3IVCA

Crystal structure of pantothenate synthetase in complex with 2-(2-((benzofuran-2-ylmethoxy)carbonyl)-5-methoxy-1h-indol-1-yl)acetic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
298
structure length
298
Chain Sequence
MAIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAGTDRPDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Pantothenate synthetase
publication title Application of fragment growing and fragment linking to the discovery of inhibitors of Mycobacterium tuberculosis pantothenate synthetase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 98
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3ivcA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3ivcA01
3LE8A 4FZJA 3RHSA 2R5WA 4MLPA 4MW6A 4QRDA 3N9IA 4YMIA 4U63A 1PG2A 1K4KA 3CLRC 1EFVB 4MW9A 1X8XA 2JA2A 4X0EA 5JBNA 4F3RA 2PXHA 1PFYA 2J08A 1WXEA 3VU8A 5FO1A 3NV7A 3IMEA 1XNJA 3Q10A 5IJXA 3N05A 2ZUEA 2DR2A 2X0KA 3CLSD 5K0TA 4DDHA 2QTMA 1EXDA 3A04A 1XNGA 3A05A 4KR6A 1Q77A 4DJAA 4ZCPA 5HUJA 4YP6A 3CVXA 2OQ2A 1KP3A 3SZ3A 1NYLA 1M8JA 4G6ZA 3FG9A 3FDXA 3GUZA 2PZBA 3ZJUA 3MUEA 1TQ8A 3PXUA 3CLUD 3KT8A 3SEQA 3A2KA 2QTNA 4GRIA 3H9CA 1WQ4A 2ZUFA 3TZEA 2WQ7A 1IHOA 1LI7A 2A86A 1R6UA 4U7JA 1K92A 2XRYA 2A1TR 1OWPA 2A1TS 1KH1A 1YIDA 4RPIA 1FYDA 4AS1A 1WKBA 2O5RA 1KKUA 3CVYA 3ISJA 4EG3A 4ZT2A 1F7VA 2J4DA 3UOWA 3IVXA 5F23A 1COZA 1GLNA 1N2EA 2VTBA 4KR7A 1JGTA 4U8HA 1YI8A 2QTRA 3H97A 4MULA 4TS1A 4L2IB 4MQ6A 1O5TA 1IH8A 1O95C 1QTQA 5J5AA 4MAFA 2PFSA 2CV2A 1F7UA 3TNJA 1MOPA 1GN8A 1N75A 1VBKA 5TGTA 4PBSA 1XNHA 4ZCRA 2E18A 1NSYA 1I6KA 2CYAA 2WB2A 1KR2A 1O96A 2WSIA 1EUYA 1T6XA 2NSYA 4MUIA 3TQOA 2QJOA 1Y42X 2X1LA 3N2YA 2VTBB 1NZJA 1J70A 1OBHA 3FI0A 4DDMA 3SZGA 2DXIA 1KQOA 3X1KA 1TYBE 3N8HA 3SEZA 3ZXIA 1JMVA 1P7PA 3AIIA 4K03A 1EFVA 4PBTA 1NUQA 1MB2A 5LM3A 3IOCA 1ZH6A 1VBNA 3H99A 2D13A 3SDBA 2CT8A 4Q93A 1N2IA 4CDNA 1A8HA 2J07A 2J09A 4NDAA 3L92A 1O94C 3ZJTA 1B6TA 1PFVA 2CUZA 5BNZA 2AG6A 1ZH0A 1JEEA 5HUHA 2XRZA 1F9AA 4EGAA 1R6TA 3GLVA 1PG0A 1O6BA 2O8VA 4XFJA 1GPMA 1MRZA 4MW2A 5H7XA 2PZAA 3IOBA 2NZ2A 3ZUGA 4PBRA 3IMGA 4OUDA 5K0SA 1U3CA 2H29A 4MW5A 2RE8A 2A84A 3CLTC 3RFFA 4EG4A 4MUHA 2JANA 4MUFA 2GOYA 1IVSA 3QTBA 3H9BA 1U3DA 3UMVA 3P0IA 1X6VA 1MAWA 1OWMA 2YWBA 4MUKA 2A88A 1VBMA 4HJRA 2CV1A 2PZ8A 4ZCSA 1JZSA 1EJ2A 4JZYA 4E1AA 1IFXA 5KCMA 4ZT5A 1QRSA 3HL4A 2HMAA 3CR8A 4MW7A 4OUDB 2AZXA 4G5YA 3KT3A 1J1ZA 1Q11A 2PIDA 1GTRA 3CVVA 4XSVA 2YWCA 2I1LA 5H16A 1D2RA 5LFAA 2YY5A 4MUEA 2V0GA 1QU2A 4L2IA 1EE1A 1KAMA 2OV4A 3HMQA 3AG6A 3FNRA 1O94D 2QUHA 1PFWA 3FWKA 3UY4A 2CFOA 2IP1A 1NI5A 2QUKA 5LLTA 1ULHA 4ZT7A 3RBAA 1YUMA 4KR9A 1N3LA 3HFJA 1VL2A 2HZ7A 1JEDA 2GKSA 1HYBA 1IQUA 1JHDA 1YULA 3DO8A 1LI5A 3ELBA 1OWOA 1QQTA 3IVGA 2CV0A 4MVWA 1KORA 3CLRD 3ZGZA 3AKZA 3IUEA 1N2JA 2HGZA 1GAXA 4MUGA 1JECA 4JFAA 1KQNA 1YIAA 1LW7A 3X1MA 4MWBA 2RD2A 3COWA 3MXTA 2CSXA 3X1JA 1WQ3A 2H2AA 1WJGA 5DEOA 1TYDE 3KT0A 2GM3A 3IODA 2E21A 3CA8A 1KH2A 4ZCTA 1K97A 2YXNA 4I6EA 4MVYA 3FY4A 1JIJA 3OTWA 3ND5A 3AG5A 2DPLA 2AKEA 1IQ0A 1J09A 3H05A 4NZPA 1M8KA 3DV2A 1TYAE 3I05A 4MUJA 2BTEA 4ND7A 1MAUA 4ZCQA 3P0HA 1H3NA 1WZ2A 3KT6A 4EG5A 3JXEA 1KAQA 3HGMA 1G8HA 5DB4A 1KQPA 2VXOA 5FNZA 2DLCX 4DLPA 4QBTA 3L93A 1I6MA 1OBCA 1ZUNA 4R2LA 2C5SA 1N2BA 1NUPA 2IJGX 3DLAA 3IH5A 1J1UA 5KWVA 3FOCA 3ND7A 1RQGA 2DEUA 1G8FA 4NAHA 4J76A 5HG0A 4I6GA 3G59A 1VLHA 4CT0A 1O0CA 1OD6A 1JZQA 1OWLA 1FFYA 1H3EA 3UK2A 3IUBA 1M83A 1O97C 2JAXA 4EG7A 4MW1A 4MVXA 4I6JA 2EL7A 4R2MA 4ZT3A 4YP5A 2E89A 1NURA 2A1UB 1TYCA 3FETA 5EKDA 1PFUA 4UZEA 4J75A 4KKVA 1N2HA 4S1OA 4Q16A 5FO0A 1O95D 1NUTA 3S3TA 3OP1A 1WY5A 3PNVA 4G5FA 3DPIA 3NBKA 1EFPB 3Q4GA 3PNYA 4KPUB 4A91A 4JYZA 3RK1A 1ILEA 1F4LA 1O0BA 4CQNA 1H1TA 4BWVA 3MLBA 2Z3VA 2WQ6A 3IDFA 1U7DA 4AQ7A 4NX2A 4UZFA 2ZP1A 3RK0A 4ZT6A 2D5BA 3VRHA 1WXHA 2X1MA 3RJZA 1R6XA 3C8ZA 2DERA 2BYTA 1KH3A 4MWEA 2B7LA 4DNXA 4F4HA 1GTSA 4ARCA 3F3MA 3KFLA 4MUNA 3ILVA 2DETA 4NAUA 1JILA 5IHXA 4ND6A 1ZJWA 1U0BB 1G8GA 3INNA 4JXZA 3ZIUA 3IVCA 1UFVA 4CDMA 4JXXA 3QE4A 3A4IA 3GMIA 1BS2A 4HJXA 3G6KA 1J21A 1JIKA 1QRUA 1IRXA 1MBZA 2IELA 4HK4A 1TFUA 2QUIA 5J59A 4WNYA 3AL0C 1QU3A 1V8FA 4OJMX 3Q12A 3PRHA 1N77A 3CVUA 1XJQA 2DUMA 1O97D 4R0NA 2CYBA 2J5BA 2A4MA 2A7XA 2QJFA 4K0RA 3VGJA 4EFKA 4WSOA 1IQRA 3SP1A 1G59A 1SURA 2QUJA 3BL5A 3FH0A 1S4MA 1GZUA 1Q15A 1U7XA 2Z08A 4NATA 5DK4A 4QREA 1M1ZA 1T6YA 3PNBA 4MWDA 3FIUA 3CLTD 3CVWA 3IOEA 1M8GA 4ARIA 3D6UA 1J20A 3ND6A 1WXIA 3LCJA 4RUKA 1QNFA 4DDKA 4GU5A 1N1DA 5DASA 3G5AA 3E27A 3ZXSA 1Q19A 3HV0A 1WXGA 3UC5A 1OWNA 3COVA 3K9WA 4XFDA 5J58A 1KP2A 3K32A 4MW4A 3SYTA 1MC1A 3ZJVA 3IMCA 1WOYA 2PG3A 1EUQA 1H3FA 1WXFA 2CYCA 4EG1A 1V47A 5TS2A 1I2DA 1QJCA 1T6ZA 4HPWA 3FHJA 2V0CA 2A1UA 4YBRA 1K4MA 2EJCA 1I6LA 3CLSC 2TS1A 3LOQA 2QJTA 3HZRA 3P52A 2D54A 3QTTA 4P2BA 4EF6A 5TEWA 4MVCA 1EFPA 4KPUA 4MWCA 3AFHA 3U1VA 5AHWA 1YUNA 2Z09A 4EG6A 1MJHA 1T9GR 1TEZA 1M8FA 1T9GS 1CT9A 5TEVA 3TS1A 3TZLA 4H3SA 1NUUA 4PY2A 2X3FA 3NBAA 3COZA 4DE5A 1DNPA 3COYA 1MB9A 2E0IA 3CLUC 1JIIA 3MLAA 1M8PA 3P0JA 1NP7A 1N78A 4EG8A 1O96B 3MMXA 3D6VA 3TQIA 1N2GA 4MW0A 5KHAA 2G36A 1QRTA 1N2OA 3M5WA 1NUSA 4ZT4A 4YP7A
chains in the Genus database with same CATH superfamily
4P7FA 2LXNA 4TKMA 1J2EA 3DYIA 4TTSA 4ENQA 3PNLA 4YRRA 2NZVG 4KO2S 1D07A 4MVJH 3TSOA 4W5TA 3GUCA 4IJKA 1S9HA 4JU9A 3UOGA 2EARA 4BE4A 3OZGA 3WFIA 2DY0A 3DJFA 5AHOA 3ETLA 4X0EA 2NZXA 4GLFA 3VHXB 4CT4B 2WJWA 5CURA 1WXEA 3MJVA 3VU8A 4F2HA 4Q03A 5KYTA 3DUFB 3IMEA 3ONEA 1IWBB 2FK8A 2P5TB 1U11A 4E6EA 4CV2A 5TDHA 4BB9A 1E6LA 1K5GA 1YK1A 4MROA 4B3BA 1DQZA 4MRMA 2V54A 4RIIA 2FDCA 4LBWA 5CM2Z 1XXHB 2C4TA 2QAIA 1I7PA 3HP7A 1J07A 4CG2A 1AXRA 2ZYAA 2ZWVA 4CMHA 1CZUA 4EGJA 4QOHA 5F5NA 4ZGWA 1GCAA 3DR5A 4WZZA 1JF8A 1PUIA 4AZSA 2IGBA 1QYRA 2OZLB 3PQEA 4UPVA 2BEVA 1OILA 4JR1A 4ZI7B 3GG9A 4LK2A 3IAM6 1V37A 4Q48A 2IUFA 1NYLA 4D9BA 3JRXA 1GZ7A 1MVOA 3A28A 1W2WB 3JAKB 1O1YA 4K26A 4H1WA 1NM5A 4ID3A 1RHKA 3WIDA 2ZBVA 3WQHA 1YZFA 1XTVA 4IDNA 4FE4A 3IDAA 5DEIA 5LNK1 3PB3A 5C5DA 2G9QA 1GZ4A 2QBYA 4QASA 1S02A 3OCUA 2QQ5A 4REQA 1XVUA 3OJEA 4YUWA 1VIAA 2CNLA 5HR5A 2WP0A 2AOUA 1XRRA 1G7RA 4Y18A 1K7EB 4C6SA 3QUQA 3I0MA 1N7JA 1JEOA 2JIRA 1DB3A 1EAMA 2AOWA 4OQYA 1S1CA 1GGVA 3ZN2A 2HL6A 2GX6A 3KLPX 1OWPA 1WB5A 4G8CA 3W3ZB 3GLHA 2JJYA 4KO8A 3HPQA 1E1RA 1SD5A 4ZKDA 4M0DA 4DT1A 3L8MA 2WG1A 3KQWA 3WWEA 5IJAA 2Y1KA 1XTZA 3I5MA 1Z36A 2J4DA 4PZAA 1A9ZA 2Y1CA 2AI3A 2PH5A 1M2WA 2ISSD 5EXPA 3NVDA 3OZUA 1JDNA 2FTKE 3PNKA 4B6OA 4E6PA 1Y6FA 4MULA 3HDHA 2FXIA 5LXTF 5GJWC 4OG2A 2IPAB 1U81A 5DT2A 3TL3A 1UK9A 1SQSA 2GO7A 3BG5A 5AVSA 1ZOIA 3OE1A 3MM4A 4LQLA 5LMNB 2VCEA 2VAWA 1Y3CE 2ZTSA 3OQBA 2ZJZA 2PS9A 5LBTA 3T3HA 5HS4A 1YBVA 1CJCA 1YONA 1VBKA 3RC9A 2J30A 5CDSA 1NF8A 1YXMA 2WFLB 3TZHA 4C6TB 3W8DA 2REBA 3L5OA 3GDFA 3IEIA 2IUUA 2RONA 4XCQA 2GA8A 1A2QA 1AVTA 2RI6A 1LPBB 3R5FA 2Q5CA 4V0QA 4D9EA 2AD1A 2X1LA 1AV7A 2PXAA 1Z25A 2ETVA 1QO7A 4G89A 2HU5A 1KDVA 3ZXYA 1A7KA 5A3VA 4BV2A 2OVFA 4MS4B 3ZC3A 4J3NA 5AYVA 3DDHA 3KKQA 3HWWA 4WJKB 5P21A 3RQIA 4EBBA 1IIBA 2EVWX 2GM9A 1QWOA 3BFJA 4M1TA 4RZ3A 3OUUA 4HAIA 3LQFA 3FOFC 4RZXA 5LP1A 3EQZA 2EG9A 4BNYA 3CNLA 4PBTA 5FWYA 3RUIA 1IXSB 4G5RA 4RU1A 1Z29A 2LKDA 3DSRA 4KQIA 4O2AB 5AVZA 3IOCA 2P0YA 1EX1A 3OO0A 4A6PA 2GB4A 1PSWA 2H7VA 2C7OA 3K09A 1WS6A 4NZOA 3WDMA 1VKNA 4WN9B 4BNZA 4FDAA 4NBTA 3SICE 4BQFA 4YMVA 4PU0A 1B43A 4G84A 1XLUA 1P73A 1U0EA 3ZWYA 1AMOA 3LV8A 5BV1A 3DZ8A 1ZH0A 1YZKA 4FKBA 2YICA 2EQAA 2G04A 2JI9A 1HA3A 1FFGA 3JYPA 3L8EA 2OHXA 3BF8A 4O33A 4TRRA 1E7WA 2WY2D 3OOSA 2DAPA 2QTBA 3N5CA 2SCUB 1J0XO 1N0UA 2CB9A 4K28A 4EKGA 1GPMA 4RDIA 2I4NA 4YI3A 3IIKA 4X92A 4G37A 4HNAA 4NFYA 3WYAA 1PGQA 2XV1A 4JLPA 4LDJA 4JBHA 2AN4A 4YEDA 3CBGA 1ZUNB 4TKZA 5CMLA 3ZU3A 1QH0A 2OXEA 5CTJA 1KK0A 2FEPA 1WP9A 2Z30A 4R1SA 2VP6A 3QP9A 4IIEA 3IL2A 1EM8A 2YN2A 3TM4A 4PW0A 2NZJA 3VYRB 3LDHA 4YRCA 1GUZA 4DNOA 1FUUA 4QGSA 5IFKA 1FYFA 1TMGE 3F73A 3NHKA 2BFFB 4OL0A 3H9BA 2J46A 3OMWA 2C7QA 1TK3A 1MABB 1RAHA 5ENDA 2I8LA 1OLUA 3AFGA 1JXQA 5BMVF 2BAGA 1Y9AA 5CB4F 2I7VA 1R4MA 1MGPA 1XMSA 4P98A 4IHJA 3B78A 4DCMA 2QZJA 10MHA 4I1YA 5KCMA 3EX7C 4G4SO 3L04A 4D57A 3HL4A 1V16B 2R9VA 4AULA 5LMZA 1W30A 2VKTA 1JHZA 4S1VA 4GOMD 4WKGA 5HZMA 4CFZA 1VFPA 1J42A 4KE7A 4DA9A 1ZH2A 2AG1A 1P1JA 3HN6A 5DBHX 3O3CA 1OTHA 4BATA 2FFQA 3Q11A 3TR5A 4UVIA 1SVMA 2XQFA 4EW6A 1QIFA 1L5GB 4Z51A 2FCAA 2XYRA 3I6BA 1ZCFA 3IJEB 3GRAA 3TFOA 4B31A 1LTQA 5BWBA 4JVMA 1DMRA 4N54A 1MV8A 2BM1A 5A4DA 4DNPA 4ZAGA 4ZDKA 1KDTA 1NI5A 1R4AA 1S2NA 3H5AA 5K8VA 2VQFB 5KYWA 4F2WA 1MIOA 1W5SA 5BSKA 2GBFA 4TVBA 5I9TA 4TS9A 1WUJS 2ON6A 2ZBRA 3ZH9B 2Y9PB 3B9QA 2B1IA 4M1ZA 4AROA 1JVNA 3KOXA 2ZROA 3IQFA 1G8KA 1UBMS 2BKEA 2QN3A 4O2BA 3SC4A 2AG5A 2J9XB 3BD8A 3EIHA 3FPFA 1YQTA 2H11A 1CUSA 2LE0A 1U2EA 3HH8A 1R16A 4P38A 3KHSA 3ZGZA 4TYYA 4K0KB 4KAXA 3COSA 3LU1A 1HRDA 3PDWA 5K20A 3L1KA 1N2SA 3A70A 5JSYA 1VXOA 3DTVA 2WT9A 1VPLA 4MWBA 2CZGA 2UKDA 4IO1A 1SZPA 3HV2A 3MXTA 3DW1X 1DV1A 1DKNA 2AR7A 3IUQA 4G1MB 1RLOA 3OE4A 4CTKA 3H1TA 3ZPXA 2QI9F 1BX0A 3I0ZA 2PXCA 3FB1A 4QE3A 4XLTA 1RYEA 1WDMA 2CJXA 3CUKA 3TOSA 2V7QA 3PRJA 1Z7WA 4MVYA 5BN5B 1C41A 4TM8A 1W59A 3A3OA 4TSFA 3ANMA 3U62A 5G1OA 4B4UA 1C9YA 3IMKA 2DPLA 1C9EA 1DIHA 2L69A 2XGOA 3RYFA 1T10A 2AE2A 3B7GA 4TYMA 1DARA 1CJBA 3KPUA 4EMUA 2C88A 4K46A 4Q4LA 5CLLA 4ARBA 1CYDA 1NY6A 2P2ZA 4EL0A 4BRUA 2R7LA 3U9SA 3E8MA 3DE5X 4P35A 4RLHA 2O20A 4B80A 1GG8A 2A0UA 4XGNA 1KJIA 3H1GA 2Y9MB 4UKDA 2YTZA 1VLQA 3HGMA 5DN6D 2C29D 4NXMB 1HL3A 3O8QA 4O3FA 2NQ8A 4WKNA 5AOCA 1G3RA 3LTNC 3GLIA 5IZCC 1GG2A 4J2OA 4TYNA 4LJKA 4ENTA 3ADCA 1Q83A 3RS7A 4BNTA 3G3EA 4M8NE 1JX6A 2PRJA 4XUCA 5DLEA 5BYAA 1YC5A 2VC2B 5AOAA 5ECYA 4R83A 3DB1A 1SZJG 3EDRA 1HZZA 4MO9A 3UPUA 1W75A 2D62A 2ZVDA 1O6ZA 2ZU6A 1Q1NA 4OBXA 4YRKA 3TLZA 4HXGA 3X43A 1MZPA 4AKTA 4E5YA 3KR9A 2BUBA 2J6IA 2F2TA 1UMCA 5CFQA 1QAOA 3OSUA 5T7BA 3JRWA 1VIVA 2EFYA 3NR2A 4YQZA 2D0IA 4Y67A 3S1AA 4OYHA 4RLFA 2C2MA 4NYMQ 4ALJA 4FHZA 4A4DA 5IX8A 1ISGA 4RJLA 1R4NB 1JKJB 3KXIA 3GFBA 4RE5A 3RREA 1V4NA 2JGEA 2XWSA 1PV1A 3DOEA 2YXDA 2HX1A 2R2AA 1SKUA 3N07A 5DGHA 3ZBQA 4F1JA 4WNCA 2C8VA 3OIDA 3SMVA 2FPLA 1H65A 2BGTA 4QAQA 1O0BA 5H82A 2VN8A 3FWZA 2F1JA 3GJZA 2QIOA 2ZBFA 1U7DA 5JE8A 1G20B 2XR1A 1G19A 2XCOA 4K9MA 1UM9A 2F00A 2VJYA 4WINA 4DCCA 3PWSA 5BW4A 3V32A 2D5BA 3QHPA 5IARA 4YUYA 2GN9A 4LYAA 1NIJA 4RSGA 4B7ZA 4D46A 4WBNB 2ZRCA 2AXPA 2FGKA 1RBYA 1MD9A 4TT3A 4BOYA 1R66A 4FDUA 5EHIA 2DERA 1KY2A 3AC0A 3TCNA 1EE2A 4FW9A 1Q5PA 2BM8A 2DWCA 4G5OA 2YFQA 4G8BA 3ZGVA 4MUNA 1WQ1R 4EGCB 1RZRD 4MVJI 3OIFA 2FLWA 3GEIA 4ZYYA 2EZUA 1I2CA 2ZDQA 3HB4X 3SMQA 3TCXB 5D01A 1GN9A 1JAIA 1E2DA 1G2OA 3IIMA 1R18A 1ZJJA 1SBCA 4L76A 4CDMA 3U1BA 4JXXA 3MCZA 2D3TA 4DMRA 1YL6A 4FFBB 4DV3B 1TDJA 1NI3A 1V0JA 5C4GB 1I94B 1RMTA 2VZLA 3DBOB 4Z7QB 4A1FA 1AA9A 3CUSA 4Q12A 5JATA 3FLAA 5IXJA 1AS0A 4BCBA 5D8DA 2A1IA 2JCGA 1MDFA 4GMDA 2GHQA 5GINE 4CETA 1T2DA 5IBPA 2PUCA 4ZVLA 4CKEA 7ABPA 1PZEA 1K6EA 3EF0A 3F98A 1ZOLA 1YJCA 4PTZA 1F2TA 2IOHA 5KTKA 1QQ6A 2D1RA 4JGGA 4JYAB 5JR3A 3S6JA 1RVDA 4WSOA 1Y48E 2QE6A 2ZZNA 2BBTA 2C0QA 3GDWA 3KBBA 1R12A 1EQ2A 3MSXA 4FQ5A 2XDWA 4L6CA 1SPXA 4P4TA 3ZZUA 4GVLA 1E1QA 4JDUA 5ALZA 4P4UA 4ZI5A 3H2GA 4DA6A 1IY0A 3AR3A 1JHUA 4MPTA 1IPFA 4CKYA 1UPTA 3H0CA 3TD9A 2XCTB 3QRWA 2NPFA 4JLDA 3X1YA 2FEKA 2IUEA 1QFJA 1HEUA 5LA6A 4HUJA 2WEKA 2XQKA 1YVUA 2PXXA 3D6UA 4QDXA 4CT5A 4CHTA 4XVCA 2P7IA 2FWNA 2H9IA 3P9PA 4IY1A 2ZM5A 3VNBA 4BVLA 4WBXC 2RAPA 1K27A 2W58A 3E27A 5A5VA 2JIQA 3M6MD 3NZEA 2N75A 5CIWA 5GJVC 4Q9NA 5HCNA 3A4YA 5HGJA 3UC5A 4HEA6 4DEVA 4CKBA 1II9A 4M53A 2GF0A 5KINB 3FFAA 1P1FA 3K92A 3QKRA 4M1QA 5FR1A 3GEHA 2CMDA 4D79A 3HYSA 4MYSA 1NR7A 2EKQA 3P26A 2QVBA 5BSUA 2R96A 4KZPA 1E89A 3IE2A 1ADFA 1HDRA 1ZESA 1Y34E 1U80A 3AHCA 4OXIA 1C1XA 3G2PA 4KR3A 1OH8A 1QJCA 3KL4A 3BN3A 4J49A 3PJRA 3PC6A 2EHDA 2ZIXA 4GR9A 3QVUA 3V1UA 2NMVA 3UPDA 2PCLA 2VHYA 5C9ZA 3PUWA 2GYUA 2V4UA 1KWGA 1AUOA 4WESB 1W0CA 2HA4A 3QTTA 3AEUA 4O1MA 4IYJA 5KSYA 2B82A 2IUTA 1TYEB 4X7BA 1JXMA 1PW5A 5C0OE 1JJ7A 5JHGB 1I1NA 1M74A 2WILA 2MJLA 4OHBA 5J2UA 2BFDB 3K53A 1CEQA 2ZAGA 5TF4A 2H5EA 5GONB 1SJ9A 4YROA 2MIIA 2FG5A 4CTMA 4C30A 1U1DA 1JH8A 4E07A 4LWPA 3L7YA 3B82A 2GPSA 4R40A 4Y2PA 4PTYA 1FLAA 1YGPA 4DBLE 1L7BA 3D0RA 4IOMA 1E7SA 2M6LA 4YJHB 3OT5A 1TZKA 3FTQA 5BY2A 3H4MA 2A94A 3QPCA 1QFZA 3G7NA 3JQAB 5BWMA 4D0SA 3BEOA 1ZK0A 2QZZA 2VNSA 3ZG6A 5IVKA 3SJ7A 1PTJA 3IE0A 3L5KA 3Q0EA 3RYCA 3RHSA 4MJXA 1YS1X 3N0VA 3CNHA 1M1NB 2Z1DA 2CFTA 4EWLA 4EDHA 1AHNA 4G4IA 5DM2A 1E20A 3EZGA 2YWHA 2L42A 3QSGA 4DPKA 3CMCO 3AUSA 3R0ZA 2UUOA 3WGNA 5FNVB 3VDRA 4C2TA 1THMA 1X7XB 2I4OA 4WUVA 4S04A 1HNNA 2V45A 4TV9F 1G7TA 1YD7A 3VR6A 2UYHA 1E9RA 1XZQA 2B0CA 3OX1A 2JJQA 3PK0A 1GQQA 4LMRA 3E18A 3HKEA 3ACCA 4MV6A 1YZYA 1T9AA 2B92A 4BMVA 2GRAA 2NV2B 4HB4A 4HAUA 4UQPA 2VYVA 1WP4A 1G4AE 2CNWD 3IQZA 1SVOA 1C4WA 1KMIY 4KGZA 3NC1C 4JJ7A 1Z0DA 4FNAA 3N74A 2H1CA 3ONVA 3N05A 2BHNA 1JWAB 3GVXA 2PD3A 2H1HA 1QDUA 3RYTC 3WYNA 5CCXA 1M5UA 2IYAA 2VXCA 4BKUA 1BGVA 4IIXA 4ND8A 2DR2A 3K6RA 1CUUA 2Q4BA 3MUNA 5F3RA 1X1AA 4P86A 5FFFA 1HI9A 3L4BA 2RIPA 1UBHS 1T1JA 3DULA 1VCHA 1EIWA 2WAYA 3A04A 3C1AA 5E0KB 1OH7A 4BMDA 1ILEA 3EUFA 2GBPA 1CQJB 1GQFA 2ZUUA 2R85A 1CXZA 4Y2QA 1FXWA 1QQ7A 3VU3A 2A58A 3DBHB 3DAFA 4LZZA 4FFNA 3AX6A 8AT1A 3I53A 1M8JA 1K8QA 5L6MB 2KW5A 5KYXA 3VPAA 3HFSA 1GL9B 1RCFA 2DUNA 4FBGA 1UFOA 4X20B 3JARB 4JEHA 2B37A 3T7TA 3LGXA 2OCBA 1T2NA 5AVWA 1QMGA 4FP9A 3TSYA 2XLCA 2J3HA 2QTNA 3HA7A 5BR4A 1H4QA 4NFLA 4MJLA 4ZO6A 1R50A 3GQBB 4OM8A 3K9HA 3LQQA 1FQWA 3GBPA 3RSLA 1CKEA 1KI1A 2CJWA 4U7JA 2IKSA 1Y8RA 2WMOB 3LX4A 4P8RA 3BWEA 4HI0E 4AZTA 3OY2A 2Q4RA 1I3KA 1N3BA 2PNJA 2NVUB 4QHSA 1ZK4A 4ZTBA 4WZAE 5E9WA 2G0AA 1URPA 2L0XA 4COKA 5JMWA 2BBSA 4RS3A 4J1QA 1E9BA 1S3SA 3RE1A 3O83A 4O4LF 2EX0A 3CVYA 3EUEA 1XQYA 1O0SA 4LKRA 2OO3A 2Z8YA 2DFNA 3CCFA 4L8FA 2GPWA 3PG5A 1L5MA 1A98A 2CXNA 3PQ2A 4GEGA 2BFNA 3SHTA 1JDBB 4WBSA 3DL4A 4D9FA 2VUIB 2ECQA 2QTRA 3HB0A 3AESA 4HKTA 3UHAA 5HM8A 5JJIA 2OILA 2HSDA 1A1VA 4CMCA 5H3LA 4KW7A 1L4EA 4E5VA 1ADGA 2DKOA 3DNFA 5F2NA 2IW1A 2WJJA 4KAFA 5AK4A 3ABQB 4YONB 4CVNA 4RETA 3QW4B 5K6TA 5BVGA 2P9FA 3N2NA 4U3JB 3N2LA 4EHDA 3TNJA 1GHTA 2EW2A 1P1KA 1TVEA 2QNIA 3O1JC 5C53B 1ILWA 3I64A 4NOJA 2OENG 3QPVA 1KIMA 1FS5A 3N58A 4NBKA 1N7GA 1NJ8A 3NEAA 3VXKA 4E51A 2TMGA 2YBEA 1ZR4A 3HEMA 1G5QA 1KR2A 1E62A 3NTVA 4W8OA 1DKOA 4GSYA 4KNWA 1BH2A 4V39A 1TIBA 1GL7A 2ZWMA 5EZYB 1SIOA 2BC9A 4I4TB 4BIMA 4D8XA 5JSHA 2OCKA 3FZYA 3AY0A 4DDMA 4JN6B 1MX3A 3QKIA 1U3TA 2G1AA 4NJEB 4CLOB 1CW2B 2RK6A 1NFRA 3O4HA 4QC2A 3ZS8A 1WAMA 3PCRB 3RVJA 1NXOA 2NAPA 3EC7A 5IN4A 3E2IA 3H5RA 3EDOA 2XB2A 3LX5A 2VK8A 2AMYA 1I0ZA 1SBZA 2VDLB 5KNBH 4J3JA 4RA9B 3ZCUA 3VHXA 5DMHA 1TJ5A 2PN1A 3N0TA 4Q93A 1VFNA 5A7GA 3WL7A 2A9FA 3AHGA 1SBYA 3RVBA 2YW9A 4NRDA 3DUFA 3IPYA 2CGEA 1FRVA 2HJRA 2OMKA 3PC8A 2LW7A 3WLIA 1OFVA 1U6IA 3JW8A 4YJFB 5F1KA 4ZDWA 3RU2A 2BJHA 1NXWA 3DQPA 3ZCSA 4Q3OA 4B87A 2O57A 3QM1A 2XKKA 1W5FA 3OQNA 1PG0A 4QYWA 3WGLA 2VBCA 1FU8A 1TEVA 1V6CA 1YDEA 2FU5C 2Z5VA 4JA0A 3V4OA 4NCIA 4KGDA 1I2MA 2GAFA 5K3EA 1FEZA 3ROPA 1TF7A 4QBIA 4R54A 1RRPA 5DCUA 2OZLA 5FJIA 3VTZA 3WYDA 5AIAA 4D8UA 4ZI7A 5D00A 4OUDA 1F6BA 2JI7A 1X1TA 2Q45A 2B3DA 4ENPA 1BMQA 3PPIA 4JR0A 2I6GA 1EGVB 1Z2DA 2GK7A 2WTBA 3W6ZA 4EMSA 3N8KA 4BVAA 2BPOA 5MN5A 2HH9A 3MW8A 1VSQA 4RZUA 4MUHA 2JANA 5IANA 4TTTS 1A96A 2R79A 4MUFA 2OV8A 4KQFA 4W82A 3WMGA 1KVRA 4Q3AA 4QSHA 2PUEA 2XOXA 3Q9UA 4BZPA 3TFWA 4GMKA 3F67A 1TA0A 2XZPA 4MYHA 4YJ2F 1IJBA 4OEHA 4Y6QA 2P6OA 1H4TA 1Y4AE 4M0KA 1I9CA 3IRVA 1TU0A 1XQXA 5CLJA 4B3MB 1U9CA 2WTMA 3WIVA 1B15A 1FC0A 4A1OA 4XYLA 1N3IA 3VO9A 2JIZD 4QLOA 2WUGA 3WV4A 3G2IA 2F1KA 1ELOA 2XUJA 4ZT5A 4D44A 4Q1EA 1Z39A 1NI4B 3B7PA 5A2QA 4OHRA 1GTMA 4KQ9A 1XA4A 4D0RA 2BGLA 1T2AA 2SKDA 4TUYB 2CLOB 4Z7JA 4V0SA 3HGQA 3KAJA 2IV7A 2FR0A 2AA3A 2PGAA 2BBOA 2HUNA 2PTHA 3M33A 4HTFB 3PE4A 1E2FA 4ZYXA 3GOQA 4YRQA 3E23A 3ZBUA 4HNTA 5H02A 1HLPA 3ASVA 4MX8A 1W0KA 4WZBE 3IP7A 5LFAA 2IITA 2WK1A 2R5NA 1I32A 1IN8A 3A6KA 1PK9A 4POAA 3P9CA 4J8PA 5LZ4A 2LDXA 2AXEA 4X7MA 3NJ4A 3X44A 3L0SA 2JASA 4MUMA 4XDYA 4NVRA 5CHYA 2QNRA 3ZWCA 1QOPB 5G0VA 1I1QB 1NR5A 1E1LA 1DHTA 4NBWA 3DXYA 4IPTA 1CR0A 2PUWA 2WAXA 5B7QA 1T5IA 3OX3A 4FFOA 1WCV1 3NIDB 4YMGA 2WFLA 2G9RA 3ANLA 3LCCA 1P33A 2B1GA 2IU6A 3LLUA 1HYBA 1IQUA 1XTQA 3N2GB 4HWSA 3REFA 1QTIA 1JHOA 1S2DA 4BE7B 1LI5A 3MMPA 1QKIA 5HA5A 4GECA 1VIDA 3GO4A 2M6KA 4EY4A 5IT0A 2C04A 3ZV3A 3MTQA 2C59A 3DYVA 1NW3A 5IT5A 2QRGA 3PA6A 1W36C 1JPVA 3D64A 5EYPB 3OLCX 1JTFA 4DCGA 5BMOA 4AF8A 2O3RA 3COWA 1V8ZA 2ZRMA 4PG7A 1FNSA 5K51A 1IEWA 1ZO8A 1DP4A 2JFXA 1A9YA 3LY8A 1WABA 4O2AA 5DEOA 3L01A 3Q7QA 4IWXA 4DV0B 3CZQA 4AX4A 3JWJA 5F7JA 4RY0A 2JDID 4HRYA 1NAHA 1E5TA 2C98A 1R9MA 1T1SA 3WMXA 4NMWA 4WN9A 1FRFS 4H15A 5A7HA 4C29A 3MJHA 3FNQA 3BRCA 2ONYA 5DYGA 1ZW6A 1MGOA 3OPQA 3CWZA 5C7LO 5BNWA 5HHTA 1GYQA 4FMBB 1ESMA 1RQPA 3TNDA 8ADHA 2R1VB 3LW8A 2YKGA 1SR8A 3ZE2B 3SVLA 4ZQFA 2Z6AA 1I13A 1T8WA 1O4VA 2HIAA 2PYDA 3FDFA 3GHHA 4E32A 3CF6R 1KI7A 4UC0A 4O3MA 3N6XA 4XJSA 5EC8A 5EKSA 5KQGA 4NZPA 4WY2A 1Y1PA 1JIXA 1BJTA 2SCUA 1E3IA 3KKPA 4WIAA 4Q7MB 3ZJYA 2PQ6A 1F51E 1O54A 3AUXA 4WACA 5B7GA 2HW8A 4KAAA 5DB4A 4YDQA 3GA7A 2CDNA 1YZ3A 2WU0A 1VB3A 1IZ0A 1LB1B 2FQ1A 3KVRA 4CG0A 1IJEA 4G9EA 3NAZA 4JBGA 4KN6A 5KVCA 3AVOA 1ZUNA 2FMKA 4IILA 4TVOA 1SXIA 3UGQA 5KYUB 3LC1O 3DLAA 2OGZA 1X9HA 5CJPA 3ND7A 2IYWA 3CH4B 3MJFA 4M0MA 4MSUA 2QX4A 1LSSA 3WKDA 3P4XA 3U19A 5LQDA 2DEUA 3W4IA 2XZTA 3FDIA 3OLWA 4RIHA 1EK2A 2E55A 1QIEA 1XK7A 4QEDA 2BFFA 1EGHA 2WE7A 4AAYA 3UKJA 3MIZA 2EKBA 2V8OA 2XY4A 4A0HA 2RGCA 1M83A 3AVXA 4MVXA 5CT4A 1YQGA 3D1JA 1WRBA 2GJ4A 2W37A 3QXJA 1QIMA 3AK4A 3FBGA 4IFBA 3D59A 1NURA 1I3NA 4TXNA 5D51S 1QYWA 1TYCA 1YNOA 5HDQA 5CB0A 4Z4IA 1EGAA 2QTFA 4WXRA 3AH8A 1V16A 1M6HA 4S1WA 3LIPA 4OD0A 1GUFA 5EMHA 4OMDA 4AFNA 5K4AA 1JLKA 1KK2A 4PX5A 5KC8A 1U9IC 4G5FA 1MQSA 1VSVA 3NBKA 1OX6A 3TO5A 1VLMA 2X22A 1A9XB 3NXSA 3WGMA 4CQJA 2FSVA 2QMQA 4ALLA 4MKZA 3HUTA 3P97A 4M46A 1L5NA 5HKLA 4PSCA 1EK1A 2D8AA 2G3YA 3VTKA 2JFQA 1Y6QA 3T5BA 3LRTA 5BWOA 5JRZA 3KZOA 4V0NA 1RU3A 2CLKB 2WJ4A 3KOOA 4BLRA 2UVPB 4MHTA 3BULA 2GCGA 1WMDA 1E3TA 1XD2B 2PO7A 2RHWA 4JY7A 1CB0A 4WA7A 4C4YA 2XWQA 4F8JA 3SIPA 1B3BA 1P5HA 2I78A 2H7XA 2IOQA 1R6XA 3DCNA 1LBSA 4FGZA 4JLKA 4PNZA 1Y8QA 2FSSA 2YWDA 3AF5A 4JJ8A 4DNXA 3UWOA 2I8CA 4G4SP 4M9RA 4CXMA 4TQAA 1KK1A 4HUTA 5EE3A 1E7QA 3F3MA 2XEXA 6CHYA 3W2IA 1YSCA 4FC6A 3RS5A 4ARUA 1GPWB 4PZCA 5HCUA 1GFSA 5CXXA 3H1BA 4XPZA 1C2YA 4N5HX 1VHDA 4UVHA 5JJKA 4JC4A 4BNXA 3V6MA 2QZSA 4TSKA 3OOHA 4IWNA 3GGOA 1U0HC 3AGQA 3TTSA 3ICPA 2IHTA 4WEOA 5BV7A 1IRXA 2AN5A 4HK4A 4J1SA 1UJNA 4R2KA 2I4IA 4RTMA 1DQNA 3DP7A 3ZW7A 2PBRA 4LHEA 4Q9IA 2PQMA 4H16A 1SVIA 4AMZA 1J2TA 3HKBB 2Z2ZA 1Q3TA 3FCXA 4KXVA 4RVDA 5BT9A 4OMCA 3SEAA 1GAWA 5ILOA 4Z4QA 4DLZA 3ENZA 4JITA 3QVGB 1BFKA 2QRJA 5BN5A 2COUA 2ZBGA 3HTXA 1BC5A 1RKVA 4TZ6A 1PX2A 2H54A 2OBFA 2REOA 3SP1A 4K8RB 1CPYA 1KS9A 1XDSA 3V4RA 3A1SA 1ZVKA 1ZEJA 2DBQA 2VT6A 1OKKA 1T0UA 2W11A 1Q15A 4O2RA 3WLKX 5LQCA 1HYHA 3ZCXA 1GZ5A 4F21A 2FZCA 1TCCA 3AM3A 1M1ZA 4BX9A 1HKUA 3KQHA 1AA6A 1NG1A 4KFRA 4FMDF 4DG9A 1UDRA 4AK9A 5FUWA 1XT6A 4X61A 7GPBA 2BVNA 2YY6A 1U0RA 4JLOA 3C43A 3CISA 4MV5A 3ND6A 1NBOA 4ND3A 4JYMA 2IC5A 2QPLA 1FE8A 2GD6A 3HCDA 1J2UA 3UXHA 3UJCA 3H84A 1P75A 4BCCA 3JRNA 2G7MC 1V71A 2MINB 3CNOA 1NNUA 3DWEX 1ZISA 3UAVA 3X3HA 1RYDA 4P3NA 4RHYA 3T5DA 5IFLA 4OBBA 3ELUA 1XYGA 2RMKA 2O3UA 5EXSA 1B8NA 1PU2A 4KWEA 2J3MA 1Z3IX 5JS2A 4BO6A 1MC1A 2MSWA 4P7BA 4Y6RA 1JT9A 5EJMA 4QG3A 2XAUA 2QRUA 4XVHA 4DVGA 3FJOA 3QWIA 4KOAA 1Z6TA 3E4CA 5H83A 2OWDA 4FFLA 4BP8A 4NYJR 2QRPA 1T9ZA 4F5YA 5C8YF 1C80A 3OFJA 4J0JA 2ECKA 3HB5X 3QLJA 4F84A 1QPZA 1Z47A 3ENVA 1R4NA 1JKJA 2OCXA 4PLTA 3HKDB 1GPAA 4YBZA 4ZWNA 5TIIA 2EJCA 1SCDA 3ASZA 2XT0A 2CLIB 4Y9TA 4H6WA 3PXEA 1W6UA 1LQUA 1XZ8A 2IPXA 4BFXA 2M98A 1G8SA 2VAVA 3EZXA 5CA1B 4UTZA 3UV6A 3V1TC 3QU7A 2GN0A 3LGAA 1JHMA 1NN5A 2GAJA 3H5LA 3VR5H 3AFHA 5E8JA 3FMGA 1AV6A 1DI0A 1P7ZA 3GU3A 3O0TA 4KYUA 2XWBF 4QTUB 4DR2B 2WNHA 3G9TA 2JFZA 2PD4A 4RJ2A 2Q7DA 1U7ZA 1W5TA 2GFQA 3F46A 1G20A 3CRVA 3KV1A 5LMUB 1K7XB 2AYYA 3UPTA 2EG5A 3DAOA 3JZAA 2C96A 2Q5IA 1WPXA 3COZA 4L0CA 4F9GA 5AQ1A 2P3LA 5L3RA 3I9FA 3N6VA 4WBNA 1SC1A 3K9NA 3K0EA 5AI0A 5HKKA 3D4LA 5JJLA 1C4XA 4BO3A 1OTYA 2NACA 4US0R 2H52A 3TIXB 1HE1C 2XUZA 4BFCA 3JYQA 2AMFA 4GX5A 5FOXA 3DVRX 3PENA 4YV1A 1YOBA 2PLWA 1ULUA 2FEMA 1Z0JA 3SAJA 1IY9A 1SCUB 4PONA 4BASA 5HQJA 5HOQA 2O8BB 4BO2A 3U5ZB 1E1CB 2V7XA 1OU4A 1N8NA 2HDHA 1HEYA 4UHDA 3JALA 3B12A 2OUIA 4I55F 4FFBA 4HF7A 4QUHA 2J5QA 5FTNA 5I9NA 2Z2JA 1U8UA 1XSEA 2O0JA 2R8YA 3H2BA 4FJ0A 4GYWA 4I36A 4LZWA 2W22A 4U63A 4YMIA 1OASA 3FLBA 4F5WA 3MPUA 3PQ7A 1M33A 2G9UA 1BYIA 1I3LA 2JCYA 4BFVA 3NM6B 3T3NA 3EXFB 3I4LA 3WKAA 3VNVA 3BTOA 2IHYA 1OSNA 3D4OA 2CNNA 2J08A 4NPCA 4R1PA 1PZXA 4Y2SA 2NUAB 5CIYA 3U61B 1PYDA 1ZGCA 4ONEA 5AKKA 1BKYA 2ZBPA 3Q10A 1ICEA 3EAQA 1P2GA 3PR1A 4UPDA 4XIIA 3EZ2A 1LVUA 4O25A 2EFHB 4LQDA 4XWGA 2XGJA 5CITA 4GYJA 4CRWB 2BUCA 3QOFA 4R71A 3D1LA 4QVIA 2W2PA 3HS3A 1D2CA 3E1KA 1GJRA 4TWIA 4JB0A 4E03A 5GJCA 2J0QA 4PZLA 1SVSA 5EY5B 5HRAA 2Q0HA 2ZRQA 1ZVVA 4IOKA 5LYJB 1PGPA 3TMYA 3HA3A 4CU2A 2GZAA 1PJRA 2VBGA 2X4LA 4D43A 2H65A 3FG9A 2YMMA 1AS3A 3AM4A 4PYNA 1GAJA 1P6UA 1C7EA 1Z8FA 1THZA 5LYYA 2O8CB 1O3YA 1CNEA 2MYPA 3I23A 4Q3KA 4E4RA 1GUAA 1EEXB 1NL3A 3N3BC 4IZIA 3BH6A 4Q24A 4ZXFA 3D81A 3OKFA 3E3AA 3ED5A 1Z6XA 5B6PA 3IA2A 4FR5A 4M9XA 1SA0B 3O94A 3T3OA 4TTPA 2W4IA 3BHJA 3IHTA 4CL2A 1TM3E 2JBHA 3VPHA 2Q3CA 3PDUA 2BHSA 2JIMA 1OJLA 1YDHA 4K2HA 1ZXBA 3UJDA 3CZRA 5D3MB 2EV9A 2XUOA 3I6IA 4ZREA 1M2GA 4XDHA 3LUKA 3S27A 1P2FA 4A26A 1Z75A 2GNAA 4MHOA 5ALSA 1M6WA 3B9BA 2WF6A 3LF2A 3UT5B 1IDN1 4KXFB 5BQ3A 4WESA 2OHIA 3TR0A 2LD4A 4I1PA 1GT91 3FVQA 2ZOSA 2BT4A 1GTJ1 3GA0A 2JFYA 3TIFA 3H3XA 3IHWA 4IMPA 3UOWA 5LQAA 2WE8A 2FSHA 3TQHA 4CR7A 2WIBA 4M4SA 3TMAA 1ZRSA 3U9TA 3VDMA 2BFDA 2R7MA 1B8UA 1FTQA 2EIHA 1DDIA 1RYYA 4UAVA 5GONA 3CVJA 5CM8B 2IV3A 5HIIA 4RMGA 3CONA 5D3QA 3ZLJA 3HNOA 2PZEA 1ETUA 3ESRA 3NHUA 1YQ9A 2BTOA 2C1XA 4LOKA 5EA2A 3T7DA 5AVRA 5JCOA 1F0YA 4R2WA 2CE7A 5TY0A 1RWPA 4IIHA 5H68A 5REQB 4XRGA 4LDZA 2J85A 3CN9A 4YJHA 3O9MA 3OIGA 3GFSA 5JCJD 3ESXA 3N8IA 1LS6A 3LUFA 3DBRB 4UNSA 3RS0A 4DUYB 3JQAA 4MCAA 3T38A 3NDIA 4F93B 2BZ0A 4U6NA 7REQB 4GOOD 3I39X 4M0EA 3MELA 5L3SB 1CC1S 1WHSB 1K9VF 5C2JB 2ADOA 4KFCA 1M1NA 2ZSKA 1O95A 1H05A 4MVJG 3HR7A 3X1KA 3N8HA 1SC4A 4WX2B 5F73A 4D92A 3RU7A 3JQFA 5JNUA 4F56A 3ZXIA 5FNVA 3HFRA 2KI5A 2XWPA 1X7XA 3CM0A 2WJYA 3MS7A 2HO5A 4U8GA 4WDQA 1YS2X 1B16A 2O6LA 2X7XA 3V3TA 4FBLA 3FPKA 2RGXA 4U2FA 2JCXA 1P60A 1JYEA 2D13A 3MTDA 2UUCB 4E13A 1XDWA 2J3JA 2VYCA 4N18A 1N2IA 2BW0A 2WJIA 3EGWA 4EYKA 4RELA 3GLSA 1QGOA 1CF2O 3FWNA 1KBZA 4LI3X 3QQPA 5TMEA 3HZZA 4N3GA 2XUDA 4KBYA 1VKRA 2C58A 2NUBA 3BIFA 1ISRA 4KH0A 3NYIA 4KACA 5FTKA 4M8KA 2J41A 3LHFA 4KQEA 3ESBA 1X7HA 3DPUA 3EGOA 2Q1XA 3D6MA 1YZTA 4C0BA 3PEEA 1U7TA 3PUVA 1VE1A 2R7NA 3W2GA 5J23A 1AQLA 3G0IA 5D7BA 3M4ZA 3DEIA 4GM1A 4A27A 3UW1A 1CQJA 1HSOA 4DRXB 4LXQA 2B5WA 2I65A 4J2TA 1NSTA 3MERA 4UUAA 3DBHA 5AKIA 2OZKA 3IRUA 3LUJA 4DLKA 1XP8A 4QEZA 3ZIAA 5E0OA 1UDAA 1U9ZA 1O5OA 4MW5A 1N5KA 4RANA 2AYZA 3ORRA 4X20A 3KOWA 3JARA 4EG4A 4JL8A 1IBLB 3OAAA 2Y1GA 4OKSA 5EIFA 3S44A 2TMKA 4NMXB 1M2EA 1XZKA 3EC1A 2A9QA 1BXGB 3KXKA 2HMWA 3OMXA 1IAVA 3GQBA 2WJPA 1Z7YA 2WMNB 1MAWA 4MGYR 1EQUA 2C5LA 2O14A 2VK4A 3M81A 3C4VA 3HVKA 4HJRA 2CV1A 4XGRA 2NVUA 1J0DA 5LQJA 1XU9A 3ADPA 4F5EA 4JI8B 1HUQA 2Y4OA 3EJ6A 1KRXA 2B8NA 2V9CA 5TC4A 1CU1A 1VPDA 3ET4A 3FTNA 3H75A 4FI3F 4LGYA 4CMEC 2AZXA 2OO5C 1RBZA 4PZ9A 3ILHA 2JCSA 2H1FA 3DDOA 3LVQE 4RWEA 1VCMA 1GTRA 4L4XA 3ZCTA 3BMCA 4QDUA 2DCMA 3FPJA 1F4PA 1JQEA 3FA2A 3DKIA 2VRCA 5I47A 4D4MA 1WIWA 5GAJA 4L78A 3SHQA 4ZYZA 3E8SA 3IKLA 3OQHA 4KJXA 2FX2A 4JLVA 5T8KA 1SVWA 2WKSA 5K4HA 4YECA 3N59A 4URHA 3L06A 3EA0A 5IK2D 3BIJA 3O8OB 4U3JA 1LLDA 3AQIA 3IAEA 1RJ9A 1JAYA 2O3SA 3UUEA 3KJNA 2VQSA 2F9FA 3GFPA 3VBEA 1UT6A 1U6JA 5I6DA 2GKSA 4MGIR 2X3UA 5CVJA 1G66A 3EZ9A 4C0XA 4HZGA 3P9NA 3AU8A 2J9FB 2AN9A 4M3NA 4WL0A 1TE2A 3LKZA 4Y9RA 5CEFA 3U44B 1TOAA 2NQ2C 5EESA 1T36B 4IM7A 5EZYA 4I4TA 5EZ5A 3COJA 4H18A 2P2GA 1KO1A 5JXIA 3GCZA 2ZWOA 1VGQA 4KWIA 1CS0B 1JTEA 1P44A 1RRKA 2B4KA 2NG1A 3GAFA 4GHWA 4NJEA 4EK9A 4MVJD 3DKKA 1KI6B 1YMQA 2OEPA 4ER3A 4QYIB 3FMIA 3T7JA 2IZ0A 4FFDA 3TK1A 3DS8A 3AXTA 3UUGA 3ICQB 2F3UA 4PRYA 1T0PA 2WP8J 3GUHA 2BEUB 4JBYA 5ETJA 4MQFB 4AF6A 1DXYA 3IB3A 4RA9A 4WK2B 1DIAA 3L9WA 3DE6X 3OLXA 2X7JA 3DMFA 1YKSA 1JIJA 3CH6A 4XJXA 3S8MA 3T5AA 1JAZA 4G85A 2WWGA 1QIDA 4GW3A 1HDEA 5CNIA 5BW6B 4QRIA 1QCDA 1IZYA 2IDJA 3KQOA 4IF6A 3T3MB 2B20A 3D7NA 5GOTA 1Z0AA 2QR5A 3PLNA 3V2GA 1BVYF 3O47A 2REQB 2YYSA 3C5CA 3P19A 4MINA 1L4FA 3IT2A 3UVEA 3CS3A 2VSYA 1D6JA 1MAUA 1L4LA 3A4VA 4PRZA 2JHFA 3G0GA 2GZDA 4PAWA 4OYLA 1CR4A 1ECLA 1XPJA 1PL0A 2GEVA 3JXEA 1WWKA 3N3AC 3QV2A 1SOVA 2BKUA 2YOFA 3PFCA 4PNPA 1WR8A 3KE9A 4H7EA 3QU5A 4QUKA 3TOVA 1DKPA 2EBWA 3WC4A 1V35A 3VSAA 4BJ6A 5JZMA 4QOFA 4R2LA 4GZ6A 3DGEC 1ZD8A 3KEMA 3QVVA 4DSUA 3NDPA 1N8TA 2ZU0C 1KI4A 4U9HS 3NVAA 5K3CA 1KFBB 4D5GA 5FBQB 4K88A 1VHWA 5EP3A 5DBIA 4NXNB 4MV0A 5KTPA 4E5DA 1UADA 1GKIA 1A9TA 1C9KA 2R00C 1GV1A 3R7WB 3S2IA 1QF7A 2QK4A 4B45A 1K8RA 3RSCA 1ZGJA 4M1KA 4RPGA 3D8RA 2Z1NA 5BN3B 3LVRE 4MMYB 1UKYA 2QMOA 5KYVA 4B6QA 1NJ1A 4LJYA 1DAMA 1P39A 3M70A 4TOIA 5EMKA 1TM7E 5ED0A 1PFUA 3TUJC 2O2GA 4Y0AA 2O6HA 3UIEA 4HOYA 1H8HA 3GPDG 1NI4A 2A5LA 3GG2A 3G17A 4FN4A 4LJRA 3AY3A 1PGOA 3V7UA 3PWZA 3I3OA 4OHFA 4ZQHA 4TUYA 2C54A 3DNPA 1ZXXA 4V0RA 1P0MA 4HR7A 5ECGC 2CL0X 2XNSA 1Z2AA 2BOVA 3EEYA 4HTFA 4P83A 3LUGA 4XR4A 4IVPA 3OTOB 3SQLA 3ICCA 3WRXA 5KOIA 1KHHA 2ZAMA 1MC4A 1UJ4A 4RCYA 1XL1A 3MLBA 2A54A 3CPSA 4I0WB 3UJ7A 1U3UA 4GKVA 4ZOAA 2UYCA 4EVRA 2IYOA 3FD8A 4CIDA 1QGZA 1QE5A 2HIMA 4DLSA 2G2SA 5ENZA 1JN0A 3SCZA 3C7KA 3H6KA 4AMYA 4HMQA 3VSDA 1Z4JA 3JD3A 4EATA 2H4HA 1KOGA 2EJVA 4DLXA 2ZIGA 4G0MA 2ZITA 2QYSA 2AR0A 5K0NA 3PUYA 4XB2A 1NKTA 3O91A 4BN0A 4HNHA 4BWFB 3E3MA 3N2GA 4XB1A 4GMHA 5I01A 1C3VA 4DSTA 3CHYA 1DQYA 2O3TA 4FOTA 3B6KA 5DNAA 3ZWXA 2CUNA 3PFIA 2FI1A 1XDDA 4L8VA 5EIHA 3HYCA 3PF9A 4Q9JA 2V7WA 4ICIA 1L7DA 3LRPA 5CYFA 4CM8B 2JFUA 4HLQB 2BKXA 5KSWB 3UKDA 2JH3A 1ZN2A 1HDCA 5EYPA 1M1XB 2ZTMA 1T5SA 1DRWA 1Y7TA 1XPOA 2YDYA 3FNFA 1FPQA 1QTRA 2ZVQX 4ZU6X 5HQ3A 1BDJA 1EGMB 1ZHHA 4FLEA 1JXAA 5ELMA 1E2PA 1XZCA 5E7MA 1GZDA 2D06A 4MUXA 2TRSB 3BEDA 4HBGA 4RTSA 3I4FA 1FYXA 2NOAA 1FF9A 1DJLA 2HKIA 3C3JA 4TYWA 1RDFA 1N77A 2XE7A 1U0SY 3Q7SA 4HRAA 4RQUA 2CYBA 4UFPA 2A7XA 1H1LB 1ZMBA 3OX2A 4G1FA 4CYMA 5K0FA 1ZCZA 2X5OA 4BP9A 1QIIA 1YQUA 1T9BA 1VYVA 2R1VA 2ZRNA 2FMTA 3D7LA 1CRZA 1FJHA 2QLFA 3LKBA 1J2YA 3P4YA 1J0AA 4JQSA 3Q3EA 1F60A 4QOEA 5FQOA 3RK4A 1LX6A 3TXXA 2EIXA 3TI9A 2AMVA 3FMPB 4NPHA 1NT2A 2NSJA 4NENB 3NB0A 3GPLA 3NBMA 4JOCA 1TCBA 3HVHA 1N9ZA 3L7DA 1EJ6A 4WHMA 1WXIA 4A10A 3EK2A 3DC2A 3TQCA 3C15C 1CUVA 2HHCA 3GVIA 1Z4KA 4UM9B 4FC7A 5DXFA 3HADA 2ACKA 3CUTA 5CDTA 2OBBA 3WBJA 3LRXA 1P5FA 2AH5A 3P71T 4Q7EA 4WVFA 4KVAA 3PDHA 3TB6A 1T5HX 1ZIXA 3LC7O 1ORWA 3L7JA 2WFZA 4CG1A 1E2HA 1OXXK 5T4BA 3JYNA 5J58A 3ZLVA 2QT0A 1A5SB 2EJBA 2OORC 2XMBA 5IVHA 4ZC8A 3CRMA 3FF4A 1RI5A 3OJFA 4O59O 4RZ2A 2EU8A 3GEEA 4BNFA 1AF4A 1KY4A 4IJMA 4LNUB 4RK7A 5G02A 2ZB7A 4Q1BA 4KUGA 1JTVA 2E4AA 1IUKA 3ZDYB 4DZTA 5LOVF 4X54A 1QCCA 4PF1A 3EB9A 4GGOA 3GDOA 1UWKA 4RSHA 3TH5A 3ADKA 3V2UA 4HQ6A 1Y6JA 3U5TA 5EINA 2FW0A 1Y1RA 5EMLA 3GFRA 3C1UA 4MV8A 4WLOA 2KPOA 2D54A 4PGFA 1T8YA 3LBAA 3H1FA 3ST7A 4PGMA 4MVJE 3CT4A 2XGGA 4ZQIA 5F7XA 3UATA 1Z0FA 3F5FA 3ZK8A 1SG0A 3O03A 1A9XA 5C46F 3U1VA 4LWZA 4XYEA 2VNJA 2QR2A 2NO6A 4B3IA 2ZI6A 1UDCA 2NXCA 3UJ6A 4AP9A 1T9GR 5C81A 2VHVA 3JVDA 5AXDA 4F86A 4BAUA 1YZNA 2QX6A 1UQUA 2FNAA 3K9BA 3TS1A 1Y37A 1U6KA 3W8FA 2UVPA 3I72A 1V25A 1XD2A 4D6PA 4UHBA 2YBDA 1E1YA 3RHFA 2BH2A 2ZYHA 1RWNA 5IT9A 4QNNA 2HEIA 3K6JA 3QLUC 4DIFA 4G36A 1X7WA 4OK5A 2GYWA 1RKXA 3SNKA 4LJAA 3W7AA 3TJMA 3HI6A 1M2VB 3V7FA 2OM6A 1SNYA 4RF5A 1X0VA 1KKMA 2J3IA 2HPZA 1D7AA 1PWYE 3N87A 2B6NA 1QRTA 1N2OA 1EXVA 1OUMA 1E64A 4K6OA 3DTYA 1OAKA 2GXSA 2A9RA 4D2IA 2G4LA 4EFMA 4HBZA 4MIEA 1NTRA 4N3AA 5E7QA 4QBKA 1J5PA 3PXBA 3K9QO 2PL3A 2PJDA 3A6EA 4EA7A 3CLRC 1EFVB 1YJQA 1KVTA 2KJQA 4HSGA 1KFKB 2HMYB 2IIVA 2RHTA 4DR1B 4XA8A 1YF3A 1QBGA 1P1BA 5L51A 2MWMA 1QZ3A 1QCZA 4QYMA 5IYZF 2B36A 4BQSA 1Y7HA 3WZLA 1NRXA 2BFPA 3HKBA 1G17A 4LY0A 1GGNA 3FDZB 4O63O 1XVLA 2Y93A 5JJBA 3K8YA 1M6VB 1GNQA 1QB8A 3FGOA 4NBLA 4Q47A 4AJ9A 4B3HA 3LYLA 3BVPA 1SCIA 3MWGA 5B37A 1A04A 4KWHA 5AW1A 2NLOA 1ZIOA 3VR4H 3WKCA 1M2JA 2QWXA 3BWDD 3EIFA 4IS3A 4C3OB 1F17A 1PX0A 2F4NA 1B2LA 2VZ0A 4YCBA 5BYKA 5K0TA 1Y0BA 4C2AA 3KQUA 4FGJA 4H7IA 3HCAA 1YTLA 5CVUA 4AYXA 4L95C 1Q21A 1Y5IA 1H85A 4R1MA 2ZIUB 3EMOA 4C14A 3O0DA 2OHHA 4NP6A 1SIUA 1C3LA 1WLSA 3UAOA 1G38A 2L17A 1X0XA 1NT4A 1QYCA 4CIAA 2P0AA 5DW3A 1KZHA 1IULA 2J0EA 2MINA 1CJKC 4OXXA 4BECA 3BF7A 3ZXXA 4PG6A 2WYUA 4ABYA 1T5LA 2QD2A 1LLCA 1RAFA 5KOHA 3UMYA 3ZW9A 3C7DB 1BXRB 4ZVTA 3SQDA 4R7TA 3EGDB 2G5ZA 4YTEA 4L7QA 2FP3A 4DWOA 1OBOA 5I8PA 3EPLA 1E58A 1F5NA 4YI5A 1UL1X 1QV7A 4GRIA 3FHLA 5I7SA 2BHTA 3FXAA 3R23A 3UA0A 2GLUA 2WM8A 3L02A 4B47A 1G0OA 4E2YA 1Q84A 1W9MA 1WCIA 3DBIA 4KQWA 3S8YA 2PZGA 4X24A 3IESA 1Z5NA 4QNRA 4YLYA 4XUDA 1XZFA 3VI4B 1JDUA 5CFPA 1KH1A 3IT3A 4AS1A 4BX3A 2JKYA 2UVQA 5DH9A 4C89A 3HKDA 2OB2A 1TW2A 2VWQA 1NY5A 1TM2A 3GC6A 4G5GA 4MLDA 4KPFC 5ALVA 5EIWA 5CA1A 2PE5A 1C0KA 2HLDD 4RK1A 2IOFK 3M34A 4KQ1A 1YI8A 1F4VA 5I7FA 1YDMA 2DR3A 3AVQA 3WVNA 3RVNA 2A9KA 1MO6A 3L1IA 1EWVA 2X0DA 4ZEVA 5CA0F 3A31A 3C6XA 3X1DA 1MJGM 1QIJA 1ODCA 1R9GA 1ZD4A 2V59A 3NW9A 1XKXA 4OJQA 3OM9A 4PLHA 3LKVA 4C2UA 5KWIA 3WL5A 1V7PC 2VJMB 2XDYA 2GT1A 3E9CA 1DRVA 4AG5A 4AJNA 1HETA 2Q7OE 1NSYA 4L3OA 2VQEB 5DYIA 5IM4A 1CS4C 1U0JA 3IQEA 3NWOA 4PC1A 5IJ9B 1BU5A 1EK0A 4Z3OA 1IVNA 1L8AA 4RV4A 2IWRA 3HB7A 1SCUA 2P9EA 2R7AA 3EZLA 2YC4C 4QXPA 4UTVA 1X1RA 3FOWA 3LPAA 4P7KA 4TV9B 4DV7B 1FJ2A 1TO2E 4OHXA 4WLVA 5CH5A 4TL8A 4EB8A 5A5FA 2Q3BA 3HM9A 1JFLA 1LH0A 1RYHA 2Q50A 3PIRA 3KPYA 3MWEB 2OV2A 1P7PA 1BGWA 1TK2A 3CB2A 2PY6A 4BEWA 1ZI8A 1NUQA 4TN5A 1PT5A 3CRW1 4GPAA 2XCUA 2Y1OA 3CYFA 3IAS6 1VBNA 4KPGA 4M8IA 1QAMA 4Z6KA 4H3KB 1A8HA 2J09A 2NUAA 3L92A 4UUNA 1B6TA 1S3GA 1BO6A 3MBOA 3CNNA 1YRYE 2Y4NA 4AT1A 2EFEB 1O03A 4TTQA 1C8LA 3HYNA 3TEMA 5JNSA 1ZUHA 2GWRA 1W36B 4LF6B 1F9AA 2WZQA 4IEEA 2H0AA 5EE9A 1X15A 4UNPA 2ZSJA 5TE9A 2VT7A 4XFJA 4UM8B 4C07A 2P9YA 1MO5A 2ZR9A 1MRZA 4D8WA 5LL6P 5EUMA 3N39C 5KTRA 3R44A 3E1GA 2ZEJA 5FL7D 2G25A 4NE7A 4W8GA 4TMZA 5IAOA 1QZXA 1YS6A 3OZBA 3V8RA 2XGMA 4GAEA 5LYJA 5IAEA 3ISVA 2DBYA 3WKEA 4A8JC 5AUOB 4IUDS 2ZDGA 1VP9A 2DOKA 3T7EA 4HFMA 4C04A 5ICGA 2QVZX 3TLBA 2WWVD 5TS3A 1EWKA 3O2JA 1GL6A 4OQ4A 3EIEA 2FMFA 1YIOA 4YDSA 1IVSA 2VF7A 2H7CA 4FDMA 3D0OA 3ZDFA 2ZJ7A 3PYMA 3KSZO 3P0IA 1N2CE 2PKQP 4PPNA 3VVBA 1ONPA 1SA0A 3D4NA 3TX2A 3DTNA 3HJNA 1PNQA 1XC7A 3VGPA 4AU1A 5C4MA 2OD9A 3PGLA 5JW6A 4BUCA 1YHZA 2NXNA 3TMKA 4AY4A 4RF2A 4R41A 3TB4A 1UDXA 1XAJA 4RHEA 3C8UA 2ODTX 1ENPA 1JZSA 4YRTA 5D3MA 1D5CA 1WUHS 3G8BA 4J0IA 3ZZ0A 3AM1A 1PVOA 2DHRA 2PRZA 1LRJA 2ZSFA 4NC9A 5IJWA 3UT5A 3TL2A 4R8KA 4NEGA 2PUTA 1QUFA 2VWGA 2PV0A 1G6Q1 3ZY3A 1Q11A 2I54A 4MZDA 5J2TF 1Y4DE 1Z8HA 2I6SA 2JGDB 3CZ4A 3SDZA 1U99A 3GT7A 4S24A 4LSZA 3OETA 4YIHA 4JI1B 3CVVA 3NOVA 1SGWA 5ALPA 2CDBA 3NTUA 4N40A 4YGXB 1R0BA 2YY5A 5BV8A 1PZMA 3CBQA 2I6TA 1QU2A 3KQVA 4I3GA 2NADA 3VPSA 5DP2A 2IUSA 4MMZB 1EG7A 3WHKA 3ZU4A 2R84A 3LXXA 2XUAA 4NZYA 5IS2A 1K63A 1I14A 5CDYA 3B7WA 4LXTA 3WQRA 5REQA 5ALUA 1HKHA 2AB0A 2CKDA 3LWBA 3IV9A 5FTWA 5EJEA 4EP1A 5JDIC 2GCEA 4QPCA 4G0VA 1K86A 3DBRA 3EGXB 3FNGA 3SHOA 3WGIA 4JP8A 3IBCA 3MB5A 1QQTA 4MEJA 3S5JA 5ITZB 3NIWA 4JI4B 2O8CA 1S6YA 7REQA 1N9GB 3RSSA 1DLIA 1V6AA 2RHHA 2TSYB 4MPJA 5L3SA 1WHSA 3WTBA 3QKUA 1KOFA 3DQQA 4FX5A 3UWKA 4U2EA 1L1EA 2MYNA 2EQ5A 4YO7A 3R7NA 1YIAA 2QU8A 3X1XA 2HK6A 1LF5A 4KZKA 2BY4A 1A8PA 1AQIA 1UC5B 2CSXA 1VYTA 4RXUA 3GBVA 1WQ3A 3IDZA 4KN5A 1ODLA 4OLJA 5CDFA 5EZSA 2XW6A 4C9BA 2Y1LA 1YBFA 5I51A 1PWHA 2CXTA 2HMTA 2R4TA 3CA8A 3HGTA 2QV0A 2YXNA 3HSSA 3PI7A 4I6EA 4UARA 1SWWA 4UZSA 4MWZA 1MT0A 2ARKA 5FUBA 4WCDA 4Y6GB 5CAEB 1IUPA 4DCSA 3IEUA 4QUEA 1B6SA 4O4JB 1E9FA 3SBEA 3FJYA 3KTOA 4UU8A 1MCZA 2FGJA 2E4ZA 4G9GA 1CY8A 2WWHA 3EXIB 2N42A 1JLMA 5HXAA 1O6FA 1XHFA 4C4XA 1DCMA 4BGVA 3NHYA 2CFSA 2M1XA 4J0HA 3WNBA 3LM8A 1TQ4A 3JQBC 3EBPA 3L6OO 3AY6A 4B81A 1U98A 4DRXA 1NW8A 4HEHA 4RVFA 4DPLA 3UA3A 3P2IA 4BVKA 2C7RA 5MHTA 3H1EA 4ILKA 4YVFA 3R3SA 2GCIA 5CX4A 1TQDA 1NLZA 2CVPA 4IHJF 3SI7A 1FJGB 1ECPA 1W49A 2G8LA 2JGRA 5KWVA 2BF7A 4PQFA 2AJBA 2GUGA 2ORYA 3IALA 1R5OA 3O4VA 4U7PB 2BGNA 1WZIA 2I4MA 4UEWA 1A8UA 1I3OA 2O0MA 1DRUA 3K0KA 4TMWA 3FR7A 4OAQA 1BXGA 4AJLA 2AXNA 2OYSA 2V6IA 1DQPA 2FCRA 2H8KA 1D9XA 4XXHA 1H3EA 3ELDA 1CZHA 2DE0X 4ETMA 2CHUA 3LECA 3SGLA 1NAIA 1ESDA 4X91A 2XNDD 3E3NA 1OB5A 3MVEA 1L4KA 3V2HA 4PHHA 3D31A 4Q02A 3E7XA 3VDNB 1MA0A 3LA8A 5IZCA 1ML4A 4A2WA 4DHEA 2IZ6A 5THXA 4UOQA 4Q16A 3TXYA 3ZEIA 6PFKA 2ZTUA 4QOIA 3F8WA 1QDLB 4CM1A 5U4QA 4AJKA 5L40A 4MITA 2FV8A 4GI2A 2ODQA 3UB2A 2YS7A 2H1IA 3I37X 3C3EA 2X7HA 4R7ZA 3EPPA 1EFPB 4H3HB 3ENQA 5LZ8A 1AZWA 2V7VA 4NABA 1W34A 3HBNA 1XEWY 2P1DA 1WM1A 4O2BF 4OH7A 4RMNA 1E9CA 3Q0TA 4K9DA 4QPZA 5FPSA 5E9JA 3NX4A 3E9MA 2J32A 3IERA 1RMYA 1JMKC 1G5HA 3O8OA 4JROA 4YDRA 1RWMA 1GP2A 1WVGA 2QW1A 4N7BA 2IF0A 2QVCA 3BERA 4IDPA 1PJ3A 5JI2E 4HLUC 3DV0B 3E5MA 2DFLA 1KA9H 2Q3EA 3HMKA 3VZSA 3EOZA 4DJDC 1DT5A 5LNK6 4J1NA 3ZGXA 2J9FA 4DFDA 3NKVA 5CB8A 3U44A 3BFVA 9MHTA 4ZEWA 2WUEA 1T36A 2L2QA 2AL7A 2H92A 1U0BB 5CCDA 1IB6A 2FE4A 4JXZA 4HLNA 3C5EA 1FU7A 4OTZA 3PHGA 1MB0A 4YMHA 1ZHOA 1ORIA 1LA2A 1RXWA 1CS0A 3IBFA 1Z6PA 2X0IA 3LY5A 3NUGA 1C0PA 2ZJ2A 3JQGB 5DRTA 2R0QC 1KI6A 4CNBA 4JLMA 4UCFA 4QYIA 4IIYA 1G9TA 1V3VA 2C7GA 2PX3A 1XTTA 3AI3A 3E4DA 5EHGA 3GLFE 4WMLA 3PTAA 2MCFA 3LBHA 3HA2A 2BEUA 4J6FA 5K8CA 4MQFA 3QUTA 4MEBA 2OXTA 5KNBD 4TWRA 4HC4A 2OFXA 2JVIA 2DUMA 3UQYS 3FTFA 2JGMA 3PP8A 3BZBA 3DDCA 4K0RA 5SYAA 1T3ZA 1NVEA 1PFGA 3R5JA 5E9QA 1PQYA 4G56A 4HFRA 4Q7JB 2QAGB 5KYKA 4Q9HA 3D7MA 4H6PA 1P18A 1GZUA 2VRBA 5FLEX 3I8SA 5K3AA 1U2PA 1ZD1A 3BJMA 4D74A 1J5XA 4BO9A 2REQA 1T2VA 3CNBA 5M2QA 1YBAA 3UNXA 5ESWA 4QQ8A 3FWPA 3T1TA 1FZQA 1TCUA 2QHXA 2FUCA 2G67A 2M32A 4D4HA 1OV6A 4UUOA 2MHCA 4D3YA 3FFTA 3QUCA 4TMKA 5D5QA 4DLAA 4EPVA 1TF5A 1G7SA 2C8KA 3G5AA 3JQCA 2UU9B 4L9SA 3BPSA 5SY6A 2JARA 3N76A 1T8RA 5H3CA 3EYAA 3ERCA 1I10A 1E6KA 3A32A 3D5EA 1TTHA 3HB1A 1PO7A 2BGMA 3GDHA 1DAKA 1XL0A 4RTOA 1P7YA 2V97A 2CLSA 2X3YA 4ZPXA 1NOKA 2D3WA 4IRMA 5LC1A 1PZNA 4Q0MA 4CM9A 1SUEA 4EB6B 5JC8A 2ZTVA 3R7WA 4BQRA 5K6AA 2ZULA 5KC9A 4HZIA 3CV3A 4PSUA 1YL5A 1SCAA 1UXJA 5BN3A 1ZL2A 3JZMA 4RNCA 5IWAB 3SFZA 4EHLA 5C5EA 1GGJA 3CUVA 1E5QA 3Q9NA 5KNDA 3GGJA 2K2QB 3BXFA 1XIVA 1PW7A 2H8GA 2G0TA 3JWHA 5DWDA 2HYIC 1Q12A 1Q57A 1K2VN 3PTZA 1JBQA 4QO7A 1PIWA 5EG5A 1ZUIA 3MA0A 4F38A 2G88A 1KVSA 3T34A 4BGIA 2JJ1A 4CDRA 5A03A 2RHOA 3F9CA 3DCJA 4D56A 1KXJA 4Y0NA 1WA5A 4N03A 3T7AA 1A71A 4DREA 4EG6A 1TU3A 3N86A 2RBEA 1GQYA 3RF7A 3RHZA 5TRTA 4JH0A 1XR3A 3LT1A 4JUIA 2IH5A 4Q1AA 4AD8A 2A56A 4YV7A 4GH5A 1IK4A 5FV4A 2QYHA 1NJGA 4D4KA 4Y9SA 3OE7D 2BSXA 1JIIA 1U5AA 3K1JA 3VC2A 4RSRA 3DO5A 1NBHA 1GZVA 3U0BA 5E8RA 1J56A 2AX4A 3WSTA 4C7XA 5DYNA 2QUZA 2B7BA 4YQEA 5H59A 4C4OA 3GJQA 3L4JA 1OXMA 2PHZA 1U4OA 3FYTA 4JP3A 1Q1BA 3KLNA 4NOKA 4RQAA 3LUDA 4CM8A 2JPDA 2XMDA 1E66A 3BRWD 2D5AA 4IHAA 4YK7A 1OZGA 1JQAA 4GX1A 1NJFA 3EQ8A 4N5DA 3VM6A 4NDNE 1Q7BA 3L4SO 4YT8A 2WAOA 3NT5A 4MLPA 4PANA 4WZ6A 1RW4A 1NXVA 2QE7A 3NV9A 4WCFA 2PT5A 3RC7A 1MV5A 4D42A 1I2AA 1WUKS 5KAPA 4UULA 5EHQA 1MOZA 1KZ7B 2AOVA 2PXHA 4OSEA 4JOBA 1I6WA 3I2IA 3MRTA 3M4NA 2X9GA 1H1LA 5BV2P 2B4AA 5GADl 4NCAA 3QQ5A 4TGLA 4Y2GA 5K0JA 2RJ3A 3CRQA 2R6AA 6ADHA 1EDBA 2UZAA 1AQUA 3GPIA 2X1VA 4QNMA 3EFBA 4J0CA 2ZRAA 5ENVA 2F48A 1IN6A 3WX0A 4NENA 2EJTA 3HCFA 3W06A 2D8MA 1XZLA 1CZLA 1DBPA 2JL1A 3L0CA 3M9LA 1V2GA 2ZIEA 2FOXA 3GK3A 3LSYA 5LDGA 1E6CA 1XOIA 3TTWA 4BKOA 3LNCA 2NV6A 3HUDA 3HXLA 2DPGA 2DFDA 3VJLA 4N48A 3GFGA 1Y1SA 4DJAA 1WSAA 3SX2A 3CVXA 1CJUC 4N7JA 4B4VA 1T9CA 4QX6A 4NCNA 1JP7A 4GLLA 4IOLA 5KJEA 3PQ8A 4EW1A 4NS1A 1SXJC 2B8TA 2CLFB 3KKOA 3TL6A 4CHGA 1BQEA 3TGPA 1MQAA 1ZR2A 3V8NA 2Q2WA 2J3KA 2AVDA 2GEDA 5K2MA 1HGXA 3TQFA 2VDJA 3OPVA 3HDYA 1YI0A 1YFJA 4UEOA 3DTTA 1VC2A 2JAQA 4LNUA 1JHAA 1K5DA 5F78A 3ELWA 3GN2A 3OU7A 1NNLA 4DUGA 4BVFA 4WKOA 3ZQUA 4ZICA 4CF3A 5JI3E 5J2UF 1TTPB 2AOTB 2Q6IA 1Z8NA 3S7TA 3OQIB 2JAWA 4FT4A 4B83A 2P67A 4JWTA 3GEMA 2E2WA 2OR3A 4WA8A 1NMQA 2P69A 2O5RA 1KKUA 4BVEA 1W2HA 4JI2B 5IN5A 3S2YA 1NX6A 4II3A 2NQTA 2J8ZA 3IBSA 2B2XA 3TGLA 4R1OA 1GLNA 4DCOA 4IDQA 4WK6A 1E5LA 2GH1A 2HWUA 1FIUA 3C1TA 3LPDA 3VOAA 1TAQA 1XN4A 4X7RA 4GKKB 3L7OA 1ZYUA 2RIRA 5EWJB 1Q91A 1HRKA 3SYKA 2AFHB 2VWPA 1IATA 3ESDA 3I6ZA 4CLEA 1Y5LA 2X5NA 3BIWA 1RXCA 3JPWA 3JQ6A 1U8CB 2BD0A 4XSGA 4JLBA 1NF9A 3P7MA 4LX8A 3B2QA 3T06B 2R6DA 4BMCA 16PKA 2O7SA 2OCIA 3R6LA 1HE5A 3DKRA 4H31A 4ZCRA 2PKWA 3IFSA 4PLZA 2QMYA 4JBXA 4V3CA 3B53X 1I6KA 3S1LA 5HBGA 2WB2A 4LZJA 1UMBB 1M2VA 4I55B 5KOYA 2WSIA 5BYBA 2CJYA 2IY8A 3C3MA 4XEUA 2OY0A 3F3SA 4MUIA 4E70A 2VG8A 3A25A 3LFHA 6Q21A 2ZJAA 1F1BA 1Y42X 4TTIA 5ALXA 2Q5QA 4TXHA 1CJMA 3ZEAA 2AJLI 1O58A 2DXIA 1QVAA 3ZVMA 4BMNA 1Q50A 1QKJA 1PR6A 1P3JA 1UCFA 1WXDA 1MEEA 2VA8A 2VP9A 1A77A 2R2GA 2Z57A 3G0BA 3L0PA 4G09A 4JL6A 2ZK7A 1WMFA 1SXJD 3VC1A 3ZWMA 1H2RS 1RLTA 1EFVA 2ZBDA 3B3AA 2AUMA 4GPEA 3RSOA 3GLRA 4R8VA 3WYGA 1D6NA 4XUGB 1X38A 3UC9A 3BTUA 1O87A 1B26A 1ZH6A 3B1KA 4W8HA 3OZFA 4IUCS 3T15A 1U65A 3FDZA 5IEBA 1LDEA 1SVNA 1TL7C 1FMFA 1JFRA 1YBHA 2FYTA 3ZCPA 4BJ1A 4GR4A 2QY6A 1Z7GA 4OU4A 3TDNA 4D5EA 2JGKA 4QG7A 5TJ9A 2R6FA 2XTZA 1KVUA 4M98A 2UZ4A 1AGNA 4DR7B 4H59A 1KSJA 1VE9A 5HWSA 4XH9B 5EPEA 2Y3IA 4N6GA 3AB3A 5DT9A 4Y2UA 2O4CA 4L9AA 4EITA 2WKQA 4EGAA 2VF2A 3A36A 3N6RA 5KKAA 3MCUA 3N7AA 5C80A 3ABRB 2YZ2A 1J8MF 3P9ZA 4JP2A 3VPXA 1KYTA 3F4LA 3H04A 4M9QA 3TTTA 1QGYA 2H63A 4CV3A 4E94A 1UJ6A 4F4JA 3GVPA 3K5IA 1YQEA 4HMOA 4ZARA 1RI4A 4BBAA 2YZKA 3IOBA 1PQUA 4DMGA 1J8FA 2G17A 1QK4A 4QICA 5JCXA 1NIPA 2W6QA 3AEYA 5DBEX 5FPHA 2MR5A 5ALOA 2DX7A 3SK0A 1K4YA 4QT4A 3R9WA 3JZDA 4LRYA 3AGPA 2V9PA 4V0KA 4PTLA 4CF6A 4JT2A 2A84A 4QULA 1BXRA 1YB1A 3EGDA 3OQMA 4D02A 1EA7A 3U3DA 3BD6A 4BGUA 3IKTA 3P94A 2VQ6A 4GE0A 1M5TA 1H2ZA 2YMPA 4UHKA 5B3AA 4F04A 1EESA 3DDUA 2D0PB 4M89A 3ROXA 1NHGA 1U3VA 2PMBA 3LUCA 5E1MA 3WNQA 4DY6A 5JYCA 4HMPA 3U9LA 2YWBA 4PEVA 4D4JA 1Q16A 2PMKA 2NO9A 4QUBA 1XLTC 5DGXA 5JOQA 5L45A 5I9MA 1P29A 2YOHA 2J0UA 4NESA 4R31A 3AJ8A 1P8JA 2LWIA 1ZJ5A 3V34A 3AF3A 2ZJBA 3CR8A 2FVYA 3JQPA 1HFEL 1T5BA 2Z4RA 3DMNA 3FUVA 2WU8A 3AP1A 1UPBA 3VYVA 3P8ZA 3VPCA 4OX9B 4MRSA 1DEXA 4UUPA 5JD5A 4N9QA 3VR5D 4YDHB 4QXQA 3IPXA 4YALA 5LPNA 3UXYA 4IHKA 1F0KA 1UEIA 1C9NA 3V80A 2IVZA 5JMOA 1KAEA 2HF7A 2WWXA 4QGHA 1CTQA 1KAMA 1Q74A 2OV4A 3JV7A 1UC4B 4J7AA 4TMTA 5B12A 5JH7B 2JRLA 2ZYVX 3FWKA 4XYGA 1GVHA 1BQ3A 3UYKA 2VJMA 4X6UA 3STUA 3TG8A 1OAOC 2NSLA 3GMTA 3CU5A 4BKRA 3MOGA 1JEDA 2FRDC 3F97A 3I9V6 4NV1A 3TLAA 1U63A 4AWXA 4CMKA 1JA0A 2BR5A 3OQPA 1NQ5A 4Z9YA 4X64B 4IZOA 5IJ9A 4KR2A 4WKBA 1ZG3A 3NTLA 4WOKA 2XCQA 3K0CA 2B69A 3HXPA 1COWA 3IJ5A 5ELLA 1MNQA 3WOHA 1FVHA 3H6GA 4P84A 1OIVA 3P2MA 1FFSA 1UC8A 1Z13A 2OP1A 2QS9A 2WF8A 3BE5A 3DEHA 1EVZA 4IEFB 4TV9A 2GRJA 1Y81A 1KZ6A 4Z9AA 1G3IA 3VH4A 4QKQA 1QH9A 3FOEC 1JJIA 3X1MA 6GPBA 2O07A 3KFXA 1U1IA 4J7UA 3MWEA 2CLEB 1QIKA 3USES 3X1JA 4KIUA 4GG1A 3TQTA 1VHQA 4PHFA 1GD1O 2WHQA 2P0EA 3CB4A 1JT2A 5F5LA 2ZYDA 3G9ZA 3GRKA 5CH8A 3W9UA 5J4YA 3PNOA 1KH2A 1NBMD 1S01A 1HDIA 1Z0IA 2OCLA 3BQMB 4N0MA 1A0OA 2Y0PA 1Z16A 2A0WA 4JJKA 4X1IB 2H4FA 5EFOA 1OPXA 3TXAA 3FM9A 5SY4A 3OBIA 2YWJA 4CMBA 4G1CA 1YRQA 4ZI7F 4ZQEA 3ZVLA 1XKTA 4OA5A 2ZRFA 4B74A 5CFZA 2WJHA 1FP1D 2KMLA 3I05A 3IDSA 4LF9B 3MJTA 2WIAA 3VO1A 1TJYA 1ZNZA 3BDAA 1SELA 3OKCA 4B6RA 1QF6A 4HVAA 5B58T 5L7TA 1G98A 4FBMA 2I2AA 4WERA 2ID7A 4WY8A 4QXMA 4URYR 3FUUA 3AINA 5GM2A 1A4RA 1I6MA 2IGTA 1E98A 2M1ZA 2ZIWB 2J3QA 3GMSA 1N5LA 1RTTA 2C5SA 3HJCA 4CTJA 3LVFO 5CBKA 1SEVA 3OUTA 4ID9A 3DVQX 2BEKA 1GGHA 4Q82A 4ZMBA 1S8OA 3NVMB 2A3NA 3ZWOA 4X8MA 1U0LA 3ORQA 2VTVA 4KLCA 4Q9KA 2OV1A 1OFUA 1VLHA 1VRWA 3AT1A 4HDQB 5AM0A 1WF3A 5EIAA 1G7CA 4L72A 3T95A 2D0OB 2CB0A 1T26A 3D8UA 3FHTA 2H31A 3AIMA 2EL7A 4ZT3A 3T99A 3OLQA 3IP3A 1KMCA 3QMVA 3NPAA 1CZKA 1J0EA 2F8TA 5KYUA 1RFGE 1GCIA 4N0PA 3ETJA 4BTLA 1A8QA 4UZEA 4UXHA 221PA 1CULC 4UVGA 1RJWA 3DE2X 4G5QA 1XTUA 5DLPA 1RABA 4YCSA 2PSFA 1RWQA 4LDQA 3ETGA 1GLGA 2JGDA 5BQ5A 3WWCA 1JL3A 1MT3A 4CM5A 2HRQA 5A4FS 1FMJA 2QMHA 4QFMA 4R1UA 5EHNA 3B3JA 4UU7A 1XRNA 3QBEA 3RK1A 3PSHA 4QJ4A 1YR2A 2C20A 3KR2A 4BWVA 1O57A 1G3QA 4FGSA 2Z3VA 1LWOA 1Z4OA 2BZGA 3H83A 1HURA 3A1DA 1P1RA 5A3JA 3QIVA 4KQCA 1YKFA 1W35A 4Z2YA 2PJZA 2Z2YA 3U4CA 4FOSA 2HK7A 3VRHA 4JC8A 2WD7B 1EM6A 3ZHQA 4NDZA 3Q3CA 4UPEA 1JQJC 1FFWA 4FJ1A 4DLBA 3TW6A 3HRIA 1WKVA 1ZITA 3EGXA 3G02A 1YRHA 3N0WA 2C9CA 3INTA 4K9QA 4QBFA 3UWSA 1R64A 1GTSA