4MUJA

Crystal structure of pantothenate synthetase in complex with 2-(2-(benzylsulfonylcarbamoyl)-5-methoxy-1h-indol-1-yl)acetic acid
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
288
structure length
288
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 96
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4mujA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mujA01
2IP1A 3IDFA 2A88A 3S3TA 1JILA 1WXIA 1H1TA 3RK1A 2QUIA 2A1UA 2ZUEA 5KHAA 5FNZA 1F9AA 1KORA 3SP1A 3IUEA 3DO8A 4EG6A 3ND6A 2QTRA 3KT0A 3SZ3A 1N2OA 3RBAA 3U1VA 1FFYA 3H9CA 5EKDA 1WZ2A 1EJ2A 1OWNA 5TEWA 2YWBA 4MWBA 5TGTA 3ILVA 2V0CA 1YIAA 5AHWA 1N77A 3LOQA 4K0RA 2QUHA 2E18A 3AFHA 5KCMA 3TQIA 1MRZA 3IMEA 3GUZA 3HFJA 4AS1A 5HUJA 4AQ7A 4CDNA 3TS1A 1N3LA 2OQ2A 1HYBA 2D13A 4U8HA 5JBNA 3ELBA 5BNZA 1R6UA 4Q93A 2CSXA 1COZA 3N9IA 1H3NA 4QREA 1VBNA 3A05A 4QRDA 3PNVA 4ZCSA 4ZCPA 1O6BA 2A84A 1A8HA 4ARCA 3P0IA 4PBRA 3IVCA 2XRYA 1M1ZA 2H29A 2PXHA 4DDMA 4ZT2A 4MUEA 4PY2A 4DLPA 3F3MA 3Q4GA 4U63A 3C8ZA 3TNJA 2YY5A 4MW9A 1T6XA 4EG8A 2VTBB 3MUEA 1K4KA 3UMVA 3MLBA 2GM3A 1KH1A 1KH3A 4NAUA 1O0CA 4EGAA 2VXOA 1K92A 2CV2A 3COVA 4MULA 3IUBA 2J07A 1EFPB 2CV1A 2QJTA 3TZEA 3P0HA 1K4MA 1PG0A 1JIIA 1WXFA 3DPIA 3IODA 3IH5A 2A1TS 4JXZA 1M8GA 2CFOA 1OWOA 3IMGA 1LW7A 1EE1A 1M83A 1Q19A 1YUNA 3A4IA 4I6GA 2XRZA 2A7XA 1FYDA 4YP5A 1IQ0A 4A91A 1KH2A 1YIDA 4RPIA 4UZEA 4MW7A 2HMAA 4XFJA 1IVSA 1O5TA 4ZT5A 3FNRA 2CYCA 1KAMA 3SYTA 2B7LA 4FZJA 3VGJA 2QJOA 4MUJA 3SEQA 1IHOA 3DV2A 3FWKA 1MB2A 4MW6A 3ZJVA 1TEZA 2JAXA 4ZCRA 1R6XA 3CLUD 1YUMA 1XNGA 3PRHA 3SZGA 3ZUGA 1GTRA 3QTTA 1WKBA 1OWLA 1S4MA 4YMIA 1WXGA 4EF6A 3VU8A 1JIKA 3CLTD 1N2BA 3ZGZA 3CLSD 1J21A 1NSYA 1V47A 2DLCX 1I6LA 2QUKA 3FY4A 4MAFA 1JEEA 1ZJWA 2EJCA 1Q11A 2X1LA 2QUJA 4GRIA 4S1OA 1BS2A 1XNJA 1IQUA 3HV0A 3KFLA 1O96B 4EG5A 1F7UA 3ND5A 1EUYA 1CT9A 1QQTA 1T9GS 2AZXA 3SEZA 4OUDA 2BTEA 3M5WA 1SURA 1ZH6A 3FDXA 2DR2A 2CYAA 2PZBA 5DEOA 1NYLA 1NUTA 5TS2A 1WJGA 3UOWA 4X0EA 1OD6A 1QRTA 1EFVA 4MUNA 2R5WA 1ZUNA 3COZA 1D2RA 3L93A 1J70A 1T6YA 1YI8A 4L2IA 1MOPA 4WNYA 4JYZA 4JXXA 2A4MA 1QTQA 4KKVA 1MBZA 3N05A 1MC1A 3TQOA 1EUQA 2RD2A 1PFUA 1WXEA 4TS1A 3N2YA 3AG6A 1N1DA 1WQ3A 4HK4A 3A04A 1TYAE 1O97D 4ZT6A 5LFAA 4E1AA 2G36A 2O8VA 1NUSA 4EG3A 2Z08A 3NBKA 1O95D 3PNBA 1G8GA 4UZFA 4DE5A 4G5YA 4ND6A 1N78A 1WXHA 1J20A 3RFFA 5K0TA 1M8KA 4ARIA 2CV0A 2AG6A 4MW2A 3H97A 3H05A 3RJZA 4WSOA 4EG4A 2Z3VA 1OWPA 4ZT3A 4EG7A 1NP7A 1KQOA 3HMQA 3IOCA 2DEUA 4GU5A 4YBRA 2QTMA 1M8FA 3HZRA 2QJFA 2PZ8A 1ZH0A 1N2IA 2HGZA 3G5AA 1O94D 1MJHA 3CLRD 2A1TR 3LE8A 3QTBA 2C5SA 5LM3A 3MXTA 5J59A 4NATA 4JZYA 4ZCTA 5KWVA 2E89A 1LI7A 1P7PA 2YXNA 1U3DA 2DERA 3A2KA 1JHDA 3COWA 4EG1A 3L92A 1T6ZA 3X1JA 1KQNA 1J1UA 4NAHA 1KAQA 1TYBE 1H3FA 4MW5A 2X1MA 4MWEA 1N2GA 1WY5A 3UY4A 5J5AA 2D5BA 4P2BA 4RUKA 2VTBA 1JZSA 2DETA 3FETA 2J08A 2J09A 3ZJTA 3AG5A 3LCJA 1NUQA 3CLTC 1OBCA 1UFVA 1EFPA 3FI0A 3CLSC 3SDBA 1TFUA 2DXIA 4KPUB 1JIJA 4H3SA 3FH0A 2ZP1A 1DNPA 3CR8A 2CT8A 3KT6A 1PG2A 5F23A 1F7VA 2PFSA 1Q15A 3AL0C 1KP3A 4I6JA 4MUHA 4ZCQA 2E0IA 1O0BA 1R6TA 2A1UB 3X1KA 2A86A 4NX2A 4BWVA 4DNXA 4XSVA 4PBTA 4MVYA 2J4DA 3FIUA 4HJXA 2BYTA 5FO0A 3Q10A 3G59A 4MUGA 2IELA 4R2MA 5HUHA 1KQPA 3HGMA 1V8FA 1M8JA 1H3EA 2D54A 2GOYA 1T9GR 3AIIA 4G6ZA 2Z09A 3ZJUA 1GN8A 4MUKA 4MVCA 2JANA 3I05A 3ZIUA 4KPUA 4JFAA 3IVXA 3PXUA 3Q12A 4MW4A 3K32A 3CVXA 1I6KA 1OWMA 1G8HA 4YP6A 3UC5A 3IVGA 2WQ6A 3IMCA 4U7JA 1RQGA 1O97C 4KR7A 3KT3A 1NUPA 4Q16A 3P52A 2JA2A 5TEVA 5IHXA 1O95C 3OP1A 3COYA 5DASA 5H7XA 2NSYA 3TZLA 3AKZA 1ILEA 1VBMA 1GLNA 3FG9A 2ZUFA 4R2LA 1PFYA 4KR9A 3FHJA 3N8HA 3ND7A 2PZAA 1O96A 4OJMX 2WQ7A 1JZQA 1PFVA 4G5FA 1JMVA 3E27A 3D6VA 1X8XA 1NI5A 2PIDA 4I6EA 1U7DA 3H99A 4DJAA 1QRSA 1IRXA 1N75A 5J58A 1KKUA 4MVWA 4MWCA 2EL7A 1YULA 3INNA 1VL2A 3OTWA 1TQ8A 3D6UA 1O94C 1WOYA 2RE8A 3CLRC 4HPWA 2CUZA 1I6MA 1M8PA 3KT8A 4J76A 2J5BA 3BL5A 1TYCA 2H2AA 3CVVA 5K0SA 3CVUA 1JEDA 2IJGX 4XFDA 4KR6A 3QE4A 3DLAA 1B6TA 3MLAA 4MW1A 1QRUA 4EFKA 4J75A 3NV7A 1QJCA 2X3FA 2AKEA 1IFXA 1MB9A 1IH8A 2X0KA 3IOEA 1JECA 3GMIA 3PNYA 3MMXA 1Y42X 4F4HA 1XNHA 4MWDA 2WSIA 3RK0A 4MQ6A 3K9WA 5DB4A 4HJRA 4MUIA 3CLUC 3H9BA 2I1LA 3JXEA 2E21A 4DDHA 3ZXIA 1VBKA 1GZUA 3IOBA 5IJXA 1NURA 4CDMA 1QU2A 4MLPA 1PFWA 2HZ7A 2OV4A 2DPLA 4K03A 5H16A 4MW0A 4PBSA 5LLTA 1G59A 3RHSA 2WB2A 2QTNA 4NDAA 1N2EA 1QNFA 1XJQA 4CQNA 4CT0A 1N2HA 1TYDE 1OBHA 2NZ2A 1ULHA 4ZT4A 2DUMA 4MVXA 1GAXA 1KR2A 3FOCA 1J1ZA 1MAWA 1N2JA 3UK2A 1G8FA 1U7XA 3X1MA 1J09A 3GLVA 1VLHA 1NZJA 1F4LA 2O5RA 4OUDB 1MAUA 4R0NA 3ZXSA 1EXDA 2PG3A 2YWCA 1I2DA 4F3RA 5HG0A 5FO1A 1X6VA 1QU3A 1JGTA 2GKSA 1NUUA 3CVWA 4ND7A 4ZT7A 4DDKA 3VRHA 1IQRA 3P0JA 1WQ4A 5DK4A 2TS1A 3ISJA 1EFVB 3G6KA 4MUFA 2V0GA 4NZPA 1K97A 4L2IB 1GTSA 1Q77A 3CVYA 1LI5A 3HL4A 2CYBA 1KP2A 3NBAA 3CA8A 1U0BB 1U3CA 4QBTA 4YP7A 1GPMA
chains in the Genus database with same CATH superfamily
3NWEA 4EMUA 2TYSB 1QHHB 3SFVA 2NZUG 1KVTA 1OBOA 4FNOA 5AW7A 2ZANA 3ZGYA 5A6SB 5BVGB 2QTVA 4ZJZA 1F9AA 1I2BA 3GV0A 3JSXA 4LDAA 4G5HA 4PAMA 4I1UA 2B37A 1CQJA 4Y18A 5G0UA 3WBBA 2ZFUA 4GLBA 2Y4OA 3OIUA 3PNLA 1OFHA 4KYVA 4RE5A 5TGTA 4RSHA 3OWOA 3THXA 2PRSA 3JWIA 1ST3A 3NP7A 5JS8A 2WAXA 1Z07A 4KAAA 3V32A 3KKPA 1HX7A 4MXDA 4R1QA 1LV8A 4KQMA 3L7CA 3QY9A 5L45A 2VJLA 1JBQA 3EEOA 3TQIA 2EGGA 1E9BA 1Z8FA 2EJBA 3GUZA 2NU9A 4HEJA 1P45A 2LWIA 2OCDA 2VUHB 2Y0BA 3D0QA 3B5IA 5CA0A 4RFSA 3DJFA 3HDJA 2F17A 1XP5A 4M8KA 5A5GA 2HX1A 5EJ7A 1Q3TA 5IFKA 5KKNB 1MABB 1YRYE 3SCZA 2H1OA 4UBNA 2ASVA 5BNZA 1Z0FA 5HIAA 2Q3FA 3KETA 4HQ6A 1ISGA 1QVRA 4HCJA 3ZWAA 2I62A 5DBGA 1CZHA 3EULA 3GFSA 3OLCX 4HGNA 1TE2A 4MEJA 2JK0A 3ULKA 4DR5B 1HYQA 1QCZA 2GYYA 2MSNA 3E48A 3EEYA 3UJPA 4QZVA 2QR5A 1N9ZA 3H84A 4TLDA 1IOLA 2C9BA 4CCYB 1KO7A 2OUKA 3CPJB 4OATA 3SJAA 1I2ZA 1P6UA 2X0EA 5BSRA 1FJXA 3PDCA 3TTTA 1A8UA 3KYDB 3AOEC 3L8YA 3L18A 3FROA 2V59A 2E37A 3JR3A 3HY6A 1JSLA 4IDGA 1W44A 5EWLB 4ZAWA 1FMJA 3TL3A 2PUGA 3RI3A 3CI0I 1DBIA 2TECE 2BTQA 1M76A 3WX0A 3E9NA 3CZ4A 1ZHOA 3LPAA 4GECA 1QTIA 1XLTA 2FPSA 2FZ5A 2NO0A 2XRMA 1KBOA 1A8SA 3FNBA 2CKDA 2D5AA 2GRJA 2NT4A 5HA5A 4W5NA 4LXTA 3E5RA 2VXOA 3UYKA 4M2LA 2CV2A 3ANYB 2DZDA 2F4VB 4TT8A 4IDPA 2V9CA 3QK7A 4G0XA 4H60A 1GZ3A 4DNQA 1N7HA 3FFXA 3OI7A 4MVJM 5ANRB 2BUCA 3ZE2B 4EY7A 5KSWB 5JSYA 1MLDA 1E9DA 1PVOA 3ZWWA 1BXKA 2WM3A 2ZT5A 3UXMA 3WQBA 2ORIA 4KNVA 4CQMA 5A2GA 1S5PA 4Z9AA 4DA4A 3CB4A 1Q17A 2R25B 2P91A 1H6AA 3OTGA 3PT5A 4F04A 4NQRA 2XRZA 1F2UA 2AHRA 3AU9A 4Q1BA 5C7LO 3NDIA 1H5UA 4ZOCA 1LDGA 3CQ9A 4PQGA 3G8AA 4EF4A 1YMVA 1TQ2A 4E12A 4Z99A 5FLEX 3O47A 3PFGA 4QGBA 5E1BA 2FWNA 3IB3A 2Q1SA 4Q3CA 4BZXA 1PF7E 4LC9A 4WOCA 5F98A 1YB5A 5K0CA 2HMAA 4EB0A 4NCBA 3LF1A 5K09A 2OSVA 3UAVA 4YR9A 1IHPA 2B8TA 4R51A 3W1EA 2G40A 1C4WA 1L3BA 4FMPA 3RH0A 5IC4A 3VGJA 1RHQA 2XVMA 2QJOA 3A6DA 3WKAA 3WJ2A 5EP4A 2F1KA 1T91A 2WJPA 2MIIA 2PYDA 2WM2A 3KM0A 3KPVA 3OJ0A 4D8VA 3AWDA 3T4UA 4BEWA 3EPLA 3AL3A 2VDRB 2QVXX 4RA9B 2J9ZB 4HDCA 4NWIA 1R6XA 2Q9AA 3AHFA 3T52A 3PK0A 1S6YA 1ZSVA 1BFUA 3C1OA 3DW3X 3QVVA 3SLGA 3O8RA 4NBRA 3LUPA 3FTPA 4Q15A 3QHPA 2RIPA 4J16A 3O4HA 4ETNA 4DVJA 1J33A 3B9QA 4K9RA 2P8SA 1UBGA 4LDRA 4DN6A 2GS9A 3ZEIA 1Z6YA 1M75A 4LMPA 1RRPA 3DW1X 5H70A 5AKGA 4CGYA 1I9GA 3BQ9A 3U2QA 4KXXA 3VR5H 4JITA 1WMSA 3K3PA 1KEWA 1HEYA 5IABA 1FXUA 1C8VB 3CLSD 3GQBB 4MOWA 2NACA 5LCXA 4DDTA 2VK4A 2RHOA 3KLNA 3KHUA 4WCFB 2JG3A 2QXUA 2O0HA 2VTVA 1SVNA 3GUVA 3OEYA 4AF6A 4DZZA 4P80A 1XMVA 1ZPDA 2EEPA 1VSQA 3KUKA 2FR1A 3ANMA 3PGKA 3EY9A 2A6PA 3O8LA 1P5ZB 1YZ3A 2YZKA 4WCVA 3KB2A 5F77A 2P7IA 3STWA 4ZJYA 2FEOA 3IQXA 3AF2A 1RBYA 4MQEB 4CM1A 4UUBA 5C4MA 3X2FA 5JY6A 5LP1A 2HWXA 1VJGA 3EYWA 1C81A 1CQXA 1NNLA 1TEVA 2X1VA 5JALA 5KINB 3FYHA 1XGKA 4H0CA 4LHEA 1G3IA 4MMXB 4CIBA 1B3RA 1K6MA 3NP9A 4BQSA 1CVIA 2C7RA 4CMIA 1H0HA 4NEQA 2E7ZA 2RHRA 4QJ4A 3RNOA 5AVQA 1NP3A 5B6IA 5JHHB 1U0JA 3CT4A 1IY9A 2YHBA 1SHJA 1A4RA 1XQWA 3FDXA 2HAEA 4YI3A 1XZDA 2HZBA 2PKEA 3JQBA 4LHYA 4YMLA 5C8YF 4BB5A 1G3MA 1XKXA 2B8EA 1UZLA 2KM1A 3PNSA 2WHPB 3DH0A 4M1KA 1H6CA 4OH7A 2Q1TA 2I8CA 4GICA 2GKGA 2ZR9A 3FLAA 3LUJA 3OEHA 3P0FA 1DP4A 4TL7A 1ISRA 5CM2Z 5C8XA 3F78A 4JUFA 3UFBA 5AR1A 1XQ1A 5KJEA 3O0DA 5DRTA 1DAMA 3D7RA 2DBZA 3W6ZA 5FWNA 2AR9A 3T41A 2XQIA 4CLRB 1AZWA 2XBLA 4N01A 1DX9A 2NAFA 2Q6OA 3FMVA 3NT5A 2RD2A 3N86A 5T7BA 1JMYA 5HKBA 1N1DA 1WQ3A 2G5GX 5AJWA 4AUEA 5K20A 4WVLA 4L78A 3RFVA 1ULTA 3W90A 5G41A 3KR2A 4NCNA 4A2PA 3GRKA 3QLVA 4FWIB 5ARBA 3MNFA 2HCRA 1U3TA 4DDUA 3LP5A 4PO3X 1EJBA 1OHHD 2NAPA 3BTVA 3K6RA 1XVTA 3JASA 3JQEA 3L7KA 4G23A 4NNOA 3W6OA 5KYGA 4TYWA 1EESA 5KQSA 1V8PA 4EB6A 4X8MA 5JJ5A 2I6TA 2JIRA 2VYNA 1U6KA 3U81A 5EWJB 2XYVA 1Z6AA 4L9WA 2AG6A 4B8YA 2QT1A 1QV7A 3B3FA 1CV2A 2D1SA 3U4MA 2R751 4K9SA 1T1RA 4IEFB 2H18A 3JVEA 1MB3A 1RP7A 2HGSA 4HGOA 3LIIA 3CG0A 4G09A 1R4MA 2IW3A 1BOFA 2W2XA 3E3MA 1AVTA 1VL8A 1NFRA 5DSTA 3WFIA 1LVHA 4BX0A 1ZN2A 2GZHA 1KAEA 2OESA 1DQSA 5AJHA 3WNBA 5HKKA 4QUDA 1AS2A 1ZM9A 3QPDA 3QNWA 4RVNA 2XXJA 1FJGB 1GKKA 4L5AA 2M9MA 5CT4A 4AI6A 3DOOA 4QM6A 3QM1A 4BFSA 4HB2A 3GGSA 3CVJA 1W36C 1M1YB 1L5SA 2V6GA 3D0OA 5J59A 3EOZA 2IUUA 5KWVA 2Y1CA 1P7PA 3UWMA 2YXNA 1SMKA 3A2KA 4OX9Y 2QPOA 4URVR 4IDQA 2XNCA 3K5IA 3X1JA 2C0CA 3MWDA 3ZPXA 1G38A 3NW9A 4G0UA 4RENA 4OHOA 3K1YA 1S3SA 1KEUA 4IXMA 2GN6A 3ZV5A 4EAQA 4D8WA 3LH5A 5AI4A 4DSUA 5AOBA 5FLYA 5HFAA 1DUIA 4OIFA 5C1PA 4J1QA 1ELOA 3OIDA 4XGQA 3HNPA 3NPAA 1O9HA 4U0JA 4UFPA 3CGGA 1J49A 3GLUA 1QYCA 3ZI7A 1XVUA 1BMFD 4BVGA 5AQ1A 2YVAA 4LF7B 1LGYA 2EX0A 2VUUA 3GEPA 4OI0A 2FN3A 3PZRA 4AJIA 1TEXA 1E63A 2W2LA 3QJ5A 4G4IA 5EUMA 4FC6A 1XLVA 3DOHA 1OBCA 4ZZ0A 3S81A 2D06A 4Q4JB 2W2OA 2YHAA 1E1RA 2DBQA 5LMUB 4X7PA 3WHPA 1Y7HA 10MHA 3UUFA 1KHTA 4ESVA 2IEDA 4EA9A 4HQ0A 2I4NA 2ZRMA 3IALA 3PXDA 3KWFA 4NBNA 2PXXA 3PFNA 4QRHA 4D80A 1U0SY 3UXHA 4RW0A 1DBQA 2AG8A 2GN8A 4ER6A 2CB0A 2JFNA 1RMQA 2Q5OA 4B6RA 2PGDA 3RODA 1IC6A 1QP0A 2CVOA 2OCKA 4F8JA 1FJHA 4QLBA 1N36B 4UD6A 3A3OA 2ZUWA 5J58A 1CQJB 2LE0A 4BUCA 2XADA 1HO3A 4MRRA 2RGUA 1JHZA 2QENA 3V4VB 1CUEA 4HNSA 1ZCAA 3C70A 2BYTA 1REQA 5CVTA 2UVDA 3LKVA 2R8EA 2FTKE 3DE0X 1ZMXA 4M9UA 1Y4UA 3R75A 4IHJF 2ISSD 4P4GA 5IT5A 4P22A 3WKDA 2GWRA 4RD6A 4EGQA 1L5MA 1E7WA 1MB4A 4ZVKA 3C48A 1IDN1 5G0WA 2NU9B 5CA0B 1H3EA 1Q0RA 3TL6A 3TXYA 1KF0A 3U5ZB 4HYEA 3DR3A 4HEQA 4RFSB 2VZEA 2X8LA 3GRYA 3T3GA 1F0YA 3SYKA 3RRMA 4EPRA 1GAQA 5A02A 1AF7A 3S2SA 3DQPA 1LSUA 1CCWA 1YZVA 3AIOA 4AZTA 3QXJA 1HNNA 2W8ZA 4D6YA 3Q2OA 1AG9A 3IS3A 3N2NA 3TM4A 4WJLA 4D6XA 2YZGA 4MW4A 4KN9S 3BFXA 3K32A 3LVFO 1BEEA 2XR1A 4JBYA 1YR1A 5C0OE 2G5CA 4RWEA 5KVAA 3OC0A 3PHJA 4PANA 1I6KA 4U2KA 4DA6A 2JD1A 1CRZA 1DX4A 3T0GA 2WQ6A 4R6XA 5DMHA 2AWNA 1DC8A 2YXLA 4BB0A 5JPCA 3EUWA 3DM5A 4BQFA 1GYRA 4OMUA 2BGNA 1JBEA 4DCVA 4HTAA 2F8LA 4GLLA 3UJBA 1Z0AA 1Z56C 2NSYA 4OVKA 4I5DA 3H2HA 5IWAB 4M8LA 3PTAA 4RY0A 5I8PA 2AG1A 1QBKC 3AF3A 3A4LA 3G17A 1Q0HA 4PLCA 3DD5A 2CUTA 1NVEA 2E48A 2HKIA 2HDNB 2PZAA 2VDPB 4WMLA 3UH1A 4IQ4A 4B71A 9LDBA 1QHNA 3NTVA 1MEOA 3RAFC 3MCVA 1FUEA 3LECA 4M0KA 4CFYA 1RLMA 3KWJA 4NU5A 2AG5A 4RZXA 4HI0E 4FYYA 2D2VA 1T34A 5BNFA 1MV5A 3AV3A 4BWFB 2WWGA 1QGED 1M2GA 3HWX1 4BO3A 3HSKA 4OSPA 4ZO7A 1RI3A 1YBVA 2I76A 4NOLA 3TZHA 2RGXA 1WRBA 2FFJA 5DK6A 1JG1A 3EA0A 3AHIA 4H3HB 5JSQA 4CQMB 2QU7A 1D4OA 2XB6A 3G0OA 3UMFA 3ZHVA 1O5IA 3HYCA 4WXPA 1F2UB 4KX3A 2AHOA 4W6ZA 3DZCA 1EMDA 4OUKX 4ETWA 3MWLA 4B3TB 1VFPA 2Y8EA 3D5QA 2WDZA 3EW9A 4C3OB 3VH4A 4F93B 2JGFA 1BXGB 3CZQA 5EJEA 2JI8A 2O52A 3P9RA 2ZWPA 3RVJA 1W5EA 2Q46A 3V1LA 1QQBA 2WUEA 4FDUA 2EV9A 5JROA 3PIDA 1AM4D 1JLKA 3ACBA 1RPZA 1Z7BA 2UYQA 3L8GA 1CP3A 1YC5A 1T10A 5D84A 5B3JC 3A32A 1KO4A 2ZRAA 1GFIA 4GEGA 1OH7A 3QE0A 2BOVA 4OA8A 2H1LA 3C74A 3FRHA 3U1BA 2YXDA 3I6IA 3Q7IA 3QV2A 4ZAVA 2EWMA 1NDQA 4A1OA 3ZHTA 4RTQA 4HX9A 1CF4A 3A14A 2R8RA 1VLVA 3LTNC 4FEGA 1XKLA 1NPDA 1BS1A 1ZXLA 4DDHA 4Y30A 3ZXXA 5LZ5A 1KEEA 1C2YA 1IG3A 2BW0A 1O4VA 3C3WA 4RYLA 5EE1A 2WINI 4QASA 2AKAB 2OD9A 3NWJA 3UHOA 3JTEA 3TUIC 4BMOB 4UM9B 1UBHS 5BV7A 5LP6A 3OO1A 2ENWA 1HPLA 4ZVNA 4BVAA 1KSFX 4BFCA 3MUFA 3F9IA 1MO4A 2C95A 2DPLA 4BCCA 3AJAA 5BSTA 1G8JA 3QUSA 3K05A 5EGSA 1QYXA 2G6TA 3D31A 5BQ5A 5DTIA 2JLSA 2PNJA 1E64A 4KG7A 4V1CI 1JJFA 2ZUVA 1I13A 3L43A 4JBXA 4BDSA 3U7EB 4DA0A 1Y1RA 1ZMTA 2RB5A 3CZRA 1OBHA 5KDOA 4CLDA 2A3RA 4MVXA 3MVEA 721PA 3QOYA 4ZVLA 1G20E 4L15A 3DC7A 2HA6A 4H1WA 2IHKA 4JC0A 5JZBA 3WMFA 2BP7B 2O5VA 2E6UX 1Z6GA 5EAIA 3T35A 4NF2A 1QV6A 4CMIB 4D99A 1JIVA 1J5XA 1CVLA 3BK2A 1DFIA 3ENNA 3OURA 5HF8A 1KEPA 3ACDA 2V5VA 1I2DA 5F7OA 1JG4A 2EX1A 4C1NA 4ND7A 5IPFA 4WY2A 1T2CA 3K31A 7MDHA 4LXHA 3P0JA 4OYHA 3I6QA 4Q1FA 3EBLA 4R3UC 4UEKA 4Y6SA 1GFSA 2Z5VA 3LS2A 1ECBA 1YDFA 3HZHA 4RF5A 3UBMA 4PX3A 5CEFA 5KWSA 1XTRA 2G7MC 4MCIA 3CEJA 2BV3A 4RZ2A 4L28A 4YAKA 4XVRA 3NIWA 3OMXA 1PEKE 1JLMA 3IA7A 4I4TB 5B3LA 2HH9A 5KOIA 1YK1A 1BEZA 4LRWA 4NFSA 1UPBA 3RIGA 3ZV4A 1L4HA 2Q6IA 3TVYA 1F4VA 4QQ8A 1CF9A 1W4AA 4DCUA 1YRBA 3FUWA 3IIJA 3KALA 4A92A 4DPLA 1JJIA 1QGZA 2JGRA 3F5MA 3ORQA 3GUYA 3EVNA 3P97A 2HU2A 1VE6A 3EXHC 4N12A 3RHFA 4TQGA 4BMYA 2HLHA 2R65A 3ABZA 4UE2A 4NG4A 4AP5A 1RRVA 4P38A 3SHVA 1E0AA 1CYDA 2G9VA 1HE1C 1I7NA 4NECA 4AECA 4EB6B 1WZ2A 5DOZA 2VRBA 3D4LA 5HHTA 4FZRA 4NE7A 2IYVA 1VP3A 2PZJA 1RMYA 2YNMA 1CLEA 4U00A 4C7JA 9LDTA 2VOEA 3NASA 1EVEA 1M72A 1XZNA 1H4VB 1NJ2A 3VH3A 1L6RA 1R4MB 2ODWA 5H9VA 1UK6A 5ICEA 1FNSA 2JIZD 3R20A 1V25A 2NUBA 1P2GA 2BF4A 2VL7A 5JD5A 1RJWA 2H4WA 1EE2A 4LKRA 1PFGA 2XYHA 4GGPA 2XUZA 5CYPA 5TRTA 2J0SA 1M1XB 4LSWA 3W5VA 5F2NA 1FC0A 4Q21A 1DIHA 2BUAA 4UEWA 5BUZA 3N59A 1QP7A 5HSGA 1R6UA 5HTKA 4FONA 4R84A 1QFJA 3DKIA 3INGA 3KPWA 5JJBA 1IULA 2X23A 2FUKA 1I3LA 3Q87B 1AQLA 4DHWA 1CDOA 2BEUA 2NQ2C 2QAIA 2XD4A 1E1KA 3WNCA 2FPRA 2G9RA 3ONWA 4GBED 4M7WA 4S1TA 5I9MA 3TLCA 3TRIA 4JJ8A 4DCPA 4ZVUA 2I3ZA 4D56A 3NTUA 3O1LA 4BAUA 4UTVA 5JTUA 1CVRA 3MWDB 3HGQA 4OFWA 3JQGA 2YWGA 1BW9B 4EFMA 5IVIA 1DU4A 1NPTO 3T5DA 3V2IA 1B0UA 3WYCA 4BVKA 2FPKA 1RC0A 2JIOA 5FBKA 1QMPA 4KQ1A 3OC6A 3HCCA 3MUOA 3PB3A 4U1RA 3SX0A 4CHGA 3WL5A 2QS9A 4DUGA 1CJSA 4PQFA 3UMVA 3R6WA 3DZKA 3GJTA 3SR0A 4CHTA 1IWPB 1G5FA 4QGSA 4AJKA 5LZ9A 2ZVPX 2V8OA 5CB6A 1ZAYA 2D6FA 3N5KA 1NYQA 2RGEA 3K9CA 3N0WA 4R2KA 1Z5GA 5LNK1 4AY6A 1I0IA 5KNCH 4ALKA 1ODFA 2W4QA 2VH5R 3BRWA 4WIAA 3IV6A 1W1IA 3KHSA 3RFCA 2PLFA 1Y5RA 1XYGA 2BFEA 4AZWA 1ZIYA 2DPGA 1Z2OX 4V0LA 1LW7A 4KITB 1WQ1R 1QONA 1ZNXA 3C3MA 3KRTA 3S29A 1CJCA 3SXPA 5EJ5A 2EKPA 3PV0A 2TRSB 4XGKA 1EP3B 3HJRA 3LUCA 5DHTA 4JKOA 4JLOA 4OTZA 3LY5A 3ABRB 3DOUA 4PYRA 1AQUA 4TXLA 2Q3CA 4V0NA 4I4NA 2PWZA 5A3JA 1HFKA 1REQB 4MHSA 2QU8A 2MTBA 1X7WA 1FDIA 1O3YA 2WMNB 1ISIA 2YIMA 1EYZA 2YC2C 3WIOA 4E4TA 3FSGA 3H2GA 4RORA 1PWYE 2OCGA 1ENZA 3CLHA 4ITRC 2VQ6A 2J9FA 3HXOA 4CR8A 1FL9A 1I1QB 4IJVA 4D8XA 1T0IA 4ASUD 3D3QA 1CQIA 3H2IA 3ITDA 3ETCA 1TXGA 1UXIA 3HJCA 5KNBD 4D5EA 2VNSA 5ECWA 2R8ZA 3D8NA 3G1WA 1E6WA 3DULA 3MWEA 2PZLA 1T43A 3SYLA 2CEAA 3NU1A 2BR4A 3QVTA 1S4MA 3WJ1A 5FWYB 4KRFA 4EIWA 1CRPA 3BUSA 1KZYC 1L7XA 2BGKA 3GLIA 1LW6E 1PT6A 2VYVA 1NQWA 3G0IA 4JL8A 1VE9A 3WYGA 5F7ZA 2Z1DA 2YVUA 3K20A 1NSYA 2HF8A 1V47A 2QRMA 4W1SA 4C22A 4EY5A 4REOA 1P1KA 3CM0A 4U5QA 1EXVA 1W52X 1TKCA 3ZCSA 3UUEA 4CIVA 1YZQA 5ALEA 3RUEA 2GAIA 2Q5EA 4B7AA 1XCJA 3II6X 4TQ9A 2ACKA 4ZO6A 1IQUA 3DGEC 1H94A 1V7PC 4M87A 2SKEA 2L19A 3PUIA 1SBTA 2WHXA 5F7JA 2FKAA 4G81A 1PJ2A 4BDTA 4FOTA 3ZU2A 1EIZA 4LE2A 3D0RA 4FYXA 5AW1A 3UG7A 3VC2A 4URXR 4Q7QA 4EI7A 1AQYA 2P0AA 4EW1A 1Q20A 3RLIA 4BJ5A 1YQQA 3ONVA 4IRXA 3NEYA 3AVYA 3BQNB 4IXDA 5K2MA 5A3VA 2ZYSA 3N2KA 4URFA 3PI6A 4JHLA 5E8JA 2EFCB 1OD6A 3LLUA 1ZGJA 3LXMA 3BTSA 2GPNA 4RK7A 3NWOA 3TLAA 4JMPA 3QY0A 4PO1A 2DWPA 1D9ZA 4JYZA 1GGEA 3T3EA 2AQKA 4CKZA 2CBZA 4QYWA 4RMHA 3PSAA 4HRAA 5KJCA 4XIFA 1IJFA 3CV3A 3N7AA 1XRRA 3QXHA 521PA 2JLZA 4JLNA 4BO7A 2ORVA 1LQTA 3L1JA 3UAWA 3UC9A 1A9XA 1FBTA 1N1EA 2WF5A 2JCVA 3C16C 1TYAE 3OUZA 3OE7D 4W7IA 5AH0A 3RW9A 1E92A 1JLRA 1Z6QA 2JJ2A 4UU0A 1GV1A 4ACAA 4JOQA 2H48A 2NN3C 3KOYA 1PNVA 4UZFA 2C84A 4WWHA 2A9PA 2J8ZA 4YCDA 1QYVA 2BFBA 3NTQA 1YQGA 2AN1A 3RFFA 3C6KA 2AFHA 4C89A 5K0TA 4N0PA 2GZAA 2OP0A 4QYIA 4MW2A 2XHZA 3RGWS 5LWHA 1CULC 2JRCA 1JFVA 2GEDA 3A6JA 3FUUA 1KEEB 4UM7A 2AJTA 2X5NA 1W0CA 3EY4A 4Q05A 2HTEA 5CK5A 5B1SA 2HWKA 4UZSA 4DJJA 3NOQA 1PIWA 3MGCA 2W6ID 5EQFA 2XLBA 3P2EA 4YUYA 2XUKA 5LP6B 2BGTA 3B20A 4JQOA 2BVNA 5EIAA 4B9AA 4CN8A 4E5SA 4GU5A 1KMIY 4Q24A 3VKGA 3RT7A 1N2IA 5ITVA 1GO2A 3N0RA 2GBPA 3PP8A 5KYWA 4B33A 2H00A 2WKQA 3I9MA 3V4LA 2YKGA 4OMFG 4EMSA 2W2TA 2NU7B 3W5IA 1YA4A 2FWIA 4FJ1A 4B2LA 2ZUSA 1ZGHA 4RLFA 5G4KA 1THGA 3SMQA 1XCPA 2E89A 3FYUC 5FWXA 4YYZA 2AZ4A 4DCNA 4FI3C 1J42A 1WPRA 4GSKA 4CG1A 1PJQA 3MOGA 1OLXA 5A3SA 1MV8A 4CEIA 1CZUA 3H5WA 1HQYE 2QX6A 1A9QA 3I62A 1K5PA 4U6QA 2XCOA 1U8TA 2DT8A 3GLQA 3LPMA 1WY5A 2GZSA 1EXNA 1X1AA 3AR2A 3DWEX 4JJEA 2VDJA 3RJMA 3TLKA 1FFWA 1ZIXA 3LT2A 3VUFA 2EW8A 2Z9BA 3JYNA 4Y2QA 5BW4A 1BE1A 1UBTS 3E18A 4XQCA 4MGKR 4OHKA 4RANA 5TF4A 3RRYA 4HLCA 4ITUA 1HEIA 3GO4A 1MA0A 1IJKA 1T4CB 5I45A 1NVVR 4L5BA 4QARA 4GI3A 3U5TA 2B5OA 2IRWA 1U8EA 3C5EA 5JSFA 4UMFA 1Z4OA 1XXHB 3D6AA 4PQYA 2QE6A 3LBFA 1ST2A 1PG2A 4HRYA 1QVZA 4RZSA 2I4LA 4TWZA 1QRDA 3L49A 3LC0A 2WKRA 3T5CA 5EUBA 1RXIA 1PGPA 1TD9A 3AYXB 1Q5PA 3SF0A 4EYOA 2YQ4A 3CKLA 3LBHA 4I1YA 1ZINA 2GXUA 4P9NA 4DNXA 2FDXA 5SYAA 3IDOA 5K8UA 3JD1A 3TIIA 5DSZA 1EK0A 2EZ4A 2E49A 5CNJA 5K0FA 3FPGA 1IJEA 2GZ1A 4LJ4A 4S1PA 1O58A 1NBOA 3TRKA 2I91A 4XB1A 5TX7A 4IOMA 2D0IA 5CCDA 4UNQA 2V7GA 3DOFA 4EECA 2Q2OA 4RQBA 3RTCA 2GYWA 3PF8A 3K4PA 4MINA 2BMJA 4IO1A 5KYTA 2BGRA 4CM8A 3AIIA 3DCNA 4ZZ2A 4MUAA 2Z09A 4MVCA 1AURA 2VP2A 5H59A 3TQRA 4TMWA 5BSVA 3DFKA 4EJSB 3WGKA 3F90A 2H11A 2RGYA 4B4UA 2CXUA 1CEEA 2JH9A 4OK6A 4OBXA 4FDAA 4IJWA 1Z0ZA 4R1SA 2BEUB 1DG3A 3K9GA 3EMOA 1JHYA 2B6NA 2PSJA 2B21A 4YPVA 5E7MA 2HO4A 5FQOA 2IU0A 5IT0A 2HHAA 4U7JA 2Q3MA 3GYBA 4R1LA 1JJBA 5LBIA 2DHDA 1FTGA 2M6LA 5IRCD 4J3JA 3OD1A 4IGAA 3U4DA 4Q16A 1XTTA 2JA2A 4KBGA 2X42A 2R48A 2WEKA 1OAKA 3NAGA 1O95C 4LY3A 5H7XA 4XR4A 3T4EA 3JQGB 3ZK8A 2AN3A 5EHQA 2YY6A 1II8B 4KSYA 1Y3AA 4Z8XA 3WK6A 4JIMA 1OJLA 1T3GA 1ZVKA 3FHLA 4KR9A 5I8WA 2DB3A 5ESXA 4TX1A 3T54A 5BRJA 2ZZNA 1B6GA 4YRGA 1S1MA 1P9NA 1AXGA 1X74A 3O4JA 1JHMA 2ZYDA 3ZX4A 3NPMA 2RBKA 1BFKA 4AY5A 3A26A 1YI0A 5FI0B 4KJXA 1Q7EA 2A5LA 3INYA 3RABA 2QEQA 2RONA 1UXKA 2H07A 3E0XA 2IYRA 4H27A 3ZQ4A 5P8WA 4A2WA 5HJ5A 4NULA 5CLGA 3V4RA 2X8AA 1BKYA 2P90A 3EEFA 3ENQA 5EYPB 3RYHA 1R15A 1CNFA 1QKIA 2XCUA 2YN4A 4UUQA 5KTMA 3GJRA 4JT2A 1CX9B 3OD5A 1O94C 3M4JA 3K9QO 3EVFA 2BFEB 5I5GA 3KK0A 2IQ5A 4JMLA 3GFTA 3K9BA 2J5BA 3K71B 3D1VA 4CQMD 5I8ZA 4U2GA 5E0OA 4WXYB 1QP8A 2E9SA 3B1XA 1U7UA 2W48A 5BV2P 4RTNA 1EDZA 5GWXA 5CB8A 3WLQA 4CG2A 5SZKB 1WAMA 1X7WB 2GCIA 3K4HA 3Q9LA 2H6EA 4X60A 2G7ZA 2X3FA 4RKWA 3OM8A 3FNFA 2AKEA 5H83A 2PGNA 2IOQA 2X4IA 4N3GA 3G02A 4G67A 2QM7A 4QGAA 3AZOA 2C2MA 3KQKA 4QFDA 4P92A 4BRZA 4JC5A 4QGGA 4QJ5A 4F4FA 1U1EA 3Q1KA 1GPAA 1R0ZA 4NYMQ 1HTWA 4DV3B 2B98A 3BWDD 3GBVA 4AZ3A 2CXXA 2XH8A 1KVQA 1LBQA 1K1EA 3GEDA 1JFSA 1DO8A 2P2GA 3IAEA 4OJTA 2EJUA 4J9UE 5JRDS 1NF2A 1SQGA 4K3UA 5I7FA 4IRUB 4OFBA 4Z7NB 4QO8A 3GLIB 1OXBB 4UVGA 2AI1A 4D4HA 4YJHA 3V2GA 1V4BA 2R47A 1A8PA 1MFPA 2RCYA 1W4ZA 1HYGA 2D59A 2ZIAA 4MW0A 3OFVA 4J7UA 4UM9D 3U16A 5FOUA 2ZSUA 4BPBA 5IF9A 2DJ5A 4HOYA 5IU6A 4IUBS 3ECAA 2XEXA 2WF9A 1PL7A 1K8QA 3HUTA 2JLRA 2QAJA 1RAGA 3BERA 5DNDA 4ZT4A 2CLKB 4XIIA 1BDJA 4Y6LA 2Z0MA 3F6RA 4HEA1 3QBTA 4FIZA 3U26A 4EZEA 3SVTA 4QHSA 2DTEA 2HPVA 3DDZX 1NOIA 4L8LA 4UHDA 4P7BA 4S1VA 3AEUA 5IZCC 1H2FA 1X1BA 4WKCA 1F6BA 1LPSA 1NR1A 4LY6A 1ATIA 3Q6NA 4RD2A 4XM0A 5CNIA 1LPNA 4DWOA 3N07A 5C32A 3E9EA 4JIGA 1BQ3A 4MWOA 5JXWA 1E79A 3DVAB 3CRQA 3N2KB 4A9AA 4UVHA 3EF1A 2Q4RA 3HA7A 5KOJA 1V96A 3H1TA 3H9UA 3G0GA 3FOZA 4G36A 2PKXA 1D0SA 3FJYA 2OB1A 4K9NA 1KC3A 3HDHA 5E38A 3QOXA 3SF8A 4WFJA 5H4GA 3O92A 3GUUA 4Q19A 3OEHD 5IBCA 2PYIA 2J3DA 2VJAA 3SS9X 3SE0A 1SQ6A 1OQAA 1ODJA 1HOXA 1OYYA 1P31A 1PV4A 1GCAA 4CM4A 1QR2A 1OC2A 2I1QA 2QQEA 3BIXA 4G25A 2IBMA 4BKRA 1VHTA 4CIAA 1P5RA 4CM3A 4L8YA 3TQFA 3REOA 3S8EA 2CE2X 5JOQA 2JIMA 3ZY2A 1R5JA 1K86A 4JT9A 3I04M 2QTRA 4DG8A 3ZDCA 1I7LA 1C7EA 1XZPA 5ENDA 3FGNA 4TRNA 2Z43A 2D74A 2AFHB 2ZAIA 1UEJA 3VHXA 4QYIB 5CA1A 2VHQA 3KJFA 5AVYA 3HWSA 3MJTA 4OQZA 3C8DA 4HT3B 3Q88A 3LOQA 2CJWB 1VCHA 2VYND 1E3TA 4NBLA 1L4FA 1TPZA 1YFKA 2PVPA 2QP9X 3MHPA 3P45A 3NIDB 1L1FA 3RSQA 2R8BA 5A9TA 3KLPX 4H7DA 3GLFE 5T8KC 5HUJA 3K5HA 3A1VA 3LLCA 2BJHA 5JATA 4NYIQ 4RD0A 1I6WA 2GT1A 2HO5A 4FYIA 2J32A 4UQLA 2Q1WA 3QVUA 2AUTA 4E30A 1NBEA 2A56A 2GJSA 3HCDA 5D2CA 3OEWA 2YFQA 4ALNA 5KYWB 1RYYA 2VNJA 3O4GA 4XWAA 2I6UA 3DC2A 3EFBA 3G13A 3HS3A 1Q7TA 5H82A 2PT6A 1A69A 2YYYA 2X5XA 4M0FA 4JLPA 5FWXB 5MN4A 4IIXA 1D2AA 3TPFA 4QNMA 3UJ8A 4ECAA 3HSSA 2ID8A 4D74A 3ZXYA 2GM4A 1Y9JA 2XT0A 3HWRA 4OQMA 1OLXB 2Q62A 1NU6A 2VXCA 4ND1A 4YGYA 1LSJA 3R0JA 4ZHQA 2D8AA 3Q3IA 1ZFNA 1JG6A 2XZDA 2NTNA 2Q0HA 4KWIA 2Z4TA 4IZIA 5AHKA 1P74A 2V7QD 4LTMA 2B83A 4DCCA 3EXAA 3ZQ6A 5BV0A 3D3KA 1W59A 3D7LA 3FD8A 2VYFA 3I4FA 4A23A 3ZD8A 3N70A 3BAFA 4YN3A 1BZYA 1DC5A 3MLBA 3T06B 4C6RA 2AIRA 4S3MA 3W9SA 1QTRA 3KQLA 5TQ2A 2ICAA 5IYZB 3KE9A 4MB0A 4NHEA 4MULA 3HZOA 4RHTA 2ZBRA 1JBKA 1ZO8A 2HWWA 1QTNA 3MBKA 4H59A 3S1AB 5B2EA 1EGQA 2UYGA 4X24A 3PD1A 5LR6A 5AFSA 5KDDA 1UBEA 2W2LD 4XQ0A 4Q1CA 1WSWA 3C43A 1OILA 5HQJA 5GP1A 4J7CA 2GBGA 1E1RD 3CR7A 3RHZA 3DEHA 1N0IA 1VE3A 4MRAA 2YMMA 2WKPA 1T5OA 1T5DX 2PH5A 2BT4A 2WY2D 1FRQA 3WWEA 4B09A 2BGIA 4YP5A 1GG2A 1RAEA 4U7GA 5TR9A 3A6ZA 1PZXA 3KKEA 4Y9UA 1PRYA 1T2VA 2G06A 3RS7A 3CN9A 3BK7A 4MGYR 1G9TA 4UZEA 5H4HA 2FG5A 3TFQA 3DAPA 4N76A 1XZFA 1IY0A 3P4UA 5AKEA 3KOWA 1ZD4A 5HEKA 2CXHA 3HBAA 1RWMA 1VKOA 3EWNA 4L95C 4LHXA 3RO7A 4WW0A 4B81A 1K63A 3C8MA 4MUMA 3WLEA 1O4WA 4ALMA 3AQIA 3DNMA 4Q9NA 2VEOA 1T8UA 3EZFA 5CFRA 3BL6A 3H83A 3R0VA 1MEEA 3EIHA 4MLZA 5IAKA 4CM8B 4EG0A 4QUEA 1PT7A 4OAPA 4ZXPA 3B1YA 3CLUD 2FU5C 3OCCA 2F1RA 4NOJA 5CFNA 3IQIX 4ZZIA 1TT7A 2P77A 2WJYA 2G4LA 1CZLA 5BUSA 4KLNA 1WKBA 2R85A 3MIZA 4GOOD 4W6QA 2UV8A 3H65A 3HADA 3NHAA 2N9UA 5FAKA 1OAOC 3I45A 4U9UA 1TUIA 2Q2QA 1JIKA 1SBCA 3M82A 3SBEA 3BILA 4OHWA 1B2LA 3A0UA 1QB7A 3OETA 1FXWF 3WJ7A 1L3IA 2OCYC 2RHBA 4PR3A 3CBGA 3T1TA 1ZBDA 2GBLA 3L1HA 4JLSA 3RRNA 4DIUA 4ZEMA 3FCYA 4BZWA 3V6LA 4DCJA 5DHAA 1X7XB 2Q27A 5ITWA 1P72A 1IB6A 1AUPA 1Y8QA 4P84A 2V7VA 4WKNA 2C58A 4Y2JA 1VCNA 3WY9A 2OWEA 5AW8A 1LDNA 2A53A 2XTZA 1DVRA 4FE4A 4IW3B 4N5LA 3ZCPA 2PL1A 1DPGA 5SYNA 3AUTA 2VK1A 4PXYA 5F9MA 4AURA 1FNNA 2GXSA 2PEZA 4FEEA 4JHXA 5B2ZA 4EG5A 3QPVA 2NYRA 2XYQA 1SCKA 3SKYA 4KNYA 2BKUA 2HIMA 3BMCA 1PT9A 4JLBA 3T99A 3RSCA 3LAWA 3D5TA 5IS2A 4DB2A 2JC3A 4JX8A 4IIGA 4JC8A 1KIFA 5LOVF 1KI9A 1KJNA 3OY7A 1A5AB 2F64A 4PPYA 4RPGA 3EB9A 3RYHB 1W30A 3AU8A 4UM5A 4HVLA 3B9PA 1TADA 3A6HA 4W1QA 3I2FA 3ZWMA 4OM8A 3UOWA 4A03A 1SBYA 2C5EA 3KEQA 4X0EA 5D5HA 4F38A 1VHDA 1KI8A 2H1HA 5FI1B 4OCZA 2XNDA 2G4VA 3R7NA 1SVWA 1UK9A 2H4XA 2CHUA 3L0OA 1YT5A 1UMBA 1G8SA 1EGVB 1QQ6A 4W4TA 1NMXA 5DIZA 3ZZTA 1G0NA 3NHPA 2ZYRA 4B79A 4Y0NA 4YRQA 3B12A 2B7CA 3H5IA 1NJFA 4E2FA 2BR5A 4YT2A 3IUPA 4EVRA 3NI2A 2VSNA 3BWCA 3KTAA 3N2YA 4ZO8A 4BFXA 1Z6TA 2LUOA 3A04A 1RI2A 4RK1A 1L0BA 4BJ6A 3DBHA 3NTXA 4CN9A 4HB4A 3O95A 3R7BA 4C7OA 1QVVA 4Z86A 5K51A 2GVZC 1ZOPA 1DBVO 3IXQA 5ENZA 4D79A 4WADA 2FJUA 3UUGA 3IB6A 3LZ6A 4J0JA 3CLVA 3EIEA 2W71A 1G42A 5K4GA 2Z6QA 2IKSA 3AUSA 2HOQA 5KQGA 3WKEA 1N78A 2GR8A 1M8KA 4KDRA 4NK4A 4OREX 4AZ3B 3K73O 1FSZA 1BVHA 4DCGA 4QU0A 4EX7A 2Y99A 2A9OA 1Q1EA 2Q8NA 4WLFA 2JFWA 3HFRA 1ZNQO 4TS4A 4GOND 3JYQA 3LF2A 1QVWA 1E1YA 1T4GA 3G5MA 3PJEA 1BHSA 4JR0A 3EVTA 4H3KB 1WSAA 3AKYA 3C7DB 3ITNA 2QTMA 4D9JA 1JEYA 3M89A 4RDHA 3TTXA 3RRBA 3FPCA 2CFTA 3U49A 3P9YA 2B2NA 3QVOA 2A58A 2EERA 1AMNA 1VG1A 4BNDB 4J3FA 2QD4A 3JQQA 1FP7A 3HRHA 4HSGA 5DZSA 3MRSA 4PSCA 1QAMA 2ODAA 3WDMA 1RQ7A 2XKAA 4QXRA 4TZKA 1FOEB 3DKVA 5AK3A 4DMLA 3N3BC 4WA8A 2UXBB 4I3GA 4DJDC 4GM1A 4KR2A 1MQ9A 1XRPA 3ONFA 3AEUB 4MW5A 3MJEA 4ZRDA 4G0NA 3NRJA 6LDHA 5KQMA 1ODCA 1X9IA 1E4YA 2IYEA 2QUAA 1ORIA 3RARA 3TJRA 4N7RA 2AUNA 1GUZA 3AF6A 4HH1A 1RKBA 3KU4A 2BI8A 4BFUA 1Y80A 3BBLA 4AROA 2JI7A 2ZTSA 1VMDA 3IAFA 4DMUB 4R1PA 5CT8A 1Y6FA 4J1NA 1IHUA 1QAQA 1WU7A 1C0KA 1T0JB 1VIVA 3MG9A 5AK0A 4PRZA 1HG0A 8AT1A 3NHJA 1MH1A 3RS9A 4AM8A 3SF8B 5D7BA 2WKSA 2I4IA 2C7GA 3LQ4A 1JKJA 2J3KA 5K3FA 4EABA 3EFOA 3RTBA 1JVSA 5JJKA 2JFOA 2C3MA 4XYBA 5NLLA 1JT2A 3EBPA 1NQUA 2X6RA 5ADVA 5D3QA 3HKDA 5TVKA 5FXMA 3GGOA 1O03A 1IZ8A 4NL4H 3PL5A 4DLNA 4N41A 2XE6A 1U5BA 2GLUA 3X1KA 3CURA 4UFNA 3OWHA 2PWPA 2XTJA 1FSPA 5IBRA 2DMRA 1JQDA 5AI8A 1B15A 1L7OA 4ZVQA 2VHEA 3Q0IA 4OXQA 2QQ0A 3FPEA 3SX2A 1NDHA 3VHXB 4IFBA 5CA1B 2V3WA 2IX9A 4QXAA 1NAHA 1QIDA 2AA3A 3CVOA 2IELA 1VECA 3DL4A 5FJIA 5HUHA 2XOKD 2E5FA 4WKBA 4TSKA 1VJDA 3L04A 3HMKA 2YNMD 3EIQA 3PGLA 4D3DA 1HH4A 1EM8A 1NF3A 1PAUA 4ZCLA 1QGAA 5AM4A 2RHWA 1ZJJA 1TL7C 3FPBA 1U1DA 5E3HA 3PIIA 3Q5EA 4GOJA 5J2TF 4PLPA 4YUAA 1EHCA 3UV7A 1J07A 4G07A 3VH1A 2EW2A 1Z8DA 5LC1A 1Y4ZA 5FNVA 3T3MB 4C43A 5HNKA 3RADC 4R54A 1JTVA 1QK4A 5HCNA 2CC2A 2CHEA 4BJ1A 1SXQA 2FLKA 3HCNA 4R2XA 1BKSB 1KBQA 3HN6A 3OECA 3U19A 4DT1A 1XDZA 2FLVA 1UP4A 5COAA 2PD4A 1I3OA 1POXA 3BN3A 2C83A 4ZHQB 1JMKC 2X2OA 4IZOA 1XTJA 3WXBA 4AJEA 5DASA 3NHLA 4W8GA 5LBTA 3HABA 1MD9A 1L4GA 1QO7A 2P9BA 1K66A 1L5KA 1SUAA 1G7TA 3GU3A 1NR7A 3KNZA 4MVJE 2HMWA 1SKMA 4MDYA 4NFLA 2XDYA 5CX1A 4FNGA 1C7RA 5I3ZA 4XW2A 1EJ0A 1KAGA 4CKCA 2VP3A 3KTFA 1PZEA 4HN9A 5TQ2B 4DUGD 1WCXA 5BN1A 3PUVA 2ZI4A 3AP2A 5CYFA 2IW1A 1GZ6A 5I9TA 4XVHA 2XKBA 1ABBA 3T6KA 5ALUA 4JBWA 1PW5A 1WUIS 1RQNA 1KKUA 2X0FA 1W87A 2BGWA 4RM3A 1R0KA 1XTQA 2YH2A 3QYFA 5KS2A 3C8UA 2L2QA 2VHCA 4NICA 4YLYA 1OKKD 2ETVA 2PFGA 3BRWD 4R3WA 3IKVA 1LTKA 5ELLA 1W5TA 2CUZA 3K70C 2OKCA 4IV5A 3ZWCA 2QMZA 2PRZA 1TIBA 1ZDMA 1NSTA 3QKIA 1CJTC 3ANNA 5KMGA 4BO6A 1DKOA 2BLNA 2J7KA 1DWOA 5CDUA 1GVHA 2VP4A 4BMXA 4A26A 1WR8A 1Y1SA 3VYTB 3G2HA 3NTOA 5EMHA 4GE0A 5DM1A 1XDUA 7MHTA 3BXFA 3KLBA 4QU8A 3Q6MA 4L50A 1F8FA 1DRUA 4EFKA 2FZVA 2R62A 1DAHA 3NUGA 5L3ZA 3KQPA 3ISTA 1RAAA 2PL9A 1JQBA 4GP7A 3F8SA 3RTDA 4ZAXA 4HQFA 4KACA 3FOWA 4NYJQ 4ZVPA 1OUMA 4DCSA 3IEPA 3IR5A 4L6CA 3TW6A 4GM4A 4XIGS 3EE6A 2JGDA 2DPYA 3P4XA 1FU8A 1ORTA 3FUTA 4MWDA 5EXEA 1ECFA 3FSGD 4Q4HA 4BUZA 3F7TA 4R1NA 1VSVA 3C6MA 5L3VA 1I2CA 7AT1A 5K05A 5EE5B 4H1HA 4EX6A 1UDBA 2NPFA 4J29A 2FQYA 2JK1A 1KK3A 1UIMA 2GLTA 2JGAA 3CY6A 1GA1A 3EPPA 4LJ6A 5FULA 3RC7A 4GPAA 2B0CA 1EP9A 3ZD9A 3RF7A 4CU5A 4EFNA 1PVVA 5DMXA 1N92A 3V1NA 2J5QA 3AUYA 3CU5A 4UHBA 1C9EA 1GRCA 2ZIUB 2QL5A 4JLWA 4FN4A 3FCUB 1V9LA 2H7XA 4FBMA 3U13A 4HGQA 4CDMA 4D8UA 1QWOA 3GAZA 4WACA 4L0MA 2O7QA 1G8YA 4ZYYA 3J7TA 3G0HA 3UA3A 2VYVD 2VKQA 1YBFA 3ELYA 3R3JA 4IYJA 3AVPA 3SQOA 1KEKA 1XZHA 1Y8QB 1NW8A 2HF2A 3L6UA 1PYGA 1NKTA 4DQDA 3T5TA 1RYNA 2AFIA 2XMSA 4M38A 1X15A 2BMAA 2RHHA 4I66A 1TYDE 5ECYA 3WQRA 1P3JA 1L5HB 1JSZA 1XHFA 2NT3A 3OBBA 4AN1A 4OQNA 3A11A 4MP3A 1NL3A 3M1AA 4EPYA 5KOHA 4HS9A 1DAOA 1UF9A 1C9YA 4HWKA 3U3KA 3BMCB 3IE1A 3WGZA 1OA1A 1S2MA 2FN9A 1RIFA 1MP0A 4QBIA 4U2DA 3CUTA 4N3AA 2PG3A 1CKEA 1BJTA 2DHRA 2UVQA 4G1FA 1RLOA 3OZEA 1GAWA 4O3MA 1XZJA 4B7ZA 3ISVA 1URPA 3QOWA 2BFCA 3SYMA 4I5IA 4KO3S 4J94A 1IQRA 3TLZA 4H0FA 3O3CA 2JFXA 2G28A 5I7WA 4GMFA 1PWHA 1V7CA 1GFWA 3WYAA 2PKCA 1LBTA 1TJ4A 1UMBB 2Z6UA 4TZ6A 2WVAA 4CMAA 3DB2A 3K0CA 4I1IA 2WTUA 2CYBA 2AN5A 4PFSA 1L8AA 2Q5QA 3AHJA 3CA8A 5D1NA 1K8RA 3DB1A 3OSZA 4XTCS 3RK4A 1QIHA 5AM5A 4B3BA 4CR7A 1Y9ZA 3C3AA 3Q7EA 2VJBA 1H1DA 4IMPA 3OJWA 1TM1E 1SIOA 3DBHB 3QI2A 4DLWA 5BN3A 1NZDA 1IM2A 3SQLA 3QV1A 1JR3A 3DWFA 4C7OB 3ZNPA 3DAOA 5KHAA 2IF0A 1PS0A 3NBQA 2X6QA 3HDYA 3UMYA 4EA6A 1PUIA 5JRJA 2O8EA 1GNPA 2PUAA 1BX1A 1NFQA 4A15A 4YCSA 1Y81A 2AQ8A 4JVLA 1GL6A 3AUXA 5LN1A 4DYVA 3WR5A 3ST7A 1J2UA 5KNCA 2CY0A 1KKLA 4TMYA 1T2DA 1DJNA 4M54A 4P5EA 4BMVA 2C4VA 3KL4A 1HMYA 4G0ZA 4YUZA 4M46A 1NF9A 1MENA 4QJIA 3RS4A 4EATA 5GONF 4QRIA 4B7UA 1IZYA 3DDCA 1HY3A 1MU0A 3JS5A 4O4JF 4UVIA 4RCZA 3EC2A 3OQIA 3GLGE 2WUWE 3LT0A 1ZD2P 1JEYB 2OQ2A 4Y9RA 4F2GA 1DCTA 4CF5A 1RXWA 4C7VA 5DI9A 3QA9A 4G5XA 3TGPA 4L57A 2JFQA 2PLNA 4G5SA 1N7GA 4CR6A 1U7OA 2H5LA 2JDIA 2AK2A 1A9SA 5K6AC 3AIMA 3PC2A 1HTBA 3K53A 3MELA 4P0TA 4QRDA 2BR3A 2II6A 4GOKA 1GYPA 4E31A 2C2HA 3EGXA 3TM5A 4FHDA 4RK6A 1V7ZA 3A70A 3BJEA 1IUKA 2JJMA 4TV8A 2WIKA 4AG6A 3PT9A 4D42A 2ZYHA 3ANXA 3MS2A 4EUHA 3PQ5A 2PPLA 1QCYA 1DKUA 1M0TA 2VP6A 3A9RA 3BRCA 3HNOA 1EH5A 5ALJA 1L8XA 2ZROA 4FSDA 1ZOIA 2IPXA 3TLMA 3JWHA 3WLOA 3NKLA 1NG1A 1OOEA 3BMOB 2RHGB 3AJDA 3HI6A 4NJOA 4KZPA 3TX2A 4V39A 4CI9A 3GEGA 3FNQA 5K3AA 5IT4A 1JDSA 1FUYB 4Z49A 1LTHR 2QJTA 4E21A 2ADOA 3KE8A 2AMVA 3IMFA 3Q6IA 1NXQA 1A76A 2UU9B 2RARA 4D3FA 4IZHA 4QJ3A 1DAIA 1EBBA 1JHXA 1Q50A 3KOUA 1P1RA 4RZQA 4YH1A 4MV9A 1SOWA 1G55A 2A1TS 3IH5A 5K3FB 2MR6A 2YINC 1P9LA 2OAP1 2W22A 4HFMA 4AD8A 2BH9A 2NV6A 3IMGA 1P8JA 3NXSA 4XWYA 3U3RA 1QQ7A 2WF7A 3HKDB 3GFBA 4ZOLA 4I08A 3RSOA 5LUBA 2C5AA 1IQ0A 2BWJA 1XEFA 1U5BB 1VP9A 1L7RA 4I3FA 1JFLA 1KH2A 1YIDA 2G6BA 4ZODA 3PCRB 1VKHA 3AHHA 4L02A 4YT8A 1BN6A 4BWYA 4XI9A 4PVDA 4M76B 3I6BA 2Z5GA 4OB8A 2MYTA 4KQHA 1G4HA 2EJVA 5EKTA 4IAOA 3TUZC 1IBMB 1USIA 1AGNA 2PO5A 3QVSA 2ZWOA 4QHYA 1D8TA 1DDOA 5K0JA 2WWXA 1NMYA 1P62B 4NBUA 4PRKA 3B6MA 3DV2A 5LLSA 3JAMA 1EM8B 3U7FB 3AT1A 4ID9A 4IFEA 1I36A 3L7OA 3DEKA 1DUVG 4HP8A 2Z57A 4MQMA 2LGJA 4GR5A 5EIEA 1KI3A 5EEGA 3BDVA 4XUCA 3JWJA 3AHEA 4RL6A 3OZCA 1BXRA 1UBMS 3F6EX 5KQLA 5FNVB 3RSSA 1MNQA 4PPNA 3GBSA 3WQSB 4C0BA 3HHPA 2JF0A 1HL3A 3QWAA 4LF4B 2J5XA 1HFJA 2ZBUA 1ZD3A 3MD0A 1MXFA 1U7PA 1BWPA 3D3JA 4G5GA 3CLTD 4WT7A 4EA7A 4YCLA 4DT1B 5TMPA 4MH0R 1FDTA 2X2FA 2OAEA 3ABSB 5DKFA 1E2GA 2SCUA 4EHBA 1GCOA 3ICCA 2NO1A 2PGIA 3OZFA 1N2XA 3R7LA 1G21E 3DV0A 4DIOA 1C3OA 2IUYA 1JG7A 2I5PO 3CHYA 4C30A 1H4TA 2VUTA 3JD0A 4LUCA 5DX1A 4ZYVA 1ISFA 3SJ7A 1P0QA 4GKJB 3RSHA 1U81A 3B8HA 3TN7A 4ENUA 3V7NA 4I2NA 2PWYA 4DLYA 4LYEA 4CMHA 2QLBA 1F6WA 5CX1B 3QENA 4V0ME 1RHJA 1QIFA 3FSJX 1KEVA 4LF5B 2O2JA 1JIUA 3HXKA 1N4AA 4F8YA 4CKCB 4RLQA 1HLGA 3EYAA 3O82A 4R8SA 2A0FA 5B3AA 4PFJA 5B36A 5CVCA 1K8YB 2A8YA 1PJBA 3H4MA 1NXTA 2LBPA 4KKXB 4N5IX 3VC1A 2QI9C 4WKGA 1T8WA 4BLPA 4BNKA 3L40A 3UAZA 3KQTA 4Q3EA 2AZMA 4BVHA 1CY1A 5KU1A 4PNEA 3C5CA 2RH4A 3PQ7A 4OQPA 4X85A 5ICFA 2P2YA 1NYLA 2I52A 5DWQA 1BJRE 1ZGZA 1NUTA 4DMGA 5K01A 3BWYA 1CERA 3T7CA 3EIXA 4YPOA 5A04A 5CMLA 1ZG3A 5CEEA 3GRFA 1EFVA 5A4DA 3DO5A 3UMCA 1D2RA 2X0JA 3D7KA 3KZCA 2PT9A 4D3XA 3VU0A 1E5VA 3K2EA 5A4FS 5A4MS 5KMGB 4LOIA 1IMJA 3H11A 3LUFA 2VTEA 2MSDB 5ESDA 2BELA 4WZBB 1A9PA 4OQXA 1JDJA 4MZDA 2POQX 2V03A 4JQSA 2AOUA 4AFNA 2AXEA 4QPJC 4AQDA 1VIYA 3EHDA 5H3LA 1XUOA 1N2CA 3N2ZB 1YQWA 3PU6A 4YAJA 1YRWA 4CKBA 3BL8A 2D7DA 1IXYA 3HO6A 4M7RA 2A5GA 4YMWA 5BOVA 4F2WA 3GDGA 3LA8A 3NT2A 4DE5A 1A5ZA 3W7BA 2V7PA 3KEMA 4GPBA 1A77A 1JPJA 1NVDA 1TZKA 1WXHA 3FE2A 4PYMA 1KOJA 5JADA 4R8VA 2FZCA 1GEGA 3EX7C 2YOHA 2FJPA 2F1HA 2WTNA 3S5UA 1HDCA 1RLJA 3KWMA 4UBMA 4MR9A 1TU3A 4WECA 2IV7A 3OLVA 3NHSA 4ETIA 4II7A 1DFHA 1E2HA 2BF7A 3IP3A 4FXPA 4II3A 1E1NA 1SG9A 2B5WA 4GOXA 1CZOA 4V0SA 1TQ6A 3E3NA 1E6MA 3F5SA 4KXFB 1FTNA 1Q6YA 5KU7A 3LK7A 5JFGA 2WFLA 1QWSA 2FRDA 2IUEA 5AKJA 2FY8A 3CLRD 2A1TR 2HWYA 2JZOA 1J8DA 5LM3A 3W3AA 4BZZA 4ABTA 3P9PA 1VM6A 4JZYA 5DNCA 4I50F 2CMKA 4JOSA 5KOHB 1RKUA 1C0LA 2NNLD 3WL3A 4R16A 1F2TA 3U31A 1PYOA 1W581 3FGPA 5KKAA 2WD8A 2OD2A 3W2TA 5GZ1A 1OFGA 2QUZA 5GMOA 2IEBA 2OWDA 2BFFA 4HGZA 4IDNA 3W8EA 1T3SA 5JANA 1N2GA 4OXXA 3KQHA 1Z15A 1P1HA 3I61A 5A4KA 2A5YB 2IS4A 4J4TA 1U2DC 3CVYA 3PX7A 3VYSB 5JFOA 3QFHA 3RANA 2BFCB 2DKNA 3KD2A 3T7AA 3PVZA 2YUIA 5FOSA 1T26A 4PGFA 1XX6A 1E79D 1RHMA 3CXUA 3LCJA 1UFVA 3C24A 3IP9A 1AD2A 5T4FA 4YVFA 2AWOA 3CEHA 3R0ZA 1FSFA 4N7BA 1TFUA 3C3CA 4F11A 2EP7A 3RVBA 5F7XA 4F84A 3BREA 2YR0A 1G2PA 2ZJ4A 2EWVA 3MT7A 3RWBA 5EIBC 2R7AA 2WHRA 3MFYA 4Z2YA 4WDQA 4CIYA 4BO0A 1GGHA 1Q15A 4NCKA 2VIIA 5BN3B 3EK2A 1LS6A 3DQQA 1PNTA 4MUHA 1UUFA 1BQEA 4M8SA 3JARA 3IVRA 4A4DA 1RBQA 2H4YA 4DMKA 2WW8A 4BQPA 1XMXA 4C04A 2EHDA 2DHQA 3H18A 1LXCA 2O8EB 2R1ZA 1EVQA 1Z74A 3QBDA 1F0NA 4C0AC 3BIWA 4KDEA 4M7OA 1C7QA 4JFRA 2CL6X 3U7GA 2FF5A 5AW5A 1R3DA 4K86A 2I8AA 1P4SA 1JF8A 2NQ8A 3BVPA 4CMGA 3GJ6A 3W1WA 2W43A 3HGMA 3EDCA 4G56A 1HM5A 4L72A 4RIFA 1QSGA 3BBPA 1BMDA 1T1JA 3HVKA 3OQIB 2JANA 3H3FA 3K0KA 3VZRA 1OB5A 4KPUA 4DTIA 5JCJA 2H7VA 2X2PA 5G1NA 3S8MA 3ONEA 4EY4A 4LFBB 4FBLA 2GW4A 4RCVA 3VQTA 2DVMA 1JHQA 1R4AA 2VSOA 3CJTA 1UM9A 2JCYA 2MYPA 3I64A 1G8HA 1TM3E 1DTWA 6AT1A 3AUFA 5AM2A 2HK6A 3EGXB 2NO4A 5TIIA 2JAUA 2WUVA 3KJHA 1VRCA 3T5MA 4W9MC 3H86A 4ALJA 3W2IA 1XHLA 3CIOA 2PHZA 4YTEA 3B3AA 5TQJA 5LVAA 3AB3A 3MQ4A 4JK3A 1N9KA 1DUSA 2OCAA 2VOJA 4H18A 4TV8B 1WETA 1KO8A 1Y89A 2HYIC 2EXXA 2OB2A 2VF5X 1N25A 4PZDA 3TVTA 3E03A 3L0YA 3FHJA 5JW6A 1LQ2A 3A0RB 3I34X 1F9EA 3IFSA 3Q5DA 2BE9A 1Z7EA 4V2IA 3BDAA 2O4CA 4O2BF 2QA5A 3C2QA 4OJNA 2Q7OE 3WRYC 1J22A 1RNLA 1DEOA 2IZOA 2PIDA 2QW8A 2GPAA 2NUTA 4ZEXA 2I7VA 4AK9A 2R11A 3AEXA 4DDWA 5C1OA 4WLEA 3QQ5A 3OTWA 2E85A 2LW7A 6CHYA 2CHGA 1EK2A 3A1TA 3B3JA 3VX4A 1NASA 2XIJA 1GIAA 1EA5A 2DH5A 3CF4G 1UBLS 1MIOA 1K8XB 4BNFA 4O4HF 1ND5A 1YO6A 1QX3A 1U2EA 2V6MA 5WRFA 3WWDA 4U02A 1M3SA 1XAJA 3PLNA 5EPUA 4J76A 1F14A 1KMHA 2WUFA 2JLVA 1E89A 4ZOLB 1W47A 3NNNA 1NMEA 1QIIA 2OLJA 4N48A 1C3EA 1CY6A 3OZBA 3HBNA 2OO3A 2LZ0A 3PQFA 2WVHA 3CKKA 3LK6A 4C4RA 3MLAA 2ZB2A 2YHSA 2UUAB 2MT9A 4FSHA 1GKYA 4KGDA 3K0SA 4AYXA 2B92A 5HFNA 5JDCA 1O08A 3M8KA 1T8YA 4H7PA 5FLXA 2R6AA 3PEVA 5KVSA 2ZE5A 1CUVA 3NHFA 2OC4A 2PMWB 4GFDA 2JW5A 3MMXA 4KVZA 2C61A 2WWWA 2Q49A 1TZBA 3CPSA 3HDTA 4P4NA 3LVBA 4QBHA 1DTSA 4B74A 1W19A 3H9BA 5FV4A 1BXRB 4Z3DA 2NU8A 2GD6A 3JAKA 1N6KA 3WP0A 3AX6A 1VBKA 2HA4A 2G3YA 1U28A 4YRKA 5I9SA 1VRVA 4TWIA 4EHIA 1FP1D 3ADKA 4OEHA 2NUAA 1Y4AE 3R0IA 1H66A 2SCUB 2UUPA 4C05A 2K7ZA 1T15A 4DAEA 3QW4B 3ZWPA 1D2CA 3DV0B 4URHA 4I1PA 1N5MA 1G59A 1C3OB 3JD2A 3THOA 2X7XA 2IHNA 3RHSA 1N2SA 4ZU1X 3MSXA 3WK5A 3AFIA 4IIEA 2G5ZA 1MN6A 1ECJA 1QGDA 1UCFA 2GEJA 3PWSA 4J0QA 5TGZA 4PN7A 1YACA 1B7GO 1BAPA 4NMLA 2RK6A 1G2OA 2ZTVA 5JCOA 1V35A 5AW6A 3K0BA 2V0NA 4L5CA 1JLHA 4Q9DA 5F73A 4JP1A 5KAMA 4PCAA 5I7RA 1Q83A 4Z3OA 1G8FA 4WLUA 2PMCA 1Y5NA 2WJWA 4FD2A 4UQPA 3ZU5A 4B48A 3SY8A 3NEPX 4XFKA 2H31A 3OCWA 1MT3A 1YR3A 2QMYA 4QA9A 2E1RA 1U94A 4A8PA 5JQWA 1C4OA 2ZRFA 1ULUA 4NZYA 2X4DA 3DEYX 3ZK7A 5KX5A 2ACVA 1GNRA 4GT1A 4JR2A 4ER0A 1A9RA 1U8XX 4XCQA 4KUGA 2OPBA 3MQ2A 2GKSA 1KL7A 3R9WA 3IQWA 1Q57A 1QU3A 1OI3A 1HE2A 4N0DA 4TXNA 3W2FA 3O94A 4YI5A 2D2IA 1SN7A 3ACCA 3G5UA 2NVUB 3DLCA 2HPAA 3PICA 2QRZA 1Z12A 1M34A 1EFVB 1NU8A 2WC1A 5JWHA 5LIPA 1SG6A 4PR0A 4I19A 3BRQA 3FI9A 1J2EA 1ISPA 3A9TA 1WW2A 3KJIA 4OQQA 3H11B 3L46A 1KQFA 2XNDD 4KQ9A 3DL0A 5AM1A 3TOCA 4J0CA 3QVWA 4Q3LA 3AEKA 3CW2A 3L7AA 5FP0A 4RELA 3WNDA 3KV3O 1ES9A 5DH9A 1QUFA 4OK5A 4HZGA 2ZR7A 2XIQA 4HBGA 4K6HA 5DCUA 2AOUB 3LPLA 1FYFA 1ZN9A 2VZLA 3VNQA 4ATNA 2XPCA 1FU4A 1H1TA 3NBXX 2QP3A 1N2CB 1KI4A 1SXJA 4FB5A 2A57A 3RK1A 3SHWA 4DV0B 1WB6A 4LV5B 4CKBB 4C3VA 4EG6A 5FNZA 2FHSA 4TVOA 3IEUA 3O90A 3OAAA 4I9GA 4HAZA 3CH4B 1JT9A 5EE3A 5CNKA 2H9AA 5TEWA 3ED1A 1L9KA 3KPJA 4OOFA 5TQ0A 2EP8A 2OFPA 1GZDA 1ONPA 3W8NA 5JPDA 2OHIA 2H54A 3BSYA 4CV0A 2OY0A 5HGXA 2OZLA 4XPIA 1TAUA 3NZEA 4LTDA 3A58B 2PXCA 4J7XA 4K0RA 1NXVA 1TCAA 1DO0A 2D0PB 1KVUA 3HL0A 2GARA 1P61B 4WJKB 2Z2XA 1M2VA 3QMMA 4PICA 3CO5A 3RYCB 1AC5A 4AQ7A 4QG3A 1NY6A 1XK6A 2OCXA 5IJ0B 1YE8A 2PRKA 4TTTS 2WSBA 1N3LA 4RQAA 5TXGA 3EXIB 5FTNA 4MK4A 4DPMA 2WFLB 2ZU6A 3VU9A 3UIEA 2IX3A 1DRWA 1BO6A 3L1VA 4LZJA 1D5CA 3LWZA 2X2EA 4BRUA 3GB9A 1H3NA 2R00C 2XDQA 3PEFA 4J3NA 4XOUA 1SUCA 5KYYA 2EFEB 4M0EA 1JEAA 4MSUA 5DF1A 1EZ1A 2ATEA 4WFKA 3MYYA 3DS8A 2I03A 1AMOA 1A8HA 1F2TB 3SQXA 2OECA 3GLHE 3IVCA 2AN9A 3X44A 1AKRA 5GJBA 3U0BA 3WHIA 3A37A 1NQVA 3A6KA 2WV9A 2BFFB 2GASA 3E70C 1MX3A 3PC4A 3QU7A 4MUEA 4HX5A 3MINB 5H0IA 3Q7TA 1PD1A 3KBBA 3VU1A 3SG0A 2NMVA 3RSGA 1OXSC 2I7TA 3NVDA 4MW9A 4Q7EA 3ZXUB 3ROPA 5KVVA 5ED0A 2OGZA 4LAFA 2D00A 4MJXA 1UODA 3KR1A 4RU1A 4W8HA 1HLDA 4UAGA 3HJFA 1E2UA 2CWWA 2CNLA 2QTFA 3A3KA 5NULA 1GUFA 4N7MA 4EOGA 5AYVA 3JR7A 5G0TA 1T2EA 4LG1A 2HREA 1HUQA 1GG8A 3HUUA 4GBMA 4YO8A 3T94A 1PG0A 1QO9A 4JAVC 1GR0A 4UDYX 4LZWA 1I4TD 1YJCA 1R66A 1ADBA 4K9KA 4XVCA 4CETA 3JV7A 3VOSA 4BCBA 3CR3C 4RTSA 4IJUA 2EF0A 1RYFA 4PFQA 1GNVA 3MIIA 2VHUA 5I51A 2Q07A 2IH5A 1F38A 2PMDA 4MO9A 1R88A 4WPGA 3A4IA 3DFZA 4RTJA 4PAOA 4RABA 1OYOA 3R6DA 2GHIA 3A4TA 4XX1A 1XTSA 4ZU6X 5YASA 4L9SA 5E9AA 5C34B 2REBA 4WK6A 5JDIC 3EVDA 5JSZA 4DADA 2QM8A 4MYCA 2M6SA 2QT0A 1SG0A 3B85A 4X20A 1T5HX 1E0JA 1SVSA 3C41J 1UWVA 1K7SN 4B80A 4JDUA 2WI8A 3FNRA 2FPWA 4C4PA 3U48A 1FU7A 1L8OA 1JEQA 3VV2A 2J3HA 2GEVA 3ZHOA 4FZJA 1LVUA 3FHCB 4A8TA 4OBWA 1YWGO 4ZGWA 4CEJA 1EK6A 2J67A 3KV1A 4MYTA 2J3QA 3GCZA 1IHOA 2IYXA 2I3AA 3Q98A 4UC0A 3KHTA 4QGFA 1SKAA 4MW6A 1V11A 1V3UA 3I5AA 5F5NA 1MQSA 3TTYA 4RDCA 5DXFA 4I99A 5FB3A 1ESDA 3KZOA 5HZGA 1ABEA 1K5DA 3ZUGA 4AJ2A 2GBIA 3QTTA 5HZKA 3CE9A 4XPZA 1GQ2A 5GVSA 1WX1A 1KE1A 4L3VA 4ZI7A 1HYHA 1VMIA 2B4YA 3RUPA 1P0CA 3L4SO 1UM9B 4JI7B 2PUCA 1DTWB 3TWOA 2JI9A 4LQLA 1T8RA 1AT1A 3BWMA 3EUEA 3BXHA 1JB9A 4AIIA 1PZNA 1ZITA 3CUWA 3OIWA 4GZ6A 3D8SA 1I4EB 4HAYA 2NXNA 1ETHA 3L8DA 4KPFC 1AIPA 5AVTA 3K2BA 4JY7A 4UBKA 5DLQC 4I1VA 1L3CA 2W5UA 3CUEF 2UUCB 5JZSA 1PJCA 1Y7PA 1EBFA 2BMWA 5A5EA 1P5FA 4QPDA 3HV0A 3P9QA 1XEXB 3QJYA 4NJMB 1GAJA 2V7UA 3ND5A 5FUWA 1RT9A 4F6LA 4Z4QA 1CUDA 1EB9A 2V45A 4UMVA 2P4UA 4PV7A 1JJ7A 5BY2A 1SZJG 1V4NA 2NUTB 1RJEA 2OO5A 4MYSA 4Q1AA 1O2DA 1XLTC 2GWHA 4NH4A 2IXFA 4AW9A 4AMZA 5FA8A 5MGNA 2DM6A 4P7FA 2W2QA 2FMUA 1E9SA 1D6MA 3KOOA 3LC7O 3ML1A 5DLDA 5HQ3A 5ICMA 5K0EA 2B35A 2CYAA 2O5EA 1MIOB 4PZCA 1YZYA 4OHPA 5HBGA 4RETA 4Y6RA 1U2GA 3D6TB 4EVSA 1HZZA 2SHKA 3D4BA 5IXSA 3OLQA 3T3PB 1VPLA 4NNJA 1KMHB 3EVEA 5CDYA 3EDYA 3R4VA 1ZUNA 2W6PA 2I65A 3L93A 1DX6A 1M2NA 4NU8X 1T5SA 4WGFA 4L2IA 1HE5A 1MC8A 5B6JA 2F3UA 3BKXA 1AHNA 4RGYA 1K6XA 3O74A 2BBOA 1OFVA 4L22A 4GM0A 3WSTA 3DD1A 5LLDA 3N05A 1M2KA 1OASA 1PFUA 1J2JA 4HO1X 1YR7A 1Y7LA 2PANA 2XYPA 5LZ7A 1CBUA 1MR3F 3AI2A 5KIAA 3BSWA 4TV9A 1J2TA 2YJ4A 4RD3A 3F8WA 3V9PA 3CS3A 1M9NA 2NOAA 5HE9A 3OBIA 2C4MA 4GZMA 4QQRA 3W06A 4A0FA 4A2QA 4DBLC 1ZUHA 3P20A 1CWUA 2QNRA 3GW8A 4FQ7A 4FYVA 3UFXA 1P33A 1TRHA 1EVKA 3V42A 3KKQA 4KXLA 3QG1A 1NF8A 1J20A 3BJZA 1VE7A 4Q01A 4YY3B 2R8XA 3GVXA 5D6NA 5JFTA 1J23A 2OR3A 4YCNA 3AY0A 3QKRB 3C8HA 3PQCA 3H97A 5EESA 2NU8B 1VHJA 1XTZA 2OCLA 3JAKB 3RJZA 5DLPA 4ETMA 5KNBH 1SCIA 1W0JA 4Q9KA 1C29B 1STOA 2C5GA 5EEHA 5J63A 1TTPB 2QTWB 1KIMA 1WD5A 1RYZA 4NV3A 3G8CA 3UQYS 1PVDA 3UTDA 4AZ0A 4GDFA 2FUEA 2P40A 3I2HA 1ZICA 1PW7A 2P2NA 3S2ZA 3TD9A 3VGPA 1IBLB 2VQEB 4RYDA 3B48A 4TQUS 5CTJA 1NLUA 3ZNNA 2WJAA 2PU5A 1EUCA 3P9KA 5CUQA 2ZWVA 1ARZA 3STTA 2AZDA 3UJAA 1U99A 2IY8A 3LE8A 3QKSA 1NJ8A 2ZI7A 2JBHA 3L02A 5FFNA 1NMZA 2D4AA 4OO3A 1PL0A 4D9KA 3GJQA 2B4QA 4PQRA 1SQ0A 4QTYA 3ABIA 3K0HA 1E8DA 1C7IA 2HU8A 2AF4C 4XAQA 1PS8A 2NXCA 2ZI9A 3OZGA 3O9VA 3COWA 1A3CA 2C1XA 2Q3EA 3A1WA 1I4LD 3WL6A 5L7WA 2FN7A 1PLJA 1T6ZA 4KQKA 4OHVA 3X1YA 4GKAA 2M98A 4BLRA 3DF7A 1MT0A 1NBIA 2VJQA 3ANSA 3FPFA 2B8WA 2VZ8A 5IJAA 3NBZC 4JSRA 4RV9A 5AW4A 2B36A 1RCUA 1IN1A 3F6SA 1FF9A 1T5LA 3ASYA 5D3MA 1G1MA 3PBKA 3FLBA 5FR2A 3EFHA 3DP7A 3VH2A 3I0NA 4L4ZA 3HE3A 1GNSA 4A8JA 4EHFA 3PXAA 1TVMA 1M34B 5DT9A 2WYUA 3DJYA 3V4OA 4EUKA 3MBIA 1G5TA 5T4EA 2CL0X 1WY7A 1YZTA 4GPIB 3JQBC 1UC5B 1HNXB 4DARA 3KQSA 4JI3B 1VJ5A 5BVHB 1IVYA 3KVYA 4W5WA 2E3JA 1L7QA 3FJOA 3WGLA 1E3DA 8MHTA 1P8AA 1U1FA 2R2AA 2ZT8A 2I66A 1J2YA 4KQWA 4O4JA 2CLMB 2OA0A 4ZK2A 2PL3A 2Y76A 3PUXA 5AWFC 2C9CA 3SX4A 2G70A 3ILYA 3O93A 2Q0QA 2J87A 4A7PA 2P9QA 4IDCA 4BLTA 3PE6A 1FS5A 4J8PA 2VT3A 4B3RB 1JR3D 1A7KA 1NMQA 1MJFA 1OROA 1Y8CA 1DEHA 3OX1A 4XSVA 3D4IA 4IQ0A 3Q7PA 1E7MA 5EUQB 3TQQA 1J9ZA 1PJZA 3QEMA 5TQ0B 4POAA 4JJKA 4KI7A 4Q4LA 4NR0A 3EFEA 1SB8A 1Q84A 3H9JA 2HNAA 5BWMA 2CJYA 2DAPA 2OZLB 4NY1A 1UFOA 2R4TA 4XPIB 4AMGA 3VVMA 4D3SA 4F56A 3ZZ1A 3WL4A 4R31A 1YE5A 5JI2E 1SUWA 2D62A 2JPDA 1M2VB 2WG2A 1UT8A 3WLMA 2VCHA 2ON6A 2ZVJA 1GN8A 5GM1A 2QD5A 3UB4A 3OM0A 4M0PA 2HJ9A 2FSVA 3KO8A 1NJ1A 1ODIA 2O3UA 1FDOA 3OWXA 3P5SA 4GG1A 2GNPA 2OGFA 1RYBA 5FHRA 4YRPA 2RC5A 4LS3A 3TRDA 3PXUA 2CL7X 4WNCA 3VU9B 5IEJA 4UUMA 5ADHA 1TD1A 2X9VA 4LK3A 1FUUA 5AIBA 4C76A 1G60A 4R40A 3IUNA 3ET4A 3SQNA 4LEIA 3O0TA 1GSAA 2EKDA 3INTA 1EX1A 1RVDA 2V5AA 1RXSA 2V9ZA 2VCEA 3LRXA 3MCUA 2C07A 5LNK6 3NHMA 3COYA 3OFJA 1XK7A 1LZKA 5GIPE 1GLNA 1SUSA 3MAAC 1MJGA 3FNGA 5CG1A 3DEZA 4PZAA 3LCVB 3REQB 3QIAA 5KYNA 4YAWA 4Y98A 2FW7A 4O4IA 4HNQA 2NO6A 1CUUA 3F5DA 1OXKB 3ZOZA 4EY3A 1C41A 3E84A 2BDEA 4LBYA 3RC3A 1VBFA 5CHEA 1L5NA 3SHQA 3OZWA 1U2QA 3WYBA 3CFFL 5BSKA 5LD2C 4RQUA 2QLNA 2CXQA 1Z0KA 2H0QA 1FYWA 1RWXA 4LWPA 1Q0ZA 2GR7A 2MYUA 2NIPA 3INNA 1KPHA 3B36A 3BB4A 4MVWA 3C3DA 1JKMA 3L0PA