4MUJA

Crystal structure of pantothenate synthetase in complex with 2-(2-(benzylsulfonylcarbamoyl)-5-methoxy-1h-indol-1-yl)acetic acid
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
288
structure length
288
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Pantothenate synthetase
total genus 96
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4mujA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mujA01
3H97A 3LCJA 2NZ2A 1O94D 4HPWA 1NUSA 4S1OA 1ILEA 3IOBA 1OWOA 1JIIA 1EFVA 1H1TA 1T9GS 2NSYA 3COWA 1MC1A 4YP5A 4ZCPA 1QRTA 2CYCA 4G6ZA 1R6TA 2DLCX 1MB2A 4ZT5A 3D6UA 3ND5A 1KAQA 1KH1A 4MW6A 2EJCA 3G6KA 3FIUA 3TQIA 1JZQA 2QUJA 4WNYA 4MUGA 5J5AA 1VBMA 1J70A 3SEZA 1VLHA 2CSXA 1EUYA 1QRSA 5DASA 2PG3A 2HGZA 3IUEA 3P52A 3QE4A 1KKUA 1M8JA 3ZXIA 4NDAA 4OJMX 3X1JA 1O5TA 3K32A 1ZUNA 1IRXA 2QUHA 2Z3VA 4MULA 1BS2A 1WXFA 2JAXA 2PXHA 3GLVA 1PG2A 2AZXA 2B7LA 2DUMA 3FDXA 1GZUA 1O95C 1NZJA 1IH8A 1G8HA 3C8ZA 1OBCA 3IOEA 1N2BA 1VBNA 3UMVA 1IHOA 1MAUA 1XNHA 2VTBB 4MWCA 4MW1A 4DJAA 4MW4A 3ILVA 1JILA 1X6VA 1MRZA 1F7VA 4R2MA 2JA2A 2TS1A 3OTWA 4HJRA 4G5YA 3MMXA 1T6ZA 1WOYA 1N77A 1EFPB 1TYAE 1KH2A 4MUNA 5H16A 1JGTA 4MUKA 5TS2A 2XRYA 4EG7A 2QTRA 4J76A 5AHWA 2C5SA 4G5FA 1J21A 1MOPA 4MVCA 4CQNA 1XNJA 1N1DA 3QTTA 2EL7A 5K0SA 1YIAA 1EFVB 1I2DA 1O0BA 5TGTA 4P2BA 3TS1A 3MUEA 3ZXSA 3BL5A 1N2EA 3IMGA 1R6UA 4JXZA 3CLSC 4PBTA 3G59A 3CLRC 1JEDA 1I6KA 4MW5A 2AG6A 2CYBA 3F3MA 1JIJA 2A88A 2PIDA 2J08A 4GRIA 2CFOA 2V0GA 4ZT3A 3RK0A 2J5BA 1GTSA 3VU8A 5KCMA 4U8HA 4Q93A 3IMCA 1PFYA 1QJCA 1IQ0A 3CLRD 1JMVA 2YWCA 1OBHA 1X8XA 4KR6A 2E18A 3CLTD 2D13A 1H3FA 3A2KA 3SZ3A 4MUEA 3COZA 3CLUC 4A91A 4PBSA 2E89A 4QRDA 2DXIA 1LI5A 4EF6A 4XFJA 4MAFA 5JBNA 1ULHA 1WQ3A 3M5WA 3CVWA 1UFVA 4ZCSA 1COZA 4KKVA 3TQOA 4JFAA 1M8FA 2GKSA 1D2RA 2CV2A 3PNBA 3FWKA 3H9BA 2H29A 2PZAA 4ZCTA 3GUZA 2OQ2A 4MLPA 3RK1A 3TZEA 2XRZA 3P0HA 4ZCQA 1NUTA 1TYDE 1WXEA 1NI5A 4WSOA 3DO8A 3TZLA 2X3FA 3L92A 4ZT7A 1QQTA 4MVYA 5HUJA 3FNRA 2WB2A 2A1TR 1KP2A 4QREA 2H2AA 4JYZA 1Q19A 1T6XA 3Q12A 1XJQA 1U7XA 1WXGA 4UZEA 3ND7A 4R0NA 1EFPA 2QUIA 2X1LA 1MB9A 3CA8A 1IVSA 3COVA 2RD2A 4MW7A 2CYAA 4EGAA 3CVXA 4PBRA 1O0CA 1HYBA 2PZBA 4HK4A 3MLBA 4CDNA 2R5WA 5KHAA 1K97A 1WKBA 2A7XA 4U7JA 4KPUA 1RQGA 2IP1A 1O6BA 4MUJA 1PFWA 1WXHA 4QBTA 2WSIA 3RJZA 3Q4GA 3IH5A 2QJOA 1J1UA 1TFUA 2ZUFA 3L93A 3DV2A 4OUDB 2CUZA 2PZ8A 3ELBA 3DLAA 3K9WA 3H05A 4EG5A 1GAXA 3HL4A 1N2GA 4OUDA 1IQRA 3A04A 4HJXA 4NX2A 3AKZA 4DLPA 1A8HA 1U3CA 1NP7A 1LW7A 3P0JA 2VTBA 2Z09A 4AS1A 2YXNA 1NSYA 1G59A 1FYDA 4ZCRA 3IUBA 1KQOA 2G36A 4CT0A 3A4IA 5TEVA 3UOWA 3LE8A 5LM3A 1CT9A 3NBAA 4ND6A 1PFUA 4ZT6A 5BNZA 2WQ7A 1IQUA 1JECA 4XFDA 1ZJWA 5F23A 1GLNA 1TYCA 3Q10A 3H99A 2WQ6A 1KORA 4BWVA 1QU2A 5DK4A 5IHXA 3KT6A 2JANA 3CVUA 1M83A 1N3LA 3MLAA 3AFHA 1F9AA 4MWDA 1F7UA 1MAWA 2J09A 1Q77A 1IFXA 2E21A 3N9IA 3IVXA 1EXDA 2Z08A 4NAHA 5DB4A 3AG6A 4K03A 5KWVA 3N2YA 1WY5A 2CV1A 2BTEA 3G5AA 1EE1A 5DEOA 1JEEA 1OD6A 1T6YA 3FI0A 4YP6A 3S3TA 4F4HA 5FO0A 4MVWA 2DERA 3A05A 4DDHA 2QTNA 1PG0A 3AIIA 4UZFA 1Q15A 4MW2A 4MUFA 1OWPA 3CLTC 1TYBE 2X1MA 2QUKA 4NZPA 2VXOA 3INNA 1V8FA 2O5RA 2YY5A 1PFVA 3KT0A 1N2OA 1SURA 1G8GA 1QU3A 1NYLA 4DDMA 3UK2A 2HZ7A 1M1ZA 3QTBA 3P0IA 1DNPA 1OWNA 1F4LA 3H9CA 3PXUA 2OV4A 1YIDA 4KPUB 3FH0A 1JHDA 2QTMA 2E0IA 2CV0A 4XSVA 4R2LA 3UC5A 1B6TA 3ZJUA 4FZJA 4MVXA 3AL0C 1NUUA 3TNJA 4MWBA 3SZGA 4EG6A 2HMAA 3OP1A 2YWBA 3ZJTA 4RUKA 5EKDA 1OWMA 2ZUEA 4F3RA 3ZJVA 1P7PA 1O97C 1M8GA 4YMIA 1N2JA 4L2IA 4Q16A 4EG3A 3ISJA 1U0BB 3DPIA 1Y42X 1KP3A 1J20A 1N2IA 1WZ2A 1ZH0A 2ZP1A 3CR8A 4K0RA 4DE5A 1GN8A 4I6EA 3HGMA 3CLUD 4DDKA 2DPLA 3IODA 1QNFA 5FO1A 3RBAA 3I05A 3HMQA 5FNZA 1YULA 3COYA 1YI8A 1K4KA 4AQ7A 3UY4A 1O97D 1KQNA 1NUPA 4NAUA 1KQPA 1YUNA 3HZRA 3KT8A 4EG1A 3IDFA 2DEUA 4I6JA 3KFLA 2D54A 1M8KA 4ARIA 3ND6A 1I6LA 1GTRA 1R6XA 4I6GA 3FOCA 2QJTA 3N05A 5K0TA 1N2HA 3PNVA 3FETA 3CLSD 4MW9A 4JXXA 5J59A 3VGJA 1H3NA 1MBZA 4ZT2A 3FG9A 1EJ2A 1K4MA 3CVVA 4MWEA 3SEQA 4KR7A 3MXTA 3SDBA 3IOCA 4NATA 2J07A 4MUIA 1H3EA 3AG5A 1MJHA 1I6MA 4EG4A 4L2IB 3PNYA 2A84A 1ZH6A 3NBKA 3IMEA 2CT8A 5HUHA 1NUQA 2X0KA 1U7DA 1WQ4A 3RFFA 4DNXA 4ZT4A 2IELA 2A86A 1O94C 4MUHA 1LI7A 1TQ8A 3SYTA 1QRUA 3IVGA 3SP1A 4J75A 2AKEA 2I1LA 4YP7A 2QJFA 4RPIA 4ARCA 2J4DA 1VL2A 1NURA 3N8HA 2GM3A 5HG0A 5IJXA 3HV0A 3X1MA 3RHSA 1QTQA 4E1AA 3VRHA 1T9GR 1O95D 1WXIA 2D5BA 1J09A 1N78A 2O8VA 5TEWA 1XNGA 1EUQA 2DETA 3IVCA 2IJGX 1O96B 2V0CA 4H3SA 1JZSA 3D6VA 3FHJA 3GMIA 4TS1A 4GU5A 4CDMA 4KR9A 1YUMA 1O96A 4EFKA 3PRHA 1M8PA 2A1UB 1K92A 1Q11A 4ND7A 1OWLA 1G8FA 5H7XA 1KH3A 1S4MA 1U3DA 2A4MA 4MQ6A 2RE8A 3KT3A 3E27A 1J1ZA 4JZYA 1WJGA 4EG8A 2DR2A 1KR2A 3JXEA 1VBKA 4YBRA 4U63A 3LOQA 1GPMA 5J58A 2GOYA 1V47A 2PFSA 4PY2A 1JIKA 1N75A 4MW0A 3X1KA 3ZIUA 3ZGZA 3HFJA 3NV7A 3U1VA 2A1UA 3CVYA 5LLTA 5LFAA 2BYTA 1TEZA 3ZUGA 1FFYA 2A1TS 1KAMA 4X0EA 3FY4A
chains in the Genus database with same CATH superfamily
4DJDC 4YUXA 1EWTA 4GLJA 4WLNA 1NHGA 2PWYA 1ZP6A 2VDQB 2QUAA 3EHEA 4B47A 3C87A 4Q15A 4W7IA 4R8SA 4XPIB 2XQJA 1EGVB 2OYCA 1E1NA 4A0QA 4YJ3F 4NKRA 1RQ7A 3W7VA 2VH5R 3SBOA 1E6KA 2VRWA 2Z1MA 4FMBB 5JMOA 1NE7A 1XQYA 4EG0A 1Q0ZA 1QLJA 1YJCA 2WFZA 2GCIA 1QB8A 3B78A 4YP5A 4D8TA 1JV2B 3KQPA 4ZQEA 1RJ9A 3M4NA 2DLCX 1X77A 3TECE 1H8HD 3DHNA 2CLOB 1ZUIA 3QNUA 1ZESA 1YQQA 3ITKA 5IDXA 1TKCA 3GJ8A 2ZEJA 4RE5A 3TTUA 1UJ2A 3PTLA 1TKBA 4XIJA 3D4IA 4J7AA 1P2TA 3AFOA 3FGPA 3I2KA 4J0JA 4NQZA 4BE9A 4ZK2A 4RZ2A 4XM1A 4YP1A 2XXAB 4L6CA 3EG5A 4CIDA 5JNSA 4AFNA 3SJZA 3JVIA 1T8WA 4QDOA 1Z6YA 4LWZA 3K70B 3VVCA 1QRSA 4XVCA 4MHTA 3HL0A 2OBMA 4H6VA 3WGYA 2JH9A 4PAMA 1LLFA 3D8SA 3WY9A 4CCWA 4A73A 1U7TA 1DELA 1U0NA 1UKZA 1EM6A 2F1OA 1ZXXA 3QE4A 4NYJQ 4GIBA 4IJKA 1BQ4A 4MGZR 4RAOA 2GF2A 4I50B 2A56A 1JE0A 2Q0SA 1Q7CA 1YSCA 3X1JA 3KOYA 1RHKA 5JQGA 2CNNA 4D0GA 3X44A 1K9VF 1Y9AA 3MGGA 3FCAA 4FR2A 1E66A 3PC4A 1VP9A 5F9MA 2PMBA 1BS2A 3Q8MA 2HSWA 1JLKA 3UWPA 4LYAA 4DBZA 1BWRA 4U7TB 4XFKA 2LDXA 4YTEA 4AMZA 4DIDA 3PJRA 2AG5A 3OURA 1EHIA 4RA9B 4A27A 2JEOA 4GMFA 2BW0A 2PXXA 5JI2E 1ZJ6A 4BLVA 2EFYA 2O1WA 1RRGA 4YMGA 5F7JA 3IEMA 4LQDA 1AZSC 4BO8A 5JADA 4HGPA 4LY9A 4FCCA 1INLA 1YB4A 3GQVA 4FX5A 4F2HA 5ALMA 2HK6A 3ZK7A 1AXEA 1XTIA 4D2IA 2H18A 4GBED 5A1JA 4M9UA 4FOTA 2Q6OA 1E3LA 3CI0K 3PP8A 3LW8A 2W6IA 4J0IA 4U7PB 1KI6A 3ESXA 2QU8A 4RSHA 1YR8A 3F46A 2O06A 1I3LA 2EAUA 3RT1A 1Y6JA 3JR3A 4CEJB 1Z25A 3PJDA 3VC2A 1WUTA 3ASVA 1QGED 4BE7B 1ZO8A 4CETA 5KJCA 3ZDFA 1TAGA 3H1TA 1ISJA 1L8OA 1VL0A 2FQWA 3QW2A 4UUNA 5H16A 5B3AA 2O7QA 4M0FA 2WU4A 5FL7D 1A7AA 3G2MA 4G5OA 3SC6A 1W30A 3VU9A 3ZR4B 4BMNA 4FGLA 2NYVA 3KZNA 4CQNA 1NSFA 3NHKA 2XKKA 5JAZA 2LCQA 5L3ZA 1KBZA 3OPYI 4ZDWA 2JFXA 4EY8A 3I42A 4B8ZA 1E60A 3DMFA 4DN6A 2UUOA 4R2IA 4AIIA 4JP8A 3FUXA 3C6XA 3EODA 3BWBA 3M83A 1BCRB 4ZVMA 3AERB 3DHWC 3O8OB 3UV6A 3N53A 2CKDA 5GGYA 5EHXA 3RLIA 1SMKA 2EDCA 4N4AA 1NMSA 4C2UA 4F9FA 5D85A 4HFJA 3ZUPA 1EGHA 3KSBC 1E1DA 2E4WA 1WKCA 4KGZA 5B1EA 1ORHA 2XYGA 3JARA 1PFYA 4ADSG 3AI2A 2AEEA 2HCJB 3O93A 3QVVA 3KJHA 4ZDIA 1G16A 2OAP1 3G2NA 3TRHA 2UUAB 3D3NA 4XAQA 2I2XB 4DARA 4X66B 4NVRA 2D13A 1E89A 1VMIA 1IY1A 3HB7A 3AZOA 3QLJA 3SC2B 4AL4A 1PL7A 4MOWA 1A97A 1AOXA 4DCGA 2O19A 2DSNA 3N6VA 4DCPA 2P9TA 1NQAO 1V11A 3PJEA 4AZ0A 4RPJA 3OLZA 5SZIA 1KJ8A 3RIMA 1GYPA 3WGLA 1EZ4A 1M2VB 4NARA 3AHJA 4F3CA 2N42A 3IESA 4FKZA 3HY4A 1X7YB 2B0CA 4TKZA 4XA8A 5BN3B 1RCUA 4MAFA 5HZHA 3U61B 3KLOA 1Q1AA 4HTFB 1ULHA 4UATA 5C8XA 4W1RA 4Q3LA 1O4WA 2JJMA 4IIBA 3UJCA 1NI4A 3EXIB 2WE7A 3OQBA 5JCJD 4B5KA 4W5TA 3MPUA 4HKTA 2J59A 4MINA 1TO2E 4BGUA 3ZE7A 1M2OA 2X9NA 3FSRA 1HO3A 2AFHA 4WERA 5K9ZA 5DTJA 1TYDE 2F8SA 1T13A 4QYIB 4M36A 4PN7A 2VPXA 4DV6B 4WCFA 2X3FA 2DULA 1JXMA 1SB9A 1VBFA 3L92A 4XPZA 1FTNA 5GOTA 3OIVA 4NQRA 4GDFA 2HIHA 3EZFA 4CCYB 3KG2A 2H2AA 3B1XA 5JNWA 4I1UA 5FUBA 1XG5A 1RJGA 4O59O 3P9CA 2YASA 4UU0A 4C4TA 4ITUA 1FMJA 4PRZA 4EA9A 2P9HA 3QMWA 2PLFA 4CODB 3ZHOA 3NHZA 4GPBA 4BLTA 2P7HA 4QIHA 5ILOA 1U1FA 4XGQA 4WX2B 1SJ9A 1NGSA 2CHUA 4EGAA 2ZYDA 1EJ0A 4NABA 2IYYA 1XQ9A 2GEKA 1GNLA 2QJRA 1L7AA 2R2AA 3BN3A 4HNSA 4LOLA 5FOSA 3RG2A 3RSGA 2MCFA 3TGPA 2VQFB 4BPRA 3G5MA 3SU8A 4LK2A 1C41A 3E81A 4G41A 3AVPA 2H1HA 5ED4A 1GEGA 1PLJA 5EE3A 1OH8A 1XP5A 4OGWA 4JP3A 2O3RA 1NR7A 1PV2A 4P3PA 5BN5A 5JU6A 2PUGA 1TQ6A 3IUYA 5IK2D 3PGJA 4OFBA 3CPJB 4Q7JB 4M1TA 4OX9B 3OZIA 2IBSA 3U13A 1JWBB 2XMDA 3E9NA 3L04A 4BFCA 1F8YA 2YBEA 1WL8A 4Q4HA 1Q0TA 3EDQA 4BMDA 3PUIA 1SOMA 4Q7EA 4X61A 3RFVA 4G1FA 4IUYA 4PSUA 1QG4A 1XQWA 1G6OA 2FK7A 2IU3A 3AP3A 5DHRA 5C8VA 3R4CA 3TSWA 2CJWA 4PLFA 1AKVA 3C3BA 4BFTA 3HCAA 1M73E 2P6UA 1E6WA 3A9VA 2BMWA 3WHIA 5KKCA 4HWKA 3SSOA 2RH5A 3EVCA 3S4YA 2PZKA 5LOVF 5IBCA 3ZE0B 2F43B 1FDUA 5L51A 1DZ3A 2GHIA 3FB4A 5DHSA 3WLHA 5IYZF 1EFRA 3W6OA 1V16A 1XAIA 3CW8X 4HTAA 2FDCA 1V43A 4P4UA 1NMZA 4BN0A 4B4VA 4GT1A 1WHSB 3RARA 1LS1A 3U3OA 1Q44A 3KZ1E 4FOSA 4Y2JA 3DZFA 5AXDA 1NY5A 3L3BA 3LUDA 4DJFC 3GLTA 3S28A 5MFZA 4WMLA 1QIGA 1QPGA 3CEJA 1PYOA 3Q3IA 1E2PA 3GARA 4G37A 1QOPB 2JJ2D 2Q3BA 5CITA 2DWUA 2QLFA 1F7UA 2X9LA 5J4HA 1XTVA 4QEDA 2R6R1 4C6TB 4Y2SA 2NYUA 4X1YB 3UKOA 4HN4B 1QHEA 3H4MA 3UJ7A 4Y6PA 1E79A 1B0UA 2Z95A 1KI8A 2ZTVA 3QKSA 2PH1A 2YX1A 2GETA 1LD3A 3UQYS 4QOJA 2RBKA 5DBHX 1EI9A 1L5FA 1ML3A 2VPYA 1R4MB 1CS0B 2B1GA 5E6UB 1LBHA 1KJZA 4NOLA 4HRXA 2CV1A 5KJ6A 4XLTA 4ZZ0A 3GMSA 5JDCA 3EA0A 2VAWA 1A8QA 3EMDA 3L8DA 1CX9B 3K1TA 4JLVA 1CUIA 4ZQFA 4ZHQA 1DMSA 3ZV7A 5FPQA 3EPJA 2OV8A 3HKDB 3TK1A 1OV4A 4F45A 1LJUA 1NXTA 3FMPB 3V2GA 1C7FA 2NQ2C 5CLGA 5ALZA 4KP7A 3A05A 5EAIA 2PH7A 1KJYA 3EMBA 3HA7A 3IAHA 4FSDA 2FF7A 3AUAA 1ZFNA 3OG9A 1OXMA 3RTCA 1OKKD 3GCXA 1GDDA 1FFEA 1NULA 3NP7A 4LRWA 4ZEWA 1L3BA 3ZNNA 2AX4A 3GJSA 3FN4A 4FXOA 5IXYA 3B2QA 3ZKAA 1VFNA 4QU0A 2QYSA 4MVJM 2R7NA 4WOJA 1DMRA 2GYYA 1QO7A 2HOQA 4YMUA 5JROA 4NNJA 4EECA 1ARZA 1KL7A 4DDMA 2O3SA 4A15A 3CNQS 1LBQA 3KUCA 4P93A 2H6EA 5SYNA 1P2GA 3D6JA 1JALA 1UXJA 4M4SA 4JJAA 1IRIA 5K09A 3GZTB 1R37A 2A9VA 3A6EA 2PLRA 2R1TA 2HU8A 1CDZA 1UZNA 3E5MA 3LKZA 3KR2A 1GQFA 3PXUA 2I4LA 5J40A 4Q3CA 3SE7A 3TPZA 2J33A 2QRVB 2RKBA 2AKYA 2XVXA 1IUKA 2ZE8A 4HY3A 1EK5A 1A2QA 3UO8B 2QRJA 2PE5A 4PO9A 4MGEA 4RNCA 1ZIYA 1L7XA 1EK0A 2H4JA 3WRXC 5AKJA 1J0EA 3I3OA 2QLTA 5GZ6A 1E18A 1Y80A 3DUFB 3OTQA 1T2UA 3UB2A 1Z4IA 5CHEA 2QRPA 2YJ3A 5CT9A 3C4VA 1U8AA 3UV7A 3IQXA 2QAGA 1ZMTA 4INJA 4P84A 5FUVA 1WU7A 4B4UA 4DQUA 3MJCA 2B36A 3PU6A 2QSUA 3UMCA 1XL1A 5CK4A 5KAPA 4C0LA 1B6RA 5I5EA 3CYFA 1FX0B 4IKEA 4JLMA 3PC8A 3QJ5A 4AJ4A 2I78A 2VTKA 4TS3A 1LTHR 2GLTA 4DR5B 5DNDA 1KP3A 2XYQA 4DUGD 1CZHA 2AEJA 2P4EA 3H5WA 3T9FA 1O7JA 3NNSA 3ASUA 3OEED 4BVAA 4E5NA 4RVUA 1YR2A 4WKOA 5D1HA 5K51A 4F96A 1VOTA 5LXTF 5I9MA 2ONJA 1I0ZA 4NU0A 4LS3A 3T1VA 3HDHA 1C50A 3AR9A 1KDZA 3IVMA 1A7UA 1AKYA 2Q3CA 4MA4A 4FBGA 2YHAA 4DSUA 1K89A 1Y1LA 1S7GA 3ZVKA 1TZCA 4TTQA 4GC9A 3VSBA 5FPTA 1L6IA 3AJ8A 1OLUB 3IDFA 1XR3A 3C5WP 3E1SA 5EJ8A 4FB5A 2MOKA 3I4CA 4IDFA 3FMVA 1QOQB 1HE1C 3PHLA 2D3TA 3UHOA 2UXCB 4IIVA 2A9RA 2C0CA 3DXYA 5FI1B 3I01M 4JA0A 3S7TA 1TUBA 2C78A 4W5RA 1JHVA 3W34A 1FTGA 2IY8A 1DBRA 2HMWA 4WPGA 1TIKA 4QHYA 3CLSD 1FYWA 5FTJA 4C7MA 4MRAA 3JYQA 3T0GA 3A6PC 2VHYA 1PJSA 1UFRA 4QJ5A 2B35A 3JALA 1T5DX 2J9YB 1IOZA 1RZRA 3DWGA 2OHFA 4G2TA 3RB8A 4TT3A 2J07A 2ATCA 2V7VA 3TTVA 3GLRA 3QOWA 2HU5A 2X0DA 2FW1A 2O8CB 1QS0B 2YXLA 2J6IA 5FYDA 3VAYA 1U7UA 3BMXA 1KVRA 3FBWA 2CGEA 3H6HA 5FI5A 2JATA 1JBEA 4ZYVA 3ZWMA 1HE4A 5KVAA 2VAXA 1UT6A 1RBYA 1QWSA 2D8AA 5TQJA 3SYTA 5EHNA 1AKNA 2ZBQA 2D0OB 3B53X 1PQWA 3OD1A 1ZONA 1U8TA 1C1XB 4KZKA 3RTDA 4GI2A 1XRNA 3TQHA 3U48A 3WK9A 1UZMA 3ZXXA 2AKEA 4AN4A 2FG6C 1F3OA 2QL9A 2XUIA 4I2NA 1T24A 2XF2A 5G0TA 1I1NA 3EDMA 4BKMA 1HDOA 2D8MA 5LIRA 4I1RA 3PUWA 3Q11A 1MF7A 5KREA 3VRHA 2KBFA 1CJVC 4ETNA 3V4RA 4OA5A 1YKGA 3TRDA 2HA3A 2XRFA 4M1YA 1PP4A 5J2TB 2HC9A 4YB8A 2WU3A 4CR8A 5HJ5A 5AVWA 1NC3A 3CNLA 4H31A 4Z4CA 3N8GA 1LBTA 3T1QA 1WUKS 4XGNA 3REFA 1QHSA 3BB3A 621PA 2PBFA 4BDSA 5L45A 2HDHA 1X38A 1O8BA 1K92A 3E7WA 3MSXA 3P2IA 1YOVA 1JT2A 1IHPA 4XWYA 3GJZA 4HB0A 1GKYA 1DQYA 1L8XA 2A3NA 5AHOA 1RP1A 4P7FA 2G8LA 5E7IA 5IARA 1VI6A 1Z0IA 3LX6A 5WRFA 1J06A 3CLHA 3CUWA 3KYBA 3OE7A 3P9KA 4RLHA 1MT0A 2BEVB 3FPBA 4I8IA 1UPXA 3AEUB 4Z1MA 1ZN2A 4Z5XA 1X7ZA 2OGFA 1ZC3A 3E9RA 2AWNA 2A9PA 2Y1DA 5JSKA 5HIMA 5HS4A 2BTQB 3JAWB 3EWSA 4UBOA 5I5GA 4D4LA 2EZUA 4A3SA 1N6KA 2FHSA 2FWMX 4PPYA 3WRVA 3DBOB 3GEGA 2YIDA 4QGHA 2JRLA 1FK8A 3P9XA 1KRWA 6YASA 1ZOLA 2JEZA 3IO3A 1JPJA 2ACVA 3OQ1A 2ZUTA 2BYTA 1P4JA 2VJYA 2Y1KA 3K9GA 3OCXA 4WZAE 4X97A 2M6LA 5BWOA 1A4RA 2GNPA 2PU7A 4TYMA 2AUNA 1SGWA 1IN8A 1QYWA 3P9NA 1NXQA 4HZGA 1FFBA 4QOIA 5AKIA 3TG2A 2ACWA 3B9PA 3R7BA 2G2SA 1XMOB 4L9SA 1QCCA 4U6SA 3GEPA 1P3JA 3KHTA 1O5IA 1TM4E 2AHRA 3BM5A 1J00A 5CX1B 3SHVA 2OZLA 3MXOA 3QV1A 5HBGA 1MD9A 2HBQA 4RVGA 1XTTA 3BJMA 4WFQA 3AILA 2IHJA 1BEEA 2WSSA 1ZWLA 2I4RA 2X5JO 2J41A 3ONWA 4ZCPA 1XPOA 4LF4B 5DLYA 5MN6A 1MQAA 4YXWD 3TTSA 5LJIA 1P17A 1YS1X 5ESRA 3VDRA 1RM0A 3RYCB 4NOMA 2FR1A 4ZTBA 1KA9H 4P6VF 2BCGY 2P9GA 3V33A 1ZVVA 4YC7A 2J30A 3V3KA 4YASA 1P1KA 2JIMA 1M72A 1V8OA 4YHBA 2VT3A 1S8OA 3EFBA 3RTAA 2V54A 1J9EA 1CVIA 3CFYA 1KO1A 1N6IA 2NSJA 2RAUA 3Q0EA 4N01A 4KLRA 3C3KA 3SDSA 3ZZ0A 1R9GA 3OQ6A 4MO9A 4WECA 4XH9B 2R5NA 2FB9A 1EB8A 4NLLA 1DKQA 2A9FA 3Q7EA 5DM0A 4N6GA 3NMUF 1LDBA 2QUHA 1VIMA 3NPAA 1Z2AA 3CX7A 1GXSB 2IYVA 4BNLA 5IG2A 2V7TA 4LI3X 1KOJA 5JEEA 3PGXA 1GOTA 4UCXA 4HDRA 5ES3A 3FFWA 1ICIA 4PLVA 3K16A 3DZDA 3ZHUA 1DL5A 3VOBA 2JIPA 4YDSA 4ARSA 2AR7A 4BLSA 1K8ZB 1OBCA 4H3KB 4QT0A 1RPZA 4DQLA 2RKOA 1RQRA 2ZROA 3INTA 5JAHA 2Q1YA 3D43A 4KDCA 1FXUA 1VJGA 1S2IA 2GXAA 1NLZA 1X1DA 4LJ8A 4ASUA 4DLVA 4FJ0A 3TLGB 4MWCA 4M1MA 5EUMA 4AF8A 3SXUB 3GLSA 3OQIA 1O95A 3P94A 4QKQA 4RULA 3U19A 3CNOA 4NDZA 2VL7A 1FFCA 4PXAA 3RV4A 4B3FX 3BRCA 4CIAA 1A5SB 4WDRA 1SOVA 3F6EX 1O8CA 2SCUA 4Z9YA 4N82A 3DBLA 3M0EA 2BEUA 1E4EB 4W6ZA 1CJBA 3L01A 2DUWA 4CMHA 1R64A 5KQRA 4D56A 1FFGA 2C5SA 1XWFA 3QQPA 2XMGA 4FC6A 4R71A 2XQKA 1TZMA 2ZRDA 5C31A 5FUQA 2Z30A 3DZCA 2AK3A 3L7NA 1N1DA 3WX0A 1NVGA 1YIAA 3AJAA 3BE5A 3ZU3A 4ZEMA 4U2CA 4N9QA 5TGTA 5SY4A 4KXWA 3FF1A 1Z12A 3IMGA 1N8KA 5BT9A 4B6EA 2QRQA 1J2RA 1JEDA 4EPVA 1I6KA 2WHQA 3NIWA 4CTJA 1VKOA 2CZGA 5BUQA 5BN4B 3IQEA 3WXBA 3TQQA 1WEKA 4HB4A 5I4BA 5KYGA 2DOKA 2PIDA 1JDBB 1PNTA 2OWDA 3RUEA 4P22A 1XE3A 3GX1A 3MYYA 4ZJZA 3ZV4A 1L4HA 1GGNA 4LEIA 3RK0A 5IEJA 5L3SA 3RAFC 2VJPA 1SKYB 1XEWX 3FLBA 2ZIEA 1CNFA 2ANCA 2V5UA 5AOVA 5E9JA 4DOMA 3MBKA 3QFFA 1ZHFA 1JMVA 2JFWA 3KWLA 2BDEA 1OBHA 2YWCA 3LFTA 2XTZA 1RSZA 3LQRA 4K6GA 4KAFA 4YMTA 5EJ9A 4KGDA 3U60B 3FCCA 2HMTA 3A2MA 3KZVA 4RZXA 4IH4A 2JFFA 3PT9A 1U8YA 3EOAI 1XCBA 1W88B 1IUNA 2ZREA 3IT0A 4J8PA 3WB0A 4A10A 3F4LA 4UVGA 2FSPA 1OLSB 2C20A 4DQDA 5BYAA 1XDUA 2EG9A 2FVYA 1XZIA 2C92A 1QH1A 2B4KA 1P8AA 4R68A 2GX6A 3D4LA 2WFLA 3U62A 2ZSEA 2EW8A 1IZZA 3MTIA 4IIXA 4ALNA 5I01A 4GEGA 2ZDQA 4X20B 4ZYUA 2F1IA 3Q3EA 3GPCA 2I3AA 2RAFA 3VTZA 4YCBA 3NUGA 4JU8A 3IDZA 1RD4A 3DE3X 4WH0A 4L0QA 1EWQA 2GKSA 1KBOA 2XZLA 4NMHA 1CHDA 4NH4A 2PZAA 4L08A 2MWMA 3GUVA 5TVKA 4TYNA 2HM7A 4OGFA 4KAJA 2XAAA 2OQ2A 4PYLA 4NXNB 2OBNA 3MBIA 1WMEA 1SHUX 1W88A 4U3JB 3K0EA 2EZ8A 1NL3A 2BH9A 3PXBA 4FHFA 1QHNA 4ZU6X 4OFXA 4KO4S 3U39A 3ACDA 2ZSJA 3MS4A 3QBTA 3W5SA 3ZGLA 3IAM1 4ZT7A 4LK3A 3T38A 3UJAA 4DY4A 2AN3A 2QTHA 2V6BA 3OP4A 4RY8A 1G64A 1HC7A 5E7MA 1HE5A 4CLHA 2WG0A 1JIVA 1W36D 4OQDA 1AE1A 1DEKA 4IEEA 3R8XA 4LTDA 1SA0A 3E15A 2NTNA 4B32A 2QAGC 1IJKA 2M1XA 3N1UA 4RJKA 1XRRA 3C39A 1NRJB 4R7ZA 1NXOA 1UBJS 4KFTA 4UQOA 2HWYA 3SNKA 3R4VA 1MPTA 2IDMA 4PFJA 4IF6A 4EENA 2IXGA 4BAGA 4ZGBA 1FEZA 4S05A 4WNAB 3WGOA 1NM5A 3W6UA 4RTJA 5H0IA 1KXJA 4OXXA 2IXBA 4RBNA 3AR5A 4N0QA 4L27A 4CDNA 4XDHA 2B82A 4YAFA 4DTIA 2I2DA 4Y2RA 1N8NA 3DP9A 4KPUA 3ELWA 3SBXA 3LAWA 4TVOA 1JPNA 5HTKA 1LLQA 2FPRA 3B3FA 1XFAA 4Q3DA 3EZ2A 3A3OA 1LCIA 4K6FA 2Q45A 2O2CA 2PD4A 1YQDA 1DLJA 3BGVA 1PGNA 1X3SA 1H9AA 3L93A 1BC5A 3BSFA 4RXUA 3AGQA 3VR5H 5J4YA 4JQYA 4MQMA 2FEPA 1KZ6A 4C6SA 3KSZO 3UJ6A 4W5JA 3OQNA 2O0HA 1E64A 2BZGA 2I7XA 4POOA 3A04A 5IASA 5IVPA 3H2SA 1AHNA 1U3CA 5DRTA 4ML3A 4Z4IA 1LW7A 2J0EA 2WR8A 3C3JA 1SXJE 5CLLA 5ALQA 5CBKA 1M6YA 5CFPA 1NNUA 3UG7A 1HFWA 3FF4A 2C54A 1WWKA 3LBYA 4NCIA 1JJIA 4GSKA 4DLSA 4HX5A 5B2FA 4UU8A 4MA5A 1HLPA 2DQ4A 3C3YA 4WJLA 1WB9A 4ZD6A 4NFYA 3RUIA 3OZGA 1FDSA 1CP3A 1RAAA 3CCFA 2PGNA 1CBUA 1VPWA 2Q1SA 1M76A 1KFKB 3CY6A 4NL4H 2GCOA 1KORA 4U00A 4HEJA 2I33A 2XWJI 3KSAC 4I9HA 2B83A 1UOEA 2YVAA 5JYBA 1WMSA 3TL6A 1FMFA 2XJ9A 4O4IA 2HRZA 3S6JA 3ENNA 1M83A 2OD7A 3MD9A 2FQYA 3VX4A 4OM7A 1T2CA 4KMOA 2XECA 3JZDA 2VZ8A 2P2CA 2G72A 4TZKA 2J09A 3HRIA 1T3SA 4Q9AA 2BC9A 3T9EA 4MRRA 1AZTA 3IVXA 3N9IA 4NJMB 3VPCA 3L1HA 1OYVA 4BUJA 2YKGA 3ASZA 2CNKA 2QUZA 2AF3C 4DPMA 3GAZA 2BJVA 3ESAA 2X0RA 1OLOA 1UXHA 1GLVA 4XASA 1M1UA 1TVEA 5J1TB 2A0UA 2QHXA 1Q6YA 3MT7A 3EPHA 1SUEA 4BQEA 3ELYA 4O2BA 1O3YA 2BTEA 3AVVA 3M3PA 1E2QA 2OXIA 5MN5A 3KKMA 4F4DA 3WQHA 1GVHA 3UWSA 3INRA 1HNNA 2WTAA 4GYWA 2HT1A 4OHWA 1CKEA 3E5HA 1V5IA 1ZWKA 1FFAA 1U2QA 3CPHA 4HFMA 4OY3A 5I7WA 5KNBA 5LUAA 3AIIA 3PA8A 4TVSA 2CNWA 3IBFA 1BX1A 1OWPA 2ODTX 3VDQA 2LDBA 4OLBA 5EC8A 4E03A 4BC1A 1DAOA 3OKFA 4QU8A 4C0JA 2NP7A 3QA3E 3DQPA 3G02A 4E30A 2R1VB 3MCTA 5KNCD 2UZ4A 2I6GA 1K0FA 1VRWA 5DTRA 5JR3A 4F38A 1SKQA 3AM4A 1G8GA 1QC5B 4IDBA 4JH0A 4AXXA 3PHBE 3WLQA 3DXZA 4EATA 4N65A 4M8IA 1ETUA 1H0KA 1JQJC 3UK2A 5K01A 3HYSA 4OO3A 1P8JA 2AJLI 3AR6A 5C1IA 3CCBA 5T4EA 4QLAA 3U9SA 2C99A 4YY3B 4KPYA 4J0QA 2JGKA 4RIEA 4ROTA 3WGJA 5GTDA 1HL3A 1K8QA 2PS3A 1C14A 3M2TA 4GS5A 3Q40A 2XUPA 3ZPXA 3MHPA 1YZUA 2OCBA 3KKLA 3TEJA 3PIRA 3ROMA 4GG1A 3T3PB 2VSFA 3UGJA 3GYGA 5FBHA 4WCVA 1M0WA 4JQSA 2AOVA 3GFRA 2D2VA 3KXDA 2QMHA 4MVXA 3H19A 5EIOA 3PTAA 1EDEA 1KE1A 3AL0C 3HA2A 2Z1NA 4IMRA 1KI4A 4YT2A 2YNMA 4IQGA 4MWBA 4R98A 4LYDA 1WAMA 2YQ5A 4G56A 1XA3A 1YRAA 4RCVA 4CCAA 3F6SA 4KVFA 5AQ1A 5BWCA 3ESDA 2O8BB 1RADA 4L8VA 4XQ0A 4ASUD 5DX1A 2GEBA 2ZXEA 4PU0A 1L1QA 3OZCA 4JASB 1Y4SA 1GGVA 5TGDA 3GP8A 1GRNA 1S02A 3N8KA 1W4CA 1OLXB 3K0CC 2YV1A 2E37A 3A3PA 4FZRA 3O73A 3AU9A 4YWJA 1L5ZA 3B9BA 4Y2GA 1KMMA 3G2OA 4N18A 5F7XA 2ZR8A 1G41A 3IQHX 1HL7A 2IHVA 1K5HA 4UE3S 4G4JA 4K9OA 4KWEA 5F76A 2OYRA 4EHJA 3GLGB 3BRWA 4PG6A 4YPFA 5KSZA 4FNAA 4C0AC 5FTLA 1CUYA 1X94A 2HF8A 3NO4A 2BRUC 4JSRA 3E0XA 4D4IA 4ZVSA 1PWHA 3GLIE 6Q21A 1CQIB 1MO4A 2AG0A 5G1OA 1VE9A 3JYHA 4DMFA 2EP5A 4AWXA 2WUFA 1Z5WA 2DEUA 1YE8A 1WMBA 1C1DB 2AX3A 1TTQB 2IX3A 1DJQA 4KX5A 1EFLA 3NXKA 1XSEA 3PKIA 4OHRA 2HDNB 2JD1A 3GJQA 1UQRA 4HWGA 4PHGA 2RI1A 1P5ZB 3PD0A 1Q91A 4FW8A 2BFMA 4X1IB 5C52B 3OCZA 3FETA 4OP2A 5ARDA 1N5KA 2P40A 3GPBA 3Q3CA 4QA9A 1J0XO 2PMFA 1LNZA 5IM4A 2IC5A 3UJ3X 1N2SA 2XUZA 1OZAA 4HLUA 3UENA 1EJ2A 2JEYA 1K7SN 2WWWA 2R1VA 4M46A 3B6ZA 4WA7A 1OI7A 2NV6A 3S8EA 1EMDA 1FSGA 4GICA 3DDUA 1QTNA 4BEBA 3TH5A 4EKEA 1HTTA 4ARZA 3AP1A 3EVAA 2IQ5A 4R5MA 1UPBA 4DV4B 2WOJA 3H18A 4F11A 5I9TA 4OK5A 1G18A 3STXA 3UK1A 1RACA 1HDGO 1N5OX 1IOVA 1ZRMA 2DLDA 2CT8A 1T1GA 5I9NA 1N92A 4JJ8A 4D74A 2X0KA 2WUWE 2OB2A 1NDQA 2YWJA 3FFTA 4RK4A 4NU8X 1TK9A 3LGAA 4M0LA 2ZITA 3IKLA 2C9CA 4MV5A 5EKTA 1M1YB 3BHJA 4BP8A 4RU1A 4D4JA 1MW9X 2B6NA 1QP8A 3WYFA 4CLOB 3D3KA 2CXHA 1UFOA 5F64A 1EGQA 4ZVPA 4ARZB 3IBCA 4E6PA 1ISFA 3N8HA 3VJLA 2Z9BA 1ULZA 5IJXA 1E2IA 2YXPX 4Z1MD 1GWNA 1S6YA 5KTKA 1NJ6A 5CNKA 1OLXA 2WZQA 1OTYA 1NJFA 2J6CA 3PVCA 4HDKB 4M1ZA 2JJ1A 5D86A 1DAFA 4DLKA 2IJGX 3N70A 4JK3A 4J2OA 4DLXA 3FBGA 4WUVA 4YJGB 4YYEA 5IU6A 4LOJA 5IWCA 1UOPA 1PJ3A 2PKXA 4L8WB 4KR9A 5B55A 1KOLA 3ZDBA 1JIXA 1I80A 1YDWA 1R4NB 3ECCA 4K3VA 4L5AA 421PA 1RLJA 1K6IA 3DAHA 3OD5A 1PDOA 4B6FA 3UKJA 1ZJ5A 3D31A 1OMOA 4OG2A 4QFCA 5K0FA 1VA4A 1XCLA 2A4MA 2VUIB 2ZI3A 5GJCA 1KY2A 1BEZA 5HIJA 1ADYA 4IMJB 5HKBA 3NWJA 1KJWA 3UWDA 3ZTWA 3BWEA 4QTZA 3IMFA 4KH0A 4IZIA 2BKAA 1RIFA 4P0PB 5EQFA 2QORA 3K71B 1VBKA 4ND8A 4K9KA 3EY9A 4WOPA 4BQFA 3KNZA 1B8UA 4YJ3A 2OORC 4YBRA 3T0FA 4NE2A 1L1FA 5D7NA 1NU6A 1AB5A 2VUSA 1Y1SA 1RJWA 2FXVA 1V47A 3B6IA 2PFSA 4KQ9A 3EZ9A 4PY2A 4JSTA 1PI3A 2WOOA 4UU1A 3EDOA 4MW0A 4CLEA 4EB8A 4EPYA 1U1DA 2OVFA 5TMDA 4AXBA 2LE0A 5CCXA 2NAFA 2R44A 3VNBA 1TT7A 1OGIA 3QJYA 2RJNA 1FNCA 4L4RA 4IDAA 1J7KA 2G4LA 1KC1A 5JDIA 2B92A 1XWWA 1G9XA 1QV6A 1RPTA 4DABA 4IIHA 3O5AA 5D01A 4DIMA 4EAQA 3GJ5A 4F1WA 3AHGA 2O8BA 5FOWA 2BSXA 1DJPA 2BHTA 2J3JA 2ZYWX 1XD8A 1CSEE 2OQIA 1K86A 3SHQA 4RWEA 3KWJA 3L0BA 2F3UA 4OHZA 3PS9A 4R54A 4S12A 4YT8A 2ZUBA 3MNFA 2NSYA 3H04A 4IILA 3H9QA 3KYDA 3ZU2A 3LWNA 4C3VA 3IC5A 3RJTA 1TZKA 4LZJA 1CG6A 2CLSA 1GFWA 1R6TA 2NXJA 2PO7A 3BICA 3G2IA 1JMYA 1N3IA 4KN6A 5EP2A 5JALA 3OO1A 3I6YA 1G7SA 1ZS9A 5G0SA 2HQBA 1DWPA 1E77A 2P4SA 3KQTA 3IS3A 4EQZA 1U1IA 3SMVA 1YF3A 1FFXB 6REQA 4A91A 2QSYA 2RGAA 2BBOA 3U1BA 1DIAA 3I09A 1SWWA 2COKA 3WFJA 2B5WA 1N33B 5IC6A 5HK9A 4PFQA 5LUBA 2B7CA 3JALB 1RE1A 4BMPB 5DN9A 4WACA 5T3UA 1QYXA 1DTSA 1MLDA 1WTCA 2BH2A 2ZM5A 5AJZA 3KM0A 5GMOA 2FX5A 1YJAA 3Q3GE 3Q88A 4BO2A 4LHSA 4HH3C 5IRCD 1Q7BA 1SBCA 1ZOOA 3D5EA 4X8LA 4C2TA 1D2GA 2WD8A 2GTHA 4OH7A 3R7LA 4O2AB 1JHAA 5K4HA 3LDUA 1MPXA 5FEMA 3ET5A 5DHUA 4MV6A 3ZCQA 2C96A 2W0MA 2UZ1B 4M1KA 4FNOA 4RTLA 1VIDA 1PG2A 3B36A 4TXNA 2Z8YA 3JZIA 3CWQA 5A6SA 2WPDA 3P8ZA 2W6MA 1F14A 3H5IA 3DKPA 3RBZA 5BT8A 1O95C 1R4NA 2CUTA 2SKDA 2FQ1A 3AP2A 2Q3JA 3E03A 4MCIA 1H4TA 1PD0A 1U0HC 4OIFA 1FZQA 2G8NA 3OTIA 2A58A 5E4FA 5HKAA 1EXVA 2C2KA 3TXAA 1RKVA 2J0UA 4DJAA 5F5NA 5FBWB 2CHEA 1UC5B 2R96A 2CCGA 2ONKA 2OCIA 2GJ4A 1VB3A 1QBGA 1U28C 2X42A 5EJFA 5IXJA 2ES4A 2X86A 3C2QA 1C0LA 3QEJA 4JQCA 3UT5A 4DA7A 3AV3A 1F7VA 4AJNA 2YWDA 1RRMA 2BAGA 1L5GB 3MMXA 3UOAB 5EJ5A 5JMTA 4Y9UA 1HT3A 3EFEA 1TYAE 1FQWA 1TX4B 4HCJA 3I9FA 4YNBA 2WT8A 3RSCA 3NVDA 4RJIA 3TSYA 3VZCA 5LQDA 5TS2A 3L1KA 1VJCA 2NU8A 2R4QA 3RYIA 5AVVA 1ZOPA 3S55A 2NNWB 5AM4A 1P6UA 1HDIA 1YE3A 2APJA 2GTIA 3EGIA 1YZQA 4BCBA 2FUCA 1U2RA 1QH0A 2Q5JA 3QTTA 4QYWA 4MEJA 2ECOA 3N0TA 3BSYA 1Z4OA 4YCLA 4YECA 4BJ5A 1NXXA 1TEVA 2JJ1D 1N2EA 1G5HA 3WBKA 4TM8A 4BMOB 3UPDA 4PBTA 1SCQA 2PD3A 4LOHA 3CLRC 3NALA 2A7QA 4MTLA 3WC4A 1Q2XA 3QY9A 4KV9A 1EXNA 1TM5E 3ROZA 5CLHA 4JJ7A 2OKGA 3H7IA 1NATA 1KVQA 2BL4A 3OPXA 4LX0A 4HYQA 3P9YA 4OYYA 4DQ0A 3FPCA 5CJ2A 1PZGA 1XD9A 4MYHA 1FZTA 2Y66A 2WTXA 3QPBA 4HT3B 2CY0A 3S0JA 1QJCA 1S8NA 3AC0A 3RH0A 2ISCA 2VTDA 3F8SA 3LQ1A 5K0ZA 3A31A 2IXFA 4K86A 2FZKA 3MRTA 1IOLA 2B99A 1QV7A 4QXOA 1X8XA 4UMFA 5A0TA 2QL5A 1NSTA 3LCCA 4L4SA 1EFUA 1JA1A 3X1DA 1G8JA 2XBLA 1SVIA 4QHTA 4CF5A 5BMVB 4U7WA 3SZ3A 5A05A 4E21A 2V65A 4U7DA 3N2LA 3OZAA 4IOKA 3COZA 3IAEA 5AXBA 3OQPA 4U6NA 4C01A 3PITA 4LFBB 3A8TA 3L7AA 3PD7A 1EFCA 1NNI1 1P7CA 3LL4A 4OEHA 3TCKA 3UUGA 1UC9A 1UM8A 5CT6A 3V8MA 1X7XA 4F56A 1BKSB 2VPWA 2HLDA 2XCLA 3PFKA 1O4VA 2XWPA 3A4NA 4JT2A 1EWKA 2VDPB 1L5MA 5JBNA 1XKTA 5LXTB 1WQ3A 3CVWA 3BS4A 4L8LA 4KC0A 3OX3A 5EEGA 3VKFA 3QXJA 4ESEA 2GF9A 2PWZA 5D5QA 3TSZA 1HQKA 5JSYA 4BMXA 1UKYA 5BURA 4XIFA 1E9VA 4WNCA 2W6NA 4AKEA 4YUZA 5YASA 3MS7A 5LYJF 3IVAA 1QFSA 3P0HA 1K3FA 3E9EA 1UK8A 3GFVA 1I24A 2AFHE 3AW8A 1U1EA 5LBIA 2M6KA 1Q74A 3LQKA 4MDYA 4LMRA 4IIDA 1OFIA 4JYZA 3TGLA 4HH0A 1NQUA 1C3JA 1MDBA 4OBEA 2YN4A 3PFWO 3R5KA 1C80A 4NBLA 4PGMA 3JRNA 3WXMA 3V7UA 2CDBA 4EYOA 2CCJA 1U7XA 3H5LA 3BBLA 4Y2VA 4CKCA 3K35A 2PQ2A 4ER7A 3WIBA 3GGGA 1TEHA 1MDFA 4R1QA 1LLCA 2GHRA 2QX4A 5F1YA 2BBWA 4YX9A 3JQ9A 1F1BA 5EGNA 3UTDA 3FCSB 1JL3A 2XCOA 3SG0A 5LP1A 1N6LA 4NWIA 5IZCA 4AMGA 1KI6B 1LPSA 3EG9A 2CXTA 5NLLA 1FSFA 3VBCA 4MUBA 1UJCA 1EK6A 3SZMA 3K30A 2BFDA 3WJAA 5JBQA 1US8B 1YS2X 2EQ5A 3E6AA 1MEJA 3MA0A 2ZXUA 5D5PA 3M6WA 3AKDA 4KQFA 2FP3A 4W9NC 1L5OA 2E48A 1WXHA 3GNQA 2WYUA 3HV2A 4KTTE 2FSFA 3RJZA 3ZEAA 4X91A 3WZ2A 3ZS9A 2P75A 4DAEA 5ANRB 2B34A 2GKOA 1JAXA 5HHTA 4FLMA 1QH8A 3R0JA 4QUAA 1SVUA 5LBTA 1IWPB 4B6RA 3D1LA 3E5RA 4LCEA 4YAEA 5IH3A 3WGUA 721PA 2VT6A 3LMKA 4K2HA 1WPXA 2WJJA 4P7KA 2G08A 1W2HA 1Z3IX 2D1SA 3CG4A 3LV8A 1U0GA 3OF5A 5DBFA 3DTYA 4ID3A 4ZALA 4PSVA 2OV6A 3U26A 1AUOA 1SU4A 4IIFA 4MQ4A 2XE7A 5SV2A 4AJKA 3ZHQA 3Q72A 3ZDDA 5JHGB 5LR6A 4DM3A 2E5WA 4IL5A 4UAJA 1P45A 2REOA 4F2GA 4B4DA 1OQAA 3GXOA 2FE1A 2I2AA 1OT3A 2IHZA 5AM3A 5CA1A 2OFFA 4JC8A 3E7FA 4ABYA 1P62B 2HJRA 3D8TA 2X14A 1I33A 5IJ9B 4PM4A 4R2KA 1HFEL 2EFJA 3PQ4A 5A5VA 3NNDA 3LHFA 1M34E 1Z0DA 3DC2A 4PX2A 5DK4A 4AZSA 1WQ1R 4MEBA 4CFYA 4JLAA 2X58A 1W4LA 4EW2A 4FQ7A 3TE6A 2HHHB 1E2DA 1SG6A 2HXYA 3UA4A 2HHCA 3A9UA 1YR9A 3KAJA 4W5WA 2BM8A 1GV1A 4XGIA 2JI8A 3FXAA 1MAWA 1Z6TA 3V9AA 3MFQA 5DRYA 5FUWA 1Z88A 1LS6A 2C3YA 1SEVA 2E21A 3Q6MA 4DZTA 1U1CA 3HBFA 2V9ZA 5GIOE 3CVJA 3LLMA 3SIPA 5A9SA 4YP0A 4II2A 3FTEA 4EAAA 5FLXA 1JFVA 1KEUA 3KVNA 2R1ZA 1S2MA 1X39A 4QBGB 4RVFA 4MUYA 4H3VA 2E1PA 3VXKA 5JC8A 2WG1A 1ST2A 5BVGB 1U0EA 1JLLB 2ISSD 3NT5A 3VV3A 3DOIA 1YVPA 1AMUA 3NT2A 4GOKA 4Z2AA 2Q3MA 3A9TA 3CKLA 2CLHB 2O0LA 5ENDA 2TYSB 1CZRA 2DFNA 4FR5A 2Q4BA 5FPYA 3HUFA 3NEPX 1TQDA 2H2FA 2XVZA 3I30X 1BFKA 1J07A 3ILXA 3LT0A 3P0EA 4MWSA 3B85A 4ND3A 5DN6A 4AROA 3FSGA 4FSHA 3NETA 3DVRX 5G3ZA 2I6XA 3D6NB 5TX7A 1E9RA 3D3WA 4Q7QA 5JLJA 5F2NA 5TF0A 1W1IA 2FPWA 2QOEA 3ZWWA 5KU1A 5L4NA 1A69A 4RCZA 4OV6B 2LWIA 4BMYA 2I3ZA 3D64A 3PL5A 4DA0A 4W8GA 5L95A 1GUFA 3TGWA 4R1TA 1XTPA 3KUKA 3O4RA 1E7QA 4ETWA 1O57A 1ISHA 4JB2A 5FLEX 5AW4A 2J6HA 5K0JA 3RHFA 1NMQA 2ZRLA 3R3VA 3TOVA 3TRJA 2XCQA 5KTYA 5LU9A 3L4EA 2A5DA 4ARBA 3T5CA 1UJMA 4Q9HA 2FX2A 3PQ6A 4B6JA 3VNVA 3M2PA 5DU2A 4BNJA 4BRSA 2P5SA 5A7FA 3VYWA 3WMGA 1JR4A 2WDZA 3A37A 2OZLB 5AI8A 1T8TA 2VYCA 2NUBA 4OAOA 3B3JA 5ADUS 2WWYA 3GRUA 1W581 2E4XA 2RGCA 4KQWA 1DRUA 1YMQA 1EP1B 4W5NA 4CR7A 1RM5A 1ZA1A 2HJHA 3OTHA 4ZEOA 4HZIA 4MI9A 5E2BA 4ZDJA 3THXA 3HK2A 2K87A 4I4CA 3BL8A 4IOMA 2XUJA 2JFYA 3HCPA 1KYIA 2X2PA 5JV5A 3ZWBA 1VECA 2EFDB 1BWSA 3E18A 2HMAA 1V3VA 2QKYA 2YINC 3FCOA 4KGXA 1RC8A 4K6HA 2PSEA 5KDOA 4OHXA 5DTQA 3WK8A 4DT1A 3GGSA 1WPGA 4IYJA 2XA9A 1UINA 1T9ZA 5EJ6A 2IE0A 2F7SA 2I2CA 1NW8A 4YRFA 2JD0A 1U0SY 4TT8A 4EKNB 2JBAB 1GU0A 1VE7A 5CVCA 5AW2A 2IXDA 4GPIB 4NXMB 3BT7A 5JH7A 3SWWA 2NVUA 4PYKA 1AUPA 4CM9A 9GPBA 1GZ7A 4P81A 4QGFA 2J4CA 8GPBA 4KITB 4CG0A 9MHTA 1TCCA 2VPPA 5ITVA 3CLUD 1E9FA 2O1SA 1L8QA 1HM5A 1JU9A 3ZWPA 4AUKA 4WN3A 1PWXA 1Y6ZA 3RDPA 5TQ0B 2QTLA 3COYA 3R9KA 5CB0A 1NZDA 4TTTS 4I3GA 5HNKA 5HA5A 2LTAA 13PKA 3GJ4A 3IDOA 3MC1A 4LAFA 5M29A 2AJTA 4D9HA 3V48A 1V9SA 3DJYA 2XYRA 1UUFA 1VE6A 3EA4A 3I9KA 3AUUA 4HMQA 3ER8A 4DEVA 2X7HA 5ALRA 4YRQA 1D2CA 4P92A 3UVEA 3N2KA 2ZSAA 3OEHA 4QAQA 2D7DA 2K4MA 4UXIA 1K3UB 1BGVA 2C04A 3QZUA 4CUKA 2W48A 1MNQA 1JYFA 3PWTA 2UXBB 1I2MA 4TRJA 2H4YA 4WXRA 4CV3A 4F3NA 4V02A 1EGMB 4IG4A 4JLPA 2QG4A 4MITA 3N39C 3LY9A 4RZ3A 3TRIA 2R8OA 2FNAA 2VQ6A 5BPHA 3IILA 1NI4B 3EXIA 5KOIA 2BKUA 1G3MA 3W2HA 3WYGA 4HDMB 2YS7A 4PQEA 5EMLA 1CR1A 5EHQA 1Z39A 4NJEA 4YRMA 4FGJA 1MJHA 3RVOA 4ND5A 3IP1A 4NBKA 1V7CA 4EJFA 1EDZA 4LDZA 4X1KA 2OCKA 3LXMA 1BN6A 1SC3A 1V7PC 2E87A 3QVOA 4FEEA 1T4DA 3OIWA 3KOOA 1FF9A 1G5PA 3TRKA 3WAGA 1GSIA 3RRBA 1RR6A 1F0PA 4L57A 3KTFA 4ER3A 1XMVA 5KVVA 2QTZA 1W59A 3EIFA 4ZT4A 1E2JA 1NVKA 3MM4A 1O9BA 4OKSA 2F3SA 1UEJA 2W2QA 2WVAA 3IPLA 4JYMA 3FZNA 4FWIB 4QUBA 2O3TA 1U80A 1WR8A 1E8MA 5TSDA 3W79A 1IM8A 3ETLA 1CJKC 4N5HX 4YCCA 1D5WA 1E8NA 1E92A 1UAGA 1BKDR 3LQ2A 3P2KA 4D46A 2Q41A 4P4TA 1AU9A 1VL2A 3L0OA 2W22A 2AR0A 3H5TA 1L7PA 4JI4B 1II9A 2VOJA 4LZWA 4IFBA 3QI2A 3KZKA 5CGZA 2WZBA 3ETNA 4EFNA 5BSKA 1O58A 1T2AA 2HHLA 2KM1A 2YW2A 3NKLA 1M0SA 3N2ZB 5K4GA 4AQYB 1I5EA 4IS2A 2HJ9A 4LTNA 5JYEA 2GWHA 4MP8A 5EIWA 1SB8A 3PLRA 1L7QA 2YMQA 1AD2A 5K6RA 1G9SA 4CDMA 4TS1A 1V6AA 1GD1O 2JIOA 3PQ5A 5HXAA 4YRDA 2W4IA 4LVNA 1FP4B 4FHDA 3DUFA 1DI0A 3DWFA 1TJ5A 2QT1A 3ETHA 4ALIA 1GLGA 4LDAA 3TIXB 5K8CA 3G8AA 1PJCA 1CP2A 3B38A 3SOZA 4K9QA 4FYVA 5H80A 1PEAA 3HB9A 1MCZA 3H9JA 4V39A 1XLVA 2C2YA 2XA1A 3P9ZA 2GARA 4ZOQI 3CJQA 3O0TA 4KO1S 1QIMA 4N9WA 4H17A 4TTIA 2IEYA 1P7VA 2QX9A 3RSFA 1Z28A 3LOQA 3PYLA 1XYGA 4AMBA 3RFTA 3O1IC 4HLDA 4B4WA 2DBZA 1L5VA 2QS9A 3W4KA 2ZCJA 5JCOC 3ZGZA 4Z9BA 3SF8A 3NHLA 3CVYA 1H0RA 2BI4A 2AMVA 2HK7A 2GFHA 4J16A 1QUEA 4NC9A 4P32A 4WESA 4A16A 2VEOA 4X8MA 3PHGA 1YBHA 2FFHA 3QOXA 5M7EA 3NDPA 3EAGA 2QMZA 2R68A 1IZ9A 2VRBA 2A5LA 3HADA 3K1AA 4FYHA 1VM6A 3L79A 5ECYA 2XTAA 3HO6A 1CDEA 1O94D 2LCFA 3JQ8B 1Y9DA 3DDNA 1DUIA 1J23A 5BQ5A 1N0HA 4R1OA 4F46A 2HMYB 1Y34E 3G68A 3UPTA 2XQIA 1GKKA 1V25A 4URUR 1T5IA 2Q7XA 3L05A 4UJ3A 1DIGA 4BYMA 3UFXA 4E31A 3COWA 1MC1A 1V0JA 1Z4LA 2YVQA 3DO5A 3DTNA 3KU4A 3ME5A 4GLBA 4GVXA 4HXFB 4MV7A 3HVKA 4PO1A 5DTMA 5E4TA 4GKBA 4QRIA 5IT0A 4Q6BA 1UJ4A 3NHJA 4INZA 1TD9A 4K28A 3ZGXA 4CWAA 4BX8A 4GKAA 4RVDA 3ICQB 4MVJE 2IHUA 4ZO4A 3FX2A 5EXDA 1LDEA 1XPJA 1DVRA 1RMQA 3FHLA 4H7IA 2NSHA 1DKOA 5FWYB 1VBMA 2WYIA 5LBUA 4Q9LA 3KJIA 4XYEA 3FNIA 4X64B 5ICCA 2ZBDA 4GNKA 3J81A 1E69A 3DLIA 4CFZA 4JI6B 2JCXA 3P52A 2I52A 1GTG1 2GBLA 2QXTA 3NBMA 4PPFA 1P5RA 2GPBA 1SH7A 1NYQA 3LCMA 1B16A 4IBOA 1TUEA 2CD7A 4OQFA 1L5KA 5CPBA 1HT1E 3GDGA 2DKFA 3PE4A 4TPKA 4KNYA 3NANA 3IIJA 1YA4A 2CLCX 3PHJA 3CHYA 1Q21A 3GZJA 4BAUA 2IGBA 2D3WA 2AZXA 4OMDA 3D4BA 1NWHA 4UMDA 4UEQA 1MUUA 2L0XA 1X7WA 4WRRA 1PR2A 2W8BB 1Z4MA 4D3DA 2VF5X 3B1JA 2VP3A 3Q5EA 4RIIA 4CXMA 1JSXA 3VO9A 1M0EA 1JR3E 4ZKDA 2CC2A 4RMGA 2CN1A 1RBMA 3EY4A 5BYKA 3OJEA 1O9HA 1C8KA 1NVWQ 3E1KA 3P4XA 4DNFA 4E7OA 2P5YA 3HB0A 3EVZA 1GFIA 1P74A 1W1UA 2I8AA 3K20A 3PXXA 4Y30A 5KNDH 3T7DA 4CKEB 3L4SO 1OGYA 3QBJA 3PZRA 3Q7IA 2A5FA 3PFGA 1VLLA 1T6ZA 2AH5A 3LZDA 5B58C 3R0ZA 3OZEA 2I03A 2R6ZA 4KI7A 1TF2A 2IYPA 5JPDA 3MTDA 1N0VC 4OQQA 4A26A 1UK6A 1JEQA 2BM1A 1ZNYA 1K7EB 4MVCA 4BIMA 1G6KA 1ZMBA 3MJ4A 5FTNA 1XJ0A 3AHFA 3ZZMA 3L0DA 5H8WA 4F3TA 5K0SA 1V37A 2P2SA 3AJEA 5EXSA 1UC4B 3OH8A 4GPTA 2RGBA 4LFCB 3MB8A 3ANTA 2O59A 1VYHA 4FI3F 2V7WA 2EEZA 3BL5A 3OU2A 1A2BA 1QGZA 3COSA 3LP6A 1OROA 2WB4A 3EH2A 3NGXA 4QC2A 2OHIA 2FVXA 3RIEA 3ZJ5A 3KSMA 4YJDA 1SUBA 2W2KB 1DJLA 3X1YA 4QQFA 3OCYA 4EB0A 3G0GA 2V1UA 2ZVQX 2J08A 1SVNA 2Z8YM 3AZQA 5K03A 2WFAA 5LOVB 2XIJA 2C4NA 4BNWA 1X1EA 1CQJB 3SQLA 1ZNXA 3M6FA 1NOJA 3PIIA 2OP1A 2ZJZA 5IMSA 1T9CA 4YWHA 4A8JA 4F5ZA 1ZUD1 5KPDA 5TPWB 4YQYA 1QRTA 1PK8A 1KGSA 2GZHA 2PGLA 1O87A 4G2NA 5D1NA 1LI4A 3SAJA 4EO4A 5HZKA 3QSYA 4AD8A 3BB4A 4ZYZA 1EM8A 2YYSA 4S1TA 4WAUA 3D4OA 4MMYB 3T3GA 5KBYA 4FMCF 2GO7A 1ZI9A 4G5XA 1NNLA 2VBFA 2UVQA 3B52X 1P1CA 2QRHA 3DS8A 3MCAA 4UNQA 3WBBA 1BX3A 1WG8A 2XSZD 2WLTA 4WZBB 2IYFA 4FNGA 1JLRA 2P65A 4PGFA 5K05A 2DBYA 2ZPUA 4DGQA 1SXIA 1ZL2A 2H63A 4WESB 3OIDA 4K2AA 2C98A 1XZLA 5JCXA 1COZA 2H1IA 1X7WB 3TQOA 3HN6A 4NTZA 4BP3A 4MR9A 1AZLA 2JLQA 4XR4A 4PSDA 2AD5A 3VVBA 1Q22A 3JQ8A 1DSSG 4YACA 1XHLA 5DNYB 2VWGA 3L0PA 3O82A 3EGEA 2LZ0A 3ONVA 4MUXA 3R6GA 2NZXA 3CT4A 3DO8A 1FVFA 1NW3A 2HU2A 4MRMB 4PG7A 3NYWA 3ZCPA 2BFPA 3NHRA 2ZTHA 5KX5B 4BNVA 5CIYA 2SHKA 4HLCA 2XCIA 4KHPB 3KYCB 3P5SA 2Z2JA 2YUIA 1L1RA 1LC3A 3A3KA 3BH7A 1TT5B 1BDJA 4I4TB 4JEHA 2IOFK 3AT1A 2J7PD 4CRWB 5C1DA 5HJ7A 5LYYA 3AVYA 1MB9A 3AGPA 3VNSA 3HCFA 4O4JF 1E3WA 1XU4A 3PE6A 2WJGA 3NBZC 1PK9A 2NZUG 2GNOA 3F6RA 3IXQA 1KK3A 3OLWA 4HQOA 4IWYA 4N5IX 1T8YA 4TQGA 3VKUA 4UDOA 2AN1A 4X63A 3B3GA 1NV9A 4PG4A 1QRDA 4FT2A 2GPAA 2XB9A 3DL2A 3ZWDA 1VLMA 4ZCLA 4C5AA 2WIAA 3IB3A 1PTKA 2WIKA 4IO0A 4LJYA 4BEJA 4EOGA 3DEYX 3T7AA 1O6BA 3VHXA 3O3NB 1YB1A 1TAUA 4UTVA 1SCUB 4NYJR 2DFDA 5AKKA 5KYXA 2E6UX 4BVGA 3FOAA 1SCBA 1DO0A 3AY7A 3GEDA 4L78A 3U5ZB 2J32A 1KETA 1FUKA 3D7KA 2Q2VA 2WIDA 2NNLD 4F0JA 5MHTA 2I71A 1YCFA 1N6NA 5B3KA 2IYLD 1X1QA 1EU1A 2J3DA 2DFPA 3CCCA 3O9VA 4COOA 5HVNA 3N7AA 3VR3A 4ZJYA 2COEA 2ZYIA 4NI5A 4WE3A 4LV8B 3I4FA 1SUAA 1VL5A 2GD0A 2PKCA 1CQZA 3AY6A 1SVKA 4HQNA 1NW9B 4L7QA 2CB0A 1CYDA 1PBNA 1ULTA 1PDWA 3EDRA 4TVKA 1XRLA 4J7CA 1T9HA 2AN9A 1PBTA 1USUA 1WP9A 1TW3A 4Y3UA 4MYDA 3SPXA 5KI6A 4DLNA 1CRWG 2X1VA 2BEWB 3DCJA 4KIGA 2ZSHA 2VDKB 3AF5A 3AL3A 4ZI5A 1MABA 3DAPA 3DLBA 1COWA 1L7NA 2OO7A 3AINA 3BTVA 5D5HA 5E0KB 5EMKA 3K53A 3R7FA 3IRUA 4DDVA 4TROA 4DANA 4IEIA 1AX9A 1YDFA 5C35A 3HYLA 3Q3JB 4LHYA 2O2XA 2ZSIA 3BQMB 1TYCA 4FMDB 4DWOA 4G0ZA 2NYAA 2A9KA 3QOFA 4RHTA 4D9JA 3MSCA 2DH6A 1I10A 3JPYA 3LX5A 4L6AA 5ECGC 4L76A 3FJOA 4FMCB 4YLGA 2PX6A 4KL8S 3RRYA 4DM4A 4MPPA 1VPVA 3AFHA 4RZQA 1I13A 5BV7A 4DBLE 4NHOA 4QDZA 1ODFA 1QDLB 3ZCTA 1HG0A 1FVXA 3HGTA 1Z26A 3OEEA 3TLEA 5AVQA 3RC7A 3AWDA 5JWHA 3JZAA 1MO3A 3ZLJA 2IWRA 4OXQA 4RIHA 4U5XA 3TM4A 3M9WA 5CFMA 3BXFA 3HRHA 4M9SA 3E05A 4AMYA 5IVKA 1MJGM 2Q07A 4XVUA 4UDNA 3WYBA 2ZT8A 2XMSA 4WZ6A 3GEHA 3WS7A 5A5DA 4MRPA 2VA9A 4RE6A 2XKJE 3HJRA 4RMIA 5LVAA 1OAOA 3LT2A 3TMKA 4NMLA 1UDWA 2B4RO 4DUPA 4RK7A 2RH9B 2YZKA 5I9SA 1H69A 1HLGA 121PA 1JFLA 2JFGA 3FI0A 3R77A 2NACA 5HDBB 1DINA 5KDLA 2UVPB 4KK3A 3T7SA 1D4AA 3F2VA 1CUHA 4Q3BA 2J45A 4R1MA 5JHHB 1H8ED 3IPYA 4KMSA 2PS0A 5DO9A 1Q1NA 4YVFA 4DA9A 5A3JA 1G21B 1KJIA 1ZXLA 1DHTA 3AVOA 1FTQA 2O50A 3JVUA 1TGVA 4CF4A 1JHYA 1EE9A 3FPKA 3KSDO 3NCTA 3QUCA 2G40A 4FSXA 4JKOA 1N7HA 1ZUHA 5DLPA 4PHCA 2HRBA 1NKTA 3BFKA 4XJSA 4YA6A 3UUWA 1ACJA 5B1SA 4IAOA 4CM4A 3RASA 1RWVA 1ECPA 1D1TA 1I7SB 3HPQA 4UCWA 1KEZA 5I4IA 1BDIA 4HV4A 3R6DA 4TT3D 1JI0A 4YLEA 4ZYXA 4C4XA 1QANA 1VLJA 2RG1A 3D4NA 2FE4A 3DYBA 3PNMA 4V0QA 1CJUC 2WW8A 2QD4A 3CURA 2F1KA 3C74A 1C8LA 2YOHA 5CVDA 1MTOA 3T5AA 3PLNA 5HFNA 4QX6A 4KPUB 2EKPA 5KJFA 3LPAA 1U2TA 3DNPA 3IAXA 5DSTA 4UUMA 1OKKA 3QXSA 1URPA 4LF6B 2YV5A 3R7DA 2PKYX 3DSRA 4XSVA 3TMYA 1K7XB 1OJLA 5GVSA 4I8DA 1UK7A 4UAUA 2DTXA 4O25A 4RPKA 4EUKA 4K0KB 3KQKA 3ZWOA 2KS6A 3MQ2A 3H75A 4EI9A 1KSHA 3C97A 1PO7A 2VJKA 2FRVA 2FRXA 1TOAA 4BO9A 3DWIA 3RU9A 3MJSA 1LXCA 3HMKA 2JIBA 4FVTA 4ARUA 1PNOA 4GPAA 1XAHA 2OLEA 4RUKA 1IL0A 2O5VA 2H1WA 2YWRA 3NAQA 4IVRA 5EKDA 4AVYA 1LVGA 1T1RA 1W85A 4M89A 3MWDA 1HDRA 2XDWA 2G70A 3RSOA 1TM7E 1KYYA 3PYXA 5KNDD 4H3SA 4ZVOA 1XEFA 1YZFA 3ISJA 3H5NA 1Z0FA 1RIIA 1Z7WA 3DPIA 2QE7A 3U9TA 3I1IA 3SFTA 1II8A 3OY2A 3RSZA 1GQOA 4I0WB 4DRZA 4TL8A 3Q1LA 2R85A 3FTCA 3ZE1B 3DE5X 5FTKA 3HWSA 3MWKA 3CZ9A 4IDCA 4CLRB 1KC3A 4DE5A 3HJFA 5KWEA 2A53A 4A8TA 2V7EA 1DIRA 4B4OA 3AHCA 3SXJA 1R4AA 1W8IA 3QKWA 3SGLA 1Y6RA 1R0LA 5CT8A 1Q1GA 4REQA 4C43A 2JS7A 5FD8A 1W8DA 2UXDB 3HJTA 4ZQCB 1HNXB 4BMZA 2QN1A 1L7DA 1L4KA 1XOIA 4RJLA 3A3YA 3NIGB 2Z2YA 4I66A 1CF2O 4XTCS 1ZIPA 3MVEA 5C7YA 2RG7A 1OLSA 1M2JA 3T7RA 3ZKWA 4EY3A 1KDTA 3FZQA 3GLKA 3EC7A 1UKCA 2XR1A 4NJMA 4B71A 4RTSA 2QBYA 1P75A 1G8MA 3PUXA 1E62A 4K3UA 4L3OA 4M8KA 1BQEA 4DSTA 1LV8A 2M32A 4GXQA 3HBMA 5HW0A 5CDFA 3WAKA 4N7MA 5B30A 4E1BA 3R7WA 3V4OA 1ZNZA 2H07A 4FFPA 4RMHA 4DV0B 1J4AA 2CXUA 1FRQA 2DUNA 1I9GA 3DVAA 1JKXA 5TQ2B 5LNK6 4WGFA 4D7AA 5KTTA 3K0AA 3EXFA 3UB4A 3W8FA 4BQPA 1KTIA 2OHGA 2CJXA 2P30A 4N8SA 1CZKA 1QZ3A 3DE6X 1LWNA 2KPOA 3GGOA 3NJ4A 5AJWA 2O7VA 2EDAA 3DL7A 5LZ8A 2IZ6A 3RFFA 4D0SA 2Y92A 4JQZA 4MUHA 4IGKA 1JB9A 3TJRA 2YWXA 3TRFA 5DYYA 3WNCA 1RP7A 1ZD9A 4C4SA 2GR7A 4HBGA 2X22A 4DREA 3T12A 2B4QA 3Q9NA 4LI0A 3GRAA 4QVGA 3WGGA 1BG6A 1WUJS 2QZZA 4EGQA 5KJ1A 1KY4A 3HE3A 1E3TA 3RFCA 3LK6A 3W5UA 4UTRA 5BUCA 1YFZA 5HIAA 2R87A 1MENA 3HVJA 3UK7A 1C2TA 2HGSA 1YKSA 4CM1A 4E1AA 1VPLA 3D02A 3DFUA 1Y48E 2D5BA 2J85A 3BTOA 4ZVUA 1W5BA 4LZAA 3ZCRA 4WTOA 3DEHA 4RKFA 3ZY3A 5AP9A 5EE5B 5DDIP 2OFWA 3SR0A 2DETA 4JJZA 1CUSA 1PNVA 1VZ2A 3IUSA 4PX5A 4LRUA 4OFWA 4QPPA 4RF3A 4E70A 1IQPA 5J4VA 2VT2A 2ZW9A 3EFOB 5TE9A 1WIWA 1WSAA 1QBKC 1K06A 4V0NA 1N1EA 3AYZB 4YCDA 5T64A 4A0GA 1W2GA 5IPFA 1I01A 2XGOA 3A9WA 1GL7A 2FQQA 3VR5D 2RI6A 5JG7A 5SYMA 4Z9XA 1UQTA 1HMPA 4GOLD 2CMGA 1WJGA 4R01A 4XPIA 2RHLA 4P0QB 2VLBA 3DFKA 4P8RA 4OH1A 4YIKA 5JS1A 3T95A 2QTTA 3DLTA 4DYHA 1T2VA 1RHQA 2B3DA 5FF9A 3SR4A 5C37A 3RKUA 2CW5A 2VK8A 2WQZA 1B14A 2JJQA 6AT1A 5GADl 3ZBTA 1GPMA 2G7MC 3O8QB 1JTVA 4FGSA 4OMUA 5KEIA 3Q9SA 4MQFA 3V1KA 2OR3A 1L6RA 4B7AA 1P7WA 2GESA 1N75A 2PSHA 2Q21A 2QA5A 1QZXA 1RLIA 3B5IA 3HFJA 3NDJA 4OJYA 3M3DA 1ZM7A 1OI4A 1LUAA 1KAMA 4Z49A 4JUIA 4JBYA 1NAIA 2GM5A 3H6KA 1N5RA 3Q5DA 4DMMA 2WSLA 4G0WA 4EA6A 1XRSB 3LHKA 2DLNA 2XEDA 3PF9A 3ZWVA 4J4BA 3O4FA 4MLDA 1Y7LA 4C7KA 3E48A 3LRPA 1V7QA 4S24A 5BNFA 3OETA 4BIIA 4XWTA 2EYQA 1QTIA 2UV8A 1Y8RA 4N3AA 3CG0A 2F2TA 3NQ41 4LHVA 4RW0A 3KYDB 3EZNA 2C77A 1DRKA 2BF4A 1Q2UA 2EKZA 2ZI7A 3AHIA 1QG2A 1R8YA 5EWMB 5IF9A 3YASA 1TZJA 2KX7A 1TQ4A 1OYOA 1E2KA 1TK3A 2AK2A 3I9MA 3KPYA 2HIAA 2KYRA 2E4YA 4M8NE 3D3EA 4O4HB 4Y9RA 2G5PA 1ZBQA 2YJ4A 4CLRA 2QUJA 1UWVA 2Y71A 3O31A 1TFRA 3DE4X 2RGYA 3I3SR 2VHJA 4Q4AB 2PS1A 3BHIA 4QG3A 5LP6F 4H9GA 2PG3A 2MYNA 3QEMA 2PSJA 1WS6A 2A0WA 2JKYA 1VCMA 4IUDS 4WINA 3NORA 1LDGA 2GXSA 5TMBA 3W3ZB 5KYUB 5C1BA 4LNAA 1ZJ4A 2YZMA 2F9MA 4HQLA 2QYHA 3REQB 3KUDA 4CF6A 5G53C 4AW9A 3MYRA 2Z3VA 3OKPA 4AJ2A 4MI3A 1CVRA 2B8JA 1KO5A 3LY7A 1FNMA 2AZDA 4MR8A 5JH7B 3BXXA 3OBBA 4E0BA 1JAYA 4CG2A 1PV4A 3B5JA 4MV3A 4QYTA 5F3WB 3NDBB 2E4ZA 1GGEA 2ZYTX 1CJSA 4XSGA 5JQGF 4DR4B 1W0KA 3IEUA 3DCIA 4JX9A 4RHEA 2GK6A 3MTAA 4RHUA 4BZQA 1J99A 4J4TA 3UWKA 3UMRA 3WWZA 3GLFA 4PSCA 1T36B 4ECAA 2BKVA 3D7SA 3NH6A 3REGA 3B6JA 1AC5A 2VTBB 1HDEA 1JFRA 2GPYA 4MW1A 3L1JA 4HWSA 3ZWXA 4J49A 4JA2A 5E9WA 2P9FA 4QLOA 1TCBA 1X6VA 1HURA 2FUG1 2JB9A 1NG1A 4QL3A 4ZV7A 1AQNA 2PZGA 1M34A 5I7OA 1NX6A 2RHTA 4JN6B 2HSGA 3OMLA 1XTUA 5FOVA 4LFAB 1F06A 2ZJOA 2B1JA 4PYMA 4OXYA 1SVWA 3ELDA 2V58A 2VZLA 4M88A 4MR7A 4Z99A 2ZG6A 2YQ4A 3SOPA 1A27A 1KFEB 2FZLA 1VSBA 1ZM2A 3H0EA 4G1UC 4XE5A 5DHQA 5KYNA 3P5BA 4HWOA 1F4PA 4ME6A 1OFUA 4R41A 4CM3A 3UPUA 1UZUA 3BQNB 3SZOA 5EIAA 4CMIA 2PJUA 3MMZA 2QTVB 1UMBA 2VNSA 2ZR7A 4KUHA 2ZJBA 3VYRB 2K7FA 3SM9A 1M1XB 2NU6B 3C41J 4P2BA 2P4UA 1YFJA 4X1KB 1HRKA 2JL1A 5TARA 4KSBA 4JXZA 1R6UA 3PCXA 4RY2A 4S3MA 1R2QA 3E58A 4FFWA 1P2DA 2Q62A 3NRCA 4JVSB 1JIJA 4NEHB 1FW8A 4PS1A 2INGX 4B6SA 2D1QA 4BZZA 4KPEC 3A6JA 5IM5A 3R74A 4J0FA 1D6MA 2ZRFA 3ZNPA 2A9QA 1Y33E 3E61A 4MR9B 3TKAA 2IIPA 5SY9A 2O2SA 1MVLA 4CV2A 2N0SA 3JWHA 4RK1A 1W34A 4AY4A 4HDOB 1ONBA 2LBPA 3BE8A 1RXEA 2AG8A 3NEAA 4NIMA 5HMLA 3TAHA 7ABPA 1KYZA 4BNHA 4LJ7A 1ULSA 4MUEA 4M83A 1RC0A 3WNZA 1HNZB 1CUUA 2KLHA 4DV7B 1N57A 5B12A 1VMEA 4H7HA 5CT4A 3HVUA 1GCIA 1EVLA 4PBSA 4WK6A 4WLOA 1QVWA 4ZAVA 3V8RA 1I0IA 1LI5A 4R8VA 2Z98A 3JVDA 5K4AA 1DJMA 3PNSA 1XHFA 1GUZA 2MSEB 3GNSA 1J0CA 1FMLA 1OAOC 3H65A 5GAJA 5A06A 1WEHA 6ABPA 1KYWA 3DDCA 4G97A 1Z13A 5F78A 3OE1A 2ZBRA 2F17A 1GL9B 4JP1A 4EUHA 4C3OB 4QM6A 1TL7C 4YMWA 2VA8A 4GAEA 4K7JA 5MDHA 2P9CA 2BJWA 1P60A 1HYGA 2Y68A 4Y1RA 1U65A 5AW1A 1P18A 1GPDG 1WHSA 4O8CA 1QONA 3LXUX 3VR2D 4ERXA 3F6CA 1BOFA 3KTOA 3LPMA 4XZ3A 3UJHA 4YQFA 4PPGA 1LPOA 1USVA 1LBSA 1FC0A 1NI5A 2XMCA 2XUAA 4G1VA 4WSOA 5G02A 4HB2A 4D9NA 4J7UA 1KHHA 3IP7A 1Z29A 4NV3A 4N0DA 4MJ3A 1Q14A 1Y7IA 4CKBA 4A2PA 3FOBA 1I51A 3N2GA 1V95A 2J3IA 2H9IA 3S1LA 3IOMA 3I2GA 4F9TA 1J39A 3A25A 2HMUA 1IXYA 3JQ6A 1CR6A 4S2EA 4D9KA 3OCCA 1BU5A 5GM2A 2ONCA 3ESYA 1J90A 1VG1A 4D8UA 1AXRA 1Z15A 2JBWA 4MNTA 4MVJH 3RWOA 1AQIA 4DY6A 1O0CA 4TS9A 3N87A 4PLYA 1FYVA 1NTRA 5ALTA 3KR9A 3SM3A 1W5SA 4H4CA 4R16A 1Y4UA 1CY1A 1L4FA 2VATA 2VWQA 2VXYA 4ZI3A 4KFCA 1OBFO 3U80A 3QA9A 4FOLA 4MS3A 3FDJA 3VYVA 2OV2A 5JSFA 1GCGA 2DFKB 1T5LA 2G83A 2WA1A 3RRFA 2BKXA 3I9OA 4QULA 1W94A 2YS6A 2J3EA 2Z9CA 1G3RA 5AI6A 5KHOC 3BDAA 4QBTA 4W1SA 1XBTA 1GZVA 1SQFA 3F96A 1KVSA 2AXQA 2IHTA 3GA5A 5C3UA 4ZEVA 4ERNA 3O2JA 5DGHA 4AZWA 3T5GA 2YHBA 2P68A 2UZAA 5NULA 3WVNA 3FLAA 4OUDA 2EF0A 3L4BC 2BI8A 1TIPA 3OOHA 2QMQA 4LISA 2HW8A 4IXJA 3MWYW 2O8FB 2K2QB 3EWIA 1WNFA 2FFRA 5BSEA 4HNAB 2I76A 4U4AA 4NJEB 2VTBA 5FR1A 1EX1A 3TXYA 4D0RA 3BREA 4KWIA 1BVRA 1P80A 3M1IA 2X6RA 3JQGA 3O38A 3HKEB 2OQVA 1Z6AA 1LJ8A 3DEJA 5CH5A 3JQQA 3QENA 3H83A 3LGXA 3UOWA 2AYZA 2A3RA 1QIHA 5E0OA 2MR5A 4KBYA 4BJ6A 3H4VA 4EZIA 2VDOB 2XX3A 1LPBB 1W5TA 3BBPA 3HY3A 4UMVA 5G4KA 4EW1A 4TWJA 5HR5A 1DBWA 4CQMA 4DLAA 5F23A 2R97A 3NLLA 2VPQA 1PW7A 4OQPA 2WIBA 1YRHA 1AUQA 3K1YA 3DCYA 4PIMA 4B79A 5AVXA 4MEAA 5CYGA 4LHZA 5T7BA 4F86A 4BO5A 1HEUA 2UYGA 4A6DA 3O94A 2QN7A 3PKZA 3R9IA 4AY2A 4WBSA 4ALLA 3BMQA 3ANXA 1DCFA 2GVDC 1V41E 2C4UA 4BNGA 3ESCA 3L9WA 4MRSA 3AY3A 2FR8C 2FWAA 3C6QA 1M2HA 1PKEA 1ZH8A 3ESBA 3I6ZA 5EKSA 3P27A 1PJZA 2ADOA 4OU5A 4BQIA 5CLJA 2FEMA 3EQ7A 3GFBA 3K1ZA 4KVGA 4EIWA 1DWQA 2EJTA 2UYQA 3EGXB 1RCTE 3OLCX 3SYKA 2AC7A 1G3QA 3JQBA 3NRBA 4CCYA 1EK2A 2HKIA 4BO0A 3FOWA 3ZG6A 2P2NA 1L0BA 1Y9JA 3QU5A 4LJRA 2FEOA 4ARVA 1F5SA 4XYMA 4L28A 2VPTA 1J5PA 2XW6A 2GYWA 2IW1A 3E22B 4MKRA 5M2QA 4LJKA 3GOHA 5ICEA 4DCOA 2II6A 3IAS6 2D7CA 2X4DA 3O91A 3PHCA 2LD4A 5CX1A 4MVWA 4F8JA 1G5IA 4H0FA 4CGZA 4QOSA 1VKJA 4NBUA 4AN1A 1H5UA 2Y4NA 1P5FA 4AZVA 2Z4RA 1TYBE 1K75A 1UDRA 2VJNA 4BQNA 1KTVA 3TVTA 4ENUA 3ETGA 2VNKA 5HM8A 2KHZA 4WL0A 5GJVC 3MUOA 4HDSA 2VXOA 4L9WA 3ECAA 2O5RA 4ER6A 4IEFB 5ARBA 4RXTA 2HMSA 3CRQA 4MYCA 4KB5A 1VSQA 2FEXA 2GWRA 2A52A 4GI1A 4WEQA 2HTFA 5IN5A 2HAEA 1SPBS 1RQ2A 4K88A 3RQSA 2VYNA 3DYIA 3RF7A 1SY7A 2HZ7A 3DUWA 3QU2A 1NP3A 3CV3A 3HCNA 4RHYA 1KDRA 3W5IA 3W7AA 1FP1D 2G9NA 4BU0A 5CFNA 1RPNA 4N0PA 5HF9A 4ZIRA 3SQNA 3QV2A 2I3GA 1W73A 4GL4A 4P7GA 1PS9A 3HXLA 3NI2A 4ZTZB 2AC2A 4F6LA 5EIEA 4C0KA 5KDDA 4V0LA 1IWOA 2FMFA 2QTMA