4EF6A

Crystal structure of mycobacterium tuberculosis pantothenate synthetase in complex with fragment 1
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
290
structure length
290
Chain Sequence
AIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated biophysical approach to fragment screening and validation for fragment-based lead discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Pantothenate synthetase
total genus 95
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4ef6A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4ef6A01
2E0IA 1V47A 3CLRC 4QBTA 3COYA 1KORA 3H05A 1U0BB 4HPWA 1V8FA 1COZA 1QU3A 3H9BA 3HV0A 1P7PA 4MUHA 1NSYA 2B7LA 2J5BA 2PXHA 4QREA 3TS1A 1WXIA 3DV2A 4PBTA 1VL2A 1M8FA 3MLBA 5F23A 5LFAA 4QRDA 3A4IA 4DNXA 3IH5A 1T9GS 1Y42X 4MLPA 2YY5A 3AFHA 5H16A 4P2BA 1PG2A 3IMEA 1LI7A 1QRTA 3ZJVA 1O6BA 1O5TA 3NBAA 4GRIA 3HZRA 2BTEA 2GOYA 2I1LA 1EFVA 2IELA 3SEZA 1I6LA 4EF6A 3AKZA 5IJXA 3FNRA 1HYBA 3FH0A 2QTNA 3FOCA 3X1MA 3IOEA 3QTBA 1KP2A 1KH3A 2QTMA 2TS1A 1WJGA 4ZCSA 2CYBA 4EFKA 2J4DA 2PZ8A 2WQ6A 1X6VA 2OV4A 3CLUD 1OBCA 4CDNA 1NUPA 3F3MA 2DR2A 5HUJA 1VBKA 4DE5A 3N2YA 3JXEA 4MW5A 1MBZA 1XNJA 4K03A 1D2RA 1M1ZA 4MW4A 2DXIA 3N9IA 1UFVA 2CV0A 2A88A 5TGTA 2QTRA 1QRSA 1Q11A 4Q16A 4MW9A 1WXEA 1FYDA 2X1MA 5DASA 1O96A 5TS2A 3ND7A 4I6GA 5JBNA 4RUKA 3P0HA 2WSIA 4ZCPA 4DDKA 4PY2A 4RPIA 3PNBA 1WZ2A 1KKUA 1O94D 3TZEA 3M5WA 5EKDA 2PG3A 5H7XA 2AKEA 1YUNA 1TYAE 3CVUA 4K0RA 4MUJA 3L93A 1GAXA 4XSVA 5AHWA 3COZA 4MUFA 1G8FA 4MWEA 4EGAA 3ZGZA 4YBRA 1ZUNA 1KQNA 3IVGA 1R6UA 3ND5A 4YP5A 3VRHA 1H3FA 1JMVA 3PRHA 2HGZA 3ZXIA 4MUGA 1MB9A 4I6JA 4R0NA 3SP1A 1WY5A 4KR7A 1K92A 1Q19A 2C5SA 2E21A 3D6UA 4JZYA 3ZJTA 1M8GA 4PBSA 5KHAA 1A8HA 3KT8A 3TQOA 4J76A 4GU5A 4MQ6A 2A1UA 2J07A 4U63A 2R5WA 1WXFA 3PXUA 1MRZA 4ZT5A 2DEUA 5DB4A 1NP7A 3I05A 4ARIA 3H9CA 2JANA 1JIIA 3CVYA 3VGJA 1K4KA 2ZP1A 4X0EA 2IP1A 1EXDA 2J09A 4KPUB 3CLRD 2HZ7A 4MUEA 1M83A 4AQ7A 4G6ZA 3A2KA 4MW2A 4DDHA 2HMAA 1KAMA 5FNZA 1JEEA 1M8JA 4R2LA 2Z3VA 1FFYA 5K0SA 2WQ7A 1YULA 1WXHA 3FETA 2O5RA 2JAXA 1DNPA 1NZJA 1U3DA 3COWA 3AIIA 1JILA 1N2HA 1X8XA 1MOPA 2GM3A 2E18A 3SDBA 2A1TR 2VTBB 5HUHA 1OBHA 2ZUFA 1K97A 1KQOA 3OTWA 4MW0A 4ZCTA 1YI8A 1GZUA 4ND6A 4EG5A 3FI0A 4EG3A 3KT6A 1PFUA 1TEZA 1SURA 4PBRA 1QTQA 3N8HA 2QJOA 3S3TA 4UZFA 3SZ3A 1NYLA 1KH1A 1J09A 4BWVA 3Q12A 1JECA 1TYCA 3UY4A 2V0CA 3FDXA 1ZJWA 1N2JA 1JZSA 1B6TA 1O0BA 2WB2A 2X3FA 1N2BA 2Z08A 4ZT4A 1KH2A 3HMQA 1KR2A 1IRXA 1JGTA 2AG6A 1TQ8A 3P52A 3X1JA 3Q10A 3MMXA 1I6MA 1U7DA 4YP7A 1G8GA 1Q15A 4Q93A 1TYBE 3G5AA 3DO8A 4TS1A 4YMIA 3BL5A 2A7XA 1NI5A 1GLNA 1QRUA 3CVVA 2QJTA 3UK2A 1MJHA 2XRYA 1IHOA 1KP3A 4I6EA 1G59A 1NUQA 4CDMA 1T9GR 1PFYA 4L2IB 3AG5A 1M8PA 2DETA 1YIAA 3G6KA 1GTSA 4YP6A 4ZCRA 4J75A 1OD6A 4HJRA 1XJQA 2PFSA 3RHSA 1GN8A 3LCJA 3UC5A 4KPUA 2NZ2A 1F7UA 1IVSA 2CV2A 4WSOA 1I2DA 1EFPA 1OWLA 1U3CA 3NBKA 2CSXA 4G5FA 4MWBA 3HL4A 5TEVA 3RJZA 2PZBA 3RFFA 1N2IA 2NSYA 2QJFA 1WQ3A 4MWDA 1QJCA 2A84A 2VXOA 1OWNA 5BNZA 1IH8A 3CLTC 4G5YA 3TZLA 1N78A 3IDFA 4AS1A 3IOBA 3A05A 3IOCA 2A1UB 2A4MA 2DPLA 1IQRA 3HFJA 4CT0A 1EJ2A 2DERA 3PNYA 3FG9A 1O0CA 5FO0A 3ISJA 4ARCA 4MUKA 5LM3A 1NUUA 1WXGA 2QUJA 3N05A 1PFVA 4MVCA 1MAWA 1NUTA 4OUDB 2A1TS 3CR8A 4E1AA 2BYTA 3P0IA 4F3RA 4MVWA 3D6VA 1IFXA 2EL7A 3H99A 4U8HA 2EJCA 2PZAA 1F9AA 3SYTA 5J58A 3CLSD 1IQUA 1MC1A 4JYZA 1ZH0A 1WOYA 2Z09A 1OWPA 1O97D 4ZCQA 5J59A 1O95D 3KT3A 2PIDA 1VLHA 3C8ZA 3AL0C 2G36A 3LE8A 2X1LA 2CV1A 3LOQA 3CA8A 1MAUA 2VTBA 1JEDA 2RD2A 3A04A 1VBNA 3QE4A 4MAFA 3ZJUA 1JIJA 1RQGA 3G59A 5TEWA 1KAQA 2AZXA 4DLPA 1BS2A 5FO1A 1CT9A 4JFAA 3RK0A 5K0TA 1GPMA 1WQ4A 3SEQA 5LLTA 1EUQA 3COVA 2IJGX 4NAUA 2DLCX 3ILVA 3KFLA 4UZEA 1J1ZA 4MVYA 3CLTD 1QU2A 4MW1A 3IVXA 1S4MA 3K9WA 3GLVA 3MLAA 4NDAA 3ZUGA 1EFPB 3QTTA 3IVCA 1LW7A 3UOWA 2CYCA 1N2OA 3FY4A 5KWVA 1JIKA 1J20A 4DDMA 2YWCA 2X0KA 2RE8A 1PG0A 2CYAA 2GKSA 4S1OA 2YWBA 3PNVA 3NV7A 1I6KA 4XFDA 1N2EA 1TYDE 2OQ2A 4ZT2A 3VU8A 3IMCA 3Q4GA 1H1TA 3IUBA 4EG8A 3P0JA 3K32A 4ND7A 3ELBA 1F7VA 4MWCA 1OWOA 4U7JA 4NX2A 1EUYA 3INNA 3IUEA 4HK4A 1MB2A 3H97A 4F4HA 3AG6A 3DLAA 4KKVA 1T6XA 3MUEA 2O8VA 3FWKA 1PFWA 1LI5A 4L2IA 3FHJA 2D54A 1QNFA 3L92A 1EE1A 4DJAA 1G8HA 1IQ0A 2D13A 1YIDA 5KCMA 3RBAA 3TNJA 1H3NA 1N2GA 3TQIA 1XNGA 1R6TA 4HJXA 1OWMA 1ULHA 1ILEA 2A86A 2H2AA 3ND6A 4KR9A 2QUIA 4FZJA 4NAHA 1N77A 2V0GA 4OJMX 4MVXA 3DPIA 1K4MA 2CT8A 3HGMA 3IODA 2QUHA 4R2MA 4EG4A 1O97C 1Q77A 2CUZA 1VBMA 1O96B 4EG1A 1T6ZA 2QUKA 1EFVB 4NZPA 4ZT6A 4XFJA 4EG7A 1O94C 5DEOA 1QQTA 3GUZA 1GTRA 3FIUA 4WNYA 2DUMA 3X1KA 4OUDA 2ZUEA 3GMIA 1WKBA 4MW6A 2D5BA 3ZIUA 1H3EA 1J1UA 3CLUC 5IHXA 4MUIA 3KT0A 3U1VA 2JA2A 1ZH6A 2J08A 1N1DA 3E27A 3SZGA 4CQNA 3CVXA 4MULA 1JHDA 1M8KA 4KR6A 1T6YA 2YXNA 3CLSC 3RK1A 4MUNA 3OP1A 5DK4A 3UMVA 2H29A 2E89A 1J70A 4JXXA 2XRZA 3ZXSA 1XNHA 1O95C 1NURA 1N75A 5HG0A 1YUMA 4MW7A 4H3SA 5J5AA 1TFUA 1R6XA 1KQPA 4ZT3A 1J21A 4ZT7A 3MXTA 2CFOA 1N3LA 3CVWA 4JXZA 4A91A 3IMGA 1JZQA 1NUSA 1U7XA 4EG6A 1F4LA 4NATA
chains in the Genus database with same CATH superfamily
3A2NA 4FW8A 3RIYA 1ZGJA 1HQDA 5L40A 2VDMB 3JY6A 3G2NA 3DZDA 1AF4A 3ZTTA 2OHVA 1FDIA 1SEVA 4XUDA 1SUWA 1NXOA 2JGMA 4H1VA 3WGGA 2V74B 4CIVA 2PXHA 4BFZA 4ETMA 1SKYE 3LC1O 2PVSA 4DLLA 1I7DA 1GN9A 5EXCA 1V11A 1TT5B 1XRLA 3KHSA 3KSRA 4GR5A 1HK7A 1YACA 2JCBA 5DWDA 2BJHA 3DVSX 3FPAA 3G02A 2P41A 1BE6A 1OIXA 2VNSA 2NW6A 3PGLA 4UOQA 5DNWA 3TSZA 4A73A 1DDIA 4B73A 1BXGB 1HURA 3O9VA 2I55A 1A9XA 3BXXA 2AB0A 3ESAA 3WLRA 2IYLD 3ETEA 1EM8A 1V35A 2WJAA 5DNVA 5CITA 1XVLA 3GEPA 3I39X 4R1NA 1EMDA 2HV8A 4IV0A 2QW8A 2DQ4A 3LRXA 4QJ3A 3MQFA 5PGMA 4BO8A 1M33A 1QRTA 3F6PA 1H1DA 2NUPB 3D2AA 4I1OA 3G5MA 1AURA 4HTFA 4JLJA 4C4XA 3P9YA 3MBIA 1CQIA 1DU4A 2ST1A 1EFVA 3UJNA 2PRJA 2BSAA 5C0OE 5TS3A 3P2MA 4RY0A 2GPBA 1F14A 3EVZA 4E11A 3AEQB 3JX9A 1XU7A 1CDDA 1Y1KE 3BILA 3DT6A 4LGCA 4B6SA 4M55A 5ESRA 5D1HA 3KPYA 3R23A 1Y8ZA 2YJTD 2H5IA 4PTYA 1SD5A 2QTNA 2BTQB 3BFVA 3EHDA 5ICFA 2C2OA 5HW0A 4QUKA 4BU0A 2WJ6A 3GH1A 1YK0A 4JU9A 1VHDA 2F2TA 1WJGA 1O95A 1GEGA 3D7SA 4F97A 4EFKA 4TSRA 3MRTA 3WICA 4L5BA 2DWPA 4JV5B 4M60A 3N6VA 1P0QA 3TLEA 3ETCA 3CLUD 4RU1A 2JB9A 1ZXLA 4JL6A 3H2YA 5EFOA 4C0KA 1K5DA 1YA6A 1OXXK 4FD3A 1FP4A 2GN2A 4MWGA 2OHHA 1IG3A 3M6IA 1FRQA 3N5KA 2FFAA 4RE5A 4ZI5A 4CCYA 2E5WA 1E32A 5IARA 2Y1WA 3VYUB 2Z8XA 3HZZA 1KY3A 4L3VA 4TSFA 4UE6A 4ZOLF 4CTKA 2TYSB 4IMIB 4U2EA 2BP7B 3CYFA 3I6BA 3NANA 4C0AC 4Q3OA 1K6MA 1YB5A 2R8XA 1GQQA 1U31A 1ZHFA 3D4BA 3HB4X 3PDUA 1EEHA 4R1UA 2E9SA 1FFCA 1X15A 4AZWA 4XW2A 5I8PA 2H5JA 4RUKA 3KHUA 5JC1A 1J06A 4NCNA 5CT6A 2IWHA 5JZVA 3DKIA 4RPIA 2OXIA 1JV2B 4EA6A 5ABPA 3KAQA 4U2KA 3TZEA 3H1PA 4A03A 1IAQA 4DS3A 4OQNA 2DFDA 1TYAE 2Q9BA 1L8QA 3MT0A 4RX1A 4CM8B 1MO3A 1SCBA 3KUDA 5I45A 2WJGA 4HNVA 2GRAA 4LOKA 1MB4A 4LJLA 5JI3E 1QPZA 1O3YA 1DAEA 1GAWA 2RONA 2W8BB 3CJRA 2TMGA 3DJYA 3P5SA 5JJIA 3JPYA 2B1RA 3IVRA 1AUXA 1JDVA 4KV7A 1UQUA 4O4IF 4YQEA 2WY2D 3V32A 5DI9A 2A9PA 4D5EA 4Z4GA 1LDYA 5JPCA 1IHUA 3FCEA 2P6PA 1ADFA 4G85A 4K9PA 3C8DA 4Q1CA 2VPPA 1NI3A 2I2XB 3RADC 5I7RA 2GAAA 3AC0A 4HVTA 5TMPA 4DNPA 3O8RA 1ZHOA 4LJRA 4QPJC 2OCXA 3DOHA 4JUAA 1AM4D 1SZJG 5J2TF 2FJ0A 4ZOLA 2NV6A 4Y1GA 5BQ5A 3G2OA 3ADDA 3DFZA 4IZIA 5AK4A 2G04A 2GBPA 2HUNA 5AHXA 1NJ5A 5K3SA 5C35A 2AFRA 2R5WA 3THYA 4P0PB 1Z39A 5HRAA 4FLFA 1HNZB 2OENG 1VLQA 3CZMA 3EC2A 4REOA 1QGZA 3QITA 2F9MA 3KE9A 5KOJB 3UW3A 5KSOA 3FUTA 3N0XA 3PE3A 2YNMA 4HEQA 5I8WA 2IHVA 1O87A 2XQJA 1JKIA 3SMQA 2ZZKA 2D8AA 3A6HA 3RAFC 1GITA 2A9JA 1FX0B 4JLBA 4M0LA 2ZBRA 2NPFA 3R7FA 1YV9A 1XYVA 3E9EA 3D8UA 3DZ8A 4M88A 3O4GA 3UKDA 1PHRA 4CKEB 1Z7BA 2OC4A 4O4JB 1XR3A 4YRIA 1CTQA 5JS2A 4PZAA 2H52A 3MPOA 3PNKA 4MQMA 2FPUA 4B75A 5IAEA 4EDHA 5JEEA 2BUAA 3U4QB 4UM5A 5AXAA 5AQEA 3KB2A 4NJMB 3WNZA 1M8JA 1J0XO 1D2HA 3LLMA 3IAAA 1RZ3A 1QQAA 1WXHA 5AKYA 3FETA 1KTVA 1NTOA 2O5RA 3CKKA 4NBWA 3LUJA 1JKMA 1WO8A 3C6YA 3K6JA 1YCFA 3M3PA 3HXLA 4FHCA 3COWA 5H83A 1SHTX 4X20B 4MRRA 4CM4A 4WASA 5J3JA 1DAGA 3OSZA 3U6BA 2AL7A 3RYFB 3FUVA 4BBZA 5FBHA 2IXEA 3KJNA 1J6UA 3ZCRA 1ZR4A 1WHSB 2I67A 2YV3A 4LHXA 4AK9A 4B0PA 2ZM5A 2B3TA 1YI8A 2I7TA 4IV5A 3K2EA 4ND6A 1UC8A 5HIIA 4BVBA 2I65A 4Z7OB 4CMGA 5IBCA 2C54A 3B1KA 4C0BA 4YPVA 3KVYA 3RTCA 4HUQA 3A0RB 3ZOZA 1JP7A 2CXRA 3U4IA 1CNMA 2WWWA 4N03A 2SNIE 1ODLA 5J2UB 5I47A 4PTZA 5JYCA 2C57A 4DRYA 4XM2A 3BWBA 1UJNA 1TZMA 2XWBF 4O4JF 4UQPA 5BR4A 1MZVA 1DHTA 2MDTA 1ZCBA 3BOSA 1HE5A 5GVRA 1JECA 4ER6A 2ZSHA 4ATNA 1KVUA 3H75A 2C58A 3SJ7A 1XL0A 1B6TA 4J4TA 3I34X 2UVDA 4I2VA 5H3LA 3AERA 2VR1A 5DGIA 5HDBB 1JKJB 4EPTA 4DUZB 1S0UA 1COWD 1N7IA 3S1AA 1N5OX 1I6MA 3EOAI 4JSTA 5FJIA 1GL3A 3LY5A 2VJBA 3ROPA 4KE9A 1KZHA 1W36D 1BAPA 4F3CA 3BE4A 3SIRA 5BSKA 3T3DA 5I9IA 5IULC 5AJZA 2QORA 3C7AA 3MWKA 2ZBQA 1OLUA 2I4OA 1GLNA 1UBNA 4B32A 3R6WA 1BQEA 1MABA 2WLTA 2YN2A 3I3OA 2QGNA 3UPUA 1KK2A 1X1EA 2OMKA 1W2WB 2XRYA 4YMLA 3RVLA 2IS1A 1VHTA 1ZCZA 4JJ7A 1VIVA 1T9GR 3DWIA 3ABOB 1VSVA 4JB8A 4U2BA 2PGIA 4FDVA 2VPZA 3OOSA 4LDNA 2BOVA 3R74A 2HSEA 3U3RA 4GLFA 5CCEA 4JBWA 2EU8A 1KWKA 4OG2A 3R76A 2P30A 3RJTA 4B09A 4F1JA 3WGIA 4QRIA 1AC5A 3WLSA 1XZ8A 5JBQA 3TJZA 1SHJA 2NVWA 3TQFA 3S2GA 4PZPA 2WIDA 4OP2A 1DPFA 1QFMA 4LC9A 1AUPA 4XD7A 2HU7A 3R4CA 4ZO4A 3TSAA 3VR3A 1I0LA 5M3BA 1R0RE 3DMYA 4K5QA 4ZMSA 1RHQA 1EVYA 2YYAA 1Q44A 3GXBA 2PSHA 1D0IA 1ZS9A 4KQHA 3SDZA 3C98A 2PPLA 2YJZA 1H2ZA 1Y82A 2MMGA 1UDRA 1VI6A 3BGVA 1XCMA 4JHXA 3ZNQA 4IQ8A 1QO0D 4DV2B 1N8TA 4JU8A 2VXOA 4HNTA 1KEZA 2YZGA 2G77B 2ZDHA 3O8QA 4XVHA 1XUOA 4CQMB 4NS4A 4M1YA 5I7HA 1U11A 1EI9A 5EWJB 1IM5A 5CB8A 5A0FA 1FRVA 2CHEA 4DGSA 5IKPA 3FZGA 2ZWOA 3H13A 4KH1A 4R69A 1B8PA 2CLSA 3KUUA 3GT7A 1WW3A 3MJFA 1KYWA 3IP6A 4N65A 4UPEA 4ZV4A 2QAGA 4PLPA 5JWHA 5KINB 2J0EA 3ISJA 3CEJA 3TVTA 3V97A 3QW4B 1T0BA 1NUUA 2HWUA 4R2JA 3H87A 5AKJA 1I2BA 2YIVX 1G9XA 5EKUA 3NBZC 1OJLA 2H5EA 1PWEA 3ZJYA 3UJ9A 4CKWA 1GAEO 1J56A 4WLNA 1KRHA 4YIHA 2JJ2A 1B1CA 3PGMA 2OT3B 2NQ8A 3RC7A 3FVQA 4E1AA 5EAIA 2YN4A 3H3FA 3K0FA 1TUBB 4IVQA 4NE7A 2PSSA 1JDTA 1D0VA 4MVWA 4RSMA 1WDTA 1HDRA 2AYYA 2C9BA 2M1ZA 4XJTA 4W8HA 3OPYA 3WV5A 5L53A 3NHSA 1T36B 4MGZR 1RAFA 1NNI1 1C3LA 4DNFA 3KTAA 2A5JA 2QMHA 5J47A 3FXAA 4Y2XA 2AN9A 4NR0A 1W52X 1TK9A 1XC7A 3EQ7A 3BWYA 2B34A 4DLBA 1KZGB 1UP7A 2L18A 1BX3A 4CE6A 3PK0A 2QM0A 1HTBA 4ID9A 1L4NA 4TWZA 2NU9B 2OXCA 4F3TA 2EJUA 3DNMA 3K5HA 2A35A 3IHLA 3QE4A 4MGEA 1Y4DE 4OI1A 3L8DA 1CF4A 2ZKIA 1V1MA 3ZJUA 4NOKA 3LQYA 4K9KA 3KQUA 1JQBA 2J4CA 2XI4A 4C7BA 1ABFA 3ICOA 4BQFA 4YCCA 2CCKA 4XB1A 1D4FA 4DBLE 1S2GA 3GLIA 5FO1A 1XA4A 5LMUB 1WQ4A 2J41A 5EPEA 1AMOA 2IJGX 2AFVA 3PHGA 1GXSA 4FLEA 2OCIA 2ZJYA 3ILVA 1UUFA 5EY5B 1QFJA 3UENA 4Z5XA 5EP4A 1F1BA 4Y98A 4KE7A 1W76A 3PI6A 2C1ZA 1H5NA 1PWZA 2B94A 1UK7A 3EOBI 3GJ4A 3O92A 1Z13A 1YA8A 4YQZA 2P8SA 3RIHA 4PS1A 5E4TA 3VKWA 4X91A 5KPDA 3LUPA 3AM1A 4UEQA 4BVFA 3OJCA 4QO8A 1AOXA 2IPLA 2YFKA 1SBTA 4IP0A 4G4GA 5HA5A 5EEGA 4AY6A 2FUG6 2R6ZA 2IXGA 3X1XA 1BKYA 3L7KA 3GROA 3NAMA 4S1OA 2BFFA 2O2JA 1TCAA 3KEQA 3V8PA 5IDVA 4ZZ2A 2PQ2A 4EB3A 1X2BA 3PXDA 4DDUA 3A6GA 2YYZA 2XRFA 5I9BA 3ZLVA 2L69A 2RIRA 2ZUDA 3C16C 2OQ2A 2FX2A 1C9KA 1DX9A 3PQ5A 4L28A 3J7TA 3M2TA 2P6OA 4AN4A 5DX8A 1O6CA 5TJHA 1JH9A 2H0QA 1KK3A 1KJIA 1KI7A 3ELBA 3S2ZA 3TAUA 2R7MA 4NULA 2PGAA 4FGSA 4A6XA 2X0EA 4KKVA 3VNUA 2CK3A 1K7XB 1XCBA 2DKOA 3OQJA 2VHTA 2VNJA 4BOYA 2ZLBA 3U49A 3WL6A 4ZAXA 3AB8A 2Y0EA 4DMFA 1RYMA 3G8BA 3DL0A 3HUDA 1YCDA 3JQCA 3E7XA 1IVYA 4YMHA 4O59O 1CC1S 5JJ5A 1HBJA 2QW1A 2VHUA 3M4XA 4PLVA 4OXIA 1GDTA 3B6IA 4FZ5A 1LPPA 3T4XA 3RIMA 4X9XA 1I4OA 1UXIA 3T61A 4RLSA 2GAFA 3ONDA 4KO4S 4PYIA 2NQTA 3FYCA 2PV7A 1BXGA 3N2GB 1AS0A 2X40A 5LZ9A 4MCHA 1RPAA 1S96A 2BBOA 3C3WA 3EGCA 4BFLA 4YAIA 1FFEA 5FB3A 1NHGA 3WBJA 4FR5A 4ZAZA 2TSYB 3AI1A 2H8GA 2O52A 1PIWA 3DPIA 3M3HA 1K4MA 1YDHA 4LECA 3U1TA 3W9SA 1Y6GA 2HHJA 5K3BA 1XZEA 5I4CA 2ACWA 2Z1NA 3IKLA 5C1PA 1Q77A 2VYFA 3KWJA 5K3OA 2DY0A 1UBLS 2HHLA 3QE3A 4UXIA 2LKCA 3BCUA 3E8XA 1UT6A 3T35A 3UAOA 3UJDA 3NWJA 4R40A 2PLAA 1ZOLA 5IHPA 1VQ1A 4OHFA 4YWHA 5JSQA 1I7LA 2DKNA 2B6HA 4QGBA 4JKIA 4BNLA 2OE2A 3DAOA 3ICVA 4HX2A 5EKSA 5ILQA 5K1ZA 3NI2A 1X14A 5JH7A 1HX7A 2J4FA 4DL9A 1XRSB 1ZW1A 3N2ZB 1UBMS 2D7CA 2W4IA 3T3MB 2QN7A 4WZBA 1VRVA 2Q1UA 2SCUA 2GH1A 4TTRA 5ALDA 5KTTA 3NZEA 1QKKA 1VP3A 3TTSA 3IXQA 4FS3A 1N1DA 2VO1A 1HL7A 2XYPA 4LY9A 4EYQA 4FR2A 5BR1A 2IECA 3EGWA 1E2NA 3CZ9A 1JT9A 3PPVA 4K8OA 3NHBA 1XZPA 5F5XA 3RODA 2ODEA 1GZDA 3RC3A 4I99A 1I3LA 1OMOA 1RWXA 2IT1A 1XDSA 3VUFA 4BGUA 5BV0A 1E1CB 2PL1A 3FOWA 1JR4A 1D09A 3BWVA 1IOZA 1WMBA 3SYKA 3KU1A 3TE6A 3MPUA 1CY2A 1W5SA 4RGYA 1UJCA 3VC2A 3T94A 1E79A 3EVCA 1MD9A 3MUNA 4AO6A 4MVJH 4HNAB 1M6NA 3FWHA 4C20A 1AUOA 4IDAA 3U60B 3ZGOA 2FSFA 4AJ2A 5T4EA 5JYDA 2BTOA 2FV8A 1GCIA 3L8GA 4PZEA 3EQ8A 1ONNA 2BM9A 3A58B 3DYBA 3FLBA 3LUGA 5KOJA 4G65A 2R7KA 3G9XA 1KR5A 1KEEA 3FNGA 4HQOA 3FMOB 3MNFA 5BPFA 2RHBA 4PAWA 3IBGA 2XXJA 1CUUA 3E35A 4CQMD 4MEBA 1K8ZB 3UPTA 5KTPA 4Q19A 3W4JA 1OX4B 5HJEA 4QDZA 3LW8A 3I04A 4O3FA 5IBPA 2NX2A 4K26A 3QVLA 5JC8A 2FQQA 2VH2A 1VL2A 2BFDB 4NJOA 4D6YA 2YXBA 4ZHQA 5F23A 3IIMA 4UU7A 1V0JA 4JL5A 4E88A 4QRDA 4G0YA 4MS1A 4DNXA 3OCUA 4BCBA 2R8ZA 1B6GA 2C88A 4DC0A 4ZOQI 1W0JA 4L57A 4X6XA 1UXGA 3VZCA 2EX0A 3X2FA 4OL0A 3THXB 2WHEA 4FKZA 3BPSA 1T35A 5GJWC 3G9QA 3W5HA 2OBLA 4C6HA 3ZJVA 4G3XA 4NENB 3OZ7A 3PJDA 4EELA 3FNEA 4JJZA 4RD2A 3CF2A 3NTRA 5G0TA 1V9LA 2B0CA 1YOBA 3KL2A 3MD0A 4OREX 2IELA 3FOBA 2B2NA 2FG6C 5A6VA 1EK6A 1G2PA 2QW0X 4ISBA 4QXQA 1MQAA 2JASA 1OCEA 5LQKA 5BMVB 2ECFA 2GNAA 2J31A 3QPBA 3UT6A 1IOVA 3VZQA 3WXBA 4LY3A 5IAAA 4OI2A 4H7JA 3UFBA 3ZX4A 1QP8A 2B2CA 2YHSA 4HBZA 1WUKS 3GJ3A 1GDDA 3QTBA 4HLUA 2FDXA 3QMVA 2VT6A 3G2QA 5LIPA 4FCVA 4QDUA 2RG1A 4YLYA 2V7XA 1V4VA 1N0WA 1THMA 2W2XA 3W8EA 1Z2AA 5A3RA 2WQ6A 3HLKA 5A4DA 3N8IA 5BMVF 5IPFA 3W6ZA 2FPMA 3AERB 2FY8A 4DLXA 1NUPA 4YJGB 4MWOA 2BHTA 2HWYA 4GMXA 4BNXA 3TFWA 2J3IA 4CHTA 5HUJA 4BTVA 1P7WA 1TRKA 2W2NA 3S1AB 5E0KB 3TMAA 4C87A 3ZE6A 2FHSA 4H18A 3DMTA 4ML3A 1XZFA 3RC1A 4QBKA 4NYJR 4XTRA 1UC5B 2JFVA 4QDKA 3QJ5A 5KNBA 1HDIA 3LA6A 1D2AA 1P33A 1VIYA 2QL7A 3FCOA 4LG1A 4Z7QB 3E5RA 4RD4A 1RLTA 4QYSA 4KQMA 1XQWA 1NU6A 2X1MA 4RL4A 5D86A 5C1IA 5TS2A 5KPJA 2VLBA 4DR1B 1US8A 4I1UA 2O3QA 4Z3OA 5D1NA 5C3MA 3WKCA 1YGYA 2QLJA 3LQ4A 4Q7EA 3KZCA 3RYIA 4ZU6X 1QGUB 2PM8A 3U7EB 4AURA 4EHJA 4CG1A 3UK1A 1IDN1 3NTUA 5HK8A 5FUQA 2QYHA 2OQIA 2ZUCA 3O4IA 4K0RA 4OV6B 3F6RA 4UHDA 4X8OA 4GDMA 4YUWA 5L6LB 1UH5A 3OF3A 1R4MB 4MUFA 2Q7XA 1D4ZA 3DW1X 3LL7A 3FJ1A 4OLFA 1L7RA 3JQBA 3AP3A 5F3RA 1EJBA 2GF9A 5FOTA 1KY2A 2PLRA 3GLQA 4U3JB 3D7RA 4KQGA 4N0QA 4UHCA 3QELB 5CDFE 2HIMA 4Q4HB 2WF9A 2B3DA 4AJLA 1EVLA 5BXYA 1X1CA 3NHAA 5BN3B 1TK3A 1ZFNA 1K8YB 4HL6A 5IX8A 4J43A 2JIRA 4F2PA 2QHXA 2YL2A 4OQDA 4BMSA 3PLRA 4NYIR 3ZJTA 5KNCA 2EFDB 2JFQA 4TXHA 1EK0A 2NAPA 4LOHA 3CINA 2LP4Y 2JEYA 2QPTA 1VG1A 4D8XA 5G0VA 3H0CA 3IEPA 4NIMA 3ANNA 1I1OA 3CH5A 4P34A 5LKAA 3GLFA 1DZ3A 1MJGM 1CBUA 1UR5A 5I7SA 2J6CA 3R3SA 1K9SA 2FEXA 1E4OA 3E6AA 3R3VA 3UFXA 4YRMA 1MV5A 4Q02A 1VL5A 4CKWB 3OLVA 3U9SA 3UWPA 3IAFA 4H7DA 5GV8A 3ZV5A 4B6EA 3IE1A 1E9AA 1A9TA 1A72A 2PGDA 3P9IA 3WLMA 3GZNA 5KDLA 5HK9A 1QIIA 1RYZA 4BZWA 1U8AA 3WHKA 4EQZA 4C2AA 2JPDA 1JA9A 3TLCA 2WWTA 3WGYA 2GF0A 2BEJA 3DV9A 2C5LA 3FTQA 1U0TA 4R1OA 3CG0A 1JXAA 3AUAA 1J24A 3ISTA 4JCCA 1Y1RA 3RJ9A 3TNYA 2L17A 1IQPA 2NYAA 5BW0B 5FTJA 2ZIUB 4IF6A 1R50A 1EQAA 3DD1A 3FBTA 2XDYA 1LB1B 4HDMB 3K0AB 3LPNA 4J4BA 4Z0HO 5A4FS 3N75A 2IY8A 2CJWA 1N2HA 1X74A 3DKKA 1PTJC 1WPXA 2FZLA 2QL6A 3F6BX 3JVDA 1VKZA 1VFPA 4I55A 4RVGA 3KYBA 1OBOA 2XIQA 2QMEA 5HIAA 4YXFA 1FYEA 4B3HA 4HFRA 2BRUC 3H2KA 4LE0A 1YVDA 4JZKA 2IF2A 1E6KA 1XAGA 5DSTA 4UM7A 5FNVB 4D0SA 1KF0A 5IZ4A 4DV6B 1B42A 4L51A 3S0JA 2QUAA 2VPWA 1JEYA 2OSBA 3ZY2A 4EG3A 3W9BA 1I94B 1CR2A 3CX6A 3MCZA 4RF3A 4RFSB 4UDOA 4CEJA 4MKXA 1UMDA 4XSGA 3O1JC 1L7BA 3K70D 2P9HA 2W2LA 3TD6A 3TNLA 2Y1LA 2RGNC 5K2MA 1U2GA 1LDMA 1JDPA 5AVXA 2Z6UA 3PQ7A 1LA2A 1ZIDA 4HQLA 1KDVA 1TUBA 1ZU5A 3EFBA 1BH2A 3G9ZA 1CJMA 4NEQA 3GJXC 4NV0A 1JIXA 2C2KA 3PKZA 5DBHX 1N2BA 4ZT4A 4N6OA 4YDQA 4GPIB 1JL3A 4XYEA 3A6FA 3AHIA 5IS2A 2WJJA 4JLKA 2JAUA 2C4MA 3KJHA 1JHAA 1JFRA 2O8CB 1H4VB 4P7KA 1I30A 4GP7A 5ARDA 3NVMB 1QYDA 1UKVY 2VYND 3PQ4A 4B87A 1UBHS 2ETXA 3O95A 2WWVD 4WAUA 4RCZA 3NYIA 1SO8A 4NZOA 4RK1A 4B9AA 1Q91A 7GPBA 4FK8A 2AG1A 2O9JA 3QI7A 2Y0DA 3VDQA 4DUPA 2YJ5A 1U1IA 5LR6A 2WU4A 3HKEA 4JR1A 4XX0B 1MR3F 3FFAA 4MV1A 1Z9BA 2ZEJA 3ADOA 2UUAB 3EZ2A 1J2EA 2AZ4A 4M0PA 1DGQA 2DVMA 3ZQUA 1MGPA 3WG9A 1ZVJA 5A5FA 5DX1A 4OHKA 3TLKA 4NXNB 1DIOB 4XR9A 1T25A 5EXPA 1O5IA 4ZI7F 5LWHA 1GARA 4M53A 3IAHA 3TRDA 3W2GA 4KQEA 3BE5A 5D7BA 2ZRLA 2D1YA 2NZ2A 2YZMA 2BMVA 1J8FA 3O8LA 1AK9A 3TR5A 1GLVA 2I54A 1Z17A 2XOEA 3KWLA 4AMUA 1NQOA 1Y7IA 3GP3A 2G80A 2F00A 4G5FA 1EHCA 1I3CA 1L7QA 3BCSA 4RKEA 4WKNA 4BLVA 4DR3B 5DYNA 4Z9FA 1DI0A 1DRUA 1DJNA 4RGVA 1GHTA 2C2ZA 4RVCA 1C7FA 5AKHA 3UHOA 1ZK4A 1NOIA 1IMOA 1I4LD 1U3FA 3M5DA 1H5QA 4NS1A 4RIGA 2EEZA 2WWIA 5L6MB 3R7SA 2CXQA 4IHQA 2OMEA 2VPTA 4MKFA 3AT1A 1HE2A 5EUBA 1KVSA 1P1KA 1RM0A 2XZLA 3IVAA 3O7MA 3DVAA 4N01A 2A1UB 4KL8S 2P1ZA 2F43A 4MGHA 1ZD2P 4OF4A 5ARCA 2WVHA 3HJGA 1LWOA 4BNTA 1TXGA 2HREA 4J7XA 4WWHA 5KHOC 1FQKA 3INTA 2Q4DA 1G9SA 4CMKA 3GP5A 4MA5A 3N05A 4UTZA 2EG5A 5CDTA 3V4FA 3MIZA 5ALRA 3LOPA 5ESXA 4BXOA 4BO5A 3W2FA 3GFBA 4P93A 3G2KA 1SR8A 3HGQA 1WMEA 1J5PA 1H6AA 1RXCA 5HFAA 3RVOA 4ABYA 4M37A 6CHYA 2DM6A 4WBNF 4A0FA 2G28A 3WMWA 2HMSA 2PS1A 2G71A 3EFHA 3FHLA 2ACVA 2GYVA 1HY3A 1XAJA 4U8HA 2ROQA 4XUEA 4E2FA 4RPHA 4ZFNA 1XZGA 2H51A 3SICE 2J9RA 3VHXB 4I5GA 2VEDA 4PTLA 1R15A 3RCBA 4DADA 3CX4A 4DLKA 1SFRA 5JRDS 2Z09A 1E9FA 1H93A 2HEIA 3GPIA 1RHJA 4K9LA 4DKJA 1AKRA 2JI8A 3UT5A 4QRHA 5IRCD 1AGNA 3DF7A 3WNQA 3IUYA 4IDNA 3E9MA 1PK8A 3HM2A 3HXKA 3AWIA 5EXTA 1KHHA 2GZAA 3ORYA 4UXJA 4WUTA 3ZHVA 4JEHA 3ZD9A 1QVAA 3A4LA 2PSFA 2H1LA 2PBFA 3OOJA 4I3FA 4UUMA 4DSTA 5BN1A 1RRMA 2C2GA 2D0PB 1SCDA 3OQIB 1CT9A 4LNUA 4XQGA 1Z82A 4YRAA 2ORYA 4TMZA 5BUZA 1T4CA 2HCTA 3KO8A 2ZIEA 4KI7A 5D87A 4YUXA 1X0VA 1Z6TA 2WD9A 5L95A 1KJZA 1YD7A 5FL3A 5F9MA 5LA6B 3ZDYB 3AHCA 4EW2A 5KSZA 2OD7A 2X6QA 1KAGA 2X8JB 2B2XA 3E4DA 1H69A 1QGED 3EH1A 4I08A 4Z9AA 3IUQA 3FYTA 1ZIPA 2G0NA 3LVFO 2P2CA 3LZCA 5AKXA 3X1WA 3F73A 2VDPB 4X61A 4DLUA 4AMBA 1C2TA 2WMNB 1S89A 1E98A 2COUA 1HDOA 1SC4A 3QTTA 1GGVA 1GZ4A 3ZZUA 5BWNA 2YWCA 1RWWA 3WQBA 2IUYA 1YVRA 4EYKA 5L3VA 5HQ3B 2QT0A 1HDEA 1BEZA 1TZKA 1ZIYA 2G17A 3HKDB 2NU8B 4N76A 4GOMD 3TTVA 1N25A 3B5IA 4WKGA 4XWAA 3GBSA 2UKDA 2WPDA 5JAIA 1TO6A 3KKMA 4NBUA 1GZHB 5FBQB 3GJTA 3X2SA 3G0OA 3ENZA 4EG8A 3UH0A 3M34A 3PFKA 4NENA 4B2LA 2R4QA 3PHIA 1FFXB 2GN8A 4YJ3B 1RXSA 1U1DA 2BFMA 3FWKA 1PZEA 2DKFA 1XD2B 2QGZA 4TZKA 2XIJA 3DOIA 4L2IA 4LHYA 3RROA 3KFXA 2OAP1 3PX3A 4LCBA 5ITZA 1S8NA 2AFIB 3ICWA 1XDUA 4GPEA 1DMSA 4QQKA 5E9AA 5BR8B 4X92A 1H42A 2C9ZA 2P2ZA 1IMJA 2P4HX 2Q49A 2GDZA 1RBQA 1PJAA 4W1SA 1DEAA 5FUMA 2FVYA 1MQSA 3MMZA 3SE0A 3T52A 2FE1A 2D1QA 1G4AE 5JPIA 5B7PA 2WTBA 4JGGA 4LF5B 4OP3A 1SXQA 1LI4A 1K2WA 1NW3A 4HAXA 4QQ8A 2AEEA 2JI6A 4Y2HA 5B1HA 3I3SR 121PA 1EJ0A 2AC7A 1VIAA 2RHHA 1PBTA 2OYSA 3ZEIA 5KQPA 4K9NA 2W43A 2D1RA 4HO1X 1CERA 1Z5WA 4WY2A 1NV9A 2FX3A 4JLWA 5A4KA 1C0LA 3CVJA 5DTIA 4R5HA 3UK6A 1LTKA 1YR7A 4JY7A 1EP1B 4X6LA 3HGMA 4Y6PA 1K5GA 2WG0A 3BFPA 5B53A 2JFGA 5CB0A 2XODA 3VI3B 2GF2A 1VSUA 5EPOA 3CIOA 4KMSA 1JVSA 1A5SB 1UKCA 3A31A 1C80A 5EA2A 4OSEA 4U1RA 3USES 4CM6A 3LHKA 1T6ZA 2PL3A 4EHLA 1NBEA 3K94A 1JHRA 4PZZA 1RPJA 2HWXA 2ZAOA 2VDNB 3B82A 4F04A 2G1AA 4GDFA 1I9GA 4JENA 4MB6A 3OAAD 3O9ZA 2UXDB 1I10A 1X7YA 4CF5A 2RGUA 4N7RA 5HCNA 4EKEA 5ITWA 1J9ZA 3SGLA 5B7GA 1Y5IA 3V1NA 2O57A 4A5OA 2HYDA 3MUOA 2I7XA 3AIOA 1FFBA 2RH4A 4EKNB 3LC7O 4DPLA 2ZU6A 2H08A 4I1IA 3F6YA 5A06A 5CLJA 3RNLA 1FFDA 4NZNA 3A26A 2CD7A 3NIDB 5EJEA 1UL1X 3D3JA 1GTG1 3E9DA 2D2IA 1RCTE 4IRMA 4PPFA 2GKGA 2L0XA 1CQJB 1YQ9A 1WDKA 2FP3A 4IG4A 4NYJQ 3W5IA 3WGNA 5HTOA 1JHVA 3KOOA 5JO9A 2AHRA 3HCCA 2EP7A 2IEZA 4P7FA 1JEQA 1MA3A 1DLIA 3HSSA 4P5EA 5DK4A 3BWMA 4BATA 2NSJA 2CNOA 2M32A 4INPA 4YBZA 1KBZA 4MIYA 2W93A 4YPOA 1M0WA 1LDEA 1Z29A 1MCZA 1JG7A 3C43A 3I37X 3KM0A 1LX6A 4QEZA 5FHRA 5CVTA 3JRNA 3PEEA 4MAMA 4ZYTA 3OE5A 1W5TA 3M6VA 1E2KA 1KP9A 2WIAA 3RQIA 3TXAA 1ZEMA 4KRXA 5JCJA 2ZRFA 3CCCA 2X42A 1UPUA 3GPLA 3P5BA 2CFOA 4DMLA 5BWBA 5JY1A 3EHEA 3DR3A 5CJJA 3AEYA 1CR6A 2ZIVB 4AUMA 4G9BA 3PUIA 3MT8A 1XAHA 4N40A 2FKNA 5ETJA 3SSAA 1P1HA 2E0IA 3VU0A 2O2YA 4N5MA 1LQUA 2QP3A 3K6SB 3GT4A 2VQDA 2WU8A 1IXYA 4HPWA 4IDFA 3LPLA 1BW9B 2ZBDA 4P31A 5GZ6A 4JI1B 5ALKA 3GCWA 1EFKA 3L7MA 3ZQ6A 1VC2A 1WXIA 3DV2A 4Q6BA 4BECA 1SC6A 4OM8A 1UAAA 3TG2A 5C46F 1SVSA 1BFUA 1V2GA 3AF3A 3TPFA 3EDRA 4KN8A 1PGJA 2A33A 4DLTA 3M8KA 3ED5A 3AMVA 1Z74A 2I34A 5IJWA 4HN4B 1CU1A 1T9GS 2RI6A 2VHVA 2OA0A 4ZYZA 3DZIA 1PNRA 3BHMA 4JOCA 3SBEA 4BNGA 2QM3A 4GBMA 1PJ3A 1P4RA 2RBGA 3WGVA 2C03A 3GA0A 4GWKA 2YXEA 4B35A 4DV7B 4LJ5A 5EWMA 3ZNNA 5ICGA 5ALWA 5JOQA 5FNVA 3QE2A 4JELA 1RLOA 2QI9F 3C2QA 4TKUA 1JUDA 3IJ5A 5CIQA 1E7YA 5AK0A 2IPNA 1QZ3A 1QRRA 3QUCA 1RD4A 1USKA 2GEFA 2QKYA 4XASA 5AI5A 1I6LA 2R8EA 1C1DA 2QTVB 3PC3A 4QA9A 4DCNA 2WA1A 3A6DA 2XMPA 2CDBA 4CM9A 3ESXA 1F8FA 1N5LA 3MINA 4BCCA 4PO8A 3TQQA 6ADHA 2DLNA 3N7UA 4YRCA 2V1UA 1GUBA 5DGHA 2QSJA 3PJEA 2X9LA 2TS1A 4AJKA 3FA2A 3R7LA 6ABPA 5K3FB 1L7NA 5JI2E 3R5JA 3A36A 1HMYA 4YMSA 3N7AA 1OBCA 2NYRA 2RB5A 3OU2A 1OH8A 4FFRA 4J2OA 1QLWA 3ND8A 4RY8A 3VTAA 4R84A 3G1WA 4HDNB 4NH4A 4TV9B 4D46A 3Q3VA 3AFNA 1VA5A 4HDMA 2YIJA 4M9ZA 2DXIA 2A2ZA 1NMXA 4NHOA 1D2CA 5K8JB 2B69A 1NQTA 3EZ6A 1UWCA 1WX1A 2ONYA 4L5JA 4LBWA 3VOSA 1P5ZB 2PJRA 1IBCA 2ZRAA 3CE9A 3PE4A 4G41A 4DIBA 4UE2A 5HWSA 7YASA 1T2CA 3EFOA 1WIWA 2VZEA 2Q1SA 4RMNA 2W4MA 1NKSA 4QUBA 2GYYA 4UNNA 1FS6A 3VU3A 3HHEA 1S2IA 2FR8A 4CV1A 4DJJA 4E22A 4X65B 2XA2A 1UPTA 4YCMA 5JADA 2GK6A 2IUUA 3VR5A 2DOKA 3IEIA 1KKUA 5HQTA 1GU7A 3PS9A 1NQAO 1B76A 4URVR 5J2UF 3FYUA 1A8SA 1B6SA 1OC4A 1UXHA 2CF6A 5U4XA 4MQ4A 3SK0A 2X0NA 4CM7A 4DREA 2H11A 2GHIA 5JRZA 5D85A 2IOFK 4NBTA 4B8ZA 4IXJA 1RHMA 5TE9A 3C3KA 3WYEA 5AW4A 1X94A 2NO9A 2VHZA 1ZNYA 2ZUBA 2C5HA 3F5MA 3JR3A 4LRXA 4PR3A 5IC5A 3V2UA 3ZGZA 1P9RA 1RCUA 3CJTA 2ZZMA 2OOSA 3H3XA 3IR6A 2GBIA 5A05A 3EXFA 1GA1A 2P2LA 3CSDA 4J7AA 4MNTA 4MPTA 4TZ0A 1XMIA 1RYHA 1EDOA 2EKZA 2Q5IA 4I6JA 3PR2B 4UNQA 5BQXA 3L0ZA 1E6UA 4CF6A 4TQ9A 2IIVA 3CNLA 3RBVA 1JFLA 5JTTA 3VA7A 3GLGA 3IR7A 5H4HA 2RK6A 3ED1A 4JLDA 3VR4A 2XADA 3V6MA 5AW2A 4HAWA 4ZO7A 1NJGA 1EBUA 1SVIA 1O7JA 1PZHA 2A1UA 2H1WA 2H6EA 3CQ9A 1I4WA 2Q0XA 2QRLA 3RU3A 3VDNB 2KHZA 3NHMA 3UWOA 2UXCB 2QG4A 1IN8A 2XGMA 5DB4A 2R1ZA 4ZWNA 5JISA 3WTCA 5LYJB 5KEIA 2IYOA 2GTPA 1BEUB 4JFRA 1HFKA 1I3OA 4K2AA 4V1CB 4JROA 4J1TC 2AT1A 1NJ8A 2JAHA 1CEYA 1XTJA 1AUVA 3QPWA 1OW3B 3ZDZB 3KSBC 2ZIWB 3K3PA 2R1UA 3IRUA 3NC0C 2ODTX 3K31A 4HDKA 4AXBA 1MX5A 3TOZA 5A4JA 2DTXA 1DMRA 3BE6A 3EBLA 1AZTA 2R1TB 3H19A 4JVMA 4LSGA 3WJAA 5MF6A 1CEEA 1XVTA 4YA6A 4R0MA 2GDJA 3MIIA 1XKQA 4ME6A 5ALYA 2XMCA 4LYHA 3O31A 1Y81A 1YULA 2HMYB 1ZD1A 4GQIA 4TLBA 1ENYA 5A5VA 4C5CA 4H16A 1WBBA 4GYJA 5FDFA 4DOMA 1AHPA 1U2EA 2P5SA 1P4GA 5EZYA 4TQUS 2DJ5A 3TPZA 3WNVA 4CFSA 2ZXEA 3DR5A 3Q88A 2A1TR 1O08A 4RCVA 3ZE1B 2AN5A 3GEBA 3DVAB 2VT3A 2NUPA 1EFLA 1OBHA 2JVJA 4M8NE 3OJFA 1P1FA 3EUAA 3GL9A 2EIHA 3FKSD 4DRZA 1HMPA 1ZVMA 3JD0A 2AVNA 1Z8HA 4DHWA 3TF5A 4QEKA 5ALUA 3HU3A 3AEQA 4AU1A 3LA8A 5CT8A 3AKYA 2JLAA 3KOWA 3O47A 2HA0A 3KQHA 2ANCA 3JD1A 2XHZA 2BTQA 4L5IA 1KO4A 3G13A 4WNIA 2I2CA 1LZKA 2REQB 5CB4A 3LGXA 1A82A 1NW6A 3VPBA 5LXTA 1KEVA 2XEDA 1B7GO 1H0RA 1P3JA 2PPVA 2C2XA 3DEZA 3OFND 3ZI7A 2ZPTX 5LCXA 3ZVRA 4CT5A 3KCNA 1SHZA 3BERA 1DDGA 1K7YA 3SM9A 3TZKA 5G1OA 3ULKA 1TAUA 3ICQB 3E7WA 4FFLA 3JWJA 3JRXA 1RRPA 3HMQA 4EJMA 5TR9A 1BROA 3H5TA 9GPBA 3T0FA 2XE6A 1NXTA 2BSQA 1LLUA 4B4VA 2DYKA 3PVSA 1FA9A 4QJ4A 3U7QB 1GCUA 2MU1A 1Z62A 2M6LA 2P75A 2DQZA 4PEVA 4FDLA 4TS1A 4J0IA 3LY9A 4TMWA 4QQRA 4YMIA 2DY1A 3QU7A 4RTRA 1KRWA 2A7XA 2GM5A 2J5RA 3QFRA 4YRLA 1N9KA 2PQMA 2ZYDA 1XMXA 2KYRA 3OECA 3O4JA 4C6TA 1JPNA 1WF3A 4BX3A 2ZT6A 3JQFC 2R6DA 4H7HA 4I6EA 1AGRA 1LLDA 1WM1A 2GLUA 5AVVA 1LTHR 1BX0A 3IESA 2YMQA 4URYR 5CPFA 3K96A 3ZW9A 2X1HA 3I92A 4XPZA 5E6RA 3V2HA 5JD6A 2LCQA 3SEFA 3QUBA 1SKAA 1YS4A 3GUUA 4EM6A 3LNTA 4BV2A 1E2DA 2F6RA 2GCOA 2WE8A 3FMPB 3NNNA 1CP3A 5IAGA 3QBJA 5C8VA 1HR0B 1HXHA 5TSDA 2QN2A 3IIJA 4HCJA 4KPUA 4J7UA 2ID4A 4IDEA 5L4SA 2FXIA 2R7AA 2X8WA 4ESEA 3FTPA 3GLGE 3AI2A 5F2EA 4YP9A 4EOGA 3EIQA 5L7YA 2QPLA 2X8AA 4C0SA 1PVVA 4TZ6A 3D4PA 3Q2OA 1NSFA 2DX7A 5TEVA 4QTYA 5JMWA 2C82A 4N5NA 2IEGA 2CMFA 1U8UA 4Z4EA 3MCVA 1TC1A 1W6UA 3AR8A 4M0FA 1W2GA 2JCVA 2W48A 2YV1A 3HZOA 1QJCA 2EQBA 3LDAA 5E2IA 5JASA 3O3OB 5IF9A 2PKYX 4YHBA 5EERA 4AS1A 4YAEA 3SQDA 1NW5A 2Y3IA 1XTQA 3T3OA 1X87A 2GXSA 2YWXA 1IEQA 3WA7A 3A6EA 1Y7PA 3B9QA 2QU7A 4YJ3A 5FD8A 2NG1A 1G8SA 5BQOA 2C04A 3T1YB 2R2GA 3ONEA 3ESCA 4B45A 3VJKA 3HABA 3RRFA 3NC1C 4J8PA 5D7NA 3MOSA 3ZHOA 1SCAA 4ALIA 4MO2A 2DZDA 4NARA 1JVNA 2QTLA 3PSAA 3F2IA 4GSYA 2G16A 2C0PA 3QXSA 3AH8A 5ED0A 2JIZA 5SYAA 2Q99A 1DKRA 4ZEXA 2GVNA 2O7RA 3R20A 4OHBA 5A3JA 2D59A 1RSZA 4F11A 4W82A 1RJDA 3VNRA 2PMDA 2I9PA 1B6RA 2VQ3A 3G2JA 3QXGA 3EGEA 3AI3A 3DS8A 3GMDA 5AOCA 4BNZA 3U19A 4LF4B 3PWTA 3KJIA 3QUSA 1YZVA 1E9EA 2FCRA 5EZ6B 3TAHA 2XTZA 3R5XA 4YJ2F 3SJAA 3E48A 3H5IA 4BNUA 2NZWA 4FB5A 1BKSB 2BE9A 2KX7A 4BKMA 1WHTA 3B1FA 2H2HA 1UDWA 2RARA 3PDIB 6LDHA 3PGA1 4OYHA 3EXIA 4X3CA 3S7TA 3EY9A 4AYXA 2LWIA 1SUAA 1NVUQ 1ZP6A 3M81A 2X1LA 1A7AA 1OVMA 1ZD4A 2BI8A 3A04A 1H0KA 2C61A 2H3HA 5FXMA 2IYAA 2PTHA 1Z6AA 2NNLD 2BMEA 1XCGB 2GAJA 4QG7A 4Q4DA 2R86A 3C3EA 3OTQA 4PSDA 2AZXA 5FKJA 3AYZB 4OATA 5FOUA 5K6AC 2YQZA 3M5CA 4YRNA 1G291 1E7SA 1PR6A 4MIKA 5HJ7A 2QRZA 1DEKA 1L4LA 4BP9A 1U81A 2YINC 4PNZA 4UZEA 3DTVA 2PX0A 1O8CA 3EDOA 4HNQA 4YCSA 4OLJA 4RXTA 5LZ8A 1JTEA 1PJCA 4XIIA 1TK2A 2BM1A 3QHQA 5EC8A 3UXYA 3V00A 1JYEA 2FW0A 2IWRA 2OC9A 4U4AA 4UHEA 3K8QA 4LFAB 4GKBA 2OHOA 4EKGA 1LV7A 1SD1A 4QOJA 3OZUA 3GLVA 6AT1A 1AXEA 5BWOA 3ROXA 1UJ4A 3D8SA 5JNTA 1QP4A 4ZQBA 4P82A 1N8NA 1Q1NA 3EY4A 3TL3A 4FNMA 3ETNA 1F20A 3T3IA 4KVAA 1PZFA 3CSSA 3D4LA 3EVEA 1YRHA 3AQIA 5D8DA 4PQFA 2QD1A 1WS6A 1TL7C 1TTHA 5HIMA 1HM5A 1FQJA 4Q9HA 2PD4A 1L6IA 5D01A 2NLOA 3LLUA 2A56A 4PHHA 2JIMA 3F3YA 2FZVA 3QRWA 5B6IA 1APBA 3ROGA 3ZBTA 3C3BA 1BHQ1 3UB2A 4YV1A 1YDMA 1WXQA 1UBOS 1TKAA 4MV5A 5CIWA 1BE1A 2O8VA 1M6HA 2ZJ3A 3UUWA 3MJTA 1ISRA 4DSAA 3M33A 5H80A 1ACMA 3BREA 5DBGA 4FNAA 1GM5A 4HH1A 4ZTZB 1Q7TA 2E37A 2J33A 3MT9A 3OEWA 4UHFA 3TK1A 3AV0B 2IYEA 1CQPA 2IE8A 4OXRA 4BJ6A 1BW9A 2QD4A 4NCXA 5EJGA 3BH0A 3CI0I 3I9FA 2ZBFA 1FP7A 4KE6A 5CM2Z 1CY6A 2C8LA 2R87A 2FN4A 4AJ9A 2G07A 1SBHA 1HTWA 1U1EA 2Q3JA 1CW2B 2QN3A 5LQAA 2PUDA 3JPWA 3OU7A 4KQJA 3I9V1 5IJZA 4C0WA 3VU9B 3CGGA 3TE7A 2Q0HA 1FPQA 4CG3A 1Q6YA 3FKJA 3E3OA 3KX2A 3D3EA 4FFBB 3G0HA 3RS8A 3QVGB 3VR6D 1THGA 2JGAA 4KVFA 4RSRA 4OLAA 5CM9C 2ZWAA 4MRSA 5LYYA 1RM4A 5ENDA 1HA3A 2G09A 2VUIB 3JWEA 2A52A 4TL9A 1DTWB 2NZ8A 3TW6A 5FT9A 5KNDA 1JQDA 3R3UA 4M1EA 4WUVA 4AROA 3L8CA 1WVIA 2P11A 1E9RA 1LWNA 3ANLA 3BORA 3AM3A 4TXJA 1DAHA 4WNYA 5JD4A 1R5OA 5KNDD 5IASA 3I53A 3FGOA 3MINB 4MJXA 3FYUB 4Q9KA 5J4YA 3GEEA 2JI7A 3DL4A 4KWCA 2NACA 2V6IA 1BWPA 1XZIA 3DZKA 3EA0A 3HCNA 4BQOA 3GHHA 5CFPA 4NE9A 1T9AA 3LBFA 1G7CA 3P9RA 3CH7A 2JGFA 3A9RA 3ET4A 1L3IA 1ZH6A 2PCLA 4NJEB 5LZ2A 4LTNA 2XSZA 4E2WA 2Y8EA 4K3VA 5TJ9A 1FLVA 3HBLA 3T5MA 2OV8A 4C2TA 4ND8B 1CR1A 2D1FA 2X9NA 4WH0A 1SC9A 2YXNA 1H2RS 5JCOA 4WE3A 2GAIA 4DG8A 4EO4A 1K6XA 1W73A 3JQEA 3NT5A 2EFGA 3OP1A 3OJ0A 2H29A 4IBOA 2DLDA 2X0DA 1DARA 4OJQA 1XK6A 4UUAA 3BWXA 4EQ6A 2A0UA 2PX4A 3P9KA 4I50A 4P4UA 4AICA 4QWWA 2WIJA 3EOZA 3B7WA 3M82A 4XH9B 2LV8A 4IGKA 3L3BA 2P9QA 3B13B 1OFHA 1IG0A 3GLRA 5CGQB 3ZWXA 3GLIB 3DLCA 1H05A 1LC3A 2YIDA 4KG7A 1N3LA 2COKA 1YB1A 3C41J 1A71A 3K1YA 4OXQA 4R1PA 1KJJA 3ANTA 4JEIA 1KYTA 1ORIA 4W9NA 1ENPA 4WY5A 4XEUA 1AH2A 4MV7A 2AJ8A 1BOOA 2P40A 3R3YA 4F9EA 1JJAA 4C4TA 2HJ9A 2A78A 3AUSA 3SYNA 3AU8A 3O83A 2D7JA 3GK3A 1G41A 1FQOA 1GZ5A 3CF6R 1J2UA 4FYIA 4GWLA 4DQXA 5C53B 2Z2JA 2R85A 1W5EA 1QDEA 1YS6A 2JFPA 3E8MA 4D9GA 4EECA 3GEIA 4PG8A 2O19A 5LQRA 1CZLA 2PIAA 4M0MA 3BRQA 3EXFB 4RGBA 4Z9XA 4LZJA 3V8MA 2GD1O 2R1TA 4DRXB 2PO5A 2QY9A 2F1JA 2XDWA 4O4HF 1KPGA 1HEUA 4PG7A 1HUQA 5FORA 3WSVA 3CF4G 1E3TA 1E58A 2VWHA 1MU0A 5D3MA 4DSNA 3CLVA 4NCHA 3T3EA 2BKVA 4Y6GB 3L2OB 3WWEA 4M49A 1Z2OX 3W5BA 1C0EA 2BGMA 4UTXA 1FNSA 3C8HA 2WPNA 3KDSE 4DSOA 1CJVC 5C8YB 2B8NA 1U8EA 3KKNA 2B5WA 5EQFA 1LZLA 5IXJA 1MMFB 1BMTA 1MG0A 1QX3A 2ZSDA 2EF0A 5JVDF 2AI1A 1Q92A 2WNSA 3EZLA 3K5WA 3NBAA 2B78A 2P8JA 5A04A 3OP4A 3VI4B 4YHHB 2QV0A 4W5HA 2B35A 3C5VA 2VYNA 3SNHA 4HDCA 1DEHA 4JLAA 1HV8A 4P9NA 4YRKA 5CDSA 2HMVA 3INYA 4P3YA 2FMKA 5L4NA 5K20A 1JLMA 2DUNA 1EDBA 3EYWA 3PCXA 4DT1A 2ZB2A 4LSMA 4NECA 4NC9A 4M54A 5TPWB 2Q3MA 1KP2A 1OAOA 2HLPA 3HI6A 4IDPA 2QTMA 2VF7A 2YIMA 3H1TA 1VMKA 1ONOA 3THOA 5CM8B 2X77A 4LF6B 2VP0A 2DECA 3FWPA 2J4DA 1Z5UA 3EEYA 5H59A 1A27A 3KBBA 4ES6A 3P2OA 3H1FA 2AEFA 2X9VA 2UZ1A 3B6KA 2GESA 1X7HA 4ZODA 4EI2A 1VZ3A 3NKLA 3NYQA 4C1NA 2B5OA 1CR0A 3WI7A 1H3EA 3T3NA 2PD3A 2HRZA 4W6ZA 3RFUA 3PX7A 1VGQA 2AXPA 5KVSA 5C1BA 1JLKA 4LOJA 3TNFA 1LJ8A 1GUAA 1I7PA 3L7YA 5KUTA 3KP1A 2O8EA 1XVIA 1NZFA 1EX1A 3HI4A 4R71A 4EBBA 3GLUA 5K8UA 3NBMA 1IJFA 3CO0S 1IULA 1U7OA 1AV6A 3C5HA 5C81A 4YECA 4QU8A 5BUSA 1Y4ZA 5A62A 2H17A 1DFIA 1SUIA 3BSFA 3BBLA 3KJGA 4I4NA 2J6BA 4KYIB 5E6RB 1E6EA 1I6WA 2AFHB 4Q7KA 3NM4A 3KTOA 3KKEA 1A4IA 2A0FA 1NVGA 2SCUB 4RM3A 2FCAA 4OQQA 4ALLA 4ZK2A 5JS8A 4JI0B 1XEAA 3I0NA 1L7XA 3B51X 4M7WA 4YREA 1C5KA 3VC7A 2P9YA 4KAJA 4ENSA 4HN9A 5DWVA 1PRYA 1CUCA 1PTKA 1MIHA 3ZHXA 5KDOA 5G3ZA 1FF9A 1EM6A 1L5OA 2VP9A 2V58A 3GJSA 2C7GA 3TH5A 2J3EA 1G5RA 2ZJ0A 4LXQA 5A7GA 3G5LA 4YMGA 3ASUA 4NQRA 1FMJA 1AKNA 2H18A 4JKYA 3Q7IA 2CCJA 1KDTA 2GM9A 4BC0A 3CW9A 4EITA 2JS7A 4QTXA 3SP1A 1X3LA 1QFXA 1M8GA 2BMFA 2IRWA 3L0SA 2X0JA 2P3QA 3V3TA 2Y92A 4C7OA 4JYAB 3NTQA 2RGEA 4CUZA 4RPJA 1E0AA 2HA4A 1RJGA 2XMRA 2HI0A 4WKPA 1R00A 4OP1A 4U63A 1CUAA 1NRXA 3ZBUA 5C8DA 5JNWA 1T6BY 5BW4A 3BCRA 5KREA 2FW9A 3AUXA 2WVJA 3ICEA 4ZGWA 3FMGA 3NJ8A 5HKAA 4UMVA 2JJ8A 3M6MD 1KEEB 3G8YA 4EUFA 2W6ID 1RFGE 4FGJA 2VG8A 3H9CA 4JMPA 4IIEA 5TGZA 4IIBA 3GA7A 5ER6A 1GL6A 2FMHA 3G8AA 1P73A 3BVPA 4ZVOA 2G1JA 5HCIA 3RC9A 1QCCA 1E2MA 1OXSC 3FSGD 3PYLA 4FE3A 4MPRA 4MVJD 1BOFA 1KDZA 4Y3UA 1R10A 5K09A 2Q2VA 4MUEA 3EPJA 4IG9A 1L4FA 3KYJB 2Z6AA 2JJQA 2H2WA 1VE3A 2YYYA 4WOKA 1AE1A 1OFIA 1TPZA 3ZZ1A 2OFPA 2AKYA 4LBVA 4Q15A 2EHDA 3VYRB 2WHPB 4AO7A 1B2LA 1NXVA 2KI5A 5IYZA 1PEKE 3TX2A 2MYPA 1U8FO 2PQ0A 3O90A 4HHEA 1LF5A 4OQZA 3SVZA 1G1AA 1NW4A 1NE2A 3LPMA 3UCXA 1SCNE 4G0NA 1GQOA 3LUKA 4ZVKA 5K3CA 5K5EA 4B6PA 3HCRA 2FQWA 2PR7A 2GYUA 4MK4A 4YK7A 1E3WB 4OHXA 3IP8A 4GWGA 2FLKA 1JMKC 4ZA2A 3ND9A 1Z2CA 5F2KA 3SKYA 2ZUFA 5EZSA 1M2VB 3BIWA 1F9EA 1R12A 3BL6A 2R6JA 4HGNA 3WGLA 4F3KA 5LMCA 3N53A 4Q48A 5IT0A 2DCUA 1QR2A 4U7GA 4BEVA 2FZKA 2P62A 1I0IA 2BFCB 1KH1A 4ZU3A 3OLWA 2H65A 3M9XA 1QE5A 1XYGA 4A36A 4I8DA 4ID3A 3S70A 1LC0A 4G89A 4X5OA 3DAPA 1ECJA 1JE0A 1Z5VA 4KSBA 4BWVA 3QH4A 3QIVA 2NAFA 3L0OA 1EGAA 2M98A 2V7QA 5BSTA 2BC9A 4RNCA 5LZ5A 5IKEA 2I71A 4ZALA 5FF9A 2BE7A 1MX3A 1NPDA 2VNKA 1NVVR 3LF2A 3GGCA 4NG4A 1W93A 4KE8A 3V2GA 4DLYA 3GFQA 2WSMA 4LDQA 1MB3A 4LTMA 3S44A 4CQJA 5JJBA 1N8KA 3FF4A 4URFA 1N4DA 2NTNA 5DBOA 2QNRA 3D6FA 2GN1A 5CVEA 2GPJA 3WQQA 3GPDG 4Q93A 8GPBA 4KQKA 3FBGA 4YEDA 3B1ZA 4HLNA 3F98A 4H3HB 1SXIA 1R5BA 3PNLA 4Q9NA 3HJHA 4GOXA 4ARAA 4AN1A 1AKEA 4PXYA 1QRUA 2F90A 1JJFA 1TM7E 3BXFA 4TTSA 2X22A 4XA8A 4X3PA 5L3SA 2G1UA 3DEIA 5HQJA 3IQGX 1G59A 4HY3A 2JLQA 1TEXA 1L4KA 4O4LF 4NBVA 1B0ZA 1SCQA 3HCDA 4LYGA 4RAOA 3HU2A 3IP7A 4YLEA 1KDRA 2IXFA 4Q9LA 5JDIC 3NM5A 1VE7A 4PLTA 4F7WA 1O0SA 3P9CA 1M8PA 3DM9B 1ETUA 3LUHA 4ZCRA 1MVOA 2O2HA 3GLFE 3HYNA 3VR4D 1DJMA 1UBGA 3CIFA 3R9IA 4JP8A 4YR7A 3SCZA 2HU2A 2IDMA 1DOAA 1HT1E 4ARZA 5B4UA 1DBVO 1M34A 3LMKA 1XMSA 3Q9LA 4GHWA 2P6RA 4ENWA 2XXAA 4NH0A 1RQNA 1XXHB 4O33A 1RRKA 3P2YA 4L4SA 4UULA 4KWHA 1FDUA 1JLLA 1RPTA 1L5VA 1Y1SA 3A9UA 3VNAA 5AWFC 1G8PA 4BQSA 2ZDQA 4IMRA 3RLIA 4CHGA 1F2UB 4DVJA 4WLUA 3ITEA 2ZAGA 3CRQA 1XI2A 1T9ZA 4C3ZA 5EIHA 9LDBA 1C9YA 1HYHA 4WNCA 2A9RA 1QYXA 1JG1A 1ZI8A 5AI0A 3TZLA 1Q3TA 1L5HA 2EGUA 4AULA 2DHQA 4F06A 4G9GA 2O5EA 1ZMRA 4GE0A 2HV9A 2Z6QA 1HLDA 1S3IA 4WLVA 1IAVA 2Q3DA 3RS0A 4RS4A 2AMLA 6YASA 3GCDA 4WD3A 1E79D 4PC3A 3FG9A 3M6LA 4TRRA 2B4QA 3VR5D 2AUTA 2JW5A 3ESQA 4Z9YA 3OJOA 3R5SA 2PMCA 4C21A 2YZ7A 1T9DA 2ZOSA 3CFIA 1X2EA 1YB6A 3CUSA 3QVMA 1VCIA 3UV6A 4D98A 3S8EA 5ECGC 1JA0A 1X38A 5CH3A 3VZRA 4UAVA 2HDOA 3LG2A 4D79A 2O48X 3B70A 2IS6A 3DMPA 1EUDA 1NASA 4UREA 3UV3A 3PUJA 4UEKA 2IP2A 4CDGA 3IV9A 5P8WA 4JR0A 4MQEB 3S81A 4EJSA 2NU7A 3DUFA 3K8OE 1ZJYA 4AUEA 4EEXA 3CLSD 4LYJA 5EIWA 2ZSUA 4NMLA 1W85B 2QR2A 4ND8A 1NVDA 3G49A 3MJRA 4FFBA 4FXPA 4D9NA 3OOYA 5ADHA 4PU0A 1KIFA 3W2IA 2GAOA 1GT91 3HJFA 4RESA 1GPUA 1Y0BA 3GWGA 5B57C 3C4VA 2GSWA 4M1QA 3FWYA 4HLQB 2CNBA 2I2FA 1Z18A 2D1SA 4MCAA 4XPIA 4XIJA 1HKUA 2Z8YM 4FFSA 1NBOA 2IYYA 4FQ7A 4I36A 4MPPA 2WT9A 4GOOD 4P81A 4TKVB 3U4DA 4OY3A 1Z07A 3MSCA 5TEWA 1KAQA 2HJHA 4CEJB 4Z49A 2VA8A 1ZQ9A 5K0TA 5A5EA 1EUQA 1VG9B 2H9YA 4XYLA 1ZY2A 4NCKA 5BN3A 1ZO8A 3OE1A 2WC1A 4B1FA 4BIIA 2CHUA 4LVUA 3SJZA 1REQA 4CLRA 3QUAA 2I52A 2HBZA 3OM0A 3D6TB 2GPWA 1YQXA 5CMLA 2YXDA 4FC6A 1M66A 1D1QA 2FPGA 1FZTA 1GSOA 1OR8A 3RS9A 4NJEA 3SAJA 3WK7A 4ZDJA 1R5NA 2CL5A 2Z3WA 3AZPA 2P3OA 3MLAA 3JQRA 4BCDA 5F9HA 1P2FA 4XQEA 4UHHA 2Z56A 5ARBA 1SY7A 2ZR0A 3E9YA 2EKLA 1ANKA 4N3AA 5TX7A 1EA5A 3FGPA 3DO6A 3TEMA 3CPJB 3E7PA 1RXEA 4ZDWA 1CJUC 1JPUA 2GKSA 2RCNA 5D51S 4YRPA 2XB8A 1DWQA 2QTCA 3FPGA 3VOTA 2WP0A 1GA6A 2XZTA 1ZG3A 4MLZA 4KGXA 3LGSA 3R7NA 1LNSA 3UN1A 1H1TA 1TLTA 1Z2PX 4FFVA 3N5CA 1RLIA 3K32A 3OZTA 2QPAA 1ESEA 1OWOA 1ZGAA 3B36A 3KR1A 3VNBA 1EUYA 1YCGA 2NVUB 3HJUA 4HGPA 1AZSC 4PSKA 4J0FA 3NMUF 2YVUA 4WFKA 4I7EA 4G5XA 1KTIA 2VYVA 3K0KA 2VKTA 5JJLA 3SSMA 2XCLA 1W46A 4YUVA 4HWGA 1GO2A 4DVGA 3QUTA 4H4CA 4JYPA 1D1SA 4Q18A 1Y5RA 2AI3A 2EW2A 3D0QA 1NX9A 3FB1A 3IFSA 4ZJPA 5FBKA 4D26A 1CS4C 2AJBA 1ND5A 1TD9A 1ODIA 3KHKA 4JI5B 1U0EA 1DSSG 1E0DA 4G09A 1ULUA 4ZYXA 1E60A 4IJMA 5CLGA 3EVGA 2E85A 3T7AA 1DBPA 1O89A 4I50F 5J5CA 2BGJA 4LX8A 3EDQA 5EJ4A 1HKHA 3W8DA 1V8BA 2L82A 3W0LB 3AFOA 3W78A 3RRXA 4D0LB 3NT4A 2Y1XA 2HPZA 4K88A 4TLDA 2FK7A 4QTTB 3H86A 3UMGA 1KO5A 2NUBA 3HB9A 1RWQA 5EE3A 3ZE2B 4M1MA 5T6MA 1SVOA 3TQSA 2F43B 3O6VA 1H9AA 3OHPA 2CHFA 1KZ1A 4Q3KA 4NFSA 4F91B 1F17A 1RI1A 2VRCA 4LEIA 5IAJA 1R0SA 3RDPA 1AT1A 4MRPA 4EABA 1FJGB 1E99A 1NWCA 2O5VA 1ZCFA 3VZSA 4G0VA 5LQJA 3WXMA 2UVPA 1KI2A 3FIUA 4YQFA 2Y05A 5LZ4A 4QNRA 3LVRE 3TJRA 2F8TA 3B5EA 4I4TF 4AJEA 1ISPA 3NVAA 2JJMA 4ZJUA 1CUEA 3LBHA 2ZJ2A 4IMPA 2OV1A 4MAAA 4XJXA 5DULA 3X1DA 4UNSA 1W4RA 2ZRGA 1Z06A 2VSQA 3IX7A 1U9IC 2DB3A 3AB3A 3CNEA 4OI4A 4EFMA 1ECFA 1JIQA 3C8UA 3F8WA 4V2UA 3LBYA 4C29A 3D2CA 1BDIA 2Z3ZA 5HKKD 1YIOA 3LFTA 1O1YA 2HSGA 4HQFA 2RGNA 1N5KA 3BUSA 4MV8A 4L74A 2QR3A 3STTA 4Z6KA 1UDXA 3R3ZA 1UMBA 3AY7A 4Y6LA 3RSHA 1EDDA 2DG2A 3TDNA 2I6QA 3KEGA 4J0JA 4E5KA 4AKTA 2XBUA 4MCIA 2IDJA 4JXXA 1WB6A 5M5BA 1E1QA 4NDZA 2OYRA 5A3QA 3BXPA 3KEFA 3MWDA 3ON5A 3UWMA 4A4DA 1GCGA 1U5BB 1I2ZA 3MTEA 3RO7A 4IX1A 2C96A 1W6RA 1DTSA 3NBXX 2N42A 4PICA 3BWDD 1C7RA 4KSYA 4FFPA 1ZRMA 4R1QA 1PSZA 3E84A 4IICA 3EG5A 3T12A 3NFYA 1JZQA 1U0NA 5BNFA 1F4LA 3B6MA 3WYCA 3AINA 5AFSA 2FWRA 3GA5A 2Y93A 1NP3A 1RLJA 3RSSA 1RWNA 2C7PA 1YU9A 4M6WB 3COYA 4TLLB 4YP1A 2DT8A 2PAFA 4GX5A 1V8FA 1ECBA 3A1WA 3AILA 3TLMA 1HC7A 1PJ8A 1ZNXA 4AMZA 1NSYA 4XD7D 1E3EA 1V16A 2DPMA 4YAFA 1Q1ZA 2FX5A 4B6RA 1TM5E 2KB0A 5AQ1A 3CM0A 4PBTA 1SWWA 2UV8A 4XX1A 2ZJBA 5C5DA 4A2PA 1KMHB 2REOA 3CNBA 3ONWA 3WAKA 5AVSA 2BFWA 2Q5OA 4QBIA 1ABBA 2HYIC 2HDWA 4TT3A 3A4IA 5NULA 5A7HA 3C3YA 3U7HB 2A9KA 2OO5C 3SVLA 2I4NA 4MGKR 1Q57A 2HKIA 2FWJA 4YVFA 1PV2A 1RE1A 1M2WA 4HVCA 1M1YE 4R2KA 2I7VA 1RWOA 2KBFA 3B38A 3T7IA 2DBYA 2GS9A 2J30A 3I4FA 3NDJA 3KV1A 1O5TA 1DLJA 1XP5A 4ZV9A 3R7WB 3HZRA 4AB1A 2VTVA 2PZGA 4PGAA 1NX6A 3PFIA 5I7UA 1S7GA 4AMYA 4J7CA 1N34B 3DDCA 4W5OA 4ZQFA 4Z2AA 3FZQA 4G5QA 4OYRA 3V80A 5IJXA 4IS2A 1EU1A 2BY4A 2OFXA 1MDFA 3NWEA 4KQIA 3ECCA 3I9MA 2MT9A 3UK7A 5IH3A 2ZW9A 3X1MA 3AK4A 1IUPA 4C4PA 3X44A 2BSXA 1AS3A 4PX9A 3O75A 3B2QA 3WRYC 1UFRA 2AMYA 3DDOA 1SH7A 4V0ME 2OHIA 3RW9A 3B6ZA 4RTPA 1VYTA 3WO1A 4FMPA 5KYTA 1D3AA 1SVNA 4KIWA 3KXKA 4BFCA 2Q4BA 3ER6A 1EVQA 4R3NA 5DHSA 3RFCA 1Z45A 1EWQA 3QEBZ 2Q6LA 1RVDA 4MW5A 4ZCIA 3D43A 3DE4X 3EPRA 3N74A 4B3TB 1A77A 3KQPA 5AI9A 4B7XA 3TSOA 2B8JA 4O25A 3HWRA 1ZJZA 2IYTA 3CB2A 4WK0B 4YS6A 4J91A 3ZC3A 3RYCB 1U0FA 3BIFA 2P9FA 4QGGA 4COKA 4WZZA 4TXNA 1VHJA 5DASA 3Q8WA 4RH0A 3ND7A 4IUBS 3JAKA 4FB4A 1VKJA 2AQKA 1GG5A 2Z95A 5DGCA 2BH9A 3KALA 5FJJA 3UICA 5AW0A 3TGLA 5LKRA 3NPMA 3MILA 4LV5B 1TM2A 1DAIA 1LKZA 3VU1A 3QIAA 7MDHA 2RGAA 4AZ3A 3SQOA 4M8SA 1U2DA 1SHUX 1B4DA 2C7QA 1PQPA 3CONA 3RVPA 3AHFA 1YUNA 1TUGA 4G1UC 4GL2A 4O2AF 3UJ6A 3W05A 2HNAA 5EFZA 2BMAA 1XCPA 2ZI5A 5AVKA 4ECAA 1LDGA 4NPHA 4MYRA 1WUIS 3HK2A 1JLRA 2YOHA 1I32A 3EC7A 3HY6A 4REMA 1G3QA 3JWPA 4YJDA 3L04A 1TM3E 3BTOA 5AM4A 2ZWMA 5G4KB 2IS2A 1TQ4A 2FPWA 1Z0AA 3N59A 1F8XA 3NNDA 1MB9A 3HJAA 4YH1A 4E31A 1UXJA 2HDNB 3PICA 2VJKA 1XDBA 4IEFB 4R7GA 2I76A 4Q3CA 5F21A 3W8NA 1F2UA 1J2TA 4M98A 3UJ3X 4E4TA 4I9NA 3CZRA 5B12A 2ILVA 2ZTVA 3B6JA 4KYTA 1FYXA 2GK3A 5IW8A 1FUUA 4F3YA 2Q28A 1O4VA 3QHPA 1FMCA 1U65A 2FZCA 2J8ZA 1A8HA 4KAFA 1BJTA 2ZITA 1OAAA 1CJTC 5FYDA 4MQ6A 5C9ZA 3QX9A 2IU6A 2W2KB 4D8VA 3ONNA 3JVEA 4EZIA 1BZYA 4URXR 1ACLA 3EG9B 3HCEA 4YONB 1V7QA 1KJNA 13PKA 1XAIA 2J87A 1QJ4A 2CW5A 1KIAA 4DLVA 1CVRA 4DSUA 1ACJA 1RKQA 5CP8A 3CVYA 2V3VA 1V96A 1YZGA 3DMTC 4AP6A 3D3WB 4DUGD 3BBPA 1ORVA 1U94A 3LQKA 3P9ZA 4DXDA 2WINI 4YMUA 1U9CA 2POQX 3Q5GA 2WD7B 4JB3A 3NNSA 1X1TA 5U9CA 1NNEA 1PUIA 4DDHA 3C70A 4DBLC 3AVQA 2EYQA 4Z99A 1M3SA 1V4BA 2Y1DA 3KL4A 1P7ZA 5FNZA 1JLLB 1Q0RA 2Z3VA 3S5UA 1RCFA 3GJYA 3RV4A 2CNLA 4YMTA 1ZOPA 2IXDA 4LHEA 5AD1A 2WQ7A 3LYHA 4JJIA 3L07A 1RBMA 5B7NA 1SXPA 3HNRA 1FDOA 4N5LA 1GTVA 4F38A 4H1TA 4V0QA 2WKWA 3AGQA 1QCYA 1TEVA 1X7GA 3WJ2A 2EKPA 4POAA 3RGWS 4TMKA 3RKSA 3G1UA 4KMRA 2N3ZA 4JLUA 2XZOA 1H1LB 1QB7A 2JGNA 1TPYA 4QNNA 4LSWA 1Z5PA 1G6Q1 1J22A 4N5HX 5DBFA 3BXGA 1CETA 2Y0PA 1KI6A 4KUGA 3VNSA 4IMJB 4TKVA 1F3OA 2D2VA 3K30A 5HGJA 3IALA 1CZNA 1ATZA 2ZCJA 3IURA 2HH9A 4IJ6A 2JBAB 4L6AA 4OHZA 2EZUA 1QIJA 3EBOA 3WHLA 4U39A 4L1KA 1QK3A 1ECPA 3QX8A 4QGHA 3L46A 2P5TB 4MX8A 2X13A 5K3FA 3IXMA 2XMDA 4M9SA 4TL6A 3LBIA 2OM6A 5CLHA 4PRZA 2VBCA 4JJ6A 3II6X 1TIBA 2ZJ5A 1C3JA 1XHLA 2Z08A 1T36A 3KV3O 2W6MA 4II2A 3OMXA 4KDRA 4E1VA 5LDDC 4RGQA 2AJDA 3ENQA 1UAYA 2SICE 1KFBB 2X3UA 2YV4A 1TJYA 2DH6A 3MFQA 1RKUA 5G53C 1GFZA 1OROA 1X1AA 4AAYA 4GKJB 2LCIA 3GYGA 1NVTA 1CY0A 3BD6A 3DHEA 4V24A 1MGOA 2PFGA 3K70C 4GI1A 5TIIA 1UODA 3OUZA 1WKCA 2FSSA 1V45E 3IPAA 3L41A 4J3FA 4IXMA 3ZQ4A 1WB4A 5HOQA 5I7FA 3IE0A 1MJHA 1KP3A 3SQNA 3OC6A 4XKJA 4Y2RA 2AMVA 2K5UA 2FP4A 3CRNA 1I4TD 6PFKA 4RELA 1ZVVA 1P1RA 2ZRHA 3HLYA 3FWZA 3NKVA 3PL1A 2GLTA 5JALA 1PFYA 1TDJA 4C2BA 1IN1A 3LK7A 2OGWA 2H2DA 3A3YA 3GPBA 2E4ZA 3K20A 3IKVA 3TRFA 2D4AA 3QU9A 2FFQA 1ZN9A 1T1IA 2ADMA 3C3PA 3O8OA 2R65A 1GTSA 1SULA 3IOMA 4I9HA 2XITA 4PSVA 4F56A 3IAM1 3WLLA 4BO7A 5IWAB 1QF7A 5EI5A 5C5IA 4B46A 1GR0A 4PQGA 5FQNA 5AKEA 1FJXA 1I2MA 3FFXA 2F64A 3K35A 3IKTA 1XA3A 3KOZA 4P80A 1EDZA 2WVAA 3CO5A 4Q00A 4P33A 4UBMA 2O8FB 4HQ0A 1MHPA 3P27A 5EHIA 4OHCA 1DHRA 1GILA 3LX4A 4EPYA 4WW0A 3G7SA 4NK4A 1BVYF 5IFLA 2P78A 3ESBA 3LCCA 2WUEA 4MB2A 4E5VA 3EARA 1T2AA 3HYTA 3LUFA 2P9TA 3DBLB 4K7JA 4X95A 1OH5A 1HE3A 4FEYA 5HFJA 3UMJA 1XFAA 2XAUA 3D7NA 2VHJA 5P21A 4JI4B 4MI9A 1JHUA 2QQEA 4DR7B 4D96A 3PQEA 1KMMA 5IU6A 1VPTA 5DN6D 3WKEA 4L9RA 4R81A 3T3HA 1CP2A 4ZTUB 4PW0A 4U7FA 1ZD3A 5KU1A 4MS3A 3UQZA 4AZSA 3QM1A 3WLAA 4G63A 5HZKA 2CDAA 4MUKA 1XELA 4Y2PA 2ECQA 4RF4A 5LYJA 2CHGA 1W30A 1JYFA 4MVCA 3MJVA 2ZTSA 3A2LA 4TROA 2G9VA 1QZXA 2YMLA 4Y1EA 2PS9A 5J2UA 2QROA 1AKWA 2D5IA 2R8OA 1SOWA 2A1TS 1Z6QA 2CZQA 2EL9A 3ELYA 2OCLA 4H35A 1OF1A 4HDKB 1T0HB 4HXFB 3P0IA 2XSZD 2IC5A 3EH2A 1GGFA 1NOKA 2G9QA 5E6SA 1W4ZA 1GPKA 3ZYCA 4EUKA 4V1CI 3TXYA 1KIMA 5BWLA 1BQ3A 1X1BA 4FFDA 4GZMA 3CKYA 3N2GA 5EHXA 4F93B 4IOMA 3MJCA 2C7BA 1V7PC 1YS1X 3I12A 1WUHS 3EZ7A 4XCVA 4UNRA 5A02A 1UMBB 4I4CA 2BGWA 1TB4A 3U37A 5I48A 3OKFA 3GXOA 2L19A 4XIGS 2VPQA 3L18A 1PW7A 2O7VA 4OMUA 5MFPA 4UOZA 1L7EA 1Y3AA 1ECCA 5CVDA 3HPRA 4MA0A 4XDHA 2RD2A 2YMPA 4H3VA 5CNJA 4ACBA 3PJRA 4C4YA 5CA0F 4QGSA 1L1FA 4FT2A 3QXXA 4P0QB 1HZZA 2F8MA 3QPCA 5ES4B 2BFNA 1IK6A 2HWKA 3IT0A 3JYPA 1K06A 3R44A 4KQ9A 2J9XB 1F8YA 1XQ9A 3JQ9A 2FPIB 2A14A 3HMKA 1OXMA 4R8RA 3VR6A 1JSLA 4HX9A 3O91A 3K9HA 2VL7A 1U3VA 5AESA 2ZUUA 3QVXA 4D8WA 5BSVA 5JS7A 1X77A 2VDUE 2XB6A 2FEWB 1BCSA 4GLOA 2GLXA 3FPFA 1W0JD 2OCAA 2ZUTA 3JZAA 3D3KA 3GJQA 3O2NA 5K0BA 3ZCSA 5BV7A 2F1OA 4PE5B 2ZE7A 3JVVA 4TT3D 5LJIA 3UJ8A 1Z75A 5I4IA 3GVPA 1J1IA 1K6EA 3KQWA 3TCXB 2YW9A