3MUEA

Crystal structure of pantoate-beta-alanine ligase from salmonella typhimurium
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
285
structure length
285
Chain Sequence
AMLIIETLPLLRQHIRRLRQEGKRVALVPTMGNLHDGHMKLVDEAKARADVVIVSIFVNPMQFDRPDDLVRYPRTLQEDCEKLNKRKVDYVFAPAVEEIYPHGLEGQTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLIQPDIACFGEKDFQQLALIRKMVADMSYDIEIVGVPIIRAKDGLALSSRNAYLTAEQRKIAPGLYNVMNSIAEKLIAGNRELQEIIAIAEQELNEKGFRADDIQIRDADTLLELTETSKRAVILAAAWLGQARLIDNQSVTLAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Pantothenate synthetase
publication title Crystal Structure of Pantoate-beta-Alanine Ligase from Salmonella typhimurium
rcsb
source organism Salmonella typhimurium
total genus 92
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3mueA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3mueA01
1XNHA 1KORA 2DPLA 5H16A 1MAUA 4ZT3A 4JZYA 4X0EA 4RPIA 1G59A 3COVA 1QQTA 3AIIA 3IUBA 4FZJA 1O95D 3Q4GA 4S1OA 3FETA 4EF6A 1N2GA 1R6UA 1WXHA 1VLHA 3AFHA 3P0JA 4ND7A 3TZLA 2I1LA 1MJHA 3DPIA 4YP5A 1LW7A 1N78A 4DDHA 1U7XA 4HJXA 4XFJA 2J08A 4XFDA 2H2AA 3IUEA 1FYDA 4WSOA 3P0HA 4J76A 4JXZA 2YWCA 3PNYA 1IHOA 2X1MA 2D5BA 3UK2A 4F3RA 3FI0A 1JECA 4G6ZA 3CVVA 5J59A 3ZJUA 2CYCA 2YXNA 1UFVA 4MAFA 1WXIA 3FG9A 3HFJA 3F3MA 4MLPA 4KR9A 5HUJA 4DE5A 1QRUA 1N2JA 2QJFA 3ND6A 4R2LA 3A2KA 2X3FA 3S3TA 4NZPA 4CQNA 3NBAA 1WXFA 4OUDA 1WKBA 3U1VA 2CFOA 4I6GA 2NZ2A 1A8HA 3AG5A 3K9WA 1NUPA 2CUZA 3SEQA 1DNPA 1WY5A 4CDMA 3CR8A 2E21A 3CVYA 1J20A 3SYTA 1QRSA 2JAXA 2DUMA 1U0BB 1ILEA 1TEZA 4ZCSA 3UY4A 5K0TA 1I2DA 1M8GA 1YUMA 1JZSA 2J4DA 1O97D 3UOWA 3SEZA 3H9CA 5IHXA 2WQ6A 3SZ3A 2GM3A 2J09A 1YIAA 1N2BA 5LFAA 1N77A 4NX2A 3CLTC 3H97A 1B6TA 4MUHA 1KKUA 2O5RA 4MW1A 1O6BA 3MLBA 1T6YA 1XJQA 1ZUNA 3OTWA 1NZJA 1PFVA 1H3FA 1I6MA 4L2IA 4L2IB 4EG7A 3N2YA 1NUTA 4K03A 1J09A 2YWBA 3H05A 1WOYA 1N2OA 3H99A 3MLAA 1WZ2A 3ND5A 3KFLA 1GZUA 4JXXA 4NAUA 1N2IA 3IOCA 1PFUA 2QUIA 3GLVA 3ZJVA 1N1DA 3X1KA 4G5YA 3LOQA 1ZJWA 3UMVA 4ARIA 2D54A 1IH8A 2HMAA 3M5WA 4PBTA 2RE8A 4Q16A 3X1MA 3IODA 4DDKA 2QTRA 1T6ZA 2A88A 2A1UA 2QTNA 3G59A 4HPWA 4F4HA 5TEVA 4MW9A 1M8PA 2DR2A 1HYBA 1TYDE 3INNA 4DDMA 1K4KA 3RFFA 4MVXA 2PFSA 4MW7A 3CVXA 2CSXA 1GPMA 4QREA 1IQ0A 3CLRC 1F9AA 2VTBB 2VTBA 1V47A 3AL0C 3DO8A 4YP7A 3FWKA 1YIDA 3IMCA 2IELA 1IVSA 3H9BA 3MMXA 3PNBA 2D13A 4R2MA 5KHAA 3C8ZA 1O5TA 1M8FA 2CV0A 4MW5A 1M1ZA 3SZGA 1K92A 3PXUA 2TS1A 4MUIA 2A84A 4MUEA 1KH2A 1S4MA 1LI7A 3G6KA 4BWVA 1N3LA 1XNGA 2DXIA 1OBHA 4ZT4A 3QE4A 5FO0A 4P2BA 4ND6A 1JMVA 4MVWA 4H3SA 3CLUC 4HK4A 1F7VA 1J21A 4JYZA 1JIKA 4MUNA 1MC1A 3AKZA 1QJCA 4MVCA 1ZH6A 2AG6A 2PXHA 4OUDB 4ZCPA 3COWA 3A4IA 2QUJA 4EFKA 1JHDA 1WXEA 3FOCA 1EE1A 3LCJA 1MRZA 4PY2A 1JIJA 3RK1A 5F23A 1T9GR 1EUYA 3NV7A 2IJGX 2V0GA 3IOBA 4U7JA 3JXEA 4KPUB 4KPUA 1WJGA 4U8HA 4EG4A 5LM3A 2A86A 3N9IA 3IMEA 2WQ7A 1PFWA 4K0RA 1JGTA 1EUQA 1O0CA 1NUQA 2WB2A 3NBKA 2J07A 4DLPA 1GAXA 4ZCTA 4UZEA 3ZJTA 4MWEA 1SURA 3VGJA 1IQUA 3N05A 4U63A 1TYCA 2A4MA 3BL5A 3HGMA 2QTMA 3TQIA 3ZXIA 2XRZA 2E89A 1M83A 4GRIA 2QJTA 2JANA 4MULA 1EFVB 1EFVA 2NSYA 2O8VA 5DASA 3DLAA 2CT8A 1VBNA 5FNZA 3TS1A 3CLSC 2DERA 4EG3A 1JZQA 1P7PA 2DLCX 4XSVA 1NI5A 3SP1A 1YUNA 2C5SA 3FH0A 3HL4A 3LE8A 4R0NA 3CLTD 1PG0A 5H7XA 5TGTA 5K0SA 4KR7A 4QBTA 1O94C 1R6XA 2ZUFA 2WSIA 3RJZA 3FDXA 3GUZA 3N8HA 3IOEA 1O0BA 3DV2A 3D6VA 3IH5A 1J1ZA 1VBMA 4DNXA 2AKEA 3IMGA 4MWDA 4MW4A 3RHSA 2PIDA 1JIIA 1M8KA 3HZRA 1OWNA 2A1TR 3E27A 1MAWA 4KR6A 2QJOA 1ZH0A 2A7XA 3KT6A 4NATA 4EG8A 1OWPA 4YMIA 3MUEA 4EG6A 1R6TA 2PZ8A 1N2EA 3COYA 1QRTA 1KQOA 1XNJA 2A1UB 1ULHA 3GMIA 3AG6A 1T9GS 3A05A 1MB2A 4PBRA 5AHWA 1K4MA 1M8JA 2H29A 4MWCA 4MW2A 4MUGA 3HV0A 1EXDA 1N75A 1TFUA 3P0IA 1G8HA 1U3CA 2IP1A 2QUKA 1LI5A 3I05A 4QRDA 1NYLA 2PG3A 2ZP1A 2CV2A 3IDFA 4I6EA 1O96B 1O96A 1NSYA 5HUHA 5J5AA 4EG1A 3Q10A 1OBCA 1YULA 1WQ4A 1Y42X 2CYBA 1N2HA 1IFXA 3SDBA 4MW6A 3Q12A 2GKSA 4CT0A 1VBKA 2Z08A 5HG0A 1O95C 3CA8A 4EGAA 1KQNA 1GLNA 1KAMA 5JBNA 3RBAA 2RD2A 3FY4A 1JEEA 1NURA 5DEOA 2OV4A 1F4LA 2HZ7A 1Q15A 3VU8A 2XRYA 2Z09A 3COZA 3FHJA 4DJAA 1OWLA 4TS1A 5J58A 1WXGA 3UC5A 3TZEA 1Q77A 2DEUA 4YP6A 2A1TS 1YI8A 3TQOA 2PZAA 1OWMA 1U7DA 3RK0A 2HGZA 2E0IA 5TS2A 3IVXA 2V0CA 1GTSA 1KR2A 2X1LA 3A04A 1NUSA 3CLUD 1MOPA 2DETA 4OJMX 3VRHA 3QTBA 4MUJA 3ZGZA 3IVGA 1KP2A 4MUFA 2VXOA 5EKDA 1MB9A 1PG2A 4YBRA 1NP7A 4RUKA 3ZXSA 1J1UA 5TEWA 4MUKA 1VL2A 3X1JA 1QTQA 3K32A 4UZFA 1Q19A 2JA2A 1IRXA 1BS2A 3KT8A 4MW0A 1TYBE 2J5BA 4ZCRA 5BNZA 1JILA 5KCMA 4ARCA 1IQRA 3ELBA 4NDAA 1WQ3A 3FIUA 1H3EA 5DK4A 2OQ2A 1J70A 1O97C 2BTEA 2Z3VA 1TYAE 3FNRA 1PFYA 4Q93A 4E1AA 1QNFA 1H1TA 3ZUGA 4MVYA 3KT3A 3G5AA 4EG5A 4ZT7A 1V8FA 4KKVA 1KH1A 3KT0A 4AS1A 3HMQA 2G36A 1FFYA 1OWOA 3CLSD 4PBSA 1G8FA 1NUUA 5IJXA 2CYAA 2GOYA 1D2RA 1OD6A 3L93A 5DB4A 4A91A 2ZUEA 4JFAA 1X6VA 4MWBA 1O94D 2EL7A 1QU3A 1K97A 4CDNA 1EJ2A 2R5WA 1EFPB 1EFPA 5FO1A 3IVCA 4GU5A 4AQ7A 4ZCQA 4HJRA 4MQ6A 4I6JA 3ZIUA 3P52A 1CT9A 5LLTA 1H3NA 3ND7A 3D6UA 3OP1A 1QU2A 3CVWA 3CVUA 1TQ8A 5KWVA 3TNJA 1GN8A 1KH3A 4NAHA 1I6KA 2E18A 3ISJA 1Q11A 4J75A 4ZT2A 1X8XA 4WNYA 2CV1A 1KAQA 3PRHA 1T6XA 2QUHA 1JEDA 3L92A 1G8GA 2B7LA 1RQGA 1U3DA 3PNVA 1KP3A 1COZA 2YY5A 2X0KA 4ZT5A 2PZBA 2EJCA 4G5FA 3ILVA 2AZXA 1I6LA 1MBZA 2BYTA 4ZT6A 1KQPA 1F7UA 3MXTA 3QTTA 3CLRD 1GTRA
chains in the Genus database with same CATH superfamily
2KLHA 2I6FA 2W6IA 5BORA 3WK8A 2VBCA 1KWKA 4TYPA 3IIMA 1A9ZA 7REQA 1UBOS 2ZIXA 1B1AA 1V5WA 4UKDA 4ZO8A 2IPMA 3GZ4A 3DOHA 5C80A 5H70A 5H82A 1ZDMA 2OCYC 3MUFA 2VRCD 4IIUA 1LX6A 1UMCA 1F0NA 5WRFA 1BDIA 1JU3A 3NHFA 1ORDA 3DM9B 2O59A 1UZAA 2VZ9A 1I7NA 3I9V1 3U1TA 4ZDWA 3AFHA 3K96A 1IZZA 4JQCA 2C9YA 4L76A 1PR2A 1GQSA 4UDNA 1DKNA 2EZUA 2FPMA 2GAFA 4ZQIA 5SZHB 1EJBA 1J33A 1OA0A 4OXYA 4DDHA 1ORTA 3MGBA 2Y9MB 3AUAA 2YVKA 2AXNA 4YWHA 4RO0A 4MKRA 4XFJA 4XFDA 2VKTA 1RYZA 4LKOA 3P0HA 2F59A 1R8XA 1SR8A 4MVJD 1WQ1R 1UDRA 3M33A 3M1IA 4Q66C 4X20B 3WLPA 1JG3A 5BSMA 2IW3A 3NHJA 5CLGA 1AD2A 2OXTA 3O5AA 3I01A 3R0IA 4Q24A 4RABA 4FJ2A 4Y2GA 3ZJUA 1ZBQA 2WJPA 1GPWB 3UT0A 1XCBA 2Z8XA 3LUHA 2DVMA 3AHEA 4NABA 3I42A 3FYHA 2PA3A 2QJFA 4ZVLA 3WIEA 3ZD9A 4EABA 2Q6LA 2VLBA 4ONEA 1ZNZA 3FPAA 1QO7A 3LCCA 5KVVA 4IXDA 5LKRA 2LCIA 3D8SA 5D3QA 5JJBA 2C5HA 4QQRA 1H6AA 3MOSA 3SKYA 4TMXA 1DQZA 1JEQA 4RKQA 1U2EA 2Y9PB 2XECA 4AP6A 2B8WA 1IZ0A 4ZHQB 2HHAA 1U1FA 3SSOA 1ZOOA 2VP6A 4JELA 3VO1A 1WY5A 4FMCF 1SOUA 2QD3A 4ZVVA 1EB8A 1E5VA 2ZAYA 2JI4A 1ILEA 1LLUA 5CYFA 1LSUA 4IWXA 4M46A 4ZCSA 4OB8A 5IYZA 4QT0A 4BWFB 1PR9A 4G5SA 3PLAE 1X1DA 3JR3A 4XGQA 2RG1A 2ODAA 2B2CA 1MABB 1L4EA 3WZ2A 3W8EA 1UK6A 1YBFA 3H9CA 1MO6A 3D4OA 3HY4A 3PEUA 4JVMA 5BWLA 4KQXA 5JAOA 1YIAA 3WQHA 1TJNA 5LFAA 2IXDA 1N0HA 2BRUC 1K8ZB 4TV9B 1YZKA 2AKYA 3AUJB 1IN8A 3SXJA 4B85A 4DLBA 3WTCA 3J7TA 1CQJA 3TCKA 3FTFA 1X7DA 3QBJA 2BGUA 1KKUA 1BXZA 4O02B 1C2TA 2A5FA 2C4MA 3TFWA 2XCIA 3UPTA 2PQ6A 2IS2A 4ID3A 1MV8A 3UFXA 2G7ZA 2RETA 5C32A 3U7QA 3OUZA 5C0OE 3PQ3A 4JNKA 3BILA 3FPJA 5ENDA 2G3YA 5FDFA 3LL7A 3PVSA 4Y1RB 4EX7A 3CRMA 3IERA 1T0BA 5IVKA 4E13A 1SUPA 4NYJQ 4BY9E 1QFJA 1Q3HA 2FY8A 2XMBA 1FQWA 4L85A 3KKQA 3DKPA 1B0AA 6REQB 1KZ4A 1VSBA 2DBYA 3MPOA 4E4YA 5IUJC 5JU6A 2IQIA 3JQ6A 1ND6A 1ABBA 5B3JC 1Z7BA 3AR4A 3PA8A 4P92A 5B7GA 1FJ2A 1A8SA 4MRNA 2WF5A 2ZI7A 1R5BA 4ND5A 2HXGA 3DL2A 1NOKA 1Y1SA 5A7FA 5L9AA 5KPJA 3HGTA 3SQOA 4X1IA 1DBRA 3M5WA 4TTTS 3UT6A 2OBYA 2KSQA 3AEZA 1DUVG 2QNBA 4FFNA 4QXQA 4XTCS 4EM6A 2GPYA 1JSRA 3DAHA 2YJNA 3B89A 2J3MA 3NTLA 4XASA 2P4EA 4X92A 1XA0A 1LI4A 1Q6ZA 3OFND 3T94A 2N46A 1GQOA 1EFLA 4KO3S 3GUHA 2XUOA 4BVHA 4EENA 4Y9TA 2DR2A 3BB3A 3IQFA 1SOMA 5DI3A 2VJAA 1KGDA 1Z22A 3QIAA 3VO9A 2EKBA 4KO2S 1AA9A 5ETJA 3RFFA 3R3UA 3HUDA 3T5TA 4LXHA 2E7ZA 1JJFA 1LTQA 5FH9A 4FFRA 4AMUA 3PEWA 4TUYB 1H0KA 1OXVA 3EW9A 2WAXA 1ZHHA 4B4VA 3KXKA 4OP1A 5CA0A 4QGSA 4F3KA 1XZKA 1Y1LA 3T4PA 1ZN8A 4XQCA 4FLMA 4ADSG 5JWRA 4EY4A 2QYSA 2C61A 2ZTSA 3B1JA 3Q85A 2RK6A 4DC9A 4LDJA 2RIRA 2OGUA 4OHRA 3BF8A 3QXCA 2CL5A 2QD5A 4G3XA 5KYYB 1X2BA 2JLSA 4NULA 4KQ9A 2WM2A 4BRZA 3ABOB 3QYAA 1PI3A 1VPTA 1H4TA 3JALB 5TQ2A 2G3DA 3L7OA 4DZZA 4KGXA 1YR2A 2C78A 2ENWA 2V9ZA 3DMFA 3QLEA 4JC5A 5IDYA 3ROTA 1B6SA 4HDSA 3SZGA 4F4DA 5CDTA 3PXUA 4MUXA 1O6CA 1Q0UA 2HWXA 4Q3KA 4WH0A 2A84A 5TT0A 3DEAA 3SIWA 3HM9A 1T9KA 1QV7A 4YIHA 1G7SA 2FEOA 3O90A 3T3DA 2ID7A 4KRGA 1XNGA 3OESA 1S2DA 1XU4A 4ZODA 4WN9B 2F1HA 3OTGA 3ND8A 4GI5A 2I7CA 4C7OA 3H9EO 2MYTA 3ZGYA 5CIQA 3TDMA 3VU9B 1SVNA 4NXMB 3HPQA 1WSDA 3KR1A 5AVTA 4M0FA 3RWBA 1L7RA 3AYZB 3RLIA 2ZRFA 4KP7A 4I1SA 3R75A 3RYTC 4DBVO 1L5HB 1E2JA 1SQSA 1Y8RB 4U7WA 3TSWA 3RYHB 5KWEA 2YN0A 4MVJA 2ZOSA 3KQSA 5M29A 4FMDB 4YROA 2Q1TA 4C2TA 4ZN6A 2PTHA 4EFKA 3VPAA 3MT7A 4DDVA 3C5CA 1Q7EA 5ADUS 2XKKA 4MQEB 1T9GR 2H7CA 3NV7A 2HEIA 3FZEA 1AXRA 1GPLA 1OLOA 1CXZA 2SBTA 1BXGB 4BU0A 4F12A 5JJLA 3VR5D 2IW1A 4GUDA 4NRDA 3R3XA 4K81B 2CJPA 2ORIA 2IY7A 2OP1A 4Z2YA 4C3VA 2BUCA 5GIOE 1A9TA 2G06A 1WB5A 2G04A 3EVBA 3HB5X 2DFPA 3R6LA 4ZOLA 1BN7A 5DGHA 3T61A 2V4MA 1H2BA 2PNFA 2VAPA 3KO8A 1GNVA 3OQHA 2VYVD 2II6A 4HHEA 3F74A 4YJ2B 1JJ7A 4AY3A 3G9UA 5K5EA 2E48A 1H5UA 4P4SA 5E9QA 1ISHA 4QOJA 4JLDA 4Q37A 4O2AA 4AIRA 1DBSA 3JQ7B 3GJQA 3CPHA 2BI8A 3TNYA 4GKBA 1BX1A 3DLAA 1IIRA 2LCQA 1VBNA 2ZUCA 4LVUA 4YJGB 3UHAA 3TVYA 4NYIR 5CG1A 5LYJA 3CTMA 2AZMA 1RXIA 4XSVA 3RVPA 3ROKA 2P5TB 2VP9A 3GGJA 1X8LA 1CP2A 3NO4A 4KVGA 4WDRA 3RNOA 4EVSA 4RVGA 5IBQA 3UWSA 1WDWB 4PGAA 2FPGB 1FTSA 2LD4A 3HR7A 4DQXA 3H4VA 3F67A 1Z06A 3G0IA 4TTJA 2PX2A 3QNMA 3TD6A 1T1SA 4BMNA 5SV2A 4LBZA 2FDCA 3QXXA 4MPTA 2IHNA 2VLIA 3M9LA 4HFRA 4I36A 4J7CA 3ZWBA 2AV6A 1LH0A 3N0RA 4HB4A 3MCAA 4QD3A 4WD3A 1XROA 2HN9A 4JIMA 4EFMA 4R1OA 3OLCX 5TRTA 3BIFA 3U62A 3BMQA 1TMGE 2FMFA 2GPBA 4PW0A 4PRKA 1EWVA 3GAZA 4N6OA 4PG5A 4TVKA 4QGBA 4TMTA 3OJFA 1NMYA 3QUSA 1NLZA 4I4TF 3L6OO 1SWVA 3GD5A 4UBKA 5EHGA 2D06A 1NONA 4WA7A 5L6MB 1APBA 4UNRA 3L0ZA 5LMZA 1T9DA 2ZATA 4ZJYA 1FOEB 3AG6A 2LE0A 5E8JA 4I66A 3TQTA 3K09A 4YV7A 2EKQA 1ZAYA 3IE1A 2OAEA 1EXMA 4RFVA 4L78A 5JT1A 1KRXA 3HV0A 1RLUA 3HVUA 3O8RA 3C5EA 2H0RA 3ESRA 2I8LA 1RC0A 1CJTC 4ZRNA 4GOOD 1RHKA 1G8HA 3EB9A 3L04A 3E58A 1B6RA 3LOPA 1TQ2A 1U8FO 3HCFA 3M89A 1NYLA 1P29A 4NTZA 4DQVA 3K9BA 4E5VA 2H4WA 4XTRA 1MNQA 2G67A 3BXEA 3QF4A 4JJIA 1E98A 4WECA 3OFNA 5K6AC 2QLTA 3L7AA 1OU0A 3LK6A 1GEGA 1OZGA 3F1LA 3EUEA 2HTEA 2RBEA 5ICEA 1IFXA 3L0DA 4W8HA 2QZPA 4DHWA 1N9KA 4BB5A 2GKSA 1G6HA 1WDTA 3QI7A 3USES 2PTGA 3DAPA 1QXSA 2E3JA 4P53A 1PP4A 3WLAA 1GU0A 2XLCA 2FG5A 3L9XA 1XAGA 1HNWB 3QKWA 4KXFB 4BNVA 1JHXA 2Z4SA 1I9GA 3CPJB 4QYWA 5FL7D 3RO7A 4AKIA 2PSFA 2AL7A 1JEEA 3SEAA 1SXJC 5CT5A 1TTTA 4AMGA 1WD7A 3ILHA 4YJ3A 2NZXA 4NONA 1XD2B 5DHAA 1NZDA 1YCDA 1VSUA 3NT4A 4JQZA 5H02A 4B8YA 2G4CA 3FHJA 5DNWA 4UNSA 3DYVA 2PYIA 5I3ZA 3ZDFA 4JZKA 3DB1A 1A9YA 2P65A 2OHVA 4LV5B 3UC5A 1FP4A 3H17A 3WWOA 2C03A 4CKXA 4ER6A 4LNUA 4WZAA 1OYWA 1UBCA 4CKEB 1XK7A 4QGFA 2QD4A 2QL7A 3GI1A 2X19A 3GR6A 2WKRA 1E1RD 1FFCA 4I5FA 1DAMA 4D9MA 2E85A 1UC5B 4DLUA 3T3NA 3K1TA 3QTBA 5TF4A 1LU9A 1ISJA 1MRSA 4PX9A 3W3AH 4H2DA 5B4TA 1QJ4A 3AVXA 1HYHA 4PO3X 5HWSA 4C0HA 1GQQA 4TYWA 1TK2A 1BEEA 2AXQA 2PV0A 4M3NA 5ED0A 3OCWA 4F8YA 2B25A 4UM9D 1DWUA 4C4PA 4GT1A 3KQQA 1P1FA 3CT4A 1DPFA 3D8NA 2A67A 5KSPA 4N9WA 1CYEA 1CUXA 1YS2X 2LXNA 4TV9F 3FAZA 1NMQA 5IT5A 3V7UA 4B6PA 4X44A 1I4EB 1YQEA 5AUQA 2W6NA 1RJWA 1H3EA 3RYFA 2VNSA 4A2CA 1KZ9A 2AFHA 4CXMA 3VR5A 3EGDB 2GCNA 2A5LA 1C9DB 3BCRA 4NE9A 5EMKA 1SA0A 2I80A 5I9SA 5GY7A 4OI0A 4IXMA 1E2QA 3O6VA 1J56A 4YP0A 4K6FA 5JROA 3HG7A 1IVYA 2XE7A 3CC8A 3SF0A 3HH8A 1PFYA 4HEJA 5T6MA 2WE7A 2NV6A 2UV8A 3PF9A 2XGSA 4OJTA 1H1TA 2FUCA 1MOZA 3WHLA 1XMOB 2IQ5A 1G8PA 2W83A 5EIFA 4FWTA 1X94A 4JP2A 2LIVA 3DUWA 2VYVA 4X94A 2P8SA 2AFVA 3K5IA 4EKNB 2CN1A 1V9SA 3I0ZA 3WNQA 1TCBA 4AJ1A 3MMNA 1PUXA 2X8JA 1OJ7A 3X1YA 1V2HE 3T5GA 5B58C 2D00A 1OD6A 3EVGA 3KVYA 5TX7A 2QTBA 4G0OA 3GBSA 1O94D 4U1RA 1R0YA 1L7QA 4A2WA 1XEXA 1YDWA 4AC9A 2GN1A 4ENVA 4H08A 3VKWA 1OPRA 4F5DA 2W58A 1SXGA 1ODJA 4XWYA 5AHXA 5EMLA 3WWZA 4BBAA 4G89A 4GX0A 3KVVA 1BEZA 2FJPA 3JQRA 4MK4A 3D7NA 1SBQA 3K4PA 4HJRA 1IUNA 2QUAA 1N2XA 4KH1A 4A6DA 3VTAA 1G5FA 7MHTA 4HYQA 4BJHB 4FFBA 3UMRA 2Z58A 3LQKA 3WL5A 4RM2A 1CY6A 2JK1A 4YRKA 3G6WA 3R41A 3LCUA 5FCDA 2BFDB 1PJ2A 2PLRA 2Q49A 3MWYW 2WJIA 4IH1A 5L4SA 2VJPA 5G0VA 1EYZA 3KLNA 1DOZA 1VJ1A 3O0DA 4BVAA 5ICCA 3MZ0A 2ZBFA 1U3WA 3JQCA 1OXUA 5EJAA 4DN6A 2R25B 1ZIYA 1KERA 1U7HA 2IHKA 2Q29A 3PRHA 3LBAA 4OX9B 3K2IA 1XTUA 3EDCA 3STYA 3WI7A 5GM1A 3TN7A 4RK7A 1ZESA 4OQQA 4MMZB 4PQRA 1XWFA 4BNDB 4CNQA 1AGXA 2OUIA 3PNVA 4L0DA 5KHLB 1XA3A 4Z3OA 5DXFA 4QPJC 1FPMA 1YVDA 3LUKA 1YXMA 2PVPA 3IELA 5C4MA 3SZMA 1IXSB 1UDWA 3H5IA 2XB2A 1ZZGA 5B4VA 3A1UA 3H8SA 2QVLA 1XDSA 1M67A 4M7WA 4WCFC 1KYYA 2AUTA 1QS0B 2AQIA 2QLMA 2DH6A 4ZXFA 4ZT6A 3BICA 3NAGA 4CM9D 1NLUA 4MRMA 3DVLA 3E8SA 4TWIA 5FP0A 3TZCA 3GCXA 1PX2A 4QJ4A 1GPKA 1T2DA 1E5QA 3E1KA 2PO7A 2XHZA 3HP1A 4XM0A 1E6EA 1G2QA 3NTQA 3RAPR 4FB4A 5KIAA 2VCEA 2P3OA 3E3AA 4IDOA 1M34B 1JH8A 2CCGA 1ITZA 1MC5A 3ZVMA 3K70B 3FOZA 2WHPB 2QYOA 4BXOB 1M6NA 2FH5B 4FZJA 1NVVR 4QQNA 5TPZD 5HHTA 2CFIA 2K87A 3HU1A 3FETA 3GCWA 1F8GA 2WSBA 3CEMA 1XRJA 4X63A 4R81A 5DHRA 3U3OA 1C4KA 1CUWA 4KBYA 1P2GA 3KHUA 3OM9A 5BN5A 3K8OE 3STUA 4FMDF 1E2DA 4ERXA 1Z6QA 3AVWA 1K89A 2ZETA 5FL7A 3PV0A 3QPWA 2Q2VA 4LJ8A 1T34A 5C7OO 3IBFA 3ITNA 4MDEA 4CTKA 5FADA 2AJ8A 4ODIA 1QVRA 5JI3E 4JXZA 1ZGGA 1L3BA 3FBWA 3VR1A 1CIVA 2XOKD 1GHTA 3KLOA 3OFVA 3OF5A 1RACA 1R2QA 1V4VA 2ZI3A 3EIWA 4N3GA 5K3EA 4AP9A 3CVVA 4DV7B 1JSXA 2DQ4A 5FTKA 3TYXA 3U4AA 2GEBA 3WJ7A 1VE7A 3ZHYA 2C4TA 2FWMX 2LPMA 3DE0X 3B7GA 4KO1S 4M1ZA 5T8KA 3WGMA 1LPPA 3KAKA 3FOWA 2G5PA 3HNRA 2OXIA 1QP4A 1P4HA 5K45A 4G8JA 5AXCA 1IXYA 1W0JD 4QIHA 2FRDC 1SQFA 3A9CA 2CLEB 3I6IA 3VHLB 2J5RA 4YJ2F 3GRYA 1E1RA 1X7XA 1U90A 4PEVA 1KYXA 3NYQA 3ZLTA 2QUBA 2RHMA 3BGWA 2H65A 3FCYA 5TXGA 2HKIA 2O8DB 4NJOA 4URFA 1BWSA 1FP6A 2PMBA 4LK2A 1VXOA 3OZXA 3FFWA 2XNKA 3MWDB 5K8IA 2J0SA 1R10A 1V11A 4Q4HA 1T4MA 4W6QA 3IEUA 3UICA 4ERNA 2B78A 4KXUA 3CR8A 4LDNA 4WXHA 4J0DA 1FDWA 2N0SA 3SYTA 5GQSA 2CWWA 2FP4B 3OEWA 4IWNA 3LLUA 5HBGA 4E08A 4ZVQA 5JAPA 3RT1A 4R9RA 4BUJA 1WR8A 1R5JA 5U9CA 1CY0A 2QSUA 5HIMA 3FVRA 2IYAA 3IPLA 2H59A 3NG1A 3SYNA 1HDRA 1L5RA 3P9PA 4IDNA 1Q7TA 5HJ7A 5DN6A 3RABA 4LQLA 5CAEA 2HA0A 3U39A 2J09A 2C2HA 3HR8A 1FUIA 4RZ2A 1LPOA 1Q17A 2DLDA 2BWJA 2C9DA 4UATA 4L16A 5LQNA 3A6GA 2PVCA 5NLLA 1VM6A 4IHAA 1N6HA 4M54A 3O93A 4N8DA 3UKOA 5EHZA 1JEYB 1HMYA 5M2QA 1B8UA 2GMWA 3KQMA 2BUAA 3KSMA 4WBNA 2NM0A 2QG6A 2XXBA 2IF0A 3A3YA 1Q1BA 3BH7A 3WRYA 5BXQC 1YTUA 4AM8A 2EEZA 1T91A 4BVFA 2Q1SA 5JCOA 2BM1A 3T54A 3CKYA 3TIFA 2QYHA 2BTOA 3UMMA 5ILOA 4DEVA 7MDHA 1A1SA 1ZMTA 5KEIA 4UNQA 1I6MA 1M54A 2V55B 3ZTWA 5B6JA 3R9KA 2Z1NA 1CRPA 3GFPA 2X1HA 3P9IA 2WFLA 4BQIA 1M2VB 4FZ3A 3TMKA 4HVLA 1L5LA 1P1HA 4DGSA 1Z6YA 3TH5A 2ZRIA 4IGKA 3RODA 4B17A 4P08A 5JSZA 1DRUA 2VDMB 3E8MA 4C89A 1O94A 4MLCA 4Y7DA 2IYWA 4CETA 1TO2E 4FHGA 3ZWAA 1NMSA 1XCOA 2B4KA 2SCUA 2YZNA 3LYLA 3M4XA 4W6ZA 4X8MA 5AK4A 5D3KA 4WFKA 5AR1A 4JXXA 4QVKA 4Z4QA 2IT1A 2AC7A 4FFOA 1E3WB 1R0LA 4PYRA 4M86A 5AVYA 3ZJVA 2VDWB 3QA9A 2IU3A 3UCFA 2HCBA 3ED1A 4OB7A 4OAQA 3LOQA 3OLQA 3R74A 3UK0A 1K6XA 2F17A 4L3WA 2IECA 3WK6A 2D54A 3PITA 3KQWA 2GN6A 1N9ZA 2QRHA 4MGHA 3ZHXA 4RTSA 2EFGA 1R6VA 1SKYB 1A4UA 2R6AA 4WLVA 3WGKA 3A26A 3HNPA 3GJRA 1QIFA 2V45A 1T6ZA 3MBKA 4UU0A 4EHNA 3A4NA 5HKLA 3GWZA 3B13B 1RJGA 4HPWA 5JMWA 2NQ8A 2OR3A 4Y1FA 1EH5A 1BG6A 4OXKA 4WCVA 1Q1EA 1RNLA 1NPDA 2QPAA 1MDBA 3GNQA 5EJGA 1Z5PA 2IXGA 2YFYA 4OPMA 2BGKA 4MJXA 3L82B 1KE2A 3T3IA 4C0LA 1CY2A 4FD2A 4C5BA 4Y6PA 3H2BA 3EZ7A 1L5FA 3K6SB 4YMVA 3KHSA 5TMDA 3NM4A 2VF2A 4XKJA 4YRAA 1CUAA 1Y1KE 1EGVB 4JLKA 5EP3A 5HYVA 4J2TA 3RM3A 2Y1KA 4R7TA 1OYVA 3PEFA 1UBSB 1YR3A 4C6RA 4CG1A 3RSQA 1JX6A 2G70A 4LC0A 3U6BA 4XI9A 2Q3MA 2Z30A 3GT4A 4Z9FA 4ZZ3A 2XYHA 1CY7A 3S8MA 4F3CA 3JSAA 3V2HA 1W30A 2Q4RA 2XDWA 2J9FB 3GFFA 2DQKA 1GZ3A 3P2MA 3MJDA 2AOXA 3D5QA 1PZFA 5EMNA 4JUBA 1RZVA 1TF5A 1O5TA 4KQGA 5KOJA 2MSNA 1D8TA 3FYUB 4F5YA 3NYWA 1U2GC 3P97A 1I3KA 4LMPA 1LS6A 4HPJB 1WM1A 1WSWA 4P98A 5DLEA 4JP1A 4TPKA 3VPGA 2HRBA 3IB6A 4ILKA 3SVTA 4IJ6A 5TPZA 4DMMA 3NWPA 4J0KA 2CHVA 1PT8A 1HPLA 3O4HA 2O50A 4EW3A 1AO3A 1X87A 3P94A 3B36A 2DWPA 1IBSA 3D59A 2XGOA 4O4HB 2FWPA 3AESB 3ITDA 3QXHA 4ZT4A 5TQ0B 4LFCB 4Y0NA 3TOCA 1XP5A 4KU4A 4CF7A 1BWRA 3JQAD 4FN4A 4OJYA 3STVA 3CFYA 3TRJA 4EKYA 5GVRA 1KI8A 1A77A 1E2IA 1FBTA 1VKOA 2IYRA 2VHZA 4II2A 4Y6SA 5DX1A 4INJA 4MUNA 2FLKA 5JZ9A 3E5MA 5F9FA 4HDRB 1EP1B 1QB7A 2PCJA 2XOKA 3BMXA 3O9VA 1HG1A 5CVCA 4GECA 1AT1A 5DX0A 4DLNA 4CEIA 3H04A 4HQ6A 1PV1A 5E6UA 5F78A 1B1CA 4DQUA 3FNEA 3VSAA 1VCIA 3DXYA 1CPYA 3O4GA 3JPYA 4U6NA 1J90A 1FYFA 3QU7A 5E6RB 1DHRA 1W0JA 2K7ZA 1TJPB 1LDBA 3D31A 3H0EA 2FJ0A 1KO1A 3SAJA 4D3FA 3EZLA 4IS2A 1D6MA 3GA7A 1Q2UA 3WKBA 3LHSA 5A1JA 5FLXA 1NUQA 1NXSA 1FSZA 3FNQA 2PR7A 4L5BA 3SBDA 2R86A 4O2LA 1U7ZA 3E0XA 2GZMA 3T7CA 5A4MS 1CS4C 1YVPA 2WFMA 1Y3HA 4L4YA 4R8LA 3MLEA 5ALDA 2Y76A 1E9RA 3X1ZA 5A4FS 2PRSA 4LYHA 2Z4RA 3KB8A 1YHZA 5J5VA 1WX1A 1R0XA 1XZQA 3SZLA 2JJMA 2I6XA 4NICA 2HV8A 4MULA 5FUBA 1GZ5A 1I0ZA 4CZ2A 4G24A 1N3YA 2G63A 4I4NA 5CW2A 4C4OA 3MAJA 5EIBD 4AJ2A 1DP4A 1OBOA 1L7DA 1YUNA 4UBNA 3D2CA 2QQ0A 5HTOA 5LD2C 1JLLA 2NO9A 3PTAA 4GVXA 1YRLA 4AW9A 1CYDA 4US0R 4B0OA 2ZUFA 1U7OA 4H7JA 2GFQA 3GCDA 1Z6GA 3EIXA 3ZLJA 5F4BA 2PCLA 2X5XA 3IOEA 4J2OA 3TFOA 4JOCA 1DRJA 4PFQA 1QQBA 2CHEA 4WFJA 4GD3Q 3LPAA 3U1BA 2KJQA 1NKTA 2PIDA 2I3GA 3NWEA 1SVUA 4NYJR 1RR6A 5EZ5A 3Q5GA 5BWMA 5JD6A 4C0AC 5KKNB 2A1TR 3ZWXA 2HR1A 2PRZA 1P74A 4IRUB 4L57A 3A4TA 4AN0A 4DR3B 1L4LA 3H5OA 3KT6A 3OETA 1CULC 1G5IA 4TQ9A 1OWPA 3BXOA 1WUKS 4BN4A 3HKBA 4HZIA 1MFPA 2Y2UA 3NWOA 4UXJA 5JTTA 1A8PA 4WFIA 3L46A 1QYWA 2FOIA 3M34A 1E0AA 1A76A 1VRVA 3ZLBA 1NYQA 1V45E 1HFWA 4ZEWA 5KU7A 3OEHD 2AJBA 4KZKA 3A25A 1EVLA 1Z83A 3NHWA 5CCEA 1T3LA 1VC2A 2JATA 3MERA 3QKRB 1AZSC 1RXCA 2B8NA 2PUJA 3N2GB 1NFFA 4IDBA 1DEXA 1U9CA 2OV6A 2QAGA 3I6YA 1JLKA 4PC1A 3SM3A 3BHIA 3IPYA 1XDDA 1UBKS 4M60A 5D84A 3WMRA 1CR2A 1M6HA 1CX9B 1ENPA 2JH3A 1LD3A 3DZFA 2BHSA 4J0EA 5E6SA 2GEUA 5FYQA 4YMHA 4PZLA 1EM8B 2YN4A 5EWLB 3CRVA 4Z7JA 4IQGA 1SKMA 4YT2A 3CQ9A 2G1UA 4GXRA 1QTRA 4XEHA 3RIHA 1JHAA 2DPMA 2PX6A 4E7PA 4OLBA 1XRQA 2GPAA 2I54A 3DTNA 1ZEJA 4IHQA 4KVAA 3C3PA 3AZPA 3UJ9A 1JSZA 4DZTA 2GK3A 4N82A 1EFHA 3RPEA 1P2DA 1QE3A 1V3QE 2BFCB 2P0YA 5AIAA 5IBRA 4GE0A 1RQRA 3LWDA 4AXBA 3FWZA 1HYQA 1SOAA 2Z08A 5L7TA 4BJ6A 2J59A 4QTZA 1MA0A 1O95C 2JBHA 4JN6B 4TSFD 5EZ6B 3T1VA 5BY2A 1ZR4A 5IH7A 3JQQA 3I04M 4GOND 3BWBA 4CMIB 1E1LA 1SPBS 1QKIA 4KUEA 3AW8A 3AK4A 3PUJA 4QBIA 2QEQA 2QX8A 4LGMA 3UAZA 1DG1G 1TA0A 1UKCA 1HDYA 1X14A 1ZGHA 2Q5JA 3I30X 3HCBA 3JQGA 3OLYA 4Q01A 4PVDA 2XQKA 2EG9A 4A26A 4HO1X 2XRYA 2PUWA 3BH6A 3COZA 3MJRA 2X0EA 4DJAA 1DMRA 3CZQA 2E82A 3QRWA 2Y2VA 3FI9A 4ER3A 3ANTA 1AUOA 3OQJA 4GMDA 4TVSA 9LDTA 1JKJB 4BUZA 5KX5F 1B43A 2OILA 2WSSD 4HQNA 4II7A 3L8YA 1YO6A 4MS3A 3F96A 1I13A 2FPPB 3UAXA 1E64A 3WK9A 2WUFA 2JI6A 3KOOA 3MTAA 2HGZA 2DR3A 4NPAA 4US1R 1EA7A 3ND9A 2N75A 1Q7BA 3VZCA 2BVNA 5JFGA 2V0CA 3F7MA 1KR2A 3WYGA 1HNNA 5DRYA 1C3VA 4IWYA 1P0IA 4JXKA 1J8YF 1MOPA 4GP7A 4NZOA 1FUEA 3TFQA 1RLIA 1T13A 4IH9A 4MUJA 3X1DA 5IAEA 3A14A 3L6CA 3JQAA 2VK8A 3CZCA 2QJRA 1JIVA 1VYTA 2C58A 3HVIA 1YQGA 4NU6A 4XX1A 1NSFA 2XE8A 5JPIA 1M1YA 4ICIA 4IUCS 4KPGA 1QAOA 2P9CA 1W5AA 2QTGA 4PPYA 5FI3A 3O73A 5B4UA 1Q19A 3IO5A 3QJGA 1C9NA 2AFIB 4FTWA 4NVRA 1NX9A 4IW3B 5E1DA 3TLCA 3ZN2A 3WP1B 2OORA 2F48A 4Y98A 2WSMA 1PRYA 4KQ2A 2P69A 1KFEB 4ZCRA 2O8EA 3TOXA 1YS1X 1SU7A 2PA0A 4XR4A 2AR7A 1HH4A 1VI6A 3KELA 1V37A 4LC1A 4LX8A 2GZ2A 3FZGA 4BCBA 3DE1X 1ZOPA 5LXTB 2Q3LA 4IIXA 4KYUA 1T5SA 1P4GA 2H1CA 2OBXA 2GM9A 1QQ6A 4XXHA 3JV7A 2OZLA 4FDMA 3ZXUB 5DH9A 1RPTA 3S2YA 4B2PA 3CH4B 3L06A 5A3QA 4WINA 5E7JA 4B3CA 4QAQA 1PKEA 4ZZIA 4D4GA 5BRNA 4JBXA 2GZ1A 1NQ5A 3DOCA 3NUZA 4RZHA 4MYDA 4LBVA 4B3XA 3UA0A 1J8MF 4MR7B 4XCVA 1NW9B 1W5BA 2APJA 2RI6A 4GOMD 3SBEA 1KO7A 1ZVJA 4D4MA 2MSWA 4BPRA 5I4BA 4HF7A 4IP0A 1U1CA 3LH5A 3TW0A 3KT0A 4P7BA 1PDWA 3E8XA 1T5DX 4DA6A 1OV4A 1FFYA 5DT2A 1YI0A 3BRQA 1G8FA 4Z2AA 2CYAA 5IN5A 4CQJA 5F73A 4F04A 2GPSA 1EFUA 3K31A 3LUAA 3CUEF 3WWDA 5E4JA 5AW2A 3UYKA 3FDIA 3BD9A 4MWBA 1L4FA 1OV6A 2XKJE 3OCVA 3WYDA 5JS2A 1DHTA 1LTHR 2YRXA 1QU3A 4L8GA 3A6KA 1T2FA 3P9SA 3QUBA 4YS6A 1BKSB 3TUZC 1SG6A 1EFPB 4L27A 1F4PA 1N7HA 2C4KA 2C5LA 2OV8A 2GBCA 4ZAFA 5FFMA 4BNUA 1XZBA 4EHFA 5IN4A 3DF9A 4C6SA 3W2IA 5EE9A 3FSGD 1PK9A 1TT5A 2ZUDA 5ABPA 5H3LA 1JJIA 1K8YB 3CBGA 4FPXA 3LWZA 3R9IA 3ZVNA 2M6RA 3M49A 1M7HA 3T7TA 1LJLA 3U61B 2QYTA 4CKBB 1QOZA 4G4SO 4XYLA 1Q11A 1VPEA 1CZOA 2OTCA 5BPHA 4NCKA 1LTKA 3SHFA 2HHCA 1XZFA 1P81A 3IIIA 4NBWA 2D74A 1Z4KA 3OURA 1C3LA 4UJ3A 1QH0A 1COZA 1HDCA 1OH8A 1RKXA 4MQLA 3OEHA 4CCYB 4XW2A 2WJAA 3R0VA 3WB0A 3NAZA 5B3KA 1P7WA 8LDHA 5AVZA 3OA0A 5I7HA 3TGLA 5FOSA 1I6LA 5JH7B 1T3SA 1M5TA 1F5SA 2XYGA 4FYXA 4XGIA 1A1VA 3THXA 3B1VA 5LQRA 4YDRA 5LP6B 3MXTA 1R74A 2G5TA 2AJTA 2RMKA 1RKBA 2H4ZA 3NETA 4GGOA 3ZWWA 3BGDA 4ANFA 4JB0A 1GTMA 2CK3D 1MAUA 2TECE 2WW8A 2Z0MA 1R6BX 2B0CA 2ZIXB 1TOAA 1ZI9A 2Z5GA 2CLLB 2IXAA 4ZVTA 4C7KA 1T1IA 4CL0A 3LDFA 4KHZA 3MJCA 3BWXA 3LWNA 4WGGA 3UUGA 3VH2A 2PZLA 3E4CA 3PUXA 2OFFA 2O5EA 4ZI5A 1UMCB 3SJBA 1J2RA 3PGLA 1WUHS 1D2MA 2D2IA 3FRHA 3U19A 2TYSB 2ZQZA 3NEPX 2HMUA 1QVVA 1RWVA 1NRIA 3TZLA 1OILA 3EQ2A 2G9RA 3RSGA 2PUHA 4QOHA 4DCSA 1ZOIA 3DMPA 4O1HA 4XLZA 3GFSA 1ODLA 4PXSA 1BA3A 3IKMB 2O54A 1R0RE 1V8OA 3L2OB 1CS0A 5IAAA 5H0IA 4C3ZA 5DCUA 1AV7A 3B2QA 4C22A 5MHTA 1GCOA 1E2MA 1G4UR 3NRCA 4F6RB 3NUQA 5BMVF 5DGCA 3RBVA 4AFNA 2JB9A 3IB3A 4A03A 2V7EA 3VNQA 2IHVA 3EG9A 2GJKA 1X42A 2X41A 4EHJA 1TD1A 3M3PA 3V1NA 4I99A 4PLWA 3P71T 2WSSA 5HDQA 1ENZA 2ZT5A 5ALIA 5GGYA 2Y8EA 3WV4A 2E49A 2ODTX 3CX3A 4DMCA 1E1QD 1XKXA 2H7XA 3N7AA 1GR1A 5FHQA 2X3FA 1RPJA 5HPYB 1TUBA 2H1SA 4HPXB 6GPBA 9GPBA 4M49A 3IV6A 2Q5LA 3FKQA 1JI0A 1WXFA 3ZCVA 4DIMA 1N1EA 2HNKA 4Q82A 2PDAA 5INTA 3TL2A 1QVAA 2G0TA 1KPHA 2MR5A 4QYMA 1JEQB 1XOIA 2W4QA 4AICA 3AOGA 1QMGA 2CHUA 2QRJA 4OL9A 4QQKA 5THXA 5IVPA 4KGDA 5J43A 2C3PA 1FL9A 1VJCA 2IGBA 4JB8A 1SRRA 4BPBA 1QRSA 1MORA 1WCYA 4Q4AA 2CLKB 3HNOA 4AMVA 5KYNA 4QGGA 2JD2A 4FQ7A 4ZXPA 1DINA 2F1IA 4DSZA 5GTDA 2J31A 5IYZB 3UH1A 4PG7A 3GWGA 1UAYA 2BGLA 1FYXA 3PFBA 2CNBA 1NBMD 2MSLA 5FNVA 3ELDA 3GFBA 4LIPD 4QODA 1FDTA 1RWMA 4PYMA 5FPTA 4AO8A 2EBHX 2FVYA 3KDSE 3WRXA 3K0KA 1HORA 3QFRA 5HILA 2ROQA 3GX1A 2PLNA 1E3QA 2QL5A 4YAUA 5CDSA 2PJZA 1CQJB 3OM8A 3VC7A 3PT9A 1N2ZA 5EJ8A 2VF7A 1IZ9A 1XRNA 4MUBA 3MS4A 4OTZA 1UFQA 4KSBA 2OFXA 4C08A 3TG8A 1ZQ1A 2E1PA 4QFMA 1RLOA 2HA7A 2IGTA 5AJHA 1W29A 3UFXB 1O6BA 2BFFA 3BXPA 2EARA 1Z0UA 4K28A 2ECKA 3UG6A 1FU4A 1T6YA 1ZUNA 2WHYA 3OZAA 5ARDA 5DSXA 4NQRA 1NV9A 5IAKA 1LRLA 4QUGA 2P2NA 2ZR7A 5A7HA 3FPBA 3MK31 1J9ZA 2CFSA 5KVSA 3NEAA 1AKQA 1M66A 3LLMA 1SIOA 3B6MA 3MJEA 1Z2CA 3TLXA 3VYUB 4YXWD 3AKYA 4W5WA 4U5XA 4ZAVA 4TX1A 3AJEA 1SG9A 1KI7A 2H51A 2VUTA 4ITVA 4EJ6A 2NU7A 5GONF 3D7MA 1PUJA 3AF1A 4G5QA 4A16A 1B8VA 3V8EA 3D5EA 2QUIA 2V7QD 3CW2A 5BRAA 3FSGA 3UMGA 2JKZA 1MENA 3EVNA 4XARA 4U02A 4KWHA 4KIUA 4X1IB 4PZPA 2C95A 3HO6A 1L5WA 2B5VA 4AUKA 4DB2A 1XELA 1W35A 2OZVA 4UM5A 3A2LA 1UKVY 1ZGBA 2ZZKA 3VZBA 3VKVA 5BUSA 5C31A 2BSXA 2X15A 3GAMA 1AKYA 1MO2A 3L7LA 3P2KA 5ER6A 2ZPUA 1EK0A 3ADCA 5AJTA 2IL1A 3R7WA 4W1PA 5FUVA 3A58B 2YOFA 3N3AC 4N18A 1UIRA 5DI3B 5DTJA 3F9IA 1UZUA 3OF3A 3SCZA 2IEGA 2RIPA 1U1IA 5A6SA 2XZOA 2EFJA 3DV0A 4HWPA 1M2NA 3SX0A 3QUQA 1JLSA 5AW5A 2ZM5A 2GAJA 2CZGA 2J33A 2Q4DA 3NONA 3OOJA 1P75A 1IBMB 2J3JA 2CJFA 2ABWA 1C5KA 5CA0B 5JBQA 2PL3A 2Z2KA 1HZZA 1J25A 2OB2A 3H2YA 4Y6GB 2HFKA 2RAFA 4BV3A 1XYYA 2XBUA 4UE6A 5A5DA 4F1KA 4MEBA 3SR0A 3KB6A 4DA9A 1NRJB 1YFLA 5DT9A 1SB9A 1VG1A 4PO8A 4YP7A 3SJAA 1E59A 2GRAA 3KEOA 1D1QA 4FFSA 4LUCA 5K20A 4P36A 2CK3A 5TQ2B 4FXPA 2GNOA 2A9JA 1OZAA 4UVIA 1XAIA 5TT1A 1N6LA 3OM0A 2YHUA 2C77A 3FBTA 3M6FA 4HDSB 4MV1A 1W85A 3RARA 4EPVA 1XG5A 1YACA 2VNKA 4YJHB 4CDGA 4IUYA 2DF8A 1GGFA 3AY6A 2K2QB 2EZ4A 2RH5A 1LI7A 3G6KA 3T1YB 1RFLA 4AS2A 3GLFA 4CEJA 2RC6A 5BN3A 3I8XA 3SYMA 4XQGA 2HLHA 1GUFA 2VDRB 1JSCA 3MPUA 3DTVD 5LMUB 2Y71A 4NBRA 2B7CA 4C7OB 1EHCA 3C3KA 1DOAA 4TYNA 1UJMA 5KQLA 2I8AA 2I4IA 1L8OA 3RJ5A 4XLLA 4D8YA 4JYZA 3OCYA 1P0CA 5LXTF 2FZKA 1XTVA 3WIDA 3KQVA 3PPIA 4ZEXA 2GJ8A 5KJFA 3TI9A 3NATA 1EE1A 1XTKA 2HDOA 2IOQA 3W5UA 5DWDA 5AKIA 1INLA 1ORVA 4GGPA 2GXQA 1E1QA 1VE5A 4KPUA 2HYIC 3SMVA 1X70A 3RH0A 1PJSA 4RJIA 4TWJA 4RULA 1SBZA 2JFUA 3KJFA 4GEKA 1PZMA 2IC5A 5H3CA 3NV9A 5K3OA 4IQFA 1XHLA 1XMJA 2OHJA 1A2OA 4DJTA 1DKOA 4LXYA 2UKDA 3L4EA 4TSRA 1GAXA 4ZOLB 1KHTA 3TD2A 3BMCA 3REOA 3V3KA 5HM6A 2F3UA 3BSYA 3N05A 2F9FA 3OZTA 3H65A 2Q7OE 3VDXA 2DECA 3NNDA 3OOWA 2HXYA 3HADA 5EIOA 2C2GA 3N1UA 4X1OA 1K7XB 4P4SB 4RXUA 2BDEA 2IEBA 2HNAA 4KI0A 1M83A 1C3OA 4O2AB 4E5UA 1XQ1A 4YR9A 4B4OA 1UQTA 4LHWA 4OGLA 1G41A 4TXMA 4LGYA 5GGXA 5TVKA 5DASA 3AU8A 5FWXB 3OIYA 2DERA 1I5OA 4ENTA 1NBMA 5LYJB 2A9PA 2PWPA 3OWXA 1HFEL 3PFFA 3U3XA 4YRPA 1QH1A 2RGNC 3HYTA 3L6UA 4I0WB 4MUAA 4U2DA 2VAWA 2G8NA 3IOMA 4PRLA 1TU4A 4QBTA 3LW8A 1E6WA 1RMYA 4U0JA 1DO2A 3HDJA 5F12A 4BECA 1BE0A 4LY3A 1U28C 4HRYA 1B41A 3NC0C 1UPXA 1Z3IX 2Q6IA 3QA3E 4R9UC 3EMBA 1RHJA 4X65B 1TTPB 2OQIA 4HDMA 1U9YA 1PS9A 2ADMA 2NUPA 4MWDA 2H18A 3PTLA 1V3UA 5JRJA 1UXHA 1VLJA 3E4DA 1C0LA 1WCV1 3D4IA 3W7BA 3VX3A 4GXQA 5BQ5A 2GZAA 2QJOA 4ND4A 2G28A 2IUTA 3ANYB 2EX0A 2LTAA 2MR6A 4MZDA 3BMQB 4UEKA 3THYA 1AURA 3Q87B 1JHPA 4UUPA 2V74B 2WLTA 4Z9YA 4MI9A 4GI3A 4OI1A 1HURA 1K8RA 1R6TA 1W5SA 2DR0A 2GD2A 1PD1A 1Y4UA 3MA0A 3T8YA 1DBVO 4YXWA 1OBVA 1U8EA 5ICGA 3RRJA 2M6LA 4IXJA 2Q46A 1I32A 3AUYA 5LP6F 3JQ8A 3U09A 3CFHL 4JLAA 4Z7NB 2Y05A 3AFIA 4MRVA 2NVWA 3ETDA 4FZRA 4M0DA 4MTLA 5G0WA 3W1VA 2V7QA 1YR1A 3PR2B 4L7VA 3RFXA 1EXDA 3SKXA 4G2TA 4MV7A 3O2JA 4YCAA 5KOHA 1N34B 3KOMA 4QBKA 5LZ5A 1YKSA 2ZEJA 3HA3A 3HN7A 4EHDA 1IG3A 2ISCA 4HNTA 2BISA 1DL5A 2DE0X 1ZAKA 4YTEA 2EQAA 4A1FA 5DNDA 5A3RA 3D02A 1WQ4A 1ACJA 2VHEA 3IHWA 2OD9A 4ZA2A 2H2FA 1AB5A 2XBLA 1YK1A 3A10A 3EPPA 4YYEA 4BE7B 4LF8B 1DG3A 5CLQA 1Z2OX 5JRDS 1JU9A 1TKRA 1W6RA 2QRVB 2IHUA 1WMFA 2EL9A 1DCTA 1F3OA 5EAIA 3ZWNA 4FYKA 1W34A 1DTWA 1WPGA 4UHJA 521PA 2JLYA 3SNHA 5KKAA 1XVAA 3C6BA 4BNMA 1KY3A 2PZEA 1O5IA 3SC6A 2Q3JA 1JEOA 4HR7A 4JJ6A 4COKA 5CD1A 4TTPA 4YJ3B 1KDOA 3IKLA 3ZWKA 2VF5X 1K66A 1YB1A 1P1KA 3B7WA 2IOHA 5G4KA 1GFSA 2FZGA 5K8JB 4GKAA 1TT7A 3LXXA 1BEUB 1P77A 1A95A 2MTBA 4H7KA 4UASA 3DDNA 1Q92A 2BDTA 4X8HA 1V4NA 3ENWA 4H27A 4AIIA 1KEZA 4EYOA 1DJLA 1ODIA 1AKMA 2JFBA 5FKJA 3DVSX 1XQYA 3MCZA 4XJXA 4LNUB 3UH0A 1AXEA 3CONA 3UOAB 1OWMA 4RMJA 3ORYA 1JTFA 3WGYA 1F06A 4F2DA 1TI7A 3CRNA 3D3KA 2V7GA 2LVBA 4BC1A 1P9OA 2ZBQA 2QRKA 1XRMA 2Y0BA 2IBSA 4IIYA 5FEMA 1XAJA 4INZA 3FM9A 2VZ0A 4OB6A 4E30A 2DETA 3RKSA 2RH9B 2KW5A 3L4BA 5IYZF 3NC4A 1HE8B 3IVGA 5EWJB 2I78A 2V5UA 1K7SN 3GLSA 1E6MA 2IH4A 2I1VB 1ISGA 1P80A 4IY1A 2BZ0A 3KV3O 2XTAA 1VL2A 3RIMA 1J07A 1FDVA 2QW1A 2R6CA 3OKAA 4BNJA 3Q0TA 3URMA 1U8TA 1QOQB 3C6KA 4KC0A 4NMXB 1V5FA 1GKLA 4IR7A 2YYZA 4W82A 2G88A 5ESDA 5TPWA 2PPVA 4BVGA 3FWHA 1EDEA 4RKWA 1S01A 2AMJA 3HR4A 4LJLA 4KXVA 5DWVA 3W2EA 2G1AA 1FRFS 1Z45A 2BGMA 2HBQA 2I22A 2J5XA 3K0CA 4OSPA 3RYFB 3PYMA 3UJBA 2AFHB 3D3WA 1J70A 3BQMB 3GO4A 1DJNA 5F1PA 3IDQA 4F7DA 3L1KA 3RYCA 5BNTA 4N0MA 2WSYB 2WPDD 3FNRA 4MJ7A 5JS1A 3A4LA 5JC8A 4YQFA 1VKZA 4V02A 4R2XA 1OFUA 1RQXA 4IDQA 1QHNA 5BT8A 4E1AA 4EUKA 1AG9A 2CVOA 4R41A 4Y2UA 3EAGA 4JBHA 3GEGA 1AGRA 4X3PA 3ZZMA 1FTWA 2HFJA 1GTVA 4F7WA 3PT5A 2HBRA 4D99A 3PNPA 1X1CA 4ZQCB 1E20A 1Z56C 4XE5A 2X8JB 5C8XA 5LWQA 1K27A 5B7QA 1I4WA 1W4AA 4ENPA 4BX8A 1CB7A 2GOYA 1E0JA 1C50A 3OIGA 3FDFA 2BM8A 2IUUA 1P1CA 5CIWA 4AKHA 3LAWA 1YMQA 1XEXB 3SPXA 3A7DA 4B7AA 2A30A 1N6RA 4P1ZA 2V5AA 3WWEA 4II3A 4ZCQA 2IYVA 1TIBA 1DEHA 5EGSA 3X3HA 4FD3A 4E15A 4YRNA 4EB8A 4N65A 3S1AA 3R5KA 1HA3A 3V7NA 1NE2A 3G0CA 3L0IB 2JCVA 5KSYA 2OSVA 2O9JA 3QHPA 1KH3A 4JUDX 3U4DA 2FZEA 1I6KA 1CBUA 4LOIA 3R20A 4UNPA 1NW5A 3ZQ6A 2C5GA 4DVJA 3B1YA 3R7SA 2VDNB 4I50A 3RVBA 2YWDA 4LDZA 1PZGA 3OLWA 5LLSA 3Q2OA 1N0VC 2E4AA 3M6XA 3KYDA 5CA0F 2JIPA 4J6FA 3TZQA 2HUPA 4Z9BA 2O2IA 3EJ6A 4WLOA 3VOBA 4JV5B 5C5IA 3EBOA 2R6R1 2BH9A 3KSUA 2R85A 4ZRDA 3PEVA 3IBYA 1FFAA 4K9SA 4NU0A 3N8KA 2EJCA 3IL2A 2I66A 3P9CA 1SU4A 3DNPA 2BF7A 3DMNA 1YNOA 2AZXA 1JKFA 1Z13A 3LMKA 4ZP1A 5IK2A 1VJGA 3U44A 1SBTA 3HXQA 2ZE8A 1RQ2A 2AFRA 4G0QA 3I9FA 4MRMB 2ZYUX 2J3HA 1Q3TA 2I9PA 4GIBA 1CEYA 4CI0B 1L9XA 1G5PA 1T2UA 2HT6A 3WGZA 2OAP1 3TPCA 5J47A 4ENSA 5KS2A 2WC1A 1KY4A 3OKCA 1T5TA 3EXG2 1QE0A 3PJEA 4J3JA 3UJ6A 4Z1OA 2I4RA 1D07A 5DNVA 3F4KA 3I32A 4ESOA 2ZROA 3U7GA 1WDKA 1VE3A 3H18A 3Q4GA 2PUCA 2IPAB 1A4IA 1I4OA 2QRQA 2GHQA 4EX6A 1VSQA 1ADGA 1YB7A 2R68A 3CCCA 1QR2A 4MX8A 4ZOQI 1XVLA 1GGNA 5BN5B 3N28A 1LW7A 3QKSA 3U4CA 2JGNA 4HWRA 3B1FA 3EZFA 5F76A 2BP7A 2GYYA 2V3VA 2XVYA 3TLBA 5J4KA 3JCZA 4YCBA 5ECDA 3BF7A 2H5JA 2H16A 2WNSA 1MAAA 1PLLA 4BQNA 3FKSD 1BJTA 1L5OA 2Y92A 4QYSA 3IEPA 4YQYA 3BJRA 3MG9A 5ECYA 5HS6A 4F56A 4X6UA 3E61A 4DA8A 3J81k 4G65A 1OLSA 2B9VA 2PSJA 3FG9A 3I28A 3UJPA 1LLFA 4FFWA 3WGTA 3U5ZB 1FYEA 3FX2A 3LCMA 1UZMA 1M0SA 2FSGA 4I4CA 4MS1A 1S1CA 2IBMA 5KO2A 4OEHA 5DMXA 1UL1X 1VPVA 2CCKA 1V7CA 3PIIA 4HTAA 4KR0A 3K1AA 2O1SA 1X7XB 3ZCUA 3DAFA 2IODA 3KEGA 7ADHA 4OXNA 4F9EA 4QVGA 4JJ4A 3V7YA 3DLPX 1KFBB 1NXWA 5IF3A 1KARA 1QGUB 1V11B 3K9WA 3B51X 3E3MA 3WNZA 3OU6A 2OBLA 1W2HA 4P4UA 3DCJA 1JMYA 4X60A 3W79A 2R4QA 4UM9B 3N8NA 1L4MA 4MGEA 5JDIA 1HTBA 1V3VA 3L6BA 1WNFA 2G0AA 4NFHA 4V1CA 1X77A 1I1QB 1GAEO 3LCRA 2X76A 1I7PA 5HQJA 5EGNA 1JZSA 2C29D 1TAGA 2AFIE 2F1RA 1RFGE 2R65A 2V59A 1O77A 3N2NA 3PNSA 4WA8A 3D0RA 3L8HA 2QLFA 1A0OA 4NZ9A 5CAEB 5SZJA 5B3AA 5SZIA 3WS7A 4F6CA 4S0XA 3BD7A 2BEWB 3QVSA 4JBWA 1POXA 2XUJA 3W05A 3OWOA 4QQ8A 3HVJA 3JQ9C 4U2BA 1SD2A 2FEWB 3O8QA 3FXAA 1KI9A 3OQIA 1TC1A 2WPDA 4Q9NA 2V3CC 1RAHA 3NHSA 3ZTYA 1E0KA 2PH1A 3PQ4A 1U98A 2VHXA 4WBNB 2OVFA 1GL3A 1Y3CE 2O23A 3LSYA 4TL6A 4UE3S 1DAEA 4HWKA 5KAMA 3QV1A 3CU5A 1H8ED 2PQ2A 4MB6A 1HR0B 2DPGA 5BSGA 4OOFA 2C4VA 1H3FA 3STWA 3MSXA 2YFHA 4NENA 3LX4A 4YK7A 1NUTA 2WFLB 2IV7A 3PNLA 4M0LA 3RR2A 5C81A 3IEMA 1P5ZB 3NM5A 1RYNA 3QVWA 3FHLA 3E2MA 2CFCA 3A4VA 4CMCA 4GRDA 1NR1A 2C4NA 3IQXA 1M75A 2H11A 2J6IA 2OFWA 3ND5A 3V9AA 5CLJA 2SCUB 1G7TA 4JBGA 4KNWA 3DS8A 4F6LA 1V71A 1P2TA 2NUAA 3W5DA 4B3DA 1Z63A 1XEFA 1V39A 2XMGA 4HCJA 3EQ6A 4CPDA 1ISSA 1MIOA 1O89A 1X0VA 1VHDA 1Y3BE 4O29A 1GV1A 4W4TA 2XYVA 5EUBA 3BIXA 3GEMA 4CTNA 1ZJWA 1DC3A 3GGPA 3R5TA 3AF4A 4C5AA 3CVWA 4TL7A 1FQJA 2NV2B 2O05A 3JZFA 1NVKA 4YACA 1YQWA 2ZIZA 3GIDA 3L43A 3IODA 4DDKA 1SULA 3QWBA 2A88A 1K6EA 5CJ2A 3U7HB 4PGMA 3UMCA 5LP6C 4WOKA 2VOJA 4ECEA 2IWHA 5LR6A 3KSAC 3P9YA 3UANA 1RP7A 4E46A 3OJWA 1VL0A 1ZRMA 3RASA 5CDFE 3A32A 3T7AA 1CG6A 4MW9A 5LPNA 1SVSA 1O3YA 3TL6A 3CKLA 5FBLB 4CTOA 4YJ3F 1TYEB 4E2ZA 4Z5XA 4OU4A 2QVGA 4N6GA 2ACVA 1X0XA 1TK9A 1NT2A 2F3SA 5FWYB 1T8WA 3LO5A 4WCFA 4XQ0A 2DP4E 2ZU6A 1URPA 3K92A 4H31A 5EXEA 4YCCA 1LBSA 3UV7A 3M4YA 4UU7A 3WY9A 2PD4A 5J63A 3EDOA 5DX8A 5EIWA 3V7WA 2A0WA 4AKEA 2GEDA 1XLUA 3N86A 3B60A 3BIWA 1YIDA 5L51A 5THQA 4I46A 2EGUA 4EAAA 4ZZ0A 4XA8A 1K68A 1CNEA 1VCMA 4KK4A 3CF6R 5J2TB 3F6RA 1OGJA 1WUTA 5KOJB 4UHEA 4RPGA 4CIBA 1G2OA 1J2EA 4EZIA 1VQ1A 4TKZA 5KYGA 1NBHA 4RXTA 3R8XA 2P5SA 3DO5A 4FHFA 3LDGA 1PVDA 4RVHA 2EXXA 5ELXA 4A0HA 2O3UA 3DKRA 1XRRA 5EJ4A 1ZKMA 2AOVA 2FEPA 2GA8A 1T5HX 4ENRA 1WETA 4Q18A 3C15C 4UD6A 2JLBA 3QENA 3DQZA 3QPUA 5JECA 3U26A 4A5OA 5ITSA 4X9XA 3W9BA 3PQDA 3H5LA 1KMQA 4P84A 1TE2A 1WZEA 3WK7A 4PONA 1KRHA 1Z5GA 2FW7A 3ETCA 3FKSA 4WADA 4AJJA 1MC1A 3N5CA 3VC3A 1VPLA 3HCWA 4MVCA 3RDPA 4PTYA 3ROFA 7AT1A 2NP7A 4G0PA 3COWA 4HDQB 4PHHA 4FW9A 4J6EA 2D2EA 3O83A 1NU6A 1A9SA 2M2IA 4DT1A 3KJXA 1WRBA 3SE0A 1Z12A 5F3RA 4CEIB 3HKCA 2P8JA 3SF8B 5E9AA 3IOBA 1G8AA 4BL5A 4EDFA 3FFTA 4IBOA 1NHGA 3ZHQA 5MN5A 4ZZ2A 1GGEA 1PYGA 4ZANA 4YDQA 1SOWA 3BXGA 5I9TA 1NAIA 4V2IA 4J1NA 1XTSA 3L7KA 5C8VA 4IJ5A 4A8PA 4I9GA 1N8TA 4Y2JA 2NVBA 5FTWA 1L7EA 5E1MA 2HRZA 3JQFA 3ZWMA 3AM4A 2GPNA 4XCQA 5A2GA 5BV8A 2G5GX 4ESVA 8MHTA 4GX2A 2A4MA 4XM2A 3KUUA 4NS1A 1V4BA 2BY4A 3AM1A 1OASA 2HWYA 3WA7A 1DAOA 4PYNA 3BWMA 2YXEA 4HGOA 2F7SA 3PQ5A 3QVMA 1E92A 5ICFA 4ZI7B 3V8RA 4CCWA 2O2SA 2VHVA 2PGJA 4CHTA 2NTJA 3VKGA 3BULA 3TS1A 4LDPA 5JRZA 5KQSA 2VYQA 5IFKA 3L6EA 1BXRA 3O8DA 4IF4A 5AK0A 1HSOA 5L95A 4WKGA 1UJ2A 2PUFA 3FLEA 2CNOA 1M73E 1MKYA 4RZIA 1PTJA 5TGTA 1YQUA 4ZO7A 4DHEA 3RW9A 1KZGB 2ZU0C 1A2QA 5LQSA 5T6BA 3O75A 2AX4A 5KU1A 3FDXA 3EXIA 2B99A 1ECBA 2R8YA 2JJ2D 1ZM3A 1WTAA 2JI9A 2ZRPA 4PC7A 2EGHA 3ET5A 4G0XA 5IDWA 4LWOA 4U39A 5BW6B 1BW9A 4UCWA 2QY9A 2QAIA 1S9HA 1WCXA 3OLZA 4YVFA 2BRUA 5DBEX 3AJ8A 1Y9DA 1E7SA 3SZRA 4HWGA 5KYXA 2KI5A 2P2YA 1HY3A 6YASA 3QFHA 3RJMA 3A1NA 2BJHA 4RJKA 2VTDA 3WGJA 5ITZB 2ZSAA 5B6IA 3Q8MA 2WD7A 3D1JA 3HKBB 3MUEA 1W94A 5J3JA 1IAVA 4Q39A 2A57A 8ATCA 1GADO 2BUBA 2IYYA 1SHUX 1FU8A 1F5NA 2PZ8A 3D8UA 4ZVUA 3U16A 4BLPA 5HX7A 2B37A 1JUDA 2C8LA 1IXRC 1NVTA 4CW7A 4NYMQ 4ZMRA 1LPAB 1JHRA 4X71A 1I3CA 1S89A 2QVCA 4MITA 1EBBA 4IJMA 5IJAA 1M7GA 2Q5EA 2IIPA 2RJ3A 2IZ5A 3A05A 2VWQA 1KI3A 3R77A 3LQRA 1PTKA 4TL9A 4G4SP 3KD3A 4BTLA 2QA5A 5ILGA 3FUXA 1RWWA 2PXAA 2W71A 3P0IA 5K4AA 4AY6A 5E6SB 3ER8A 4N1AA 4XVRA 1ECPA 4Y6QA 4BNYA 2PVSA 2FPRA 3F8WA 1P9LA 4RMGA 1GNLA 2ZSUA 1DIBA 3X2SA 9ABPA 1VMKA 2BFEB 3BRWD 1OBCA 2ZRGA 1W93A 2QL6A 2P9GA 4OGGA 2YIDA 1P1JA 4YUWA 5FB3A 3PXDA 4IDEA 5CFOA 4PTZA 1NU8A 3GOQA 2IDKA 1UBRS 1UEJA 5LP1A 1ZJ6A 1C8LA 1E8NA 3P0RA 1AC5A 4YBZA 1DAFA 4NE2A 2YZKA 3CM0A 1HE2A 4XRGA 2XHEA 4DIDA 3K71B 2J9ZB 5H81A 1J2YA 3S2SA 4NHEA 5I9IA 1Q14A 4QTYA 2RD2A 2R4UA 3W5JA 4QULA 4D45A 4LYGA 2V8OA 1KO5A 3DYBA 3K7EA 1WSAA 3K53A 4OQ4A 3P96A 4YO8A 4I8DA 3D5TA 2HZ7A 2H2IA 2XTNA 4RSMA 4IJUA 3JAMA 4RTRA 1QPZA 4IF6A 1PWYE 1Z62A 1A2KC 1O4WA 1WSBA 1OWLA 3WK4A 2BSQA 3NANA 1X2EA 3DVAA 1Z33A 2Y1GA 3CEAA 2HJWA 3G82C 1PR1A 2NU6B 2XW6A 2PBZA 5DCLA 2HK7A 3FN4A 4MS3B 4K87A 4WL0A 4B5LA 1LWOA 4UVEA 4EMUA 1Z82A 4UHHA 3DZ8A 4ZYVA 4G1VA 3D1LA 2E0IA 3Q6MA 4WJZA 5TS2A 2P35A 3BSSA 4QHSA 3TCNA 3W5HA 1L5ZA 2Z3WA 4CIXA 2JIDA 3AHCA 3B38A 4GOXA 1AQ6A 3UHFA 3CLUD 5LVAA 4N41A 1U9IA 2D6FA 2FRXA 4REQA 4YAIA 5JS8A 3JQAB 1EG7A 3HTXA 1GNRA 3HI4A 1Q74A 5MGNA 2R8ZA 1M1YB 1V8ZA 1SPXA 3IP6A 5DIFA 3LW7A 1RZRA 1JXQA 1EQ2A 3A70A 4OFXA 1U1GA 2CC2A 3ABRB 1KEPA 4OBXA 3RU7A 1GGJA 3LDUA 4MW0A 1EQAA 1U2ZA 2C7VA 4TV8B 4QARA 4U9IS 2IV2X 2CNKA 3FYCA 2O8EB 2QM8A 3DSRA 3LD9A 1C30B 1ST3A 2XB8A 2ZIWB 2ZUSA 4NDAA 2XT6A 1CUJA 1LZLA 3DZGA 1QB8A 4WBNF 5FOVA 5L40A 4OHXA 1T4BA 4F5WA 3VMFA 2C9MA 5AWFC 2BELA 3OZGA 2FLVA 2OZLB 4FEEA 4HB2A 4R31A 3NP9A 4RA6B 4A5SA 1LBQA 1TYAE 3EQZA 3WBKA 5J2UB 3TLMA 2BI4A 4KE9A 1U11A 2JJ8A 2VZEA 3O9MA 3QNUA 2QLLA 4P7KA 4DYVA 1QYRA 2VH5R 3Q7IA 2GSWA 4HEHA 4RV9A 1ISFA 1FLNA 4JR2A 4OQDA 4ECAA 3C7CB 1U5AA 3NVMB 3G0GA 4N54A 4NQZA 4Q6BA 1J4AA 4RD3A 3U40A 2FDRA 3G0OA 4PBSA 3MMSA 5AW8A 1UUFA 2DPXA 3ORFA 1D2RA 3NH9A 1CW2B 2OHFA 4EJFA 5PNTA 1Q7CA 4A91A 3GNTA 2HK8A 4RH0A 4UQPA 4U6QA 3V3TA 2XITA 1V7ZA 4D9FA 1K97A 1CY1A 1RXEA 3E9MA 1CRLA 5LBUA 3WZLA 3LZCA 4AF8A 5ALNA 5B6PA 4G9GA 3ZNNA 2X0IA 2QQ5A 4HLCA 1H2XA 2N47A 3PI6A 4IHJA 1TT5B 4DMUB 2JJ2A 5FULA 2IHZA 5YASA 1UOPA 4Z0HO 4YMGA 1Z4NA 3WO0A 3ZG6A 3K09C 1VFPA 4C6TB 1A9XA 4PICA 5C37A 2P79A 4NAHA 3QX3A 4TLMB 2I4NA 3S7ZA 2AMLA 2H92A 4DREA 4H7HA 1QH9A 1E9BA 1LPBB 1P62B 4HGRA 4X7MA 3NVDA 4ZAZA 3KCQA 3QLJA 2QORA 3VU1A 3EVZA 1NW3A 1ISPA 3DC2A 1K6MA 3LT1A 4B43A 5LQUA 1RBQA 3BYZA 4ZIRA 1IXZA 1AQLA 2I2BA 2WVGA 1IM2A 4G1EB 4JBNA 4TXHA 4B6SA 3PL5A 4LYYA 5AXAA 3CIFA 4IX1A 2DWOA 3M4JA 3IIEA 1I6WA 3O84A 3PFIA 1CUZA 1Y5RA 3HYNA 1I2CA 2P2ZA 4O8CA 1CQXA 3UN1A 2HLDD 4V38A 3ZXXA 5IANA 1QP0A 2B1JA 5AM2A 3VKFA 2V6JA 1OA1A 5AOAA 4BN5A 1EKXA 5J2TF 4UOEA 2J0QA 3FTEA 1YR8A 4R8MA 3EPRA 3KUXA 3PHIA 3RWMB 1PL0A 1Z4MA 5K9ZA 1U9ZA 1X86B 1XU7A 3THXB 3PZBA 4IFTA 2F3PA 5AICA 3FUCA 1HT2E 4H7IA 3QBTA 4Q7LA 1L7AA 5BSFA 5GJBA 1ZCFA 3DZJA 4L9RA 3BSWA 3Q9LA 4CJXA 4BLWA 4ZO4A 4M53A 3GOHA 4ZT3A 1VLMA 1E2NA 4LXQA 2I2FA 4OXQA 1ZNXA 4X61A 4ZQGA 5FHRA 1SIBE 3GRRA 721PA 1E79D 2H08A 1UKEA 2WWFA 1H85A 2P9JA 4LW8A 3WQQA 4S1OA 3GK3A 1OSNA 3QMMA 4KQJA 4HV4A 1DJMA 1XP8A 13PKA 1MJHA 1G20A 1MJGA 3CRRA 3DHWC 3VKHA 2PJDA 4JC4A 4BLQA 1ZUHA 2EBWA 1QIHA 1TJ4A 4ITRC 3UYLA 5BW0B 3X43A 1OC2A 2A50A 1UBTS 3BMNA 2ZYIA 3EIEA 3IUEA 4ZGBA 4WSOA 1PNOA 1EUCA 2ZPTX 3CS3A 5BO5A 2VJCA 1IHXA 2NO5A 5L4NA 3FMVA 1WVMA 1KO4A 2VFAA 3RC1A 3EG9B 1DKQA 2DWUA 4LF7B 3EDQA 4XCXA 1IY1A 3VUEA 4DRYA 3Q3IA 2CJYA 3F3MA 3TR6A 4M9ZA 1P8AA 3P5SA 3AR8A 1LEHA 2D1QA 1HXHA 3I52A 4FUQA 4WY5A 5AW3A 4JT4A 4M1TA 3WHPA 1ZRNA 3EDRA 4NZNA 1KZ7B 2ZYRA 5AKKA 3ESZA 3RKUA 1CB0A 1RLJA 3H6GA 1Q1AA 4YXFA 4Q9HA 4GVLA 2CCJA 2Q4TA 1A4RA 1JR3D 3O95A 3RB8A 3LNCA 4WZAE 5CGQB 4BE4A 2FCAA 4F3YA 3ICOA 1UOEA 2IWRA 4AD8A 4MWGA 5CNMA 3RHFA 4LNHA 3AHFA 1LA2A 1C9KA 2JASA 3BXXA 3GRZA 5D1HA 1AMUA 3WG9A 3RU3A 4EVQA 1IDOA 1P0QA 4TRJA 4RM3A 5KSZA 1KEKA 5GJCA 4A8JA 1LB1B 1FTNA 2JZNA 5JCPA 1JLMA 1US8A 2NZJA 4HTFB 3N2KA 5DHTA 4DYHA 1M2HA 3B20A 4Q4AB 2Y66A 1SU6A 2YY7A 5HDBB 1GA6A 2VHCA 1JG7A 2PZKA 1F2VA 1Y8ZA 2ERYA 3JARA 3OQMA 2J4DA 4LS3A 4PCAA 5FNVB 1Q6YA 1T29A 3ISVA 4BZQA 3EGOA 1Z18A 3I2YX 1GY8A 3IQIX 4C88A 4FYVA 4HQ0A 1EUZA 3IR7A 2Q9BA 3IUJA 5AVRA 3HSKA 1RI5A 3AEQA 3B3GA 3X2FA 1UJ4A 4IIGA 4Z1MD 1WEHA 4K5QA 1PWXA 4PSAA 2Y1LA 3H16A 3KSBC 4O4LA 1E61A 5BOSB 1XDUA 3HEMA 4KYIB 2ZT8A 2BHRA 2FLWA 4ZCIA 1Y4AE 2ZJ5A 3GEDA 4MW1A 1E3JA 2BFFB 3UXEA 4B76A 2EJBA 5I7FA 2OV1A 1YJAA 3BD6A 4GMXA 1HLGA 2VAMA 5HA5A 1QGYA 3PZRA 1GZSA 1WHTA 2HSEA 4IZHA 5AJYA 1Z6AA 1PBNA 2WA2A 1GCUA 4DAOA 2RONA 4RMHA 2WM9B 1N2OA 1JU4A 1LDMA 3H87A 4FCVA 3OI7A 5A05A 1ZN2A 1U6KA 2XAAA 4KKXB 2NU7B 3QTLA 1PE0A 4ARVA 4Y9UA 1F14A 4WKOA 4BKRA 3GD7A 4J1TA 2GO1A 4G9BA 1UCFA 2FEKA 1OGIA 1W1UA 2B7BA 3JPWA 1MAVA 1V8BA 3KWJA 3NTUA 3N8GA 4WKCA 2W00A 1SRQA 4RCYA 4WKPA 5I5GA 1LXCA 2BBSA 3MWEA 4ARCA 3EEFA 4Y18A 2HBZA 3EE6A 5E38A 1Q0PA 2C3UA 3Q5DA 4QUAA 3LX6A 3VTFA 2N3ZA 2PT5A 2PL1A 4JY7A 5IKOA 5TVGA 3HZOA 4OHPA 4EKEA 1LK0A 4CVNA 2A1UA 3L7IA 1YBHA 4K8OA 3RUDA 5TDHA 4B48A 2W42A 3ASZA 3R7WB 2AQKA 1QAQA 3PDIA 3A3NA 1NULA 2GRJA 4YRTA 5LUAA 4PU0A 3RRYA 4WESA 5A6SB 2FPIA 1YE8A 3W5SA 3INNA 1KZ6A 1XLTA 3DV0B 4AAYA 2VNIA 4CN9A 5C2JB 1O58A 4M36A 4HG2A 1JAXA 1GXSA 1K06A 1E0DA 3MQFA 4L8VA 2HLDA 2JRCA 4J8PA 4AQDA 1IQ0A 1T4GA 1BZYA 3ZY4A 1G66A 5FPPA 1C8BA 5H9WA 4YT4A 1I2AA 1K5DA 3OPYI 2PANA 3OZWA 4JDPA 2OCDA 3QVUA 4C1BA 4PNEA 1P44A 3VJRA 1U3GA 2XUAA 2O19A 2XCSB 1N25A 4IQ8A 4LHZA 1ZH4A 2J7PA 4MHTA 1LVGA 2BBWA 3UCEA 3UMJA 2W2NA 5E7IA 4CM6A 3H9BA 1IVSA 2A0UA 1C9YA 1C8KA 1OIXA 3FTCA 4OI2A 4UUMA 5U4QA 3RTBA 4JI8B 2QLBA 1L3IA 2O0MA 2RAUA 5DOZA 5HS4A 1W85B 4YALA 1ZITA 1E79A 1FB5A 2FZLA 3FNBA 2GO7A 2HJ9A 3BX1A 5T8KC 4E5KA 4YYZA 1QHIA 3E9QA 3GLFB 4CEJB 1ZJZA 5BN3B 3TRHA 3HFRA 4KACA 3D3NA 3KOYA 4GMKA 4X24A 2P9EA 2WUWE 1EFAA 5DLPA 4P7FA 2PX3A 1CC1S 3LHKA 3WVNA 3NBMA 5D7NA 1ZD3A 2NYAA 4CR7A 1JDZA 4YQZA 2W98A 4PO9A 4E5YA 1Z0JA 2DQZA 2EJUA 2JFVA 3GJ7A 2XMRA 3KFVA 3LJKA 1KJWA 1HRDA 3CJTA 1YDHA 2AW3A 3CRQA 3P27A 4IIHA 3WAJA 1J21A 2YXDA 3SQLA 2FPLA 1IM5A 3NW9A 4WK4B 4DUGD 3EMDA 3ETNA 1Z7WA 3IQEA 2UZ0A 5IJ9A 5KCZA 5F23A 4URYR 2FPKA 2WVJA 4P33A 2QKYA 5D2CA 3GUCA 3MWLA 2AW5A 2G2SA 2QRMA 4X54A 4D9KA 4KPUB 1PD0A 2YZ2A 1CLEA 3MHTA 3EW7A 3FNGA 4WTOA 5CFPA 1YRWA 2CY0A 2A86A 1JAYA 3VJKA 4OYHA 4Q05A 2XMSA 2ZSJA 3LF2A 3HN6A 2JGDA 2ZSHA 3CX4A 4NY1A 3TQQA 5CB4B 1G8JA 3GUUA 4OHUA 4PLVA 3H8JA 4B75A 5CDHA 4AO7A 3QZUA 1HT1E 5BV1A 4B3FX 4IPTA 3RUAA 4WRRA 4UZEA 3BMCB 2OBMA 4BKPA 4DARA 5CMLA 4BQEA 1WUIS 4ME6A 5KNDD 4X66B 1II0A 1QTNA 5C7YA 3LIPA 5K4GA 4NMHA 4HQLA 4NMWA 1KE1A 4M7RA 4U3JB 3UAVA 1KC3A 1AGPA 1Z2AA 2FEMA 3WRYC 3ZXIA 1T3TA 3IJ5A 3QVXA 4PS1A 5JCOC 2F2TA 1C3OB 1KK0A 3F6EX 1R8QA 4GOKA 4LF6B 1JYEA 1UDAA 2CD7A 2VCYA 1D2CA 4UDXX 1H1DA 4Q34A 4EYQA 6PFKA 5JJ5A 3TDKA 2BEVA 5ERYA 4EG3A 2FSIA 3T9EA 2XMCA 1TQ4A 3AB8A 1QH1B 5KVCA 2AG1A 2WVHA 3TZHA 4CR8A 3C1TA 3PGMA 1QIKA 4PXYA 5D8DA 4LMRA 3A2MA 1O94C 1GV0A 2QTVB 5FT9A 3INRA 3HCAA 3KD2A 2PMDA 4X90A 4D98A 4Z1MA 1T2EA 2VSFA 1QO0D 4NBLA 5F98A 4HDMB 5EE3A 1H6CA 4A6XA 4B4WA 3D6VA 5LDDC 1LV7A 3JAKA 3T5DA 1XQ9A 1EINA 4K9PA 2VPIA 4IRXA 4E6PA 4F97A 2VWPA 4NXNB 3E9YA 4FOPA 3RC8A 3DT8A 1LLCA 4DR4B 5CHEA 4MP6A 3J7AC 3ZY6A 4BVBA 4DJEC 1GD1O 3FOBA 4J3NA 1ADYA 4FR0A 4YRRA 3AFMA 3PA6A 4XPIA 2G16A 4UHCA 5COAA 1KFJB 2GPTA 3DZHA 4AZ0A 1YQ9A 3L7JA 1M7BA 3DLHA 2ZRHA 3COYA 4HKTA 4DXHA 1RYEA 4YAKA 6Q21A 1QRTA 2WG1A 3T5MA 3KR0A 3EWSA 1V26A 2H48A 5K3BA 1KDPA 3LTNC 3LY5A 4XZ3A 3RROA 2IU0A 1P33A 4FT2A 3WRWA 1FZQA 1T9GS 3PIDA 4PBRA 5C9ZA 2H29A 2N1BA 5FLYA 3FDZA 1GCGA 2NZWA 1LQ2A 1T4CA 4UCQA 8ADHA 3T7IA 4Q3BA 1S8AA 3IAHA 3PU6A 4QU5A 4S05A 5SYAA 5KOHB 1EWKA 1XLVA 3A6DA 4KLAA 3C43A 5F33A 2WZBA 1LNSA 3FZQA 4G4GA 4LZWA 5JQGA 1Y4SA 3URKA 3IP7A 3NJ8A 1O96A 5J5AA 1FNNA 3CE9A 3EZ2A 2XB6A 4Z0NA 2P9HA 4EB6A 2JLVA 1P9NA 4DFDA 3TKYA 4G1FA 1Y42X 5SY9A 4EEZA 1Y3FE 1U8UA 2KPOA 2R96A 2BT4A 1TEXA 4MINA 5G0SA 5ALOA 3ZJ5A 5EJ7A 2B35A 1FRNA 2JH9A 3UA4A 3MEQA 1GPDG 1H6BA 1Y7TA 1NZFA 1Y1RA 2EDAA 3O8CA 2IPXA 1DTWB 5I7WA 4GH5A 5SY6A 2VJNA 3OKPA 3LXRA 2BLLA 2QR3A 3KDAA 1X3LA 3GFRA 2PBLA 1T1RA 3IC5A 3T7KA 4LFBB 3NGMA 2GK7A 4PNZA 1E1CB