3IOBA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.80 ang resolution in complex with 5'-deoxy-5'-thioadenosine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
287
structure length
287
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Pantothenate synthetase
publication title A Fragment-Based Approach to Probing Adenosine Recognition Sites by Using Dynamic Combinatorial Chemistry
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 93
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3iobA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3iobA01
4JYZA 5TS2A 3IVCA 3LCJA 4MUKA 1JECA 2QUHA 1GTSA 2XRYA 5HUHA 3ND5A 2X3FA 3AKZA 1K4KA 3RK0A 1GZUA 2DEUA 1ZH6A 3F3MA 1YIAA 3AIIA 2QJTA 3IMCA 4ZT4A 3SEQA 2O5RA 4JZYA 1Q77A 3TZLA 4ARCA 1JIKA 3N2YA 1EJ2A 4OUDA 2YXNA 5DK4A 5LLTA 1EXDA 1OBCA 2QUKA 3P0JA 2QUJA 2PG3A 3VU8A 3COZA 2PIDA 4XFDA 3CLUD 2IELA 5DEOA 4JXXA 5TEVA 1NZJA 3HMQA 1WQ3A 3FDXA 1BS2A 1J1ZA 4I6EA 4ZT5A 1QU2A 3QTTA 1T6YA 3MLBA 1GLNA 3ZXIA 1WXGA 2HMAA 2V0CA 1MB2A 1KP2A 1I6LA 1KAMA 4L2IB 4MUEA 3RJZA 4UZFA 1WKBA 1JGTA 5HUJA 1R6UA 1O95C 1T9GR 2AG6A 4DNXA 1KH2A 1KQOA 3PNBA 4ND7A 1I2DA 4ZCQA 1EFVA 2PFSA 3D6UA 1ZH0A 1M8PA 5FO1A 4PBSA 3UK2A 4DDMA 1KH3A 2WQ6A 4ZCPA 1ZJWA 3CVWA 2NZ2A 2A7XA 2A1TR 1OWNA 5J59A 3UC5A 1N75A 2B7LA 4EG6A 4ZCRA 1G8HA 1I6KA 4R0NA 5J58A 3CLRC 2DPLA 1YULA 3GMIA 5K0SA 1JEDA 1PG2A 1YUMA 3TQOA 5DASA 4DE5A 3CLTC 3HZRA 2E89A 4MUNA 1N2HA 4QREA 1KH1A 4ZT6A 2CV2A 1O97D 2ZP1A 4CDMA 2CV1A 2DERA 2YWCA 2I1LA 1COZA 1N2JA 3SEZA 3E27A 1IQUA 2A88A 4MW6A 4HK4A 3RBAA 3AG5A 4PY2A 3RHSA 3VGJA 4KR9A 1NYLA 3A05A 3QE4A 3IVXA 1TYDE 2IP1A 1MRZA 3ZXSA 2HGZA 1H3FA 1WXFA 3IOEA 1DNPA 4EGAA 1IVSA 1G8FA 4MUHA 1GAXA 3A04A 2JA2A 3GUZA 3RFFA 3TQIA 3ZJTA 4G5FA 1QU3A 1FFYA 3IOBA 4DDHA 2PZBA 4EG7A 5HG0A 4KR7A 1IH8A 1QJCA 2GKSA 4I6GA 1WXEA 3OP1A 1IHOA 2PZ8A 4DJAA 2DR2A 3PNYA 2GOYA 3DPIA 1NI5A 1LW7A 2VTBB 2DETA 3KT0A 3QTBA 3M5WA 4DLPA 4H3SA 1WY5A 1IFXA 1MBZA 2JAXA 3FG9A 1JZSA 1JZQA 2E0IA 4YP6A 1J20A 3MXTA 3ZGZA 4HJXA 4F3RA 1SURA 3ZJVA 1H1TA 2A84A 1QRTA 1MB9A 1VBNA 4I6JA 4NATA 1O0CA 4KPUA 3ND6A 1EFPB 2G36A 2ZUEA 4UZEA 3MUEA 3P0IA 1KKUA 1WXHA 2E21A 2D5BA 1M1ZA 3UY4A 2YWBA 3Q4GA 3N8HA 1NUQA 1WOYA 1Y42X 3UOWA 1KR2A 1F7VA 3AL0C 1U0BB 3TZEA 1O96B 3HFJA 3Q12A 1TYCA 2XRZA 1S4MA 2A1UA 2CYAA 3KFLA 4YP7A 4HPWA 3NBAA 3L93A 4KKVA 1TEZA 4L2IA 3IMEA 4MW5A 1QRSA 1OWOA 2TS1A 3GLVA 3TS1A 4A91A 4PBTA 1MAUA 3DO8A 4KPUB 1JMVA 3IMGA 3NV7A 4E1AA 1MAWA 2CYCA 1TYAE 4ZT3A 3X1KA 1PFWA 3AG6A 3CLUC 4CQNA 4JFAA 5K0TA 2A1UB 5LFAA 3CR8A 1OD6A 4WSOA 1OWLA 1XNGA 3FHJA 3SP1A 3G5AA 3P52A 1N2OA 1PG0A 1N2BA 1X6VA 1O94D 1Q19A 1VLHA 2A4MA 1IQRA 3D6VA 2R5WA 3SDBA 4MUJA 3CLSD 4MWBA 3X1MA 3LE8A 1D2RA 3ZIUA 1WXIA 5LM3A 1TFUA 5AHWA 2RE8A 3U1VA 4EF6A 1OBHA 1H3NA 1N78A 2DLCX 1F4LA 1HYBA 1FYDA 1MJHA 1ILEA 2CSXA 1Q11A 3H9BA 1EUQA 1I6MA 5EKDA 1LI7A 5TEWA 4MVWA 2WQ7A 3IDFA 2H29A 4J76A 2PXHA 3CVUA 1N2GA 1T6ZA 1LI5A 4YMIA 1PFVA 1N3LA 1K97A 3G59A 2WB2A 2DXIA 4ARIA 4XSVA 1NURA 4YP5A 1T9GS 4QRDA 2AZXA 3H05A 4OJMX 1B6TA 3UMVA 1GTRA 3SZ3A 2VTBA 3CLTD 1J21A 5JBNA 4MUFA 3K9WA 1O97C 1NUSA 2PZAA 2YY5A 3IVGA 1JEEA 5IJXA 3FOCA 3P0HA 1EUYA 1NP7A 4MULA 3COWA 2C5SA 2X1LA 2VXOA 3IODA 1G8GA 1V47A 1EFPA 4MVCA 1TYBE 5H16A 3C8ZA 1M8GA 3TNJA 3FH0A 4MVXA 3LOQA 3CVXA 4RPIA 4AQ7A 1JIJA 4MW0A 3A4IA 4GRIA 1ULHA 3DLAA 1O96A 4WNYA 3AFHA 1VBKA 1XNJA 1NUUA 3IH5A 5FNZA 4EG3A 1F7UA 2QUIA 1X8XA 5DB4A 1G59A 2A86A 3HV0A 4MW2A 3FY4A 2CV0A 4MUGA 3CVYA 2WSIA 4U8HA 3FWKA 4ZT7A 3COVA 4NAHA 1EE1A 3FIUA 3KT8A 1JIIA 1F9AA 4XFJA 1M8JA 2J08A 4JXZA 1KQPA 1ZUNA 3MLAA 5KHAA 3ND7A 1QQTA 2J4DA 2QTRA 1NUPA 2O8VA 4BWVA 5J5AA 3DV2A 1KQNA 1XNHA 2H2AA 1IRXA 4G5YA 1Q15A 1KAQA 4QBTA 4J75A 3SYTA 1YUNA 1K92A 1WJGA 4ZT2A 3N05A 2D54A 3CA8A 3HGMA 1N2EA 2QTNA 1N77A 2BTEA 4R2LA 5KWVA 1KP3A 1NUTA 2X1MA 3H97A 1A8HA 1T6XA 1U7XA 4EG5A 4NZPA 2J5BA 1M8KA 5F23A 1WZ2A 3H99A 1O5TA 4MW4A 3I05A 1R6XA 2QJOA 4ZCSA 3G6KA 4R2MA 4MW1A 2BYTA 1H3EA 1O95D 2J07A 3ELBA 1O94C 3PXUA 2EL7A 3JXEA 4KR6A 5H7XA 3CLSC 1QTQA 1JILA 5KCMA 2Z3VA 4S1OA 2CT8A 1R6TA 4OUDB 3INNA 2Z09A 4EG1A 3KT6A 3ILVA 1YIDA 4TS1A 1QRUA 3CVVA 4Q93A 1IQ0A 3COYA 3N9IA 2GM3A 3SZGA 4RUKA 4MLPA 1O6BA 1RQGA 4K0RA 3CLRD 4P2BA 1NSYA 4F4HA 2JANA 2EJCA 3IOCA 1PFUA 2OV4A 4DDKA 4MW7A 1WQ4A 3OTWA 4CDNA 2QTMA 5BNZA 1UFVA 1J70A 1GPMA 1P7PA 4FZJA 1U3CA 1TQ8A 4MW9A 2A1TS 1KORA 1QNFA 4EG8A 1VBMA 4CT0A 1EFVB 3L92A 4U7JA 4NX2A 1MC1A 3BL5A 1XJQA 3K32A 4PBRA 1U3DA 3PNVA 4HJRA 1N1DA 4NAUA 4K03A 1YI8A 3KT3A 1M8FA 2CYBA 4G6ZA 4MUIA 3S3TA 1MOPA 2J09A 2X0KA 2IJGX 1J09A 2AKEA 4AS1A 3NBKA 5TGTA 2ZUFA 1V8FA 3Q10A 3PRHA 4MWDA 5FO0A 3ZUGA 3ISJA 3HL4A 1CT9A 1K4MA 3RK1A 4ZCTA 1N2IA 4EG4A 5IHXA 3FETA 3ZJUA 1OWPA 1OWMA 3FI0A 3IUEA 4MAFA 1PFYA 3H9CA 4YBRA 2NSYA 4GU5A 1JHDA 2QJFA 2CFOA 2RD2A 2HZ7A 4MVYA 4MWEA 1M83A 2Z08A 3IUBA 3FNRA 1J1UA 2DUMA 2CUZA 4MQ6A 3A2KA 2D13A 4U63A 1U7DA 4EFKA 4NDAA 4ND6A 1O0BA 1VL2A 2OQ2A 3MMXA 3VRHA 4MWCA 1GN8A 2E18A 4Q16A 2V0GA 3X1JA 4X0EA
chains in the Genus database with same CATH superfamily
2RI1A 3LW8A 4LXHA 1HWYA 4WKOA 2DBYA 1RRGA 1IZ0A 3R3ZA 2HSEA 3SEQA 2B4TO 1RJFA 4XWKA 2IPNA 3GG9A 1UJMA 2Q7DA 4KO1S 4RS4A 3RAFC 2ID9A 2ZJZA 3B6KA 3HU2A 4PZ0A 3CGWA 2OWDA 2FF7A 2ZDHA 3AFMA 3F74A 2C5EA 1DQZA 2DFPA 2KMLA 3FWHA 1QVVA 2Q9BA 3P0JA 2OD2A 4FXOA 4B2IA 1YQQA 3VU8A 5CFMA 1JEYA 3FPSA 4X1YA 3BXZA 2JI8A 1O9GA 2OLJA 2YYAA 2PKQP 5IXJA 4G84A 4O4IA 1F51E 2HC9A 1J7JA 2XMBA 2WF9A 5B1SA 3TE6A 2PJZA 1RRFA 3UFXB 2JS7A 4BLQA 1IM8A 3WIOA 3BS4A 2OO3A 4BO5A 3KDSE 3AK4A 4B73A 4XDZA 1K5HA 2PGJA 2ZJ4A 4YR7A 5BN4A 3QUTA 1CUYA 1S2DA 2QROA 4F46A 1NVTA 5EWJB 4FE7A 1JBEA 3EXFA 4O3FA 4XGIA 3P20A 3S68A 1HPLA 5F4BA 1L4NA 1RKBA 1QIMA 2AD5A 2J6HA 1XJCA 4CW7A 1KU6A 2ZJAA 3FNIA 1C81A 1J8DA 2W8BB 5HIMA 4CTOA 1AG9A 3PR2B 1PDVA 1XHEA 4TV9A 4R1PA 2VL7A 1G64A 3G2IA 4H31A 4C22A 3VDNB 4Z4CA 1IUNA 5AI8A 3MFYA 1CUEA 3O8OB 3S2EA 1W5SA 3EEQA 2ZJ8A 5BVGA 4I1PA 4RIFA 1B42A 1G9XA 2VK8A 1AGXA 3C5VA 3SSMA 3H2GA 2GPYA 3MT9A 1V11A 2Y8EA 4JWTA 5EKSA 3R4CA 1EWQA 4X1IA 2H3HA 2YXLA 3PENA 4R68A 4BFCA 3ZTTA 4FFBA 1ZL2A 2VWGA 1M0EA 1Z4LA 3GBSA 5FTWA 1CUFA 2WV9A 4BVHA 5LUBA 1I7LA 5ELXA 4YLEA 3CLRC 3N6RA 3MWFA 1BEZA 1DV2A 4R2KA 1NDUA 1YUMA 3FVVA 3LQ2A 1UXHA 2EKZA 4Z0HO 1ANKA 3ORSA 4LECA 2YXBA 3CLTC 3NHWA 4NYIR 1HDCA 3RU9A 1DIGA 1WMFA 4U2CA 1KZ4A 2G4VA 4E31A 2AJLI 3LDFA 1P2UA 3U7IA 1E3WB 2HB6A 1T3LA 4M0KA 3VYRB 3VYWA 3MT7A 2GK3A 1WM1A 3GFVA 2BCEA 1H5NA 1I3LA 4NBVA 1SD2A 2VYVD 4EWLA 1IQUA 3FVQA 3A32A 1E32A 4KLZA 2IH4A 1PUIA 2AC4A 1JKJB 3AC0A 2P8JA 1V3VA 3GJ8A 3JYHA 2W48A 3QKRB 2PZJA 4LOJA 1E5VA 2NW6A 4QGBA 4LGYA 3R7FA 4CKBA 2FWMX 1AF4A 1V8BA 2OQIA 2HBRA 4WD3A 1BD4A 4PPQA 3ZZ0A 4PM4A 4HX9A 1U99A 3TTTA 4EPYA 4UU0A 1QU3A 3ZI4A 3HHEA 4I3GA 3NONA 4DCTA 1YS6A 3CF4G 5AIBA 3L0PA 3ZDYB 1O9BA 2AL7A 1L4EA 3M81A 2O23A 4NLLA 4P0TA 4EPWA 1CC1S 4TRJA 1LW6E 5K6AA 2HXSA 4ETNA 4RV9A 1T0UA 1QGED 1GPAA 2BEUB 2FN3A 3QXJA 4WBSA 4ZHQF 2R0QC 4HEHA 3RYCA 3G2HA 3PUYA 4KL8S 4H7EA 4YASA 2FZ4A 3EFEA 6LDHA 3K2QA 2GAAA 4EFNA 1DEKA 3GRZA 1BX0A 3HXPA 4OQFA 3C6XA 5T6BA 4CM8A 3HNRA 4C7OA 4JI2B 4KZKA 4KWHA 1RLJA 5ICMA 4D81A 4JP3A 1P1CA 3EG9B 4PIVA 1J2JA 4LOLA 5AW6A 3EXG1 1NHGA 3RREA 4I6JA 4C7JA 2LPMA 1PI3A 1CUHA 3OCWA 3E3AA 4HRAA 1XZLA 2COEA 3LMKA 5DO9A 4UZEA 5SZIA 2XDYA 4A2QA 4YRSA 1QB8A 2E21A 3Q9LA 4HDOB 1FSZA 1ZISA 2CZCA 2Y0PA 3LC1O 3M0EA 2EJWA 2VT6A 4CM9D 5FNVF 1LD3A 2FCRA 1S3SA 4G0WA 2BY4A 3TEMA 3WAGA 1T2NA 4YK7A 4MHTA 3U16A 4HLQB 3AJDA 2FUG1 2Y0EA 2IYWA 3HFJA 3HVKA 4JAVC 3A0UA 1I7SB 2P2SA 2D1QA 1HDRA 3JQBC 2QVBA 3SS8A 5H0IA 2NUBA 2IH2A 8AT1A 3OLXA 1QZXA 3DVSX 4J0KA 3ZU5A 3W5DA 3NDPA 1K86A 1T5TA 4NVRA 4MW5A 4BQOA 3KOYA 3L5OA 2TS1A 2YWHA 3AVQA 2PX2A 3VR2A 3DT9A 1AE1A 5EHIA 1DDGA 2C8LA 1DEXA 2IZ6A 4WJKB 2YZKA 4KPUB 5D86A 1JMVA 2JGFA 2RGEA 3NV7A 2R60A 5DHQA 5LYJB 1ZQ1A 3ONFA 3QXXA 3HLYA 3ZCVA 3W1EA 2O3QA 3QHQA 1U3TA 2OPBA 3IB6A 3Q15C 2PDAA 4I50B 2UZ4A 2XHZA 1A76A 1EGVB 4NU8X 4PZYA 1OZHA 2OGUA 3DBHA 1KZ6A 5ALUA 3WLOA 3FMFA 1J97A 4L8YA 2AH5A 1X7ZB 1TEHA 4GE3A 3QLVA 1E5QA 4RCVA 5FJIA 3W04A 5C8VA 5CBPB 4LQ4A 1HRDA 1NBEA 1XVAA 1I2AA 1N0WA 3DULA 5AXAA 3STYA 2QD1A 4DLXA 4QGAA 4UFNA 1HGXA 1XBTA 2BLNA 2W4QA 3CURA 3IKVA 1W25A 1KOGA 3GJRA 1R0LA 1U6JA 1Y3IA 2JI6A 2WU3A 5IBQA 4DMUB 1TVEA 1U8ZA 3OQHA 2Q4EA 4YH1A 5JLJA 3ZX4A 4Q48A 3EDYA 2TMDA 4D44A 3SDBA 5KJ1A 2YY6A 4KYTA 3E4CA 3SBDA 3C7CB 3X1MA 5BOSB 4MLZA 4LHEA 4CF7A 3AERA 3RD5A 2I1WA 2YFYA 3TTYA 4RFSA 4F6RA 5EKTA 5C53B 1DXQA 5FTJA 4BNNA 1X7GA 2FQXA 2XNDD 3LS2A 2V6MA 4U6NA 3B6IA 2BJHA 1ZW6A 4PC1A 1F4LA 1U8XX 3BJEA 3H6HA 4N5MA 3W2IA 2GYUA 1ZMBA 2DJ5A 1YFZA 2Q7XA 3CVOA 1KU0A 2FPRA 3OIGA 4OUKX 5J2TF 1EUQA 4EPRA 1DKQA 1Y9EA 3JQRA 4DT1B 1P75A 1WX1A 3TWOA 4MVWA 2DHQA 1O8CA 4JVNA 2EKLA 3E3LA 4NV3A 3I62A 4FK8A 4WZAA 4UDXX 3FVTA 3DHWC 4ZIRA 3M6FA 1NR5A 2MYTA 4JEMA 1UDXA 4PNEA 3K0BA 2W6NA 2O7VA 3ZIDA 5LB2A 4UTPA 2ZIEA 4NIMA 1SCJA 2X0FA 3HO1A 3B60A 1D6SA 3SSNA 1G19A 3ZY5A 1ZR2A 4G25A 4QOIA 5T3YA 2AWNA 1RI2A 1NJFA 4EO9A 1TK9A 1B6TA 1OGYA 3EGDA 4OJKA 3ZKAA 2DP4E 2FG6C 3CLTD 4WZBE 3FJYA 1G4AE 4GWGA 4N47A 5DCYA 5E4JA 3DNPA 3OEED 4EYEA 3M3PA 4BTLA 4UXHA 2XYPA 3T06B 1E1CB 1NUSA 4OXIA 5BQXA 4K9OA 2IZZA 2DLDA 5JC1A 2QX6A 2ZB4A 4YMUA 2G1JA 1U1IA 2OUIA 1HLFA 3CYFA 3EZGA 2ZTMA 4QFBA 4W7IA 4ZHQA 4FGUA 4OMDA 2WJ6A 3B1FA 3NKFA 3QFSA 3HC7A 5KX5F 2ACWA 1TYEB 3EE6A 3JD2A 2RGUA 4QXPA 1CPYA 2AQIA 2CLLB 2QMUA 5FL3A 4B5KA 1DX6A 4K9NA 2C57A 5IEBA 4GD3Q 4QQFA 4Y2VA 5I4KA 4MJXA 4EEZA 1PX2A 5T4BA 1VMKA 2YMLA 3RKSA 1JIJA 4MIOA 1QG2A 3I9KA 1XMIA 2OILA 1WR8A 4B4UA 1BVHA 1AB6A 3LVQE 3BX1A 1EVJA 4BGIA 2R48A 3GGCA 1O4WA 4L4SA 3B9BA 5L3ZA 2Y66A 2I7VA 2Q1YA 2ZRKA 5KAMA 3ONVA 2X0IA 2YMPA 2ZT6A 3MMPA 3R3UA 5FNVA 3LWDA 2ORED 1I32A 3PEFA 4X1OA 3TMYA 3ROQA 4YECA 1EQAA 2JAWA 2M6RA 3IS3A 3ESDA 3FY4A 3R0ZA 5TQ0B 3SKXA 3KYCB 5JMPA 4C0LA 3WZ2A 3EBLA 1D5WA 2VP6A 3ZY2A 2NUTB 4OIFA 3ZWMA 1PZXA 3GUCA 4RADA 5DBIA 3GL9A 3AF4A 4NAHA 3IQEA 3JATB 1BN7A 2RGNC 4FOLA 1BHSA 2JVKA 1F48A 3OH8A 3B1JA 3SN6A 4G0YA 4OG2A 1G5FA 5J4LA 3OQJA 4LC1A 4TL7A 5I9BA 2FPPA 3IP6A 5ES3A 2AV6A 1M2WA 1NASA 1ELOA 3PF8A 1G4HA 2ZUWA 3AHDA 4ALLA 3D7SA 2A3NA 5IBRA 1U2DC 2VUSA 2ZM5A 2BM8A 1KEVA 2EKQA 1VYUA 4E70A 2APJA 3A1SA 1Z74A 2DHRA 1EINA 3BULA 1IHUA 5T64A 3NDRA 3FTDA 1B0PA 4D46A 3LFUA 4FNMA 2JAHA 1VIMA 3U3ZA 3BMOA 1RYYA 1H42A 1UZAA 2QGZA 5ALSA 1I3OA 5E7QA 3BWDD 2OBMA 2AKAB 1IK6A 1JKIA 4MIEA 5IFLA 4GZ5A 4ZJZA 4LYGA 3CLKA 2WIGA 5DN9A 1L5OA 5HOQA 1U0EA 1UMKA 3DL2A 4FLFA 2BGIA 5FBHA 4ZCIA 2V74B 4RTMA 3N8NA 3HJHA 1RZRD 3ANYB 1Y6JA 3H5TA 4BP9A 1B0UA 1CUIA 4U6QA 4WKPA 2VHUA 1GCUA 4UUOA 3U62A 2VSXA 1U80A 1D8AA 2BFDB 2XPCA 3A7DA 3HR7A 4MQ4A 5J2TA 2GAIA 3BF8A 3GCXA 5FBWB 2P78A 4G8CA 3THYB 1NXOA 2XUJA 1POXA 3QV1A 5KQPA 3QOWA 5FWXA 1XL0A 2PL1A 4HDKA 1I2BA 3T3PB 3SFTA 3U7GA 1GNTA 2JFBA 2J07A 4RMIA 1O7JA 2VPTA 1EE9A 3ILYA 3K92A 2C82A 2GCPA 3HKCB 5HFNA 4NJMB 3R5FA 2OKGA 2Y6VA 1APBA 3L7OA 4MINA 3VC7A 3VR0A 2RBGA 4PG4A 4J7AA 1MFZA 3IUSA 2HMSA 1TK3A 4TL6A 1JLHA 2PY6A 5H4GA 1QCDA 2G0NA 1QIIA 5AKXA 4MCHA 2PH1A 2FKAA 2QSZA 3CHYA 3ZBQA 1C7JA 2XMQA 5BQ5A 4LDNA 3ENZA 1UR5A 2R8BA 3AUFA 3ZGOA 1UMCB 3EPHA 1Y4SA 2V98A 1AK1A 2NXNA 3B3JA 1D5CA 2PMBA 2G07A 3L9WA 1Z22A 3SYKA 4EDHA 8LDHA 4FEEA 3ILXA 1L5VA 3HL6A 3IBCA 3K5HA 4EL0A 2O8BB 4ZHSA 4QYIB 4UCQA 1QG4A 4KYVA 2PAFA 1R0WA 4PAWA 4CGZA 5KX5A 4XVQA 3T9EA 4NC9A 5FA6A 3F6BX 2FEXA 2H18A 4PC2A 2HF9A 4KN6A 4LJLA 5INTA 5KNCA 4DR6B 2NU7A 4Y30A 1LQTA 3VAYA 4JT9A 4BFLA 1TCBA 3V8BA 1NU8A 2XWPA 3I42A 2NQ8A 4FQ7A 4ZJPA 5K8VA 4CMEA 3RS7A 3GV0A 3QVLA 4XDYA 2C8KA 2XNHA 1Y98A 2RCYA 3C3KA 4CV3A 1NTRA 3DAGA 4YPFA 4A8JC 1ENYA 3D1VA 3KTAA 4PICA 2BFBA 1II0A 1L4BA 2AOWA 3BOSA 1SG6A 1XMXA 2KPOA 3OT1B 3PYXA 2DH6A 3MAGA 4ND4A 1K63A 6REQB 1LI4A 5JS7A 5MN6A 2BSAA 3RTEA 1VIDA 3AEYA 4I66A 5KAPA 1MOPA 1LPMA 1RC1A 4JC5A 2YNMA 1GU0A 1RHQA 2G5PA 4X63A 2VJDA 3WL5A 1K7SN 1QZUA 2ZDGA 4RGVA 5EUMA 4J0DA 5B1HA 5TX7A 2LCIA 1MV8A 2I91A 3SLGA 5DXAA 1DV1A 2MR5A 3CW8X 3EVNA 1JQAA 1YC5A 4F8JA 2GEBA 2OP1A 4YMTA 4RF3A 5FO0A 3PQ2A 3VR5D 3DW3X 2ZYTX 4ALJA 4E2ZA 5HJEA 1J0DA 5MFZA 1YTUA 2EYQA 1L7QA 2WA2A 3HL4A 1ORTA 1QSGA 3F7OA 4GP9A 5K0LA 3VTZA 4ZCTA 3U6BA 1SUAA 4HWTA 1KTVA 1FRQA 1P9WA 3KTFA 3NGXA 5AQEA 5DWVA 3WDMA 4ON9A 2O5VA 1OWMA 3I1JA 1AKQA 4IRMA 1S0UA 2YJTD 2W2MA 5EGSA 3ANNA 4BMDA 1I5OA 4GEGA 1JSLA 5AUOB 3U44B 3VDRA 1J0XO 1UDAA 5B6JA 1RM5A 1U2TA 4GU5A 4NBNA 1E2NA 1FW8A 1WW2A 2CUTA 2ECFA 4YRCA 3QWHA 2EF0A 3DTYA 3IESA 3KAPA 4H18A 4PR0A 4TTRA 1Y8AA 3IUBA 4GYKA 4JU9A 2HA2A 5AXCA 2BR5A 4KUEA 4WMLA 5KNLA 4MMZB 4KIUA 1M74A 2OPHA 3LC0A 2P9ZA 3GGGA 3NEAA 1ABEA 3HXLA 2NP6A 4L8LA 3A1UA 3C3MA 3U4IA 3DH0A 1B3RA 3O4HA 4KW7A 1IDN1 2GM5A 4TKLA 1DAIA 2BHNA 5JFGA 2IDKA 5AOVA 3AHFA 1I1NA 2CWWA 5F3WB 7REQA 1X1DA 4Y2UA 5HUHA 2DECA 4BX3A 3C3XA 5J5VA 2OTCA 4WVLA 2MYUA 3EPPA 5ALMA 5LZ2A 2VDWB 4FT2A 1XQVA 3ZD7A 3FOAA 1JWAB 3OIUA 4TXJA 3SS9X 3N2YA 4D0SA 1C8KA 3AF5A 2ZI9A 1MABB 5F5LA 5A2QA 1SG0A 4UM5A 1ODTC 3BB4A 2QY6A 4PZZA 5T41A 1FNMA 1YDHA 2WD7B 4Z8XA 2HK9A 3SHWA 4KQJA 1J8YF 1J5XA 3D3EA 2ZVDA 5EZQA 2DHCA 1UMBA 4O59O 4TXMA 5TEVA 1KFKB 5J4HA 4W5TA 1ZHOA 3JWGA 3GGSA 4ISBA 4QICA 1FLDA 2JFWA 3BMXA 3KLPX 5CX1A 5G1PA 4AZSA 4DKJA 1J8FA 2XB4A 3ZD8A 4B0PA 1BROA 1CQJB 2P7HA 3L0BA 4JSTA 3Q0TA 2QP3A 2IZOA 5DYNA 3ZXYA 5A5DA 3G1TA 2NVUA 2ENUA 5FUQA 1EFRD 1W9HA 3HBMA 4OK3A 3BXFA 2H1OA 4EPTA 5J4YA 2HA6A 4HNSA 1ZC3A 2MWMA 3LRXA 3VKUA 4TX1A 1AHNA 3K6RA 1Q74A 5CXQA 1Y5RA 1WKBA 1YS4A 2CBZA 1T9GR 3E18A 2PQ0A 4B31A 4RXTA 1L1EA 1SCQA 1IQPA 2JKVA 3PHBE 1Q1GA 4FIZA 4ITVA 3R5SA 1N92A 2CXSA 3HCEA 3DUWA 2AI3A 3Q3EA 1LLFA 1JJIA 3OIYA 1BMDA 4OQMA 4M8IA 3NIGB 2YFHA 1Y1LA 3NORA 4ARZB 2EZTA 1C3OB 3BTUA 4HBGA 4Z4FA 2QTVB 4J07A 1G2IA 3VOSA 1RBQA 1RXEA 1FDIA 2YS7A 4OMFG 5KS2A 3E5NA 5IYZB 2Y05A 3MEQA 1T1SA 3IT2A 4DG9A 2WJVA 2ZSAA 1T0HB 4AWBA 1JAZA 3HNPA 3K72B 1SBHA 4MR9B 1TF5A 4YNBA 3E3MA 5IDVA 3SJCA 5JVDB 5JXHA 1SVNA 1RAGA 1W4BA 1EK0A 3PKIA 4WFQA 4G8DA 1W9MA 3VR6A 5DDIP 4IKPA 1Z25A 1DELA 3MK31 3CSDA 3VHRA 4DRXB 1KNXA 1V6CA 1V48A 1ZNZA 4LF5B 2Z8ZA 4DIUA 1DMSA 2K6GA 1MDBA 3M5PA 5K0NA 2WYUA 5M3BA 2ZUBA 1BMTA 2R1VA 1ZHHA 4C07A 5ILGA 5BSRA 1YVPA 1WB4A 2QX9A 1AC5A 1Q57A 3BD9A 1L7BA 1A9TA 2NNLD 2O9JA 4M0UA 3CY6A 4PAGA 4PLWA 2DTDA 3RC9A 1TYDE 2BN4A 2FSUA 3Q8MA 4WCFB 1RXIA 4UE6A 2NTYC 3M4YA 4KR2A 2NYVA 3IOEA 4CT5A 5BVHA 1YV9A 2XCTB 1KAHA 4IFEA 4XM1A 3C6YA 1ZXXA 3G9ZA 4UHHA 4PV7A 4CIWA 3VAAA 3FBGA 2QRMA 3L6EA 1C3EA 4BMYA 3REQB 4TRMA 1M6VB 5EE9A 3M1AA 1VKZA 2IV2X 1F60A 1ID8A 1TMGE 3DDOA 2AG8A 3ZNNA 2IEBA 4CIBA 3TOSA 2GH1A 4RTQA 5KKCA 1NP6A 2A53A 1QHSA 4NMWA 4R1SA 5IG2A 4JS0A 1WVGA 1PJTA 4BFTA 4RDXA 1KARA 1V2GA 3EXEA 3ZZNA 2WUGA 1Z47A 4OH1A 3P97A 4JLBA 3UVEA 3HXMA 1XQ6A 4MPDA 4MQFA 1KZGB 4FZ3A 4NP6A 3JYQA 3HFRA 4XWTA 1R1DA 2NU9A 5AHKA 5BW8A 1JZSA 3LFTA 2YVAA 5JCZA 4OCZA 1VKRA 1QIFA 4IKOA 1SURA 2CXOA 4CM4B 5DP2A 4KMSA 5K0GA 1GKIA 4FVTA 1XZQA 1O8BA 4AUNA 1ILWA 1VBNA 2D5CA 4J43A 1EFPB 5LPNA 1HE4A 2R4QA 1X8JA 2C9ZA 1J00A 1A8SA 2I6GA 2AFIB 3QG1A 3ABSB 3UJDA 4B6JA 4HGOA 3KSRA 3HB4X 5KSOA 3TAHA 4JYAB 3SF8A 2ZI4A 4KGXA 4E2FA 1QX3A 3OCVA 2C0CA 5D2CA 1EBUA 4KE8A 2ZR9A 4PTLA 4UFPA 1AXGA 2G2SA 3PGLA 4QA9A 1J0AA 1LF5A 2ORWA 2DHEA 2EBUA 3BWEA 3CUTA 4RQTA 1FA9A 3I4FA 1Y9JA 4BZPA 3OT5A 2VDNB 1TFRA 1F8YA 1I4EB 2ZSKA 3ZVLA 4JHXA 4L2IA 3QBDA 3C3EA 2VZ8A 3IT0A 1AX9A 3WKEA 3Q3JB 4R1QA 2VLBA 4G0MA 3THOA 1NVDA 2H4FA 1MAUA 3K0CA 4M1SA 1FJ2A 4R1UA 3WISA 2P35A 1FTGA 1XQYA 4AULA 4PG5A 2VCEA 1RWXA 3SR4A 4G0UA 3GLRA 2QF7A 2IU6A 2XI4A 2YDYA 3QE9Y 1ZDMA 4ER0A 1IY0A 2NSLA 1L4YA 3BEDA 3LWNA 1V16B 1YHNA 3H4IA 4KLCA 4ABYA 2EF1A 4ZCLA 3X1KA 1I4LD 4U4AA 2P1RA 3TNFA 4CQMA 2GBCA 5K3AA 2HA7A 3VZPA 4M1YA 2QP9X 4GNRA 2HXGA 4TTSA 3CNBA 2R6FA 4GVXA 1XEXA 3CR8A 4F56A 5JFTA 2Q6OA 1K7YA 2IYEA 2WUVA 2X9GA 3WWYA 4NFHA 5IT5A 4TQ9A 1DKMA 4JL6A 4L9SA 5JD3A 4CKCB 3PGVA 2ZREA 5SZKB 2FFRA 3K0SA 4J0GA 3WGJA 5CURA 3FTNA 3SF0A 3RUPA 2Q1TA 2IU0A 1CR2A 4UU1A 4CLEA 4CN8A 5LM3A 4NMLA 2RE8A 2E5LB 2VK1A 5K0EA 1USKA 2A94A 4YALA 2CVHA 3VI4B 1M1YB 1F0PA 2QL6A 1YR8A 4GI5A 4QEZA 2H1FA 3MILA 1BWSA 2X5XA 1H6DA 3BILA 3LECA 4MKIA 1TVKB 2ZROA 4OQLA 4ZQCB 4BKUA 4BP1A 3MFQA 4FT4A 4TLAA 1DTWB 1JR4A 3BGVA 5J40A 4JKOA 1ADGA 3ISTA 2H29A 5G3ZA 2AHRA 1HFEL 2QI9C 4L76A 1NMQA 1U5CA 1GY8A 3HE3A 3FSRA 4FU0A 4O8ZA 3T3IA 1FSPA 4YCBA 1Z0FA 3NRBA 1BE1A 2PTHA 2XA2A 5ALXA 2VP2A 2WW8A 1EUZA 1E1MA 1MA3A 4BO8A 1NOIA 1W0KA 1JX6A 1FNNA 1YS2X 4G23A 3K4HA 2Y1GA 1XR3A 5LZ8A 3V6LA 4AKIA 3U48A 2ZBVA 3U5TA 2B2NA 2DFNA 4XWYA 3UQYS 2WWWA 4O1HA 1Q21A 4QYMA 5BNFA 5JH7F 1K89A 1MVLA 3Q98A 1EUCB 1UODA 4M6WB 4U7FA 4E5YA 4WX2B 4R2HA 1BJTA 1BMFD 2PZAA 2RSLA 1CEQA 3N8DA 4H59A 3VGJA 4F2HA 9ABPA 5KMGB 5SV2A 4M0FA 4ZI3A 4DC9A 1T9AA 5EJGA 3GLIB 2OM6A 3HA2A 1UDRA 2GVDC 4CHTA 4G8JA 2C54A 3RYHB 1Q12A 1T8UA 3TW4A 2XMRA 2O0KA 1EG2A 3PNMA 3RABA 1ZJJA 2AC2A 2W2KB 1M8GA 2ILTA 1D7OA 2FEAA 2YVUA 3DEZA 1SZCA 3HCBA 3T7CA 1NAIA 5ITZB 1D8TA 1QGOA 4PXYA 5H81A 3JYOA 4BRSA 2R6CA 1M0TA 3R6LA 1SEPA 2HX1A 3DLAA 2XUDA 3JQBA 4D3DA 1QC5A 1XXHB 4EP1A 4POAA 1MJNA 1N2CA 3IJRA 1GTVA 4QPCA 1JFSA 3GFGA 3IAFA 1GYQA 2F1JA 5KWIA 5EFOA 4HO1X 2RI0A 1QHFA 1OAOC 2EFEB 2WG2A 2X7JA 3DWFA 3E7FA 3KS9A 2PV0A 2ALJA 2QUIA 3OU6A 3HJAA 2Z58A 4HKTA 3C6BA 4HLDA 1KJ9A 2ET6A 4DAEA 3GWGA 1XALA 1F0YA 1UOQA 4DA8A 1NM5A 1T5SA 2CJFA 4BNJA 2FRVA 2R11A 3BE5A 4FUQA 2XY4A 3OQOA 4S1VA 4RORA 2HIGA 4EHKA 4H3HB 4RFVA 1JFTA 3HKDA 4MVJP 3W2EA 3KQUA 4ZVRA 4DGSA 4M46A 5LOVF 1E2UA 4KAJA 5F2KA 1AOXA 3G9UA 4EUSA 1IZ9A 1E2IA 1B74A 3RWBA 4MV9A 2ZRHA 1X3SA 3IEIA 4G0NA 4RKRA 5JANA 1TC2A 1HOXA 3RSFA 1A9XA 1FRVA 1XWFA 5DIZA 5BW4A 3E9EA 4HFMA 5CTAA 2C98A 4GPBA 4PG6A 4TLCA 5ED4A 5BR4A 3R9XA 3CCFA 1FYFA 2Z9BA 1C4KA 3KVVA 1CQIA 1IRXA 3RSCA 4NPCA 3C2QA 3LXRA 4YHBA 4WN3A 5A9RA 2RH8A 1U04A 2QW0X 4I2VA 4A0HA 1OYWA 2ODPA 2RHDA 3LCMA 3MJEA 2XB6A 5AMXA 5IF9A 2F6RA 3UXEA 2PQMA 5L6LB 1IY8A 1B43A 3T5MA 5A4DA 2R8XA 4RK0A 2IUSA 3OCZA 5DM70 1Y5IA 4J3NA 1P0QA 4HN9A 2OFFA 4DFDA 2D54A 4HEQA 2G67A 1Z5VA 3NO4A 4M9ZA 1N2EA 4IR7A 5P21A 3ZE9A 1F6BA 5T8KC 1P6UA 1RM4A 4MKXA 4EMUA 1L9KA 3GLGB 1JHRA 1HZZA 3IAS1 2C2HA 5HMMA 1UBNA 1FTSA 4ND8B 2GHIA 4K26A 1BA2A 1EHCA 4JB0A 4MRMA 2WZDA 5B37A 2HK8A 2IA5A 4L4UA 5TF0A 2FXVA 1JHZA 2OC9A 3WP1B 1L7AA 2P11A 1GZDA 3QX9A 5F3DA 2EGHA 1E8DA 4XYBA 4IOLA 4KXLA 2EW8A 3C8DA 3R7WA 2V3CC 4IGFA 1XCPA 3CLVA 3K05A 4HDAA 3JARA 1H1LA 4TROA 4FR0A 3EODA 2QRUA 1X7HA 3TLXA 4BVLA 2IX3A 4G67A 1PJCA 3OP4A 3R77A 5JWOA 1DIHA 4Z53A 1AKEA 2P4QA 3OM9A 3URMA 1TZKA 1TW3A 3EIEA 4OUDB 2AEMA 2G04A 3I30X 5JADA 5J2UF 3T1YB 1V4NA 4JN6B 4OYHA 4DA4A 4B7UA 1QRUA 2NUPA 3BPSA 4NNOA 4BLTA 2PUJA 1T24A 3WSVA 3COYA 2V9CA 2XMDA 2ZBFA 4OOFA 4UUQA 4EA9A 4O1MA 3IALA 4RUKA 3AGPA 1YRBA 3WFIA 4E6EA 3N8GA 1MZPA 3AR6A 3CI0K 3OIVA 3U9SA 5JH7A 2G16A 1OI4A 3S1SA 1M9NA 1EHYA 3W5HA 2FWIA 4W5WA 1WDLA 3BWVA 4JITA 3MC1A 5ALPA 1HA3A 4OBEA 2OBNA 2FHPA 4PXSA 2HDHA 4X90A 1FX1A 1XCOA 2JCSA 2G3DA 1QLWA 2XTAA 3H5OA 5E7IA 3H1AA 5LKRA 2H0QA 3CNLA 1QHXA 3PT5A 1ITZA 1YCDA 1SA0B 2HM7A 3OKAA 4RAQA 5IW8A 3ESRA 4M1WA 1U8UA 4FZVA 3RK4A 1HNNA 3B3QA 5AVKA 3NPMA 3H6GA 2VK2A 3HSYA 2JEYA 2A1TS 3OPQA 1WUJS 1JQBA 2G8NA 1YJXA 1XDDA 1POWA 3NDJA 4R3NA 4GZLA 2QD4A 3D3NA 5F2EA 2CY0A 3GEEA 1L3IA 3DJYA 3QKSA 3PEYA 1JR6A 6CHYA 5KTSA 1X7YA 4XQ0A 3K32A 3K8OE 2IOFA 4LA4A 4BB0A 1BVUA 4N5DA 1EZ1A 4OOEA 1EB9A 3DXFA 4DR3B 1E2JA 2NVOA 4EVIA 3KT3A 4IGKA 3Q6NA 4G4SO 2CYBA 2PH5A 5DLDA 2QX8A 2OV1A 4BBJA 4FNAA 4L57A 1G3RA 4K6MA 2VFAA 3DMNA 4L7QA 1R4AA 2OB2A 1UWKA 1Z0SA 3VAZA 2ZCUA 1OLOA 1T6BY 4ND1A 4FWBA 5GVSA 2RJNA 2XQGA 4P32A 5LOVA 1QV9A 4HB3A 3D1LA 1LPSA 2GHTA 3G8BA 4I9GA 2ADFA 3PXBA 5EKXA 3TQQA 3UXHA 2GI4A 5BXYA 3ZUGA 2YOGA 4S12A 4B6OA 2VRNA 3ISJA 1Z7YA 1T8SA 1PT5A 2I03A 3WIUA 1N2ZA 4I81A 2JHAA 3QZUA 3T4UA 2QRHA 4EHJA 4BMXA 4C0AC 1T5OA 3B89A 3OE4A 3ZWKA 1XPUA 1PSWA 2Q5HA 4PQFA 5GM2A 2WWVD 4M36A 1MO3A 3ANTA 4JVMA 1XN4A 3H9CA 5KTMA 4I4IA 4MV4A 1JEQA 1A9ZA 3S5JA 1KI9A 2R1ZA 2ZKIA 1NMYA 3I2KA 4P4SB 1ZD9A 4AX4A 1FXWF 1XZMA 4M9CA 3LT5A 3JYNA 3R41A 5KYUA 3TUIC 2WAAA 3VPCA 5BR1A 5LQNA 2BH2A 3TIGA 1EVLA 4ENPA 1IJKA 3EOBI 3BGDA 5I8ZA 3DPUA 5SY6A 2BSXA 1ZK3A 5B3AA 3HDHA 3MCVA 3MINB 2HWUA 4IDDA 1VDMA 5BRAA 2V0GA 4HOYA 2GJ9A 4N0MA 2O1WA 3DUFA 4C7MA 3EIOA 4NICA 4RA6B 4DCPA 5AVVA 4MSUA 3LCJA 3CXUA 4ENSA 2GXQA 3EMVA 3L0DA 3OLCX 1A2BA 3JQQA 1N5OX 2XUIA 2RJ3A 1XROA 1PSDA 2W22A 3KKOA 3LGSA 5F12A 3DDNA 3TINA 1JFRA 3RYFA 1VFNA 1FE8A 3PPVA 4NFLA 2D0PB 2WI8A 3BSWA 4AJNA 2BBOA 3LCVB 3DTTA 2ZQZA 4GL2A 1OSNA 2PG3A 4ZEXA 4IZIA 3T9BA 4RJTA 4WOCA 1KZYC 221PA 3C45A 3O5AA 2JBWA 2Z8YM 2AQKA 5CG2A 1FTNA 2GF9A 1XCMA 1JFFA 4EB8A 1ZGJA 5B2FA 2F3PA 2BFEA 5KNBH 3C1UA 2L0XA 1PHRA 5J2UA 2TSYB 1P5RA 4ZJYA 1T3SA 4A7PA 3T4PA 3K5WA 1GLNA 1ZICA 4JASB 3ZY4A 1ORVA 1BFDA 4G65A 2P2CA 3VR2D 2VHZA 4BNUA 4TXHA 2YHBA 3LL4A 5ILQA 3WGUA 3PHJA 1JKXA 4LX8A 1JF8A 4I55B 4PHFA 4PCUA 3WAKA 3CUYA 1HI9A 5AT1A 1Q83A 3M9LA 2Q5IA 1JIXA 3MD9A 3NHLA 4C0JA 1PK7A 1CQWA 4CM5A 1RWMA 1A71A 1EG7A 2VUIB 3OG9A 3PNBA 5JJCA 2P41A 5LWQA 2EFCB 4R7ZA 4GXQA 2UUAB 3CUEF 1HSZA 1TIBA 4KLRA 2BR4A 1NJ5A 4PBSA 4YGXB 1SD1A 4XVRA 5JYDA 2XKBA 3QF4B 3AUXA 4TL9A 2PSSA 3O8QA 4LY3A 5DI9A 4RPJA 3I3SR 4ARBA 3AOGA 3AUAA 4KV7A 2IEZA 3U56A 1RMTA 3B38A 2JARA 4IV0A 4ZAVA 4QXOA 3VNBA 2A7XA 3HCNA 2G7MC 4KGZA 2XCQA 4LZPA 5A5GA 4G9EA 2AOUA 4QQNA 3UC5A 1A7UA 2W6QA 1UKCA 2I3BA 2UXDB 1CNMA 4RWZA 4M8LA 4F3YA 5IC5A 4F6CA 5C81A 2Z56A 2YW2A 1M3SA 1KEPA 2P0YA 1KVTA 3C6QA 3PXCX 4TQAA 1FSFA 3ASUA 2PZFA 3C8UA 3LIIA 5JJLA 4DLLA 2O3RA 4U3JB 2B1QA 4YLGA 2EJUA 2CV2A 4D8WA 4NXMB 1FL9A 2ZS8A 3LTEA 3OOYA 2PK3A 4PHHA 4URZR 5CB8A 1NI3A 1HDGO 4BP3A 1RI3A 5AIAA 4UVGA 4W1SA 4LF4B 3IUJA 2V7WA 2A9PA 4COKA 1FMLA 1NWHA 4ZOEA 3DL4A 3GLGA 1O6ZA 1UKEA 5AH0A 3JQ8A 3GPBA 4YRTA 1MW9X 4LJAA 4UE2A 4U9UA 2P1ZA 4WCFC 5I7HA 3A27A 3K1TA 3NUQA 1GZ6A 2JA1A 2EATA 2AZMA 3HP7A 4B82A 4URVR 3L7NA 2ZULA 3UV7A 1CY1A 3AL3A 1WU7A 1WU8A 4G8BA 4M1QA 3CIOA 1JI0A 3IMFA 2MHCA 4WINA 4YP0A 3VH1A 4O4LB 4DLBA 1IH8A 3EQ2A 2R6R1 2X9LA 3ZPXA 4PNPA 1WXEA 3TTWA 4CIYA 1IHOA 4LZNA 1KP9A 1A8UA 4XIYA 5IJ0B 1CBUA 1KK1A 1VE6A 1FXWA 5ALFA 4A23A 4M7RA 3DOOA 4HAUA 1OVGA 2GN0A 1SRQA 3FX2A 3ZWPA 3DKIA 4QDOA 5JLAA 3WBBA 4MVJG 2GR8A 3UK0A 1GQ2A 2JAXA 4YJ2B 1V8DA 3O38A 1UBSB 5H1YA 3PIDA 5IN5A 4Y6SA 1PJ8A 2PZLA 3D6HA 3IX7A 3N86A 3PWSA 4NCKA 3B2NA 1TL7C 3M83A 3ZJVA 2R86A 2MMCA 5I9LA 3OQVA 3RVDA 1N7GA 3AM3A 4X41A 1GL9B 1U8TA 3KDAA 1HG0A 2ZUEA 3FZQA 5EN4A 2V54A 1GRNA 2A0KA 2XTZA 3UY4A 2XB9A 1S9DA 3B20A 4NTZA 4UD2A 4AYXA 4YUZA 5HIAA 1MO5A 3WYGA 2PUVA 3UFXA 5K3CA 3X0DA 1W4RA 3F7TA 1Y42X 2RJOA 3T7TA 1K5DA 3OKCA 2QRGA 3RAGA 4TMVA 3FMGA 2H5LA 5K0SA 3NATA 4J4HA 1NW3A 2X6TA 2VRWA 2A0WA 2F48A 3REGA 3W9SA 1QIHA 5EWJA 4AF6A 4IEFB 3CINA 4C2TA 3Q7TA 1VQ1A 4AMYA 1Y81A 1WNFA 4CLDA 4I50F 3DT8A 3WYCA 5TPWB 1NSFA 1R8JA 4FM9A 3ADOA 3GJZA 3GLVA 1TOAA 5BWCA 5HM8A 4D8UA 2W8BA 1T5LA 2W6CX 3LBHA 3DA8A 3PPWA 3G3EA 5LMZA 3GMTA 2B20A 1Q0SA 4NH0A 1TZMA 4FYXA 1I24A 2Q9CA 5KYYA 1ADYA 1UBFA 4OQQA 1E8NA 4BBPA 3O8OA 2W37A 5FPHA 7YASA 1WO8A 5J1TB 4G89A 1FBTA 3OJCA 2CNLA 4DRZA 3CLUC 1TCAA 2BFMA 4XUGB 1I0LA 4QHYA 2HJ9A 4QXRA 1W0CA 1LTQA 4AU1A 2ZTLA 2ZZKA 4XDHA 3VSDA 3Q1LA 5JS8A 1DKPA 3E8XA 2RHHA 1XFDA 1SXJB 1VRCA 1D6NA 2JGJA 3SICE 2JZCA 3EZNA 4XJSA 2BI4A 3GH3A 3QG5A 3WE7A 1GM5A 3LA6A 5DYIA 3M34A 2D1RA 1DC5A 4H7KA 2A4MA 2AK3A 2R96A 3MJVA 2G09A 4Q9LA 4Q01A 4UHJA 1OGJA 1NVEA 2QMEA 3E5HA 4XGRA 2QI9F 1YUBA 1ID1A 2JGLA 3BB1A 1SZDA 3JQ9C 4HSEA 4PGHA 3S8YA 4KDFA 1E3WA 2FQYA 1I1HA 1AS0A 1YQWA 3FTCA 5IKXA 4CTMA 1ONNA 4R54A 1NG9A 1JHXA 4GBGA 1ZMXA 3H1TA 2JCYA 3PX3A 4I4TB 4TYNA 2QYSA 2A9OA 2F67A 5GZ6A 1VLVA 3OFVA 1DBSA 4KC0A 1E1RA 1AGYA 1JKJA 4FSXA 3QKRA 4K6HA 1N4AA 1U7ZA 4I1RA 3U3MA 1GFIA 3NRCA 4DCGA 5JSZA 3S70A 4QUKA 3H19A 5JZSA 2XXAB 1FP4B 2PXHA 3GDWA 3HI4A 4RV5A 4XYMA 3ZVKA 4MAAA 3RLFA 3DD5A 4ZICA 2C03A 5HP4A 4KHPB 1FFGA 4Q00A 2HF7A 5BSVA 1Q95A 1RM3A 3RS3A 1R9NA 2AF4C 4KZPA 2FY8A 3A1TA 1T2UA 3OM8A 3E8MA 2OQVA 3D4BA 2AK2A 1B2LA 4RD6A 1IB6A 1T9GS 1DRWA 1H0RA 4QRDA 1U1CA 1CUBA 3JD3A 4LDPA 3EMKA 4MV1A 3D7RA 5GJCA 4BVBA 4W5NA 2Y68A 3QVGB 5IU6A 4Q7JB 2BEUA 1QYWA 4QUJA 3WLRA 1RRCA 2CB0A 3U4GA 3LYHA 1ZZEA 1EPUA 4OY3A 1VB5A 1KPHA 2JKZA 3SHTA 5KC8A 2XH8A 2H1VA 1CJTC 1JYSA 2ZPUA 3KJXA 3KLOA 3LT0A 1B0ZA 4G86A 4X3PA 3UAYA 3OTQA 2I80A 5CJJA 3KV1A 3R0JA 4GC5A 5D5QA 1JB1A 1OV6A 2FPMA 3ZHVA 121PA 1Y8ZA 3PGMA 3OEYA 3DF9A 1V41E 3EG9A 1NJ8A 2FPKA 3DEIA 3OZIA 3E9RA 1KI2A 1VMDA 3AVYA 3FLMA 2H57A 1Z7GA 3I2JA 4DY4A 2O14A 5E7JA 3ROEA 1KY3A 1RYEA 3EJWA 1K2WA 3H1BA 4WH0A 5J1SB 3FH0A 3PUIA 1KTIA 3PD1A 3U7FB 3HJCA 5AI5A 3C8MA 4N12A 4HNUA 2GARA 1YL5A 3AJRA 4Y2YA 4R9NA 4CLXA 3OQBA 3AFHA 2ZJ5A 2JC3A 4A8HA 4DEVA 1PLKA 4W1PA 4NBKA 2DAPA 3C4QA 1RCFA 3OOWA 4IF6A 1Y1KE 4EFLA 4EL5A 2ADOA 1IXRC 1PU2A 5BSEA 3BREA 4DLWA 1ESNA 2H4XA 4YRAA 1X8XA 1Y7IA 1UXKA 4OFXA 4XOIA 4HDRB 1GZ5A 1Z2AA 1EVYA 1ULAA 4QE3A 3FWKA 2AVNA 4IO1A 2RAVA 3IR7A 3AM5A 1YB1A 1UJ2A 5F9HA 4TSFA 1XIVA 5C1PA 4I50A 4CLHA 3WP0A 4C08A 4CM3A 4EEXA 1N0UA 4X45A 5CM2Z 1WUTA 2HU7A 3ZHRA 3D6FA 3ENKA 4R7TA 4Y1RB 3M3DA 1MMFB 3TSZA 4B3IA 3T1HB 1X7ZA 4R16A 4JLUA 2PFKA 1EX7A 2CLDX 3ND7A 4ZAWA 4EKGA 2GJSA 5SZHB 4UBJA 1EZ4A 1E18A 4V2IA 2FJPA 3N2NA 4X8LA 1THMA 4AMVA 1Q6YA 1V37A 3G2MA 2OD9A 1DAFA 3RJ5A 4B84A 3MTAA 4P38A 3URKA 2H2AA 4EYQA 4RK1A 4KE9A 3P4YA 3FOZA 3TVTA 1V45E 3LPCA 2VR1A 3T1TA 1I3NA 4RK4A 2YC4C 1FP6A 4KH0A 5LKAA 1R0KA 5GJBA 3BA1A 1DJQA 1KYVA 4ZO7A 5BOSA 1AHPA 4JFRA 2VAVA 5AJTA 4ZRMA 1ZRNA 3SIWA 1E79A 1H66A 1XQ9A 4R1TA 4XQ9A 2B34A 1J6UA 2YZGA 1EFUA 3O0DA 5DF1A 4YDSA 2Q27A 3HRHA 1QKKA 2ZM6B 1GCIA 2BMVA 1DT5A 1BA3A 4JUIA 4QBHA 4NG5A 1SUPA 4Y7DA 2IKQA 4Z0PA 4XE5A 2IIPA 13PKA 3DLPX 4DT1A 2XBLA 3IIMA 4AJLA 4E5VA 2V3WA 3EF3A 3ACBA 4M76B 4WUTA 2XUHA 1QO9A 4E03A 1N78A 4KWTA 1G8MA 4L6IA 4DMKA 4K7JA 4WKBA 4DV6B 1WF6A 3SC4A 3C3AA 2GNPA 2AA3A 3FB1A 3MRSA 1TT5B 3I04A 3ETJA 5K45A 2ACEA 5KNDH 4C6SA 4RHEA 2R8YA 1ZKMA 3ASVA 3DEJA 2I6QA 2ZVPX 2HWWA 1YJCA 2Q41A 3Q9SA 3GRAA 3R6GA 3FCYA 3CLSC 1QTQA 4RL6A 1RBYA 2V7VA 4I3HA 2V6JA 1R15A 3DT6A 3V4OA 1RPZA 3BSYA 5CXSA 4M2LA 3ILVA 2WT8A 2B4YA 4N18A 3TR5A 4K9DA 1ZM9A 1D1QA 3AXSA 1T0PA 2JHCA 2QUAA 2WWRA 3NS7A 3OIDA 3DGEC 4BGUA 5AVRA 5EJ4A 1C1XB 2JI4A 5FYDA 3SJBA 4LGCA 3ZWQA 2O7SA 1VHQA 2DQYA 4UCFA 2GK6A 3UF0A 4V0KA 3WKCA 1USVA 1IY2A 4P2BA 3LF2A 3EMOA 1XTSA 5K8IA 4HY3A 1XG5A 3KKEA 1NY6A 3IRVA 3AT1A 1PFUA 3E9YA 4MUYA 3SDSA 3NTUA 2XNKA 3FA2A 2VZ0A 3OTWA 4PFJA 1C7ZA 4D0NA 4S05A 4TTTS 1PJQA 3GUHA 5CCEA 1EXMA 4AB1A 4ALNA 1JVBA 2WUDA 1PJZA 1OASA 2DBZA 3IKLA 1JB9A 1PR3A 2WJZB 1AKVA 3OEHA 4INZA 4BQNA 2FPGB 2D2EA 3HDGA 3SM3A 3WWOA 1HOTA 3IR5A 1KORA 2VKQA 1VBMA 1VSBA 1NOKA 1SOAA 2C9DA 4FZ5A 3WHKA 1U5BB 3ROFA 3PJEA 3H7AA 5TQ0A 1P4SA 2QQFA 4TL8A 5DM60 3KYCA 2F64A 1ZW1A 3QYAA 5L3SB 4MV8A 2BWJA 2AW3A 5JZMA 4CV1A 2NUTA 2BZ1A 3LPDA 1YZ3A 3HNOA 2ZUTA 1U3DA 2R5FA 4F4IA 4W5OA 3R3YA 3SGLA 2OV8A 3JATA 3IO5A 3MWJA 3LPMA 4B6FA 1U0GA 4JXJA 2DE0X 3B7GA 3VR6D 1S8OA 1PV1A 3K2EA 2B9VA 2J3EA 3V33A 5HHTA 4ZXFA 3NYRA 6YASA 3GP3A 5DK6A 2CJPA 4TVSA 3IP7A 3ZXXA 2JB9A 1Q1BA 1GCAA 2QL7A 4W8GA 4WJZA 4EY5A 1P45A 2LKCA 5T4EA 1WW8A 4WPGA 4UEOA 2FWPA 1EGMB 2AI1A 3TE7A 2P9YA 2Q2OA 1FFXA 4MWDA 5F33A 2VWQA 3LOUA 5ECDA 2H0RA 1XWIA 1PE0A 1SU4A 4QJ3A 4IIBA 5EA2A 4EI7A 3O91A 3ZZTA 2PVSA 2ERCA 2OGSA 1A2QA 3O21A 3VU0A 2VDKB 1GT6A 1B8UA 1KY5A 2XGMA 3AB3A 3BFJA 3TLGB 3ER8A 4ER6A 1X92A 2OLEA 4HQRA 1VMAA 4RK7A 5EG5A 3N5CA 1VCIA 4A5SA 1JN0A 1RYZA 3OUTA 2YV5A 4XVHA 1MQSA 5B1DA 1L5SA 5FOVA 3I9FA 3WK5A 3MA0A 2A9RA 2XR1A 2C59A 3JS5A 4PLVA 4RU1A 2Y1CA 4J7UA 1PLLA 2PJUA 4D92A 4EH1A 3I83A 1KOFA 3M4ZA 1PQUA 2LIPA 3UKDA 1L5GB 3PE6A 4YVFA 2BM9A 2QQ5A 2QPAA 1WXXA 4NDAA 5G3YA 2BFDA 3MMXA 5TARA 3ODGA 1R3DA 3FFBA 5IN4A 3THYA 5GAJA 1U28A 5KIAA 4AJPA 1BU8A 4DBLC 2CDBA 3LDGA 2XLBA 3A1VA 1XZFA 4RKFA 3HPRA 1JECA 3JWPA 3ND9A 3TM5A 4F5WA 1IWBB 2FW1A 1K8QA 1P91A 1ZIOA 2QPLA 1PNTA 4UATA 4DWVA 2IPOA 1Z7EA 2IF0A 4M1EA 3HKCA 4NJMA 2JFZA 4PPNA 1OH7A 1AV6A 1C1YA 4QXQA 1VG0B 3CZ4A 2X3YA 1ZX1A 4B3FX 3CZRA 5LLTA 1SBQA 1TJ3A 4RZIA 5ER9A 1UDWA 1GHTA 1OF1A 3O3MB 3BH7A 3VU1A 3OZBA 2ERXA 3CG4A 5EL0A 2GPNA 5KQMA 1U6KA 3UMMA 1E1DA 1OU0A 4EKDA 3MTQA 5JUWA 5JY1A 4GP6A 3HA3A 4H15A 3E23A 1UMCA 4BX8A 1V5IA 2NTNA 3QW2A 1BFKA 3FNGA 4RVUA 5K51A 3CFAL 1WPQA 3HU1A 3UGJA 1ORHA 1SFRA 1V4BA 2VP5A 4Q4AB 2MYNA 5TJHA 1Y37A 3UWSA 1E0KA 1NLUA 2AR7A 3MGGA 1QZ3A 3AYZB 3VFDA 2O8BA 4KVAA 2ILVA 4UUPA 4BQEA 1GITA 1DBWA 1KAMA 1T10A 3CE9A 3GVCA 4MYCA 5DNAA 2QT1A 3KZKA 1YQUA 1CP2A 1WKCA 1VZ2A 4GSKA 2V7QA 4CVNA 5L95A 3RJZA 1UQUA 1VI6A 1S7GA 5D85A 5CLQA 1REQB 1BH6A 3S99A 3CC8A 1O95C 3MJFA 1V3TA 4C30A 4BFXA 1NNSA 1KH2A 3K0KA 4X7PA 1CIVA 3DXZA 1ORWA 2WU8A 4P22A 5FBZA 4CQMD 2JFXA 2SECE 5ARBA 1IAVA 4ZC8A 1PQPA 3PD7A 2VP4A 3EOAI 5IYZF 4EA7A 1KYWA 1SR8A 2WAYA 1OB5A 3WMGA 5JAUA 4BEBA 2PLWA 3QNMA 1ZJWA 4OGGA 1WTCA 2QR3A 3VNRA 2GCOB 2WHPB 2ZYWX 3AF0A 3U9TA 4JBNA 4QARA 3VPDA 1RJEA 1T4DA 2NZUG 2XZDA 5E7MA 3DV9A 2Z30A 3MYYA 3OT1A 4HMOA 6REQA 2DUNA 4J29A 2QW8A 4ZCRA 2AUTA 2Q3DA 3TDNA 3HEBA 1I6WA 4OIMA 1JJFA 3AVOA 3KV3O 3QWIA 3QXSA 3QA9A 2QN9A 1SQ5A 4RNCA 4CG2A 4KXMA 1G38A 2I8AA 2PKRA 2O8EB 2CW5A 4NULA 2UUBB 4DOMA 3HZRA 1XLWA 3I0NA 2W93A 3AV0B 3T3NA 4E5DA 5EYPB 4UAGA 3UO8B 4UTRA 5KREA 1E89A 1M2KA 3V2UA 3DBLB 4TMFA 1XO1A 2OVBA 1M54A 4D99A 3FGZA 5CFLA 2ETXA 1WZEA 4YRLA 1JJAA 1LC3A 1UM8A 1UMDB 5BQPA 3U44A 1DUVG 1UWLA 1UJ4A 2CCJA 2ZB2A 2IHKA 3ZXSA 1PCXA 5TMDA 3TL2A 4JJZA 1B8VA 3R5TA 4RIGA 1PNOA 2WYWA 3WWCA 4EGAA 5KKNB 5KJCA 3W1VA 4B2YA 5CM8B 4H1VA 4Q3NA 1W0KD 3WLEA 4LN1A 2AG5A 1X1QA 3W8DA 3ZJTA 4UDOA 1CUWA 1Y1RA 1ZI9A 5AICA 1QJ4A 3SHFA 1NAHA 3BHNA 3EDCA 1S8AA 4QUBA 2GD2A 4BV8A 3OQPA 4EB3A 3A06A 5JSUA 4U7WA 3GJ0A 1F8XA 4RH0A 1FNBA 3AR8A 2MMGA 1JKFA 3HKBB 3X2FA 4P0PB 2Z1MA 2HQRA 6ADHA 2HWXA 3L7YA 1LSOA 1NIJA 2JCBA 3AY7A 3IHTA 5DM1A 4DREA 5ILOA 1FZQA 3DE3X 5F98A 4BV3A 4NE7A 2PGOA 2VDWA 1MX5A 2WUEA 5E6SB 1R9MA 4FC7A 2E0IA 3S2UA 1HKUA 2EU8A 4B74A 4A1FA 2HJSA 1QH1A 1T5IA 2DPYA 4HJXA 5CVUA 4MGKR 5GOZA 1TZCA 2Y67A 2I4RA 2R6HA 3VC1A 4HNTA 2NO9A 2HD4A 2RG1A 2X6QA 4P7BA 3R6WA 4UNNA 2FFJA 2KI5A 3EZ7A 4FMBB 3UJHA 2WD7A 4BS9A 4GVPA 4RYLA 1KS9A 3SHVA 2YJNA 5JROA 2OE2A 1NLMA 2N42A 5EIAA 3UATA 3WS7A 3AEKB 4LZWA 4MGHA 5FBKA 2ODAA 2AX3A 1YC2A 2ZYUX 2C5BA 3EGCA 4M9SA 2I2DA 4E5KA 1Q20A 2H07A 2P67A 2O2DA 1KK2A 1CQJA 3EPRA 2A5FA 2CXQA 1S4MA 1FTQA 2C5GA 3G2OA 3MTBA 4PE5B 1JR3E 4FYMA 1J33A 2XTNA 1KZ1A 1T2VA 5CW2A 7ADHA 2UXCB 3R0IA 4B9AA 1MZVA 1EESA 3H0KA 3LHIA 2LCQA 3ZLTA 5A02A 4DMCA 1LH0A 2IY8A 2PYIA 2HTEA 4KFTA 1IPEA 3TL3A 2NO0A 1Y1PA 4MVJI 3GW8A 4OMUA 3QPDA 1G6Q1 2VT3A 3PL5A 4DCJA 4JJIA 2XZLA 4BL5A 4W9MC 1TAGA 2AD1A 2BISA 3EXHC 2HI0A 2ID8A 4PC7A 4YCMA 2RHJA 1NN3A 2IHBA 3INGA 3MERA 4HN4B 4P5DA 3SBEA 2V9PA 4QC2A 1H2EA 5EJ7A 5LP6B 2O8DB 1U65A 3MSXA 4LFAB 1TUEA 2XTJA 4PHCA 1WHSA 1ESMA 5HW0A 4M4SA 3DBVO 1LEHA 1H4SA 1C3OA 3GJXC 4H2DA 2A1UB 1XT6A 3CPEA 4LDZA 4LDAA 1I2CA 1OD6A 4PU0A 4C4RA 4CFSA 3DMTC 4F21A 1BVYF 2G9NA 5IYZA 4MITA 5G0VA 3LNCA 1ZCZA 3JVIA 2OYRA 2QQ0A 1N2OA 3DKVA 2QN7A 1A8QA 5JAPA 4MR9A 3VTFA 3U3OA 4EHLA 4LTDA 1USWA 1ZG3A 1HY3A 1IQRA 2VUHB 3AYXB 3CH5A 4AJIA 1MT0A 3LE8A 4FMDB 1YOBA 3SZMA 1GQSA 2BT4A 4OB7A 4B9EA 4OKSA 2PCLA 3AF2A 4OO3A 4HQ0A 2PBRA 2H5JA 2WMOB 2Z57A 5B30A 2YHSA 1ZKDA 1V7QA 2C3MA 2CLMB 3I32A 3PPYA 4NSNA 4D0GA 3DJFA 1HYBA 3GF4A 3THXA 2NACA 1A1VA 3HWRA 5KDOA 5AK3A 1ZCJA 3WLHA 3D6MA 1IJBA 4ZV7A 1E0AA 3HS3A 1L0BA 3KUUA 3PEEA 4L3VA 2REOA 4WRRA 4WCFA 4KJXA 3IJEB 1J9ZA 4FW8A 5E1DA 2L17A 4FTWA 4YMVA 2W4MA 3I8XA 1Y3CE 2C20A 2OOKA 2OV6A 5EE0A 3H9EO 5CU7A 4PHGA 1QRDA 1D2NA 3JD1A 4OK5A 5H68A 3REQA 1M6VA 3UK7A 3OZVA 1G6OA 3BIFA 3RSOA 4KVFA 1NJ6A 1K97A 1SXQA 3G5TA 2DXIA 7GPBA 4N3CA 4YP5A 2BF4A 1JPNA 4LNAA 1A1SA 2COUA 2QM3A 2GCEA 1ZGZA 5C7IO 2UUPA 2JFOA 2QLFA 4LYDA 2Z6AA 3ZD9A 4DR7B 1NHWA 3OU2A 1X70A 4WVFA 3O8LA 3K9WA 5CVTA 4L16A 5T4FA 5JYEA 4PPYA 3OTOB 2JIMA 2ZRFA 4F84A 4G85A 1ZN8A 1BDHA 5ELLA 3O9VA 1ZCAA 1OXSC 1DWPA 2DGDA 3WMRA 4AM8A 1EUYA 4CM4A 4RH3A 3FPLA 3NHUA 2X1LA 4C4PA 1N8TA 1J5PA 1FLAA 2PX0A 1FW6A 1G8SA 1OHHA 1EFPA 3FIJA 3GRFA 4BP8A 2Z6QA 4KN9S 1FVFA 4PGMA 3MWDB 4Q4CA 1RWWA 3TQTA 3C5CA 3LVFO 4LHXA 3RT7A 3NIDB 3A6GA 3P27A 3B82A 3EY4A 3T3HA 3N0TA 4H4DA 3RODA 1D04A 5CVJA 1JDBB 2E3JA 1OJLA 2P7IA 3WGHA 2DB3A 5JCOC 5K3FB 1Z12A 4CUKA 1GU1A 4EMBA 1GPWB 2YJ5A 1GCOA 3A1DA 3H2JA 1NN1A 4N8EA 5FLYA 1NUUA 2IP2A 2ZQYA 5B36A 1SY7A 1XVUA 2B92A 4JBWA 1T1IA 4U2EA 2FLVA 3D8HA 1UADA 1KMMA 2POQX 1UKVY 5AVJA 2GHQA 1FQOA 2HEIA 1MX9A 3KPWA 4GQIA 1LPPA 4ENVA 3L79A 2Q3JA 1KVUA 1IRIA 1Y4UA 5AWFC 1LQ2A 1MEJA 1NLFA 4ESOA 2WF5A 3SQLA 4WCDA 1UQRA 3P8ZA 2B69A 5DE3A 1X7WA 1PFQA 3ZK8A 1Q1EA 1AZTA 1F9AA 1V16A 1DFGA 3AH8A 1G1AA 4HEA1 4UM7A 2BC9A 5BWLA 1VJCA 1U5AA 2EWMA 3AHCA 4L5BA 2LD4A 1W0JA 5I5GA 2ZJ3A 3PQ3A 4CKYA 1NF9A 3WDKA 2EKBA 4GUAA 1B1CA 1R74A 4CTNA 4B8WA 2WYIA 4IV8A 3PNLA 4LJ5A 4CKCA 3DFUA 4D80A 1SUIA 4EGCB 4ZVKA 5TY0A 4ASUA 1NATA 3KOXA 3C8HA 1EK6A 4KPGA 5GINE 1M6YA 1P7CA 3GPCA 2AMYA 3FVRA 4G07A 4U2DA 3ZR4B 2YCBA 2QJWA 4UD6A 2WIKA 3L8FA 5TIIA 1E3MA 4ZAGA 3D59A 4NRDA 4L75A 1SQ0A 3CT4A 3GGOA 4MKHA 4X66B 1EA7A 2EWWA 2YWJA 3ZGVA 1N6OA 1M1YA 2JFHA 2DTXA 4WNIA 3UB4A 4AZWA 1WJGA 1KGDA 3G68A 3L8MA 4HBZA 1TVKA 3HXKA 1SC4A 5IKMA 2ZTHA 1ZSYA 3PT9A 2H7YA 2WILA 4CKEA 2MSEB 1DQNA 3O4VA 3EFOA 3UQZA 1L4UA 5CA1F 4NZNA 3W7VA 1CY7A 3ZQ4A 1NVWQ 4LV5B 2J5BA 3ICPA 3L0OA 4ZV4A 1WLYA 1WXQA 1H9AA 5CDFE 3AI2A 3PL1A 4C2UA 2HMYB 2G80A 2EYUA 1P5FA 4N7BA 1O5TA 3CX7A 3RI3A 2FSPA 4GM4A 2C9YA 1KK0A 3W7AA 5DHTA 2JZNA 4WKCA 1JXAA 3HWSA 4ZCSA 1ML3A 4R2MA 1TA9A 1XTBA 4RNDB 2X4GA 4V02A 1IG0A 1Y6FA 4P93A 1LFDB 2VF5X 1DX4A 2VHXA 3GDGA 3PXUA 4IHJB 4UOQA 3LW7A 1LDGA 2J3JA 3CR3C 2AEFA 2Y2UA 5KNBA 3W7BA 2E9SA 3JX9A 3O31A 3T9DA 1YZFA 2D2XA 4NK4A 5HR5A 4XDGA 2CT8A 1EUCA 2FZGA 5DX0A 1L2TA 3L7CA 2Z09A 1MJGA 3RRBA 1EM6A 1XYYA 3EK2A 4OQDA 1QB7A 1QVWA 3CVVA 1W34A 2WJWA 3DP9A 3QQPA 1XXLA 3GLIA 3P45A 2QZ4A 2ID4A 2HSJA 1I5RA 3ROPA 2XDQB 3RYHA 1C0LA 2RHOA 1UL1X 5FUVA 3R5KA 4YRRA 2JNWA 3AI7A 2RKWA 5KYNA 2YHIB 3I61A 1HNXB 2YV1A 4C3UA 4CIVA 4FDAA 2W2KA 5C0OE 1E99A 3RTCA 3W2TA 4WT7A 3SXJA 5ITZA 2I3DA 5HIKA 1Y6GA 1V96A 1C0IA 4KUHA 2XVZA 2HN9A 2ZJ7A 3UOGA 4OU4A 4YXFA 5BYJA 1YR2A 4DDKA 1OC2A 1XXHA 3OZUA 5BR8B 3Q41A 4IIFA 4JNCA 3PTLA 2UZ3A 1Z4IA 1CW2B 1R16A 3FYCA 3KAQA 4L5JA 2ZRJA 3VXKA 3FYUB 2RBEA 1LLUA 4R9SA 3G2NA 5EIWA 4IH4A 1WPGA 3RIHA 2AMLA 1Z5ZA 1HE2A 1YR3A 3T7EA 3UJBA 1EFVB 3QEOA 2P9CA 2X76A 3R40A 4KLAA 1SVOA 4BN0A 4F3TA 4XARA 3WO1A 1GL3A 5A7HA 1S5PA 5D1NA 2GAFA 3T4EA 1XJQA 4LXYA 4O5OA 3K0EA 2ACVA 4FLEA 2P69A 3F8TA 1M6HA 3BIXA 3HBJA 1B6GA 4I4NA 5F1YA 2JLYA 1BU5A 3PHHA 1NUHA 2RHWA 3K9HA 3F6SA 3HSSA 5LBIA 1DJNA 1P6XA 4IQGA 2QZSA 4A36A 1SZPA 2A9KA 4PPFA 3O2QB 4TN1A 5EHGA 3VGPA 3UUFA 5HEKA 2KQUA 1W75A 3ELWA 3GCGA 4EI8A 4TMYA 3VHXB 1NW6A 1KYYA 4KAAA 4RZXA 5KYTA 2PN1A 4H17A 4P7GA 1A4IA 4MWTA 5LZ5A 2ZVJA 5BMOA 4RTKA 4EW1A 2YV2A 1L7MA 4HUQB 5CH3A 5AKIA 3DP7A 2AN5A 3V7NA 1XAGA 5IHXA 4FJ0A 2HLPA 4ZOQI 3U7HB 1FDRA 1QFSA 1Z2EA 1WDTA 3EZ6A 2EHDA 3F9IA 5E6RA 1QHNA 4ZI5A 4CR8A 2F3QA 5HRCA 4U2BA 1U0JA 5B55A 3L0YA 4P53A 1QIKA 2O2JA 5EJFA 2EARA 1XVTA 4OHOA 3PGXA 4I5EA 4A6XA 1XDBA 2CL7X 1E63A 4L8VA 2DFLA 1Q7EA 5TS3A 3ZWVA 5B3LA 2I4LA 4NS1A 4M54A 1P61B 2XQFA 1CR6A 1P6QA 1YCHA 2R85A 3DDZX 3FNBA 1ODLA 3IYLW 5A5VA 1FVOA 1Y9AA 3E3NA 1SKQA 2FQWA 4MV7A 5BWMA 1QKIA 3ILHA 3W4JA 1JU4A 2OQ2A 1YRAA 5CIYA 3H65A 3WWZA 4ZYWA 1V39A 3KSAC 1YOVB 1ZIXA 3H6KA 4HWOA 2JH3A 2OXFA 4WERA 1HO3A 2FEWB 4JYZA 3IVCA 1SUBA 3JTMA 2GF2A 1Z0ZA 3WVNA 4GE0A 5JZ9A 4XLTA 4OHYA 4QFDA 3VDQA 1C2TA 1GZUA 4RAOA 3LQ4A 5T3UA 2Q28A 3VZQA 1JVNA 4BNMA 5JJBA 1J22A 1V1RB 4JZYA 3T7SA 5CAEA 3U4AA 5KU1A 1DADA 4A6DA 2WF8A 2CJWB 2FUNB 3FSGA 4OUDA 5DW0A 4Z1MA 1TIKA 3ZWWA 3BFKA 2NVBA 4J1QA 3VPFA 2PVCA 4W7SA 2QW1A 1Z26A 2PIDA 3DVQX 4RACA 3CV3A 3U61B 2X19A 3WZLA 2OGFA 1E9VA 1MAHA 1OXVA 1DQRA 2O2CA 2HMVA 3ZTWA 2GTIA 4I55F 4FFWA 2J31A 4D6PA 2WWIA 3LQKA 2YL2A 4KDEA 5I6DA 4LRQA 4F9TA 2INGX 2J7KA 1YHZA 4MKFA 4JVSB 5CLHA 3ESZA 5CJ2A 5EZ5A 5D3MB 4Q4LA 3ZNOA 2CVFA 3L18A 4TMXA 3DZDA 3P9IA 1RHJA 4F96A 4IICA 2JIQA 4EYOA 4F6LA 2DRIA 2H3EA 1P1RA 3KWJA 3EYWA 1EM8B 4OTZA 1KGSA 5B1EA 1S8NA 3OAAD 1E9AA 1GV0A 1RYNA 3BMNB 3KQPA 4IDEA 4RO0A 2W2QA 1QLHA 4UPEA 3EZYA 2B35A 4BN4A 3EBPA 2VHYA 5I3ZA 4ND7A 4QT4A 3MPOA 3IAHA 3HYNA 3IEKA 1YQDA 4MS1B 1HETA 1NLZA 2D7JA 3H2BA 4F93B 1ZH0A 5F5NA 4FDTA 2WAXA 2CJXA 5IDYA 4XIIA 1ZK1A 2QL5A 1SVMA 3CZ5A 3GOHA 3LBAA 4DEYA 1TJ5A 4X7RA 1HBJA 2CKMA 4TLMB 4HHEA 1RT9A 3GP5A 5KVAA 2OORA 4BMOB 4B8ZA 4JQZA 2E1PA 3D3QA 4MJ3A 2B7LA 2BH9A 1M2HA 1OV4A 2VXCA 4G3XA 3WGGA 3N28A 4EG6A 4TOIA 4JI4B 1O77A 2IS4A 5J58A 1II8A 4KWEA 2IHJA 4LXUA 4AYTA 4XRGA 2NNWB 4WADA 5KVVA 2JLCA 3VR3D 1OILA 3N58A 4K9LA 4DTIA 1Q0PA 1SKUA 2A5YB 2QQGA 3ZD6A 3NQ41 5FKJA 5KSPA 4BPBA 3DLBA 2I4MA 3QE0A 2G72A 3IIJA 4L4XA 4V0MA 2GRAA 3BICA 3LGAA 1G5RA 4OI2A 1E1RD 1QONA 1TKBA 3TLMA 1JA1A 4B45A 2C9BA 2EGUA 3PYMA 1J2EA 1UAAA 4YCJA 2ZPAA 4TKVB 4LTMA 5DGCA 1JTEA 1K7EB 3JASA 4DMHA 3B5IA 4MW6A 3I45A 4IDOA 1F0KA 3OUZA 5KYKA 2QOEA 2E4WA 1RXSA 3L82B 4O4LF 3W3AD 4AMZA 4UMDA 1H3FA 3B52X 1LB1B 3SX4A 4AECA 4FBLA 1C9NA 1RWBA 1GLGA 3F2VA 1JHQA 1QLJA 1GLVA 1GPBA 1UBTS 4P4SA 3OZWA 3OJFA 4Q03A 3ZG6A 4WESB 3WSTA 4UM9B 3H84A 3AM4A 4MKZA 2VSFA 5I3CA 2V6IA 3COPA 5JXWA 1EIZA 3B8HA 1CKEA 3B51X 5HIIA 4KR7A 3JAKB 4YJ2F 1Z0IA 5JY6A 2ENWA 3PC2A 4G26A 3G1WA 3MINA 4RK5A 2W6OA 1JR2A 4M22A 4DC0A 1K98A 1OR8A 2GZMA 5DYYA 5H82A 1F8GA 5JDIA 5KPDA 2OP0A 4HUJA 3I9V1 1BH2A 4RA6A 5B6PA 3LZ6A 3UGTA 4DQKA 1JMKC 4QHTA 4L0MA 2VDVE 4GLJA 3IUMA 5DT2A 3N2IA 3KQNA 4QEKA 1EK2A 2GX6A 1ENZA 1VYHA 1LV7A 3EUAA 4U5QA 1BHQ1 3SIXA 2G1PA 2ZIVB 3HJNA 1XF1A 3K0FB 5JAMA 3ABOB 4EGFA 4PG8A 3PDJA 4NYJR 2OCKA 1CDDA 1ZFNA 3ENVA 4I1IA 2PGAA 4DYVA 3VH2A 4ZI7F 4FHGA 4HTFB 5G02A 3TZQA 1D9ZA 2ZTVA 2OHGA 3TLKA 1Y3HA 3I28A 2YWBA 3EZLA 2ADMA 3OURA 4PX5A 1SMKA 3D02A 2BJVA 3FPGA 2CEAA 3CBGA 3K1JA 4UDYX 4DZZA 4K6OA 4R31A 5DX8A 2PGIA 3RIMA 3TZEA 3VM6A 4V38A 5AM4A 3QELB 2C96A 2AWOA 2D59A 3UK1A 1HLDA 2PRZA 4XI9A 4EJFA 2G1UA 4P7FA 5MDHA 3H1GA 3BJZA 5E3HA 1JQ5A 3LQQA 3EVCA 2GAJA 3M1LA 4I55A 1KPIA 3BRQA 3LQYA 4JGBA 3RGWS 4NNPA 3A3YA 3G0CA 4KQIA 4UHDA 3ZBUA 3U7JA 2V7BA 2Z2KA 1O95A 2C8JA 4J91A 1AY0A 4NBLA 2EDCA 2XD4A 4KGVA 3JZMA 2IYPA 4TSFD 2WHXA 3U7QA 1W85A 3PPXA 5LWHA 5C80A 4N39A 3GBVA 3N2KB 5C8XA 1I0IA 2AR0A 3BSSA 5A06A 3THWB 4CMJA 1VHLA 2SKDA 1JP7A 1GUAA 3KJEA 3QF4A 2XCRB 2Z5GA 3UPUA 5LP6C 2JCVA 1VL6A 5BW6B 2WNHA 1S3IA 2AFIE 2ZWVA 4Y7CA 4C7BA 3RNOA 2OHIA 2E5FA 4M7WA 1PL7A 3FPEA 4ZVNA 4C78A 1EIWA 3USCS 4K6GA 1U3WA 2BEJA 4WSOA 1B0AA 3IDSA 5DTRA 4OK6A 4KPFC 2BFWA 1JLKA 3ME5A 4NMMA 2C5AA 3DDUA 2ONKA 3ECSA 1CDOA 5FWAA 1U0RA 1NBWB 1E79D 4EDFA 4I4TF 1C3XA 3UOAB 3MGKA 2H51A 4PAQA 1ZK4A 2G63A 3DV0B 3U3XA 4ZYLA 3ZIUA 3ANLA 1XLUA 2FSFA 1TFUA 3S0JA 3Q8XB 4QOHA 1AN0A 4LWPA 1E2LA 2C4NA 3B1KA 3CH7A 4EAAA 2RB4A 5CP8A 4KQ9A 1H3NA 3TQSA 5IAAA 2KS6A 1USGA 1J06A 5IAKA 3VO1A 4ZPXA 1MJHA 1ST3A 1DAMA 2AUNA 3KSZO 5EKDA 3PUVA 4QJ4A 5BSGA 3UWMA 5KNDA 1N2XA 2ZETA 5JZVA 4YGYA 4GP7A 4IJ6A 3RRZA 5DU2A 3TRHA 2YYYA 1OZGA 1CUDA 3OJLA 4LOKA 2RGYA 1AUQA 1A95A 2B4QA 3QYPA 3R6DA 1XKTA 2V7TA 4WWHA 4B6QA 5HXAA 2C4KA 3K70C 5F9FA 4DA0A 2FZKA 4LW8A 1DJMA 5DW3A 2Q6KA 4LFCB 1SIOA 3ORRA 1JZTA 4OXNA 1KMHB 5EPUA 1ODIA 4O4LA 2WB2A 2JJYA 1PG5A 2RGAA 4QLAA 4AS2A 1CS0B 2GEVA 4KNVA 2PR7A 2YBDA 3E7XA 2XXJA 4QGHA 4X97A 5BYBA 3SR0A 2X9NA 1HQCA 1LBQA 2FPIB 2VKTA 3DW1X 3ZCXA 4DG8A 1TD1A 5IJ0A 3HM9A 3ASYA 1TCUA 1VSVA 1EU1A 3Q8WA 4Y1FA 3GCWA 4MUFA 2HRRA 1CULC 2ZSDA 1J56A 2JLQA 2VCHA 4H6VA 1VSQA 4YJ2A 3PQCA 2F00A 1YZHA 1MB3A 1P9OA 2UVPB 3GFFA 3H2HA 4HLNA 3LCUA 4JQCA 2XXAA 1YB4A 3MCWA 4KXQA 4LMPA 4H35A 4PZUA 1WIWA 3VSCA 3DDHA 3C87A 4DIMA 4KV9A 3COWA 3E22B 3UA3A 4FI3C 4XH9B 2O6LA 2WABA 1G0NA 5CLLA 3UYLA 1WW3A 4P81A 3JQEA 1GT91 4LWQA 3L5KA 5K3SA 1ZMTA 2FGJA 3K8YA 4I99A 3ID6C 1FU4A 4N7MA 1E59A 1D0SA 2QYTA 1NBAA 2IV3A 3WQBA 2OBBA 3G5UA 1EE2A 2XODA 1PVVA 5K2OA 3FCSB 3A9VA 3B9RA 1SPBS 4D7AA 1RLTA 3OEHD 3AL2A 4XX0B 1O5OA 4ZI7A 1JDBC 1CHNA 2CFTA 4LFBB 4PR3A 4LZZA 1B14A 4TYPA 5DLEA 4MDHA 2ESRA 1UJ5A 5AHRA 5TPWA 2I1QA 5AKLA 5ALKA 1G59A 1Z33A 1HL3A 3OFJA 4Z3KA 2PXXA 2Q1UA 4CR7A 3BQ9A 2HSWA 1U2PA 2WSIA 1E2QA 1BJKA 2W0MA 1RXWA 1LLDA 2GPTA 4HQLA 3WGMA 1Z29A 4D4JA 2QU8A 5EJ8A 1H0KA 5C8ZA 4EARA 4O1IA 3DBOB 2QM7A 1M2VB 2ZBRA 2ROQA 5FLKA 3ZWYA 4J6FA 4XFJA 2I6XA 1C9MA 3A31A 1J1IA 3MLAA 3OTGA 4LQCA 1OOEA 3WGQA 3O90A 2DBVO 4E12A 1P1IA 1M7HA 4HNAB 1L7DA 2JGMA 3PHIA 1DO0A 2CBXA 1SXJA 4IDNA 4N5NA 3V8PA 4AG6A 3M6IA 4YCNA 5IS2A 3OQ1A 4NCHA 1AUOA 2QT9A 3ZEIA 4BAZA 5FX2A 4PW0A 2A2ZA 1KETA 2G1KA 1W46A 3CU5A 4P86A 4OLHA 1LX6A 1Y8QB 3TMAA 4I08A 1JPUA 5HZHA 3RROA 1WLSA 4E2XA 4PGGA 4Q12A 1LWNA 3SYTA 4YDRA 1R2QA 1YUNA 2Y1KA 3PE4A 1GCGA 4ZQHA 4DL9A 3KUKA 1QFMA 3OE1A 4I4TA 1FUKA 2NQTA 5DNVA