3IOBA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.80 ang resolution in complex with 5'-deoxy-5'-thioadenosine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
287
structure length
287
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Fragment-Based Approach to Probing Adenosine Recognition Sites by Using Dynamic Combinatorial Chemistry
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords Pantothenate synthetase
total genus 93
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3iobA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3iobA01
1K97A 1EE1A 1NI5A 4OJMX 1WXHA 1QNFA 3CLTD 3LCJA 4EG4A 2PG3A 1WOYA 1WY5A 3IOEA 3ELBA 1MB2A 4MW5A 3P0JA 1TYBE 1O5TA 1T6ZA 1LI5A 1M8FA 1U0BB 1UFVA 1JMVA 3DO8A 5TGTA 2HGZA 1PFVA 2CV0A 4E1AA 1KP2A 3CA8A 2BYTA 3UY4A 4MVYA 1SURA 3F3MA 3AKZA 1B6TA 2X1MA 4ZCPA 4MW1A 1MAUA 1I2DA 1IQUA 3L93A 3KT3A 1O0CA 1N3LA 4CDMA 3C8ZA 3TQOA 4G5FA 2QTRA 1Y42X 3GLVA 4R2MA 3CVVA 1O94D 2A1UB 2OQ2A 2CT8A 4TS1A 4G6ZA 1QRSA 4ZCRA 3KT0A 1X8XA 2YWCA 5DB4A 1JECA 4MULA 2WQ7A 4EG1A 3CLRD 5J58A 1R6UA 5LLTA 5FO1A 4DDMA 4K0RA 1TYDE 3HMQA 4MUHA 4ZCQA 3H99A 4EFKA 4MW7A 1JIIA 3INNA 2QTNA 4YP5A 1MOPA 2IP1A 2E0IA 3G6KA 1GN8A 1X6VA 2D5BA 1HYBA 2RD2A 2H2AA 1JEEA 3QE4A 4QRDA 3CVWA 3ZJVA 3N9IA 1H1TA 4HJRA 3CLUC 5J5AA 1J1UA 3AIIA 1JHDA 2X3FA 4X0EA 3A2KA 4K03A 1J21A 1OWPA 1WXEA 1N1DA 1WXGA 3FHJA 4MW6A 3SZGA 3PNBA 4GU5A 5K0SA 2R5WA 3Q10A 1KQNA 3ZUGA 4KPUA 2B7LA 2V0GA 2NZ2A 2QJTA 4MW4A 3AG6A 1TQ8A 2A86A 2QUJA 4P2BA 1PG0A 2QUKA 1NUTA 3AG5A 2Z08A 3HGMA 3COZA 1NP7A 3S3TA 1OBCA 4UZFA 1EUQA 1D2RA 1F7VA 4ND6A 4F4HA 5LM3A 1LI7A 2CFOA 3IODA 3RBAA 3QTTA 2EL7A 4HJXA 4EG7A 1IQRA 1GTRA 1JEDA 3UOWA 3RK0A 1WXIA 1P7PA 2CYAA 1Q15A 3BL5A 4L2IB 3DLAA 4XSVA 1DNPA 2D13A 1QQTA 2OV4A 3IMEA 1TYCA 1GZUA 4PBSA 1N2IA 1QRUA 1MB9A 1ZH6A 2QJFA 1N2BA 1IFXA 3FI0A 4JZYA 4NAHA 2Z09A 1VBKA 2X0KA 4L2IA 1F7UA 1M1ZA 1I6LA 4ZT4A 4DNXA 2A84A 4AQ7A 1MC1A 1A8HA 3X1KA 2QJOA 3AFHA 2D54A 1Q11A 3CVUA 1OD6A 3ZIUA 1FYDA 4MUNA 1S4MA 2DERA 3FY4A 4RPIA 4FZJA 1M8KA 2JA2A 4ZT7A 4MW0A 3DPIA 2CUZA 5FO0A 3IVCA 1T9GR 3GUZA 4GRIA 1YUNA 1COZA 3COYA 5HUHA 2VTBB 2DLCX 3X1MA 1OWMA 1R6XA 1O96B 3I05A 4KR7A 1IRXA 1PFYA 1KR2A 4I6GA 1WQ3A 3OTWA 1OBHA 1EUYA 1K4MA 5HUJA 4G5YA 3ND5A 3Q12A 2J5BA 4MQ6A 3CLTC 4MWDA 4U63A 5EKDA 3SEZA 3IUEA 2QTMA 2PZAA 4U8HA 3FOCA 1F4LA 2J08A 1NURA 1U7DA 2PZ8A 1YULA 3VU8A 1ZUNA 1ZJWA 1N78A 4EGAA 4ZT3A 2X1LA 2DPLA 3G5AA 1PFWA 4MW2A 1O95C 2XRZA 1NUPA 1RQGA 1NSYA 4XFJA 1GLNA 4MUIA 1YI8A 1TEZA 1GPMA 1XNHA 1ZH0A 5TS2A 3IUBA 3NBKA 3TQIA 3UK2A 2CV1A 4EG5A 2TS1A 1XJQA 3KT6A 5IJXA 3FWKA 4J76A 4MWBA 2IELA 5DK4A 2CSXA 5KHAA 2PZBA 5FNZA 2BTEA 3SDBA 2DXIA 1T6XA 3QTBA 1WKBA 3MLBA 4KPUB 2AZXA 1TYAE 2A1TR 2C5SA 4DJAA 3CLSC 3D6UA 3N8HA 3TNJA 3ND7A 3NV7A 4PBRA 4Q16A 1OWOA 1KKUA 1YUMA 4DDHA 1G59A 3A05A 1FFYA 1O97D 4MVWA 3HZRA 2YXNA 1M83A 5TEVA 3G59A 5HG0A 1U3DA 4MUEA 2CYCA 1I6KA 4QBTA 2YY5A 1K4KA 3SP1A 1NUQA 1QU3A 4I6EA 2AG6A 1YIAA 3D6VA 5LFAA 1I6MA 1VLHA 1NZJA 3H9CA 1H3NA 3MLAA 1N2JA 4MVXA 2G36A 1EFVB 2VTBA 4A91A 4R0NA 4PY2A 1O96A 3RJZA 2DR2A 1MRZA 4EF6A 3E27A 3KFLA 1N75A 1O0BA 4NAUA 3IVGA 1EFVA 3FNRA 1GAXA 1VL2A 1NYLA 1MJHA 2ZP1A 1BS2A 3IH5A 4PBTA 2QUHA 1OWNA 4MWEA 1MAWA 3SYTA 3MMXA 3FG9A 3CVXA 3ILVA 2CV2A 1V8FA 3HFJA 5DEOA 4YP6A 1K92A 2A1UA 4F3RA 4WSOA 1WZ2A 2DEUA 1EJ2A 3PNVA 3FETA 1U7XA 1M8JA 3U1VA 1KAQA 1KH2A 3UC5A 3PXUA 1JILA 3MUEA 2YWBA 3L92A 3K9WA 4AS1A 4DLPA 1J20A 1O94C 3KT8A 3Q4GA 2PXHA 1J70A 4OUDB 2A7XA 2J09A 1J09A 1R6TA 3OP1A 5TEWA 4U7JA 1QJCA 3A04A 1ILEA 1N2GA 4S1OA 3HV0A 3SZ3A 2A88A 4JYZA 1O95D 3IMGA 3LOQA 4I6JA 4JXZA 5JBNA 1KQPA 4MUJA 3AL0C 3ZXIA 4HK4A 1N2OA 1XNGA 1JGTA 1N77A 2IJGX 4NZPA 1NUSA 4YMIA 3VGJA 1KQOA 1YIDA 2O5RA 4XFDA 3CR8A 3K32A 1CT9A 5KCMA 1WXFA 2CYBA 4ND7A 4Q93A 2Z3VA 1PG2A 2GKSA 1JZQA 3MXTA 4MUGA 2O8VA 1M8GA 4NATA 3TZLA 3JXEA 3ZGZA 3FH0A 4KR9A 3ZXSA 2PIDA 3P0HA 3N2YA 4EG8A 2RE8A 1EFPA 1Q19A 1IHOA 1GTSA 2PFSA 1IH8A 3NBAA 3RK1A 4DE5A 4ARCA 3PRHA 1PFUA 3IDFA 3FIUA 1QU2A 1Q77A 3FDXA 4NX2A 3P52A 2VXOA 3IOCA 3H97A 3ND6A 2A4MA 4ZT2A 1KH3A 3RFFA 4YBRA 3LE8A 1T6YA 1JZSA 4HPWA 5J59A 1T9GS 5AHWA 3CLUD 2E89A 1J1ZA 1WJGA 1G8GA 1OWLA 5H7XA 4YP7A 4J75A 4JXXA 3ZJTA 3HL4A 3CVYA 1WQ4A 3H05A 4BWVA 5H16A 2WB2A 1MBZA 1H3FA 1N2HA 2V0CA 3GMIA 1F9AA 2GOYA 4MW9A 4CQNA 3SEQA 4MVCA 1VBNA 3M5WA 3IOBA 1H3EA 4MLPA 2WQ6A 4ARIA 3COWA 3H9BA 2J07A 1M8PA 4NDAA 2XRYA 4UZEA 2QUIA 3UMVA 4ZCTA 2NSYA 1NUUA 4QREA 1KORA 3A4IA 2ZUFA 2J4DA 4DDKA 3P0IA 3X1JA 2E18A 1V47A 1N2EA 2JANA 3IMCA 2AKEA 1G8FA 1QRTA 1O6BA 4JFAA 5F23A 1KP3A 4MWCA 4ZT6A 3TS1A 3COVA 2E21A 1KAMA 3IVXA 2DUMA 4WNYA 3CLRC 1G8HA 5IHXA 1O97C 4EG6A 2DETA 4R2LA 5DASA 4CDNA 4KR6A 3ISJA 1JIJA 2JAXA 5KWVA 2A1TS 3N05A 2EJCA 3CLSD 3VRHA 2H29A 4CT0A 4H3SA 4OUDA 1EXDA 1JIKA 4ZT5A 1IVSA 4ZCSA 1QTQA 4MUFA 1ULHA 4MUKA 2WSIA 2I1LA 3PNYA 5BNZA 4RUKA 1U3CA 2GM3A 4KKVA 4MAFA 3TZEA 1TFUA 2HZ7A 3RHSA 2ZUEA 1VBMA 4EG3A 1IQ0A 1LW7A 2HMAA 1KH1A 1XNJA 3DV2A 3ZJUA 1EFPB 5K0TA
chains in the Genus database with same CATH superfamily
3V97A 4LSGA 2XTNA 2XA1A 3T1VA 1W0KA 2GCGA 1M73E 2W6JA 1NRWA 4RPGA 2MYUA 4RZIA 5IK2D 3IUQA 2X8JB 1LLDA 1QE3A 2G09A 4E5UA 1UC8A 5C8YB 2V9ZA 2V1XA 3FR7A 3W3AA 1OLSB 1JIVA 5A6SA 3PHCA 2VNJA 2OKGA 1E9RA 2RJ3A 3DC2A 3FNEA 3ROGA 4C1NA 4X65B 4N40A 1W93A 4OXKA 4HNRA 4C89A 3KO8A 4X54A 3FPBA 2QM3A 2IIVA 3SIRA 4AMGA 1CR2A 2GAAA 3H1EA 3VR6D 4BZPA 5E8RA 2HRDA 4BE4A 1FU8A 1KQ3A 3RVLA 2O54A 3HYCA 4G1FA 3JPWA 3CA8A 1WL8A 1QIEA 3UY4A 1ILWA 3QV2A 3EMOA 5JAIA 1RHUA 2X1MA 4CM4B 3PHIA 4Y1EA 1S96A 2SHKA 2HMSA 3OQPA 2X22A 4ZOLF 4C0SA 1L5HA 1ZCBA 3ZCTA 1A5ZA 4M21A 1F8XA 3UAWA 2YIMA 1RM5A 1FFHA 3AIKA 4EPRA 3VR5H 1ZK0A 4TS1A 2PXXA 4CG1A 2AVNA 3NIGB 4LXYA 1X0XA 5E9AA 3PGLA 4JJ7A 3QPUA 4ZI7F 4QNMA 4X6XA 3KDAA 2R4TA 4IVQA 4RE6A 1OIXA 4QOFA 4DCUA 3DKKA 3MZ0A 1KYWA 3QVJA 4I1YA 3EJWA 2R11A 4NVRA 1RXVA 4Y1RA 1SVIA 1I7SB 2QMQA 4DDMA 2NUPB 2VPIA 2W2KA 4AF8A 1U4SA 4MIEA 1A76A 1E66A 3FYHA 5FNVA 2OXRA 4OLJA 3VPSA 1U9ZA 3D7LA 3WQBA 4D8XA 2ATVA 3SXPA 3W6ZA 1GRRA 4P4TA 1DE0A 2AJDA 1PZMA 4BLUA 1UDWA 2IP1A 1M7BA 2P9GA 3O83A 2XGJA 2D5BA 2WWXA 3EC7A 2AW3A 1FLAA 2GPJA 3VR6A 3T1YB 2AF4C 3K4HA 1KBQA 4P2GA 2DECA 5FWDA 3N9IA 4CYMA 4JYAB 3OSUA 4EW3A 1NVKA 1VLLA 3OQ1A 4FNAA 4TVOA 3AONB 3UK6A 2GR8A 1GIAA 1BD4A 3CY6A 3A4VA 3CFYA 4MR8A 3L41A 4L8LA 2PGJA 1U8TA 1WXGA 2YBDA 3Q9LA 4KIUA 4Z4QA 4CU2A 1B8OA 2GK6A 2PAAA 5K0SA 2NQTA 4HZUB 1THMA 2QSJA 4MS1A 1WHSB 2O0LA 2CE7A 1F60A 2F2TA 4G86A 3VVBA 1HGXA 1KMIY 1R66A 2CZGA 4YAEA 3HLTA 2VK1A 2ZQ5A 1KZ7B 4RHXA 1JNXX 2YVUA 5DLDA 2Q5FA 3TLEA 1ZN9A 4B7UA 1J5PA 3CKMA 3SYNA 2QUJA 3WHKA 1H2BA 3TLJA 4AROA 5A4IS 3JZIA 4NPHA 4B2PA 3CX3A 3UJNA 3N2GB 5K0JA 4BNVA 3LQKA 1U6IA 1Z45A 3AINA 1FDUA 1PSZA 4HQFA 2QA5A 1ZC3A 3I6ZA 3JQ7B 3COZA 4KE8A 2Y9PB 2DE0X 1JDJA 3C6QA 1EKXA 1H5UA 1CQWA 3I30X 1DAIA 2CUNA 3P32A 2F43A 4H0NA 4ND6A 4F4HA 4JKIA 2P4UA 4J0GA 4RVNA 5KTMA 2UUBB 4HJXA 4IAOA 4BQPA 5A4MS 4IEEA 2A33A 4ZAXA 3VV3A 1RZRA 3HXLA 1SU6A 2PA3A 3OKAA 3V9PA 5EAIA 4DMUB 1V6AA 5JCOA 4LE0A 4F11A 4AJOA 4NDZA 2WSYB 4PLVA 5AI6A 4AURA 2WFLB 3HVUA 1EP3B 1JPVA 4B44A 5I5EA 4OLFA 4TKVB 3IUNA 4B3XA 5AO9A 2WLSA 3N86A 3O75A 4XQEA 1JG2A 3G9XA 1MB9A 4IYJA 4URWR 2H48A 4AJ2A 2MYTA 1I36A 2JL1A 4GOXA 2V7BA 3LZDA 3Q3IA 4BGEA 4EYKA 2X0KA 1BJTA 3L7JA 4Q3NA 2IXBA 3X1KA 4B3CA 1QC5B 2QJOA 2RI6A 3A10A 4M8KA 2NU7A 4ASUD 1AQUA 1OU4A 1S4MA 3E3MA 4LY6A 5AKJA 5F1KA 4BNZA 4DQDA 3MCAA 4UOZA 1A3CA 2WD7B 3MC1A 3OEED 4HPJB 5LBTA 1PN3A 3BA6A 3L79A 1Q57A 3R0VA 4QOSA 2F55A 2GSDA 4M0CA 3AF1A 2CUZA 4JLNA 4BMPB 1X1CA 3K96A 1E1QD 1N3IA 3G7UA 4GUDA 1R3UA 3VZDA 3Q11A 2NMVA 1R4ZA 3GUZA 3S2UA 2Z1MA 3V4PB 5LQAA 4BNGA 1E3QA 2RGRA 4TLCA 4DXAA 1NKTA 2PEYA 2DLCX 2AN5A 1UPAA 2M6SA 3EN0A 1L4NA 4J16A 4TVBA 5JWRA 4G0MA 2Q3JA 1F38A 2QJRA 4RCVA 4RJKA 2FFQA 1OF1A 1U1EA 3FDZA 3LO8A 4TS3A 2IYEA 1ZIDA 3K2IA 2AZTA 4WI1A 1FP2A 2QE7A 4AKGA 3PC8C 2IX9A 3K35A 1W19A 4N0EA 4ARUA 2Q3LA 1TCUA 3L0ZA 3IIMA 4G07A 3B6MA 4KXUA 5F2EA 5H3CA 4BQIA 1EXWA 3RT1A 4OA5A 1ODCA 2IHZA 4QOGA 5BN3A 1B6SA 2YQ4A 3L0IB 4HDMB 4YT8A 1DAHA 1U7DA 2C4KA 2VWGA 5KJ1A 3CKKA 4UDOA 3JQ8B 621PA 2IQ5A 1X14A 3B70A 4S2UA 3I6MA 2BFCB 1T8PA 4WFKA 5HJ2A 1TL7C 2RSLA 3HG7A 4ZT3A 3KYJB 2IUYA 3H1TA 4ZA2A 1U2SA 3JS5A 2HJHA 3L07A 4DR7B 2VWQA 1P2UA 3EFEA 4H3HB 1RAAA 1TKBA 4EMTA 1KXZA 1KK0A 1NUPA 2XV1A 3CRMA 3J7TA 3P0EA 2GHIA 1Q74A 3B82A 3L8DA 2FMFA 4J8PA 5FAXA 2C2BA 5TQ0B 1WULS 3TRIA 1CU1A 2ZYDA 3OHMA 4PGMA 2G5ZA 2G6BA 1ZOPA 1QE5A 3I28A 5DEIA 2ZSUA 1HKUA 2J6CA 2TS1A 1N2CE 3ETCA 3O0DA 4IOKA 3UJHA 1FMTA 1I6WA 2UUCB 4O1HA 1CVLA 4KPYA 2BCEA 4XI9A 2OHXA 3ZQ6A 2IZZA 2FP4A 4M6WA 4ABYA 1MNQA 3GYBA 1THGA 1NBWB 3T4XA 5E0KB 1O6ZA 3P96A 3AHGA 1ETUA 2VEOA 4BNNA 3D2BA 4EHLA 2VYCA 1Z5UA 1VB3A 4R7TA 3UB4A 2ZQYA 1QYIA 3I64A 4RJTA 4TWZA 3EZGA 4R3WA 2X6TA 5GVRA 3CRNA 3L1HA 4OU4A 5CT6A 4HP8A 3UV3A 3LH5A 2YTZA 1QIHA 5CFPA 2IS4A 4D0GA 1UMKA 5BR7A 1Q0QA 1WQ1R 3ZW9A 4F56A 2ZBEA 2HLDA 5HIJA 3CH7A 3N7TA 3DZHA 5C31A 1M83A 1DCMA 5HG0A 5F77A 1QFZA 1X7HA 4AYXA 4BV8A 1SKYE 3AKYA 1BS9A 4MQEA 5F64A 3SP1A 1GCOA 3SLGA 1H6DA 3N2ZB 3M2TA 4BE9A 5A6VA 2PLNA 3NCTA 3KPWA 5L51A 1PJAA 1JG1A 5IM5A 2HCJB 2VF5X 2GF2A 2OMEA 3O1JC 5T5QA 4BNIA 3R5JA 2P5TB 4NR0A 4CETA 4JROA 3RS7A 2EBHX 1I6MA 1IM8A 4G4JA 3BH7A 4YRLA 1C3OB 5GP1A 5I9IA 5JNLA 2BH2A 3NBZC 1Y9JA 4IDGA 3OH8A 1HFKA 3HADA 4IV5A 3GLHB 4RMNA 3DV0A 4I9GA 4IXWA 3GVXA 4U2BA 1KI4A 3WLPA 1SCNE 4G26A 4A91A 3AIMA 4TM8A 2YQZA 5BQXA 2OECA 3LDGA 3K1AA 3KTAA 1KA9H 4P4UA 5A1TA 2KQUA 2P0YA 4Y1RB 3S4YA 1H4QA 1ULZA 2Z0MA 4G8BA 4ENUA 2RB5A 4DUGD 4TXNA 3ROTA 1DOHA 3NT5A 5H3HA 3TNLA 2GTPA 2C4NA 1F1JA 5H70A 5EZ6B 2OMKA 3VSEA 3K6SA 1NNSA 2P67A 3FNRA 1RPZA 3ADKA 2YN4A 3ETGA 4PFSA 1RTKA 5ALKA 4C3VA 5BV0A 2PQMA 1TZ2A 2BGNA 4HDKA 1YVPA 3D54D 3TCNA 3JALA 2ZYTX 5L7TA 3DMFA 3GRYA 2ZJ3A 4R2WA 2MSCB 4BV3A 1TZMA 1B41A 3TKLA 1AS0A 1G5PA 2LIVA 2GF0A 1YZHA 2GILA 1DEOA 4FS8A 3CI0K 4Y2SA 1N6RA 4AS2A 2X2PA 2XCOA 4GVLA 3WBKA 2PWBA 4C03A 3F6RA 4R9VA 2QZPA 3L5KA 2AI3A 1JILA 4EELA 1AO3A 1PJLA 3WK7A 5FWXA 2DP4E 3ESYA 2IYNA 2XWSA 3Q4GA 2FCAA 1T0HB 5ALWA 4D3ZA 2Z9BA 1E8DA 3IB6A 4OUDB 2P6NA 4FC6A 3LP8A 3F9CA 4JN6B 3VHRA 2AX4A 2X8WA 4KE6A 4U7JA 4JDPA 3A04A 1ILEA 1N2GA 1MG5A 1XWWA 5DYTA 1U2EA 1YVRA 3D8BA 4LA4A 1LWOA 4Z5XA 1DV1A 1WTCA 3U7GA 2BOVA 5EE9A 1DKPA 5FEMA 4WBNF 3R2JA 3V4OA 5JBNA 1AKWA 1C0PA 1US8A 4OXNA 1MH1A 2FH5B 4MUMA 1R9JA 1SC3A 1ORDA 1TRKA 2WG2A 2ZB4A 4JL8A 3VGJA 4PR0A 4E5VA 5C8XA 3DLHA 4LJ4A 3AY6A 4EARA 4A2WA 1KQOA 1Z8FA 5CVEA 2QIPA 1FX1A 4UFOA 5I7SA 5ALDA 3IP7A 1PVDA 4S24A 2X1HA 2Q0HA 3BF7A 4IIJF 2KW5A 4XIYA 5ESDA 1B1AA 3AXTA 1OX4A 4F45A 7REQB 3QXHA 4ND7A 2HU7A 2A9VA 2EQ5A 2FMUA 1JZQA 3G1UA 2CLSA 4I14A 4XWTA 3X1YA 4D9CA 2PXCA 2ZBFA 2PWAA 4R9NA 3LQYA 4MPDA 3AB7A 4RCYA 8AT1A 1GAEO 3KHUA 2XD9A 1W34A 3H86A 5CU7A 2UZ3A 1VPVA 1Z6GA 3I0ZA 1U7TA 4FZ5A 2O07A 3LFUA 5AVXA 5IAAA 3H65A 2QM7A 2WMDA 3KETA 3EOZA 1C7QA 1HC7A 2D1FA 2D2EA 1OXKB 1PO7A 4H16A 1QVAA 2FPGB 2Z6AA 4NXNB 3IX7A 4G5HA 3L4KA 4TKLA 1O0SA 3O1HB 2BMWA 2UUOA 2YW2A 4OVKA 2Q1XA 2PZGA 4RSRA 1GNSA 2VF7A 4HYEA 4PGFA 3VZCA 1PQYA 3DQPA 2D5LA 4ZU6X 1ZSYA 1MN6A 2VSXA 3O93A 3OSZA 4I19A 3ZDEA 4S1NA 1LJUA 3QXXA 4XVRA 5GTDA 3O5AA 5KYWB 2F8SA 2H2HA 4DIDA 4A15A 4LWOA 4M38A 5MN5A 3VR2D 2YMQA 2JFQA 4HX5A 4Q3CA 3W3ZB 4Z7OB 4NCAA 2PSEA 1WJGA 2YXDA 3KJGA 1VIYA 4J4HA 3SBDA 3U0VA 4DXDA 3K70B 3WE7A 4C04A 1K2VN 2VZEA 1VG9B 1G8YA 4M0MA 4CIVA 4QZVA 4NMXB 4XCQA 1E69A 3PDHA 3SX0A 1WQ4A 1E4OA 1U7OA 4OQDA 3SY8A 1XKQA 4RD2A 2BE9A 4RVSA 4BWVA 2WUGA 3GHHA 4BP3A 2HNBA 2YZ7A 4TWBA 4EHJA 3DLCA 4NJOA 3ZEAA 1TIPA 3M5DA 2A0UA 5EPOA 5GPBA 3AVVA 2HCTA 3DFKA 1DMSA 4QDOA 3RJ9A 5JSFA 2AMLA 1CUIA 3QVOA 5JFOA 2I66A 1XTVA 1RLUA 3D7SA 1ZK4A 3QY0A 2WBLC 2XRYA 3OCYA 1XRMA 1YJ5A 3DZDA 1M34E 4MINA 2ZULA 2VDVE 2OBXA 3E48A 4LX8A 1L7MA 4L0DA 4XFKA 4B3HA 5JHHB 3BDIA 1QQ6A 4NEQA 4RM2A 4J94A 3A1VA 4LPKA 3D5QA 4TV8A 2FYTA 4U5XA 3PD1A 3VFDA 2WZDA 2I9PA 5KJEA 4MXDA 4C78A 1BSVA 4HNHA 1CYEA 3IMCA 2O14A 3NHAA 3S8YA 1G8FA 5L45A 1O6BA 2AKEA 1P9OA 4BNWA 4BFYA 3UN1A 3R5HA 3AR2A 3TS1A 4GM0A 4N03A 3D8HA 3IVXA 4L73A 1GWNA 1NVEA 5JAQA 2EGGA 3CO0S 3DQQA 4J0CA 4AXBA 3AYXB 5B3KA 5BN1A 3ZXXA 5CA1B 4QYSA 1K63A 1OAOC 2BZSA 3HCWA 4RHCA 4HQRA 4A3SA 2BEWA 4K86A 5KC9A 3IT3A 3N28A 2DX7A 2JAXA 2NXEA 4YQYA 3DZJA 4GWGA 3VRHA 3FHLA 3M49A 4K88A 1UJ2A 4IGFA 3URKA 5TIIA 4ZT5A 3ONWA 1CRQA 2CLLB 4GMDA 4KQHA 4BO1A 1PUIA 1JHZA 5D85A 1N4AA 5CP8A 2CKMA 3ZDBA 2YHSA 3F49S 4GYWA 5K6RA 3EG9A 4TL6A 2XYGA 3FZYA 4ZYUA 3CB4A 2Q5LA 1Z26A 4XYBA 1P80A 3HBFA 4KSBA 3RG2A 4D8TA 5KVSA 1YFZA 5JMPA 2NTNA 1EVYA 3WRXC 5D5QA 1E8NA 3BRSA 5JJLA 5I7VA 4LWZA 2B78A 3PA6A 1QCYA 3D0OA 5FUWA 2P65A 4EG3A 3NWOA 2G80A 2JCVA 4IHJF 5FWAA 4PXSA 3N75A 3HQ4O 5T8KC 1JKMA 2BGLA 3NFYA 3OFNA 4YGXB 4Q66C 5LJIA 1YCHA 3JARB 1Z4KA 4B2LA 2D7CA 1W25A 1WCIB 2IP2A 3DVLA 2F1HA 4LYHA 5BN5B 3F78A 3MWDB 1OHHD 2DM6A 2O9JA 4FEAA 3UXMA 3ZCXA 2IFTA 1WNFA 1VYUA 1Z2EA 2H1RA 2Q46A 3GI1A 4AKTA 1Z6ZA 4GP6A 4N6GA 3WJ7A 3DO8A 4FB5A 4MH0R 2GM9A 2OO5A 3DE4X 3BQMB 3FM9A 1Y8AA 4XYMA 4PX2A 1SA0B 1VA4A 2GGSA 4TLLB 3MTBA 4PM4A 1EGAA 1DFHA 1X3LA 4LZOA 1EWRA 4W5QA 1R7RA 3FWHA 3BMXA 2ANBA 5D2CA 3TPZA 4G5FA 4K9QA 1L5FA 4LTMA 2IECA 2NV2B 3RBXA 3TOZA 1GGEA 4B09A 4MTLA 3FGNA 4JSYA 3MEQA 1JA1A 2ZYSA 3O47A 1HQYE 1R0CA 1CR4A 1RR6A 2BWJA 2XUJA 3OPXA 3VQTA 4LNUA 3KT0A 1YB2A 1BE1A 3HB9A 2LR0A 4DIBA 3KAPA 2YS7A 2BT4A 3H1BA 2ETXA 4E13A 2ORYA 5AYVA 2H7XA 4MS3A 4EG1A 1K8RA 3D4LA 4M49A 1IULA 2ZYWX 3UJ9A 1R6UA 1WB6A 1AT1A 1ECJA 1Z0UA 4MNTA 3OM1A 3LAWA 4WKOA 1LD3A 1BHQ1 4HLQB 5DSTA 1UPBA 4RVHA 5IVKA 2W2OA 4L0CA 4A23A 2AJ8A 3EUEA 1W76A 2WHPB 1UH5A 4NONA 4IILA 3K6JA 2B7BA 3LECA 4ME6A 4RMHA 4HD8A 1B8VA 1P1FA 1AKVA 1GKUB 1KI2A 3KIPA 2RHJA 4G01B 4UPDA 3KLBA 3KR1A 4G0PA 4BVFA 4GPD1 2ZR8A 3C1TA 3DDSA 3CVWA 2OAGA 1K5DA 2ZCUA 4E51A 4P7JA 4HUTA 4ZYXA 5BUCA 2PIAA 1H2EA 5EERA 3QW4B 3WL7A 1X1RA 2QP9X 1ADFA 1KK1A 2I6XA 1M0WA 1WXEA 2I4IA 2J30A 1K6JA 3WMFA 4EY6A 5AJYA 2IV7A 3EZ9A 3B6JA 1GGHA 3O2JA 4RACA 4IMPA 1QF7A 1HNZB 3P8ZA 4YO8A 2J3LA 4AVYA 5B1HA 1JUDA 3D6TB 2QN9A 5EXDA 4RH3A 2ZVQX 4WKCA 4UDNA 2R00A 1YXMA 4GL2A 3T3OA 2CFCA 4ZYZA 1TDJA 3ZCRA 4LGYA 1UXIA 2D2VA 5KJCA 4WK6A 4BMNA 3F4BA 1OX4B 4ZAVA 1Q95A 1RWQA 5EJMA 1N57A 2HK9A 1YJAA 2B1JA 3HJCA 3LS2A 2PGLA 4RL6A 2UXDB 4RD4A 1V71A 3NHPA 3P45A 2HA0A 2DFNA 2Z08A 5DSZA 4QT4A 2FV8A 1F4PA 4NNOA 4P4SB 2KB0A 3OJLA 3LY7A 2Z57A 4DSTA 5F7XA 2BUBA 3PXGA 3NU1A 3R3SA 4J7AA 1DWQA 4AUKA 4JEIA 2YZKA 3ENZA 2YHIB 1QHNA 4E5KA 5AKLA 4E2WA 4WLVA 4WFQA 1VJ1A 3TW6A 3C15C 5BV1A 3UJCA 4EHDA 4QLOA 4N5IX 4MKIA 1FVXA 4MRVA 4RA6B 1OTYA 5CNKA 2ODAA 1MJGM 3ZNNA 1PQWA 1AHIA 3AEQB 3PI6A 4UUMA 1N6IA 4WXPA 4XSVA 1CQZA 5T6BA 3CH4B 5ITZA 4CXMA 1H9BA 1NXTA 2FVXA 3VO1A 2O8EA 3JZAA 2G4LA 3L01A 2UYHA 3W7VA 2ZUDA 1R8QA 4NMWA 4RQAA 1S8AA 2G06A 2A5JA 1KI3A 4RY2A 4UTRA 1NA5A 1UBOS 2XBMA 1Y3CE 1XMIA 2QZ4A 5GGXA 3LZCA 2X0JA 5IAJA 4DIOA 3OFKA 4FYHA 4WXEA 1NXOA 4ZU1X 4LJ6A 4QU9A 4B3DA 4Y2TA 1NAHA 1NP3A 3D3KA 4BX8A 5LZ5A 3IIIA 3PRYA 3UT6A 16PKA 5K3CA 3SFVA 4LJSA 1DXHA 4RPIA 3PGMA 3L4SO 3RASA 4GECA 4B46A 2V7QD 4H1WA 1MAHA 4A0SA 5T4HA 1EWYA 5HKKD 2B36A 3OTIA 4KE7A 4YDQA 3I32A 5EN4A 1SVKA 3IP8A 1MVOA 2PX6A 3VH4A 4A2QA 3ZR4B 3DHNA 4BBPA 3B3FA 1COZA 2NTYC 3BREA 2CNNA 1KYXA 1L1FA 1R88A 5FI0B 2VRNA 2YZMA 1VJCA 4CJXA 3GQVA 1G21B 3GOQA 2P1DA 4OMDA 2F3PA 2QROA 1SMKA 3NYRA 5BNIA 3IYLW 1UADA 2X6RA 3ND5A 4L8WB 1TIKA 5C81A 2EYUA 4CKCB 4RTRA 2Z6UA 3QGMA 3FZEA 4IJWA 3PHBE 4ZZ3A 3GJYA 2IEIA 4WDRA 1U28C 1JIXA 3BSWA 4D6PA 3C2QA 3FOCA 3WIDA 2AXQA 1UM8A 3HWWA 3A0UA 3IQXA 5GZ6A 4MQLA 4UAJA 5BUSA 2NSHA 1P9NA 1RYBA 2BJVA 2VZ0A 3MCWA 2ATCA 4P1ZA 5EMHA 4DTIA 2FLKA 4EFLA 3OJWA 4EGAA 4YIHA 3BTUA 5KNDH 1KEKA 1Y8RB 5I7WA 3CLHA 1VPEA 3CGWA 2DKOA 5CIQA 2Y99A 1P0IA 2X0DA 3JWIA 2PT9A 2BHSA 3LIPA 2KPOA 2H1HA 1X19A 2DWUA 1C3EA 1GZ5A 2O2SA 1QZUA 3NBKA 4L8YA 2CUTA 3UK2A 5BSWA 1TEVA 3LXXA 4CLRA 3M1IA 4EB3A 2VJCA 2CV1A 1D1QA 1T9AA 2C5AA 4BMZA 4KN9S 2G40A 1AQIA 2BKUA 3KQUA 3GLIA 5DK4A 1UBKS 3C3WA 1P2SA 1BE8A 1NXSA 2C99A 2WABA 1J5XA 1LPOA 1SXJC 2H57A 1CD5A 3C3XA 3PL5A 5M3BA 1DIBA 3RU3A 1LRLA 1S6YA 1A9RA 3O92A 4GW3A 5KSZA 1P7VA 2AG8A 2R751 3EWNA 2HTEA 1E9SA 3PR3A 4RWEA 2RMKA 1Z6AA 4IHKA 4L8VA 1G9XA 4QHSA 1BXRA 3BORA 1PEAA 1FJGB 2FN7A 5FJJA 2XUKA 5HIMA 2XTJA 3IVMA 1VHLA 3FSEA 4RENA 4G0VA 5I4KA 1YC2A 3QHQA 1PZXA 4NXMB 2NYVA 2P9FA 3T4EA 3ZXUB 2VYNA 4OCZA 1RP1A 1P8AA 1DJQA 4TUYA 1OLOA 1FFYA 1RRFA 1ZGJA 3QI2A 3PJDA 2PQ2A 4M9SA 1PEKE 2F3QA 2YXNA 2ZJFA 1K5HA 5HA5A 2X76A 3I6IA 1VLJA 5A0FA 2IOQA 3NJ8A 2ZYHA 3U4HA 2YWEA 4FSHA 5AUPB 1NWHA 1S8FA 3UB2A 5AR1A 3RUDA 1G41A 3VMFA 3ED1A 1USGA 1IQPA 4CF6A 4LEIA 3PK0A 4D4LA 1Z47A 1TU3A 2FW7A 3UJBA 4DNFA 3UAVA 2AT1A 2PRZA 1GUZA 2X8JA 4EL5A 4WN9A 4A4DA 2M98A 3L0SA 2Y1WA 3I76A 3VR5A 2VP9A 4F4DA 3A11A 3UKJA 4I36A 1G19A 3V32A 2ZPTX 3N6VA 5AW8A 2QIOA 4GSLA 4M36A 3BT7A 1G4AE 1OGYA 1ZIPA 2XE8A 2XXJA 3FROA 3QZUA 1ACMA 1C3VA 4QE3A 4ZOAA 4DPLA 3AESA 1JDVA 4FYPA 2HA6A 1KZYC 1U0FA 1JSLA 4C0HA 3ITKA 2COUA 1B3BA 3PA8A 4GMKA 3VI3B 2QBYA 1EB9A 4JJ6A 4EF6A 2C59A 3E27A 3RG8A 3PJRA 3PXCX 4WIAA 4UEWA 1SQGA 1L4LA 3FB1A 3H3XA 3JZFA 1GGNA 1WX1A 3W9UA 2P9HA 1N36B 4TZTA 2EVWX 4M7WA 2IQIA 3ABSB 3I04A 5E6SB 1VL1A 3LUDA 3S7TA 4BECA 3RHZA 1FU7A 3GMTA 4MV6A 3SJ7A 4QBGB 1MAWA 4A2CA 2Z2YA 3FG9A 1XAIA 2JH9A 2B6NA 1KPGA 1TCVA 2VUSA 4PICA 4H7JA 1W6UA 1NVTA 2I6QA 2JF0A 4HDNA 4I50A 1WZ2A 5KPDA 1YQDA 3IHLA 4GM4A 2Z9CA 1FY2A 3ZC3A 3E5HA 3U1VA 5JDIC 4TL9A 3LBYA 4KRXA 3GCXA 3FJOA 1XD8A 2DBRA 1KIMA 4HQ6A 1WE2A 4Y7DA 5F51A 4BGIA 4EUSA 5C4MA 4R2IA 3A1UA 4FYVA 2PH1A 4ALNA 4ZHSA 3VPXA 4BEVA 5AXAA 3NHJA 4QDTA 3UAOA 3A4MA 4DLPA 2AV6A 5I4CA 3DEIA 3QLUA 1XDWA 4KV7A 1BG6A 4Z3DA 5LCXA 1J70A 3L1IA 4ZEVA 2DUWA 2B4AA 1QFXA 4TMKA 3TSWA 5B1SA 3I6YA 1O9HA 4L6IA 3H2BA 3H84A 4LQLA 3UICA 1DWPA 1SZJG 5J2UF 1GGJA 1SBTA 2HQOA 1PZGA 2LDXA 3B1KA 3H9JA 1R2QA 5BMOA 4PHFA 2PUDA 1C30A 1JSCA 3WP1B 4QYXA 1P2BA 5CLHA 1JDSA 3A1CA 2GPBA 3O4JA 5GZ1A 5F98A 2C9MA 3IMGA 4FJ0A 1DIAA 2BV3A 4MWGA 4PQEA 4Y2UA 3ZHSA 2I78A 2O3JA 3LVFO 1MJNA 1NR1A 5LNK1 5IDWA 1G17A 3AL0C 4XKJA 5E6UB 5TARA 4LPSA 1HE3A 3ZV6A 3B9RA 4NZPA 3HM2A 3U7FB 4MEBA 4QQKA 1C1DA 4TX1A 3MMPA 5IUNC 2R6JA 1HLDA 4ZO7A 4UASA 3NPAA 1YMQA 4ZPXA 4II2A 5GJWC 1P1HA 1OFVA 3OPYB 3ZKWB 5JCXA 1FP4A 1YIDA 5FR1A 1NIJA 2V65A 1T5TA 3B8EA 2FPSA 4ZVLA 2ZK7A 1BA3A 2ZIGA 4U7TB 3AEQA 5T7BA 3VU9B 3DDWA 5AI9A 1UZMA 4L9RA 4LJAA 5FX2A 3V4VB 5HVNA 3TSAA 4R05A 3QK7A 3CBQA 4BKUA 4A6EA 3CHYA 1FDVA 1YNSA 4H6WA 3FPJA 4URYR 1NT2A 2O8VA 3GDHA 3HN6A 1M1NA 4I08A 2VPPA 4XB6B 5F2NA 5EP2A 3ICCA 3SR0A 4AJEA 5B36A 5H68A 5ALGA 5A5VA 1NN0A 2O7VA 4B4UA 3A1WA 1EFLA 3OZVA 3WHPA 1YJXA 1DJPA 2CCGA 4K9KA 4AP6A 1GZHB 4HWGA 4IIBA 4ARZB 2DG2A 1IVYA 1N34B 4LJRA 1CXZA 1CQXA 2ALJA 4G1UC 4DILA 1ISJA 1OASA 1VRWA 1FLNA 3DQZA 2H4JA 4DE5A 3DVQX 3EC1A 3INRA 3LVBA 4P7FA 4BAZA 4F84A 2C7RA 2B4TO 5TQ2A 2P0AA 1WZNA 3LKVA 1MEEA 4K6KA 4MVJG 3BE5A 5HCNA 2QR2A 3PNLA 3ZVMA 3VYWA 3FZNA 2ZIXB 4QOHA 2NPOA 1E9AA 2A30A 4CT4B 4TKVA 3OT4A 5J59A 4QJ4A 1GKIA 1EK0A 1DQSA 1M6NA 1PT5A 3AJDA 4A0GA 2WLTA 4L6CA 2O7RA 3B7GA 1KZ6A 1I3OA 2VJAA 4GQAA 4AYWA 2XNKA 4NE7A 5CDFE 1UJ6A 3DZ8A 2EQAA 4KAJA 1F6WA 2BP7A 1V8DA 4Z9XA 2ISQA 2DUJA 2NUTB 1DBWA 3HUDA 1J49A 3O8OB 4HHEA 1T2FA 3A2NA 4PC3A 2PSDA 3ETNA 1E7SA 2QT0A 1XEWY 4UBKA 5H16A 3HDTA 3C70A 4JGIA 3FD8A 2N47A 3EXEA 4TQUS 3GMIA 4PQYA 1KE1A 4KN6A 1HSZA 3FHOA 1ESMA 1F9AA 4R8LA 3I9V1 2WF9A 2AC2A 5DZSA 4ANFA 4CMJA 1Y7TA 2YIJA 4PYJA 2BC9A 3B6ZA 3MJSA 2R62A 4HN4B 2PD4A 4CTJA 2IBSA 1CF9A 1U8ZA 1DOAA 1L8XA 1T8SA 3ZZUA 1Q22A 4OA8A 2JLQA 3IDZA 1T5LA 4GWLA 3DWGA 3BMCB 3N58A 4JUDX 3PGA1 5F7OA 4I4IA 5JEDA 1AKYA 3U80A 1F14A 3Q7IA 3DWIA 3SEAA 3I62A 2Z5VA 2AG1A 4AU1A 5LQDA 1JN0A 1FFDA 1L4HA 2P6UA 2RFLA 4DDKA 3MWEB 4FKZA 4HBZA 4S0ZA 3A6DA 1OXSC 1G66A 1F2UA 5LYJA 3L1JA 1AXEA 1I4DD 1B23P 3BWYA 4N3CA 3NRCA 3UQYS 2PT7A 2A59A 3DVAB 5I3ZA 2A52A 3DCIA 1PNOA 1Q16A 3CFHL 2IC5A 1ONSA 4WNYA 2GBIA 3AI2A 4GE3A 4R8VA 5GV7A 1X86B 4RK1A 5KSOA 1V41E 1ZGHA 3E9DA 2FU5C 4R2LA 4RFSB 3FKJA 3ISJA 4GP9A 2PUVA 3VPCA 1X8KA 3QFRA 2DB3A 4QPCA 4AZVA 5JZOA 1K6XA 3HN2A 2CJFA 3S1SA 1NULA 1D9ZA 5JSZB 4O6VA 4WLFA 2Y68A 2K2WA 3GDGA 2MMCA 4DY6A 3UWMA 2Z1DA 3D8RA 1JLSA 2ABWA 1QBGA 2RBKA 3ADPA 4MLDA 4ND8A 3ORFA 4A7PA 3HU1A 2NZYA 3KL2A 5AW1A 4D4KA 4H17A 1NZDA 1SM4A 5KNCD 3RHSA 5EJFA 2FWPA 4M55A 4ILKA 1SCUB 4RZHA 3CZPA 5JSKA 3TIFA 4BQRA 3U5TA 3VYVA 3RVNA 1OH8A 2JBHA 2PUHA 5KX5F 3N7AA 1VE9A 1NBME 3E0QA 5HE8A 3V7UA 2H1FA 1Y7PA 3A7DA 3DAPA 2IZ7A 4H7EA 3OA0A 4TYQA 3W05A 1P0MA 4KRYA 2XB8A 4HDAA 2R6ZA 3T7DA 5EWMB 5GOZA 3RF7A 3KC2A 5PNTA 1QIGA 3ZLBA 1Q3TA 2RONA 1EFUA 2AD1A 2DQYA 2NO6A 1ZNQO 2JIPA 2PDAA 1KKLA 5EWJB 1MDBA 4BWGA 4DHEA 4G85A 1ORTA 4PG8A 1K9VF 2W2PA 4ODIA 1EVEA 5I45A 3CN7A 4ZOCA 2E48A 1KVRA 2IPAB 5KNBD 3O90A 2E3JA 3Q2KA 2P40A 2UYYA 2DRIA 1KFEB 4YO7A 4M3NA 1R1DA 3MGKA 2XXAB 3LPNA 5SZIA 2V6MA 3WDSA 2Y1KA 5DMHA 1RXWA 3FKSA 3TO5A 3OAAA 1CQIA 2VTEA 4KXXA 2AG5A 3A9RA 5E38A 4ZGWA 3RE1A 1MAUA 1AS2A 2LTAA 3QYAA 3MT7A 4F9GA 1WETA 2QSUA 4IEIA 3UXHA 1O0CA 1S1MA 3W34A 1V37A 1NI3A 1RHJA 1Y42X 2B8WA 2X4GA 3HYRA 3TR0A 2F1KA 1D09A 3DYIA 3WB1A 3OY7A 3QE9Y 4U4AA 4MOWA 5H1YA 1CBUA 1DIHA 3GEDA 2XJ9A 3GAFA 3I4FA 5I9SA 1T4CB 4PZLA 4JUFA 2E1RA 4G6ZA 4EO7A 2ZJ6A 2RHCA 2ZAYA 4IDOA 4CZ2A 1R12A 5KWEA 1X8XA 5FOWA 3O8DA 3ESBA 1DC3A 2ILVA 4N0MA 4RIGA 5SYAA 3GAMA 1NBEA 1ESDA 3ZLTA 2PLWA 2FFBA 4XM0A 5LLTA 3HJTA 2CXPA 5DNDA 2GPYA 3HGQA 1QP4A 4PHTA 1XP5A 3H99A 4YPVA 3KEMA 5AVYA 3MJFA 2QG4A 1QIMA 1TEZA 4MPPA 2J9GA 2JVIA 4M9QA 1OOEA 3HRHA 4QFCA 2JC3A 4RTQA 5K09A 4G0QA 3JAKB 1G4UR 2P9BA 5A3VA 5NLLA 3T1QA 3BH0A 2QORA 4N3BA 3L0BA 5J5AA 1DTWA 4PAWA 5DFAA 1KXJA 1YZYA 1OX6A 1NBMA 2C4VA 3O03A 1GPLA 1NX9A 1W5AA 4QXPA 4S05A 4QULA 5LIRA 1FTNA 2VN8A 4DLTA 4V0ME 3TDNA 3UMGA 2RGNA 1E6CA 2G5PA 1KQNA 1EI9A 4CI9A 4HNTA 1K06A 3EF1A 3KQQA 3K9HA 3M6VA 3WLTA 3O73A 1MV5A 2KLBA 1T36B 5TC4A 1WB9A 1PI3A 4O4LA 3MCUA 4POOA 4AICA 4QLBA 2XYVA 3MQ2A 4WBNB 1XAJA 2X2EA 2R6R1 2V58A 2EBFX 4DMGA 1WZIA 4FONA 1H4TA 4JP3A 3RD5A 3KWFA 5ITWA 2R44A 3VGPA 4EUKA 2O8CA 4KREA 2VNSA 1E5DA 1DMRA 2MYNA 4U39A 3PE6A 4PIVA 4J2HA 5KOIA 1QIKA 1Y3FE 1OT3A 3L43A 1NP7A 1WOMA 1S7GA 3AWIA 3ORYA 1Q1NA 1VI5A 1QPGA 2B9VA 1BKDR 1O4VA 2P2DA 3FB4A 3JVVA 3QNMA 4GRAA 4IIJA 4JLJA 4ALMA 3TINA 1EUQA 4WGGA 1JA9A 3F98A 4B76A 3KR2A 2G9VA 4ZU3A 5LM3A 1GNTA 1UFRA 2VUTA 5ALLA 3RT7A 4M0PA 2NP7A 1ICIA 4WPGA 3WXBA 4UREA 3TQQA 4EG7A 1P75A 2EC5A 1WY7A 2DKFA 4JU9A 1JMKC 3GRPA 3T34A 1L9XA 4KO8A 4BQNA 5JYBA 2G8LA 3CMCO 1WDTA 3L7LA 3W8DA 5LN1A 2ECOA 2JLSA 4I5EA 4IJKA 4MA0A 3I5YA 3D5TA 4OSOA 3E7PA 4FR0A 4JUBA 4KTTE 2D13A 4P3KA 3NDRA 1NM5A 2NO4A 5T4EA 2DFLA 3ZE2B 3RADC 3QENA 4GQIA 4TTTS 4WZAB 3ZWXA 2B2XA 4C2AA 5TVGA 3FI0A 3FYCA 4WASA 4AZ3A 2C2WA 2PH5A 3DL0A 4X64B 5IM4F 1SFRA 1KJ9A 1SOUA 1U9CA 1XA0A 1NASA 5JADA 4Z9YA 2ZJAA 5JH7F 2GFIA 5KYXA 3PC7A 5EJ5A 4B0PA 4JI2B 5DTQA 4GX5A 2QLBA 3WA6A 3EXEB 1J56A 3DEYX 4HXGA 4KCGA 2BM8A 3D3EA 1T8YA 5T8KA 1FPQA 2BM9A 2RHGB 4WXRA 3OHPA 2FPWA 2ZUBA 3OX3A 3TD9A 1WVMA 3PP8A 1ONPA 2AN3A 4JELA 5KSWB 3L6UA 1K8XB 2ZREA 4FCCA 4GRIA 2QMUA 3B89A 5ALIA 3T5AA 3PUKA 1YI0A 3RIGA 3S5UA 1JHYA 5KI6A 1OA0A 4ENWA 1BVYF 3EODA 1XQWA 4LOIA 4QO8A 3MYYA 1ZW6A 1WQ3A 3OTWA 2J9XB 3EVZA 2Z6VA 4B83A 3GA0A 3L1UA 1K27A 4F1JA 3I61A 1EUYA 2CLEB 1K4MA 1KMNA 2BGKA 2GVZC 4S3MA 3GRAA 2WVGA 3A70A 1X9HA 4MA4A 1QVRA 2HK8A 3CWZA 1OKKD 1TEHA 4HRVA 4MQ6A 3M6XA 1KYZA 2EHJA 3OBBA 4Y9DA 2ZVPX 5FFFA 1L5MA 4MV8A 2K7ZA 1IN5A 1M2EA 1JG7A 1ODTC 3K16A 4ESVA 2FUKA 1NURA 1MCZA 1PV1A 2H65A 2Q3BA 3PIRA 3Q7PA 2PD3A 2XMZA 4R81A 1ZUNA 4FD2A 1ZY2A 4RK7A 1F8UA 4YWJA 5HTOA 2ZATA 3RM3A 1D2HA 4WKPA 1O95C 2IDZA 3N2KA 2Q41A 3UTCA 4I66A 3AU8A 2ZJ2A 1IEVA 1JQDA 1Y82A 4QGHA 2ZUUA 3IUBA 1QO0A 4XW2A 3EXFA 2WJ6A 2XMBA 3BHJA 5I7OA 2HSGA 3OQOA 2AZDA 2OQIA 2A94A 5A7FA 1SXQA 1J0AA 4I46A 4LZNA 3WNBA 2YYYA 4YMUA 1NVVR 2RH5A 4OO3A 3B8HA 4DGQA 1UMCB 2W37A 3EQ2A 1PNQA 2B8TA 1C7FA 5FNZA 4BO2A 1LV7A 1XMJA 5JSUA 5LQJA 3QTBA 3YASA 2ZPUA 1QYWA 1OILA 4WLOA 3AVYA 4XOIA 1EJ6A 3T35A 4HWSA 1SBCA 4V0KA 1JQLB 1GXSA 3OCVA 4AL4A 7GPBA 1QIDA 1L3CA 3ND7A 1P74A 4LI0A 4YJHA 2JATA 1T25A 4PBRA 4TROA 4J1TC 5CH5A 1GGKA 3DL2A 1L5VA 4HDRB 1FLVA 5JVDA 2O5VA 4B7ZA 4PLTA 4IDCA 2P3OA 3IAS6 2QD2A 4O2BF 3RRBA 4DDHA 2V03A 3A05A 3QFHA 5E6RB 2G83A 2PMKA 5JSYA 3PQ3A 1WUTA 3VSBA 4IOJA 2PGDA 3ZK8A 1U3DA 2C7PA 1RWVA 2VHVA 3IQFA 4QJIA 2FEXA 1AN9A 3H9QA 1V16B 3FJ1A 3I6BA 3ZW8A 4F9TA 1MB3A 3GIWA 5DNAA 5CDTA 1OIVA 2CFRA 1CUUA 3UGKA 4QDZA 1AXGA 1ULTA 4YASA 5C4IA 5E1DA 4H4DA 1NUHA 4WZZA 2BHTA 1B73A 1R18A 1WCIA 2V4MA 2AOUA 1TT5A 5CTAA 4TVSA 1P3Y1 1V8BA 1XU9A 2OV2A 2GXQA 1BU5A 1ZGAA 2AR0A 1ENZA 2ACKA 2IYOA 5K3FB 1J25A 2XUIA 4EAQA 1CZNA 2OESA 3IUJA 2KM1A 1LDGA 4YH1A 4KQIA 1MHPA 4HN2A 2Q99A 3R6WA 1G2OA 1R00A 3PE4A 1RC8A 2OZVA 4JYMA 4PY2A 3OECA 3A3YA 4W5TA 2ZR0A 3LC0A 2PFKA 2HO5A 4FFDA 4G36A 4GLFA 4OQXA 3ASVA 3AYZB 3EDRA 1E5VA 3UCEA 1A8QA 2PBFA 1XRJA 3K31A 1NYQA 3BJMA 2Q5JA 3BX1A 3R3UA 2WJJA 1WA5A 2EERA 4JZKA 1VL2A 4MV9A 4W82A 5BP7A 1WBDA 2ZP1A 3GN1A 3UW1A 2AX3A 2VT7A 1IOZA 2QN1A 3EVEA 1LNQA 1OWNA 4K9PA 3VYSB 1R8SA 4PN3A 2WK1A 2CV2A 3LCRA 2FAXA 4H3VA 3T95A 3JVEA 3CINA 1K5GA 1PUXA 1DEXA 3BSYA 2CMGA 4L3OA 4J0HA 5TGDA 2DWQA 3QRWA 2Q2OA 3QU7A 1VECA 2DEUA 1ATIA 2EG5A 2HREA 3O4GA 3MTIA 3SXUA 4LF9B 1ZJYA 1LVGA 1PUJA 1TA0A 3IUSA 4J4TA 2DU8A 3SJBA 3LW7A 3UC5A 3ZDDA 2HRCA 1NVBA 1ZQ9A 1IEXA 5T4FA 3W0LB 3ROZA 4QU0A 1C4WA 2XCRB 5HIIA 4QPDA 1NYTA 3AUFA 4GL4A 3AUKA 1J20A 4R0VA 3G49A 2BSAA 4GI2A 5AKKA 5K4AA 5EJ2A 3RW9A 4U8GA 4EJSA 3THRA 5FFNA 4DB2A 4I1PA 3AY3A 3EZNA 4NPCA 1PQPA 1SBZA 4Q9AA 5BURA 3HDGA 4IIDA 4Q0MA 2IZ6A 2VHTA 2C92A 2J7PD 3B9PA 3C6MA 3L77A 4WHMA 4ESEA 4IH4A 4ZGGA 3VHXA 1JX6A 1QAQA 1E89A 1XGKA 4TWAA 1CJBA 1JDPA 2FZCA 1O95A 1WUKS 2IPOA 2R25B 4Q03A 1HT0A 2FEKA 2N9UA 1VKOA 1KZ4A 2R6AA 3FI9A 3MAJA 1ZINA 4HK4A 3ICVA 4QICA 2C07A 5EIEA 3PYMA 3WGNA 4G5XA 1N5IA 3O4VA 3KAQA 2YMPA 3C4JA 1D9XA 3VX4A 5HM6A 1JSXA 4U2EA 1AC5A 1MA0A 2VA8A 5C80A 4CQLA 3ILSA 3EDYA 2Q50A 5P8WA 3WLQA 1HTTA 2BFEB 1W47A 3BSSA 2PMCA 3B1ZA 1CT9A 3C5EA 4RF3A 3PEUA 3R9IA 4I3HA 3RVQA 4TYNA 4RDXA 2QMHA 1VL0A 3B1XA 1O8BA 3OPYI 2VDNB 3R1IA 3QX8A 4K8OA 1SUSA 4P93A 4W63A 1XMQB 4LJ5A 1P6QA 3K0HA 5TRTA 1J7JA 4C4SA 3E5MA 5KEIA 1TQ2A 3IOYA 4KQ9A 4WD3A 3ANNA 2Z98A 5IKMA 4JV5B 2RIPA 2EW1A 4Y18A 2HSZA 2QPTA 3GMSA 3JQRA 4C0WA 4QBHA 3PPVA 5K3EA 3N2YA 3K9BA 2NVWA 3GEPA 2WVHA 4PG6A 3TQFA 2RE8A 4YVFA 4B3BA 5KYXB 1V45E 3P4YA 1S0UA 2QYOA 2ZIVB 4CR6A 3GUVA 1KAEA 4LXUA 3C41J 5CDFA 2I6TA 3OEHA 2NU9B 2GN1A 4KLCA 4Q7EA 1TIBA 4KQGA 2VXOA 4IIHA 4X8LA 4CIXA 5CB6A 1DOZA 3CF2A 1WXWA 4ML3A 4G5GA 3ZXYA 4U9HS 2CHFA 1HNXB 2DPXA 4MPTA 1CR1A 1RWWA 2ZIZA 3L84A 4ONEA 3U4GA 2O52A 1LSJA 4WW0A 4YRDA 3QEJA 5DW0A 5TQ2B 4CEIB 3KKPA 5FOVA 3W78A 2GK4A 1N3YA 3IBSA 3I01M 1X7YA 4KO4S 3UPTA 1SULA 4RVFA 1K8QA 3ZWQA 4EHHA 1IDOA 4V0OA 3TH5A 2MTBA 3MJ4A 1BWPA 4BO9A 8ABPA 2XMSA 2ADOA 2YCBA 1ZPDA 1GTMA 3HACA 2HJGA 1RCTE 5HS6A 4EYOA 4HNUA 1OYVA 1TQ4A 4J0QA 3IURA 4G4IA 4IHJA 3OLCX 4ARIA 2O3SA 3ESXA 4Q9KA 3H9BA 1Q0SA 1W4BA 1LDMA 2ZITA 5BSKA 4L4SA 3V6LA 4KGVA 5BW8A 4JSRA 4XSGA 2SKDA 4MYSA 4D4IA 3HJNA 3O4HA 5TDHA 3G88A 3NHLA 3BJEA 1NJ8A 2Q6VA 1NUUA 4QWMA 1XVTA 3G2QA 1RWMA 3C7AA 2WD9A 4TYMA 2OHGA 1LK0A 4LUCA 1KJYA 3GNQA 1Y81A 1JLLB 1ESZA 3HU5A 3IKMB 1WCV1 5H80A 2W93A 4F4IA 1JSRA 1V4NA 5CIWA 1SVNA 2OD2A 4HWKA 3EX7C 4FNOA 3COSA 1N1EA 3KBOA 5AXBA 3VU1A 4GIBA 1HNNA 4O2BB 2FX2A 1PJRA 3LQRA 5MGNA 4E46A 1UEIA 3K72B 1NG1A 4QUDA 5BW4A 5JXGA 4OHUA 4QOIA 3WDMA 5BRAA 2AUMA 1GHTA 4QBKA 3MELA 1E32A 5AOBA 3T99A 5EHZA 1RLMA 4GZMA 2FG5A 1M1XB 1H0RA 1W88B 3D5EA 3PNYA 5KWIA 3U19A 2XEDA 3NMUF 3KPVA 4AG5A 3U61B 4OLBA 1ID8A 3E8SA 3KE9A 2HW8A 9LDBA 1V2HE 2CNWA 1E60A 3FDJA 3HA7A 1HORA 1RRMA 1CLUA 1EUZA 1KPHA 2PU7A 3H4MA 5ELMA 1OYWA 4BDSA 2E4ZA 2H3EA 3U3RA 4CQJA 2QRMA 5L6LB 3AWDA 3AIOA 3TPFA 4BLWA 4MRAA 1IPFA 3CS3A 3DAFA 1GYQA 2Q2VA 2P2ZA 1FMLA 3ETHA 3TUJC 2C54A 4EYGA 4OJMX 1V3QE 3EPKA 4IOLA 3DAYA 5HPYB 2GARA 2RGWA 4IS3A 1H6CA 4XARA 2ZIWB 1A9PA 3GDFA 4JEMA 1APBA 3KZOA 3BFKA 2YRXA 1TOAA 1WY5A 4KE9A 4OPMA 1VPLA 2WAXA 3GFGA 3TXYA 5KCZA 5KOHA 5HFJA 1LPNA 4MW5A 1NAIA 4RK5A 1SD1A 4WOPA 3F46A 1C4OA 3AL2A 4JVSB 4LJYA 1ZD2P 5G4KB 5KYYA 1Q0LA 3N0XA 5A0VA 5TMBA 3CEAA 4XX0A 1O5OA 1MB0A 4MHTA 3OZEA 1B6GA 1N7JA 1X1EA 3FWZA 3LLMA 2QX9A 4ZJUA 1PFVA 4Q3EA 2Q6KA 1NMYA 3HVJA 4QTXA 5BPHA 2UYCA 1NI4B 4NJEB 1O94A 2NTEA 3OD1A 4JA2A 5FL3A 3OE1A 3AVTA 1X7DA 2Q6IA 4B40A 1T9KA 1B42A 1PT8A 3PZRA 3KZ1E 4B3GA 2D2FA 2M1ZA 1ZLXA 2AJBA 2FJ0A 3C4VA 3JCZA 4DC9A 1KDTA 3R0XA 3H2HA 3I9FA 3ZWMA 1HFEL 4FXPA 2JCSA 5DNVA 3N74A 4JVMA 1T8WA 5E9JA 3RARA 4J7XA 2HQRA 4LJ8A 3GGJA 2FFRA 4F0JA 3EFHA 3H5RA 4AQDA 1PR0A 4FFBA 4KHZA 1XKLA 1JECA 1M1UA 2DHQA 2PGXA 3A1EA 4NK5A 4TZ0A 1VSVA 5G53C 3TW4A 5ED4A 3G5TA 5CJJA 4CMEC 3L8MA 5FLKA 5SY4A 3ZD6A 3OX1A 2ZSBA 4TSRA 2Q29A 2BHRA 3N07A 3R09A 1ODSA 3GNSA 1JHUA 5KTPA 5LD2B 3OZFA 4MW7A 5TMDA 3PNOA 4CKXA 2RBGA 3IUMA 2BPOA 1FVOA 4LRTB 2G71A 4QG7A 5ITSA 5FYQA 2HDHA 3TXXA 1HYBA 2X0EA 5B3AA 6PFKA 2V7VA 1U0OC 5AM0A 5B3JC 2O59A 4LC9A 2O5CA 2CLFB 5DIFA 3HDYA 1YRBA 4D99A 4EVSA 5IVIA 1H1TA 4NYJR 3CLUC 1CIPA 3NB0A 3PQFA 4U7HA 3SBOA 4C6TB 5HK9A 1NNEA 3WLFA 1E64A 2WMYA 2EBWA 5FA6A 3OTOB 3A2KA 1QVWA 5AH0A 1I9GA 2VHXA 4CKYA 2CF6A 1KJNA 1N1DA 2QR5A 3KCQA 4L57A 3THYA 3OTHA 4Y6RA 2O3TA 1Z0DA 2XYPA 3NDJA 1G1MA 4IGEA 1M7HA 1TM1E 4C4AA 4G97A 3KWMA 1IOLA 5A4AA 7ADHA 5LA6B 1DC8A 2RGXA 2LCQA 2AIRA 5CT9A 3EIQA 5H8WA 3AG6A 3AXSA 2FEMA 3K0CC 1LRJA 4RADA 4P2BA 3PWKA 2ODPA 4DBVO 3VNUA 4W4TA 2NO0A 3EH1A 4IX1A 2NVUB 3ER9A 4BCDA 4YREA 1Z73A 1BMFD 4JI7B 2Q3HA 2ZJ7A 1NUTA 2IXDA 1Y5RA 2ENWA 3HL0A 3W5AA 4Z2AA 4IXJA 2LD4A 2ZBDA 4AN0A 1Q1BA 4EB8A 1GQSA 4M7RA 1A27A 4EOGA 5HUQA 4P31A 5BMVB 4E2YA 5GY7A 1G20E 1D2RA 3RAGA 4KEAA 5IXSA 1Q1QA 2IXTA 2QS9A 2GBFA 3ASZA 2DULA 3AY7A 4YJKA 1VKNA 4PGHA 4TL8A 4CV0A 2Q3MA 4RVCA 3PX2A 2H4YA 3RSZA 3ZGOA 4YLYA 4IINA 1GCGA 1S02A 1FRNA 2PLRA 1GPBA 3UQZA 1JEDA 3UOWA 4WA8A 1WO8A 3N76A 5FUQA 2JGJA 3EFBA 3PHLA 3HXKA 5P21A 2EKBA 3TB4A 4QPPA 3P9ZA 3P2JA 1DS6A 5ECDA 1CVRA 9ABPA 4HGYA 3QEMB 1ORRA 4NQZA 4NECA 3WGTA 4DEVA 4DWJA 1V4VA 2PS9A 4U3JA 1E2QA 4BO7A 3JYPA 5C46F 4D92A 5I4BA 1QHFA 1N25A 4QATA 1WMSA 2RHMA 2R0QC 2V45A 1QQAA 1IIRA 1BAPA 3H3FA 4ZZ2A 3NONA 3E6AA 4JYPA 3HU3A 4M86A 5I7AA 3HKCA 4ZVMA 2JG3A 1NXPA 1ZKDA 1HDXA 2OSBA 2AWNA 3AFHA 4MI9A 2D54A 1J8FA 1S2GA 5HILA 3TI7A 1R4NB 2CUKA 5AVUA 3RVPA 4RDCA 1V6SA 2FLVA 1D6MA 3M9LA 3HCBA 4UAGA 4DIMA 1XRPA 1EJBA 2VSNA 3DBRB 4AZSA 1XTBA 2W2VA 1JVNA 3FSGD 3AGPA 2EFEB 2VAMA 4IUBS 1R15A 3RS5A 2J6IA 1BKSB 2LUOA 1T2DA 1SU8A 2QTVB 3A9UA 2C5BA 4OOEA 4WK2B 3SAJA 4WH0A 2VTBB 4LVCA 2UV8A 3RUHA 2OPHA 1T4DA 1XOIA 1HETA 4AIIA 4RANA 3LCVB 1OI2A 3WLHA 3ZBUA 4PPFA 1PGQA 2O05A 2AOTA 2F7SA 3PBKA 3QW2A 4URFA 2W6PA 3VH1A 3ZDRA 3WGJA 4BEWA 5JLAA 2ODNA 3FCEA 5E9QA 3RIMA 4F5YA 4OMFG 3KU4A 3NRBA 5BNWA 1XALA 3WNQA 4BE7B 1XJCA 1AUPA 1ZZGA 2XUAA 4JVNA 5DGDA 3JATA 2E5LB 1YZ3A 2FDXA 3HA3A 1Z4JA 1HV8A 1SK8A 4U8HA 1GG9A 1L4UA 2CVPA 4BRUA 3UMMA 4Z4EA 3RC1A 2QRVB 4X6UA 4BLVA 1BDHA 1ZD8A 3JWPA 2XNHA 2O6HA 2ZRMA 4G41A 4L8FA 4UJ5A 5CX1A 3ZWOA 4BEJA 2G5GX 3FSRA 5BSUA 5CH3A 4XZ3A 1BZYA 4OHPA 1C9EA 2AKAB 2PWZA 1CFJA 4D80A 2JAOA 4AJKA 4Y2VA 1FJXA 4XD7A 4GBED 1E2JA 1JR2A 4JP2A 3UK0A 2BVNA 2ERCA 3PS9A 1SVUA 1TU0A 2PRSA 2GASA 3TQIA 2AJTA 1HZZA 4NPAA 4QAJA 4G4GA 4WVLA 4LXIA 5IVHA 2VDLB 5D84A 3SKXA 2PJRA 4ZRNA 3IV7A 5E4FA 5LOVB 1CEQA 3EAFA 4H6VA 5BT8A 1PYDA 2YMLA 1V5WA 2N1BA 2NG1A 4HMQA 2W6NA 1ZM7A 5FHRA 4QOEA 3DXFA 1Q5PA 3I2IA 4EHKA 3A9WA 4B1FA 2XADA 2AZXA 3T06B 3AP1A 3ZCSA 3I9KA 4NKRA 4GSYA 1R0KA 3AFNA 4OQMA 2D4AA 4P54A 3OMXA 3VO9A 2NNWB 3A6HA 2G77B 1C8KA 1MO4A 4H0FA 4N9WA 2FP4B 1BW9A 1YDGA 2C31A 2QY9A 3BWXA 4NCIA 4XWYA 4DQ0A 4YS6A 3P94A 3B5IA 2V6GA 4RJLA 4D45A 3WICA 6NULA 4V1CI 2D7DA 2WB4A 1G59A 1T26A 2GS9A 1JDZA 1K75A 2R8XA 3TAUA 5THXA 1BRTA 1LPBB 3F7TA 4EFNA 5L3QB 2ZYUX 4M8SA 4N7MA 3WLLA 1U0LA 4OHVA 7REQA 3RVRA 1ZMRA 5CLGA 4E5DA 1XTPA 4IFEA 2FWMX 4I1IA 4YNBA 2ZIXA 1Q7TA 5BWNA 4C5AA 3GLHA 4KR3A 2BHNA 5ALOA 1YDFA 2Z5FA 4B3IA 4JC4A 1L8AA 4NFYA 1ZXXA 4BMDA 3ROKA 4Y0VA 5CFMA 4Y98A 3I4CA 3OZRA 5F9HA 2PYIA 1TVCA 2G07A 1R9MA 1VGVA 2ZSEA 2ZYAA 4W6QA 4F8YA 1P9LA 2VK2A 1DBPA 3PLAE 1BEZA 2GJ8A 3UGJA 4D6XA 4YRGA 2QY6A 1OY1A 2VDJA 3O8RA 1F3LA 3V8NA 4KRFA 1QWSA 1QX4A 4BV9A 3P9RA 3RT9A 1ATZA 2OCKA 4OBWA 1MRZA 3FVRA 4OHBA 4FMCB 5ILGA 5GONB 4PWYA 3QWHA 3VR6H 3AW9A 1WEKA 4E33A 1JR3E 2P41A 2PQ0A 4M53A 4CMCA 3ICEA 3ZE9A 3WDLA 1Z5NA 3GH3A 3CCFA 3IVGA 1EFVA 5DHPA 3D3NA 1YJQA 1G5TA 1NYLA 2W58A 3LT2A 4RHTA 1Z34A 4D9HA 5TQVA 3REQB 3LG2A 1RZVA 1EUCB 2UUAB 4BYGA 3IAM1 1V1RB 3A4YA 3I1YA 4UXJA 5DEOA 4M0EA 4PNHA 1M1YE 2A1UA 1IXYA 4C4XA 4GQBA 2BFCA 4KUEA 3CM0A 1RTTA 4Y9RA 2AFHE 2CBXA 2REXB 4IZ6A 2Z2JA 4B6OA 4B71A 5JMTA 3PC6A 1JIUA 1NBHA 1DINA 4OLAA 1IBRA 4R3UC 3JALB 1T91A 3NORA 2YNMC 4PYNA 4LK2A 5JROA 5AI0A 2XT6A 5JS1A 3R6LA 4IDHA 4CW7A 4ZMBA 3THXB 1YS2X 3C7DB 1UJ4A 3LX6A 4P0PB 2Y3IA 3U56A 5LWHA 2QRKA 4MV7A 4WNIA 4P4GA 5DHRA 2GR9A 4EY4A 5EZ5A 3MIZA 3V9AA 2OD9A 4ERXA 1JG6A 1US8B 2IY7A 1R6TA 1YZUA 1JJVA 4S2EA 4EI7A 1ZOOA 2BFOA 2VSQA 2GPWA 3H6HA 3JRWA 4GXQA 3SOZA 5IT9A 1RLIA 4MIOA 1WBBA 4RU1A 3O8LA 3KQVA 3MA0A 2C57A 3EBLA 1MP0A 1K2WA 1Q0PA 2GA9A 3RJMA 2X8LA 2RGYA 4GS5A 2EKLA 2WIDA 4JL6A 1P60A 3L6OO 4F7DA 4JXZA 1KK2A 1WEHA 4ZC1A 1TUIA 2FFAA 1V26A 3KR0A 2OG2A 4FOPA 4PYMA 4WK0B 5REQA 2RGAA 3T9CA 2TYSB 1NUSA 5AJXA 2NACA 4GOOD 3VUEA 2E4UA 1XV5A 1ORHA 4LMBA 2QN6A 3LWDA 2QLLA 2C94A 1RDFA 1O9BA 5DM2A 5TPWB 3PT5A 3QEKA 2GJ4A 5AUOB 3GLRA 3CR8A 4WLNA 5DCWA 1EXVA 5F73A 5EEHA 4MVJE 4EKYA 2HEIA 3QQPA 3OUZA 5L6MB 1XD2A 1CEYA 3K2EA 2EZ4A 3HBJA 4KI7A 1MZPA 1R3DA 3A9TA 4X93A 5EKXA 3IBCA 1NJ6A 4IP0A 4OBEA 4NHEA 4F8EA 1TEXA 4KWHA 1M0TA 3F3SA 5T4BA 5D1NA 2XY4A 5L3RA 4CF3A 4PSVA 4DS3A 1G291 1E58A 5CFNA 4X20A 4V03A 3UHOA 2CXXA 3L8CA 4DCVA 5A9RA 4TTPA 3ME5A 2EEPA 2ZAMA 3WL4A 3SM9A 4EHFA 4O5AA 2ZJOA 4PLYA 4J1NA 4PCAA 1KWKA 1NJSA 3HU2A 3I0MA 1ZC4A 3NS7A 4B7AA 4D3XA 1YDEA 3BMOB 5FTMA 1UODA 2HIHA 1ZD1A 2VC2B 3K0FA 1E9BA 1Q77A 2WYUA 3FDXA 4NLLA 3DMHA 3TTUA 3W5VA 4BVKA 4DUYB 1EE9A 4INOA 3TRKA 2EZTA 4FFVA 4QPJC 2GZAA 2P11A 1GLGA 1PJQA 1F0NA 1CY0A 4D9GA 1UOQA 3IE1A 4YA6A 3OZGA 2Y93A 3PIDA 3DMTA 1ISFA 4NF2A 7MHTA 1C0EA 1X70A 1XZMA 4DA0A 2D74A 5ICGA 1ZEJA 4GPIB 1VSBA 1QLJA 1XFDA 3DM9B 3U7IA 4M54A 3A58B 3UMSA 2EV9A 1FS6A 1X87A 2F9MA 3KSAC 2XZLA 4IDEA 3KZKA 3HEMA 3WRYA 4GPEA 4WLUA 1YS7A 2GOYA 1G8AA 5JNUA 4CQNA 2AB0A 4JX9A 1U2QA 4MVCA 4GE0A 1Z35A 3IOBA 1J39A 1Z2NX 3DTVA 1HZJA 1L1QA 3H19A 1G3IA 4N5HX 4NDAA 4D9IA 5JRJA 2WQ6A 4J3JA 3BBPA 3HR7A 4MR9B 4LF6B 4OYYA 2JLBA 4HR7A 2IOFA 3O3OB 4UD6A 5EIOA 1EK5A 1SXJD 1W35A 1C4XA 4H7IA 4MS3B 1SQ5A 1T1EA 2IVFA 3F6YA 4K6FA 4LTDA 3SQDA 1RFGE 2BBWA 4Y6PA 1MEJA 2JKVA 2QN8A 4GR5A 4LBVA 5CA0B 1U80A 5AVWA 4RKRA 5EZYF 4C7KA 2H4WA 4ZJZA 1EHCA 2OCAA 3DNFA 5KYUB 1K8ZB 3B3AA 1LEHA 1JTFA 1IATA 4BWYA 2A56A 4O4LF 4R0MA 3C7TA 4U7FA 3THOA 1KYIA 1G5RA 3NTOA 4DMLA 3G17A 1RHQA 4HUJA 5AM5A 4I4CA 2ID9A 3H9EO 1UT5A 4G5SA 2DBQA 4IX9A 4EY5A 1P5HA 3G1TA 3T3IA 1KEEA 3RFUA 1J8YF 4LW8A 2AS0A 2JBAA 3MD9A 2EOAA 2F3SA 2V7EA 2FZLA 2QK4A 4R9RA 2R7LA 2JI6A 1XTSA 4OHXA 2GLUA 2XRFA 4ZQIA 3UC9A 2PUBA 2YZ2A 3SQMA 4BNKA 1C4KA 4QUGA 4LWPA 5BNZA 4AZ0A 4TZ6A 2O8DA 5UKDA 2IPNA 3E61A 2N0SA 2HL6A 4N8EA 2OB2A 3NNNA 3TZEA 4BFZA 5B2EA 1E7WA 5DNWA 2IH2A 1BXKA 1VBMA 3GUCA 3MWDA 1IQ0A 3ET5A 3RYCB 3QE0A 3IAXA 2Y0CA 3EDQA 4UU0A 3THSA 4AKIA 4DIKA 1K5PA 1Y4AE 1EE1A 1OXTA 3B1VA 1CS0B 3ORSA 3NEPX 1XHEA 3ED5A 2I4OA 4D79A 1RAEA 3EEYA 3FFTA 1Z6XA 5C5DA 5IN5A 4EA6A 2IXGA 1QR6A 3U31A 1JKJB 1AZWA 1ZUD1 3U3MA 4DMFA 1JDNA 4P0QB 1O5IA 3P27A 4YRJA 1Y1PA 1ID1A 3KQLA 3FUVA 1E9DA 4KDEA 4MI1A 2DHEA 4EABA 2AOWA 4OATA 2NAFA 3TPCA 1AKQA 3EULA 4JD5A 5E6RA 3MAAC 4LQ4A 1JBKA 5AK0A 1NONA 3EEOA 1PD1A 4PO8A 2J3HA 3ZWPA 3G13A 1WHTB 1YNOA 3TL2A 1PF7E 1MO3A 1E5LA 1AGPA 4UATA 2PRIA 2XCUA 4FFPA 5AM2A 2P8SA 4DUPA 2GLXA 2OV6A 2OHHA 2D7JA 5G4KA 4KSYA 5E3JA 1LJLA 1SHTX 5KYKA 5EXPA 5IT5A 4GMHA 3T3EA 4AN4A 1PLKA 4JJGA 4IXMA 1QTRA 2I2FA 1U0TA 1U0SY 1YR3A 2WV7A 1A7JA 4LJKA 2D0DA 3DW1X 4JMLA 2AFHA 1GZ7A 3RO7A 3QVUA 4M60A 4A16A 1KWGA 4XUGB 3N3AC 1GFIA 1O94D 3S2IA 2A1UB 4B7XA 4BB5A 3H5AA 4FFWA 4LF5B 2F9LA 1GILA 4HUQA 4MWTA 5L3SB 1MQSA 2WKSA 1XK6A 1LBTA 1XBTA 3ROMA 3ZCUA 4DR5B 5BR1A 2XAUA 2DFVA 3V3TA 3T5PA 4NI5A 1Z7GA 3UAZA 4CMIA 4NCHA 3L82B 3RU7A 5ADVA 1QS0B 1T6BY 1ZJ5A 1VQ1A 3VSDA 1W36C 5GM2A 3HMQA 1NR7A 2R1VA 4AZTA 1FA9A 1SZCA 3IDQA 4D57A 1VLZA 1Q50A 3N6XA 1OFTA 1E6WA 3F0TA 3PC2A 1EX7A 3OAAD 1T2VA 1OZFA 2QZ9A 1ODIA 2E0IA 3O9MA 5IJ0A 3FIJA 1YKGA 5JOQA 3LVQE 2BFPA 3HCDA 2GNOA 3JSAA 1H2WA 2H2AA 2ZUSA 4X61A 3PIIA 3H2KA 4FP9A 1FP1D 3S5JA 1A71A 3LYUA 5BVGA 1KI9A 1YOBA 2V3VA 4IGKA 3GEEA 4C06A 4E88A 4RLSA 3TIIA 5B6JA 1JHDA 2X3FA 2IEZA 5F3DA 5J1TB 3RRXA 2JI4A 1L7NA 3ZHXA 3QQ5A 1FSZA 4MKZA 2IV3A 3SFZA 5CLFA 3P5BA 2YVLA 1PRYA 5AJVB 4CHTA 1EP1B 3P71T 3TXAA 1Y6JA 1C29B 3A28A 3O91A 5HF8A 2OYRA 1CUSA 4EPXA 2G5TA 3N0TA 4W1PA 3C97A 4RE5A 4D9KA 5F1OA 4G5RA 5CM9C 4DBZA 1Z37A 4ASUA 3LNTA 1Z0IA 3IBTA 1L4YA 1S2NA 1U3FA 4I2VA 4URUR 3T0FA 3ANMA 4JCCA 3M5CA 3R44A 4EO4A 4RLHA 3RVJA 5CD9A 1IN7A 3MWGA 4OFBA 1ESCA 4IW3B 1MC5A 1UCFA 2FP3A 2QUKA 4BRZA 4D2IA 1Y4DE 2DUNA 1W0JA 5JVDB 4RCZA 1IY8A 3H9UA 3SDZA 3TFOA 2VDMB 3A6EA 3B6KA 3NC0C 5CLIA 1ANKA 1E1MA 3FVTA 1W1IA 1GV0A 3IVAA 2VT3A 1VE7A 4Q9HA 2OAQ1 1NLZA 3C6XA 2AN9A 1GPKA 4BRWA 3NM4A 4URXR 4UZFA 2B20A 5KTRA 1NLUA 4Y6GB 1YKSA 3EWAA 3L7NA 1DLIA 2QTHA 2EL7A 2BELA 1Z4NA 3KXIA 4ZQHA 5LP6F 4PZCA 3K8YA 1Y1TA 1Y5MA 2KHZA 1SUBA 4HEQA 1A5TA 1I01A 1Y5LA 2O2JA 1KS2A 1DVRA 2PUFA 2YIDA 1F6BA 3K09C 5JO9A 3ZDZB 3W5CA 5TF4A 1IUKA 1A8UA 5FA8A 8ATCA 4L85A 5FBRB 2QVGA 5IP5A 2V59A 4B3JA 5LZ9A 1I10A 2R1UA 5AHOA 4X8OA 1NPTO 3JD3A 2QU8A 4PS1A 2VQEB 2NUBA 3AKEA 2QJFA 4K7JA 3NX4A 4RA6A 5DNEA 2AMVA 2NM0A 1JYEA 2YC2C 3J7AC 3K5WA 1MHTA 2QSYA 4ESHA 2Y1CA 3LY9A 1LPPA 1REQA 1OX5A 3AEKA 4DNXA 4ZODA 4RMGA 1A8HA 3DEAA 4UZSA 2GEVA 4H59A 4CLOB 1ZGGA 4FMCF 2JK1A 2I33A 3BXPA 3PNQA 3ZCQA 4BMVA 5KREA 1B00A 2A7QA 1EFHA 2X2FA 2J9FB 2QQGA 1AGNA 3CLKA 1RACA 3A37A 3V1LA 2NO1A 1CUBA 4B35A 5LZ2A 1ZGCA 1YAJA 1T9GR 4RAQA 1E1YA 2MYPA 1JXQA 4TV9F 4CKCA 3U4QA 4DLLA 1YUNA 4HRXA 4UDYX 5HUHA 5ALHA 3X1MA 1XDGA 5DOZA 1E0JA 1GKLA 2FPIA 4BHTA 1BTOA 1P2FA 3AESB 4I6GA 4C3UA 3C8DA 1VKHA 2ZT6A 1CJSA 3DLPX 2C7VA 4A1FA 4HQ0A 4K2AA 4C4ZA 1Q7CA 2A35A 5LVAA 1CJUC 1TM7E 1J2RA 4IGIA 4IJ5A 4NOKA 3ZS9A 5EWLA 3RIXA 3HE3A 4FGSA 4R41A 3EIFA 3VZPA 5LKAA 1FFXB 4DZRA 3PR2B 4YMHA 1MAVA 2QTMA 4FJ1A 4IQ8A 1XTUA 4PAMA 4ZDWA 4RTPA 3VNVA 1X1QA 4Q05A 2HJRA 1E4EA 4PONA 1YA4A 3LGSA 4RKWA 1A1VA 1HTWA 5DULA 3EMBA 3CZ4A 3EVAA 4HFNA 5KU1A 4NBUA 5KSPA 5AI4A 1ONBA 4ZZ0A 2VDOB 1E98A 4YN3A 3JATB 2QRZA 4NQRA 4Z1MD 5B5SA 4Z9BA 4Z53A 1KZGB 2O2IA 1PHPA 3VBCA 1EWVA 1RJGA 2OP1A 2GCOB 5EZQA 3SC3A 1GPMA 1ZH0A 4IUCS 2GBLC 2O6LA 1BO6A 1XF9A 4OXRA 3EAGA 4QGBA 4HZGA 3LKDA 1BXRB 1RLTA 2X2OA 4ZARA 4J76A 3K15A 1V1MA 2EQBA 1M6HA 1JHOA 2WYHA 3EUFA 4AMZA 4DDWA 4CODB 2Y4OA 4KQ6A 1IHYA 1DG3A 1OKKA 1Y4SA 3OICA 5GOTA 3T3MB 4I9UA 3OCCA 2FUG1 4JK3A 3DCJA 3PUHA 4BJ1A 4OQZA 2TMYA 3QXJA 3WMRA 3T5MA 4MI6A 1GPJA 2J6HA 4ZREA 4TMYA 3LRPA 3BWCA 1D2NA 2HHAA 4IF4A 3KVNA 3G2NA 2VHQA 3HVKA 3MCTA 3EQ8A 3U17A 3WNZA 4ERNA 1T9BA 1T1GA 4Y2PA 4YFYA 5IZCC 3CZQA 3U4DA 3NV7A 5CCXA 4FEGA 1SB9A 3IE2A 4G0OA 4LC0A 2GNPA 3GNTA 1GY8A 3RRZA 3WQHA 4QJBA 2DH6A 1EG7A 2W4IA 3BHMA 2YJ4A 1W0CA 2L17A 4Q16A 3HN7A 4RZSA 3TD2A 1XIVA 1XF1A 3QUQA 1S2DA 1MU0A 3THXA 3E8MA 3BZBA 3DH0A 5TJ9A 1YDHA 5JS6A 1T24A 2VP5A 3G59A 1PG5A 1V9LA 4XXHA 4HGZA 1TQDA 2OG1A 1XAHA 4JQZA 5ALEA 3SC6A 2JIBA 3IO3A 2GMWA 4LWQA 1OVGA 5JZ9A 5JJIA 1TAHA 1Y1RA 4TV9A 3WWYA 1MD9A 5K0EA 5D5PA 1VP3A 1U7PA 1XRRA 3L4BA 5LNK6 1IXKA 1D2CA 1TMYA 1EVJA 5BUZA 1RI4A 4FCVA 1RQPA 3RS8A 4PWZA 5LFAA 1H3NA 2RAFA 3OZUA 4BAGA 5CAEA 1Q12A 1G8KA 2VCHA 3HL6A 2NW6A 3WGHA 1Y8ZA 3CNNA 4O4JA 1P6XA 5AICA 3V2IA 2QW1A 2P5YA 2PAFA 4L74A 4DEYA 2X9VA 3U9LA 1T0BA 3SXJA 3ZV4A 4PN7A 3AHHA 2CK3A 1FP6A 3CNLA 1AA9A 1L5QA 3A9VA 4CMIB 5EIBC 4F3KA 1KEVA 2NUPA 4LS3A 5EE3A 4EHNA 4OLHA 1G2QA 1FRZA 3MFQA 2H06A 3MOSA 3EXIA 5GJCA 2X40A 4TKUB 1P33A 5F4ZA 5DBGA 4C87A 4K0KB 4RIIA 1U8FO 2PTHA 4ZQCB 4EWLA 3MINA 1PL8A 2G9ZA 4ZHQA 2HHCA 3U7QA 4E1BA 4DC1A 1CUCA 3PTLA 4RXUA 4JBHA 3HNRA 2WUEA 1XRLA 3NC4A 4N82A 3FMIA 4XDHA 4HYYA 2EGUA 2NUTA 2WNIA 4BGUA 2CVZA 2H2FA 2C2KA 2DTEA 2P7IA 3B36A 1DARA 4HAIA 4UM9B 1PR5A 2VK8A 2OGZA 3VR1A 3KLPX 4JDUA 13PKA 1BWQA 2C1XA 2FSUA 3AHDA 2JFYA 1DO2A 1NFQA 5C5IA 2W2MA 3QPAA 5DT2A 1SKAA 4I55F 3SR3A 3S1LA 2AE1A 4PC6A 4DMHA 1J5EB 4R1PA 4CEHB 3DCNA 1P7YA 2WWVD 3VBEA 2JJ8A 3BQNB 2A9RA 2PXHA 3CF0A 4QM6A 4A6PA 2PSFA 4JKOA 1WNTA 1DIOB 1EZ1A 2UVDA 1H2XA 2VBGA 1HOTA 5G2FA 3KPUA 1IEWA 2CEAA 3QVLA 5IKOA 3SQLA 3UWKA 1SCQA 1X1TA </