 2VTBA 2ENWA 2O59A 2HEGA 2V1XA 4HWTA 2H48A 4RF4A 3LPMA 4ADSG 3R7BA 4CFZA 1ZUWA 5FA8A 3EW7A 3PIRA 1I4LD 2YCBA 2EFHB 3DNPA 1Z6AA 3MGAA 2WLSA 1PL7A 3B1KA 1EU1A 5AHRA 4PANA 3UA4A 5KTTA 4WH0A 2A0YA 4R7ZA 4EPWA 1DTWA 4J6FA 2VXCA 3M4JA 2WNIA 2BFBA 2ZS7A 4YP1A 5MN4A 2O8EA 4HUTA 4KUGA 4MWTA 2QUBA 1WMBA 2QT1A 2WHXA 4OI1A 1LI4A 4E32A 5IYZA 1TO1E 3OPYI 1P75A 4MB2A 3IOYA 5KTOA 3U9TA 3A4NA 2O8CB 1ZH4A 4QUAA 2RDMA 2SBTA 4YCDA 3RT9A 3ZHZA 3C3EA 3OOEA 1S3FA 4Z9XA 4I1VA 2JZCA 4OXXA 1N5JA 4UUMA 5AK5A 4YY3B 2UYHA 4IEEA 3LDAA 1XU9A 1CC1S 2B2NA 4ECAA 2DX7A 3KZ1E 2RBKA 3NHLA 3PNOA 3KPVA 1NP6A 5CAEB 5DI9A 4XWYA 3A6HA 4GVXA 4M1WA 3KKNA 3AV0B 2GERA 3TMKA 3IL2A 3L4KA 1ZEMA 4V02A 3U81A 2CDRA 2X7XA 1EP1B 1RI2A 2CWDA 2Q2NA 4RO0A 5IARA 2PGOA 2WWRA 3DUFA 2YHAA 1M54A 5EFOA 4B2YA 2WM9B 3R6WA 3MINA 1FXSA 4MI9A 4ZEMA 3EN0A 2NZXA 1ZD5A 2DQSA 3NDIA 3OFJA 3QLUA 5CJPA 2VC2B 1ZH8A 1LBIA 2OC4A 3N0XA 4MVWA 5ERXA 2AYZA 3U16A 1L8LA 5ALTA 4D4IA 2C92A 4QBTA 4XE5A 3N7TA 4RADA 3P0IA 4DILA 1G42A 3JQDA 3SHTA 3EMKA 4OHMA 4Q02A 2VPZA 5ADUS 5JIBA 4QE3A 5IH7A 4J43A 4EB8A 3MD9A 4H1TA 1KZYC 1WUKS 5IYZF 3FVVA 2I6SA 3UG7A 1LPAB 1MAAA 2D13A 1WOYA 2GCEA 3JALA 4ZU3A 5TV2A 1BX0A 1YTUA 1T1GA 1L4NA 3ETHA 4RVFA 4B7XA 2XYVA 1SZDA 4X92A 1US8A 1P5HA 4F4FA 2FWPA 1N7GA 3CLSC 1E6MA 1NVAA 1NPDA 1PT6A 4KX3A 4CG1A 5JSZB 2HWYA 3Q8LA 2GJKA 2P9JA 4HT3B 1A8HA 3FNQA 3LVBA 4D6PA 5IXJA 2QRNA 2D6FA 2LUOA 3PGJA 2I1WA 2ZI5A 1SFRA 2B20A 5EE9A 3HCRA 4TN1A 4AYWA 2GRUA 2HSWA 1YULA 4BYMA 5BQ5A 3R75A 4IVPA 2GHIA 1IN5A 3HKCB 1HLGA 5DN9A 4YGXB 3JVUA 4HYQA 3QU9A 1Z5ZA 2IYAA 3EDMA 5COAA 3GLIE 4O5AA 2E4VA 3UHAA 3PGA1 5CT5A 3NIWA 3W0LB 4WHMA 4TVSA 1T6ZA 5DYNA 3LYHA 3IP9A 4MOWA 4UC0A 3NG1A 1BS9A 3LE8A 4B1FA 1DIHA 3FOWA 3OJXA 4FU0A 4PINA 1QTIA 4WLEA 1TYZA 5CFLA 4G4GA 2H2FA 2BEWB 3E61A 3FRHA 2M2IA 1MIOA 2HA3A 3QVKA 1U90A 4FOPA 4OHWA 1XTVA 5TDHA 1JFSA 2IELA 2VZ0A 2QAGA 1U1IA 5AESA 2H4ZA 2Y0PA 5FWYA 4B31A 5CBPA 1N25A 4WJLA 2I4TA 1RPJA 2ZP1A 2C83A 3G82C 3LBHA 4C7VA 3AR9A 3RASA 2C1ZA 4PNPA 4Z9AA 5EIAA 3VU8A 1L1RA 4H18A 2AXQA 3E8SA 2PRKA 2JNWA 4PO8A 4B5LA 4UVHA 5ALWA 4CR8A 2V7EA 5JPCA 1LPNA 2OO7A 4WFJA 4YLGA 2XCOA 2EEPA 1RXWA 1DV2A 4IS3A 3RVRA 5IANA 4WK6A 3LQ4A 1E6KA 3NBQA 3IJRA 4DSUA 4S2UA 3JD3A 4HBZA 3L43A 4XVRA 4FWIB 5IC4A 3GRZA 4AK9A 1UK8A 5HF8A 1OPRA 1S3SA 1YD7A 5TVKA 1C2YA 1W94A 1VJ1A 5EE3A 4UE6A 4NBLA 2YNMD 4OYHA 3BMOA 4YAFA 3SQNA 5KTMA 2QVBA 3HXQA 3KKEA 4TMXA 4EAAA 2QBYA 2HR1A 4GE3A 1Q0HA 3KL2A 4XSHA 2QUHA 2CMGA 1CDEA 5KTPA 1X1BA 1OH5A 2GM3A 1ZZEA 4F4IA 1PGJA 1SXJB 5JBIA 3SKXA 2ZANA 3DBHA 1Z2CA 3HFRA 3OBBA 3MA0A 4MNTA 3U7QA 4RTOA 3OFND 1XRRA 2X6RA 4W1RA 5AKLA 1KDYA 3NFRA 1AO0A 5HRCA 1L7NA 3HI6A 1Z4MA 4BNXA 1D0SA 3EXFA 3VGPA 4U7TB 5HJ7A 3VDRA 5FNVA 2I66A 2MDTA 2Z4TA 4HRVA 1ZSNA 2G3YA 5G2FA 3ITEA 3S5UA 5FPKA 5JAMA 5JW6A 3KSBC 3OM8A 5A04A 4BTEA 4HY3A 4DRXB 2YY6A 2NUTB 2P3SA 1JFVA 3E0XA 5KPJA 1KQOA 4RVSA 1BHSA 1GTMA 1WMAA 5CM9C 1K7EB 4I46A 3W6OA 3A3KA 5ALNA 4CODB 5D84A 3RK4A 4D6YA 5AVSA 4C22A 5GTDA 3R9WA 1N5LA 2IIBA 4EH1A 5CYGA 3KPYA 2CVZA 1LWOA 2H59A 3G0DA 3OM1A 3PDIB 2FB9A 4Q6WA 1RHUA 2HCFA 3SIPA 3C87A 3FOAA 2OC9A 3QLEA 2PR2A 2IQ5A 1T8SA 4QUKA 2VUIB 9ATCA 2IH2A 3LL7A 4YRQA 3ZQ4A 1EJ0A 5JD5A 1N1DA 1N2GA 1YZVA 3BXEA 3M1AA 3WE7A 3ZD9A 2VHUA 1LJUA 3I6MA 1XZFA 4ZK6A 3NDJA 1K3TA 4EL0A 1E60A 2WBLC 4P2BA 1JP7A 3PYLA 1JECA 2VJMA 4P34A 3ZK7A 3KWFA 1NQWA 3MS2A 5LL6P 4RKEA 4RLFA 1Z8NA 5TJ9A 5AK3A 1C81A 3PPIA 1VFPA 4M60A 1PJCA 4LXQA 3IKVA 3W8NA 1WXWA 3DSRA 1PBTA 4NTZA 5K2MA 4N3GA 5EIBC 3LXMA 3QGMA 2NX2A 3B2NA 1F38A 1NXQA 5FNVF 2GF2A 5AW7A 3VQTA 3OVMA 5DCLA 1F6DA 3ETGA 3BB4A 5BYJA 1JEYA 2FP4B 3HB4X 4NH4A 3WFZA 1IU9A 1B2LA 2QRVB 2R00C 4IOLA 5TQ0B 3SX0A 3WGIA 1KRXA 2ZI7A 1WL8A 3D7NA 4IIBA 3Q12A 1JZTA 4KGXA 2BRUA 2R4UA 1W0KD 5AKHA 2BM8A 1IYZA 4UTVA 5CURA 3GRYA 3H5IA 4PAMA 2WTEA 6REQA 1GSHA 1IHPA 4LRXA 1CR0A 4COKA 3A9UA 1ZQ9A 2FWMX 3CTPA 1W96A 4UQOA 1W0KA 4V0ME 3RC9A 4EF4A 4P08A 4YUVA 5L3QB 1FDWA 1OFGA 4YR9A 1YBVA 3B7WA 2F1IA 2HIAA 4TV9F 2P9BA 4DIEA 3TE6A 1ECPA 4AQDA 1GPDG 1PFQA 4N0EA 3TJZA 5HA5A 1UJ2A 3AFMA 4H3SA 4RL4A 5DM1A 1W47A 2PN1A 4BV3A 3TSYA 1PQWA 5L7YA 3HCOA 4ZU1X 2ON6A 2SCUA 4OGGA 4TTVA 4C3ZA 5AD1A 2WYIA 3B3JA 4EFMA 1OWLA 2GN2A 1V45E 3SI7A 2BBSA 3OUZA 4PG5A 1EQ2A 5MGNA 1FRFS 1HG0A 1ZVKA 3GJZA 2N1MA 4MUAA 1I33A 5IASA 1F17A 2OORA 1MG0A 3FVRA 1MTOA 4DG5A 3FOEC 1EAYA 3CMMA 2I9PA 1AE1A 4LX8A 3PJGA 1QV9A 1R3UA 3HNPA 4AXXA 3N2KA 3B6JA 1MJGM 1YQXA 3ZDQA 3OZWA 2WWHA 1EZ4A 4C78A 2ZSAA 5HZGA 3S1SA 1X39A 1EJ6A 3P2JA 4LJYA 2A5FA 3K6JA 1J09A 1HE4A 1M0SA 4PLFA 5MF6A 2UYGA 2IYRA 1ZD1A 2EG9A 2W9XA 4I81A 1CZNA 5H80A 1DBVO 5A6VA 4NMXB 3V8NA 3O8BA 3KCNA 1AKMA 4JWKA 2EZ9A 2NW6A 4F06A 3F49S 1N5DA 2VSOA 3GMIA 3HYNA 3KUUA 3E3LA 1IJKA 1D6NA 3PJEA 1R6DA 1I4WA 1X7DA 4LNAA 4UD6A 4DAOA 1AHIA 4CDMA 1UKEA 2NSYA 4H4CA 4KKXB 3NKFA 4LUCA 3LLVA 3WZMA 1QGOA 3ECAA 4QBIA 1G5RA 1RWWA 4QG3A 1QDEA 2RHMA 1G6Q1 3Q11A 2PKQO 3TX2A 3Q6MA 3WTCA 5EMKA 2F3RA 4BBPA 6Q21A 3GD7A 2HGZA 2GDZA 3BFJA 4AG3A 1ECFA 3CLTC 3QVGA 4MRPA 1AHPA 1E77A 2P9CA 2XDQA 4KQXA 4W5NA 2XOXA 3HY3A 4RD1A 1ZNXA 1VI5A 2Q50A 2H4XA 4Y7DA 4B81A 1RIFA 1G38A 4H08A 1ACJA 1NVVR 4Y0VA 4C4OA 3F73A 4IILA 2IZ7A 3DGFC 2JIRA 2I55A 1KE2A 2GPWA 4H31A 4MIKA 5LBTA 1ZHOA 1WVIA 4BAZA 1O6ZA 4JB0A 4QODA 3EAQA 2VHQA 3WQSB 1W85A 4RXMA 1XQVA 4U8GA 5ALRA 2VRBA 3KHKA 4CDNA 2H08A 1LWNA 4BNVA 3V8PA 3WX0A 3LP6A 1EGAA 3I1YA 5TEWA 1QH9A 5C31A 5KO2A 2PIDA 1FQKA 5GM1A 3FFXA 1T5SA 4BZXA 3UYKA 4DCJA 1Y98A 1K92A 2WV9A 1O0BA 1JB9A 5FBQB 1U2RA 1VDMA 1H1LA 2OL4A 2X8LA 3DBRA 3ZHVA 3JZAA 2JJMA 1R5OA 3TZQA 1XL1A 2ONZA 5A4KA 2JG3A 4WPGA 4YJFA 1FYFA 3X44A 4JI4B 4EJ2A 5CJJA 3TLYA 1OJ7A 1JEOA 3CE9A 1E2LA 2HJHA 4FILA 4P35A 4RE6A 3TIXB 3EQ7A 2JW5A 3F4BA 5ESWA 1QS0B 1FDSA 5L95A 1JL3A 1KJQA 5F5LA 4GLFA 5LZ4A 3VHQA 4BLTA 5K0CA 4BQFA 1DFGA 2G72A 4AXBA 2PV7A 4RMNA 4C2BA 2QX8A 3GI1A 3OQOA 2XEDA 3U3DA 1UT6A 4HGYA 1NL3A 3DT9A 1ECCA 3LPLA 5DHPA 4Q39A 4II3A 4X3PA 4PHFA 3F6EX 3L0IB 4X3OA 4URUR 5DN6D 4QM6A 2C3YA 2XWBF 3OZCA 4XSGA 5EZYA 2G28A 2WYUA 1F2UB 2JFXA 3ISVA 1UIMA 4MVJM 4HH3C 2OOSA 3HUTA 3M8KA 4UEOA 1SD2A 3QEOA 5CAEA 1LFAA 1BKSB 3BH0A 1NVBA 5DN6A 2WTXA 3BD8A 3W3ZB 2FZ4A 3NBZC 1OA0A 1JU9A 1NBME 3CNNA 3I2KA 4KXLA 4JJ6A 5LLDA 5REQA 4D9MA 1UOPA 2GBLC 4KCGA 2BBTA 2Y93A 4AM8A 1Q21A 1BQ3A 4BKRA 3O9MA 4YC7A 2BI8A 3H9GA 1F4VA 1XJCA 4F5DA 3FMGA 2WINI 2PFKA 4YP9A 4DAEA 1PK7A 3GFSA 3OF3A 4YO8A 4F9EA 3PEVA 5JECA 1P2FA 4XLLA 4EG6A 4D26A 3NHAA 4L3OA 2VJKA 3N05A 4JQYA 2IF0A 5GINE 4Q4AA 4ZEVA 3RAEC 3CB2A 3ILYA 3TZEA 3RUHA 3GZ4A 4AP5A 3CM0A 3BJIC 3UMSA 1NJ8A 5AM1A 3RDPA 1L7AA 2OQIA 3I5AA 4NI5A 3DE2X 3WISA 3KQPA 3ZDYB 1N6NA 1JDPA 1W52X 1Q0ZA 1ULUA 1Y3FE 5I7SA 1GNQA 1I51A 4LDZA 1SBYA 3NH9A 1TAHA 3OA0A 4RMIA 5D7BA 3V7NA 4EENA 4HVCA 4FLFA 5BW6B 5JSZA 4X41A 2W4MA 1J6UA 5YASA 5EZYF 3H4MA 3ROEA 3WWEA 5FCDA 2JI4A 2ZCVA 1MQ8B 2WFMA 3T3MB 3UAXA 4BO1A 5KYYB 3M6UA 4L8GA 4EJ0A 3TSZA 1GR0A 1B73A 2FSHA 3ACCA 4MITA 3T15A 3VR5H 4JC5A 4E2YA 3IA2A 1YS1X 1PU2A 1ADBA 1GZSA 3AUUA 2IHYA 2JLBA 3PUVA 1BH2A 4IGIA 4R9SA 3DLIA 3T35A 1O95C 4KSYA 1TEXA 4N5IX 2LCQA 1P4GA 1USWA 1ZNWA 3EFHA 4G89A 4O4HA 4PO1A 2HO4A 2VO1A 3T54A 2I52A 2XMRA 2J0UB 3KV3O 4LJ9A 4QJIA 2FSSA 1MB0A 4Y9DA 5A5DA 4Q93A 1ZK3A 2Y27A 3L82B 1XEXB 4LF6B 3FYCA 1VHJA 3KOOA 5FPQA 3WBBA 4C7OB 2A57A 2EERA 5LDDC 1Q57A 4X44A 3WQQA 4YRBA 3AL3A 1NVMB 3D64A 2I91A 3GO4A 4GHWA 2IOFK 3H05A 4Z51A 3PHBE 2N1BA 1NONA 4YMWA 3P26A 5CT8A 3VR3A 1WX1A 4W7IA 1E98A 3RS8A 1NLUA 4OK3A 4YJHB 1J33A 4Z7NB 2HGSA 1YWGO 2IXBA 5AM5A 3ZH2A 1T5HX 2JVKA 3F2IA 1Z56C 2CLMB 1MU0A 1Y5NA 5WRFA 2J85A 4P22A 3BXOA 2G7ZA 3H19A 1ZFNA 2FPMA 2AJLI 3KYBA 1GPAA 5JXJA 2RFLA 3SFVA 3JCZA 1GZ5A 1NQUA 1T5OA 2HWKA 3KVNA 4LYFA 2Q0QA 5TJHA 4L78A 2IU0A 4FGJA 4V3BA 4WKBA 1R8JA 1GNSA 2O5CA 1GILA 1TTHA 2C5LA 1RQ7A 4YUYA 4IIDA 5A03A 1Q12A 1QXSA 1JU3A 2IKSA 5GADl 4Y8VA 3AR3A 4M36A 5DWQA 2C7RA 2C1EA 1V3QE 1SPBS 1FJHA 4QDZA 5LP6B 4RD0A 3F46A 3ZGXA 1XCOA 4O4HF 3R4CA 3UW1A 3VAZA 1CVLA 1E5QA 1SEPA 4DPKA 2R2GA 3URKA 4EQ6B 4ECEA 3G17A 1BRMA 4OXRA 4GRDA 4BFUA 3EVEA 1EVKA 3AVOA 3MGBA 4HN4B 3A1VA 1T0IA 4YWJA 4ZV7A 1X15A 2HF7A 3R76A 3TLKA 1ZJJA 3W1EA 3W8FA 1XQYA 2Q1SA 3L5OA 4YBZA 4C3VA 4D8VA 4DY6A 4G9BA 5FQOA 2RH5A 1DIOB 4FXPA 2VJOA 3PI7A 1GJRA 4IOJA 5JAZA 2A53A 2IY7A 1T2FA 2G71A 3FKSD 1U3DA 2GF0A 3GPDG 4P4LA 16PKA 5DT9A 1XNHA 3A11A 3M1LA 4Q21A 2PLAA 1J5EB 4COOA 4IMJB 4TYWA 3N8GA 4CF3A 4H17A 2XRYA 2CD7A 1BEUB 1TZBA 2C2HA 2JGMA 2Z2YA 3QPBA 4RETA 3UWKA 4BFWA 5H4GA 1DHRA 3EIQA 3GBSA 4LY9A 1COWA 4RD3A 5TPWA 2AL7A 3OPVA 2ZBUA 5FLEX 3ZWKA 2IY9A 1D1PA 3FRIA 3BORA 3GYGA 2EZ8A 4MV0A 1KP3A 3SEQA 3ZBPA 1NJ5A 1AUQA 1L7EA 2D0IA 2FU5C 3KX2A 1JQBA 3TW8B 4BOYA 4EI7A 1Y48E 1XXLA 5KJCA 3K05A 4EMBA 1T3HA 5LA6B 3NAMA 3CLKA 4N48A 5FL3A 2D54A 4Y98A 4ZWNA 1Q83A 3BDAA 4K6CA 4CUJA 2AB0A 2O54A 1DV1A 3TQTA 1AJEA 1FSPA 3FKJA 3WOHA 5FYDA 3RYIB 2VH2A 5CPFA 2RHHA 3THWB 3UB2A 4UAUA 3VNSA 4BHTA 1Q44A 2AEFA 4JB2A 1G6HA 3V00A 4QBKA 4I08A 4O2LA 1RM0A 3DOHA 2H1FA 3ZXXA 4K8OA 3L06A 1UWKA 2I62A 4BFTA 5L40A 3D1JA 2QMYA 2O0KA 1M76A 3AXTA 3DQQA 3I2HA 3ZWQA 5COBA 4IMPA 4ZO7A 3OTOB 1OXSC 1E2QA 2NO7A 2QTVA 1JAHA 3EE6A 4QUEA 4RVOA 3E4DA 4URFA 4LV6A 5EFZA 5JNLA 5E7JA 1LCIA 2RG1A 2ZJFA 3NORA 3SE7A 1VI2A 2GLXA 1ELOA 4JA0A 1KA9H 3O21A 1SB8A 2V98A 4FMDF 4PXYA 3WSTA 4U7DA 1RQLA 3HRKA 4DMCA 4INPA 2JAQA 1NXOA 1ATZA 1IPHA 5E2IA 3UFBA 1UJ5A 3JQ6A 4OFZA 1SUIA 2WT8A 2G9QA 4FE3A 4TROA 2QPOA 3WV4A 2J9GA 1T3GA 3OFSA 1A9ZA 1QJ4A 4PVDA 5TGTA 4CLRA 5JNRA 2VWHA 4HAVA 1EEXB 2P2SA 3NHPA 5DWVA 2BEVB 2JJ2D 2MSWA 5CITA 2ZE5A 1YXMA 3K8QA 3N9IA 2ZM6B 4WKNA 1QZXA 3JYQA 2R8ZA 5CFPA 4LQDA 3WIVA 1WDLA 2X4LA 3NGXA 3W3AA 4P3XA 1E3LA 2H63A 2W2OA 3HJTA 4L2IA 4DLLA 3X1WA 4Z6KA 1Y0BA 4Z3OA 1TU0A 2X5KO 1R8YA 2OHHA 1L7QA 2IDKA 1SUFA 2O6LA 1FTSA 2GN0A 4FW8A 4YMVA 3CR3C 4ZC1A 4IP0A 4CIXA 2QQ5A 4XUGB 3VVCA 2F00A 1LX6A 2AFIA 2X8WA 5M3BA 5EP1A 1TVCA 4IDGA 4TYYA 1FTNA 2R7MA 5DIZA 2WTBA 2QTWB 1SEVA 5K6AC 4NR0A 2Q5OA 4DIFA 1EPUA 4JB8A 3FLBA 4ND5A 1DDIA 2GXSA 4DBVO 3C1OA 2LE0A 4GVPA 1FX0A 2H1VA 1P3JA 2QTTA 3N6VA 4OG2A 4BO9A 4E03A 3L7KA 1MRSA 5JWRA 4TKZA 2YOFA 3ICEA 2ERCA 3I58A 2I65A 4ZALA 5I4BA 1XROA 1BFKA 2B7BA 1VKZA 2OO3A 3ESBA 1R1DA 2IP4A 3ETDA 4LZNA 4NE9A 1ZMOA 4UU8A 2ZZMA 1XAIA 4D92A 3MJ4A 3ED1A 5CUQA 4UBOA 4EFDA 1GRCA 1H2XA 3BN3A 1IVNA 5ITZB 3IAS6 2HCBA 3HP7A 4HS9A 5KYXB 1NASA 3BHMA 3LLUA 3A6GA 4PC2A 1LQTA 1QG2A 2PCLA 3JVEA 4W6QA 2PYZA 1C9JA 4GDMA 2IHBA 5G4KB 4PHHA 2R1ZA 1YI1A 3P5SA 2Q41A 3FPBA 1XWFA 1NOKA 3JVVA 4EHDA 3A70A 4U00A 1ORTA 5F1PA 1C0EA 4BWFB 3Q5DA 1U7WA 2XMSA 4P98A 3RANA 5C52B 3FD8A 3GGJA 3LP5A 4PX5A 2PEZA 2DECA 2PGIA 2XB6A 3WJ2A 4DIBA 1AKUA 4RGBA 2ZSBA 4O4IB 4YJ2A 4XDHA 3GB9A 3ZY2A 1CBUA 4AJ9A 2QGZA 2NXCA 4IQFA 2BGMA 4UNNA 5THQA 2J3IA 1M1NB 1BYIA 1PGOA 1ZDMA 4ZN6A 2B37A 4UPVA 5KCMA 2WWXA 2J9ZB 4JI2B 4TYMA 2WKRA 1E2DA 1P0QA 4XPIA 3K6RA 3BWVA 3NEAA 1O08A 2JHPA 3O4RA 1H65A 1C2TA 2VP9A 2HJWA 3GT7A 4W9RA 3K94A 4YCBA 3AVWA 1ZNZA 1SD5A 3I42A 2VFAA 2EXXA 3MRXA 1NG9A 1I5RA 4BHRA 1XEAA 2ZDGA 5L53A 2VLBA 3KLMX 3RIEA 4B8WA 1RKUA 5F4BA 3AUTA 5B1DA 2ZM5A 3M33A 3R0ZA 4OQXA 1ST3A 4B83A 1YZFA 4BFYA 2OCPA 3G2HA 3E1SA 4NYIQ 4OXYA 3BHNA 1DRJA 3WIDA 5E6UA 3REFA 1BEEA 1Y4AE 3JQGB 4U9HS 1HE2A 5IX8A 1UKYA 2PK3A 3AHDA 4J4BA 4PYJA 4CXMA 2FPIB 5LOVF 2WTNA 4BPBA 2O8BB 5KWJA 2BM1A 1E2IA 1M6WA 2VDPB 3DPSA 1OC2A 2Q3CA 1N2BA 2ZE7A 2I7DA 3IUQA 3MTJA 5BPHA 5CFOA 3KETA 5JFOA 1RR6A 2LGJA 3A37A 3G7NA 4XQEA 2L42A 3N5KA 4P54A 3ZCXA 1FU8A 3VZBA 2X8JA 3A9WA 5LQAA 3BCSA 4QYXA 5GONB 4YJ2F 4EA8A 1ZAYA 4L8YA 1Z73A 5THKA 5P8WA 1N3BA 2Z5FA 1A7JA 1RYZA 4JQZA 4B43A 4XYMA 1WEKA 1W49A 3AESB 4DEVA 3IVXA 1TM5E 3Q3EA 2EDCA 3SC6A 4LEIA 2V4UA 1U7PA 1F3LA 2MOKA 4I5EA 1SXPA 4NCNA 4V0NA 5HZHA 2LP4Y 4HCJA 4S35A 3O82A 4C5BA 1RT9A 2UAGA 1VPWA 3Q9SA 3WC4A 1CZRA 2CSUA 2YQZA 1H3NA 3QFTA 1TGVA 1UC4B 5FOQA 3E53A 4UULA 1VBMA 3DYIA 1PEAA 2WFLB 1ZX1A 3A28A 3EXEA 3OBIA 2GNOA 4N5NA 1P5FA 3PNVA 4Q3NA 1Y42X 3ZWVA 1FP4B 3PFGA 2GRJA 2I0FA 4A26A 1SC9A 2Y92A 1SIWA 3UA3A 3OTQA 3PLAE 4EW6A 1I0ZA 4QDJA 7AT1A 1U9ZA 4V03A 4AYXA 2W0MA 4G07A 3NC4A 3I01A 1E2KA 1JH9A 1D2HA 2D1TA 2W98A 4XX0A 3U61B 3RUDA 3DE7X 4XQCA 4URVR 3FF1A 3AH8A 4TYNA 1UJMA 1NVUQ 1YI8A 3A3YA 4LA4A 1L8OA 1YO6A 4MW7A 2BFMA 1I3NA 5AW8A 3G7SA 1MDBA 2JD1A 4WCFB 4ZV9A 2RB5A 2BMVA 3AR8A 4HQNA 2YHSA 1BQEA 2P2ZA 4D8XA 1C7IA 1SCBA 1RJ9A 4N7MA 1R5BA 1S7GA 4OA5A 1CX9B 4HI0E 2CE7A 3GX1A 1CW2B 1LSOA 1XA3A 2FN7A 2GLUA 4FZRA 2OQVA 2R2AA 1ZKMA 4H7FA 2BTEA 1QHHA 2HQBA 5DULA 4DS3A 3K0EA 1DC3A 1AX9A 1MQSA 1Z4JA 4XYBA 1NNSA 1NY6A 1RAHA 2H2WA 4D57A 4Q9AA 1TRHA 3PVCA 2EV9A 4JFAA 2G4VA 1RWVA 2PXHA 1RI4A 1SVNA 3GHYA 4NIMA 3HG7A 3S6JA 3AVTA 1NN5A 3KFXA 4QLAA 2IH5A 1HEYA 2WF6A 3O3CA 1SOMA 2RCYA 3GRVA 3JZFA 3ETNA 4L73A 3U7IA 1EMDA 1R4NB 4IDHA 4EGJA 2XUHA 2Q9BA 1XJQA 4ITUA 3GP8A 1EH5A 3Q7SA 1NLYA 2GJ8A 3AUYA 5IHPA 2Q8PA 2VJCA 1X0XA 4YT2A 2JJQA 3IEKA 2D4AA 1WABA 3VBCA 4PGAA 2NU9B 5I45A 3M5DA 3LDFA 3VKUA 5JAIA 1NF9A 5DNUA 5DBOA 3AP2A 1PQUA 1W36C 1E1NA 4FB5A 3WRYA 2NO6A 2FV8A 4PLVA 1OFHA 5AKZA 1U5AA 3N2GB 1SWWA 4A0HA 2VT6A 4YJHA 3ASVA 4FVTA 2XD4A 3I9OA 1E2EA 2HA2A 5ETJA 1F8UA 3AF3A 3KE9A 4D44A 3AF4A 3B5IA 4JS0A 3HUEA 3V7WA 3QELA 1U0NA 1PSWA 1XVAA 2I3AA 3C98A 3CURA 4KH0A 3PKIA 1POWA 3KLBA 1R4MA 3Q15C 4TXHA 3I3SR 3H6HA 4HDMA 3B51X 4HUJA 4QXQA 2IBMA 1ZJWA 3SNKA 3ZIAA 5KX5A 2DUWA 3SICE 2PUFA 4W1QA 1QYDA 4X91A 5JH7B 1NULA 1KE1A 3TBKA 3DPIA 3KG2A 3H0CA 1FW8A 2DFLA 1AV6A 2XNSA 4BASA 3LOPA 3F5DA 3ESQA 2K6GA 4KO4S 4TV8F 3H42B 4QSHA 2X0FA 4Y9SA 3SQMA 3V48A 3W06A 4AKEA 4C4SA 1PJSA 3BMXA 1DC8A 1FSZA 3V6MA 4ZCRA 3ADDA 1I32A 3P45A 1C8VB 2HZ7A 1BHO1 5A05A 4HRYA 2EOAA 4CPDA 2EGHA 5KJFA 1WUIS 3ICVA 3MPOA 1QH1A 5MN6A 3HN6A 4ASUD 3FB1A 4GKBA 1GPKA 3AHJA 1BRTA 4QARA 2XUDA 1ZI8A 1ISGA 4TUYA 1ZD9A 4MYDA 3ILSA 1H2EA 4QWWA 3LUBA 1OI7A 4POAA 4HAYA 1O5OA 1LPSA 2M9MA 3L3BA 8AT1A 1AURA 3P52A 3WB0A 4RESA 3LKZA 5ERGB 1M8KA 1T1IA 5DNAA 2NXJA 4KVZA 5B58T 4Z86A 2G9ZA 1ULHA 3PHGA 2VQDA 2IDJA 5ICMA 3JWIA 3RO7A 2BUBA 1WDKA 1EFHA 2A35A 2PS9A 3LUJA 4ZA2A 3AWIA 4GI7A 5TSDA 3TEJA 2B4TO 3AVVA 1I5EA 5IFLA 3MCVA 4PX2A 4K9OA 4FOLA 5JJBA 5IJ0A 4A27A 2ZJ3A 4MVYA 1E1CB 3HCEA 4QGAA 1THGA 1X9IA 3KPJA 3QWAA 4D97A 1T35A 1RZUA 3FCSB 5KX5F 1Z0UA 1J23A 3IIJA 3DCJA 2PWZA 1Y8CA 1U1FA 2VVTA 3WFJA 1KVRA 3R7DA 4BCBA 3L9XA 1CB7A 1JIQA 1PQPA 1V48A 1ULTA 3ESXA 3N2ZB 1J2TA 3VFDA 4P3YA 1HNNA 4RHXA 2WWWA 3EIOA 3PNQA 3CRW1 4KXUA 1LF0A 1Q11A 2MSLA 2NZWA 2X5JO 3DM5A 2VATA 3OPXA 1TCAA 3Q5EA 4FDVA 4IF4A 1J5XA 4S1PA 2F3PA 3T95A 3CZ5A 2FMKA 5KOHB 1YK1A 1F7UA 1URPA 4KWHA 1M5RA 1AK2A 1O1YA 4ENSA 2AR0A 1N2JA 1GCAA 2K4MA 3N70A 4IDDA 5FA6A 4S05A 4H0CA 4TUYF 4V2UA 1K9SA 2ES4A 1YMUA 2VHZA 4MV8A 1SUCA 1Z45A 3FZQA 4FFNA 1E6WA 3QPVA 4E3ZA 3UV3A 2Z58A 2VDWB 1JE1A 3BF7A 1I2ZA 3H5TA 3KELA 3T1YB 1RBMA 1T26A 1JH8A 1YBMA 2R7LA 3W6PA 2O7RA 2HCRA 2Q4DA 1T25A 2VUHB 4BNUA 3DV2A 1VLMA 3IDSA 3A6PC 1OGIA 3D8SA 2OZKA 4DL9A 2FUEA 4OFWA 1D1SA 1T0HB 2GBPA 1GNLA 1WDTA 2QN7A 5DTRA 3PCXA 5JCXA 1MOZA 5DCYA 4Z4QA 1F5NA 2RKWA 2P3OA 2OGFA 4C4AA 5IM4A 3AW9A 4X54A 3AY6A 2C4TA 3QE2A 4P7FA 1VA5A 1Z28A 3U4CA 5KHOC 4C87A 2XX3A 4D0SA 3HVRA 2IW3A 5ALVA 4LISA 2PH1A 2E6KA 3JATA 2EYUA 4ZOQI 1PYDA 1JQDA 5BRJA 1L7MA 2YJTD 2WKQA 2FMHA 4HAOA 4UCQA 4XAQA 3VH4A 1YK0A 1H9AA 3I3OA 4JT2A 1VPDA 1V37A 2V97A 4RTSA 3NI2A 4ABTA 1ZQ1A 4YLEA 5EA2A 1Q92A 1R10A 1KI6B 5J5VA 5BSEA 1W4CA 4X90A 2WMNB 1ORIA 4E51A 3WQHA 3NR2A 3K20A 2IYXA 3NANA 4FHZA 2X6QA 3NJRA 2GA9A 5JATA 2ADOA 2HBRA 3AETB 3UJBA 4U02A 3UH0A 2C98A 5CH3A 4GKJB 3O4GA 1UBLS 5GJVC 4JMLA 3T5PA 4RLHA 3PQ8A 4FEAA 4L5YA 2DY1A 4JBLA 2W2QA 1VL0A 2JJ1A 4GPBA 4J0IA 3BGSA 3VZCA 2FEPA 4CT4B 5IMSA 2O8FB 4ZT7A 1LLFA 2GOYA 4IXMA 4B2IA 2ZJAA 4PV7A 4I1YA 1RI3A 4RYLA 4F6RA 2ORIA 2HDHA 2NV6A 4BQRA 1VL6A 1TDJA 1TF5A 3MT0A 4B3BA 2RHDA 2NG1A 1DWOA 1UC8A 4YDQA 5IT9A 2H1LA 4IOKA 3EEOA 2PT5A 3IGFA 5LMNB 1K3FA 2WUEA 3RYCB 3L4BC 2F2TA 3R5TA 4OBBA 4WADA 5LMCA 1ZMTA 4N7JA 5IM4F 2YXLA 4MDYA 3TH5A 1TPYA 1MLDA 1IUKA 1HETA 2QRGA 2ZGVA 3B8HA 3GH3A 3U3KA 1JMKC 4WEOA 3FDJA 1C1DB 4G3XA 2ZBRA 3KJQA 4RHFA 1AUOA 2NTJA 1BN7A 1D2MA 3IILA 2GCOB 4KI0A 3UKJA 4BQQA 1C0KA 3CH6A 3H9QA 3L07A 4KNWA 3ADCA 1ZOOA 2R48A 4ZQEA 5LQNA 3EGXA 2QUJA 2JGIA 3S28A 5EJ7A 5K4HA 2Q5CA 1VM6A 3FYUC 4ZREA 3TI7A 5HPYB 5I7OA 1N6IA 5JISA 3AKDA 4O4IA 2GFHA 3EZNA 3IV9A 2HKIA 3R41A 2JFQA 3KHSA 4UM8B 4EW2A 3KYJB 2J31A 5ECDA 3G9UA 4JC8A 1DT5A 3BFXA 4A10A 1PYOA 4E5KA 2I76A 1OYYA 2OV3A 2WIAA 1F20A 3EMDA 2AEEA 4HQLA 3V7FA 4EABA 2O2DA 1ZLXA 3G8BA 5DTEA 3T8YA 3UK2A 2QG9A 3EIUA 3T5DA 3T1HB 1RAEA 2H6EA 2NV2B 2NMVA 3NOXA 1IHOA 3AM5A 1HPLA 3A6DA 1OXVA 3QLJA 4G5SA 1MRZA 2H9IA 1Q1NA 3GGPA 4ZOCA 2QV0A 2A14A 3SSOA 4AQ7A 3CZMA 3PF9A 2PNJA 2X1VA 3C3KA 3CZPA 3UT5A 1WKCA 5DNWA 1ISSA 1HDCA 1ICEA 3DZBA 3H2SA 3QVJA 3U4AA 4LDNA 4R0NA 5LLTA 3CNBA 1CIJA 1RLTA 2FKNA 1R0SA 2X0EA 2CYCA 3OIYA 2CYAA 2XWQA 3GCZA 1JXMA 4JU9A 4LVUA 5DFAA 3WLJA 1NNEA 3TSWA 2HBYA 3DZIA 1OI2A 5A0TA 1TA4A 2OYRA 1YVRA 3JPWA 3Q9LA 3O47A 1EUCB 3SEZA 3ZWOA 1YDGA 1E7SA 1ZRHA 1Q0UA 4EGFA 3OA2A 3MLEA 3STXA 2GCIA 1TLFA 1VPLA 2E9SA 3JRXA 5I5GA 1R18A 1DC6A 3Q5GA 4HQ0A 4AZ0B 5DYGA 3HDJA 4AIIA 1SUWA 2BMAA 3THYB 2GHTA 3ANSA 4O3MA 2EC5A 2HK6A 3T99A 2OAP1 5E4TA 4EFNA 3UV7A 1TCUA 1Z33A 1SCUA 2FMFA 2CXTA 3GDHA 5CT9A 3I64A 4Y1EA 3T4PA 3BXPA 1NYTA 3QLTA 5DNVA 5EPEA 4IUCS 3DTTA 1J24A 3DEZA 5A7FA 1A95A 3GMTA 2DH5A 2X3UA 2ZE6A 2W6QA 4N54A 3AOEA 1OA1A 2PBZA 5C34B 1W36D 2I54A 3ETEA 1L7XA 2ZSDA 4A2QA 1JEQA 3IJ5A 1NVWQ 1KYIA 3JQEA 4WNIA 2E4XA 3MUOA 2XQGA 2GLTA 5C8VA 3UTDA 1Q1QA 2YOGA 3JRWA 5A5EA 3QXSA 3X2FA 1UFRA 3GLTA 4NZMA 3GWZA 3GDFA 1K3UB 1MVOA 2R84A 1JLRA 4TV9B 2PHZA 1VIMA 2PUHA 3RAFC 3BMQA 3MGCA 4OB6A 3NBFA 4Z4HA 3BWBA 5JR3A 4PFKA 3DEFA 3QE3A 5E6RB 5FWXB 1QBGA 1NXVA 3CX3A 1DHTA 1QLJA 5IAAA 1D2CA 1V26A 2XUFA 3B20A 3DDHA 5E6SB 2IWHA 1BX3A 3SXPA 4IIYA 1OHHA 4L4UA 4HQFA 1ZGBA 2BELA 2C9ZA 3KKPA 3T3HA 4GR9A 3OEWA 2AQ8A 3ZV3A 1DG3A 1DU4A 2C5AA 5ALXA 2X8BA 2GVDC 4L3VA 4L7VA 2ET6A 4E22A 5BW8A 2RKOA 3G5AA 1NVVQ 4QUDA 3EPJA 4KVGA 3HA3A 4FYIA 4KL8S 2F1JA 4KQHA 1FNBA 1VYTA 3IAAA 3HRIA 4JOQA 4AECA 2GEKA 1RC1A 2W6OA 3C15C 1MQ9A 4WOJA 4KOEC 4FE4A 1NLMA 3BSSA 4HMOA 4CCYB 4AZ3A 4E2WA 1TUEA 4ZQGA 4KBFA 1LSJA 1E3MA 1JLLA 2H1RA 3HJUA 2OFXA 1ENYA 5T8KC 3UPDA 3RRYA 4AKGA 1VJCA 2H29A 3QTTA 3M4YA 3G3EA 4F5ZA 2FZVA 4I3FA 5KWEA 3K0SA 1N33B 1KFEB 5CBKA 1Q0PA 1U98A 3IAUA 4AU1A 1LNZA 3B1XA 1JF8A 5B4TA 2AN1A 3O4HA 1PRYA 3GU3A 4G67A 4Z99A 5TT1A 1YMVA 3OCYA 2NU9A 1TM3E 5AXBA 3O26A 4ZCQA 1JILA 1NYLA 1ULZA 2FGKA 2VTVA 5DHUA 3N0TA 3Q7RA 1NI5A 4D3YA 2GD0A 1IZ9A 3BK7A 3W79A 3ZH9B 3KTFA 1N6OA 4OU4A 2IYUA 3VOBA 3WL8A 4JI7B 5MHTA 3I5XA 3NWOA 5J23A 3F6CA 1ADGA 1HZZA 1V96A 4AZVA 1LSUA 1KZGB 5GY7A 1KJYA 1Z38A 3FNIA 4EPXA 4ESOA 4N0MA 4HLNA 1HM5A 3L7CA 4C7XA 2QVYX 3CRNA 1WUHS 3AYZB 4FLEA 3MLBA 2KLBA 4KMSA 4RJKA 4UZSA 2WYOA 3LS2A 3PUXA 2O9JA 4UASA 3WXBA 2PZFA 1K08A 4A2PA 4J29A 1G5PA 1XO1A 1ZJYA 2IQIA 2WNSA 3DEHA 4HFRA 4QOFA 4E5PA 3IDAA 4MP6A 3WVNA 3KP1A 3SLGA 2FFBA 1JQ5A 1UXKA 2H4WA 2H8GA 3JX9A 4KTTE 4YROA 1E20A 3TOZA 2J67A 4X66B 1XVLA 3NEJA 4P5PA 1L5RA 2OAQ1 3CRRA 4I4TA 1EG2A 4MX8A 4FYPA 4Y2GA 3SD7A 1JHPA 1OLXA 2J6HA 2CJWA 2WPDD 3W34A 4LBYA 2IS1A 1FTWA 1GQFA 4CM4B 1O4VA 1SIOA 1WU7A 5BWLA 3Q88A 1TT7A 1R6VA 3A27A 2NAPA 4DKJA 4QBGB 1IN7A 1NLZA 2WPDA 3TD9A 4HAUA 3E9NA 1C9DB 1UXGA 1M2HA 2H57A 2XF2A 4DCUA 5ISMA 4OHCA 4B45A 1FUUA 3ANLA 2IT1A 4FQ5A 3TRHA 4W9NC 2V1UA 2IECA 5CEFA 3JXEA 1C7EA 1E96A 1JKXA 4JAVC 5C5DA 5BY2A 3DVLA 1QKKA 1AA6A 4M1KA 3RUPA 2O2IA 2FY8A 1NDQA 2PR7A 1QH8A 2V7GA 1ZKDA 3RQIA 3V1UA 4UHHA 5DSZA 3O4VA 3WGOA 3NHMA 1E1CA 2XXJA 1I7DA 3KKOA 1HYBA 3WGKA 2PZMA 3EGEA 3F2VA 5CDSA 3KXKA 2OLKA 1PW7A 3LVFO 1CF4A 2X41A 2I3GA 2TS1A 4V39A 3T7RA 3GLIB 1UJ4A 4H6XA 3QWBA 4M88A 1PJRA 3ELBA 1U04A 1U6JA 3FZGA 4UMVA 5DX0A 4YV1A 5B64A 4Z4FA 1GU7A 3A1SA 3FBGA 4H0FA 5T3YA 1FSSA 1QORA 2OBLA 5TEVA 2DY0A 1KYYA 4NULA 1PEKE 5KSPA 4I4TF 4AJ2A 3KQHA 2R8OA 4M8LA 4GE0A 2DUUA 4MI3A 1KTVA 3BCHA 2OBBA 1E9VA 2G8LA 2FPGB 4R7TA 1E2PA 4MW0A 4EI2A 5LYJF 1KZ7B 1H1DA 2R87A 1UBJS 4P1ZA 1E3WB 4A8HA 1SAYA 1ESNA 4YV0A 3TI9A 2C59A 3MCZA 4IX1A 4ZAFA 5AUQA 4TQUS 3I76A 1NV9A 2FP3A 2WOOA 3CFFL 3B9QA 1AU9A 4EVRA 2QTCA 3X2EA 1AIPA 3DMGA 3RVJA 1HMYA 2G16A 1ZMXA 3IKTA 3HJNA 4NENA 2AZTA 1T0PA 3EYWA 2V6IA 1XV5A 4MTLA 5JJCA 2X2PA 1FLVA 1CDOA 1TB4A 3QV1A 4HLDA 4URZR 4UXHA 1NAHA 1AMNA 3NKLA 3KVYA 1UP6A 4DV7B 1XFDA 5SZHB 2Q1TA 1QIGA 1XF1A 4L22A 2IXTA 2YW2A 4M9SA 2WD7B 1GKKA 3HUDA 3JPYA 2XLBA 4AYTA 5JV5A 1VJDA 3C1UA 2XW6A 1TA0A 2A5LA 4W5RA 1G20B 4JFRA 2C4NA 3LCVB 4MW1A 1QYXA 3TQFA 3WIUA 2RBEA 4G85A 2C8KA 4LE2A 1JQLB 4URYR 4OXIA 4ZCPA 2NVUB 3KOZA 1E89A 2BKUA 2QB5A 1E7YA 3U09A 2Y4OA 2P9GA 3JQ9C 4O4LB 3VHLB 4D99A 3FPLA 5BYAA 4CKWA 4OQNA 2BMWA 1IHYA 5CM2Z 4S1OA 2BI7A 2KPOA 3E2MA 1JXAA 3GEGA 5I48A 3QVSA 4IO1A 1T4CA 3H1GA 3PQCA 1KI6A 5C8ZA 2CNWD 3IKLA 1WU8A 4MKXA 4IUDS 3TE7A 1L5HB 1GP2A 1TIKA 2J3EA 4GX1A 4BKQA 2B5OA 5B3LA 1W581 3H87A 5KIAA 3V2HA 5FOWA 4DIMA 4IV5A 2R1VB 2RHRA 1NAIA 1N75A 4QDOA 4L76A 3RVQA 4B6RA 1DAFA 1Y3AA 2VBIA 2X77A 4IIVA 4J7UA 3AETA 1FFXB 1WO8A 1YOVA 2GASA 2FTKE 4KFUA 2ZI9A 3GY0A 1ZRSA 1L5VA 2PAFA 3DTVD 4HQKA 1WLSA 2ARKA 1P1JA 2CNDA 1M9NA 3BE6A 5IDVA 3B7GA 5IT5A 4F7DA 3GUYA 3LQ1A 4HN2A 4P2GA 2B8NA 2W2LD 1E0JA 5FTKA 2Q1XA 3GZNB 3OOWA 1IEQA 3HBAA 5A2GA 1MFPA 1VHQA 4BIIA 3DTVA 1XMXA 1L5KA 1C3OA 2WF5A 2ZVQX 1ORDA 4DWOA 3B3QA 2Q9AA 1W5TA 3WNBA 4KSBA 4O4JF 3KLOA 2E18A