3MUEA

Crystal structure of pantoate-beta-alanine ligase from salmonella typhimurium
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
285
structure length
285
Chain Sequence
AMLIIETLPLLRQHIRRLRQEGKRVALVPTMGNLHDGHMKLVDEAKARADVVIVSIFVNPMQFDRPDDLVRYPRTLQEDCEKLNKRKVDYVFAPAVEEIYPHGLEGQTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLIQPDIACFGEKDFQQLALIRKMVADMSYDIEIVGVPIIRAKDGLALSSRNAYLTAEQRKIAPGLYNVMNSIAEKLIAGNRELQEIIAIAEQELNEKGFRADDIQIRDADTLLELTETSKRAVILAAAWLGQARLIDNQSVTLAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Crystal Structure of Pantoate-beta-Alanine Ligase from Salmonella typhimurium
rcsb
source organism Salmonella typhimurium
molecule tags Ligase
total genus 92
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3mueA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3mueA01
2E18A 1PFUA 1U0BB 2PG3A 3N05A 1G8GA 3QE4A 2YWBA 1N3LA 3SDBA 1JHDA 1WOYA 1MBZA 1PFYA 2X1LA 2QUKA 2RD2A 5FO0A 4ARCA 3FOCA 4R0NA 1KH1A 3AG5A 1ZH6A 3KT0A 2A1TR 5HG0A 1JIKA 2PZAA 1H3EA 1QRSA 3IODA 1CT9A 3IUEA 5JBNA 1O95C 2GKSA 1I2DA 3G5AA 1OWLA 1WXEA 4EG8A 4MVYA 2D54A 1LI5A 1YIDA 1M8FA 1V8FA 2OV4A 1I6MA 3N9IA 4KPUA 3CVYA 2CT8A 2DEUA 1ZH0A 3ND7A 4YP5A 2Z08A 2ZUFA 1NI5A 1KORA 3IMCA 1M8GA 3UY4A 2XRYA 3D6UA 1IFXA 3D6VA 1MAWA 4JZYA 4ZCRA 4MQ6A 3ND6A 4MVWA 3COVA 3IVXA 3CLTC 3Q10A 3LE8A 1OWNA 4KR7A 3ZJTA 1M8PA 2CUZA 1K4MA 5KHAA 1VL2A 3Q4GA 1MB9A 1WQ3A 4OUDA 3ND5A 5J58A 1JECA 3TZEA 1N77A 3HZRA 1U7XA 3CLRC 3MUEA 4HJRA 1IQUA 3UC5A 4CDMA 1WY5A 3N8HA 4E1AA 1N2GA 1QU3A 3H9CA 2PXHA 4CT0A 1KQPA 3TQIA 3NBKA 3N2YA 2DPLA 2PFSA 1JEDA 1O96A 4NAHA 2D13A 2PZ8A 3GUZA 2QTRA 5IJXA 4YMIA 1NUTA 4GU5A 3COZA 2ZP1A 1TYDE 2O5RA 4JYZA 1IQRA 1O6BA 1PG0A 4R2LA 1N2IA 3FG9A 1OWOA 1TYAE 3I05A 4MW2A 2A1TS 4DDKA 3TNJA 1JZQA 5K0TA 4DLPA 2Z3VA 3KT6A 1OWMA 1EFPA 1NUPA 3CLSC 4H3SA 4I6GA 4MWEA 1HYBA 4EG3A 1EE1A 1TQ8A 1IRXA 2ZUEA 5TGTA 2WQ6A 2A7XA 1KAQA 3A2KA 2QUIA 2QUHA 4MW5A 1ILEA 4YP7A 2RE8A 1NUSA 4KR6A 4YBRA 3IH5A 1PFVA 2AG6A 3NBAA 2J09A 4MULA 4PY2A 4ZT6A 3X1KA 3CA8A 5DB4A 3HV0A 1XNHA 1OWPA 4MWDA 1MAUA 2VTBB 3AG6A 3FH0A 3ZXIA 3ZJUA 4MUKA 4KR9A 1EUYA 1M1ZA 3ZJVA 2EL7A 3NV7A 2YWCA 1Q19A 1KQNA 1COZA 1GAXA 4G5YA 3SEZA 1JZSA 3FIUA 4EG6A 1XJQA 4F4HA 2AZXA 4MUGA 5H16A 3AL0C 1K92A 1O95D 5AHWA 3ISJA 4BWVA 3IVCA 1KAMA 2J5BA 3AFHA 3OTWA 1H3FA 3CVUA 3QTTA 1R6TA 2J07A 1J1ZA 1TFUA 1K4KA 3K32A 1PG2A 3HL4A 5IHXA 5LFAA 4MUHA 3P52A 1QRUA 3ELBA 1QJCA 1YUMA 4QBTA 5J5AA 1O97C 1F4LA 1G8HA 2WQ7A 3A04A 2DETA 1VBKA 4MUFA 3PRHA 5TS2A 4NAUA 4NZPA 3TS1A 3CLTD 3LOQA 1OBHA 1WZ2A 2V0GA 1FYDA 1J21A 4ZT7A 3UMVA 3DO8A 2CV1A 4EFKA 4ZCPA 1VBNA 1NUUA 4JXZA 2CYCA 4DE5A 4MUJA 3MMXA 2XRZA 1KP2A 1GPMA 4A91A 2A86A 2A1UB 3S3TA 5KWVA 3FNRA 3HGMA 2QJOA 4MWBA 4I6EA 1JEEA 1IH8A 4KKVA 1N2HA 1MC1A 3FWKA 3CLUC 3RBAA 3SEQA 4XSVA 1J70A 3FETA 3TQOA 1GZUA 1R6UA 1N75A 1KH3A 1N2BA 2E0IA 1P7PA 1LI7A 3KT8A 1Q77A 1XNJA 4U7JA 1QQTA 4HPWA 1WXHA 3RK0A 4UZFA 1YI8A 2E21A 3CLSD 4UZEA 1TYCA 4MW6A 1BS2A 5LLTA 2BTEA 4U63A 4EG5A 4GRIA 1M83A 4S1OA 1WXGA 2QTNA 3H05A 4RPIA 2QUJA 5FO1A 3RK1A 1G59A 4MUIA 4QREA 3FDXA 5BNZA 4AS1A 4HK4A 1NURA 4R2MA 3QTBA 1SURA 3CR8A 4ZT5A 2CV0A 1QU2A 4WSOA 1RQGA 2YY5A 1H3NA 4MW1A 1H1TA 1KP3A 4MLPA 1IQ0A 4ZCTA 5TEVA 5F23A 3ZUGA 1UFVA 4FZJA 3ZIUA 1B6TA 3UK2A 3ILVA 1N1DA 3TZLA 2B7LA 4J76A 3IOBA 2WSIA 1N2JA 3LCJA 2CYAA 3H97A 1G8FA 5HUJA 1DNPA 4K0RA 4MW9A 1U3DA 2D5BA 2DXIA 2DERA 2CSXA 4P2BA 2J08A 1J09A 4EF6A 3SYTA 3KFLA 3SZ3A 2IELA 1PFWA 1XNGA 4MW0A 1O97D 1LW7A 3VU8A 1WQ4A 1F7UA 3IMGA 4G5FA 4U8HA 4QRDA 1TYBE 2OQ2A 1WXFA 3FI0A 3PNVA 1FFYA 5TEWA 3ZXSA 1A8HA 2GOYA 4I6JA 4ND7A 4JFAA 4HJXA 3U1VA 3COWA 3KT3A 1ZUNA 2VTBA 4OJMX 3E27A 1M8JA 4DNXA 2AKEA 1VLHA 2HMAA 2X0KA 3FHJA 1JIJA 1T6XA 4L2IB 3CVXA 3G59A 1T6YA 1X8XA 1NZJA 2CFOA 3OP1A 1WKBA 1MRZA 4DDHA 2Z09A 1YULA 1GTSA 4MW4A 4Q93A 3CVVA 4DJAA 1S4MA 2JAXA 1O0CA 1O94C 3VGJA 3IOCA 2G36A 3IMEA 4CDNA 3CLUD 4L2IA 2PIDA 1NYLA 3F3MA 2HGZA 4J75A 3MLAA 3PNYA 1O5TA 2X1MA 3HMQA 1T9GR 2X3FA 2A4MA 4KPUB 4ARIA 3CLRD 3RJZA 5DK4A 2DUMA 2IP1A 3BL5A 1X6VA 4ZCSA 3GMIA 4AQ7A 1IVSA 1JILA 2QTMA 2JA2A 3M5WA 1V47A 2A84A 1Q11A 1NP7A 2O8VA 2VXOA 3RHSA 1QNFA 1TEZA 4MAFA 1VBMA 2NZ2A 4ZT3A 1N2EA 4OUDB 1I6KA 3AKZA 1OD6A 2H29A 4WNYA 2R5WA 4MVCA 1GN8A 1F9AA 3K9WA 4EGAA 1U3CA 2QJFA 2YXNA 2A1UA 3AIIA 2H2AA 3G6KA 4NATA 3P0HA 4X0EA 2DLCX 3IVGA 1JGTA 2A88A 2NSYA 1EXDA 3PNBA 4EG7A 2WB2A 3RFFA 1O96B 5KCMA 4PBRA 3VRHA 1JIIA 3MLBA 5DEOA 3SZGA 1U7DA 3HFJA 5DASA 4MWCA 3DPIA 2JANA 1N78A 1R6XA 3SP1A 1Q15A 2HZ7A 3A4IA 2IJGX 4DDMA 1EUQA 1JMVA 4ZT2A 1MB2A 2TS1A 3H9BA 4F3RA 3P0IA 2I1LA 4EG4A 1EFPB 1KH2A 1ULHA 3ZGZA 4ZT4A 4PBSA 3X1JA 2E89A 1KQOA 2PZBA 3JXEA 3IOEA 1T9GS 4RUKA 4XFJA 1YUNA 4ND6A 1ZJWA 4JXXA 1I6LA 1IHOA 3INNA 4MW7A 2J4DA 1F7VA 5FNZA 4EG1A 5H7XA 1MOPA 1Y42X 2C5SA 2DR2A 1EFVB 5EKDA 3L92A 3COYA 2CV2A 4MUNA 4ZCQA 4YP6A 3H99A 1KR2A 1N2OA 1T6ZA 1M8KA 3P0JA 4G6ZA 1J1UA 4NDAA 4CQNA 3A05A 2EJCA 5LM3A 3MXTA 3X1MA 1O0BA 3C8ZA 2QJTA 1WXIA 3L93A 1K97A 3Q12A 1O94D 4NX2A 3UOWA 1EJ2A 1OBCA 5K0SA 3DLAA 1EFVA 1D2RA 1MJHA 4MUEA 1J20A 4MVXA 1KKUA 2GM3A 4TS1A 1QRTA 2CYBA 3FY4A 1YIAA 1NUQA 3DV2A 5J59A 2BYTA 1GTRA 4XFDA 1NSYA 3CVWA 4Q16A 3IUBA 1WJGA 3PXUA 1QTQA 1GLNA 4K03A 2V0CA 4PBTA 3IDFA 3GLVA 5HUHA
chains in the Genus database with same CATH superfamily
1LPNA 3BTVA 4QODA 3SC6A 3SJBA 2V4ZA 4HAUA 3R76A 2DCMA 3CSDA 1U7OA 1QF6A 1EK2A 4FCCA 3U61B 1DV2A 5EIXA 2PGDA 2FN7A 3ZGVA 2RG1A 2X6RA 5I5GA 5B4VA 3C85A 2PQ2A 1V11B 4RXTA 1QIEA 4ETIA 1OREA 1ULUA 1KYWA 4YASA 2IIBA 3N1UA 1C9DB 1OYVA 2G67A 2PUBA 4IIHA 5ALKA 1SZCA 5FBRB 3KT0A 3QF4A 5F51A 4GOXA 1PSDA 3H65A 4D92A 1R0KA 2HCFA 1W35A 2WTXA 2EKDA 4KFSA 5BN5A 3RYHB 1G63A 1FMLA 2FK8A 2HJRA 4DLAA 1JKXA 2QD5A 4KJZA 4HDMA 4N7JA 1G5PA 1OLXB 4F6RB 1GPYA 3O9VA 1XZPA 3FUXA 4Z7NB 1A71A 1PVVA 2ZSIA 2HBQA 2V7QA 3QNMA 5JLAA 5TS3A 1H2AS 1JIUA 4XGNA 4CM9D 1ZH0A 1OKKD 1KTIA 3G2QA 1P1KA 1FJGB 5GIOE 1P7ZA 2Q5JA 2E85A 2X6TA 1FBTA 1U2EA 1TQHA 2CK3A 1US8A 2DFVA 1GL9B 2FG5A 4L02A 1QFSA 3QXGA 4Q12A 4B46A 5EJ8A 3PCTA 4JI0B 2PUAA 2N47A 4IUYA 4ZC8A 3T3DA 3MELA 4WN3A 1TEHA 1HETA 1MX9A 1XLTA 3PRYA 4OKIA 3PYLA 1Z13A 4MR8A 2V97A 4JNCA 1Y8ZA 1ULSA 3Q10A 1P45A 2DAPA 4OJQA 1PF7E 3ETDA 2QA5A 3N5KA 1IJKA 2YN2A 2CXRA 1Y4UA 4J8PA 3S2ZA 4KQGA 1PT8A 1UAAA 1QCZA 4NBLA 4EUNA 3AFMA 3K0AB 2QB5A 3QA3E 3JZAA 3W8EA 2CL7X 1NJ6A 4A6DA 4BLPA 2OVFA 1N77A 2UYGA 2RGWA 5DEIA 4PIVA 1YWGO 3LC0A 5HRCA 1FSFA 3DM5A 2AW3A 1KI9A 5G41A 4EKIA 5TNXA 1NG9A 2OXFA 5JNSA 4W6ZA 1QU3A 5LJLA 1E7YA 5IYZB 3O4VA 3PQ4A 4ZAVA 4OX9Y 3ESAA 1VMIA 3KHUA 4LOKA 1FW6A 4C21A 4F84A 3NBKA 2OXCA 1FNDA 2YICA 2WZQA 1U9ZA 3OQIB 3U49A 1JEDA 4MR9A 4NAHA 1WF6A 3T1HB 5I7FA 4C0WA 1NUTA 3JQRA 3M83A 2IYEA 5BV2P 5JYBA 3PDIB 5EQFA 2P9CA 3K72B 1L1EA 1TYDE 1EUDA 1JDBB 3EXIA 4IS2A 4IRXA 4R7TA 1T4GA 5CG2A 2G8LA 4NXMB 4O29A 3D5EA 4EJFA 1PVDA 1JVNA 4NICA 4Z4CA 1OI7A 1Y9EA 2C83A 3AR7A 4LDQA 1M1YA 1FB5A 2QGZA 3SIRA 4BZPA 1T2FA 2FUG6 4LJYA 1NYQA 5SICE 5A9RA 2JAPA 4Q9AA 1Q1AA 5J23A 3EW9A 1V1RA 3CLSC 4C43A 2XLBA 2H00A 1P73A 1C9MA 1JHXA 4M36A 4EG3A 4DEXA 5AW7A 3OMXA 5MFZA 1VZ3A 4BGIA 4CLOA 2ZUEA 2PV0A 2HA3A 5DK6A 1J7JA 2E9SA 4TXHA 4BBPA 1GIAA 3ESBA 1MPTA 3N2KB 4N5MA 1Y1KE 4C6TA 5J2UB 8LDHA 3OLWA 5HF6A 1QAOA 4PQFA 4CM8A 3AJ8A 2GYVA 5GAJA 1DJNA 2FPXA 4MWDA 2R68A 2P2SA 2BM8A 2VF8A 3HGTA 3EDCA 3TMKA 5ALVA 2A35A 1DXOA 4AKTA 1RWOA 4LRQA 3DM9B 1NLFA 4LX8A 4ZMSA 3ZJUA 3G2NA 4CQMA 1F3LA 4LHVA 3QF7A 3B5EA 4OXQA 4OOFA 1ISFA 5DXFA 5FUVA 5AKLA 1E32A 1OUMA 3IUPA 2D2VA 1T2AA 3HABA 4IHJA 4YA6A 2I8AA 2MR6A 2G5CA 1XDWA 4HDSA 1C3JA 3RSGA 4F4HA 3A6EA 4IAOA 4G97A 2J9XB 3TLZA 2QRGA 3A7EA 1N0WA 1RWBA 4PWZA 4Q39A 1E8MA 2UAGA 1RHRA 2XUAA 4C0QC 1X0VA 3IVCA 1PDWA 1XE3A 3OTWA 3BB4A 1UJ2A 2AFIB 3R7DA 3CS3A 1MHTA 5DSZA 4BZQA 4IWXA 3D43A 1IYZA 3UN1A 4BNVA 5JFTA 2ZS9A 4ACBA 1DC7A 2JHCA 2ODBA 4JEHA 5JSZB 3TF5A 2PX0A 1AKYA 3LCUA 4I1VA 2AMYA 2IHZA 4D3ZA 4D4LA 5EJ6A 1C7IA 1N2ZA 1ODJA 5JANA 3HB5X 4GRDA 1X9IA 2IYYA 4X6YA 3ZE7A 5SZHB 3S99A 2P0AA 4HDAA 3ORQA 3EMKA 3X3HA 1ZD2P 5HIAA 2VP6A 4UM8B 3OCZA 5IARA 4DQDA 3CV3A 1AKWA 1DCMA 1ONSA 1VKHA 1JDBC 3PRHA 1TJ5A 3E2PA 3GAFA 2FYTA 3GIWA 5AVYA 3K09C 3QENA 4D25A 1W34A 2A14A 1SVOA 2VYND 3C6QA 3KBBA 1SHZA 4PLWA 4QOSA 3K0CC 4WL0A 4ZALA 2DX7A 2HBYA 3INGA 4HFRA 4R05A 1J21A 1OV6A 2D1SA 3PEUA 5DGXA 3CTMA 4Q18A 1X8LA 2BCGY 2HD4A 1WR8A 1O6ZA 3VNUA 1V4BA 1BKDR 2Q8QA 2AN5A 2V6FA 3NJ4A 3F71A 1LV7A 4KYVA 4PW0A 3V34A 4A2CA 4FYPA 4D82A 4EK9A 2C2ZA 1J24A 4XTRA 4P3XA 3K8YA 4E5DA 3NCHA 3HDVA 5TRTA 5HQTA 4NBTA 3K1AB 1OT5A 2XMCA 1U2RA 3S3TA 2PKEA 4MJXA 3H19A 2BFDB 2PS1A 2JLXA 2QTWB 2XMSA 3UJ7A 1XCMA 4I6EA 4I5FA 4BMPB 5L4SA 3W79A 5TR9A 2DBVO 3PEFA 1IMJA 2CJYA 4XSHA 5DI3B 5D87A 5KOJA 5SZIA 1PX2A 3LZDA 4REOA 1K7FB 4L74A 1NXXA 2C42A 3HWX1 5AXDA 3W2TA 4DABA 1ZVQA 3WG9A 1R15A 1QZTA 4OB6A 1WL8A 1JE0A 2RIRA 1CDEA 4IICA 2I3AA 2O7QA 4TWZA 4Z2AA 4JVSB 3ZWDA 1H6BA 1G8AA 2VSXA 4Q7QA 1ZEMA 2DFNA 1XKLA 4MK4A 1GLGA 3T9EA 3MTQA 3R75A 3RK0A 5HTOA 2L0XA 2JLCA 4L28A 1DOAA 1L0BA 2GNPA 1KJYA 2Y2UA 3AINA 4MP8A 3OC6A 1Y8RA 2Y1DA 5FPQA 4UBKA 1TUBA 3DW3X 4GRIA 3ZBPA 4GR5A 2VAMA 2R4QA 5KYUA 4LF5B 3DR3A 3ZV5A 3IVAA 4NBSA 1W0KD 2P67A 2VWPA 5LMUB 5IU6A 1WBBA 5JR3A 1ZRSA 3B6ZA 4XM0A 2BEWB 1EB8A 3EXHA 3K2BA 5BWOA 3WNVA 4IOLA 4DLXA 4AP5A 3I6YA 1W59A 3ZWKA 3H1AA 2AIRA 2GJSA 4QUBA 4TMZA 3RQSA 3CR8A 3VYRB 5JXWA 3R5JA 3RTBA 3KQHA 2PE5A 1LPAB 1CR2A 3KL4A 5D1NA 5EHZA 5JVDB 1BGWA 1Z12A 4MW1A 4B47A 2ODEA 3ZLVA 4ZU3A 4ZCTA 1NULA 4AX4A 1PEDA 3TOVA 5J43A 5KYXB 2BEJA 4KE9A 1UFVA 1GZDA 5HCNA 5I7HA 5EXPA 1ZQ9A 3ZW7A 4Q1VA 1MX5A 2HV9A 3NLLA 5GONF 1A82A 5D3MA 2DBRA 2VHXA 2AC2A 3GLTA 1MJFA 1DVRA 1PDVA 1KEEB 2VHWA 3P1JA 4XYMA 2FEWB 1Y9DA 2I0FA 2VNAA 3KO8A 4V03A 3BIOA 1Y33E 1LFDB 5HKAA 5HK8A 5DYWA 1BHJA 4MVJH 5I8WA 1OFUX 2NG1A 2WJAA 4RGYA 4RLSA 4Z7QB 1ZW6A 2H54A 1P4HA 1QORA 3B53X 4KN9S 5K3SA 5J47A 1MW8X 3HZOA 2XB4A 4OMCA 1VI6A 3LLSA 3QMPA 5T6BA 2A50A 4A8HA 3A27A 2BONA 2EATA 4G25A 1Y6QA 3MS7A 2PJRA 3OOSA 4Z4FA 2VZ0A 4X85A 2P62A 4FNMA 1KO5A 2GN2A 4ZGGA 2WTBA 5EWMB 4HXYA 1C3VA 1FW8A 2WFAA 5EWJB 3EIXA 4OHMA 3TLAA 3FE2A 1IN4A 3EA0A 3N74A 2HIHA 4F5WA 1NTRA 3OPYB 1S2LA 1W88B 2IYZA 3IIMA 4GQAA 1V3VA 4MQ4A 4RPJA 4DSAA 5AQ1A 1KRXA 2L18A 3L8EA 2XCTB 1GT91 1KSHA 3GEBA 3WP1B 4KNWA 1VLHA 3GOQA 3EDMA 3MXOA 3S68A 2EW8A 3EZ2A 4D41A 1NWCA 4LZPA 4D5EA 4DLTA 4DT1B 1JSRA 2EFCB 4OHVA 3THWA 3LSTA 1T2CA 3CQ9A 3O3OB 4YWJA 3CUVA 4NYJQ 3W2GA 5KQPA 2QTTA 3EPRA 2D5CA 2O4CA 1MRZA 2Q1SA 3A6DA 1JYFA 1T4CB 5CD9A 1CHNA 1YBVA 1SUSA 4JUCA 1SXIA 1MPXA 1S3FA 4WY2A 4ASUA 4DJAA 2QV7A 3G9QA 1BRMA 1G8KA 3ZZ1A 1T15A 1EVQA 4Q1BA 5THXA 3VX4A 1JAYA 1PD0A 1SPBS 3R4CA 3LHDA 3TR0A 1ZD3A 3WRYC 4DV7B 4XGRA 3FRJA 2DF8A 3ZHVA 1Y7HA 2N42A 1N2SA 2G36A 4PGHA 4GOOD 2PIDA 3M4YA 2B5VA 2HGZA 4L9WA 5ED0A 1GARA 1RWMA 1YB7A 3IR5A 4FMBB 5DH9A 5CCEA 2XVYA 5EJMA 4US2R 4I50A 4HAYA 1KK0A 5AUNB 4YQFA 1UFRA 2R1TB 3W3AA 4H18A 4IVPA 5IBCA 4NBRA 1G2IA 5COAA 4DIOA 4Y2RA 4M9QA 1IAVA 1DT3A 3M5WA 2D1TA 3MWLA 2VWHA 5CEEA 1OXKB 1YJAA 1C1HA 5FBLB 1RAAA 2XVXA 2CMHA 16PKA 2EBWA 3BE5A 3EODA 3GQVA 3I8OA 3QW4B 3T1OA 1DBVO 4LWQA 3U7HB 2PMKA 1DQNA 1ZGAA 4G23A 4KCGA 1TZBA 2VJMB 2QRMA 2ZYDA 5J2TA 4LF4B 4OUDB 5KNDD 3KQVA 2YZ2A 3AU8A 3PJEA 4EFMA 1SEVA 2E4ZA 4F2GA 5L3SB 1J5XA 5CCXA 4F5DA 3KETA 1WBJB 2BTQA 2H2DA 3VX3A 2QAJA 1QQAA 2X9LA 5LA6B 1ABFA 2VPWA 4Y2UA 1MC8A 6REQB 1PNQA 1K9VF 2B94A 4Q4AA 2J41A 3RJMA 3NBYC 3IT0A 4M83A 2HXGA 2IZOA 4M7PA 3BWVA 1LJUA 4TGLA 5CAEB 1WPQA 3CEJA 4LJ7A 4JVMA 1OOEA 4NE7A 2XUGA 4DM3A 4BNUA 1M34A 5JJCA 3HCRA 1SBQA 3KOXA 1JEQB 1QHHA 4A0GA 3CY6A 1UXKA 2AJCA 2R79A 4RS3A 1CP2A 4F1JA 1QK3A 2SCUA 3CZMA 3LBAA 3LPLA 4Y30A 1GSHA 2KX7A 2ZANA 1E2KA 2NN3C 3E9MA 5EINA 2A92A 4YRTA 3HNPA 5DCLA 5KYTA 3FOFC 3K9FC 3CKKA 4BCBA 2V7BA 1HNNA 4MLDA 4YPVA 2Q5EA 4FX2A 3ESYA 4K6FA 4C3VA 5TF4A 4DWOA 2YXEA 1A5ZA 2WUWE 1L3BA 3FYHA 3X1JA 4B4DA 4ZKEA 3VZPA 2WMDA 3PQ7A 2HA7A 2FSFA 1Y9ZA 2ONZA 3MS2A 4Q7JB 1BFKA 3D5QA 5DTEA 3WLMA 2PRJA 3FDZB 4FR2A 3X1XA 1Z73A 1LI4A 3CR3C 3S2UA 1YRBA 4NBNA 4QJIA 3LV8A 5JBIA 1GQRA 5IBPA 4CLEA 5CYPA 3ZZ0A 2JS7A 4IZIA 5LSAA 2XNSA 1P7VA 1UMCA 2MTBA 1EFDN 4LYDA 9ATCA 3HKEB 5M5BA 1KE1A 1OBFO 1S1CA 3O8CA 2YINC 3H18A 1E6WA 1VP9A 3F49S 1DS6A 3KPUA 1WWKA 1E6EA 3CNLA 1M75A 2FHPA 2ZM5A 1NF3A 2V4MA 3IBCA 4RVHA 2W22A 4EPVA 1E2HA 2E5FA 1QV9A 2RGNC 3A3KA 3CBQA 1OC2A 3K8ZA 3DAPA 4X92A 1GR0A 4Q3DA 2WM9B 5IJ9A 3KSMA 3NVKI 1J1UA 2C7BA 3DUFB 3EVDA 2QX4A 3GY0A 4N3GA 4YUAA 3D8HA 1RHJA 4FKBA 4ZODA 3DZIA 5AVVA 3ER8A 1NQTA 3LHSA 1H5UA 1DKMA 1FNSA 1LLQA 1L1QA 1X2EA 1YV9A 1ZFNA 2GDJA 2H5JA 2VK4A 1CR0A 1JQ5A 2NAFA 5KIAA 1SJ9A 2KQUA 1XVUA 2G2SA 1BEZA 4WK4B 2HGSA 3EOZA 5ECGC 3H1BA 1MFZA 1QS0B 2OESA 1KKUA 1UM9B 2H4HA 3CW2A 3R0XA 3PPWA 1GSAA 2Q41A 4F2PA 4GPAA 5LQMA 1YIAA 4PHFA 3R3YA 1XTSA 2LTAA 1L6IA 1GDDA 1PUXA 2F2TA 4UASA 2W9XA 2PGOA 4XFDA 2MINB 5FTWA 2N0SA 3NDBB 3PFNA 1RAIA 2XUQA 4M1KA 2WTUA 1XLWA 1W1UA 3ZGNA 2PO7A 3KZMA 1JHZA 1UBLS 5AKGA 3GLVA 1FLNA 5AM2A 1SFRA 4YMTA 2XWSA 4GDMA 5EJ9A 2VPXA 3REQB 4C03A 5AOVA 1OXSC 2NVBA 1TCBA 1WB4A 3FYUB 3IR7A 4K6KA 1W44A 5F35A 1E1CB 1TM4E 2GPNA 3NHBA 3WGHA 1SCIA 3DXZA 3LIIA 4QG7A 4BMCA 1WOYA 3BGIA 3PHBE 5IULC 4KGXA 2FZKA 5IRCD 4OQLA 3IAAA 4F11A 2C8KA 2PLWA 4NU5A 1RU3A 2VZLA 2DWQA 3FOCA 3DDSA 2W6MA 2F1JA 5JMWA 3HLTA 3WADA 1DKRA 1SG0A 2CNLA 3DQPA 3K5WA 5AJHA 4JOBA 4ALIA 1THTA 3ET5A 2A5JA 3EN0A 1JTEA 5IKOA 4YP9A 1JI0A 3P2JA 5IKPA 1ISJA 3A6PC 4TMTA 1T2UA 2FSHA 2DG2A 2QT0A 2XODA 4GE3A 4NV0A 4BKOA 1SB9A 4QOHA 3VAYA 4MIOA 1OWLA 2ZCVA 3AIKA 3VU3A 2XE4A 2SECE 1AHIA 3E7FA 1JYSA 4U9IS 1G55A 2QI9C 4JUAA 4IHJF 4EGQA 3UW3A 3TRDA 1XVTA 3V48A 5MN5A 1BXGA 1RW4A 4IUDS 5BR8B 5H8WA 3SMQA 1G6HA 3H2BA 1G98A 3NM6B 4G67A 5KS2A 5KTPA 2CNKA 2OAGA 4CMGA 4KYTA 3D6UA 4W8HA 5CA0A 3DMNA 3W6OA 2MHCA 4NDZA 2F7SA 1A27A 1KMCA 3OPYI 2XSZA 4TKVA 4OHZA 3QX3A 5LMCA 2NZXA 1CUHA 1EFRA 2I7CA 2XLCA 3UCFA 3KALA 4BO5A 4UVHA 1V7PC 4QJBA 1KXJA 4DNPA 1B7GO 5H82A 3JQ9C 4ER3A 2VH2A 3Q4GA 1MB9A 4AO6A 1L7AA 1DRUA 3PF8A 4L27A 4Y98A 1SCNE 1L8OA 1N8SA 1A9YA 4A6XA 3CF4A 4AN1A 4F8YA 1IDN1 5JJ5A 4GQBA 2UZ4A 2VJNA 2VDWB 4KX3A 1ZUHA 1MEEA 3TBHA 3QMMA 1PS8A 2GZHA 3N0RA 1TIBA 2A0YA 4Q6BA 4QBKA 1WY5A 3ZBTA 2P6UA 4ARZA 4MDFA 3SWWA 4N48A 3ENQA 2FPMA 1N2GA 4FGKA 5JY1A 4IVQA 4RETA 4DCUA 3OZCA 3ZWBA 3IO3A 1X8JA 5A9TA 5FOQA 1EWKA 2KE5A 4W5RA 1EIZA 3QZUA 3M4JA 1LLFA 3IKTA 3VI3B 3DBLB 1P39A 4ZCLA 3TXXA 1Q14A 3A3OA 3WLHA 2D13A 2H9YA 4YMIA 3FYUC 3IEPA 2NU9A 3F6PA 3WGYA 3C1TA 1UBJS 2KWIA 3BFXA 3B3QA 1LPSA 4GM0A 3R9XB 3EYWA 2WVAA 5PGMA 2OQRA 4XYEA 4RD4A 1CV2A 5AESA 1PGQA 3SKYA 3EHEA 4H7DA 4QPCA 4L5AA 4H3KB 3L7MA 4ZAYA 2EIHA 5LKRA 4AXXA 2XOXA 4Q4JB 1U9IC 3ILXA 3HJRA 5H83A 4C4SA 5C7IO 5CDSA 2HF2A 3HL6A 1E1YA 3C45A 1OQAA 3EFHA 2PRYA 5G1PA 2PT5A 4B2YA 3FROA 4ENQA 2ZRGA 3G2LA 1RSZA 2EGGA 3MD0A 4ZD6A 3V1YA 4AJPA 4AULA 3TM5A 1Y4SA 3O94A 1W5BA 2DUJA 3EW7A 2HJ9A 2YH2A 3DDUA 4NJEB 4PCLA 4WASA 3RW9A 2PWYA 3GRYA 4JLDA 3SC2B 1ZH8A 3BZWA 2WF5A 1BVYF 5FIUA 1EP2B 4UEJA 3RVRA 3S70A 3TPCA 4KR2A 1Y8QA 4I4TA 2CHFA 4RJTA 3EPKA 3VZRA 4KR6A 1ZNXA 2V7PA 1CRQA 3LGAA 1IEQA 4BYMA 5FADA 4YXFA 3DOJA 1GSOA 4FFLA 2GPBA 4MRRA 3LPCA 2R6DA 4FGJA 5ELXA 2Z2KA 1TQ4A 4B3BA 1M1ZA 1NTOA 1MX1A 1PZFA 2VF5X 5L9AA 2P2DA 1ZS9A 2I7TA 2C7RA 3FHTA 1Z68A 1NMSA 4TV9F 3QK7A 4KQEA 1Z7BA 4ER0A 3FPBA 5E6UA 5LU9A 1UDRA 3FB1A 2P5TB 3A4LA 4BECA 3D54D 1UEIA 2QXTA 3LYUA 3QBTA 4WKNA 5CLFA 3GQBB 5KWJA 3AL0C 3PDCA 1ENZA 1H69A 1QIJA 2ZRAA 2Q1YA 3L7DA 4ID3A 5AT1A 3CVUA 1RBYA 3P2MA 5JSQA 2N9UA 4K6GA 4F6CA 3NOVA 2WM3A 4H60A 3P71T 4RV5A 1U7HA 3P20A 3PC7A 4EQ6A 5LFAA 2B34A 4LHXA 3A9VA 5EXSA 4GKVA 4LWZA 2IHUA 1OF1A 2VSOA 1T3ZA 5BWMA 4N18A 1OPXA 4AXBA 3PYMA 3AJDA 4KMRA 4MB2A 4R51A 3GLIA 3MPOA 2DULA 1FUUA 4NK5A 1LSUA 1U65A 4L78A 5AVKA 5IWCA 1G17A 3NHYA 5EXTA 1TGVA 2ZJOA 4TTTS 4FDTA 3WWEA 4PZUA 3ROXA 1F6WA 5IDWA 4O08A 3QFSA 1SXJD 4R6WA 1LLCA 1GFZA 2PEZA 5C9ZA 4BL5A 3ZU5A 5K09A 5DX1A 2IUSA 3EG9B 4ZYTA 5DT2A 1R64A 2ZTUA 1QZ3A 3D3KA 1HZJA 2CWWA 4Q34A 4YCNA 2H3EA 3DKIA 3HB4X 221PA 4BEJA 5I3CA 1GGNA 1WSAA 2G1KA 3ENZA 2FWRA 3LUPA 3ZGLA 4LV6A 1SIOA 1GPMA 4A91A 3GDWA 3ZY5A 3GRCA 4NCAA 1FNBA 2CHEA 1U5BB 3THSA 5CW1A 1EFAA 3E9ZA 3G9TA 4DEYA 2OUKA 4MWBA 1C50A 3MZ0A 1WA5A 2W6PA 4UU1A 3F1LA 4B9EA 3UWOA 2F59A 4LE2A 5EE9A 3RARA 3SGLA 4D74A 3LHIA 4V0QA 1AK1A 1R8JA 1A7AA 1LD3A 3P5BA 3ERCA 2O2CA 5JJKA 1W36B 4Y6SA 3UWPA 5C80A 1HORA 4MKIA 4UHJA 1J70A 3I9MA 4UQLA 2VDKB 3QFHA 1A9RA 3CXUA 3FETA 4IXTA 2QPOA 1JU9A 1T5DX 3IP1A 3WLNA 1P8JA 5KJ6A 4REQA 3V4OA 2JIOA 4KUGA 5ARBA 3ZG6A 2P2YA 3ITNA 4QT0A 1Q77A 2AL7A 4KXVA 3SR4A 4HNAB 2G04A 2NXCA 4ETNA 3F5DA 4KFTA 2ZUFA 4TMWA 3WIVA 3AUAA 5JARA 1PWZA 1TYCA 3HFGA 4AN0A 4ZOBA 3VUEA 1M83A 4S1OA 4WRRA 4Z1OA 3CF6R 2QUJA 4MB0A 5JZVA 2LGJA 3U4QA 2DUUA 4BGVA 2WV9A 1FFXB 2BI4A 1IHXA 2NO5A 2P7IA 2XJ9A 1GU1A 3A6HA 3FDXA 5AKIA 1ZGBA 2WTEA 3JWIA 4D9GA 1T43A 3EIUA 3O3MB 5FLXA 2HPVA 1XPRA 4M1MA 3MFYA 2M32A 3D7RA 4KRXA 5B1YA 3A26A 1HY3A 3RIYA 3EDRA 3AHGA 3H2KA 1GO2A 4U7PB 3TR5A 2HCJB 5IAEA 2X4LA 3RIGA 5KO2A 2VAXA 1H1TA 1V16A 2ACEA 2WSSA 4TN5A 2B37A 1C3LA 2IPMA 2ZRIA 1W0JD 3SF0A 1FK8A 3DZFA 1RXVA 3AVTA 1P4GA 3D1VA 1PEYA 2QHXA 1BOOA 1J4AA 1F9EA 1NZFA 2V9ZA 1Z5WA 1TUGA 3GJXC 4OY3A 3WB1A 1HLPA 4LTNA 1SCBA 4TN1A 1E3TA 3NHPA 5K05A 2C7GA 3QUSA 1XMOB 1ONBA 4O02B 1Z08A 2FCRA 5KMGB 2H5EA 5ENDA 1W7AA 1D4AA 3MYRA 2OORC 2O8FA 5CXXA 4I66A 1XTQA 1I6WA 5SY4A 3T3IA 2JZCA 5HOQA 1H8HD 3JATA 4IIBA 4URVR 1U3DA 1Y82A 2DHEA 121PA 2WE8A 2ZQ5A 5DV9A 3BUSA 4Q1FA 2ZQZA 1I2MA 4ZI7A 3EGIA 2QR2A 2FSVA 3SYTA 2NXJA 5F78A 5BRJA 4C6SA 4IDHA 3ONWA 1O97D 4BNDB 1TU3A 2WY2D 2BSQA 1HURA 2BMDA 1FZTA 1M10A 4PRZA 4NENB 4INAA 2FH5B 4G8JA 1EUCB 1ELOA 2GBCA 1IJBA 3EUFA 5D3QA 2ZUVA 2FUKA 4KB5A 3NIDB 1XMIA 3BWYA 1PKXA 4GT1A 2BJVA 2DBZA 3HG7A 4B4WA 2ORYA 2VZEA 2VUUA 5EJ4A 3QVTA 3ABRB 3PGVA 1XFAA 4CKBB 5KVAA 5LBTA 1EFCA 1T6YA 1GKIA 1X8XA 3GC6A 4HLDA 4LKOA 2OFPA 1PGNA 1SIUA 4A4DA 1YU9A 4LC0A 2Z09A 5CT6A 4ZK2A 2F64A 3ORYA 2EDAA 1PEAA 2R8ZA 1GL3A 3PD7A 1KO8A 4G85A 3S8MA 4C0AC 1IBCA 1ZGGA 2B6NA 4BTEA 3ZWOA 1XCLA 3L8YA 3BQNB 4ZQBA 3A11A 5HKBA 3RS0A 3IKMB 3JVDA 3KPJA 1MJGA 2BJHA 3ANXA 1BH2A 1PCXA 1G2QA 1QIDA 3FYTA 4RZXA 3UWDA 4DA9A 1NYLA 2XDAA 3F3MA 4Z1MD 1EK1A 3MLAA 4BKRA 1Z22A 2ZIXA 3MCVA 3M2TA 5BVGB 4GKKB 5BSUA 1DB3A 3VVBA 4RTOA 5IDXA 2HK8A 5EUBA 3PJDA 4B6FA 3HB1A 4K6CA 1A1VA 1Q0SA 1Z17A 1QHEA 3PIIA 4L7QA 1IDOA 3ED1A 4BNIA 1G16A 2FZCA 3GMIA 4HBZA 2YVQA 3TMAA 2QTMA 3DQQA 1UXOA 4X84A 2RCYA 2AUNA 2J0VA 4HVAA 3KP1A 4LOLA 5EYPA 1FUYB 3C7AA 5DNVA 1UJ6A 2QTVB 4UFPA 4ZZ0A 3KUCA 2PH3A 5D5PA 3L4JA 5FWAA 1HEYA 4PRYA 3WL6A 1N2EA 2OV1A 3E81A 4BNZA 2VCYA 4B6EA 2GAJA 2NO0A 4A1FA 5IFKA 1PL0A 4W6QA 3GDFA 4ZEWA 4MV9A 1RM4A 4UREA 3PQDA 3FPGA 2CNWA 2HUNA 1RVDA 4RIEA 2UUOA 1GCUA 3PENA 4H16A 1YFKA 1IY9A 1JFFA 1P60A 3HRKA 2C98A 2W8BB 4RJKA 4F4DA 4WADA 3OX4A 4H7IA 2A0WA 2NSYA 1Y5RA 4OLHA 1FXSA 1I30A 2BWJA 4HEQA 3ZWQA 1UBNA 2O23A 2QMOA 2ZUTA 3PVSA 3HMKA 4LSMA 1ZU5A 2D59A 3E5HA 3BD9A 3VRHA 5C7YA 5DEOA 3P9ZA 4HAZA 4CR8A 2H4YA 1YB4A 1SCUB 1XTZA 2BBOA 2D0DA 3B1KA 3OSZA 4NAVA 4QECA 3VKFA 2IH2A 1NOIA 1PJZA 1EXNA 3CMCO 3U7JA 1XQ6A 2ZR0A 3FCCA 1E5TA 2LZ0A 4D0LB 1VE5A 3BL8A 3HDTA 1DTSA 2H9AA 2CJFA 2FRXA 1PK7A 4HI0E 4NMXB 4WMLA 3WOHA 5A5GA 5L8VA 3I04M 5FNVA 3P0IA 4UBJA 2ACWA 3AWIA 1M66A 1NW3A 3L07A 4P3YA 3IA7A 3CG0A 5DBEX 1M2NA 3RLFA 4MS4B 4DHWA 4U2EA 4Q4HA 5A4KA 4U7DA 5EE0A 1G4UR 2X9GA 1U8ZA 4GP9A 3DBOB 2QBYA 2XMPA 3D2CA 3LGXA 5JG7A 4DMLA 3AEZA 4QDZA 1AKTA 4B7UA 4AAYA 4IKOA 4EB3A 1RHQA 5KC9A 4L0QA 4KE6A 1YBAA 4N0EA 2J3EA 3VR2A 1F7VA 1E1KA 1GRCA 2DWOA 2HA2A 3H1FA 3HN6A 3NDIA 1YRQA 2TMGA 4EG1A 2ZSEA 3DP7A 1K7XB 3NUQA 3QJGA 3EGCA 1SB8A 3EXAA 4HSGA 1NQUA 5EKDA 2G28A 4NYIR 4RVDA 3AUUA 4XH9B 3H4VA 2C3OA 1YT5A 3L0BA 2O2EA 2H7XA 2QLMA 1SBYA 1T6ZA 3DZHA 5KAPA 2PSEA 5FWDA 2Q3CA 3D4BA 1GHTA 3IIEA 1B6SA 4EHAA 4AD8A 4DV3B 1JHUA 3KSRA 5E95A 1H85A 2GXQA 4ZZ2A 4IQGA 3ZHSA 4BUCA 2BGRA 2HJWA 4DN6A 1M1YE 3U7QB 3LO5A 3NTRA 3VR6D 4RA9A 1E2EA 1CRPA 2X19A 1TTQB 3HA7A 1S2DA 5G2OA 4E11A 5AIBA 5K0SA 2F1KA 3BFKA 1BKYA 5C8VA 1WEHA 1LQ2A 5K6TA 1ZNYA 4NV3A 1NIPA 5DHFA 4MQEB 2Q3BA 3WL3A 1I10A 3OQMA 2CYBA 2WZBA 2ZPTX 5BUCA 4YRLA 2PUHA 2RH8A 3NYIA 2NUTB 1CLUA 3L1VA 3NHMA 3QPCA 4JB8A 1KOJA 2B3DA 1ACMA 1ACJA 3A3YA 3R5TA 5CVUA 1ZMTA 2Y0DA 1S3SA 4Z9BA 3U0BA 2Z5VA 5HIMA 4UKDA 3RPEA 2J6IA 1NRWA 3O03A 4AICA 5IM4A 4CLHA 1THGA 4YS6A 2BEKA 3N75A 2XXAB 1VE6A 2NUPA 2ZPAA 1KP9A 1XZDA 5JQGA 4GM1A 3H42B 4DGSA 1ZM4A 1BS9A 5JTTA 3Q0EA 2B21A 4V0LA 1PSWA 4R1PA 3X1WA 4DV4B 1FS6A 1JDPA 1SN7A 1XF1A 3C8DA 3AETB 1FBNA 1WUIS 2P9TA 3I4LA 2VSYA 5FI1B 3ZE6A 4AJOA 4J7UA 3TDMA 1IL0A 721PA 2GCEA 1JRLA 1T36A 3CUYA 4HWGA 1ZH6A 3B52X 4I4TF 4DNQA 2BGTA 2I29A 4U5QA 3ZGOA 3QRWA 4C0BA 3TDNA 1U0LA 1X9GA 2X2FA 3GLGB 4ZRDA 3F6BX 1ZGZA 1Y6GA 1NDUA 1KOFA 1MA0A 2AE1A 3T7TA 4W82A 4C1NA 4S05A 2QRJA 1HDXA 3PLRA 4O4JA 3AGQA 2WRZA 3RCBA 4I8IA 4YAEA 1ZNQO 2E82A 4YJGA 5B3LA 1GPKA 1KPGA 2PM8A 3KYIB 4WBSA 3WBKA 2FZLA 1M8FA 2XNJA 2PS0A 3M4NA 4Y8VA 4M0EA 2O3UA 3D4NA 1KQ3A 3NIGB 4RVUA 4P5PA 3UBTA 2HK9A 1BVUA 1N5IA 2D0IA 2Y99A 3F1KA 3K4HA 2C99A 4LHZA 4ZVTA 3TNYA 2WKWA 2Z08A 4LEIA 1C8BA 5SV2A 1SULA 3ELUA 1LDGA 2GZ3A 3NKVA 2I1VB 4DSTA 5TC4A 1MAWA 1UR5A 2YWJA 2DBYA 1VRCA 1EEHA 4BFYA 1TQ6A 4WD3A 3GNTA 5A4JA 1D6SA 3QLUC 3AK4A 3S55A 3VSEA 2H51A 3VNAA 1UXJA 3T7RA 4CW7A 1I0ZA 3SZRA 4OUKX 2EX4A 3ZVMA 2ICAA 3CKMA 4TOIA 1GCIA 4XYGA 2BZ0A 3Q3IA 3NYQA 1CRLA 2EIXA 4NP6A 4FUTA 1VJTA 2WYWA 4AJHA 4DARA 2R47A 2IV7A 4LOJA 3T1QA 1XD8A 3I62A 1V9SA 2P2LA 2QRLA 2ZRFA 3W8NA 4CKEA 2V7QD 4N12A 4Z5XA 2EF0A 1G41A 4OGLA 1ZZGA 1AS0A 4JCOA 4KXLA 1V0JA 4O6VA 4V0SA 4NCBA 3ESZA 1J8DA 3H9CA 2E6KA 3A4VA 3LUBA 1DXQA 4IJQA 4QYIA 4V38A 3A9CA 1NF8A 3TLBA 5IXYA 4G36A 4B4UA 1UKBA 1ZWLA 1V6SA 2NT3A 1MC4A 1PT5A 3UT5A 2XD9A 1ODKA 2QTRA 1F5SA 3LRTA 2OBLA 1GGEA 3B8EA 1VGQA 3WISA 4RVNA 2CLFB 3O8LA 5K20A 3GCZA 3NH9A 4P0TA 4MWSA 4R9SA 1YZ3A 1RBQA 5AJXA 2Z5GA 1E0KA 2KMLA 2XWQA 3MMZA 3NNSA 2P5UA 5K3FB 3RHTA 1QP4A 2YX1A 1PNTA 1DAOA 2ZRBA 1G8MA 5ITSA 1CDDA 4QGFA 4YUVA 3OO0A 4AF7A 5B4TA 2YHIB 3VOBA 3ZTTA 1DT5A 1MB0A 3SQOA 4RFSA 1LW6E 1I1NA 1CEYA 3L7LA 1RCTE 2R5NA 4G1VA 4I6GA 5LYJA 5A4IS 3KXPA 1EE1A 4D6XA 4EY3A 1Y3CE 2ZDGA 2X0RA 2E5WA 2PGLA 3IE2A 3A0RB 4HLUA 1O95A 3TKYA 3WIBA 4NBVA 3QSYA 5F3WB 4M1ZA 4B7ZA 1NUSA 3FBGA 3IAM6 4TYQA 2DSNA 1PFVA 1T8UA 1IN6A 1V8BA 1XQ9A 2PD6A 4QELA 4AJ1A 4CV0A 2QDXA 3CA8A 3TGPA 3HV0A 1JAZA 4WJZA 1ZUNB 1MT0A 2FW8A 4E4TA 4XD7D 1A7UA 4BFUA 4MRMA 2FW9A 3F6EX 3MN1A 3NVMB 5TMBA 4UEKA 2F3RA 2COEA 1WB9A 1F4PA 1STOA 1EKXA 1YQXA 1W75A 3LX6A 4RIIA 3GPLA 1NXVA 1AGRA 1TLLA 2EL7A 4EHHA 2BISA 4II7A 1Q19A 2QOEA 4GICA 3F9RA 5I6DA 3ET4A 1MDFA 4JT2A 2FR8A 2ZUBA 3V4VB 2OC9A 1XJQA 4K7JA 1WUTA 5CX4A 5ICEA 3FCYA 4MAAA 3KEFA 2WUVA 1IZYA 1Y5MA 4DCPA 3ISJA 1PJ2A 3OU7A 1KQFA 4NEGA 3GJRA 1U8FO 3L1JA 3OUUA 4RL6A 4HATA 1OA0A 1NHWA 3GBVA 3NTQA 3HL4A 1NW6A 1G38A 5B7QA 1B8PA 1OX4A 2WI8A 3T41A 2O7VA 2AOVA 3AGPA 3E48A 3KVVA 4JXJA 4QRIA 3UXHA 1H93A 3VSDA 2CJWB 4ZYLA 1OU4A 1B8UA 2H57A 1P44A 3A2MA 4J7CA 1O97C 4LQCA 5C7OO 2RHWA 1L5MA 3B6JA 1RWNA 4X91A 3HSKA 2XGJA 3I83A 2GCGA 4MUFA 2IHNA 2EHDA 3CUTA 2H07A 1JNYA 1NN0A 2JLAA 2NTNA 3USES 1CF9A 3TQQA 4RFVA 1CQZA 1C9YA 1OBHA 2CDRA 1KHTA 1OW3B 5T64A 4ZI7F 2PJDA 1UMDA 2V9CA 1GLVA 1NQAO 2IXTA 4ZT7A 1B1AA 1EK6A 1PRYA 3KQTA 4MMXB 1Y6ZA 1ISSA 2II6A 3ELWA 3HC7A 1DE0A 3OVMA 1Z28A 4BO6A 1XMJA 4H4CA 4Y9UA 4B6SA 5LP6F 3T5PA 1PD1A 2V7UA 2C58A 3TPFA 2E48A 2GN0A 5CNMA 5JSHA 1C0LA 2XCRB 2CYCA 2CL0X 3OLQA 4AKSA 4N0DA 4P0PB 4NOJA 3AL3A 4NZNA 1JHVA 3FWYA 3RVOA 3SVZA 2J46A 1SZPA 5KWVA 1CJCA 1SVIA 2C9OA 1U3GA 5HILA 2DUNA 2IXAA 1L7XA 5IT5A 2OAP1 3RWBA 3PTAA 1ORVA 3UMVA 1QUEA 3EPLA 2V6IA 4EUSA 1N6RA 5F5XA 4JI5B 3QKWA 2PGNA 1EZ4A 2FVXA 2L17A 2X22A 3LQ1A 1C2YA 3C1UA 4MQFB 1JEYA 2XQJA 4H6WA 2I4RA 2Q50A 3QV1A 3P32A 1M9NA 1R0ZA 2O8EA 3RG2A 1HK7A 3E84A 3UHFA 2Z4RA 4G4SO 3COSA 4FEEA 3DCNA 1M6VA 3JARA 5BT9A 2FGJA 2D00A 4UBIA 1KEUA 2Y27A 4RPHA 4MOWA 3AQ4A 3F5QA 5I7AA 2F17A 2Z2IA 3GT7A 4EG5A 3CKYA 1R9MA 4XR9A 4WLOA 4FS8A 4JSYA 3LRXA 3GRFA 4TLBA 5FUBA 1EB9A 3WK5A 4Z54A 4HGYA 4PR3A 4ZU1X 1LEHA 3A6FA 2PZFA 3C7KA 4UM5A 5G3YA 1E0JA 4KGVA 4CLDA 3K53A 1SCJA 4FDLA 5IDVA 2XMGA 1J97A 3CZRA 1M6NA 4A2PA 5ITZA 3Q5GA 2YDYA 3ACBA 3ML1A 2XEXA 4JDUA 3AEYA 8MHTA 4GZ3A 4BQOA 4KQ1A 1NU6A 4L3OA 2YVUA 1JLLB 5EHQA 3IEIA 2ASEA 4WIAA 4WSOA 2A1IA 1ZY2A 1M34E 2PUFA 1TJ3A 1XU9A 2P9HA 5MN4A 4PXAA 2B7CA 1KRHA 1Q17A 3D0KA 1A4RA 4DA4A 3ZUGA 2QRUA 3VVMA 2Q3FA 1APBA 3VDNB 2BFFA 1JT9A 4UVGA 3DTVA 3TLJA 1I01A 1AH2A 1A5AB 5B7NA 4Y2JA 3TL3A 4J1SA 3EYAA 4WOJA 4EA7A 3I30X 5TMEA 2HNAA 2GFQA 3FZQA 3Q5EA 1HQCA 4G5OA 2BFAA 3PFGA 5A7GA 4HGPA 2CLCX 3AEQB 3OZAA 4FFDA 1ZA1A 4BDTA 3S81A 3I01M 5IN4A 2ZSDA 3Q72A 1NVMB 4FOTA 2ASVA 3ANTA 3SN6A 1YIOA 1QRSA 3F73A 3W2EA 1DC8A 4LE1A 5CFRA 1B0PA 3JAMA 3JWEA 2J45A 2ECKA 3HCEA 4FSDA 3RABA 1IATA 5K1ZA 3ZVRA 2RJ3A 1OTHA 2KHZA 2FN3A 3KQOA 4QNMA 5FNVF 3LXMA 2BDUA 2OILA 2IPOA 3RNOA 4BNYA 3GB9A 3DSRA 1K3FA 1USVA 5CIWA 1A2BA 1KNXA 3RSZA 3EGXB 4Z3DA 3VPFA 4OJKA 5KNDH 4PO8A 3RC2A 1JIJA 1PZGA 1Y4AE 2XE6A 1XZNA 2EFGA 5ALEA 3K0BA 4EYEA 4AK9A 4ESHA 4TKZA 4KI0A 3JQ7A 3H3FA 1OVMA 2PLFA 3PR3A 3WLAA 4DOMA 3H3XA 2FG7C 1M0WA 5EUMA 3RB8A 2ZUCA 5FA5A 3QF4B 1P2SA 3VI4B 5E4FA 4KIJA 4WZBA 4EF4A 4IGEA 5BN5B 4C78A 1BDBA 5GZ6A 1NNSA 1GG2A 4MA4A 1K98A 5G4KA 4RTLA 2PBRA 4JODA 1W0CA 4RO0A 4YK7A 4HDMB 5L4LA 2PZEA 1H9AA 3SQXA 1R18A 1U1EA 3O47A 3Q7QA 3EARA 421PA 4A16A 4ZO7A 2IC5A 3MB5A 1TZ2A 2O6HA 1ZOSA 3RU2A 3WZ2A 4OP2A 4CDNA 1P9NA 1FTWA 1YZUA 4LTMA 2X1MA 4U2FA 4QHSA 5KVCA 3LD9A 5HQ3A 1DJMA 3LWNA 2ZAMA 1DU4A 2OMKA 2A94A 2FFRA 3SF8A 3RO7A 1NVGA 5EIOA 4AZVA 3I6QA 4MX8A 4P54A 4R3NA 3CF0A 1A95A 1US8B 3I3SR 2OPHA 3TX2A 1IVSA 3V4LA 3D6JA 3PA6A 4RJ2A 3E9CA 1N33B 5TMDA 1RYHA 2Q7OE 4JI8B 1QNLA 4XPZA 5FV7A 1S3GA 3RTDA 3ICQB 3VZCA 3OTOB 5EP1A 4MR8B 4ASUD 1TL7C 4DM7A 3MBIA 5BW6B 2NZ2A 2J3HA 2FETA 2QMQA 1ODIA 2FUEA 3DMYA 3G8AA 3IQIX 4FGZA 2GBLA 1X7DA 5CNIA 2RONA 5HKKA 3IA2A 3MILA 1UT5A 5CVJA 4UMDA 3VQTA 2OO5A 2OCBA 2F8TA 1M2WA 2ZCUA 1NNI1 1SVKA 1LGYA 1VBFA 2H29A 2OHXA 2ZI7A 2ZETA 3OFVA 3Q7RA 1EFLA 3FWPA 4HNRA 4DB2A 1F9AA 3HVUA 4XVHA 2JIPA 4TWBA 5DN6A 1IVYA 5IM4F 3OIUA 3OEHD 4PIPA 4PSDA 4EOGA 3AHHA 4DIKA 3QX8A 4FINA 2A1UA 3G6KA 5C31A 1TM7E 2CLOB 5TGZA 1ZN8A 5JQGF 5MF6A 2I4OA 1QPZA 5ALZA 3BXXA 1DTWA 3HSYA 3IP5A 3BZUA 3PC2A 3R44A 3QX7A 4P81A 2YWHA 2R7AA 2OTCA 3ULKA 3W3AD 4DXDA 3IULA 1XFDA 2Y0CA 3RFFA 1LK7A 3IGFA 1VL0A 5EJEA 4MR9B 1NVAA 3JQ6A 1GWNA 4J0CA 3UGTA 3TIGA 2G7MC 3AO0B 1JIIA 3P9KA 3ZHXA 4AF8A 4KXYA 5I4KA 4BXOA 1O08A 4B6RA 3CH5A 2NO1A 4J49A 3V9PA 1Y4DE 1HXHA 1KPHA 2Z1DA 4IX1A 4QUKA 5H3LA 1EUDB 2YRWA 3EXIB 1N78A 2G83A 2QL7A 2XZDA 1D03A 1MGPA 4O4JF 3AOEC 2FVYA 4RQAA 1JQBA 3D7MA 3PRKE 1G6OA 2R4TA 4IDDA 1QYIA 2TECE 4PONA 3I0MA 2JJ1A 4B35A 1ZIXA 2TS1A 4G4JA 3IS3A 1XRJA 3N7TA 3PP8A 3C8MA 3RV3A 4P92A 3N7AA 1PL8A 2BJWA 1SY7A 4W5QA 5A03A 1V1RB 4LSWA 2DM6A 1XNQB 3E9YA 4AIRA 3W4IA 1HR0B 1N8KA 3AP1A 3R0IA 1OFVA 3JXEA 1T9GS 1XJ5A 4XFJA 5IG2A 1JPVA 2EZ4A 4HXGA 3WB9A 2EYUA 2PNFA 4LDAA 2ODAA 4NECA 1N6OA 2CB9A 4U6SA 5E1BA 4J43A 3ROEA 4K0KB 5EI5A 5FNZA 1LBTA 5JAZA 5ALWA 1S2GA 4MP6A 2FP4A 1AZTA 1Q0UA 2GA8A 1SBHA 4JLBA 3RYIA 2X1HA 5AVTA 1NZDA 4EKNB 4X00A 2A56A 3ZDCA 1XJWA 2JAHA 1FU7A 1IY1A 1B8NA 3AR2A 3VKHA 2HRRA 4GQIA 4D9CA 2NTYC 5LZ4A 3N3BC 4CQMB 5A71A 2ZJ6A 4KXWA 4G6ZA 4OH7A 2PMEA 2N1BA 3F90A 4C06A 3W9YA 3CB4A 4H4DA 3L6DA 4CVNA 1OYYA 4Q3LA 2Y6VA 2GEUA 1Q0TA 2QLTA 4URZR 2JFBA 1RRCA 4WZZA 3LX8A 3IELA 2QJTA 4HDSB 5JJIA 1ZJYA 2VDJA 3AFIA 3E4DA 3OCXA 1H1LA 3ETEA 1KJWA 3GVHA 2Q2VA 4RF2A 4X71A 5BQPA 4BP8A 4ZI3A 4OPMA 1XTBA 2QZJA 2WIFA 4FUQA 3DLAA 4IXNA 1G5HA 2ODTX 2O2SA 1GGJA 2BM9A 2HDHA 5INTA 2IUYA 3B6KA 2HIGA 1SKYB 5E1OA 1U0FA 1H05A 3DMHA 5HVNA 4FR0A 1NSYA 4K40A 4Z9XA 3L2OB 1IEWA 1G291 2Z2JA 3LP6A 1WJGA 2I9PA 2ZTMA 3DZBA 1GLNA 4J6EA 5F2KA 3SPXA 3T3HA 4C4AA 1GCGA 2JK1A 3I09A 4O5OA 4P3KA 4CEJA 1RI5A 1P19A 5HJ5A 4NYJR 1ZIPA 1IY8A 1U2DA 1GA6A 1NDHA 2E18A 3QE3A 4J16C 4LOAA 3RFXA 5B6IA 1Z7WA 3FSRA 4QJ3A 5LYJF 2C3MA 1HE1C 1WQ1R 4CM6A 1T5HX 1LBEA 1WKCA 2NOAA 5EC8A 4OIMA 2FLVA 1QYRA 2ZB4A 3V2HA 1P91A 4BNFA 4DJDC 2AN9A 4BVFA 4G0MA 3PI7A 1JQKA 1Z6YA 2R25B 1P5ZB 5AVZA 4ZVVA 2D1QA 1HMPA 4OV6B 4L8LA 2PH7A 4LTDA 1K6XA 1XPOA 3W2IA 4AECA 1ZMRA 3WL7A 2A59A 2OGFA 4DLNA 3DF9A 2CXUA 2HIMA 4LZWA 3EPHA 3LDAA 1QGOA 3GNQA 1AGYA 4ZQHA 4CQLA 2UXBB 3VR0A 1VHQA 5KC8A 1A8IA 2GKSA 2EJVA 4GXRA 2Z9CA 4JC0A 2ZIGA 4TMFA 1WXEA 4PC3A 3BB1A 3T5DA 4DJEC 2F9FA 3IP8A 2X1VA 1YIDA 1P3DA 2G82A 4A6EA 2V8BA 2GVDC 1OILA 1V95A 2DFLA 1GT6A 1F3OA 2JHGA 2OBBA 2B82A 2FFQA 2Y1OA 4R2JA 5EY5B 4B8YA 2VT6A 3FRIA 5KOJB 1M6YA 3DBVO 1Z4IA 2OCIA 4RY9A 1G4AE 1A3CA 4KV9A 4OHPA 1TF5A 1BCRA 4KEAA 4YJ2B 4ROTA 5I4IA 2C7PA 4B82A 1L7DA 3PQ8A 2I87A 4NFSA 5CT4A 2FWBA 1KJ9A 3EBPA 5HTKA 5ILQA 1TQDA 5EERA 2C31A 3ELYA 3KRTA 2V58A 1E9VA 3NAZA 1KU6A 1YC5A 2XTJA 4YQZA 1G3IA 3QBEA 5GOTA 2IUUA 4A2WA 1Y8RB 2YCBA 4IX9A 3E1SA 4LMPA 1K4MA 4FI3C 1TUBB 1HO3A 2XOKA 4IIJA 4LZAA 1LV8A 4UM7A 4L0CA 2OGWA 1L6RA 4HS9A 3KOMA 2W2LA 3G1UA 4MA0A 4Q9IA 5KYVA 2PZLA 5KYUB 1D9ZA 5HPYB 1TKRA 3G0BA 1U7XA 5K8JB 3JYNA 5KYKA 1THMA 2RKOA 4HQRA 3EFEA 3EXHB 1C7ZA 3HP4A 4AB1A 2UYHA 5JD3A 2GZ2A 3LQKA 1LBSA 2PTGA 1SPXA 1UKCA 3UH1A 4DCCA 2PXHA 4XVUA 3PXCX 3UGQA 2J0EA 4BRSA 3QHQA 4UDYX 4C20A 1SBCA 1SC1A 2JFGA 1XEXA 2QZSA 3DHEA 2YXDA 4KQIA 4YRFA 5KHLB 3N8NA 2O2XA 2XSZD 5MGBA 2V1UA 1YZVA 1T8PA 3P9XA 1IUKA 4GR9A 2B4TO 4GU5A 4HUJA 4N5NA 1EFRD 2C97A 2NYVA 1T0BA 1VG9B 3COZA 2WE7A 3U4DA 3ZS9A 4BNKA 3CLHA 1PSZA 4ZANA 2ID4A 1B2LA 1AQNA 1BMDA 3JALA 3M1LA 1AN9A 1DEHA 4JBIA 2OM6A 2VP0A 5CD1A 2QWXA 4IR7A 2WSLA 4OYHA 4E5UA 4YRZA 1XRQA 1N7HA 2IUTA 1KI8A 3LBNA 1DDOA 2NAPA 3LY7A 3ZTWA 1I9GA 5FA8A 3F9CA 1IM5A 2LDBA 4L4RA 4RJIA 4AJ4A 3AI3A 1BE6A 1HDCA 1JXOA 1NJSA 1NUPA 2A5DA 2DH5A 2VXBA 4WQMA 3R5HA 2PLNA 3OLVA 4BMXA 3BJMA 1HE4A 3C3WA 3L01A 1D1PA 4O3MA 2PRZA 4I1YA 1IRXA 2XT9A 1BHO1 3U9LA 3IAFA 1XMSA 4WBNA 3GJSA 5H5JA 4IIGA 5JSUA 3E9EA 3VJRA 1KL7A 3A58B 2QUIA 4J3FA 1RFGE 3PI6A 4YP7A 1XK7A 3I0NA 4NH0A 5BOVA 3V1UA 1QC5A 4B44A 3DMGA 2VDUE 3ETGA 2AG6A 4IV0A 3ZHRA 3HA3A 4PY2A 5MDHA 5DB4A 4Q3AA 3F47A 3OHSX 5H0IA 4LFCB 2I2CA 3G9UA 5AJWA 1ISPA 4A0QA 2XQKA 1SU8A 4I5GA 5HRAA 1JA1A 4OQ4A 2YWRA 2X8WA 3SJUA 1YRAA 2BBTA 3THWB 4C30A 2WWHA 3R3SA 5ICGA 4QFCA 2HMSA 2EJWA 4WT7A 1S3IA 1Y98A 2PT9A 4OXYA 1U3UA 1RABA 1D09A 1G7CA 1IPEA 1PQPA 3BRSA 1WUKS 5H16A 1J9EA 3A32A 1Z4OA 4R2HA 4LXQA 4RY0A 1MO3A 3P27A 3W7BA 1UIRA 3EXHC 5HFNA 2O0LA 3ITKA 4YCBA 4TSFD 5HF5A 3QPAA 1PU2A 1VG0B 1OZGA 1KEWA 5HJ2A 1JMKC 3N2GB 4FZ5A 1BXRA 3OJXA 2COUA 3GPIA 4XE5A 1N5LA 1P7CA 1H9BA 1VJRA 2W6ZA 4O1HA 4KITB 1U1DA 5JS8A 3HR4A 1C1DA 2XTZA 1YUMA 2PBFA 2WYUA 3LT0A 4P98A 4P7GA 4QBTA 521PA 3O8NA 1F4LA 4G26A 4I50B 5H59A 1A2QA 2HHJA 2REXB 2Y6UA 4DBZA 1OGIA 2C4VA 4V2UA 2ZE6A 5ALYA 1X1DA 3VV3A 4YMGA 3CI0K 1QGYA 5AVQA 3DMFA 4MAMA 3CLTD 4YJ3F 3PCXA 4B4KA 3L7YA 3TW4A 4X3PA 2FN8A 3PE6A 3KYCA 2I34A 3DOEA 1R66A 4GI3A 1R5OA 3DOOA 4MRNA 1S8OA 5F64A 1OAOA 3JR3A 4F6LA 1XN1A 3GEHA 5ADWA 1NVBA 4QFMA 2ZIFA 2VOEA 4GMFA 4GLLA 1Z5ZA 3LCVB 2EERA 3PWSA 1G9SA 3SBOA 2B8TA 4L75A 1WF3A 1MVOA 1JHYA 2CD9A 3PJRA 3C74A 3AEXA 2BTQB 5ULLA 3QVJA 4YRNA 4Q1AA 4DGQA 5KREA 2J30A 3GCDA 2K87A 5F7JA 2A86A 4KPEC 1KO4A 2LIPA 4Q4AB 4BJ1A 1NVVQ 4AJIA 1FYVA 1I7LA 5ESWA 5CB6A 4A73A 3KV3O 4Z6KA 4JH0A 2GXUA 3AM3A 1KERA 4R8MA 3QJYA 4F60A 5KYNA 4M8LA 2ANCA 2HWWA 2VPTA 3DP9A 3GYBA 2KLHA 3KKEA 2XYGA 4NBUA 5A0TA 1HX7A 1F51E 1M34B 2DPXA 4ER7A 1BEUB 1F48A 2Q2OA 4KQCA 4EENA 1QHHB 1FTQA 2IL1A 2Z3WA 1ZONA 5FTJA 3GV0A 5D3ZA 1DDIA 4RANA 5K8VA 4QX6A 2CXXA 2ZT8A 4ZCMA 2SCUB 2XH8A 3OMWA 3PHIA 4V3CA 3WI7A 3EIOA 2OCAA 4JLUA 3UA4A 2HSEA 1DMSA 3JYLA 3VR3A 3CH4B 3RG8A 5A4FS 2PL9A 1J2EA 4UU8A 1J33A 1Q0LA 1EK0A 2P9BA 1KEPA 5HM6A 5AM0A 1R0RE 1YI8A 3W0LB 1A9SA 3N2ZB 3FUCA 5JAOA 1E2GA 4S0XA 1RPZA 1IHDA 1Y7PA 4PNHA 3GVIA 5D85A 5FFFA 4BFWA 3NHJA 4KQMA 1DBQA 2DE0X 2J7KA 4GMGA 4YMWA 5ICFA 5LCXA 3RK1A 4AJJA 1YASA 5HDQA 5JJBA 3S0JA 1WMFA 1EVZA 1L5QA 4Z9AA 3SAJA 1NN3A 4G2NA 3I3OA 4MGKR 5CDHA 1GPH1 3I5YA 1P1HA 4G5HA 1UMCB 2QE7A 5JEDA 1X1AA 1ZITA 5BW0B 1ULBA 2AC4A 3AZPA 4FFBA 4P34A 4X7RA 5C8XA 3G7UA 5CXQA 3TFQA 3S27A 5DYGA 2XUOA 4NRDA 2JH9A 4L76A 5B3JA 5B12A 4AG3A 1HT2E 2YHAA 2WJWA 4DA8A 4FKMA 3UNXA 4MH0R 3IHLA 4ESVA 1XWIA 2F00A 4IXDA 4NTZA 3IYLW 3LT1A 4TS4A 4HDRB 5M29A 1V26A 5EGSA 4YR7A 1SGWA 1B6TA 1RKUA 3JYHA 5IJ9B 3D7LA 4I5IA 4NESA 3QP9A 3C8HA 5J4LA 3ZW8A 4G8CA 4Y1EA 5DYNA 4C4OA 3QBJA 5E1DA 1I7NA 5KWEA 5AHRA 5K0BA 5K4GA 2H5LA 3PTLA 3FPCA 1YHYA 2PZJA 2H16A 3SOZA 3HCBA 3DULA 4K0RA 3I45A 2HMYB 1ZUD1 3GFQA 3UG7A 3W5HA 3BA1A 3DZCA 1CNEA 3T15A 4JI7B 3G0GA 3OEED 1V8ZA 4UNNA 1BVRA 1V7CA 1ZGCA 3PRJA 4XLZA 4ZPXA 4A92A 3D3NA 1SQ6A 5DX8A 1QQ7A 2AHOA 4EJ2A 3BMXA 4X62B 1TK9A 4NCXA 4M7RA 5KTOA 2VQFB 1NA5A 1WQ4A 4G5FA 2IPLA 4OVKA 2HDOA 5GIPE 3HXTA 4WI1A 5EIHA 4YALA 5IF3A 1Z6GA 3ABQB 3BTSA 4B3SB 2FSPA 5AKHA 1KPIA 3GDOA 3ZXSA 2PUEA 3O0TA 1AQYA 1PJLA 1SKQA 1TD1A 1E1QD 1XL1A 2A2ZA 1Z8FA 2JVKA 2Q1WA 2ZIVB 3Q7IA 2X8JA 2QN8A 5C46F 5E3IA 3V6LA 2PYDA 2X0KA 4C22A 5ALDA 3B1YA 3EMOA 2AOWA 3M5DA 1RAFA 2YUIA 4CV2A 3L6BA 1L7EA 1JW9B 3RNLA 2R7MA 4L08A 4XEHA 5CPFA 1XNRB 3FSGD 1DBSA 1NBMA 3NHAA 3UFXA 5K3BA 4L22A 1MZVA 2BLLA 2PUTA 4MKFA 3EZFA 2VSQA 4RK1A 1QE3A 5GINE 3W5IA 1NKSA 2ZYWX 3EWIA 4FBLA 4XB6B 4D8TA 2N75A 3D8BA 3BH0A 1XZEA 2VUIB 5JCXA 3KKMA 3ZDZB 5JTUA 1ZOIA 1OZFA 4UDNA 3RBZA 1CY8A 1CVRA 4AJ9A 1TFRA 4QBGB 4Q9NA 2ZJZA 3PNSA 5JDCA 4IEIA 4A36A 1V5GA 1QG2A 4J75A 4LXGA 2Q4TA 3N6VA 5CLGA 3HMQA 4Z0NA 2C2KA 1DKOA 3KE9A 2X3FA 2I6XA 2RG7A 2QIOA 1UK9A 2IECA 2H2HA 2MSCB 2FGKA 2XNDA 2ZAIA 3BE8A 1NXSA 3I28A 2VZ9A 4LRSB 4OQDA 3W8DA 1U0OC 2WDPA 1N7JA 2PMWB 5CFOA 3RH0A 1FTGA 3TLKA 1U9JA 1GM5A 4CKYA 5CA0B 4ZQGA 4WX2B 5F52A 3ZDBA 1AN0A 1L4FA 1AURA 1XZLA 2EHJA 1LUAA 3MT8A 4PVDA 4TKVB 4WAUA 5EJ2A 7REQB 1Q11A 3NEJA 4EEKA 1ILWA 1NW8A 1Q7BA 3OCYA 1D0VA 3GRPA 3IQXA 1MJ5A 4K46A 4L8FA 1CQXA 4WLFA 3QU5A 3GEMA 4BNJA 3GLFA 4RD6A 1XA0A 1YI1A 3EEYA 4ZTUB 4WXHA 4JKIA 3FWHA 3IKJA 4UUNA 3CLKA 1M54A 2X2PA 4UE2A 4YMSA 4BPRA 1WPXA 4RAQA 4WNYA 4ANFA 2DJIA 3I1YA 2ZR9A 1UZNA 3EUEA 1ADGA 7MHTA 3Q0IA 4R7GA 4C6TB 4ARZB 4FT4A 4ZYWA 1DAHA 3RVNA 1BFUA 3ANYB 3UXMA 2W93A 2YOFA 3V1TC 3AIIA 4AKEA 4B6PA 1UEXC 3U3XA 2VJBA 1ZJ4A 4CF4A 1N5DA 1JGTA 3L5OA 2GK6A 4ME6A 4R1UA 3OJEA 4HYQA 1T1EA 5ALHA 5IJZA 4QG3A 3K1TA 3SX0A 1CUAA 3GAMA 1W5SA 2DQSA 5LJIA 2F8SA 4QWMA 4Z0HO 4JB2A 1F2TA 3F7MA 2Z6UA 1ICEA 3A28A 4BNLA 1Q1EA 1WB5A 5JAIA 3H5RA 4EFDA 4XIGS 1K6IA 3EMDA 1EJ6A 1YAJA 3GH3A 3TTVA 2V98A 3VR6H 1KI1A 4PICA 2NZYA 1EXWA 1H2FA 4RHUA 3FTEA 4RHYA 3D3WA 3G1WA 4HWOA 4DDMA 1QGED 2JFYA 2JATA 4NCJA 3STTA 1UL1X 3H9BA 1QH8A 1U0NA 1GA4A 1OHHD 2WYIA 3O0DA 4XGIA 1G6KA 5JS2A 3B51X 3ZHQA 1SQFA 4U39A 3D6MA 3I1FA 4BBJA 4PBSA 4DJ5X 4CQJA 1F0YA 1JJFA 4R2KA 5AW2A 2W6JA 3PUXA 4UZSA 3WMWA 4DV1B 4DYVA 1EVKA 4DKXA 1Z16A 2QVCA 4U2KA 2J85A 5EVJA 2OZPA 5D6NA 4B3IA 2VKQA 1MRNA 5KDDA 4CG1A 4OHCA 4PCUA 2C4HA 4FZ3A 1XZJA 1FYWA 3L43A 3WLTA 5JC8A 1RLTA 1UH5A 4MW7A 1K89A 1Y8QB 3NM4A 4I4TB 4X95A 5JEEA 2HN9A 3DE1X 4RF5A 2G71A 1SKBA 4RNDB 1NOKA 1ZDMA 4R8KA 1D2GA 1HKUA 1PW7A 4BV9A 2HT6A 4IIJF 3TSZA 4C0XA 3TRFA 1W2HA 3AHIA 4ZO8A 5DMHA 2RARA 3E70C 3KZ1E 4HNUA 1QO0A 2VJKA 4MEAA 1JLSA 3T4XA 4P3OA 5KPDA 3O95A 2IYOA 2F43B 4D8UA 2F1RA 2BGJA 3SFZA 2I6FA 2P1DA 2VSFA 1RTKA 2CGEA 3KB1A 1O0BA 5JS1A 2WABA 5E6UB 2C1ZA 3ZWMA 3A4MA 4XX0A 3O2NA 3AW9A 4FTWA 4DY6A 3OAAD 5DLEA 4JLNA 2VJLA 1RCFA 1Q21A 2P9ZA 4QNNA 3V4SA 5FP0A 1JHRA 4M1YA 4X20A 1FU8A 3HBNA 4C14A 2QAGB 4HFJA 3VR2D 3BJEA 3P9PA 4Y9SA 1XJ0A 4PSAA 2DKOA 3ZI7A 4HFNA 5H3HA 4RH1A 2G9VA 4CIVA 4EQ6B 3BRWA 3KJHA 3CNOA 3MRSA 1VB3A 4RHEA 3DFMA 3AT1A 3PXUA 4A5OA 1FFBA 5JNRA 3HYSA 2G16A 3C14C 4ZYZA 4R31A 4B5LA 2O1XA 5KKCA 3GLIB 2RGDA 5J9FA 1YR7A 5LU8A 4LJ9A 1ODLA 4IL5A 4WZAA 4P7JA 1U0JA 3WXBA 4WY8A 1VL6A 1UJCA 1V2GA 2WMOB 1TO6A 3GLKA 5LBUA 3SC4A 4HGOA 5CFQA 2YV2A 4PFSA 2GH1A 5DI9A 3VNRA 4B32A 1FSGA 1V7QA 2ZXEA 4G65A 4R0NA 4M3NA 4C08A 1VOTA 3H2HA 3KJQA 4DLVA 3TG2A 1P3Y1 1X7ZA 4D3XA 5DX0A 3OOWA 5HG0A 4NOMA 4TROA 2OHJA 2H4XA 1ZH2A 1QCYA 4Y7DA 2OYCA 5ENZA 6CHYA 1ES9A 2I4MA 4K6HA 5F1OA 1G20A 1YMQA 5BYJA 5A06A 2G3YA 3G2OA 3DAGA 5BURA 1WU7A 1WZEA 1VI5A 1VL1A 3EFOA 1Y48E 2ZUUA 1CY2A 2JLBA 3DTTA 3V4ZA 4O4IB 3L77A 4C7MA 5ES3A 2PKQO 3THYA 1P1JA 2CXHA 3VOAA 3LM8A 1C41A 1I5OA 1NNEA 1Z4MA 4R9RA 4MVJF 4QUGA 5DF1A 3O2QB 1JDJA 1EQUA 3GX1A 2Z8XA 1CLEA 4REQB 3RYHA 1NVEA 1DIAA 1EU1A 1MG5A 1YZHA 1GP2A 1RRMA 2D4HA 3GJQA 1ZR2A 1J0XO 3C43A 2JL1A 1Y4ZA 2I71A 2FXIA 4WHMA 2HFKA 4MICA 4EW1A 1CQJA 1E9DA 3CLTC 4J1TA 3QYAA 3SQWA 2JZOA 3LOUA 1GUFA 3K70D 1CY7A 2VHTA 1ZM3A 2A58A 4E5NA 4PN7A 1DKUA 1K5HA 3O92A 3EQ6A 1HFKA 2V6GA 2VN8A 4H0FA 3TXAA 5DVZA 4BUJA 2CVQA 3U4QB 2QAGC 1N6LA 4HJRA 5AW5A 4DA0A 3U4GA 1KMNA 1QE5A 3O90A 5EOVA 2ZSFA 4DS3A 2HSDA 3H2GA 5M2QA 3DONA 3KAJA 1QBKC 3CCCA 2VYQA 1TZMA 2WM8A 4FHDA 1PHRA 1D04A 1O9BA 2Y66A 3ZV7A 5B64A 3K4PA 2QD1A 1V8OA 2QZZA 1J42A 4BFTA 2HNBA 4JOCA 5AK5A 5I01A 5T4BA 1V16B 3CF2A 3DKPA 4D43A 1KBOA 4GOLD 5EHNA 3AB3A 1NPYA 3URKA 5CPBA 4JYZA 4J1NA 1P2BA 1T13A 5A04A 5IFLA 1G7TA 5G4LA 2B5WA 1JLKA 5DHRA 3I04A 5E8RA 4AQDA 5IYZA 2QLLA 4Q9LA 2GBPA 1IBKB 4XJTA 2O8FB 1QF9A 3LKDA 1NRIA 2FCAA 3CNNA 4ODIA 2GD1O 5BN3B 3K30A 2OXRA 2IEBA 4MV7A 4ND5A 1SBZA 1DQRA 1EWVA 3JATB 1YGPA 2BKUA 4XWOA 3PC8C 2CXOA 2H17A 1GTZA 2IP4A 2QNIA 3A9SA 1ISGA 2ACVA 3PKZA 4MWEA 1J23A 3JSXA 1QGZA 4TV8A 4ZI7B 1EJ0A 3HWRA 3GFPA 3AILA 3HJGA 3AF1A 3EC7A 1AF4A 3RF6A 3HFSA 3P97A 4GMKA 5JNVA 3LUGA 1GV0A 5AWFC 1JG6A 1UT6A 1D0SA 2QUHA 4HXFB 3RI3A 3CIFA 4DR5B 1FMFA 1ZSNA 3K0CA 3FPEA 1WMEA 4YBRA 3V2IA 5BNWA 1D1SA 2GPJA 3EB9A 4M49A 3MRTA 4BFXA 4UFNA 2V1XA 3DWFA 4MGIR 3F67A 2P91A 5EQTA 3VO2A 1UC4B 2PV7A 4JNKA 3V3KA 3DAFA 4UU7A 1R74A 1KARA 3I9JA 3VTZA 2B25A 3GIDA 3GCGA 1HDOA 3IQWA 3E9DA 4BQSA 4O25A 1BHQ1 1KMMA 1R0BA 3UV7A 1QKIA 1F0PA 1N1EA 2J67A 3FSJX 1A4XA 3N2KA 5FQOA 2VQ6A 1PFGA 4AMBA 5TT1A 4EG6A 4IGIA 2Q0HA 4DZTA 2WWIA 1CS4C 2UVQA 2QN9A 1O95D 1UJBA 4MNTA 1W4RA 2UZ3A 1Y8CA 3NP7A 3WYAA 4BO7A 1BQ3A 1TM2A 1IZZA 3QTTA 2XKKA 3K9HA 3PNKA 2C2YA 3EIEA 1YVRA 3MGAA 3JQDA 4QUHA 5T57A 4MUHA 4HH4A 1JAXA 1OSNA 5I4BA 3AF5A 1P1FA 1YU6A 4QLAA 5IT9A 3BEOA 2OKGA 4QUAA 3ELBA 1TKBA 1WP9A 3A25A 1YRWA 3NAQA 2QVBA 2PY6A 1ZCBA 4LZLA 4PPNA 4UVIA 3OFNA 4KL8S 3FLAA 2IQIA 4RZIA 1N5MA 1Q1ZA 1YUBA 2GTPA 5HDBB 4DB4A 1O5OA 3I9NA 2DWUA 4O2RA 2VDMB 2RH5A 4MWGA 3W77A 3WYFA 4IVNA 5FYQA 3LCMA 2G3DA 3SI7A 3DFFA 1GN9A 1NN1A 2XBUA 3LOQA 3DVSX 5EL0A 2BPOA 5GY7A 2AR7A 3I52A 3L8DA 4PZCA 2O5EA 1KA9H 1FYDA 3LH5A 1BGXT 2CV1A 3LVBA 3MVEA 3RADC 2GT1A 3FVQA 3LYLA 4CF7A 4DVJA 4CTMA 3JZIA 4RACA 1NUUA 3UZUA 1TIPA 5IVDA 3L40A 2FJ0A 2FZ5A 2B8EA 5IF9A 1V5WA 1U2QA 5ECDA 2PL1A 1PP4A 4ND3A 3OT1A 3JWJA 3CVJA 4B2PA 1JFFB 3CGWA 2R2AA 3CNBA 1M76A 3E9RA 4XQGA 1AA9A 4Q66C 2PKYX 3KOOA 1A69A 1HYQA 4RM3A 1CY0A 1YONA 4DTCA 5FBHA 3QUCA 4UNIA 3IP9A 2GN9A 3ZVKA 3ANMA 1MC1A 3PE3A 4G1FA 3G7SA 2YMPA 4OQFA 5DWQA 4YEDA 3FI9A 3UB4A 4MS1A 4L4XA 2ZSJA 2R1ZA 1M6HA 2IYNA 3IAXA 1JG1A 5CLLA 1UOOA 3TAXA 3KQUA 1GSIA 4BEVA 1C4KA 5EZ5A 1KVRA 2R6FA 3K1AA 4L9AA 5FI0B 1XDBA 3B3FA 3E8MA 3SYKA 4QTUB 2JLUA 3JVVA 4NE2A 4BLWA 3OPQA 3VR4H 4K2HA 2WKRA 3MSXA 3OHPA 1BYIA 1PN3A 3T3GA 3E2MA 2QPTA 1QYWA 1SVUA 4ZQEA 5FNVB 1CHDA 4MW6A 4IRMA 4LMBA 4W99A 1BCSB 1YGYA 3DGFC 3Q7SA 4Q4HB 2XTMA 3VTFA 3OT5A 1DO0A 4HNHA 1E3DA 2QBYB 1R3UA 5TQ0A 3TBFA 3TEMA 2IOYA 4FYWA 1D0IA 5BSRA 5BN4A 1JFLA 2RI1A 4AS1A 2GK7A 3FM9A 4RD3A 5LMNB 4HK4A 4BRWA 1NW7A 4C4RA 2FWNA 4QDOA 1NBWB 1OV4A 4CI0B 3A9TA 4EGCB 1QU2A 3ZDRA 4YX9A 3JVUA 3FAZA 4PS1A 1FFWA 2YY5A 1PQYA 2CY0A 2C0PA 4U6QA 4C5CA 3C24A 4PAQA 5IXJA 8GPBA 1TM1E 1U0EA 4YNBA 2C4TA 4AZ0A 1L7NA 1Q91A 4J90A 4AN4A 3PX2A 4DMUB 5F33A 4EHIA 4JP3A 2JKVA 4QYWA 2EFDB 3JQPA 1VCHA 1RKXA 2CE2X 4UNQA 2JZNA 3IUYA 4F9TA 5DLYA 2EC5A 1EGQA 3K2QA 3ZR4B 2ISQA 4I36A 1HFEL 1NAHA 3HEAA 1GG9A 3OZUA 1JKJA 3Q7TA 2NU8A 1G8FA 4M0LA 3GJYA 4LPKA 5DDIP 2R62A 5LIRA 3H7AA 4C5AA 2J8ZA 4TL6A 4RA9B 3E5RA 3B9PA 2IIQA 3DEKA 1RZRA 2DJ5A 2MSLA 3AY7A 2D2EA 3HA2A 3PD0A 3P9QA 2PVCA 4RHXA 5EG5A 4W1PA 3N0WA 1GPWB 2J08A 1U4NA 4L4SA 4LDPA 4RKEA 5FB3A 5BV1A 1C14A 1ZRNA 3EDOA 3QH4A 4TSRA 2J3JA 3DHVA 4GO1A 1MCZA 4YAFA 5CDFA 1R0YA 1WETA 3CX7A 4ENPA 1E9EA 1XNGA 3DVAA 3RUPA 4BB5A 1L8LA 4Q7EA 3D64A 1ECJA 3M6AA 1BAPA 2ODWA 3SNHA 4LZNA 4QJ4A 3KJGA 3MQ4A 1QFJA 4HLCA 5BWNA 3H0KA 4RZ2A 3SOPA 1Q16A 5CVVA 1PT7A 3WL5A 3D6HA 4ND7A 5HF8A 2QQ5A 4D42A 3KYJB 5IDQA 1ZM9A 2NUPB 2P2GA 2WOOA 4IDBA 5JQGB 2D5AA 3B85A 1U4OA 3G59A 4PAMA 2EP8A 5TDHA 4DA7A 1Q74A 1KNQA 1Z06A 2UUBB 1P0CA 2YQZA 1Q95A 2OD2A 2FPUA 2I6GA 2NSDA 5BV0A 4C4XA 2R6ZA 2FDCA 2Y0EA 5EWMA 1Q22A 2Q1UA 4QIHA 5H81A 4B17A 5K5EA 1JFTA 1GTSA 1XTPA 3Q40A 1V43A 2JGAA 3CI0I 2V03A 3HEBA 4UCFA 2F6RA 1NU8A 1PNVA 4AURA 4CGYA 4KQ9A 2AZDA 1QUFA 2O7SA 2OZLA 2ZS8A 4RH0A 4WKOA 3K70B 2HRDA 3GLUA 4O4JB 5TQ2A 2XPCA 2QL9A 4TTIA 3TDKA 4TL9A 4YECA 2IZ0A 1E2JA 1MHPA 1YACA 3VPHA 1LCIA 1OKKA 2XMQA 4JJKA 3PIRA 4C2BA 2J32A 3H5TA 1EP9A 2HSGA 2XUPA 4JQYA 1TVCA 2XYVA 3IDQA 4ER5A 3I2IA 5JPCA 1YL6A 2A4MA 2J6BA 3M