3MUEA

Crystal structure of pantoate-beta-alanine ligase from salmonella typhimurium
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
285
structure length
285
Chain Sequence
b'AMLIIETLPLLRQHIRRLRQEGKRVALVPTMGNLHDGHMKLVDEAKARADVVIVSIFVNPMQFDRPDDLVRYPRTLQEDCEKLNKRKVDYVFAPAVEEIYPHGLEGQTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLIQPDIACFGEKDFQQLALIRKMVADMSYDIEIVGVPIIRAKDGLALSSRNAYLTAEQRKIAPGLYNVMNSIAEKLIAGNRELQEIIAIAEQELNEKGFRADDIQIRDADTLLELTETSKRAVILAAAWLGQARLIDNQSVTLAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
molecule tags Ligase
source organism Salmonella typhimurium
publication title Crystal Structure of Pantoate-beta-Alanine Ligase from Salmonella typhimurium
rcsb
total genus 92
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3mueA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3mueA01
1EE1A 3KT0A 4MVWA 1H3EA 4NATA 1EXDA 4G6ZA 3P0JA 3UOWA 1N3LA 1QTQA 3ILVA 3PNBA 1F7UA 1M8GA 1TQ8A 1CT9A 3CR8A 2X3FA 1VBKA 2VTBB 3IUBA 3IVXA 1IQ0A 4UZEA 3PXUA 3ZUGA 3OTWA 1P7PA 2HMAA 1O6BA 2YWBA 4CDMA 3N8HA 5TGTA 1ILEA 2PG3A 1QRSA 1GTSA 1Q11A 3CVXA 4TS1A 1O5TA 3CVWA 1NYLA 1MRZA 1X8XA 4KR9A 3COWA 4K0RA 2CT8A 3N2YA 3KT3A 2CV2A 4GRIA 3FIUA 3DLAA 2QTRA 3OP1A 3FHJA 3E27A 2J09A 1GPMA 4ZT4A 1GN8A 1M8FA 3RFFA 2D13A 1IHOA 4DLPA 4YP6A 1JIJA 4DJAA 4JXXA 4E1AA 4DDKA 4EF6A 4MUNA 2OQ2A 4KR7A 1J1ZA 3H99A 3L93A 3ZXIA 2CYAA 3RJZA 2CFOA 4MW9A 1H3NA 3HGMA 4Q93A 4DNXA 3FNRA 2O5RA 4DDMA 1U7DA 2A1UB 1M1ZA 3SYTA 1OWNA 4QREA 1K4MA 3UY4A 3IVCA 3A05A 4OUDA 1K4KA 2A1UA 1N75A 1N2IA 1WXGA 5J58A 3IMGA 2CV1A 1JECA 1T6YA 3MLBA 2I1LA 1TYCA 1O96B 1I6MA 4KPUA 3NBKA 1O0CA 4MUFA 2H29A 1O96A 1J09A 2QUJA 5HG0A 1R6XA 2ZP1A 1N2OA 3CLSD 1KR2A 1MBZA 3H9BA 1M8JA 5KCMA 1XNGA 1MB9A 3IOCA 4Q16A 2WQ7A 2D5BA 4PBTA 1JGTA 3K9WA 3HV0A 1GZUA 2QTNA 1COZA 3CVVA 4PBRA 4QRDA 5K0SA 1S4MA 3RK1A 1F4LA 4MUEA 4WNYA 2A1TS 4NDAA 1T6ZA 3HZRA 1N2HA 1N2BA 1ULHA 5K0TA 1J70A 2GM3A 2VTBA 1T9GS 1Q15A 1WKBA 1EFPB 1JEEA 1NURA 3PNVA 1QNFA 4NZPA 4ZCQA 4MVXA 5DASA 1A8HA 2PIDA 1J1UA 2AZXA 4FZJA 1SURA 1U3CA 4WSOA 4ZT5A 3H97A 5TS2A 3Q12A 4G5YA 2E21A 3K32A 3FY4A 1MAUA 3VRHA 1NSYA 3MUEA 4EG4A 1M8KA 1GTRA 5KWVA 2YWCA 3C8ZA 4JYZA 3D6UA 2DLCX 1T9GR 4MVYA 2RE8A 3A4IA 3GUZA 4UZFA 2E0IA 4EG8A 4EGAA 1JHDA 1NI5A 4MQ6A 4JXZA 1X6VA 1EUQA 1G8GA 5JBNA 4HJRA 4H3SA 3UC5A 4ZCRA 2J5BA 4NX2A 3IODA 3S3TA 1Y42X 1PFYA 3CLTD 3AG6A 1I2DA 3KT6A 3L92A 4R2MA 4MUJA 4HK4A 3TQOA 2DPLA 4JFAA 1IFXA 1XNHA 2RD2A 1EFVB 3FOCA 1G8HA 4PBSA 1NUPA 2NSYA 3MMXA 2O8VA 2WQ6A 4MW4A 1JIKA 5DEOA 1N2GA 4EG5A 3A04A 2DEUA 1ZJWA 1KP3A 4J76A 5IJXA 3IMCA 4MUKA 3SZGA 1DNPA 4EG3A 1O0BA 1IVSA 1U3DA 1NUTA 4ZT3A 4G5FA 2JANA 4ARCA 4XSVA 2WSIA 4F4HA 3CLTC 3AL0C 4ZCTA 2CYCA 4HJXA 3MLAA 1KQPA 4YP5A 1NUUA 5HUJA 3AG5A 4MAFA 4XFDA 4YMIA 1OWMA 4R2LA 4RUKA 5H16A 4OUDB 3P0HA 3MXTA 2IJGX 4DDHA 1V8FA 1KQOA 1QRTA 4P2BA 2PZBA 1QRUA 2GKSA 1KH3A 4ZT7A 1D2RA 4EFKA 2A84A 2VXOA 4QBTA 1WXIA 1IQUA 3F3MA 1OWOA 3LCJA 4CDNA 1TYBE 4U63A 4HPWA 3SP1A 3P52A 1OWLA 3NBAA 1N1DA 3ELBA 2Z09A 3CVUA 2R5WA 5IHXA 5F23A 2PZ8A 2ZUFA 5FNZA 1J20A 3COVA 1NZJA 2Z3VA 5LLTA 3CLRC 1IQRA 4DE5A 3NV7A 3ZIUA 2OV4A 2TS1A 3AIIA 1KQNA 1H1TA 5TEWA 4PY2A 2CUZA 2HGZA 2PXHA 2AG6A 4MW5A 2C5SA 4ZT6A 3TS1A 1M83A 2A86A 1K97A 3KFLA 2D54A 1YIAA 1O94D 4MUGA 3UK2A 3X1JA 2XRZA 1QJCA 3X1MA 3SEQA 1YI8A 1LW7A 1VBMA 5HUHA 4K03A 4AQ7A 1Q77A 1EFPA 1N2EA 3N9IA 1RQGA 4RPIA 1GLNA 1OD6A 4L2IB 4L2IA 1WZ2A 4EG6A 1V47A 2YXNA 1J21A 1KKUA 1O97C 4MWDA 4YBRA 4MLPA 4MWCA 1QU3A 3Q10A 4CT0A 3N05A 1G59A 5DB4A 3IH5A 2X1MA 3GMIA 3KT8A 3I05A 2CSXA 5FO0A 1I6LA 2QJFA 1WXFA 2A88A 3LE8A 1IRXA 1KH1A 3CLUC 4KKVA 1WQ4A 4NAHA 1XNJA 3QTTA 3HL4A 1NUQA 3COZA 1WY5A 4ZCSA 3ND5A 1NUSA 3PNYA 4I6GA 2J4DA 3ZJVA 4MUIA 2V0CA 2B7LA 2BYTA 1Q19A 1WQ3A 1NP7A 2WB2A 1TEZA 4X0EA 3FWKA 3DO8A 3FH0A 1QQTA 2A1TR 3M5WA 2G36A 4CQNA 3FI0A 1O94C 1EJ2A 4XFJA 1N77A 3BL5A 1TFUA 3TZLA 2NZ2A 2QJTA 2E18A 3H05A 1TYAE 4ND6A 1N2JA 3CLUD 3AFHA 3ZXSA 1EFVA 4JZYA 3TZEA 4KPUB 3X1KA 1R6TA 4I6EA 3IMEA 3H9CA 2DXIA 2CV0A 4MW1A 1JZSA 1O97D 1B6TA 1G8FA 1U0BB 1XJQA 1KAQA 2HZ7A 2PFSA 3ND7A 1TYDE 4AS1A 2A7XA 2IP1A 1GAXA 3GLVA 3IUEA 3G6KA 3P0IA 3A2KA 4S1OA 3ISJA 1I6KA 3DV2A 1VBNA 2PZAA 3COYA 4MW0A 4ND7A 3CLSC 1JILA 2JAXA 4EG7A 3DPIA 2QUHA 1UFVA 1FFYA 1KP2A 1MJHA 3JXEA 3PRHA 1JZQA 1T6XA 1YUMA 3SZ3A 1FYDA 3HMQA 2EJCA 1BS2A 1JEDA 1EUYA 4MUHA 1PG0A 3CA8A 4MVCA 4U8HA 1IH8A 1YUNA 4OJMX 2H2AA 1PG2A 1VLHA 1KAMA 1ZUNA 2X1LA 3QE4A 2J08A 1F7VA 1H3FA 2EL7A 1WXEA 4ZCPA 1KH2A 1ZH0A 2GOYA 3ZGZA 5DK4A 4BWVA 1M8PA 4A91A 2AKEA 1HYBA 1LI7A 4GU5A 1MOPA 1PFVA 3INNA 1WJGA 5TEVA 3FDXA 5AHWA 4ARIA 3LOQA 1VL2A 2QUKA 5KHAA 1OBCA 2DERA 1O95D 1ZH6A 4YP7A 1PFUA 5H7XA 1MB2A 3ZJUA 1JIIA 1MC1A 2V0GA 5J5AA 3IOBA 3VU8A 4EG1A 3SDBA 1QU2A 2A4MA 3UMVA 3CLRD 4R0NA 5BNZA 2YY5A 4U7JA 1WXHA 1KORA 4MW7A 2E89A 2XRYA 5J59A 3IDFA 2QTMA 4NAUA 3TQIA 3QTBA 1PFWA 3RBAA 3D6VA 3G5AA 1U7XA 3Q4GA 2ZUEA 3SEZA 1R6UA 2JA2A 4F3RA 3HFJA 2BTEA 1O95C 1YIDA 4MULA 2IELA 3FETA 2CYBA 5LM3A 1N78A 2DR2A 3U1VA 5LFAA 4MWBA 1JMVA 3RK0A 1WOYA 2Z08A 2DUMA 3G59A 4I6JA 2X0KA 2QJOA 4MWEA 3VGJA 3ND6A 2QUIA 3ZJTA 3FG9A 1F9AA 3IVGA 1OWPA 4MW2A 4KR6A 1LI5A 2DETA 5EKDA 5FO1A 4MW6A 3CVYA 1YULA 2J07A 1K92A 3IOEA 1MAWA 1OBHA 3RHSA 4ZT2A 3TNJA 3AKZA 4J75A
chains in the Genus database with same CATH superfamily
2NU9B 1Z8NA 3DVAA 1SQFA 1YH3A 1ZW6A 2QG9A 2CHFA 1RPTA 1JIUA 2Y4NA 4HS9A 4Q3OA 3UT6A 1OT5A 1FFDA 4IVRA 2ZZNA 1LFDB 1CT9A 1A9XB 1Q2UA 5J1SB 1MZVA 1U7HA 2QU8A 4XX0A 4B4WA 3OICA 1PDOA 3U7QA 2MSLA 4XWOA 3G2JA 3QLJA 2HMUA 3TM4A 2R4QA 1JEQA 1O6GA 1P7WA 2I1VB 3TKAA 3B6MA 4P38A 2YWBA 4EMBA 5KEIA 1IY2A 2IYZA 2W7TA 2X2OA 3DUFB 2A9VA 2BMAA 2LCFA 2XOXA 3LZ6A 4DG5A 2A54A 2VAPA 2FUG1 4M98A 3ORRA 4HUTA 2FJ0A 5FBHA 2P9JA 1KZ9A 4Z9XA 2A78A 3AB3A 1H2AS 1L5RA 3TZCA 1X8XA 1W19A 5COQA 3COWA 4KR9A 3SFZA 2OUKA 2C9YA 4JLSA 3OP1A 1RQRA 3P27A 2QI9F 4HY3A 2J45A 5FTJA 1TVCA 2RHRA 1G8KA 4IS3A 4W9MC 4RZ2A 3KPYA 4NSNA 1UXOA 2WHRA 2RFLA 2PH5A 2BWJA 2JLWA 1Y9JA 4RJ2A 4C0BA 2I4OA 5T8KC 4YWHA 5MN4A 1IYZA 1S7GA 3GGCA 2ZIXB 4XR4A 1WWKA 3ZI7A 3ZXIA 3STXA 4I4TF 3DYIA 1DOZA 5TQVA 1ISJA 4Q1VA 4JVMA 2XRFA 3H5TA 3N6VA 1AK9A 1YBHA 1XNQB 5EIAA 5TGZA 3OQVA 1Q0LA 3E22B 4DDMA 1M1UA 4KLAA 2EW8A 2FF5A 2MHCA 3C1TA 4FTWA 5HJ5A 3LY5A 1WP9A 4B4KA 3KSBC 3G79A 4QZVA 3HVRA 3GJ3A 3LXMA 4B5LA 2VK1A 4ENPA 1X7XA 3AUXA 4YPOA 1WXGA 1E5TA 1ZSVA 1VG0B 2CV1A 4HF7A 1CNMA 1JECA 2VHZA 1JJFA 1D6NA 2Q3CA 1OR8A 3K8OE 3NEJA 3NBMA 1O96B 1G5RA 1P8AA 4FJ0A 3TLAA 3OIDA 3M0EA 5FULA 1RC0A 4HP8A 3ASVA 4KXXA 2VUIB 1KBQA 3N2KB 4BNDB 3KKMA 3CF4G 2QUJA 2VJKA 2VQSA 5JY1A 3QU9A 4H3HB 4TTVA 5HG0A 2ZP1A 3Q1LA 4V3BA 1AGPA 3KQPA 1KR2A 3QVMA 1ZJ5A 4MR9A 2ES4A 4AYWA 2NLOA 4E4RA 4OKIA 4DIOA 5KCMA 5B58T 1AKEA 4G23A 2IKQA 2CNNA 1SHKA 3IA2A 4LWZA 3QRWA 4W5RA 4Z4QA 2WQ7A 4OMCA 3T6KA 2UZ1A 2RGCA 3NWBA 4JITA 2QTNA 2R84A 2VRNA 4P3XA 3EDRA 2M6RA 4CCSA 2K87A 3ZI4A 3FZEA 5ED0A 3FZGA 1PKXA 2UYGA 3K1AB 2BJWA 4O25A 4YLEA 1WMEA 3O4IA 3UYKA 3ZLUA 4RM3A 5G41A 2IU3A 2GILA 4QUGA 1QDUA 3UG7A 4JUIA 2HK9A 1HDRA 3QNMA 3UB3A 1DAHA 1CY1A 4EPRA 4L57A 5LKAA 2DCUA 2O8DA 2ZT5A 3QLUC 4F04A 3C6QA 4F1JA 2PRKA 4GDMA 5BWNA 1JEEA 2G16A 5C7OO 4MVXA 2BJVA 1F8UA 1X8KA 3B5JA 3U44A 2G4LA 2BR4A 1ZK4A 9MHTA 2O3RA 1JKJB 5KTKA 3BQMB 1TKBA 2FZ4A 1XLTA 2WJYA 4PX2A 3LP8A 4FZJA 4ME6A 1G0NA 3GH1A 1V11B 1A2QA 3LPCA 4JI6B 1E63A 2D2VA 5DBEX 3H9QA 5AO9A 4DMRA 4W9NC 5JYBA 1TIBA 2RKBA 2I2XB 4I4CA 3ZK9A 2IEZA 2QQFA 2QV7A 3M4YA 3SHTA 2HAEA 1MRSA 2PFGA 3C6XA 3I37X 3SAJA 1VFPA 4ZZ3A 5CB0A 1FUYB 1NMQA 4K2AA 3U7EB 3ZWOA 2FPSA 2FSSA 2JBHA 3PGXA 3D6JA 3Q2KA 2ZVQX 3IAFA 4NCBA 3Q8LA 3LBHA 1PGJA 2XWSA 2PGLA 4K9NA 1DBQA 4DCJA 2BN4A 3U4AA 2IQIA 2EDAA 2OOSA 4D92A 3EXIA 3LX4A 4YUAA 4TS3A 4JC8A 2HMVA 1YRLA 3L0DA 5EMHA 3WGTA 3WBFA 2VDMB 4K1XA 4KJZA 3OEED 8ADHA 4F21A 1QWSA 2G4CA 4EHHA 1E9VA 3CRRA 5AVYA 3LT0A 4M49A 2WVJA 1L5HA 1Y9ZA 1QO9A 1JPJA 3HR4A 1GQFA 4OTZA 4QSHA 4R2WA 5D51S 3VPAA 2J0SA 2ECQA 3QUTA 5K3FB 4C2AA 4DYVA 3U0VA 5JCOC 1XMPA 5KUTA 2RIRA 4XUCA 1EFVB 2IPLA 2ZBGA 4IIJA 4PBSA 1NUPA 1YOVA 1JPNA 3JYQA 1IHXA 1HYGA 1RZRD 5ECWA 4M37A 5E6RB 3EEIA 1PG5A 5DP2A 2EJVA 2VYQA 5EXCA 2DKNA 1WKCA 4I3FA 1PJ2A 4X94A 2HXGA 2XCLA 4EFDA 1LV8A 4ARCA 1FJ2A 1YDMA 2HA7A 2IHVA 3A7EA 4PFJA 4XSVA 4QDOA 2BBSA 2YC4C 3K6SB 4EHLA 4GR9A 5TR9A 5JRJA 3NH9A 3HVIA 3LFHA 2BDEA 3ETJA 4KQ9A 3MTGA 2CJFA 1J2UA 1KQPA 3BGOS 3MM4A 4CODB 1K7YA 1NUUA 1X1SA 2DUJA 1EFTA 1WE2A 1GGNA 1U0EA 3K9HA 1QC5A 2D0PB 2OLEA 3SBOA 2JG3A 3PHBE 4WNIA 4C7BA 1KOGA 1U2ZA 1YAJA 3TB6A 3ZY5A 1HLGA 3C70A 1RSZA 3PFBA 3V2HA 3AKEA 1NF9A 3WNDA 3QF4A 4IJVA 3EG5A 1B0UA 2VXOA 5IPFA 2QD5A 5KC9A 3UPUA 1CE8A 3MCVA 3ZOZA 2L19A 2XMRA 4C1NA 1OPXA 5CB4F 1N0HA 2ZI7A 4WOPA 4LY6A 4WUVA 4LJLA 4ZD6A 1IVNA 3SP1A 1GKYA 4NZOA 3L5OA 4OKSA 3I9NA 3EQ9A 1CS0A 2VDOB 3A0UA 4FMCF 4R1NA 4J1TA 1N1DA 1SVUA 1W0JD 1Z5OA 4KE6A 1QH1A 2YHSA 1ZGGA 3AZPA 1DO8A 3UATA 3HPRA 3C0KA 1QQ7A 4BNJA 5K0LA 2ZRJA 4FYJA 1M0TA 2Z3VA 1QRAA 4R7TA 1FTNA 4B6RA 3JWEA 4QELA 2XZTA 5HM6A 2ZSAA 3ZIUA 5DSZA 3RHZA 4OHVA 4BFXA 1XELA 3HNRA 4D8TA 5JWHA 4DLWA 4MROA 4LFAB 2D7JA 4JL8A 2QYHA 2VDWA 3D2AA 3DLPX 3RYHA 3DD5A 4QT4A 4PY2A 3ZGNA 3PNQA 2FG5A 2HGZA 1P7ZA 1Y8QB 2CK3A 1C3JA 2VYND 2WHPB 2XITA 3CUYA 4R51A 4YMGA 1ELOA 4V1CI 5I48A 4DXHA 5TMEA 4ZDIA 4UXJA 1Y3FE 3ZHBA 2ZS7A 3OMXA 1G3RA 3FJ1A 1SBQA 2CMKA 4G0NA 3HFRA 1NYRA 1YR8A 1T15A 3L05A 3LQQA 1N2EA 3IUNA 3LCVB 3S1SA 3G9ZA 1R10A 1KPHA 3IA7A 2XB8A 4P86A 4HT3B 4ZK2A 3HXQA 4JJ7A 3AKCA 1CPYA 1SCBA 3FUUA 4O4HA 1U7ZA 3PL1A 5T67A 4EG6A 3Q9UA 2ZCJA 3HTXA 1E98A 3L9XA 4YJFA 3AILA 4LDPA 4GOLD 2WWGA 3V1MA 5KMGB 3RE1A 3Q7RA 5HIJA 2QL7A 4JLAA 5M29A 1E1QD 4WXYB 3VOBA 4KREA 3KSZO 4ZZ1A 1BMDA 5LIRA 4B09A 1QGYA 3JQ8A 3MWLA 4IIHA 3I05A 3PKJA 3HP7A 3IAM6 4O2LA 4PYRA 4Z49A 2QJFA 1IRXA 3PNSA 1ECLA 1ZCFA 2QP4A 2Y0EA 5E6RA 3ST7A 1XD2B 1E2EA 4QYWA 3PCXA 4ON9A 1I4EB 1LNZA 3ZD8A 1SZPA 1ITZA 2ZIAA 3RQSA 1GPBA 3HO8A 1N57A 2HSGA 4Q18A 5DHFA 3TW8A 1UC9A 4ENRA 3U7QB 5KYGA 1LQTA 1E2PA 1ACJA 2NXCA 5KYWA 2YMQA 1LD3A 4MA5A 2WB4A 5IF3A 4H3KB 4L78A 3LECA 3R09A 2WB2A 1Z56C 2HBZA 3WIVA 2W43A 3GAFA 5B2ZA 3VDQA 4NCNA 1V1MB 3PUYA 4NE7A 4X20B 4EBBA 1C5KA 5BSKA 5EJ7A 5H3CA 4ZYTA 1PRYA 3A1EA 3GRRA 1JDTA 2X7JA 3GJ4A 2JKYA 5A05A 2XZOA 1ZQ1A 4UAJA 4UBOA 5JROA 1V1RA 4ND6A 4PX5A 4RD6A 4IXWA 3WKBA 2VQFB 4GQBA 2Q5OA 2WTXA 4H7IA 3EN0A 1ZC4A 3MC1A 4FFSA 1EFVA 2Q6TA 2YS6A 4BXOA 3L8GA 5DBGA 5FOVA 1FYFA 2A67A 3WNVA 4JV5B 2ZTSA 3IALA 4WXEA 5DM4A 5IARA 4YS6A 4CEIA 1R8YA 2GVZC 4DLVA 1XQ6A 3BSYA 1E1RD 1CUFA 1XJQA 1A7JA 4W8GA 2ZUTA 4F4JA 1X86B 2H5JA 4UU7A 3RTGA 4ZICA 3I0ZA 2NOAA 4G5RA 3CIOA 5K0BA 5L3QA 2ATXA 3ESXA 3AY7A 3ZLTA 4QDTA 4EZIA 1JQ3A 2I80A 3UKDA 3L6DA 4I9FA 3AP3A 1VBNA 4Q7LA 5IBCA 3PQEA 1E1LA 1XF1A 1C4XA 1E3LA 4NFHA 1A71A 1QE5A 1Q6ZA 1RLJA 4KAFA 2YZMA 3ENWA 4YPFA 4YHHB 2C5GA 1A7KA 3R3ZA 4GOMD 3ZE9A 5EHZA 1LBSA 3JXEA 3PXXA 4HDKA 2RAFA 1R4MB 4BFLA 3PEVA 4AG5A 4AQDA 3PEWA 4ZTUB 3M3PA 2OHHA 3K5IA 1WD5A 2GHQA 3HYCA 1UKVY 1YB2A 4MUHA 3VAAA 1PG0A 1M1XB 3PHLA 2AR9A 2PS1A 3REQA 621PA 4LZZA 4I4LA 3ZCXA 4CFSA 4US2R 5TRTA 1EVEA 4BO7A 3QEAZ 1KAMA 4EJFA 2CFSA 4IDQA 2X1LA 3C4QA 1PL6A 1RZVA 2J08A 2N9UA 2ZYDA 3E0QA 4WFJA 2H9IA 1DDOA 2GASA 4HNSA 4UUMA 3UFXA 4MCJA 3H5RA 1PNTA 4KODA 5KSZA 2LDXA 3BL6A 4MZDA 1NMZA 4MO9A 5EP4A 4KQKA 1N5MA 1UAYA 3DE6X 1RR6A 1U2GA 4WKOA 3R5FA 4QBGB 3GLFA 5JH7A 1MOPA 4RQBA 1GOTA 2G28A 5GPBA 4IYJA 4IRUB 4UDOA 3OU2A 5KX5B 1ORWA 2H07A 3LS2A 3QUSA 1S2LA 2CXUA 1Y8CA 4GQIA 2UZ3A 4DAOA 3RR2A 2HT1A 1G2OA 4Y0NA 5AOBA 1EMDA 1L7QA 1LK7A 1AKTA 4AG6A 3CISA 3N8DA 5K5EA 1YKFA 1I8TA 2APJA 2H52A 3FPJA 4K6MA 3NUGA 3V46A 3FPLA 1IULA 1MB2A 1J0XO 1KEVA 1XRMA 2BLLA 1Y4UA 2YNMA 3CIFA 4PQGA 2I6XA 2Q8NA 5G40A 2V0GA 3MMSA 1JTFA 1WSAA 5TLSA 5LBTA 1RMQA 1NJGA 1T0IA 1WD7A 5JDIA 3WB9A 1LBEA 3KPWA 3RS3A 2GEUA 3CFFL 2LP4Y 5EE3A 3HBAA 2A94A 1C9MA 5H81A 1TAGA 1QYXA 3WISA 3VH4A 3HPQA 3FKSA 1TT5A 3KB2A 4DLUA 4X41A 4LI3X 3IOYA 5J59A 1O9HA 5DBHX 1XRQA 2WV9A 4E6EA 5ALGA 1Z3CA 2HRDA 4AKSA 5KOJB 4L8FA 5DN6D 1ZI6A 2RGDA 3D4BA 4Q9NA 3RBXA 2XEDA 4F3RA 3UJ9A 2YFHA 2RHHA 1PR1A 1CJUC 2R751 4UCXA 2H4HA 5JPIA 4MP6A 2CXRA 1J56A 2JGLA 2OUIA 4LXYA 1WAMA 2A9PA 3UQYS 1GADO 4LYHA 1AKNA 2I7DA 1J22A 3KELA 4OB8A 5REQB 5EE1A 3WXBA 2YR0A 1H5NA 1HTTA 3ZV7A 5IJ9B 5KKNB 2QZZA 2ZRLA 1K6XA 3ZJTA 2F9MA 3IXLA 5CU7A 1IATA 1J0CA 1B74A 1SBTA 1SXJD 1WF6A 1DFGA 2IDMA 2IZZA 4OXYA 5BNFA 1Q2XA 4BFUA 1PV4A 1XCPA 4BX8A 4TM7A 4FOPA 2JAWA 1CV2A 3EQ8A 4FQ8A 5TPZD 2AEJA 3OE7D 4G1BA 4KQCA 3RC1A 3TEJA 4G84A 4AJ4A 2BHRA 1UP6A 2GSDA 1ZY2A 4LXTA 2IXTA 5EYPA 4CF7A 1EIZA 2VNSA 2Y4OA 3OM9A 3AKZA 1ODTC 4MPTA 1W36B 2ZETA 2P30A 3F8SA 3M6XA 2PY6A 4PGGA 2BFBA 2MJLA 3LFTA 4ZIRB 4V1CB 3N2NA 1ZM4A 1ONNA 3OZGA 4UAUA 5DPMA 5B1HA 4BV9A 1Z0UA 3A9WA 1BX1A 1A97A 2X3FA 2AF4C 2O9JA 4YALA 3IUBA 2OPHA 1Z26A 1R6BX 5JJLA 4KBFA 4YX9A 3HK2A 5TT1A 4IYRA 4YJHB 2R1VB 2OAGA 5E2BA 3SDSA 3BA6A 4MSUA 3TGPA 3CUVA 2X4GA 4Z1MA 1FBTA 3EVZA 3SNKA 3VC2A 4CDGA 3OOYA 3E5NA 3U62A 1ZGAA 1JHXA 5EINA 2QE6A 1OHHD 3HO6A 2XNHA 1TJNA 2CL7X 2O0HA 4F8YA 4RTQA 5CNMA 3MEQA 3FRHA 5L8VA 3WP0A 3N0VA 5F7JA 4QOGA 3WL7A 5LYYA 1VSTA 2QN9A 1N5JA 4E22A 2QRGA 1R6AA 4EHBA 4CM6A 3M89A 2O8CA 3N0WA 4QGBA 4B6PA 2O1XA 5BSHA 3ZXUB 2P5SA 2V6JA 4EF6A 3NTUA 1Q7EA 4IHJF 4DMLA 3QZUA 5E8RA 1NVTA 3VR5A 1N8SA 1EA5A 1J1ZA 4NH0A 5ULLA 1P1FA 1K27A 3QK7A 3JWIA 2F3QA 3EVAA 1H3NA 1BDMA 4MW9A 4CKEA 4LC9A 5AYVA 1EINA 3MAJA 3STTA 3RIEA 3TMKA 5K0EA 1T9CA 2PBLA 3SF8A 1SOVA 2VP4A 1W9HA 4TXJA 4F0JA 2H4XA 5DX1A 2FAXA 3PEEA 2MSCB 3G9XA 3VU0A 4B9AA 1YCHA 1B3RA 1CJMA 3CZ9A 2G5PA 1OI2A 4Q9KA 4G25A 2OVBA 3RYTC 1VCOA 2B21A 2QD1A 4NMLA 1IBMB 5KQMA 2I1LA 2VOJA 3GRAA 1T6BY 4M1ZA 1X1QA 1YMVA 1DPGA 3S44A 3WLRA 5IU6A 1QJ4A 3G88A 4QUHA 3L7DA 2Z2KA 4JKOA 4B84A 5KYNA 3P2KA 2FWBA 1GM5A 3A2NA 3QWAA 1TK9A 3VJMA 2EF1A 1Y3IA 4X44A 2HPHA 3H6GA 1HLFA 4XX1A 3QKWA 1F51E 2OGUA 2OHGA 3M4ZA 1SHJA 5DO9A 3W04A 1YA8A 2VYCA 4Y6OA 4D8WA 2RCYA 1I7LA 1P2GA 2X8AA 3G2OA 4F3YA 3H2IA 2GW4A 3LLVA 4JSTA 4UMFA 2Q62A 5LP6F 1Z8FA 4DA6A 1CQWA 3HJHA 1Y8RB 4K86A 4MEJA 4N3AA 1PNOA 4G4SO 2V4UA 1WNFA 1RPNA 4DUGD 4NS1A 4L3OA 2HDNB 3K9WA 5JPCA 3AVXA 2BD0A 2YICA 3L0YA 1W5TA 2QLNA 1DFHA 5K8JB 2VNKA 4GGMX 4LF9B 1ZA2A 4I5GA 1F4LA 4LZPA 2NTNA 5EJMA 1G9TA 5A3QA 4X93A 3N6XA 3W9YA 3BE8A 2D4HA 3VUEA 1CVRA 3DOIA 4NDAA 4AY3A 1FC0A 4U9IS 2VR1A 1XDBA 2VK2A 2ZUDA 2NNLD 3CUSA 3FB4A 1R2QA 3WGIA 1TA9A 3HR8A 4GXRA 1Y3CE 1TI7A 2OBMA 2VK8A 4L9WA 4X3PA 5AKYA 5YASA 4Y8VA 5L3ZA 1SEVA 4OLFA 1EDZA 3TBFA 5HK8A 5H80A 1LF5A 1UADA 3O4HA 3ETHA 4CL2A 2C4WA 5FADA 3C6KA 4AW9A 4CW7A 3LH5A 3D8BA 3LSYA 1DADA 1QLJA 2WYIA 3SDZA 4Y9UA 3UZUA 3PYMA 5BYJA 4MQMA 1IBRA 4FC7A 1XL1A 3ESYA 3G2KA 4N7BA 1AQIA 2P2YA 2PUVA 4J07A 2YJNA 1GAEO 2OXTA 1NRIA 2BAGA 4L8WB 2PZFA 5JFOA 2QMUA 3IP7A 5CXUA 3DDHA 2BPOA 16PKA 1FFAA 3FNBA 2PV7A 2ZRAA 4A4DA 5C8VA 1MF7A 4DA8A 2BBWA 3KYJB 1KSGA 4KDEA 1VPDA 5AHXA 3VOTA 4FVTA 4GPTA 3U4HA 4GR5A 4O08A 1QP7A 2JFXA 4PC7A 3G0BA 4JVNA 1JHDA 4RABA 1HURA 4LWPA 4I9NA 1P2FA 2H6EA 2VJBA 1U0SY 2BR3A 4E0BA 2GO7A 5BSMA 4V03A 1ZM7A 3ZIAA 1ZN7A 1T5TA 4LE0A 5HF9A 5JBNA 4X64B 3MGBA 4B8ZA 4MV4A 3RASA 4Y98A 2WU4A 3UC5A 1ULTA 3BGIA 4BVLA 5IMSA 5LMNB 4YRSA 1Y42X 5EXDA 3IP1A 3LMKA 5I7AA 1NAHA 2JCBA 5KTNA 1Y80A 5JASA 4M1TA 2X14A 2ZIEA 5HZHA 1QF9A 1N8KA 3QSGA 4H6PA 1KYXA 1ZM9A 1OLUB 3O73A 4OHCA 1CLEA 1KKLA 5G53C 3DZ8A 5EHGA 5BUZA 1XNHA 2LW7A 2ZJ0A 2OBXA 1HSZA 2Y1OA 1JJVA 3OPYB 2KQUA 5CR9A 3OPNA 3W8EA 4YR7A 1LSOA 3UXYA 3FOEC 2JIQA 4G0PA 4JENA 4UVEA 4UMEA 3MMXA 3QKRA 1I2AA 4LRWA 3FTFA 4QJ5A 3DLTA 5JCJD 3H7IA 1KVSA 1XCBA 2O2JA 3U17A 2ID7A 4JBGA 1O4VA 3GA7A 4LRTB 1UK9A 1UM9B 4RHYA 2GLUA 3C15C 1HY3A 3HKEB 1V6SA 1VSQA 4KTTE 5FPTA 1NDUA 2YH2A 4M7OA 3TLMA 1PHPA 1O0BA 4X66B 1MB0A 4N5DA 5I5GA 4C3ZA 3GEBA 4BDSA 2O2DA 3UAVA 3PGLA 4TTRA 2ZTLA 4CIDA 2QM8A 3A2MA 3O74A 2FPLA 4ZAGA 1WPRA 4PG5A 3VPXA 1PR5A 1MB3A 1LPNA 4YP5A 1ISRA 4G1FA 2PT5A 4HPJB 3FE2A 3BD6A 3GCZA 1X3SA 1U4SA 3OOHA 4ICIA 4NCHA 4YMIA 5ERXA 1RRGA 1TADA 1MA0A 4NZNA 5DHTA 5CA0F 2Q28A 1H3EA 4RTJA 1P33A 1OJLA 4MVJM 2PRSA 4ND5A 4JP2A 5CD9A 1QHHB 1YBFA 4BV2A 1ZOLA 1GZVA 5DTRA 1U1EA 4E30A 1D2RA 1HUQA 2HLDD 2OAEA 3PQ2A 3NBUA 4FDUA 3BF7A 2JHGA 3DYVA 3LCJA 3AL3A 1TYBE 3G9TA 1YHYA 4XVUA 4Y1EA 1U9YA 2FRVA 2BBTA 1M6VB 1NV9A 2GFIA 3RVRA 2DFTA 1Y3HA 4KVAA 4OOFA 1AQJA 5G0SA 1X0VA 4H35A 4XOUA 3WJ2A 2YYYA 2NSHA 2OY0A 5TC4A 3CVUA 3NHBA 3OZTA 2MYPA 2OTCA 4N41A 2YXBA 2WF5A 2JHFA 3OQPA 5KNBD 4LS3A 1YQWA 2C3MA 3HZHA 1AHNA 1TTTA 2HADA 3DKPA 5ARCA 3NV7A 3OE5A 4OU4A 2LXNA 3E3NA 1CVLA 2OV4A 2QZSA 4U2BA 4K6OA 2WG0A 3VOAA 4YMTA 5LP1A 2ZYSA 5LA6A 1GPUA 1Q7GA 1TGVA 3DB2A 1E2GA 1QIIA 2TMDA 3PC8A 4OMUA 5F1YA 5TEWA 5AM1A 2JZOA 4MW5A 1Y7LA 4CNQA 5IN4A 1MO2A 3TDMA 3TS1A 3TUJC 3RU3A 1ZM3A 3O4RA 3IJRA 4LCJA 3GVXA 4PYMA 1CNEA 2LNDA 5A6SB 1IE3A 2ZW9A 3DAFA 5LDGA 3RS9A 3UK2A 4P7KA 2JH8A 1Y3BE 4YT5A 3A3KA 1RP1A 2O8NA 3A3YA 1JR3A 3R0JA 2V7QA 1PCXA 5T5QA 2XBMA 3U7JA 1A8QA 2RB5A 1ZVQA 1T5LA 1Q77A 1LKZA 2JI4A 1EFPA 1NBWB 4WOBA 1AU9A 3V7WA 1G64A 5HNKA 1PV2A 3SHQA 2YNMD 1SQSA 2QY6A 3OPVA 1GV1A 5BYBA 1CCWA 4ZGWA 1KDOA 2FUKA 3IB3A 3CF2A 2IYPA 4DS3A 3NHRA 2ANBA 1BNCA 3AB8A 4KVZA 2AVDA 3ROMA 3SPXA 4PFSA 1XT6A 3OSZA 4WOCA 1CR6A 4XXHA 1ARZA 2O07A 5IVHA 2P67A 3TKYA 3DHEA 1XPUA 1UC8A 2Z0MA 1ENYA 3RUCA 3GLHB 4NQRA 3AFMA 4HXFB 2Z3ZA 1QR2A 1QKKA 4IVPA 2X19A 3HJCA 3COJA 2BUAA 4CVNA 1HRDA 4LFBB 2R62A 1KZ4A 4HUQB 1O6CA 2HT6A 5DHUA 1WY5A 2BF4A 3BMNB 1R0CA 3N7AA 5CH3A 4LYAA 4PIMA 1TO2E 2VPTA 3PQFA 4ER5A 4MTCA 4DR2B 3C3MA 1ODIA 4MUIA 3S55A 2WWHA 1ZPDA 2O6HA 3EMVA 1IBLB 3OF3A 3B8EA 1NP7A 3ZWVA 1DP4A 3LDHA 2J9FB 1S2DA 1SUFA 2ZQZA 3RSCA 4EJ0A 3BJRA 4NDZA 3SQOA 2Q4BA 3ONNA 4DXDA 2RH4A 2C7VA 3WDKA 1HOTA 4JNCA 1G5IA 1M5UA 1XP8A 4H1WA 5JLJA 1D07A 1AMNA 3AEQA 3LUAA 4LVOA 4WA8A 1Y33E 1OGYA 1N77A 2QBYB 4NONA 2IUYA 4RH0A 3SEAA 5T3YA 1FYXA 1XYVA 3TB4A 3VV3A 3KEOA 4L9RA 2XGOA 1XFDA 2WZBA 1JQDA 1THTA 1XZFA 1N2CB 3C85A 4EY5A 2QRZA 5GGYA 1N25A 2JI8A 1M2KA 5FFNA 2CD7A 4CQMA 1BRMA 4NHOA 4CEIB 5KVAA 5CEJA 4LZWA 1XTIA 3AUYA 2GCOB 5LDHA 2IDJA 3BWDD 4EUNA 1L3BA 5JSQA 1XXLA 2HMTA 3TO5A 1MCZA 1VC2A 2Y05A 5C7IO 3KQVA 1SK8A 3BXFA 4OAOA 2CXNA 1MGPA 1FNSA 3L0PA 3M6UA 4OYRA 2IV2X 4J7XA 5IXJA 4DNFA 3R7BA 3ZHVA 3RB8A 1R9MA 4MJXA 5ENVA 5GGXA 5DP1A 5LQAA 3VR3A 3PXAA 3TLCA 2WJHA 5DRYA 4L50A 3OZWA 1H5UA 1OKKD 1VCMA 2XTMA 4W5NA 1SIWA 4U02A 3WFIA 3FSRA 3F6RA 2RGXA 1RD4A 1DV2A 3PRHA 4PSCA 3UOAB 3V55A 3EDQA 5JEDA 5ICFA 3T61A 5FIUA 1DCMA 1YRYE 2PSJA 3TL6A 1KDZA 2Q3DA 1E2HA 2ADMA 1NULA 3EA0A 2ETVA 3ODPA 1XLVA 5CLQA 3WL6A 4EW1A 4YYZA 1WIWA 4RKFA 1L7NA 1FP1D 3OLZA 3EGXA 3CNHA 2V65A 5KJ1A 1KZ6A 3UT5A 4IWNA 4E07A 1YS9A 4QHSA 4WBXC 4TLLB 4UBNA 5TQ2A 2Q4RA 4E6PA 3ZD7A 1EQ2A 3VMFA 4YCDA 4JODA 5AXDA 2QM7A 2YZNA 3L1IA 2EKLA 4UMDA 1LY1A 3KSUA 1AB6A 3PQ7A 4FK8A 4B44A 2FQ1A 2GN8A 1GKLA 4JT4A 1PR9A 4Z4EA 4UBMA 4BPBA 5D1HA 3PT5A 4IFIA 3MT9A 5IZ4A 3GJSA 2GMWA 1DHRA 3K1ZA 2D7CA 4L6AA 4U6SA 5EG5A 1N7GA 2QTZA 4IDNA 4OJNA 3TLZA 5B1SA 5K3EA 1SU4A 3ROXA 2G17A 1V4BA 1V26A 1T5HX 2WR8A 4HH0A 2C7RA 4P4NA 5H82A 4ECAA 4TMWA 1GLGA 1XTZA 1ZVJA 3PNLA 4Y2JA 3KJNA 3SG0A 3W8FA 5IC4A 4A1OA 3IEIA 4DPMA 2QUKA 1K8XB 5JXJA 3J7AC 2XUDA 1X19A 2YWDA 2O57A 3PJRA 2XUOA 4PCLA 1VLQA 1XKQA 3EZXA 4ML3A 4EGSA 4KITB 5K6AC 3TFWA 1WEHA 4NOMA 2W22A 3JRWA 4R6WA 2WU0A 3NTRA 4ZVQA 1KJQA 1RTTA 2ZROA 3OBBA 4P3NA 4MDFA 4DOMA 1C4KA 1PR0A 2O5VA 2IYTA 3M33A 4LOLA 4O4LF 4Q3AA 4NJEA 5F5NA 1KORA 4PTLA 5CVJA 1MGOA 1VXRA 3AJAA 1D1SA 4LDRA 5LZ5A 3EG9B 4UHEA 2A6PA 1PFQA 3DFFA 4R8SA 1G20E 2GRUA 4N3BA 1FW6A 3O95A 4WACA 5E3JA 1VMKA 1KJIA 5IVKA 1AKUA 2W58A 4HLUA 1PEKE 2PKQP 4RGQA 1W96A 2HSWA 2AR0A 3TPCA 1FUKA 3D0RA 4GKBA 1G1AA 2NSLA 1WSDA 2CEKA 3E1GA 3O1JC 1O95C 1WVMA 4MB0A 1Y37A 1CJSA 1FFHA 1HE1C 4CEHB 2GDZA 2XWJI 2X8BA 3JD2A 4ECEA 4IF4A 3ER6A 3E70C 4QOFA 3K6JA 4PN7A 3CURA 3R5HA 1IC6A 3QELA 3V6MA 1I2ZA 2V7TA 4I8IA 4DLZA 3RGGA 2Z8XA 2J9YB 1MJGA 3M5DA 1H2HA 4RLSA 1OWPA 3LJKA 3ZGYA 2BI8A 2MTBA 5CFLA 1LBTA 2JHAA 1NRJB 3K70C 1ZIOA 1K92A 1SKYB 1VA5A 3DV0A 3GAAA 4G3XA 4MRRA 4PFKA 1GKKA 2MSEB 3OPYA 3AHDA 3MTQA 3O1IC 4DLAA 3VAZA 3RHSA 2W2NA 1EFLA 4J91A 1V1JA 4IEEA 1UJ5A 4LXQA 3WGNA 2VFAA 3WYCA 3BS4A 3Q7EA 4F6CA 3CT4A 1KYZA 4PYJA 1I2BA 1Y1PA 4G6ZA 3LHSA 2JCVA 2FPXA 3WGMA 2QTVA 3LL4A 3GPLA 3TCKA 2F4NA 4H7KA 5LMUB 2VSXA 5BMVF 1ZAYA 4BRUA 5AI8A 8LDHA 1J06A 1E8NA 2XCQA 1TMYA 4KLZA 1T2AA 2QP9X 3A1FA 3JQGA 2FOIA 3IBSA 3FZNA 5DBIA 1ESMA 3T54A 1IM5A 3CW2A 3GYBA 3L1VA 4FFNA 4DR4B 3TJMA 3ZQJA 3Q3JB 4FDMA 4B3TB 3CVXA 1CKEA 3AM1A 3UJBA 1E3EA 2DT5A 1A0OA 1CP2A 4TL6A 2YY7A 2PEZA 1N5RA 2ZPAA 4G4GA 4UU8A 4PLPA 4BB5A 1KEKA 3PX3A 1P4AA 4BO4A 2PS0A 3CJRA 1CY8A 1ENPA 2ZBFA 1VECA 3FIUA 4XJVA 1E4OA 3RT7A 5FWXA 1O1YA 5B5SA 2IBSA 1F8FA 1EJ6A 1K8QA 1M8FA 2IDKA 4LRUA 2AS0A 4R9UC 2ZWAA 1BE6A 1ZWLA 1FQKA 4HXGA 3WB1A 4DYHA 2Q5EA 3LC7O 3KCQA 4C0QC 4ITRC 4C6RA 4YRZA 3U3DA 2OO3A 4ZQIA 5EHQA 1M6VA 1XHEA 3UJNA 1XRRA 2BDTA 1U3GA 5J9FA 1ECPA 3LBFA 1QE0A 3L3BA 3L93A 1PEYA 2CYAA 1EUDA 5LNK6 2WFLB 4WN9A 3QVOA 5A02A 2VA8A 3GA5A 2X6TA 3JPYA 2O5RA 5AIBA 4PSDA 1U31A 2IA5A 3M1IA 1SUDA 3UY4A 4IGFA 5FL3A 2F4VB 2RJNA 2I3GA 2PDAA 3H18A 3NPMA 2FR0A 3JW8A 4QD3A 4B33A 1Q57A 3RC8A 2QBYA 1IMJA 4AS3A 1ADYA 7MDHA 3HU5A 1U5CA 1ZUIA 4DMGA 3DEAA 3GB9A 3MCWA 1IEVA 2FZ5A 3IUPA 1PX2A 1BVRA 4H17A 2IUTA 3OQHA 2EGHA 3TCNA 2ZRFA 3OZDA 3V8MA 3WMWA 4Y2QA 2AFIA 3ZCSA 5L53A 2W4QA 3OLVA 3WBKA 3DHWC 1LW6E 3V1YA 2FZCA 4CU5A 1YA4A 2HX1A 1TCVA 3IE2A 3KKQA 3MXOA 3OKPA 2JJ8A 3ESZA 3TZBA 3UWDA 4B71A 3H9BA 2FXVA 2OT3B 2AD1A 1XVAA 3AEXA 3NCHA 1NSTA 4BX0A 2NP7A 4HNAB 4EYEA 1CS4C 1HE4A 4M1EA 1DWQA 5BQPA 4AN0A 5CFRA 5L6MB 2XA2A 4A6PA 3H5VA 1B2LA 2H57A 4IJKA 3CKYA 1S5PA 1UWLA 3MNFA 2SNIE 3FJYA 1QCDA 2PIAA 5AW6A 3CVVA 1ZSNA 5JVDA 2JIPA 3AY6A 4EEKA 2P35A 4B2IA 4EW2A 1WVGA 2QLFA 4AY5A 2BFCB 1PDWA 2GZSA 3BHMA 4FEEA 4TRRA 1Q1BA 1Z82A 3NOQA 3PUZA 4Y1RA 3T5PA 2P75A 2VS1A 2H3EA 2F3UA 4JX9A 1FE8A 5F9MA 1PJRA 3A6DA 3KQYA 4RA6A 5G4KA 4JBWA 1MVNA 3VSDA 2J4FA 3C3EA 2R6GA 4PRKA 2QAIA 1K3TA 4JLJA 1VKOA 3B20A 4OFWA 4POAA 3V9AA 2QRVA 1N6OA 1FSPA 2AJCA 4OLJA 4E11A 1OZAA 4FMBB 1YZNA 4Q37A 4P7JA 4RJJA 2JKZA 3SC2B 5IJWA 5EJGA 2B8JA 3K3PA 2P91A 1T3ZA 2LD4A 5FLXA 4EB8A 4EHFA 2C4HA 4L3VA 4NHEA 4LJ6A 2VUTA 1U3CA 1UDWA 2ZR7A 6PFKA 2HF9A 2AUTA 5B1IA 1XEFA 4OJTA 4EJSA 3HO1A 1ZQ9A 2E21A 4O0LA 3IJ5A 1TUBB 2ZZMA 4M46A 3MN1A 2K2QB 4GXTA 4M1QA 4MYTA 3RFUA 3GVPA 2YWCA 2VZ8A 4D74A 1G4UR 4BNYA 3CFAL 5CGZA 1LPMA 4RTRA 2I52A 1E58A 2A9QA 1EX9A 2XYGA 1SVOA 4F72A 3DAPA 1N36B 1SQ0A 3ZY4A 1M7BA 3VZCA 3F1LA 4M9XA 3Q41A 1UPFA 3FR7A 1U63A 3DMHA 3U61B 3FCXA 4UHCA 3PGA1 3HN2A 4KLCA 4YCBA 1IPEA 4X1YA 2GZDA 2I3DA 2IUEA 2Z2ZA 5CUQA 3UENA 2OXFA 1NUHA 3IVAA 2P8JA 3MTIA 1M0SA 2GZ1A 3DZIA 3W90A 2AH5A 1D2HA 5AWFC 5B30A 5TIIA 1E61A 1S3SA 3GJYA 2XNCA 3WL3A 1BCSA 1N3BA 1P3JA 1TQ6A 3DKVA 4EMUA 5HYVA 3DL2A 5AK0A 2OESA 3OA2A 3MT7A 3PDIA 3GEDA 1NR1A 1DAIA 4UDXX 1JHMA 5FLYA 5GV7A 2PSHA 1OYWA 1WBBA 1BHQ1 3OFJA 1JXMA 4MMYB 3ABIA 4NK4A 5JXHA 1BMTA 5GONA 2J3JA 5WRFA 4Q05A 1NNLA 3AK4A 1R8SA 1R9JA 1PK7A 3P4UA 4UC0A 1YJAA 3FOCA 3IX7A 3LGSA 3LFUA 5FRDA 4JS0A 1CEEA 5BNTA 5JH7B 2ONCA 4UHHA 4JBXA 4X54A 2GF0A 2X7HA 2OFPA 5FBVB 2XYHA 3EWSA 2NQ2C 1UXGA 4ZO7A 4E4YA 1WDWB 3ZLJA 2C7OA 2WW8A 1KP3A 1ZJWA 3Q3VA 2E55A 2XQVA 4EG3A 3U4QA 4IZIA 3DM9B 1UP4A 1H22A 1QAOA 2YCBA 4ZOLB 4ER3A 5JYEA 4YT8A 1QONA 5U4QA 5BSVA 5HUQA 3BKXA 1V35A 4N54A 2FPGB 4NF2A 4GPD1 1HKHA 4YRJA 4W5WA 4BAZA 5LYJF 2I4NA 5HZKA 2YJZA 1T1EA 1LDYA 1PBNA 1VYUA 2XJ9A 3HDQA 4BVAA 3RAFC 1Z4OA 3UVEA 4CR6A 3P0HA 4F1WA 1UKEA 4JL5A 3L02A 5L9AA 3L7KA 1HQKA 1TT5B 2YQZA 2X1VA 1CDZA 4MV0A 5T4BA 4FYHA 2AD5A 3ADCA 5G2FA 4TVBA 4WHMA 2X9GA 4Z8YA 2C9ZA 2PTGA 3OC0A 4LTDA 3T5MA 2BH9A 3UJ8A 2P9CA 4GI3A 2PRZA 1GRQA 2BEWB 2J9RA 4PLVA 1AA9A 2C4VA 2HJHA 4RY8A 4XSGA 5EY5B 4ZYZA 4DILA 5BSGA 2YXDA 4OI4A 5F2OA 3JQQA 4KRYA 1XPRA 5AVQA 3IAHA 3ABRB 4W1RA 4YJ2F 3ESBA 1Z7BA 3M7IA 3T94A 3P4YA 1G8SA 2GYUA 1II8A 4ZI5A 2O5EA 2JGMA 2R5WA 2OO7A 2D1RA 3LHDA 3WGZA 5JANA 2Q6IA 3KO8A 4AURA 3AF0A 3ZU6A 1NZJA 2C2YA 1D2CA 3GLRA 4QFMA 4QLOA 4L16A 3UFXB 3U16A 5JZOA 2HF2A 4UUOA 4D9HA 2HL6A 3EWNA 1CZLA 1TL7C 1KI2A 4WJLA 5AUNB 4CIAA 4NMXB 2B3DA 4O2RA 1DBRA 3SIPA 4M7RA 3B85A 8ABPA 2Y93A 1KSFX 1VRWA 3KJHA 1H1TA 2ZGVA 2Y3IA 1AGYA 3CHYA 4BLTA 2G07A 3CNNA 2JGRA 1T4BA 4FW9A 4BKPA 2X5XA 1WPGA 2OZVA 2Z6AA 1KY4A 5E4YA 4DG8A 2O2GA 1CUAA 4BQPA 2CDBA 1Z2DA 5FTWA 1WL8A 2ZJAA 3PDJA 4XIJA 3WKCA 4CF6A 2VJAA 3WZ2A 1MT3A 3GF4A 4DCNA 4RZ3A 2AJ8A 5AI6A 1AK1A 1E96A 1ODFA 2OGZA 4FSHA 2QD2A 4IIEA 5KVVA 2QRVB 3OMWA 2B7CA 2PL5A 3GUVA 5GQSA 3FM9A 4YV2A 4O2BA 3CX3A 5BYKA 1TM7E 2C2XA 5D3MA 1QH8A 2QMHA 4GKAA 5T64A 2K2WA 3KLMX 4YRPA 4L0QA 4PONA 4G0YA 1VZ3A 4MLPA 4PCVA 2B7BA 1HTWA 5AMXA 5JCJA 2BFCA 3SHVA 4C14A 1QGUB 2R6HA 5EJEA 1Z7GA 1KZ7B 4WK2B 3WKAA 4KAAA 2FTKE 1JHYA 1KI9A 2IP2A 1KVUA 2WF6A 3ES9A 3IIIA 3KT8A 2FDXA 3QVGA 4GVLA 4C0HA 4TLCA 1IAQA 2QUAA 3ZVRA 1KH1A 1Y63A 1DC4A 1E7QA 5DM0A 4EB0A 1OH6A 4A15A 4Y2GA 4DMUB 3WRXC 1NBMD 1NUQA 5ES4B 3COSA 3FZQA 4OAQA 1ZJ6A 4FT4A 5JISA 1DIHA 3GJ6A 4XYBA 4UEQA 2NTEA 1SHUX 2SKEA 3BCSA 3S40A 4A2WA 5IZCC 2PKYX 5DLQC 3LPDA 3ETCA 5D7NA 2UDPA 1FNNA 1R88A 1V7QA 3CZMA 2ZT8A 3O3OB 4ZVVA 1L5GB 4WKCA 3RC3A 5B7NA 3IDOA 3QF7A 4BMVA 3C3WA 3H87A 4G8JA 3H3XA 1VQ1A 4ZEMA 3DO8A 4TTTS 4GMDA 5D5PA 3VC7A 4XYMA 2AWNA 3FI0A 3P5SA 4B32A 4B9EA 3CVJA 2Y99A 5F2KA 2C58A 2R5NA 3ZDFA 3LG2A 1NC3A 2C97A 4XFJA 4ACAA 2AKYA 3NETA 3ICEA 2BVNA 4BASA 1ZKMA 4WJKB 4AP9A 4YMWA 4TQ9A 1PGNA 5TGDA 1P29A 2AOVA 1DEKA 1V8PA 1U0OC 5SZIA 5AIAA 1J24A 1XD2A 2ISQA 4NECA 5CCDA 2VN8A 2O2EA 4I6EA 1Q1EA 4YJGA 1DTEA 1MG0A 4BEJA 3MF4A 2WYHA 3VHQA 3BEDA 3JQ9A 2PBZA 3AEZA 5KOIA 4FFVA 1YACA 3TW8B 1WKVA 4IICA 5JWRA 2XE8A 3RRNA 3C6ZA 3DYBA 1GSAA 2HA0A 3MIZA 4DCUA 1TYDE 2A58A 4KVGA 5A06A 3PHJA 1KTIA 4JLVA 4U7FA 3W4JA 4NMMA 2O2ZA 2R1UA 3CVOA 1QGDA 2X2EA 1M2FA 3IBTA 4XDYA 5JADA 1Q5PA 2B5WA 2FA9A 1I7NA 1W49A 4S1OA 1BH6A 4AX4A 3L4KA 1F4PA 3F7MA 1ZXLA 3AFOA 1XZIA 1LTKA 3QY9A 1VPLA 4G0XA 3W05A 3RSFA 4ARUA 2NTJA 5GM2A 2QUHA 3WGJA 2DSNA 3HR7A 1UJMA 4MX8A 2GKOA 3LKVA 1BE1A 2GJKA 4NG5A 1DBSA 1TO6A 5LU8A 2G40A 3HP1A 3LWDA 2GESA 2VHWA 3QLTA 2FPPA 4JJ4A 4M36A 1A9TA 3F3YA 3DDUA 4CM5A 1BN7A 3UHAA 3VKUA 3TW0A 3EOBI 3L0SA 3PFIA 2QUZA 3WWOA 1HMYA 5BR8B 2B0CA 3NBZC 1QO0A 2J3KA 1JLLB 1PWEA 3JALB 4QARA 4MS4A 4P92A 4E46A 2VBGA 3HYRA 4PANA 4B43A 3LWNA 5A3RA 2W6MA 3BPSA 5BVHB 3KQWA 3MS4A 5EESA 4PICA 1F7VA 1JLMA 5KTOA 3MOGA 2GTHA 1G19A 3TH5A 3EF1A 2IU6A 4U1RA 4BWVA 3T5CA 2O20A 1RIFA 1Q22A 3O5AA 1HYBA 1GYRA 3PU6A 1F2VA 2OCYC 4FD2A 4L1KA 4WK4B 5TDHA 5EIWA 4HMPA 1VXOA 4CEJA 4F93B 1XOIA 5IH7A 3R5JA 4LNHA 3ASYA 3DOFA 1CE8B 3T5DA 4GLFA 4F4UA 1X7GA 1D2GA 1V16B 4J90A 1JEYA 4HAVA 5K3SA 3VH1A 1O95D 1LSSA 1US8B 4P2GA 2QQEA 1MFPA 3BILA 5DBOA 5ITVA 4R9SA 2AEMA 1RQLA 1PFUA 3L43A 5ALTA 1GFIA 1HNZB 1JRLA 2BMJA 3EB9A 2HCFA 2YWGA 4LRXA 1S96A 2H54A 3D8HA 4P93A 3UA4A 2LV8A 2A4MA 5ALUA 5EKXA 3QTLA 4FBGA 4QGGA 3NW9A 3VVCA 1RZ3A 1UWCA 3PGJA 2M2IA 1XDWA 3CLRD 4BMXA 2YY5A 1H2ZA 2GZ3A 5TJHA 1JS1X 2JVKA 3BD8A 3ILSA 4EABA 1SCUA 4MUMA 3OZSA 1O7JA 3STWA 4E1VA 2BSXA 3JD4A 3EGCA 5C8YA 5IT5A 2ONKA 2OP0A 2Q0XA 3RS5A 3V8RA 221PA 2B4TO 2P9GA 1DWPA 1JZTA 3D02A 3E1SA 3IKJA 2REBA 1C3EA 4YRLA 4HB0A 3V34A 3X0DA 2ODTX 4OP2A 1ZEJA 5DT2A 4L74A 1K7CA 1A5TA 3SBXA 4GP6A 4B31A 5CXQA 5KU7A 1DU4A 4RADA 1JDPA 3G8YA 4CUKA 3HU3A 4LZLA 2EBFX 1VB5A 1RIIA 3KHUA 1YBMA 3L7MA 3PJEA 4MVJP 3SJUA 4ARVA 1O0SA 2Z5GA 4FKBA 4BV8A 3RK0A 3DHVA 1WOMA 5JC1A 4YAUA 2D5CA 2YMMA 2X0KA 2CXQA 2ZXEA 5ARDA 3ZDYB 2QUIA 4HQRA 5E1DA 4PHFA 4CL3A 1VLVA 4ENTA 3HA7A 3P9IA 4QNRA 3TRIA 1EFCA 1AKQA 4PM4A 1F9AA 3IVGA 4TYNA 3TNLA 1VM6A 4BCBA 1TUEA 5IBPA 1LK5A 3RAJA 2DHCA 1C1DB 2JEYA 2YFKA 3I61A 4XRGA 1KE2A 4RF5A 3OO0A 1AUQA 1VG1A 2IYQA 2VNIA 3PC2A 4KNWA 3HBMA 1I3CA 1PBTA 1TVKA 2XNSA 1WUTA 3KM0A 4B7UA 2W42A 3BG5A 2R0QC 3RYCB 1PGPA 2I6TA 1FTQA 1IU9A 2BT4A 3L6CA 1YZ3A 1UMDA 2INGX 1KXJA 1MO6A 2WE8A 4M22A 5CT9A 1W87A 1FBNA 3TGWA 2R68A 2XMBA 3FCCA 3UOWA 2HNAA 2R1ZA 1S2NA 3DZHA 4JA0A 4NABA 4RO0A 4EO9A 3E8SA 3QFTA 4BKQA 4YMVA 2QT1A 2RKOA 3D2LA 4UZEA 5GOZA 1CS0B 1W25A 2HBQA 2WWWA 2DRIA 4GI1A 4IDPA 1GUDA 4RY0A 2F67A 5CX4A 4M0UA 1E59A 1GNPA 3TBHA 4JI3B 5CLGA 2IIQA 1E3JA 3A9UA 3CX4A 3FCUB 4JLNA 5BW5A 2IFTA 1TUIA 1WB4A 4BEVA 2O05A 3V2IA 4J1SA 4R1OA 1K98A 1XVTA 2DMRA 3EDMA 4CG3A 4M0KA 3NBQA 2Q4TA 2VF5X 1NYLA 4I7EA 2FPIA 1MLDA 4C29A 3HACA 3QXJA 1YE5A 1ZH2A 3DE7X 2IEAA 1L7MA 4AJLA 2Z56A 5J4HA 4RK5A 2GBLC 3NDBB 1RQ7A 3AJEA 4IUCS 4WCDA 1F0NA 2QD4A 3V4FA 5KYXB 1GL7A 2ADFA 5BSWA 5L4LA 3WYGA 3MJTA 3CS3A 3KALA 4KXYA 4GXQA 4AJ2A 1P0QA 4PYKA 2FY8A 1O54A 4MUNA 3LU1A 1RWOA 1JSXA 3P0EA 3H99A 4D5EA 1E3QA 1P2UA 5G0VA 7GPBA 4P98A 5EWJA 2X7XA 3S5UA 4EM6A 4MR8A 3GFOA 1QM5A 3EW7A 3Q1KA 3GPCA 3GYGA 4R0VA 5DXFA 1RYYA 4P5EA 5IRCD 2IIVA 2IZ1A 3RUHA 3OOSA 4TT8A 1TO1E 1J2TA 4PSKA 1E9AA 5FUVA 4FEYA 5EE5B 4XWKA 3LF2A 3E18A 3H2HA 3PGKA 1DXQA 2GXSA 4HCJA 4PX9A 3C97A 3KR1A 3RV3A 1C3VA 1N75A 2F1OA 2YWHA 3AIOA 5KJEA 4ZMSA 2O52A 1T1IA 3O21A 4WDQA 1UL1X 3U4DA 4BWFB 3RC2A 4ZQBA 1HT3A 2JD0A 1XVVA 3ESQA 10MHA 1FVXA 4JYBA 1JG1A 2Q2QA 3W5BA 1YJBA 4OQYA 1TLLA 2DWUA 3EXEA 3DEZA 2XA9A 2CVHA 4UOQA 3UJHA 1WPXA 3ITNA 1PT9A 2VZEA 3VHLB 5BR1A 3M83A 3F6EX 2BGLA 2GR9A 1ML3A 5B6IA 1TCUA 2C8LA 2PLWA 5KYWB 5L7WA 5EUQB 3URMA 1K7EB 3FNHA 4BHRA 5KU1A 3ILXA 3TBKA 1NQVA 4X45A 1F3OA 1ZD4A 2VJLA 2A8YA 1L7PA 3ABZA 2D5IA 4OQQA 5DNEA 2C9OA 3SHOA 4AROA 3I04A 3S2IA 2G1PA 1QB8A 2QN2A 4QBKA 3LCRA 5DGHA 1ILWA 2J9FA 2JFQA 1EX6A 3N76A 1QMPA 1YZFA 4WY2A 5P21A 1COZA 3H8WA 1L5FA 3N2GB 4PBRA 4BTLA 3DPSA 4NULA 1RXYA 5HTOA 1QLHA 1J5EB 4WZ6A 4BUCA 4BNLA 3KDSE 4YEDA 3NHKA 4J16C 3KPUA 1WTCA 5C3MA 3LXUX 4MPPA 3U9SA 2PS9A 1T6ZA 1YS7A 1PT5A 4Q4JB 3DGFC 2TECE 2VWPA 1JT2A 3I8OA 2VJPA 1GPDG 2W2LA 4UQPA 4N5LA 3SVLA 1FXSA 2AIRA 3D1LA 1H1LA 2FSFA 1RJEA 1ZOPA 1BXRA 3FLBA 2R8ZA 3ICOA 3PNVA 1P4HA 4PAGA 2I2BA 2QA5A 1AURA 3K0AA 3BJZA 3QITA 4IEFB 4JI8B 4U7TB 1LPAB 2VF4X 4X71A 2AOUB 1H8ED 5AVOA 1UIMA 5GV8A 3WVNA 1QDEA 4LY3A 3T9BA 3E23A 2B6HA 1XHLA 1WUJS 4Z2YA 4OFBA 3LA6A 1RXEA 3CR7A 4Q66C 4ZVUA 3QPCA 4EG8A 5IK2D 4KFRA 2ZI9A 1P4RA 1ZISA 4BY9E 1MAUA 3UGQA 3PFWO 2BGMA 3I6YA 1FPMA 4NENB 1QHFA 3W8NA 4R3NA 4BYMA 1C7QA 2X0NA 4C20A 1M8KA 3ESCA 3ONFA 3G8BA 3DLBA 1L5LA 3D6UA 3P2JA 3GPIA 4YQYA 1R18A 1R4AA 2AN1A 3FYTA 5BUCA 2YHIB 1T9GR 3MUOA 4HGOA 1L4HA 2XGSA 3ZBUA 1W4BA 1O6ZA 4UZFA 3E1KA 1I2MA 4IXJA 1R4NA 2GBFA 1CQZA 2VSQA 1HETA 3QYPA 4JOCA 4LDJA 1Y1RA 4L5CA 3ANNA 2ZBPA 4YVFA 5ILQA 3VDXA 2HPAA 3O4GA 3WMFA 1MG5A 4NPHA 5JSFA 3HH8A 1FTGA 4XLTA 1LRJA 1SRQA 2L18A 2Z6VA 3JWPA 4ND2A 4OSPA 4RF3A 5EPUA 3AEUB 5IYZF 3WLIA 2OQIA 1JBKA 3HDTA 4KPYA 1RXIA 4RCVA 3KT6A 3HUUA 1SQ6A 3SKVA 2FX2A 5AQ1A 4TPKA 3EGDB 3HY3A 4Q6WA 3U48A 4UTVA 1ZOIA 5CDSA 1RCTE 4B85A 1I9GA 3KDPA 2UYHA 1UMBA 5C46F 3WNQA 1GCUA 1SJ9A 4RXTA 4RVHA 4Y7CA 5EN4A 5CEEA 5KTSA 4XEHA 2ECPA 2CCGA 2BGNA 4NYIQ 2GSWA 3M9LA 3PQ6A 4YHBA 1XZDA 1B3BA 2YASA 3H11A 2Q3FA 1C3OA 3EVDA 3KHKA 2P7IA 3VPHA 1CXZA 1PI3A 1SKUA 3JARB 3UICA 4HYQA 3W9SA 2QYSA 2FVXA 3U56A 1W2WB 4UM9B 2IHZA 2FPPB 1MH9A 1XQ9A 2NTYC 4MW4A 1EHCA 1JIKA 4RY9A 4MHOA 2V45A 3TPZA 3WE7A 4A0QA 3NPAA 1VSUA 2LIPA 1LDNA 1JQKA 1NVGA 1YZUA 2QVLA 3F8TA 3PNKA 4C5AA 2R66A 2ERCA 1LWNA 1QKIA 4IKEA 2UVPA 2V9CA 4JJZA 4AJOA 3CZ5A 4PXSA 4DBLC 3MLEA 5H9WA 4LZJA 2A30A 2OCDA 4O2AA 4F4HA 3DOOA 3TWOA 3F4KA 5CD1A 3VI3B 4X84A 3ZZ0A 4QTYA 4UUBA 3LX6A 3K9FC 1N6PA 4XFDA 2AQ8A 4LMAA 4BNWA 1V5FA 5BRNA 2ODEA 3GT3A 4EX6A 4KQMA 1AUXA 4JYPA 2Q45A 5AK4A 4F60A 3W79A 1MKYA 3MCUA 3C74A 4D0GA 2GKSA 3RTEA 4LC1A 2Z8YA 4BNMA 5C4GB 3BE5A 5B3KA 2BISA 2QVYX 1TMGE 5D87A 5HWSA 1P81A 2ZPTX 4DLKA 3EEBA 4IXTA 4CDNA 2BY4A 3IR7A 2EDCA 2XIJA 3HBJA 3IB6A 2IYSA 2V6FA 1G7RA 2A0FA 4KOEC 1J8VA 3ITDA 1VIVA 5LVAA 2ZIVB 2CXOA 3USZA 3HM9A 3IP9A 4B4DA 2NO0A 2H63A 1CB7A 1R00A 1WZIA 2B98A 4UD6A 2P4EA 1BWQA 1PLJA 1D8AA 2ZBQA 1AKMA 1YQEA 1DUVG 3SKXA 1LPSA 1H8HA 2P9FA 3MSCA 2Q6KA 4JQYA 4URUR 1HBJA 4DE5A 1VHLA 4MKGA 4NYMQ 4CL8A 1FSSA 4UQOA 5IXSA 3AL2A 1E4YA 3RNOA 3DA8A 3TQRA 5A6SA 4B3RB 4Y1RB 4BMDA 5EIOA 1SR8A 3VSCA 4MGYR 3TLJA 2PKWA 4IIJB 1I0ZA 2WT8A 2B1RA 5FBRB 3AONB 1ZD8A 2ATEA 1W46A 3PCRB 4FNGA 2N42A 1Z2CA 2W2MA 4HB3A 4X6UA 2FWPA 2M1ZA 1Q6YA 3PTLA 3VNVA 2HRQA 2QT9A 3VR5H 2R6AA 1E3WB 4X00A 1XR3A 3PFFA 2EU8A 2FUCA 2XDWA 4K03A 2DCMA 1KR5A 3VO1A 4BO8A 4JP3A 1N5IA 3CX6A 4V02A 4BOYA 3K0SA 1VIMA 3KVNA 4UE3S 3I6MA 4NU5A 1OLOA 2I6SA 1QIKA 3UMCA 2XCSB 3G1UA 1T4GA 3HWX1 4ZJZA 4NG4A 2QN8A 5B2EA 3HADA 1LPBB 1P31A 4HGRA 4Y7DA 3ZVNA 3VNUA 1KDRA 4GT1A 1NN0A 5CX1A 4K6GA 2Z9CA 4PNPA 5SZKB 4E7PA 3DAYA 3Q8KA 2DM6A 4J94A 3IQZA 1GP2A 4WZAA 3VO8A 4E5KA 4ER0A 4CIBA 3EUWA 1G17A 1P5HA 5HJEA 3E9CA 4UHFA 2PXCA 4FW8A 2WILA 2ZJOA 1WQ4A 2YUTA 3HJUA 2C29D 2OHOA 2POCA 3MWKA 3LNTA 5J1TB 1WCV1 1KI7A 1CQXA 5B6JA 1NHWA 1J0AA 1JMKC 3BMCB 4RK6A 4TZKA 4AD8A 4QXPA 4IMJB 4WIAA 2EIXA 2PSDA 3H13A 2J41A 4HDMB 4HX5A 4E5UA 5J2UF 2B7LA 1EZZA 2WUDA 3PUKA 1XDGA 3VV2A 2JGDB 5HKLA 3GDHA 1WU7A 4FDTA 2QXTA 1IN1A 3PB3A 5G0WA 2YV2A 1IHDA 2WKRA 1YGYA 3DF9A 1U8TA 3F8WA 4KLNA 4N12A 3PTZA 4PYQA 1J39A 5EYPB 2CLHB 2XTJA 3G2NA 1T4CB 2ZKIA 3GIWA 4P1ZA 3EA4A 4WESB 5K2OA 2GLTA 2ORWA 2W90A 3VZRA 4LYFA 4FFDA 5BT9A 3E61A 2GPYA 3ON5A 4MYSA 5LD2B 1X7WB 4M9RA 1N1MA 3ZXSA 2PUDA 3H11B 2VUSA 3SZLA 1RABA 1C30B 1X9GA 1I94B 4HFJA 3WHLA 2BFMA 2HEIA 2G7ZA 5KBYA 1FFBA 2R8OA 1S3IA 4BNGA 2QYTA 2Z2JA 1N6HA 1Q3KA 3O0TA 2BONA 1K2WA 3R8CA 2BP7B 2JFPA 3SBDA 1GVHA 3UAOA 4AP6A 2FW7A 4E09A 4F3KA 5F64A 3FMGA 2ZXFA 4QUDA 4CM1A 2OLJA 3R8FA 1FFXA 3L4BA 1SXJE 3VO9A 3JTMA 3IUEA 4O33A 5LBUA 3VC3A 3ZDQA 4YT2A 3BK1A 3VJKA 4HV4A 1FJGB 4U3JB 2G0NA 4DLLA 9GPBA 4KQFA 5HF5A 3WLOA 1DC5A 1O77A 4PIPA 4U7PB 1CRWG 1C7RA 5FBZA 1Q0QA 2BFDA 4PLWA 3C7DB 4AX8A 4KPFC 2JDID 2VJQA 1G8JA 3EMOA 2QMZA 4P80A 4R2IA 4YO7A 1JJBA 4CI0B 3TG8A 2RKWA 2HDWA 1FFYA 1MJHA 3DLCA 3BH7A 3T34A 2QR5A 1EGQA 1KWGA 4LHYA 3ZZNA 3EDYA 3O38A 2EZTA 4NL4H 4WE3A 4ZRMA 3C5VA 4X1YB 3RADC 3ANYB 2ZUSA 4HWTA 3PWKA 2V9PA 4CLRB 5CIQA 2YHAA 1XROA 4Z9YA 4HWGA 5DULA 1OLSA 3PTAA 4DJ5X 3QHAA 1L5QA 1YJQA 1Z83A 2FZWA 4EB6A 4OJMX 1J23A 1CY6A 4RV4A 3V7YA 1FOEB 3OQBA 5EL0A 2RG1A 2UYOA 4IHKA 1D1TA 2XAAA 2FMTA 4KH1A 1QOQB 2K6GA 4ZJPA 2EL7A 3MWJA 1A96A 4HO1X 4OA5A 2CNBA 5CX1B 4LF7B 4JBNA 1VDZA 1HWYA 2AQIA 3ZWBA 5DK4A 4JKIA 1HEUA 2EATA 1H9AA 1M8PA 1ZUD1 3AVQA 3FCYA 3O84A 3QIVA 2NU7B 2Q5FA 3IT2A 4GOND 4XH9B 3V3KA 5CHEA 5JJBA 5FLEX 1J49A 5ESRA 4IKPA 3CY6A 3L79A 1I3LA 1B73A 2HA3A 3MFYA 4OFXA 4AUKA 2ZJBA 4DLSA 5LOVB 2HGSA 3FFXA 1E4VA 1QFZA 1IZ8A 1OFUA 3O7WA 1RMYA 3I53A 3WB2A 5A4FS 4JEHA 4QM7A 1T9ZA 2QPOA 3QXHA 5E1MA 3WA7A 3P94A 4PYOA 4EI2A 1K8RA 4NU0A 2DERA 2RGUA 1ZRMA 3BEOA 4G4JA 1ZRNA 4S35A 2I1WA 3IILA 1L5YA 4PSUA 3QE9Y 5REQA 4RX1A 4L5BA 1EZ1A 1Y8RA 2ZSDA 3BKWA 1DRKA 4H4EA 4GPIB 4BNHA 3JAMA 1J1IA 4QTZA 4B6OA 2WYVA 2ZSFA 4LK3A 3K30A 5D3ZA 2VDQB 4OQEA 5DHPA 1I1NA 2E4VA 3ZGOA 1V5GA 5FUQA 2XSZA 4EH1A 1XZKA 3D6AA 1BDHA 3GRPA 3HJAA 5FNVA 4L9AA 3QYAA 4EAQA 3DXFA 3ASZA 1DTWB 4EI9A 5JDIC 3QVXA 4BEBA 1NVWQ 3IP5A 2XVYA 1T91A 2AB0A 2QLLA 5FR1A 2X41A 2RGAA 3FJOA 4OOEA 4LIPD 4WOKA 3D6VA 3EAFA 2ASEA 4FKZA 4EY6A 1E62A 2PKEA 1OQAA 1YIDA 5LUBA 3TRFA 2E4YA 5CTAA 3I4LA 3W3AA 2XWQA 1W5BA 1H4QA 1DKNA 5E8JA 4F5WA 4EA7A 2AMYA 1HEIA 1NZFA 4UUNA 4OD0A 1D09A 1C0PA 2C5AA 4I1VA 4EOGA 3ZU4A 2PAAA 1XLTC 3OUTA 4OGWA 1T0HB 3FG9A 5CNJA 3SYMA 4DNQA 4CKCB 3IEMA 3QU7A 4G0OA 4XARA 1H65A 3EGDA 1MVOA 5IAEA 2ROQA 2DETA 2QX9A 1E5VA 2PZKA 5BUQA 1GUYA 5IJ0B 4JBIA 5IK2A 1G6KA 2C1XA 2EBWA 3CINA 3PUWA 3SHWA 5KNBH 5H4HA 1YR6A 3C8HA 5FPPA 1QAQA 4ZYVA 1NNEA 2YX1A 4FLFA 3GZJA 5B4VA 3ITKA 4DB4A 3KL4A 4D3SA 2O8CB 1R0YA 2YZKA 4J75A 1VMAA 5BV7A 1JQJC 3HMKA 1EXDA 2WYOA 1OFTA 3AHEA 4CKBA 1BXRB 2AW5A 5EMKA 4PPYA 4ARZB 1JWLA 3ZWXA 1MT0A 1M8GA 5DYIA 3Q88A 1F0KA 1NLZA 3IVXA 2JGEA 3HUDA 1V4NA 1XXHB 2XCRB 2VJMB 3A25A 3OJEA 2XUGA 4JB2A 4LDQA 4QXMA 2UYYA 4D79A 5JBQA 3ZWCA 1E3IA 3ET4A 3HXOA 3ICVA 3MMPA 1RWBA 3VVBA 2CW5A 2PG3A 3PPIA 2ZPUA 4KSCA 1Z6XA 1GNSA 1ZC3A 2R1VA 2ZSUA 4MQEA 1E79A 1KXZA 1D3AA 1K7FB 3QPVA 3U7GA 4AECA 2QTTA 3M2PA 3CVWA 3H2YA 2NV6A 1DINA 4I1IA 2FETA 3RREA 4ETIA 4BLQA 1FEZA 4I3GA 2IZ0A 3F74A 2X1HA 4O4IA 1N2XA 4PZLA 3N2IA 3KT3A 3N2YA 3BRWD 3DWGA 4QYTA 4QYXA 1CYEA 3FBTA 1XTUA 1N8NA 1UK7A 3JSAA 5E9QA 2MR5A 3PEFA 1RPZA 4LOJA 3DL0A 3STVA 5KPDA 3R0ZA 4RZIA 1A98A 4MGHA 4YP6A 3TLXA 3U40A 1MNAA 1TA0A 2AW3A 4ZAZA 1LXCA 1XWIA 1Y3AA 2HTFA 5F2NA 3SYNA 1ZU5A 4ZCLA 1MABB 4LSGA 4YDHB 5H70A 1VI2A 3UHOA 4IHQA 4PSVA 3R9XB 3HKDB 2WZDA 5LQSA 4FXPA 4JIGA 4C88A 4ZDKA 2ODPA 4E33A 4BVHA 4G5SA 4H16A 5LQNA 3EULA 3RKUA 2RIPA 2PAFA 3Q0EA 5BMVA 1KJJA 3WDLA 5DM60 2RI1A 5IUNC 1OWNA 2JBAA 3FSGA 3HB9A 3OD5A 3JYNA 1ABEA 3LKBA 4U7GA 3MWEA 1YL5A 1KRHA 3LT4A 3TNFA 1AGXA 3QBEA 4MHSA 3U3JA 4DG9A 4ETMA 3KQNA 4I55B 3REFA 1FIUA 3S6JA 3R6LA 1T6YA 3G2LA 3F2VA 3OEHD 2OD9A 3KQHA 3HKCA 1GGFA 3ZH9B 3N2LA 2ZM5A 4TLAA 5DTJA 3C7KA 2JLZA 4YYEA 5DI3A 4DW8A 4JC4A 1J09A 3H0KA 1MX3A 1CVIA 4C01A 2ZI3A 5LLSA 5I6DA 3L4EA 2IPOA 2FSVC 3AW9A 3PFNA 4XQ9A 3I5YA 3N70A 5ALNA 5J5VA 3UV6A 3HJFA 1RJFA 3EFHA 2I8LA 1G55A 4RYLA 5K20A 4RD0A 2ET6A 2P7HA 2FJUA 5H59A 1H94A 3UHJA 5BQXA 2X8JB 3RRBA 3HZZA 2ZBRA 1BJKA 3L7BA 3O92A 2G77B 4Y6SA 3C43A 5FA6A 1TMKA 2EGUA 2A0YA 4N49A 1JGTA 2AQHA 1WSBA 2V4ZA 3C98A 2E3JA 3N2GA 2K7FA 3E6AA 4FHGA 1OAOC 1AQ6A 3GZNB 4KN8A 4FQ7A 4MUEA 2GJ4A 1YDFA 3GJTA 4WNYA 1TTHA 5LDDC 1Q1GA 4Y6RA 2X9NA 4D0RA 5ADWA 3IL2A 1IPFA 5T7BA 3A7DA 4ZAXA 1W73A 2JK1A 3EC2A 3UHFA 3ZE8A 4DCPA 3PNOA 3ZD6A 4MWSA 3HUFA 5K8IA 4OBBA 1SXHA 4FQ5A 1BWSA 5A0TA 1J70A 2GPAA 2GM3A 2NXJA 1FJHA 2E49A 5AHRA 3U9TA 1T9GS 1FU8A 8MHTA 3H5LA 4I8XA 4KQ6A 1AY0A 4NBSA 2H5IA 1YQDA 3E4CA 3SZMA 4MVJG 2O2IA 4EDHA 4L0CA 3JS5A 3ML1A 5SYNA 3RYFA 2IUSA 4CR7A 1ZOSA 3LPNA 3DUWA 4KJXA 5E3HA 4IOMA 3NAGA 3NHJA 5KTRA 1KMNA 1YF3A 1PX0A 3G7SA 3F4BA 5SY6A 2QW1A 5JYDA 3K32A 2JD2A 4KIUA 5J47A 2J59A 2PZJA 1X94A 1Y4ZA 3ANMA 3P9KA 2IPXA 1UPAA 4NNPA 5A7HA 4Z1MD 1M0WA 2PUAA 3EPLA 1JA0A 2NADA 1DELA 4X8HA 3VR6A 2QRMA 2J6BA 3AF2A 4DT1A 5DCUA 1NW6A 4HDRA 4NBRA 4GP7A 3BMOB 2E4AA 2ZG6A 3GQBB 1CG6A 4AZVA 4BXOB 3H1EA 5F4BA 1TD9A 4EGAA 2EKQA 3HNOA 4JOBA 3K2BA 5J43A 1FX0A 2OMEA 2YN2A 3I32A 1I51A 2PU5A 4OM8A 1LUAA 3MINB 4MR9B 2O3QA 2PSSA 3G8CA 1C1YA 1G8GA 3EXIB 2FMIA 3IKTA 2ZRQA 4NYMR 3B53X 3FMFA 4E2WA 2J9XB 1USUA 1KA9H 2O3TA 5L3QB 2AE1A 3MAAC 4KX3A 1F8YA 4JCCA 1FP4B 4AXBA 2FWIA 1W8IA 1K5GA 2FWJA 1FDVA 1HE5A 3PUIA 5IJ0A 5JXWA 5K2MA 5BVHA 1DC6A 4YJ3A 4Z0HO 2I66A 4JFAA 1IFXA 3QGMA 4OLBA 3LTNC 1ZK3A 2WQZA 1TKRA 1NXPA 2Z58A 1ZR4A 5KSPA 2J9GA 4YV7A 1EFRD 2G9UA 1KYVA 4LHZA 3JARA 1N9GB 3VR2D 3CUWA 4EKYA 1Q7CA 1H0SA 2X5NA 1HH4A 3C1OA 4B2YA 2BFEB 4DDWA 2Z6UA 4M88A 4INZA 2PX8A 3DWFA 3OLWA 3QMPA 2QN7A 1YASA 4G85A 1T1GA 5E3IA 3FNQA 4JGBA 4YQEA 5E7JA 4I1UA 3A1CA 1U3DA 1E79D 1KFBB 4XD2A 2Y0CA 3SN6A 3SX0A 2GEDA 4KG7A 1RRMA 1G2PA 3FMVA 2G67A 3ZWAA 2OVFA 2YJ5A 1CR2A 4BLVA 1OH7A 2JCSA 3CLTC 4BHTA 2IYXA 4ZDWA 5EXSA 4YRBA 5FI5A 2P1ZA 3KEQA 2XD4A 1AS3A 1AGNA 3ONDA 3A4VA 4BFWA 4O4HB 4DLTA 1YCDA 3EJWA 1DBIA 1MFZA 1OX6A 1RVV1 1SBCA 5JAUA 1T3SA 5K03A 4NPAA 1P7VA 4R2LA 1PVVA 4HS4A 5CPFA 1AXGA 3VXKA 3CZPA 3MCTA 1ESCA 4Q48A 1UEIA 1YZKA 1KQOA 3ITEA 5FV7A 5HJ7A 4DR5B 4Y9TA 2C8KA 1V5EA 5JD4A 1KAGA 2RHDA 3EXG1 4WLOA 3B38A 1RYMA 3L8EA 3ROGA 5CA0B 1BKDR 1A2OA 1N2CA 4K81B 4P4GA 4QATA 2HHAA 3EGXB 4XDGA 1MIHA 1XZQA 1PD0A 4U63A 4RD3A 3UA0A 3QLUA 4HPWA 1ZI9A 4DA4A 3FGZA 4RVGA 2PZGA 3K09C 2QTHA 1Q0TA 4MI3A 2VJDA 1M5TA 1XJCA 2Y1KA 3NBAA 5NULA 3ELBA 3SHFA 1OFUX 2IC5A 3LBYA 4W63A 4PU0A 3OJWA 5AFSA 3S2GA 5CEFA 4FS3A 3TD9A 4O63O 3U3MA 2W6NA 2X23A 5AW0A 2I2AA 5LLTA 3BMQB 5AT1A 1UAAA 4BO5A 3D5TA 4TLEA 2O48X 2QX7A 3QJGA 5DIZA 1KO5A 1JDNA 1X3LA 4E5NA 3QHQA 4CM4B 1QCYA 3BBLA 3LK7A 4HEQA 4A8JC 3GCDA 2JFZA 4QPNA 4D9CA 1DB3A 2F7SA 1X7XB 3IAXA 4MV3A 2MSDB 2OV8A 3QOFA 4FS8A 3TQCA 3JV7A 1YOVB 1W4CA 1DVRA 4WL0A 4IGEA 5I7EA 4DV7B 4ZT6A 1T0JB 1XDSA 3JD1A 1KMIY 2G9RA 2HQRA 3CCCA 2PWPA 3K4HA 4O4LA 1GNRA 5B57C 3O8DA 5H9VA 2HSDA 4JLMA 2OORA 2PV0A 3F5SA 4K9KA 4WY5A 2COKA 3X1JA 2C2BA 5CAEA 1DMRA 2DHQA 2HRBA 5HKBA 2ZBEA 1NQ5A 1A5SB 2R6R1 3SEQA 1PF7E 1S0UA 3FVRA 1E1YA 2FWRA 4R41A 3L8YA 3L8ZA 4AF7A 2DBVO 7MHTA 4RVDA 1Y6FA 1KNQA 4OHOA 3ZE0B 2FRXA 4MGZR 1OLXA 2YWFA 5E1OA 2IZ5A 1X2BA 3W5SA 1OD6A 5M34A 2IWHA 2YWXA 4IIBA 1KO1A 4HWRA 1ENOA 2DSTA 2GCPA 4LJSA 3DFIA 5F3DA 2P27A 5BV1A 1Y6QA 2QQGA 1P39A 1I1QB 1IUPA 3IIMA 3A11A 2XY4A 4YI3A 4Q7EA 1B8NA 3IH5A 2DPYA 3N53A 4GMFA 3BTSA 4LYJA 2EW2A 1FB5A 4TLBA 5C81A 2A9JA 2VBIA 4QO8A 4C0LA 3S1LA 2Q0QA 2ZYUX 1UFKA 1AB5A 2YC2C 4NAHA 5MHTA 2GCEA 3IIEA 1NV8A 3HL4A 1ADCA 3R20A 1M7GA 2WIJA 3EQZA 5EXPA 4BATA 3FDZB 1X0XA 2QJWA 4GE3A 4ANFA 1Z0ZA 1NUSA 1N92A 4XWGA 2SCUA 3VTFA 2DPXA 3LW7A 3AP1A 2P2GA 3D59A 5JIBA 3MCAA 2IKSA 2G4VA 1XC7A 2AG1A 1BFUA 2GCIA 3GL9A 1U28C 2GTIA 4PG4A 3T9AA 1POWA 1OH8A 1CUVA 4YIHA 3ABOB 4QDJA 3QI2A 2ACWA 2ZSBA 3RCBA 4G8CA 3D0KA 5BRAA 2O0JA 1EVQA 3LI2A 2A35A 3QVJA 2SKCA 4KO2S 3I52A 4JP8A 4NICA 2QLMA 4B5KA 1PJ8A 3WKEA 1ND6A 3A1DA 2FN3A 3MTDA 1ACMA 1C9JA 3EAGA 3H05A 2H59A 3PG5A 4GPZA 2E9SA 5HCIA 3BCRA 1IY1A 5KQSA 5FL7D 1JR3E 3ZHRA 3CLKA 4JZYA 1NJ6A