3IOBA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.80 ang resolution in complex with 5'-deoxy-5'-thioadenosine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
287
structure length
287
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title A Fragment-Based Approach to Probing Adenosine Recognition Sites by Using Dynamic Combinatorial Chemistry
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 93
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3iobA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3iobA01
3RJZA 1M8PA 4OJMX 1WJGA 3N05A 3ZIUA 4L2IA 1H3NA 2CYAA 1K97A 4G6ZA 3CLTC 1YULA 1LI5A 2CV1A 3CVYA 1OBHA 4KPUA 4S1OA 4RPIA 2X0KA 2VTBB 1J1ZA 3CLUD 4YP7A 1CT9A 3MLAA 2A84A 4F3RA 2X1LA 4KKVA 1KAQA 2AZXA 1VBMA 3FWKA 3H9CA 1I6LA 3L92A 3FG9A 1M8FA 4DNXA 4PY2A 3COZA 2J5BA 1JIJA 3D6VA 3GMIA 2BTEA 1PFWA 2Z3VA 5TEVA 4MVWA 3INNA 2A1UA 3LOQA 5AHWA 2PZ8A 3KT0A 4P2BA 3FOCA 4U8HA 1IQUA 2IP1A 2A1TR 3I05A 2E0IA 2RE8A 4MULA 1UFVA 1RQGA 2NSYA 4UZFA 5DEOA 2QTRA 1EXDA 2V0GA 1NYLA 1EFVB 1QQTA 4MW2A 3KFLA 1MBZA 4ZT2A 1GAXA 3CVVA 2DEUA 3TZLA 1J20A 3DPIA 1G59A 2DETA 1MRZA 4EG6A 2ZUEA 2A88A 2XRZA 4U7JA 2PG3A 2QUIA 3HV0A 3PXUA 4J75A 3RFFA 1N77A 1VLHA 1O94C 3UC5A 4CQNA 2BYTA 2E89A 1O95C 1NP7A 4ZT5A 4AS1A 1D2RA 1WXEA 2YWBA 4FZJA 3ZGZA 4QRDA 4YP5A 3PNVA 4EGAA 2ZP1A 2CT8A 3H9BA 4JYZA 1GN8A 3COYA 1M83A 3AFHA 2VXOA 3ZXSA 4MW1A 4MW0A 3AL0C 4EG1A 1KQNA 1K4MA 4MUHA 3TQOA 1T6ZA 2GKSA 1U3DA 4HJRA 4ZCTA 3MXTA 4PBTA 2E21A 2PIDA 1YUMA 2DPLA 3IDFA 3CLRC 1G8FA 3IUEA 1JMVA 2J08A 5J5AA 1U0BB 1U7DA 1JEEA 1KH2A 1GTRA 5IHXA 1BS2A 1N2EA 4Q93A 4DE5A 2QTMA 3ND7A 3SZ3A 2D13A 3DO8A 1COZA 5FO1A 1NUQA 3LCJA 4ZCRA 2YY5A 1QNFA 4WNYA 3IVCA 4MWCA 2G36A 3U1VA 2WQ7A 1PG2A 2E18A 3LE8A 1J70A 1QU2A 3A2KA 3ELBA 3IUBA 2RD2A 5TGTA 3MUEA 2CSXA 4MUEA 4EFKA 3RK1A 5HG0A 1IH8A 4G5YA 1TYBE 1WXIA 3IH5A 1I6KA 5HUHA 2AG6A 3ZJVA 3MMXA 2QJOA 1XNGA 2ZUFA 2PZAA 1N1DA 4JXXA 1VBKA 1M8JA 1I6MA 1EFPA 5J58A 2GOYA 3UY4A 1SURA 2O5RA 4TS1A 1NUUA 1O6BA 2H2AA 3RBAA 3ZUGA 3ND6A 5LM3A 2JAXA 2EJCA 1PFYA 1N2BA 4H3SA 4MWBA 4EG4A 3P0JA 5JBNA 1WZ2A 5KWVA 3A4IA 2A86A 1IFXA 3OTWA 2X1MA 4GU5A 1H3FA 1JHDA 4CT0A 2HMAA 4OUDB 3VU8A 2IJGX 3AIIA 1KORA 1KH1A 3X1MA 1N78A 1O97C 3IMEA 4ARCA 4QREA 1N2JA 1J09A 1T6XA 1B6TA 2PZBA 3H05A 3CLSD 1M1ZA 3QE4A 3SZGA 1YI8A 3FH0A 5DK4A 1JILA 3ZXIA 3P0HA 1O0CA 1ILEA 1O96A 4R2LA 3SEQA 2A1TS 3CLTD 3HMQA 5K0SA 1OD6A 1MC1A 5F23A 1G8HA 5TEWA 3C8ZA 5DASA 1PG0A 1OWOA 2WSIA 3IMGA 4ND7A 1QJCA 1J1UA 4NZPA 4K0RA 1JIIA 3CVWA 3K32A 3TZEA 3IVGA 1KP2A 3X1JA 3HGMA 2QJTA 2QUHA 4ZCSA 1N2HA 1NSYA 4Q16A 1WOYA 3SDBA 4DLPA 3OP1A 3KT8A 1TQ8A 5LLTA 1R6UA 1KP3A 4G5FA 1R6XA 4CDNA 1H1TA 3H99A 1U3CA 4UZEA 1OWMA 3TS1A 4MW6A 3IOBA 1QRUA 5BNZA 1V47A 1WXGA 2A4MA 4L2IB 1F7UA 1PFUA 1WY5A 1ZH0A 3ISJA 1IVSA 2GM3A 1VL2A 3G5AA 2JA2A 1EUYA 3N8HA 4KPUB 4R0NA 2CUZA 3FNRA 4MLPA 1IRXA 1YUNA 4A91A 1X8XA 1KH3A 2Z09A 3H97A 3DV2A 3HL4A 3QTTA 1ZH6A 4PBSA 1YIDA 4MVYA 3ILVA 1ZUNA 4QBTA 3SEZA 1O95D 2XRYA 3UOWA 2CYCA 2AKEA 2CFOA 2J4DA 2VTBA 1TYCA 3TQIA 2A1UB 3IVXA 3A04A 4MWDA 3ZJTA 2DLCX 4NDAA 1R6TA 2O8VA 4XFDA 3TNJA 2YXNA 4OUDA 5LFAA 4EG3A 1KQOA 1N2IA 2NZ2A 4EG7A 3FETA 4HJXA 3GLVA 1QRTA 4I6GA 1K92A 3IODA 3JXEA 3M5WA 4XFJA 3CVUA 1OWNA 1FYDA 3AG5A 1IQ0A 1WQ4A 2PXHA 1A8HA 5H16A 1OBCA 3CLRD 2CV2A 3MLBA 4MUNA 1T9GR 4ZT7A 1Q77A 3HZRA 5IJXA 2X3FA 4JZYA 1XJQA 3ZJUA 4MUKA 1EFVA 2V0CA 5J59A 3COVA 1F9AA 1XNJA 2QUJA 3CLUC 3K9WA 1O0BA 2H29A 2I1LA 2QTNA 4K03A 1NI5A 1JZSA 2QJFA 3F3MA 1IHOA 2EL7A 3UMVA 4AQ7A 4MQ6A 3NBKA 3FY4A 3IMCA 1XNHA 3PNYA 2D54A 1NUPA 1JIKA 4ZCQA 3FIUA 1KQPA 1F7VA 3HFJA 4MUGA 3IOCA 3N2YA 3KT3A 4PBRA 1GLNA 1NURA 4MVCA 4MW4A 3P52A 2Z08A 4E1AA 3SYTA 1MAWA 3CR8A 4F4HA 1Y42X 2WQ6A 4I6EA 2HZ7A 3RK0A 2HGZA 2B7LA 1TFUA 2CV0A 1DNPA 1Q11A 5TS2A 1KR2A 3D6UA 1P7PA 3DLAA 1LW7A 1KKUA 4KR9A 1M8KA 4DDKA 3QTBA 2DR2A 1HYBA 5KHAA 1WXHA 3FI0A 4ARIA 1NZJA 1N75A 1TYAE 2J07A 1OWPA 3CVXA 5FO0A 4KR7A 1O97D 4EG5A 3G59A 1MB9A 3FDXA 4NX2A 1ZJWA 3IOEA 3RHSA 4ND6A 1GZUA 3BL5A 4RUKA 4XSVA 1EJ2A 2OV4A 4MVXA 2WB2A 1K4KA 4DDHA 4GRIA 1GPMA 1WKBA 1EFPB 4MAFA 2TS1A 1YIAA 4ZT6A 1EE1A 5H7XA 4NAHA 2CYBA 4YBRA 1JEDA 1VBNA 2R5WA 4ZCPA 3KT6A 5K0TA 1GTSA 1TYDE 1S4MA 2J09A 3X1KA 4YP6A 1QRSA 4JFAA 1JECA 4JXZA 3SP1A 4MW9A 1U7XA 3Q4GA 1X6VA 1T6YA 4DJAA 4NAUA 1TEZA 1H3EA 1N3LA 1EUQA 1NUTA 3VGJA 1J21A 1KAMA 4DDMA 3P0IA 4KR6A 1O94D 4HPWA 1PFVA 4EF6A 2A7XA 5DB4A 5KCMA 3COWA 4MUFA 2D5BA 1JZQA 3ND5A 1I2DA 3GUZA 1N2GA 3Q10A 3FHJA 1WQ3A 4I6JA 5FNZA 1Q15A 1O96B 5EKDA 3AKZA 4MUJA 3NBAA 3NV7A 2IELA 3CA8A 4J76A 3G6KA 1IQRA 4X0EA 4ZT4A 4EG8A 1O5TA 4WSOA 4HK4A 3A05A 1NUSA 4R2MA 3VRHA 3Q12A 1MJHA 1QU3A 1JGTA 1N2OA 1V8FA 4MWEA 2DUMA 1F4LA 2YWCA 2OQ2A 4YMIA 3AG6A 1MB2A 4CDMA 2QUKA 1LI7A 1T9GS 1G8GA 4BWVA 1MOPA 1OWLA 3UK2A 3L93A 2JANA 3S3TA 3PNBA 5HUJA 1ULHA 2DXIA 2DERA 3E27A 1Q19A 3N9IA 1MAUA 4MUIA 1WXFA 4ZT3A 1FFYA 1M8GA 4MW5A 2PFSA 4NATA 4U63A 2C5SA 3PRHA 1QTQA 4MW7A 3CLSC
chains in the Genus database with same CATH superfamily
4GHWA 2IODA 2DWCA 3N6RA 2EGGA 1SHTX 3BZWA 1QG2A 2I78A 3H86A 4G97A 1R00A 3OZBA 1S8FA 2IF0A 3CLTC 3LA6A 4G0YA 3LCUA 4TT3A 3TG2A 1RMTA 5FBQB 5HZMA 3INGA 1I7SB 1BFUA 1OBHA 1NMYA 2WM8A 3JPYA 2WIJA 2WKPA 3RRNA 1MU0A 2VTBB 1C50A 1FYWA 3BRCA 3EXFB 5LQUA 2GK6A 1BWQA 4WGGA 2MYTA 1G5HA 3KYCA 5IN5A 3EZ6A 1XP5A 4KQ6A 2JLYA 1J9GA 2QM7A 3EYWA 1HLPA 4UU0A 2XRMA 1JR3D 4Z2AA 3R20A 4AMYA 1E0AA 2WMYA 4KN8A 3HHEA 4IPTA 1H8HD 4UE2A 5BXYA 1DWPA 4ZA2A 3SC2B 4DNXA 1SPXA 1DE0A 1EP1B 2PWBA 3PKJA 4FYXA 3MMNA 2BTEA 2G28A 2UUOA 4H60A 1DKUA 1PNTA 1W2WB 3K09C 4HX2A 5TEVA 3SX2A 5CCEA 4KK3A 3I8OA 3F71A 3JYPA 2Q8PA 3NHYA 4DYDA 2OYSA 5KWSA 1NQWA 1UM9A 2A1UA 3SSMA 3V8RA 3KT0A 3KOWA 1FTYA 1E1DA 4ETWA 4YMHA 1QM5A 1NXPA 3P2OA 4HVCA 3ZBPA 1IQUA 3YASA 4PG5A 3U4MA 3VVMA 2A1TR 2JA1A 4BP9A 4Y18A 3ZEIA 2ID8A 1M1NA 4MULA 1RQGA 5DYWA 4TS4A 1EXDA 4R3WA 3QJGA 2IEZA 3FGOA 1LCIA 1BDJA 3BCHA 4TMZA 5E7JA 1G2IA 3SKXA 4DRXA 4DZTA 5A2GA 7ADHA 1UJ4A 2HWYA 3WHLA 3ZHSA 4CIVA 5BURA 3STUA 1F3LA 5F7JA 3I0NA 3I4CA 1QG6A 2HF2A 4PCVA 4ZVSA 1IL0A 1MRZA 2ATIA 3A37A 2QZJA 1GG2A 2REQB 4FYKA 2XRZA 1P9WA 1V7CA 2PG3A 3LQQA 5H81A 5K20A 3E7DA 1XQ1A 2JZNA 4J7XA 1Y48E 4DB2A 2AB0A 2JFOA 1DMSA 3BD8A 1QPGA 3QOWA 3IAHA 4FW8A 1R5NA 2HZBA 4M3NA 1WXEA 1EUZA 1VHWA 2H06A 3HP1A 3WXMA 4OI0A 1Z0JA 1EE9A 1IHXA 3IELA 3GGCA 3IQXA 5IAOA 3DCYA 4OL0A 2ZEJA 7REQB 3KTDA 1Q3HA 3U4HA 5A3QA 1WR8A 1NTRA 1ESNA 1YK1A 3A6FA 5TS3A 1W9MA 5JNVA 2C9CA 2O20A 3FROA 5C7YA 2G3DA 3VMMA 5FV4A 4LRTB 3W5HA 1XVVA 3JWPA 4CBVA 1Z73A 3HNOA 3FLAA 4IV8A 1N0HA 4RK4A 4ZHQF 1SBNE 1JIXA 3IP9A 2XV1A 2J3EA 2QT1A 2XUIA 4LY3A 5CB4A 5J5CA 1NBMD 4CCWA 1XG5A 4CUJA 4QYWA 1CR0A 1SBYA 2ZI5A 3AP3A 1XVIA 2AOTA 2E21A 4GP9A 1GCOA 5HDQA 4OHFA 2W6ZA 3GFBA 3R6DA 4E07A 2UAGA 1P72A 1RBYA 3KU4A 2QRLA 1W9HA 1YQEA 2ZLBA 4L6IA 4QC2A 3RUHA 4BRZA 2PUBA 5CT4A 4P34A 5B3JC 2IZ7A 3EGCA 3PHJA 4FIZA 3NGXA 4W8GA 4PWYA 4A9AA 2D13A 1WSDA 2D0PB 3M4YA 4Q4JB 3U6BA 2ZJ8A 3GHYA 2H48A 1HFEL 4IOMA 4GXQA 3RM3A 3WLEA 1QDEA 1U2GC 3P9KA 3BGSA 3F8TA 3U1VA 3HKDB 4B4OA 3D2BA 3PQ5A 1M6VA 1Y1QA 5K6TA 3O4GA 4UE3S 2PRKA 4EFLA 1X13A 3UGKA 4YROA 3IIEA 4YH1A 3U44A 3HB0A 1H5QA 4DIDA 1JEYA 2QTHA 5F1OA 1SCQA 3GRPA 1XMSA 3EVCA 2XQGA 4LCBA 1XZMA 1EJ6A 3HR8A 1EWVA 4YJKA 5HUHA 4PQGA 2E4ZA 3V32A 5JMTA 3H11B 2JGDA 1B7GO 3CXUA 1Y1RA 3MMXA 4EKIA 3U7EB 1GTZA 2P6PA 3I28A 2E82A 1NRJB 3RSCA 3FSRA 1T4MA 1QH9A 5CBPB 1GZ3A 4EKEA 3FM9A 4DQLA 2FP4A 1JXAA 2YJ6A 2FMFA 2RAVA 3G2JA 4G0PA 3ZCXA 3ZUGA 4FC6A 2ZJ3A 4FOTA 1BA3A 4TMKA 4UTZA 5FA6A 4H3SA 2CUNA 5CA0A 3UMCA 1R0BA 4LF9B 4DRZA 3R23A 1ZGZA 5CX1B 2XB8A 4LPKA 3P0JA 3L8FA 1J8DA 3OCWA 2VO1A 4G0MA 1U0TA 1LH0A 3A2NA 1KU0A 1K5DA 2DAPA 2VJKA 2ZIWB 1USVA 2ONYA 4JBYA 4Y2VA 5D01A 2HMAA 1SKAA 4JWTA 4RLQA 1WU7A 4KVFA 4M0UA 3OTGA 2WNIA 3A36A 2P8SA 4ZJUA 3E9DA 2EJWA 4Q6BA 3DHNA 1W94A 4P58A 1O6FA 2ZPTX 2VTKA 3X1MA 3KYDA 2VJAA 1I3LA 3KAQA 3I9V1 3BL6A 1E1KA 3ZCVA 4MTLA 4HDAA 4M36A 1IAVA 1DQZA 2YVLA 1PTJC 1T4GA 3FR8A 3PWZA 2Q2NA 5H4HA 3ZCRA 4F12A 3ZW9A 1FTQA 3GDWA 5IU6A 1YI8A 2BF7A 2CVPA 1DPGA 1Z2PX 1UKCA 1UBMS 1ZITA 2H1WA 2VPTA 1VRCA 4N3AA 4KXQA 4RJTA 4R81A 3GFQA 4TVKA 2H4WA 2ORED 1HUQA 2GN6A 3A9CA 4IGKA 4J9UE 5KTNA 2GHQA 3FDJA 4DR7B 4CDGA 2BFOA 4M0MA 1G3MA 3DZIA 4F2WA 1G3RA 2OCDA 4ZVPA 3U3RA 2ZDQA 5CM8B 3T3EA 1ZD1A 3JV7A 3LDUA 2WSIA 5JS1A 1Z18A 2W43A 1KOFA 4K0RA 1JIIA 4PQEA 4WWHA 3ZBTA 3D1VA 3IAFA 3K32A 2GJSA 5KWIA 3KQHA 1UF9A 3HJAA 3CLKA 5KNCA 3PXXA 2JKVA 1V4NA 2NIPA 4U6NA 2YRXA 2DMRA 5B53A 4CEHA 2I2FA 5F52A 3N2GA 1BEUB 1NW7A 4Y1GA 2O54A 4F3YA 1I33A 2BIFA 2G5PA 1R6UA 3E4CA 3PP8A 3L0DA 3HADA 1U28A 2YVQA 2OB2A 1R6XA 5FEMA 4YT8A 3H99A 2NU8B 5GIOE 4TMYA 3AU8A 2UXBB 3ICVA 3MT7A 2CY0A 3VDQA 1PYOA 3TMYA 4HAYA 3ZN2A 3Q8WA 2JLBA 3Q3VA 2Z5GA 3HZZA 1KYIA 3CNOA 4OLHA 2VHUA 1P0IA 3I1YA 3AFGA 4ER6A 1H85A 1YJXA 3A6DA 3G89A 1YZVA 2AXQA 2VHTA 2GBLA 3M4JA 5IBRA 5BVGB 4XWWA 5IYZF 3PEWA 1A27A 1LNZA 1XEFA 2QRKA 3D7NA 2MDTA 2PKYX 3HLTA 4FVTA 3DT6A 4MPRA 4ZVNA 4DG5A 1W4RA 1T1GA 1UEXC 1X8XA 2QVCA 1UC4B 3T3NA 2TSYB 2Z09A 3LC7O 4WDQA 4EHJA 3DA8A 2WF6A 3FPGA 1ZVQA 2OAGA 4YRZA 2WD7A 3WIVA 3R0VA 2ZUWA 4UOQA 4K87A 4Q48A 3L5KA 2IHYA 2PRJA 2I34A 4X93A 4XGRA 3I6IA 3WNZA 3PGA1 4YJ2B 3C7AA 3PIRA 4BNNA 2QP9X 1SUPA 2R96A 3OA0A 4LX0A 1T9BA 4XQEA 3EOAI 5TVKA 2Z8YM 1ZOSA 3ML1A 4EVQA 5EJ6A 4BAUA 3H8VA 3ZJTA 5DN6D 1NW5A 3TFWA 2UVPA 4M87A 1TVMA 1V6SA 1TJ3A 2EZ4A 4CM4B 5FBKA 2XCUA 3RANA 1UXOA 1YS6A 4XVRA 5SZHB 3SQWA 2J6HA 2V9PA 3CZ4A 2CMFA 3BGOS 2I87A 3AHFA 4RGYA 4YS6A 3QE0A 3RYCB 4D5EA 3CFFL 3IODA 1MRSA 3HXTA 3WO1A 3SYMA 3ETHA 3DXZA 3KZ1E 3VH4A 3M5DA 3WSVA 4QFDA 1TT5A 2YWEA 5FB3A 5H16A 3HDJA 3VTKA 3ZX4A 4F9TA 4C22A 2YH2A 2F3QA 1SVIA 1H1DA 1KDZA 5J2TB 4OFBA 2IE0A 1KYQA 4HVLA 1K0FA 3T06B 2X8JB 4YY3B 4XPZA 3KEMA 2ON6A 2OXRA 4C89A 4DMMA 1GSHA 3PWKA 4C07A 4EL0A 1RXVA 1LK5A 2RHGB 4MP3A 1TUEA 2IUTA 5CVVA 1H0KA 3ZZMA 4IWNA 4BYMA 1E3LA 2RBEA 1A4UA 4UOZA 4UQPA 5CEFA 4WAUA 1B6RA 4LJSA 2KI5A 2ZRAA 1RM0A 3IT1A 2JH8A 2ACWA 4Y6QA 4YJHB 4BP8A 2QTNA 1D4AA 3FB1A 3ZU2A 1OZGA 3FDZA 2GAAA 2Q3CA 1ZNXA 3Q8KA 4KG7A 9ATCA 5JJLA 4C0BA 1QDUA 1XNHA 1TW3A 3VNRA 5AESA 5A9RA 1C0KA 2GMWA 1OX6A 1VYHA 2QNIA 5HRUA 3I5MA 2CLOB 1DXOA 1KF0A 1Z17A 4I1IA 3QVOA 2K87A 4QOGA 1KEPA 3S2FA 2EZTA 4J0KA 4LTDA 5YASA 2HT6A 4C4YA 5GZ1A 1DL5A 3TLCA 4BTLA 3RSSA 1LF0A 3ZLBA 3UAWA 5GZ3A 2OORA 2CFSA 4Q5IA 4MW4A 2ZIEA 3N2ZB 3I5YA 4JT4A 3FSGD 2JATA 4BJ3A 1Y42X 3EGXB 4S05A 2RHWA 3MWGA 3PC6A 3KQVA 2LRHA 3M82A 4KE6A 3AHHA 3DLBA 1UT6A 4A0RA 4K9QA 1JKFA 4ENSA 1SOMA 3WBJA 3CEMA 1HI9A 4BVJA 4PGFA 3V1MA 4PO1A 1NRWA 1ZCBA 3UMBA 4LY6A 1B26A 3BAFA 4IXNA 4R3NA 4N01A 2Y27A 4RORA 4JZKA 1KZ9A 5BSTA 4HAVA 3VNUA 5HGXA 1UDXA 4J16C 3QTBA 4ARZA 5EE9A 2W00A 1M2VB 3NNDA 1HLFA 1LA2A 2QX7A 2ADMA 4UCFA 1N1GA 7YASA 3U62A 5JBIA 1FS4A 4TSKA 5ALRA 4ZTBA 4RA9B 1WVMA 1HFWA 1YB4A 2RH4A 5EHNA 3TBHA 1I94B 1ZJWA 1Z74A 3I8XA 2R0QC 2VBGA 1VHTA 4CRWB 2EZ8A 3AVYA 2R8RA 4KO2S 4IDHA 3KUXA 4EKDA 1VPEA 1ZJZA 1GPMA 1EFPB 4AZSA 1U9IA 2OCPA 3IUJA 5JH7F 5GVRA 3NB0A 2V98A 1EDEA 1JE1A 3MN1A 4HYTA 4R7TA 3DTYA 3IXQA 4I1OA 4RD4A 3SYLA 2AYYA 4JC8A 4ZXFA 1NYRA 2D4HA 3BCUA 2CDAA 5DM0A 1PK9A 1PJ3A 4GQBA 5JNUA 3HFSA 4ZO6A 4LN1A 4MB6A 2YINC 1WDKA 3PPVA 1V11B 3SVZA 5IKMA 2Q7XA 3WRYA 4NZOA 4BC1A 3N6XA 5LOVF 3O1HB 3S81A 1JXQA 1EXNA 3EQ7A 2O7QA 3KE9A 3P2YA 3RYHB 3GDGA 4CG3A 3M5CA 3JQAD 4GUAA 4M9UA 4NG4A 4OHBA 5DBIA 1R12A 2J9RA 3VJRA 1ZMTA 1Z0ZA 2YJ4A 3WQSB 3MUNA 4D9HA 3QW2A 3NPAA 1R0WA 5M5BA 1H4SA 2BFEB 3TTXA 3PXAA 3VZSA 1TK3A 2VOEA 1BMDA 1LPOA 2XZTA 4YJ3B 1V35A 5EPOA 3ND5A 1XZHA 3GUZA 2AT1A 3LCVB 4LOKA 3TZ6A 3WGVA 4KQWA 4P84A 1RFLA 4NPAA 3TO5A 1PR5A 1HK7A 1XTUA 3GJXC 1WKVA 1TIBA 2AXPA 2BI7A 4GYWA 1RTTA 4DCCA 1AV6A 2C4KA 3IE1A 3LG2A 3LQKA 3NBAA 1DEHA 3NV7A 3Q9SA 4XARA 4PNZA 2IELA 2AK2A 9MHTA 5BXQC 4NEQA 1J90A 3UGTA 2FQYA 2WF5A 3PQ7A 2PFGA 4KI0A 2GILA 2XE4A 3BGWA 3IHWA 4CUZA 1EWTA 2Q4DA 1IULA 2I8CA 5L51A 3AX6A 1HZZA 1MF7A 4KYIB 1JQEA 4PTYA 3RU2A 1JQDA 3JX9A 2Q1WA 4BO6A 3GJQA 5JS6A 4HWPA 1ZM4A 4X66B 3NDBB 1HG1A 4F06A 1VJ1A 1TO1E 1VCMA 2GVDC 2Q5EA 3ZHVA 2I0FA 4HYEA 4RE5A 1MEEA 1V8PA 2IBMA 3WNBA 1NBMA 1S9DA 1E6WA 3M6MD 4J03A 3OSZA 1UMBA 2F1KA 3ITEA 1QXSA 4P3KA 1X3SA 4RMHA 3TLZA 4WZAB 2OV8A 2YZ7A 2J59A 3DB1A 1JEQA 1YDMA 1Z7YA 1M54A 3GPDG 3P0RA 3QKIA 4QTZA 3CCCA 2GTPA 1O95A 2NMVA 1NVUQ 2AN4A 2LVBA 1IXZA 3VC1A 2Y6UA 4M86A 1AUOA 5D00A 4NU5A 4I3GA 5BOSA 1PJZA 3PFCA 4MH0R 2A7QA 4OB6A 2AR0A 1KXJA 3EDCA 1FYEA 4H27A 4RIGA 1QFMA 1T2FA 5DHRA 3RT1A 3EPHA 1KI4A 1YI1A 5EUQB 2BISA 5C4IA 4JYPA 4JQYA 2IYVA 2JGIA 4L3OA 2ZUCA 3P94A 4OYYA 2ZPUA 5EQFA 1E9FA 3ZXYA 1Y34E 2PS0A 1Y33E 1GGVA 5FNVB 1WJGA 2NU6B 3M70A 3OHPA 2CWDA 2J9FB 4M1EA 3U5TA 1EESA 3N0VA 1RMQA 1HEUA 5C5EA 4IW3B 4DR4B 2MU1A 1OSNA 3VPHA 4IOJA 5ALIA 2D1YA 1AKYA 3CVYA 4UVEA 2BMAA 2XQJA 2C9DA 3FJOA 1T6BY 4ANFA 4OKIA 1Z5GA 4JYMA 4UU1A 1SXJB 1V5GA 2Z5VA 3TW6A 4HMQA 1CT9A 4QDUA 1W1WA 3JAMA 1KEUA 2CNDA 5AI0A 3DVAB 4R9SA 3ZGVA 2ZE7A 4C2BA 3ISTA 4M22A 2AZDA 4OV6B 3U80A 5JQGB 2P5TB 1R74A 1ZH4A 5EWLA 4YRDA 3JYHA 3QVJA 2Y1OA 1XEXA 2QORA 3G9QA 3OI7A 3DS8A 1T36B 1IUPA 3F6YA 4G5XA 5KNLA 4OHVA 5IVDA 4LSWA 4B4UA 1S3SA 1AS0A 1BX3A 4RPHA 3ICWA 3BM5A 4GGPA 3V97A 3WDSA 1OX4A 1Z5WA 2C2WA 4H7EA 4CWAA 3LOQA 1NPDA 1Z0FA 3BWVA 3EIEA 3ZDFA 1CRPA 1MIOB 1EUDB 3LOPA 5BQ5A 5ALLA 2CMHA 2HRCA 2AMLA 2XEDA 3HWWA 3WA6A 1Y9EA 2IP1A 4L4XA 1PUJA 3TIIA 1ENYA 1ZQ9A 5GWXA 3ZNPA 4E31A 2XF8A 4HDNB 1YKGA 2GDZA 4FMPA 4TLCA 5HILA 1AGYA 3SR0A 2PUGA 2W6NA 1BE0A 1PDVA 1QOPB 5EXSA 1KTVA 1KRHA 1VC2A 4MA0A 4MS1A 3TZKA 1BDHA 1DARA 1TZMA 1BXRA 1Q95A 3FPCA 5FL7A 4BKPA 5CLLA 3O4VA 2ODBA 4BKMA 1LSUA 4J75A 3RFFA 1B73A 1SXJD 4RPGA 3BGDA 1WL8A 1XU4A 3DEKA 2C2ZA 3VKFA 3EEOA 5EMHA 3L8DA 2GZ1A 3HI6A 2NVUA 3ODPA 4BWFB 4MDHA 3KELA 4O4JA 4TN1A 1DXHA 1HE2A 1A4XA 4FQ7A 4YRNA 5E3JA 1KK1A 3QU9A 4J4TA 3OY2A 1LDMA 3CNQS 3C6QA 3MINA 4V39A 5EMLA 5CNMA 5IAJA 1BOOA 2UUCB 2VDWB 1B3RA 4LGCA 4EO7A 2V7TA 3CIOA 1VMKA 2ZP1A 1ZMXA 2XQVA 5GGXA 3IR6A 4LHZA 1MVLA 1RRVA 2VZ0A 3UF0A 5DWDA 1LF5A 4YRGA 4BZZA 3DV0B 2IPLA 2C3YA 1N57A 2OBNA 3MAGA 1DMRA 3PQ8A 2VSYA 4G1MB 1VE3A 4FLFA 4RPKA 5CGZA 1M0EA 3RTCA 1FQWA 2ZE5A 4WEQA 1W5FA 1N5MA 1Q3TA 2ZBPA 3EEQA 2RARA 4XDHA 1Q91A 5I8ZA 1I32A 5LQSA 4OHMA 5TMDA 5AJXA 3D9QX 5FOXA 3T9AA 3LPDA 1BKYA 3ASUA 4EI2A 4EKGA 3R4CA 1WW3A 1YCHA 4ILEA 2FTKE 2JEZA 4YDRA 4EM6A 2QAGA 3GP5A 3CUEF 3CFAL 4Z3KA 5AK3A 3FYTA 2QTMA 1TUBB 3LZ6A 4MWGA 4PPNA 1V45E 2COEA 3HKEB 4RACA 2VWPA 3KQTA 1YCDA 2XGOA 3VU9A 3FZNA 1WKCA 3K3PA 3O7MA 5FO1A 2IYPA 1T10A 2WHRA 4FHGA 4JDUA 5A9SB 1M7GA 16PKA 1UMCB 3LCJA 2WWVD 4ENPA 5JHHB 5AVTA 1G60A 3N2KA 2OT3B 5K3CA 5HZKA 2Z83A 4TM7A 5J4YA 3VJMA 1IZ8A 1W581 3OJFA 2ORIA 1HXHA 3IP3A 1QU2A 3ZZTA 3R75A 4DWOA 2EF0A 2GFHA 2XBUA 3R5KA 1HNZB 1XPUA 2X9LA 3ZXXA 2VPWA 1SBQA 3M9XA 2PO7A 4HZUB 4BVFA 2IA5A 4DBLE 1WB5A 2J46A 3C1UA 3A9VA 1R4ZA 1SUBA 2AUTA 1Q1GA 3KFVA 4TTPA 5COAA 4BLRA 2Q6TA 3IH5A 1CUDA 1S2IA 5IDXA 1XVAA 3MBKA 3S55A 2HSEA 4BGDA 3Q40A 5E8RA 5IANA 5BMVB 1NNSA 2QJOA 4WT7A 4XYBA 1O57A 4KMRA 4CKBB 3ZU4A 1C3EA 2HB6A 1PV2A 3TAHA 4GBMA 4CM1A 2X4IA 4BNVA 4UJ3A 2WWRA 3CJTA 4BNTA 5JD4A 3I76A 3F8WA 3CB2A 2QPTA 1CS0B 3CJQA 1PWHA 3C41J 1NUUA 2HF9A 1OYYA 1E2IA 1PP4A 2FOLA 3TIXB 5IF9A 3RNOA 2OV1A 1U2RA 3IPLA 3LLMA 2ZR0A 4CMGA 3RWBA 1WUIS 3SJCA 1JHRA 1TM1E 3JWHA 5T3YA 4AO6A 4INOA 3ZGYA 4GI1A 2EWVA 5GGYA 3RS8A 4BFLA 4FB4A 4NS4A 5IH3A 1Z2AA 5K5EA 3OM9A 1O58A 1SCJA 1Q0SA 1UDBA 1P3DA 4PW0A 2O07A 3T52A 1NF3A 2BGWA 1HLGA 1WMAA 5F9HA 3FN4A 4HSGA 3RDPA 3T34A 2Q29A 1KORA 1K8QA 2P5SA 1YZUA 1QIMA 2GT1A 1WETA 1NVDA 3BSSA 3BXEA 4P81A 4UXJA 2FW8A 3HB7A 5EEHA 2PLWA 1G98A 4LOJA 4LGYA 2I3ZA 4MJXA 4P5DA 4RVOA 4LTMA 3K0CA 2QQ5A 4M8SA 2HDNB 4F85A 1DDOA 1SZJG 5J2UF 1T6NA 2XGMA 4P5EA 4QGAA 5H9WA 4FSHA 2JLWA 1T0IA 3MBIA 4R2LA 1PGQA 4L0QA 1E2BA 1CRZA 1CY4A 1K7YA 1KO5A 4XLLA 2HADA 4A8HA 4FWIB 2X4GA 3G2KA 1H0HA 1O9BA 2FDXA 1OWOA 1M66A 2VCHA 3C5VA 2CNOA 4KXLA 4V38A 3U7QA 3EWAA 3EBOA 4DT1B 1J1UA 1YK0A 3JASA 2QLTA 1LUAA 3IVGA 3R7BA 3AZPA 1QGUA 4OI4A 3T0FA 1J9ZA 1XTKA 2EVWX 1NLZA 2PA3A 3I6QA 4OJNA 4TX1A 4U39A 1M33A 3KXDA 3V34A 4DJJA 3I6ZA 2BFBB 2GEFA 2OGSA 1LSOA 2ZUDA 5JC1A 3CO5A 1G3QA 4NZNA 1LRKA 3L41A 4CFYA 2GA9A 2BD0A 2WE8A 2DTXA 3ADPA 3M6UA 2G67A 4UVIA 3UXEA 3DOIA 3LP5A 4E21A 3ZDCA 2XY4A 4N8EA 5BUZA 1ZHOA 4ZZ0A 2IOHA 3LY5A 3NLLA 4A10A 3AEXA 1CETA 5L95A 1P29A 1Z6QA 3D59A 1GIAA 1QQ6A 3IFSA 5B4UA 5AK5A 1H42A 5KQSA 1SJ9A 1UBOS 1URPA 3CN7A 5JHGB 4KQIA 4C05A 1G3IA 4OBEA 4WKCA 5BNZA 2FNAA 1WXGA 4JC4A 5K4HA 4WK4B 3BE5A 4FGWA 4OP1A 4ZPJA 5DX8A 1KI7A 4CF7A 1JSCA 2JS7A 2R7MA 4EY3A 4IIYA 2YIMA 3EEFA 3QUCA 2BSAA 3MD9A 4B5LA 1AKEA 3FTEA 2QTBA 4KE8A 5DM2A 1IWBB 1X0XA 2WUVA 3EJWA 5K8UA 2FQQA 3AKDA 3OZFA 3RNLA 4C5CA 3FD8A 3PUZA 1FMJA 2P2DA 3KSRA 2GN4A 1T1EA 2JJ2D 3W9BA 1K06A 3WYAA 3RS0A 3GLFB 5F1PA 1JLMA 2I4TA 2VHEA 4JELA 3G0IA 1AS2A 1J39A 4EW3A 3TKLA 4TSFD 5CVDA 3TVDA 2CLLB 1ZH6A 2AEEA 2RGCA 1MFZA 4LYAA 3K5IA 4MVJA 4NU8X 4RM3A 2HBRA 3P7MA 4MV3A 4I9HA 3RWOA 2XRYA 1UT5A 2QG6A 3GD5A 2BBWA 1F8XA 3JD4A 3QIVA 4MJLA 3RRFA 3WB2A 2F90A 2RGEA 2XZDA 1H8EA 4I5GA 3ONNA 2MSEB 3F4KA 4OQZA 2QX8A 4HTAA 2RH9B 4E15A 2H7XA 3FNBA 2B82A 3H2ZA 3PUXA 4E2FA 5BWBA 3IKTA 3L8YA 3MRTA 2VHXA 3JQAA 2OG1A 4UAJA 2QLBA 1TPZA 2BR4A 4LUCA 4K6MA 2QEQA 3W6OA 1K0UA 2JGAA 5BT8A 2EKQA 4IMJB 4X62B 2PU5A 2H1FA 3M34A 2C9ZA 2B94A 2BGTA 3VV2A 1BW9A 1XZLA 1JTFA 4WJLA 2VQFB 2GWHA 3PNSA 1ONBA 2YRFA 2INGX 4QUIA 2NN3C 3F7OA 2IHNA 1IXRC 1EEHA 2GXAA 2R11A 2WT4A 1DQSA 1CB7A 1JWAB 2XNCA 3E8XA 3LW8A 1IUKA 1ZJ6A 4CLRA 2JAHA 1CQIB 3BXXA 5AICA 1HFJA 1NI4B 2UZ1B 2PWZA 4PAMA 5BV2P 5LQCA 2EGUA 1R9NA 1BHO1 1NVBA 2AFIE 1T2EA 2J4FA 3K20A 2IU0A 4BQSA 4CHTA 3R7DA 4LKRA 3IDZA 2DZDA 4MUNA 4UCQA 4CIAA 1Q77A 3AB8A 3AEKA 5IULC 1EM8B 4D3DA 4B9AA 4LWZA 4L8FA 1U5AA 4E3ZA 4MUKA 1EFVA 1U2QA 2A35A 3WP0A 1KJQA 2QD4A 3CLUC 5CDTA 1DQYA 4OJQA 5IK2D 1OB2A 4YUWA 2V7PA 1YZYA 3NS7A 1IQPA 1JI0A 1A7JA 2XMGA 1H93A 1MTOA 5TJHA 3UMVA 3CZPA 1U3FA 1UJBA 5CLGA 2MSKA 1VBFA 2GEDA 1A8QA 2OSVA 3PC8C 1GRNA 2PGOA 3S2GA 2ZWPA 1KMHB 1UDRA 3TRJA 3ZQKA 5KREA 4G8JA 1GTG1 4YAIA 3HM2A 1PNOA 2QX4A 5ER9A 5HIAA 5F33A 4I1UA 3T1NA 3VJKA 4RK1A 4J4BA 4I66A 2OHXA 2EFHB 1P8JA 3EQ6A 1QFYA 2JAQA 1QV6A 2KSQA 1CUHA 4ND8B 2O0KA 3TSZA 1J2RA 4YAKA 4K81B 2Z08A 2C59A 3PFFA 3B1ZA 2YCLA 3LQFA 5TARA 3R5TA 4P53A 1S2OA 5JJBA 3DQQA 3NTVA 4BEJA 3U37A 1NQXA 2CV0A 4KIGA 2G82A 1RAAA 5HF9A 1JDBC 5TQVA 1D5WA 3JVUA 3H1FA 4OH1A 2FZWA 4P6VF 2QE7A 4HADA 5IMBA 1PWXA 3AY6A 2CFIA 2HSZA 1G9TA 1Z8FA 2LTAA 4GM4A 5ALYA 1HNWB 3FWHA 3IKMB 2BKAA 1MB4A 4PLPA 2BGRA 3PU6A 3WISA 4XWKA 5HQ3A 2Q2WA 1MQAA 4BEWA 4I1SA 2ZJ1A 3N8GA 5AJTA 2O1EA 4BCDA 3LF1A 5K0EA 4EW6A 2OZLB 3RIYA 1HV8A 4UEJA 3RSHA 1T9CA 3FDXA 3RUIA 3S29A 4ARBA 5HBRA 1CRLA 2A78A 3BSWA 2PX2A 2OCIA 3EULA 3ISVA 1EJ2A 5A3SA 4BKQA 1AOXA 1RYNA 5CYFA 3PLAE 5BSFA 3FPSA 1FJHA 5G4LA 4X65B 1UPUA 4OXQA 2D7DA 1P7WA 1FVFA 2OHVA 1H6BA 3F6SA 3MZ0A 3QVVA 4B40A 2YOFA 1PNVA 4UTNA 1TM7E 3HO6A 4QO7A 5EGNA 5L3SB 4TUYB 2FU5C 2HT1A 5ESDA 4B09A 1UWKA 3SOZA 2MYNA 3RYFB 4EPYA 3LYLA 1S5PA 1N1MA 2QVXX 3VR2A 2VDJA 2R8ZA 3C70A 5LMCA 1YS9A 2JAUA 2OECA 3BTSA 1MGPA 4I4TF 5SYAA 3FR7A 2G04A 3GB9A 4M8LA 3ROKA 1O54A 2AFHA 4NBKA 1DC8A 4NFSA 4EDFA 5IM4F 2ZIXA 3G8YA 1G291 2VPPA 1BE8A 2FJPA 3WMGA 2OZPA 4ER3A 4B6FA 3U6KA 2QMHA 1C3JA 1I7PA 3HVHA 5T67A 3D81A 4P8RA 4ITRC 1JAYA 4Y2JA 4DDMA 2HCJB 3L07A 1GILA 4JI1B 4X3CA 5FIUA 4WOJA 3URMA 4F71A 3BWDD 4LYJA 3IP6A 5D8DA 1ZJJA 4LDRA 4UTVA 4RD0A 5IZCA 2BM9A 2Y1LA 5IJWA 2PU7A 5KVAA 1RAIA 3G2NA 4I6JA 4F3CA 2J45A 6ABPA 4E22A 5JSZA 2GKGA 1ZY2A 2NTNA 4ZQFA 3L06A 1ZW6A 1GAQA 3PPYA 2C31A 1E3QA 1QE5A 2ZG6A 3PKIA 1U9JA 4RNCA 5ALQA 5TMEA 5BRJA 1JFLA 1M1NB 3WK8A 3K1AA 3S44A 3Q5EA 4OSEA 4B71A 3BHJA 1Z82A 3ILHA 1A72A 2GPWA 3G6KA 4K9MA 4QPCA 4ZOLA 5G2OA 3NMUF 3V6MA 4GXRA 1O5TA 3QNUA 1IVNA 1UAAA 3AF5A 3IOYA 2RCYA 5DISB 6GPBA 4BMOB 2WPNA 4REMA 1V8FA 3A9SA 3FGPA 4WCDA 5SICE 5D3QA 4G4SP 4IFTA 4N3CA 3LHIA 3WB0A 5TY0A 1OAAA 5JZ9A 2G16A 1C7ZA 1C9MA 1T9GS 4ZYWA 3P2EA 3O91A 4HNTA 4CF4A 4BWVA 4W1SA 2UUBB 2RCNA 3CYFA 2J1LA 1QANA 2WIFA 3UXYA 5C8XA 1JR2A 1N6HA 2JIRA 2CXTA 2QTGA 4D42A 4JT2A 2ZIAA 1L5ZA 3BC1A 3EC1A 5K51A 2WAYA 3DL4A 3PDJA 1E8MA 3A32A 3ZCUA 2Q9AA 3MG9A 1Q19A 3EWIA 4JAVC 3SIXA 2GPTA 3SJZA 2GEJA 3ZI7A 1CE8B 3GT3A 3IIMA 2L42A 2NPOA 3FYHA 3VR6D 4P3OA 4RAOA 5ALWA 2J7KA 2M1XA 4K1LA 4Q7EA 4DTIA 2ASEA 3PRHA 4FNGA 4L5CA 3VR3A 5A4FS 4PZPA 2VSOA 5FBLB 5CB4B 4CN9A 3OF5A 1MX9A 4P5PA 2OSBA 2C98A 4LJKA 4BFUA 2AOTB 4PYNA 5K4AA 1ZEMA 4CUKA 1JKJB 1OREA 1JDJA 1F2UA 2N46A 2BJWA 2IUEA 3M7IA 3AM5A 4L8VA 3UV7A 2XUQA 1LI5A 3WR5A 2FPPA 1QIHA 1NF8A 1P18A 5DRTA 3R6TA 5FPPA 1ULAA 5AVXA 3B1XA 3MLAA 3CB4A 1NU6A 2YY7A 1OGIA 2ZGVA 2Q4TA 4WZBB 1JPVA 3IMFA 4JEIA 3O94A 2JC3A 4QU0A 2FCRA 4DEVA 1IY1A 5IMSA 3UMRA 2VPZA 3TF5A 3H9CA 1NHGA 1CHDA 1Y6ZA 1R4MA 3AL2A 4FC7A 4IVRA 1R66A 3ZE9A 2A54A 1JTEA 1XRNA 2FQXA 3EEYA 3A1UA 1ISIA 4PY2A 4Q4AB 1XNQB 3QV1A 2OBXA 4UVHA 3S1LA 3EYAA 1OYVA 4AZ0B 4ZMBA 1PFWA 4WN9A 2Z3VA 3DMRA 1JEYB 3PJGA 4IG9A 1QO0D 3ANSA 1WEHA 1T2NA 3QVKA 3WK9A 1BYIA 2Y9PB 2AC4A 4GECA 3DLIA 4W7SA 5JPDA 2YV3A 1THZA 3BORA 1C5KA 3VSEA 4DIEA 3KVVA 5EWMA 2JGDB 4KYUA 4P33A 2Z4SA 3D3EA 5AOAA 2UYYA 1IMJA 1GQ2A 3EF3A 4K5QA 2FPOA 3F6BX 2IYNA 4L50A 4R2XA 4UZFA 3ZY4A 3A9UA 3CSUA 4FJ1A 4RTLA 2V0GA 3L7KA 1ZA1A 3DZKA 2EBFX 1PAUA 5M3BA 3GUVA 4CM5A 2P41A 2COUA 3JQPA 3IAEA 1M5TA 2D59A 3LLUA 4IIUA 2HLPA 3ZV5A 5CA0B 3H19A 4TYPA 2J7PA 3EXHB 3V7FA 2R6GA 3A4LA 4BVEA 4DCJA 3AKYA 4BV8A 5FFMA 4G0VA 4A03A 3SHWA 5JNTA 3IBCA 3FNHA 3IP8A 5B58T 2X7JA 4GLLA 1V71A 2PT9A 3CS3A 4C6TB 1E3MA 2F1RA 4QNMA 2FP3A 3IS3A 1M7BA 3HY4A 4KDRA 4P7GA 1W5EA 2JCGA 5JZOA 3CJRA 3C5HA 2VAPA 3T5GA 4DZZA 3KYDB 2QTTA 2H11A 3C43A 2B37A 4MLDA 4YGXB 5FPYA 1GADO 3TZBA 2Q3MA 3G7UA 4HGNA 3UMSA 4QPJC 3WTBA 2IS4A 2EP8A 1UBEA 5FWYA 2B0CA 4X1IB 3KE8A 3AVXA 2YYSA 2FEWB 4QPDA 3NTOA 4Y1RA 1AK1A 4JB0A 4B8WA 2BEWB 2RBGA 3S27A 4OJYA 4H31A 1ZU4A 4KI7A 5DPMA 4MW1A 1HQDA 2I52A 1D1QA 1MEJA 2R1UA 1UZLA 3HWSA 3H75A 5F76A 4E11A 5BN4A 1TUGA 3N59A 3K9HA 5EA2A 4AZWA 2LCIA 1N2CB 4PGHA 5JCJD 4C04A 5IT4A 1JU3A 1QOQB 3BMCB 1K7CA 1YUMA 2DPLA 3H65A 1NQTA 4HNQA 3F6CA 4W8OA 5GV8A 1VIYA 2BMEA 2HF7A 2V7XA 1P8AA 5J5AA 5LMUB 4N3BA 5DOZA 2EDAA 3T7EA 1CNMA 2B3DA 2Q0HA 2JGEA 2VLBA 4WUVA 3FJYA 1KH2A 5HFNA 1Q83A 3B1VA 3GIDA 4QYXA 4EYEA 3I9KA 4Q7LA 1U0FA 3Q1LA 2AHOA 3KYIB 3ND7A 5JXJA 1UT8A 3KTAA 4J49A 5JCXA 5G2FA 5DNYB 3JAWA 4KW7A 1ESEA 4LDQA 4ZAXA 5ENZA 4F46A 1BS1A 3L6EA 2R6DA 1AZSC 2X0FA 5DGCA 3VNSA 4MKIA 4NARA 5DYNA 1JFFB 2W11A 2PS3A 3CU5A 4G56A 5KQRA 1NXTA 3GG2A 3L82B 1RJFA 1TLLA 2Y1WA 4O4IF 3FLBA 1OAOC 1VSVA 3U17A 2Q1SA 4DLUA 3RC8A 4TMWA 2EHJA 1BOFA 3A3KA 1Z7WA 4OYLA 4BFYA 2P9YA 1RYBA 1TYBE 3I61A 1E4YA 1NMSA 3LJKA 3Q5GA 3A9RA 4NCNA 2VP0A 1RXYA 3ACDA 4S1NA 4TZ6A 3NJRA 2GSWA 3HNRA 4FHZA 4REQA 3EIUA 3ZYCA 1D9ZA 5HHTA 1SB8A 1DRVA 1XNGA 3BKWA 3VHXB 3WGIA 4LZNA 1BSVA 4WA7A 4GPBA 5A4MS 1E1QD 2RHLA 4Q1VA 4EF5A 5BV1A 5CB0A 3TRDA 5CJJA 1JT2A 3WIDA 1M8JA 2WD7B 2QNRA 2H8GA 4LRWA 4BU0A 1USWA 4BFCA 1KE2A 4TS1A 1U0LA 3LRXA 4QZVA 5EL0A 2FUG6 3I6BA 1YGYA 3PD7A 1CP2A 1GYQA 4MCAA 2JAXA 1U2DA 4Y6PA 5K8JB 5J3JA 1L8LA 3H7AA 4H7HA 1V3UA 3TD9A 5EYPB 1NBEA 2V3CC 4YAUA 2FHSA 1ZXLA 1U80A 5J1SB 3E22A 1YBFA 3LLCA 4NF2A 3UFXB 1U1IA 2UVPB 2O7VA 4ZODA 4GOOD 4WGFA 4YMSA 3ZE7A 3NHWA 4CI9A 2I8AA 4Q3OA 5ALGA 3WGJA 2ECPA 2D1QA 2ZRPA 2REBA 4WE3A 1CB0A 1KYWA 4QG3A 1XROA 2Z3ZA 4NHEA 5C4GB 2PQ0A 3GLHE 3EG5A 1A2BA 2RMKA 1QCDA 4U7FA 2B7CA 1TAQA 4M8IA 1H9AA 1T6XA 8AT1A 3MWYW 4MRRA 4X8LA 1AHPA 5G0WA 4QUDA 2IQIA 3B53X 1R0CA 4XX0A 3ICQB 3LXUX 3ZC3A 2Y1FA 3WBFA 1HOXA 1FQJA 4FJ0A 1YB5A 2IXFA 1E94E 1ZUWA 3C3CA 3K05A 4I36A 1C7IA 3PQ6A 4NLLA 1HX7A 3INRA 3QI7A 2OXFA 4C4PA 2ATVA 4CL2A 4Q03A 1KY4A 3R6LA 1YKFA 3BRQA 4FE3A 1LZKA 5DI3B 4WBNF 4P3YA 5FTLA 4JEUA 2IXDA 1XP8A 3VDNB 4BQFA 5EPEA 2FWAA 3TZEA 3MK31 3RRYA 2JIZD 1D0IA 3HGMA 3PC7A 1M2OA 4KXVA 3THWB 1TGVA 2AOWA 2Y77A 1O5IA 4GBED 4V1CA 3A14A 3VPSA 3DOEA 1BNCA 3CW9A 5AHXA 4C7OA 1UBRS 2WU0A 3E3NA 2M9MA 4B75A 2FN4A 4MGIR 1L5WA 5HE9A 2HWXA 1AUPA 3B52X 5DNWA 3X43A 3HVRA 4D8XA 3NFYA 3P71T 1KO8A 1LV8A 1BVUA 2ZZKA 4W5WA 2C57A 3QMMA 3GJ5A 1J0EA 3IOBA 1GL6A 2N42A 3LC2O 3GDFA 4J7CA 4DMFA 4QGHA 4IOLA 5JO9A 1GAEO 1ZI8A 3UCXA 2H7YA 5MHTA 2PK3A 2I6TA 1NSTA 4R1MA 3K0EA 4XPIB 3W9SA 1BWPA 2ZRBA 2QVZX 2V7EA 3LUFA 5AK0A 1TE2A 3D0RA 3DLPX 4Y2GA 1R8SA 3A9WA 5K3FA 5LP6A 4URWR 2PQ6A 2H1IA 1FFXA 2GW4A 3KHSA 3QBDA 1YQTA 2E5FA 2VDUE 2Y99A 3NHRA 3CF0A 2VA9A 1CXZA 3GJSA 5HR5A 4BV9A 1EDBA 1W46A 3CR7A 1ZP6A 1OH7A 3NKFA 3QFTA 4J0JA 4BVGA 4CEIA 1P2SA 1U3VA 2WEKA 5ED4A 2JK1A 2W0SA 2NO4A 4I50A 5ITVA 2MINA 3D8TA 1E8NA 3EVAA 3FGZA 3H1AA 4KYTA 4QBKA 1R0KA 2OVFA 2VP6A 1G21A 1KAHA 1RXEA 2EFJA 2GTIA 4OHOA 1E8DA 1TTQB 4UHHA 3AB3A 4NR0A 3R44A 1S2MA 3TLBA 4KVGA 4OFXA 3TUIC 1INLA 2F9FA 4K8OA 5K3BA 4RSRA 1GA6A 2HWWA 2JI4A 2V7BA 4TRRA 1SH7A 2WVHA 4JU9A 1TO2E 4IYRA 3AKCA 4ZZ2A 3HP4A 1M1YA 3OLZA 5JG7A 2AZMA 4G4JA 3W6UA 1Y37A 2WKSA 1P9OA 1XEWX 3NTQA 1ISGA 4IIJF 4O3FA 3NTUA 3ZQUA 4B45A 1KC1A 1Y9DA 3NUGA 2JD2A 2H5EA 2IPXA 3F74A 3GZNB 1DKOA 3QHQA 1Y8CA 1E96A 3SJBA 4FBLA 1ZS9A 2ODAA 3COPA 3PV0A 4LZWA 1QS0B 1TYEB 2WAOA 4HAWA 3MWDB 3QM1A 4C3ZA 1G8JA 2C29D 4ZYLA 3L8ZA 3UHAA 5AH0A 4WXHA 3ZCSA 3GEEA 4ZPXA 3UA4A 4BMCA 1E61A 1RJ9A 1TZCA 1XJCA 2YHBA 1YAHA 2XR1A 3D7RA 3A1EA 3MGCA 3R8XA 2PSEA 2C1EA 3GG9A 5AVUA 4C1BA 1G7TA 2H16A 3HZRA 1MABA 5A62A 1MPXA 2J9XB 4PG7A 4CKEA 5C18A 1XJQA 3HCAA 3G1WA 4JLJA 1XDDA 1G20E 2P5UA 4FFOA 4RDHA 5GONF 1M6YA 4OMFG 1G2OA 2NNWB 2ZOSA 1XTRA 4KPEC 2O3QA 2NO0A 3PEFA 4WFIA 3HO8A 3VR5A 4K03A 5CCXA 1FMCA 2ATEA 3OKCA 2CW5A 2UZIR 2DWOA 2ZB7A 3ELDA 2ACKA 3A0UA 3Q3GE 4H6VA 3O2QB 1SC9A 3X1ZA 4NULA 3IMCA 1OPXA 5IW8A 4UHCA 3RB8A 2IIBA 4F1KA 2YFHA 3NV9A 3JQ7A 2X1VA 3TQRA 4EO4A 4MVJH 4EP1A 2BAGA 5AKIA 3I73A 5M2QA 3FF1A 3W1VA 3DFKA 1ODLA 5DBGA 3U49A 3L7OA 3GRFA 3KLPX 2O2SA 3HRKA 3M4ZA 3V8VA 1H94A 3FFTA 2WRZA 3A9TA 4PHTA 4EIWA 5JJCA 3GA7A 1JHQA 1WXDA 3KSDO 4MVCA 4KFCA 4IV0A 2O2CA 1UC5B 4GMXA 4L8YA 1I3KA 2DPYA 3BMXA 3H5AA 1QTRA 2K5UA 4Y0AA 2RGDA 2ZYUX 1UBGA 2QN2A 4FN4A 4GYJA 5KWEA 1U31A 1GGMA 4RYLA 3RFTA 1B93A 1Q3KA 3V1LA 1OT5A 2IPMA 2GR7A 1T5TA 2OO5C 2XUKA 1KFJB 4RKEA 1H2FA 3P27A 4QTXA 4D98A 3CGGA 2OP1A 3USCS 2X2EA 2FJUA 2W6IA 3NTRA 5GY7A 2J9ZB 3GYBA 2FPUA 4KR9A 1ZJ5A 2XXAA 1JEQB 2BM0A 2TYSB 3U3KA 2RAUA 1T2CA 2YMLA 3H2YA 3SLGA 1YASA 4PZZA 1XDZA 2WU1A 1HDZA 3JZDA 3FYCA 4WACA 4HNVA 5BN5A 4Y8VA 5JJIA 1HE5A 2IDKA 4D3FA 1LX6A 3CLHA 1BQEA 2FRDA 2LUOA 4W5NA 5ALOA 3MERA 4KZKA 5HZGA 3I32A 4EG5A 4FTWA 1AGNA 4NNJA 1CYEA 3IOEA 3FYUA 3B2EA 3EXIB 4GYKA 4O1HA 2J0EA 4C2AA 2XYHA 2I71A 2VUHB 3AL3A 5EJ5A 1CPYA 1K4KA 3ILSA 3VVLA 3DC7A 3E7PA 3TEFA 2HC9A 3S28A 2C9YA 3IPRA 2HTFA 3GJ8A 5TQ0A 4V0KA 4WUTA 1JEDA 3LP8A 1E3WA 2XD4A 1MH1A 2ZQZA 3DFZA 4L28A 1EVYA 3ROFA 5FEUA 4UNQA 3TTSA 3LV8A 1YB1A 2A57A 2GAIA 3DBHA 5FI1B 1SVWA 4Y6RA 3EOBI 4Q37A 5DCUA 5KSOA 4E7OA 3RPEA 2AFIB 2PMEA 3WKAA 4ZAZA 3OQHA 1ZIPA 4D9EA 3RGGA 1EHIA 1Z6TA 3GROA 3R7FA 4EMTA 4LNAA 4ZVRA 3UK7A 4MX8A 2GN8A 1VB3A 3EVZA 1EBFA 2AL7A 4OI2A 4BU1A 1KHTA 1X9GA 4R8LA 4FWBA 4Z99A 5EWLB 4CM9D 4V2IA 3ZVNA 1XEXB 3CFYA 1I5OA 2O19A 1ULTA 4KQGA 1N6NA 1SD5A 3TXAA 2JJ1A 4LIPD 5JALA 3KHUA 2Q5QA 1OX4B 1Q0PA 1FX1A 3ABRB 2CXXA 4Q24A 3U0BA 2YS6A 1Q1AA 4DWJA 4FR2A 1SCNE 4D56A 4UEQA 2Q1XA 3LIIA 4RWEA 2E37A 1IG0A 2NTYC 4B48A 4M21A 1L5FA 1ZOPA 4F92B 1U1FA 2CL5A 2XI4A 3F3KA 4S0XA 4EGJA 3PHBE 4ZVKA 2QENA 1ILWA 1MJGA 1J22A 1OXSC 2VRBA 2ZCUA 3HDQA 3TLKA 5ADUS 2GZ3A 4OL9A 5FTNA 1JGTA 4K9OA 1AKMA 4E5SA 1ABBA 5FFNA 4L4UA 2FFBA 1A9PA 1BXRB 1D03A 1MB3A 3ZU6A 2Z6QA 3KOZA 3IPXA 4R51A 1LPBB 1O08A 5HIKA 4RTQA 1P81A 4M9XA 2YMQA 1CIVA 5EN4A 3T3OA 2WTMA 3CZRA 4DR5B 1M6EX 2G72A 4JBNA 2NVUB 2WJVA 1F38A 2JKZA 3HRIA 3RIGA 3WMWA 3BXHA 1FC0A 4ERXA 1EDZA 3RT9A 2X0NA 4WNCA 4D8WA 3MINB 3RVSA 2GF9A 3WK5A 1P7CA 1V0JA 5KMGA 3K2QA 4UJ5A 2B21A 2ZRGA 3Q3HA 3TKYA 4X3PA 1JAIA 1QVWA 3A6GA 2XGSA 5FD8A 3FNGA 2NQ8A 2Q8QA 1ZGGA 3NOQA 5EJGA 4ZK6A 1A9QA 4JP3A 4E3WA 1HYQA 3D0QA 3T5PA 1V3TA 2FWRA 2PFSA 4QG7A 2IH5A 2QOEA 4YQYA 3DH0A 2EKBA 4JLSA 2KE5A 4GMDA 5FA5A 2A56A 2CLSA 5JCOA 4E03A 4MRPA 1XZJA 3HCCA 4LC0A 4HDKA 1DZIA 2EYUA 1OXKB 1TKCA 1XQYA 1TPYA 2OHOA 3P2MA 2YOHA 4TQAA 3VU0A 4NRDA 3ZHYA 5K3OA 1IEQA 4CKEB 1K3UB 3OKAA 4H1WA 3LP6A 2RONA 2OHGA 2ZVJA 5EC8A 2HNBA 3KRTA 3OPMA 2W70A 4GLFA 3QPBA 3BGVA 1T5IA 1ZHFA 2ECOA 2NXCA 1D0VA 1NJ1A 1RCTE 2VC2B 2WBLC 3EEBA 1P6QA 5CW2A 4U7DA 3I2HA 1DG9A 4NFHA 4NZMA 2GK7A 5CT8A 1EBBA 5DM70 5E7MA 2H18A 3BE6A 2OGWA 2HM7A 1ADFA 2JGNA 3CF4A 3HYRA 2IEDA 3IBGA 1G8PA 5FBVB 3FWKA 1V7PC 4J9VA 1N33B 5EP2A 2EZ9A 2H4XA 4FYPA 5LN1A 1NAIA 3RIMA 4E5PA 4WXRA 1U9YA 4TV8A 1SVOA 3ZY5A 2GYVA 3K4QA 4YRTA 1N7JA 2OCBA 3NYWA 4PPGA 5MDHA 3I42A 3R3HA 3GAAA 4FGLA 1XXHE 1EBUA 3OD5A 4Q3CA 2HDHA 2QIOA 4U7PB 4FX5A 5F35A 1L5GB 3QV2A 1L7PA 5L7TA 1VRVA 4GPIB 2ZSDA 2PKEA 2NQ2C 2AK3A 4FPXA 3ZE1B 1RWKA 2B30A 2CMGA 2NZXA 4N0EA 1C3OA 3I72A 1L4UA 2E0IA 4C78A 2ZYIA 2OENG 2PHZA 2BY4A 3LQYA 1AQIA 2P35A 3OG9A 4MHSA 4XA8A 3QEAZ 1MGOA 3LYAA 1CDEA 3LA8A 3PJDA 3I5AA 1BEEA 4H7DA 3Q7PA 4FMCF 3HLYA 3NVKI 1BGXT 5DSZA 4BGVA 3FA2A 1RWPA 4JLKA 4QECA 2GHRA 3RABA 3UB3A 5I4IA 3OOHA 4PVCA 5C7OO 1TRHA 5AW6A 2C5BA 4B2YA 1EM6A 1W4LA 2ID7A 2IYYA 2BV3A 1CZKA 4MSUA 5CEJA 3UUWA 4Z2YA 3AGPA 4D3SA 1WCIA 5BP7A 2RAFA 3PIDA 4WL0A 4F93B 4BO2A 2NU7A 3D31A 2H00A 3EZ9A 3PR2B 1L5SA 2X23A 4JGIA 3ZWAA 5KC8A 3WGLA 1IXKA 3ZGZA 3MOSA 4QRDA 2NV2B 1U7ZA 2GCGA 2GN2A 4BB9A 2O8CA 2DKFA 4YRJA 3CZCA 3KL2A 3PNVA 4R05A 4WK0B 5HKKA 3J80A 3EY9A 1NE2A 2QM8A 3S40A 4HXGA 4AC9A 4MICA 2WIAA 5B30A 5K0BA 1HDRA 4FGKA 4L15A 2NT4A 1VQ1A 1FFHA 1C3LA 1GDHA 1JZTA 5FUVA 1LNSA 3UHPA 1HM5A 3Q6IA 1MX5A 2JLXA 3S8EA 3UXMA 2DE0X 1QCZA 1JNYA 2OC9A 4YDSA 5E3HA 3DBRA 3VVCA 1JQLB 4EZIA 4UD2A 2BCJQ 1NVTA 2Q5IA 3VOSA 3FPFA 4HP8A 2YIDA 2YNMA 4IEFB 3IPAA 1G8FA 2VEOA 5FOUA 5F98A 1D2NA 1VGRA 1QGUB 2GETA 2O2YA 2ADFA 5FLKA 3TSCA 4R8VA 1GLGA 2NLOA 1OR8A 4B76A 4ENWA 5JASA 2YFQA 1J49A 4P4SA 4CIXA 3KK0A 5FORA 1COZA 3EDQA 1WTAA 1KL7A 1QK3A 5B1EA 1U3UA 1MC5A 2DBRA 4QM6A 4OGWA 3OQMA 4URZR 2FHPA 1FEZA 1FDSA 1XAHA 2H0AA 2YASA 3H2KA 3NBUA 2EX0A 4O2RA 5HS6A 1KS2A 3DOUA 1E77A 3E61A 1ZN8A 2C8KA 3HCNA 3TVYA 1PFQA 5HCIA 3SBEA 1EXMA 2WT9A 1VHQA 1Z2NX 4P1ZA 3TW8B 3I5UA 3ENNA 3HA2A 3WB9A 2FN9A 1HE1C 2VRCA 5HG0A 3AINA 3BMOB 3OOWA 5LZ2A 1XPRA 1RXCA 2CFTA 2HK7A 2YVUA 2PLAA 3FWZA 3ONDA 3QKRA 1WF3A 3GT0A 3NAZA 4ITUA 4LNUA 2IITA 4CQMA 4HB4A 4FNMA 5B4TA 2P2LA 1MX1A 2WFLA 3LKVA 4JOBA 1MCZA 1NV8A 1RQPA 2CJWA 2FB9A 2XUFA 4MYHA 2FWJA 4KR3A 2GEKA 2GSDA 3IAXA 3L01A 5K01A 2O5RA 3BRWD 4CVNA 2XNDA 5CRIA 1E98A 3QLEA 2NTEA 2ZBEA 3AHGA 5K0CA 1LPSA 2ANCA 3TQTA 5F5LA 1PWEA 1X7ZA 4G0NA 3RS7A 1E9BA 3AR2A 3SM9A 4YRMA 5BR4A 3QVSA 2IYTA 3S5UA 5JBNA 3WGZA 4HN9A 2VF7A 1VLLA 3OY7A 1CJTC 1OFUA 2IOYA 5ITSA 4F4CA 4FSDA 3WQQA 4CF6A 4MQFA 4C3UA 4GU5A 4KQHA 4LVOA 5I9TA 1O4VA 2P9ZA 2YFKA 3FFWA 3V3KA 5EAIA 4OSPA 4JNCA 1J8QA 4ILKA 1SU6A 4KN5A 4F45A 1LK0A 3MCZA 5JUWA 1Y6JA 1PEDA 4WK2B 1EAMA 1EWRA 2NAPA 2GLXA 2GFQA 2PZBA 3D6FA 1DELA 3OFSA 1P5HA 4HC4A 5IJ0A 4KNYA 1EK2A 4LJ4A 3C7CB 1J42A 3WBKA 3QELA 2DC1A 4LJAA 4Y2YA 2RG1A 3F6RA 3ZKWA 4CLRB 3IUPA 1CUFA 2R7LA 1EZ1A 5MGNA 1VLQA 4BLOA 3L04A 1Y7PA 3CLTD 1UEIA 4IO1A 1RQXA 4WEOA 1CR2A 1G0OA 1TD1A 2BEVB 2WMDA 1F20A 3AEKB 3D2LA 3L6BA 2P9GA 4R4JA 4V0LA 5EUBA 2Z8XA 1AA6A 1UAGA 3I39X 3IMGA 4BX8A 1LBHA 2Q3EA 4G8BA 4PZ0A 3EVFA 1TJYA 1BJTA 5JAOA 2V8BA 4AUNA 4DBZA 2AN5A 2AEJA 4X6XA 2AMVA 3W77A 1PJ2A 1B0ZA 4NV1A 4F56A 1D3AA 4PSVA 4EZEA 2HIHA 2A5FA 1L4YA 4RCZA 2FPKA 3P9ZA 3RS2A 2FETA 2ROQA 4B7CA 4DDVA 4X8MA 2PD6A 2PQ2A 1M34B 3IEUA 3NH9A 2ZTUA 5DIFA 5EIAA 1S4QA 1YQXA 1AGRA 1JMYA 1PQWA 3H9JA 3ZE6A 1QG0A 3EARA 3I53A 2XUPA 1P73A 1U3CA 1JG6A 4PLYA 2M32A 5B37A 4P7FA 3HJFA 5FQOA 2O3JA 1QGOA 3OEHA 2FZCA 1FVOA 5HP4A 1GKUB 4KQMA 4IDAA 3PEYA 5KNDD 4YI3A 3I64A 4EEZA 3ISJA 2DQSA 4G5HA 5ALJA 2WJYA 4LFCB 2IBSA 4BVHA 5I9SA 4R9VA 1LC0A 3IPYA 1SWVA 4OXXA 4Z1MA 3VI3B 3KPVA 2VYQA 4MKFA 4QYSA 3T3MB 4XGIA 3K16A 4YREA 5KYXA 2CE2X 3GPLA 1I3NA 1CJCA 2PT5A 4DIUA 1JHAA 2QN9A 3MTJA 1LPPA 4RF3A 4UXIA 5KZMB 2D8MA 1K5PA 3A2LA 3RBXA 1PJAA 3HL4A 3ORRA 1YRQA 3W2IA 5D2CA 3HVUA 5MN6A 2ZR7A 3WK4A 1JP7A 2ALJA 3T1VA 1E0DA 1SKUA 5BSHA 4PBSA 1QF9A 2H5LA 3RSFA 3DLTA 3U4QA 2D3TA 2R2GA 4IZ6A 5K45A 2CZQA 3ILVA 4WZZA 2FVXA 2WHQA 2MJLA 3OJXA 3GVPA 4L72A 1VL1A 4XM0A 3ZW7A 4BJ1A 1KPGA 2XOEA 5K2OA 4IP0A 4FXOA 1VLMA 3EZLA 3MPOA 2Y2VA 3QXJA 3KWJA 2OD9A 5CFOA 4L7VA 5T64A 2R4QA 3SZOA 3O9MA 8ABPA 5AJYA 3LF4A 1KKMA 2GASA 1GRQA 2NZ2A 3HU3A 3LPNA 4NEHB 3KKQA 4HJXA 5JMOA 4P31A 1QRTA 3DKKA 3OU7A 1K92A 3GLHB 2VCYA 2AD1A 5KO2A 3OO0A 4IL5A 2B4TO 4RHTA 3PUYA 4AP9A 3PUHA 4EPVA 2I65A 1W5BA 2ZYDA 3GI1A 4EEKA 1C7FA 4D4GA 5H5JA 3A6KA 1WPXA 4CODB 5EXXA 1E2NA 4QSMA 4X94A 1FDWA 3T3DA 4AK9A 1OVGA 3RJTA 1NQ5A 1QZ3A 3KXLA 2ZIXB 4QXQA 4BO7A 1UXKA 2PUHA 4V0RA 3SHQA 2WYHA 1L7RA 3P5SA 5CNJA 3UMYA 2RDMA 3O93A 1CVRA 3R3WA 4GS5A 2V0CA 4GI2A 4O4HA 5B1HA 2OAP1 3GGGA 4I14A 2W8ZA 4C29A 1GQSA 2GK3A 4DIFA 1YTLA 2PNJA 4C0AC 4AJLA 1PVOA 4FI3C 4MS3B 1PD0A 3ANMA 3JY6A 3EB9A 3DW1X 4YTEA 1YR6A 4KOAA 3AY0A 1IATA 3JALA 4MQ6A 1ESZA 3LDAA 1RT9A 2D5AA 2VSNA 1X7XA 3EFHA 2H0RA 3HU5A 3M5PA 4IWXA 2D54A 4U2KA 2WHPA 3SDZA 1VHJA 2VYCA 1DOAA 4QJ4A 1T4CA 2P62A 1L4NA 1R4NA 5K3EA 3A1DA 1WHSB 1FY2A 1XTPA 1TF5A 2SKDA 2ZBGA 3LBNA 5KYKA 4YT2A 4AMZA 5JR3A 1ODJA 4TXLA 2X5XA 2IU6A 2OGFA 2FUNB 3LC0A 5A4JA 4KAXA 3WHIA 1TZ2A 2Z04A 4BV2A 3QXGA 5JW6A 3C3YA 3GWGA 2WF9A 2HV9A 4EGFA 6Q21A 2PZKA 3ROTA 4RKRA 1BHJA 4UHDA 3Q7IA 4TTVA 4B6EA 4UBKA 1HEYA 3LFUA 2O2XA 1OZ0A 2ZVDA 1BQ3A 3ZEAA 1TFUA 1YE3A 1FIUA 4QOFA 4MKXA 1NKVA 2F59A 3T7KA 2J67A 2A0FA 2EU8A 1P60A 3U7JA 3R40A 2P8JA 1UCFA 3O2NA 4PZYA 2IE8A 2VDOB 1MO6A 4B3XA 2XPCA 4G85A 4MEAA 3CZQA 3L7YA 1JG3A 4YCJA 3NHZA 2IHBA 4YO7A 2RKWA 3IQIX 3OICA 4IJQA 3PUWA 1SZPA 2WUWE 1XLTC 2AOUA 2RIPA 2PANA 3WL5A 4F2GA 3EEIA 2X0DA 3RVKA 2ZYTX 3FI0A 4DLRA 3C2QA 5CXUA 2IUSA 1X7WB 4KBGA 5F2KA 3WNVA 3RKSA 5KYNA 5HW0A 3I01M 1THMA 1KIAA 4KSCA 2A9OA 1RW4A 3TZQA 3IYLW 4TTJA 4KQ2A 4OQNA 3D5QA 2C2KA 3QEMB 4CTNA 3ZGXA 1Z8DA 1FVHA 2N1BA 2H2DA 3P9CA 4ESVA 1G6OA 3CKLA 3MT0A 1OFIA 1WWKA 5AK4A 3U3ZA 5FOVA 3VR5H 2DHRA 4K6KA 4DIOA 1LI4A 3NHLA 1JDZA 3DMFA 1T5LA 4FHDA 5JAZA 4HGPA 1G7CA 1E1NA 4HCJA 4YXWA 5F1KA 5I4KA 2EC5A 4DCGA 3C24A 2QSZA 5A6VA 2JFGA 3K8OE 1QMPA 1SVLA 1T2VA 1MQSA 2FPPB 2BGKA 2O4UX 4PR0A 3WLRA 3L9WA 1AURA 4DKXA 3MS7A 4P2GA 3T4XA 5I3ZA 3ZDEA 3V1UA 5M34A 3FUWA 4S3MA 1MAAA 3FHCB 4JXZA 4C0KA 2HN9A 3K5PA 2YC2C 4YFYA 1G64A 2XYRA 4OHRA 3NWPA 2DLDA 1EG2A 2G1PA 2ZKIA 3EQ8A 3LXMA 4BXOA 1NVAA 1KEVA 3H4MA 3VR6H 1G20B 3GUCA 4QKQA 1YMUA 4PZDA 2ZB3A 3JWEA 5EVCA 2YV1A 1EWQA 2A59A 5KVSA 3DHVA 4NCIA 3F67A 3PEVA 2GZRA 3Q7RA 1G3UA 3C0KA 3E2PA 1NDQA 4Z7JA 4XSGA 5LYYA 5KTKA 2BT4A 2WP0A 4FI3F 3BIWA 3RUDA 4DDWA 4H3VA 3N2NA 2ZJ6A 4B79A 2QPOA 1G5RA 2H85A 3D5TA 3LWZA 1MW9X 2I54A 1C9NA 2PX5A 2DQKA 3NAGA 4IZHA 4V0ME 1V3QE 3H9EO 4C9BA 4QGSA 5JEDA 1T0UA 4O5OA 2PVCA 5K0NA 2OKCA 2VDRB 1IQRA 4P32A 2ZIGA 1N9GA 4WSOA 1A82A 2DJ5A 3Q12A 2P9QA 2IU3A 3EDYA 3SS7X 2VUIB 4D57A 4GMFA 4X97A 4U00A 4WJZA 4LE0A 1FS5A 1MO4A 1HKUA 1UWCA 1XD8A 1K86A 2J4CA 3D1LA 3JTEA 3KTOA 3O26A 2RB4A 4WXPA 4X95A 1ZO8A 3R5JA 3R9KA 4ZOQI 4JASB 4ZV9A 3H4TA 2XMDA 4DLXA 1TCUA 2V97A 1FUUA 1K2WA 2WHXA 4HSEA 5HF5A 1JL3A 1UKAA 1PGPA 2R00A 3HJHA 3I2FA 2B5OA 5DYYA 5KKCA 3TG8A 1IB6A 1VYUA 2CNWD 4LNHA 5E9QA 1OJLA 2QR3A 1QFZA 1II0A 2HMVA 1DX6A 5E6SB 4E7PA 4EMSA 1XRJA 2I7XA 1ULHA 2XOKD 4YP9A 1W1UA 1HC7A 3NC4A 2DF8A 1HDYA 3H84A 3N9IA 4PFSA 1G17A 5L45A 1WXFA 4Q12A 3AI2A 3QNWA 4MRAA 5EIOA 2HJWA 4Y1RB 5CLIA 3EF0A 3DTVD 4G86A 4NESA 2EBUA 4U63A 2ZUTA 4DCUA 6PFKA 2HCTA 2QLFA 3FWPA 2YYAA 1U2ZA 5TVGA 2WPDD 4FOSA 1F1BA 2QRMA 4QEZA 3OTQA 3SVLA 1NXXA 1SBIA 1UXHA 1XZCA 3ERCA 4IRUB 5BT9A 4OQPA 4MDFA 2W2OA 2MCFA 3RTAA 4D0NA 3C5CA 2QBYA 3WS7A 1AIPA 4TMXA 5C7IO 1VKOA 3V8EA 3R2JA 4DCNA 1M3SA 3NT5A 3O47A 1ISPA 1ZESA 4OH7A 1F0NA 1XDUA 2G25A 4RPIA 3RK0A 1B15A 3ZHZA 1Q1BA 3QPVA 1KE1A 3K0FA 1SNYA 1YE5A 3JR3A 4NCHA 1XTIA 1Z34A 2ZWMA 3DUFA 3H5WA 5LSAA 1SVUA 1JEAA 4IXWA 3LUHA 5CLQA 2FX3A 3JQ9C 4RV4A 1N92A 4ADSG 3D4PA 3VU3A 1XU9A 4PE5B 1U98A 3FG9A 2UUPA 3PUKA 1IN5A 3NDJA 4RQUA 4RZHA 2CNNA 2G9QA 3LBAA 4RTOA 1Y6RA 1QZTA 3B7WA 3LWDA 2F8MA 5IAKA 5E7QA 2GF2A 1SQ6A 1XRPA 1KEWA 2IC5A 2NXWA 1IMOA 3AVPA 3NHKA 2ZTLA 3PA6A 4I2VA 4MVWA 1PQPA 4DPLA 1UZNA 5BVHA 4QM7A 2BKXA 2FMIA 3INNA 1GGEA 3DF9A 3WWYA 1G42A 2E3JA 4ALNA 4AMUA 1UH5A 3CFHL 3EAQA 3F78A 3P5BA 5AHWA 4QYIA 5DNAA 1D2CA 2ZDHA 3ETDA 4C4XA 4AN1A 4YRIA 4ZYXA 3KQKA 1XAGA 3NAQA 4RENA 4KGXA 4RPJA 4REQB 4LHEA 3GFTA 3PZBA 2IZOA 4ES6A 3TX2A 3U9TA 1V9SA 1YR3A 2G5CA 1YCFA 2H3HA 3MCUA 2RE8A 1EIWA 4YMLA 2NSYA 4H15A 4F11A 5HYVA 3SIWA 2QTRA 3UJ3X 1JKIA 4X60A 4ABYA 2FN7A 3NDRA 1CERA 3CUWA 3JW8A 3KFLA 2AG0A 4QBFA 4UCWA 4RTMA 5THXA 4D96A 4E46A 2Q2VA 1C0EA 1YQGA 1Z35A 4NJMA 1GA4A 1WP9A 1V8DA 3O1JC 3UK1A 1J0AA 1CY8A 3HLKA 3TLAA 4JMPA 1PZNA 4OX9B 1H9BA 1TVKA 1CQPA 1MA3A 3EVGA 1JLSA 1T24A 4HDRB 4U9UA 1LZLA 1VLHA 2AWOA 3GLIB 3KR0A 4N3NA 3REOA 2E89A 4YBZA 1PSZA 3K4PA 3SE7A 1DX9A 1Y8AA 2HA0A 3VISA 5K6AC 2PYIA 4X1OA 4ENUA 2YV2A 1S96A 2PWAA 2VTDA 2XMRA 5DX0A 4QUHA 3MWLA 1KWGA 4PC1A 3TTTA 1GDDA 2HK6A 4MI9A 4NICA 4JYCA 3DZGA 3MAJA 2IEBA 13PKA 1DADA 2FPXA 4L8WB 2JB9A 5INTA 5F1YA 2I6GA 2D5LA 2V6IA 4YRRA 1DHRA 3COYA 4TTAA 4B3CA 4M9RA 4MKZA 3QVTA 4L4ZA 2GPBA 2JIOA 1GPKA 1PSWA 4EG1A 3A3OA 3OTHA 1K4MA 2L19A 4HB2A 5BR8B 1DJNA 3U4CA 4U2CA 1WB6A 2QL7A 3PIIA 4HJRA 4E5NA 2E49A 3SLKA 3TR5A 4OHKA 3EFOA 1L1QA 2DLNA 5FPHA 3LSTA 3WGGA 3KEGA 1RHMA 2C3MA 4ID9A 2FRXA 1B8UA 4HQLA 4AG5A 3IUEA 1G6KA 2XWPA 1CX9B 1MTZA 3JRWA 3LUJA 3UAXA 1VJDA 1KFCB 1U7DA 2WWFA 5IHXA 1TJ4A 2KBEA 1T1SA 3NWEA 3RCBA 3SMQA 2BN4A 4LXXA 3OFKA 5A3VA 3GCDA 1S8OA 5EHXA 5HRCA 1WV0A 5SV2A 3U3JA 1E2GA 2YY5A 4XB6B 1XEAA 3UIEA 4CKCB 5FJJA 4NVRA 4CIDA 5EJAA 5FX2A 2E18A 4OGFA 1J4AA 3LE8A 2H2GA 3N0TA 4LRQA 3RRXA 3ELBA 1ZVMA 1IPHA 4PX9A 2G76A 4DSNA 2PBFA 4UUNA 5C51B 1I9CA 5BMOA 5I6DA 1I13A 3I0ZA 2WP8J 4KQ1A 2M6LA 1Z0DA 2VSQA 2IH4A 2CHFA 3DPSA 5EJ9A 3RLIA 1Y3AA 4KREA 1XXHB 2RHOA 4DA8A 3ZJVA 1U0EA 1ND5A 2XZLA 3TIVA 3VZBA 1Z56C 3FTFA 5K3FB 5I9MA 1SR8A 5LP6B 4EUHA 1N3BA 3B70A 4IUYA 5GV7A 2PBZA 3GT7A 5CT5A 2C78A 1OLXA 1VBKA 3W7BA 4RD1A 3O92A 4KDEA 4AJOA 3WGHA 4WI1A 4YRCA 4M7RA 4CG0A 2GD1O 1PD1A 3DAFA 1C8BA 4HRAA 3RJ5A 1WVGA 2QPAA 3CXRA 2EJCA 4R5HA 3QKTA 3OVMA 2XCLA 4MYCA 3DDWA 3LM8A 3SNKA 1N2SA 2ZBVA 2C3OA 3LHSA 2Z95A 3A6LA 4FMDB 1UDWA 2UVDA 4TKZA 3CM0A 1G21B 3DQPA 3O0TA 4AMGA 5KTRA 5LD2B 1NBWB 5E4FA 2QU7A 3C8MA 4S1PA 2X1MA 2IV3A 2R6AA 2XZOA 5B3JA 4RSHA 5EJ2A 3BN3A 3V1KA 5CTAA 1B00A 1TMKA 1VFNA 2WKQA 3L84A 3OA2A 3RF6A 1M1YB 4A2CA 1MENA 2VYND 1C1DA 1FUKA 3CEJA 1DBWA 3ICCA 2PIAA 2FUKA 3PRYA 3M1LA 5HA5A 4AM8A 1NT2A 2X4DA 3A7EA 4A8TA 5CW1A 5KYYA 3EMKA 4PO9A 4YV1A 2QK4A 1SXHA 2HU2A 4RS3A 3T12A 3T61A 2PUCA 2CCGA 3DE4X 5DK4A 1KY5A 2QD5A 4WH0A 3ZK9A 5IYZA 4JYAB 1U8ZA 2AKAB 3DZ8A 1JHPA 4CJXA 6LDHA 3DYIA 3Q8MA 5F7OA 1XTJA 3ET5A 4WLNA 5KVVA 4M99A 1KY3A 5ICMA 1Z0KA 5DASA 3R76A 4OA5A 3T5AA 3F7TA 3HDYA 4NYMQ 2ZJ2A 5ICGA 3DEZA 2WHYA 3G9XA 3E9ZA 3QBEA 1CUUA 1ORWA 2PTGA 5G3ZA 1P0QA 1SXJC 2EJUA 5EXDA 1UPCA 2VHWA 1OA0A 4OATA 4XJXA 1GPNA 4PEVA 4RZSA 1WF6A 4R54A 4BJ5A 3BSFA 5FOTA 3KKNA 1NSYA 3R3JA 4AJKA 1ND6A 4OX9Y 2IWHA 3A4TA 5IF3A 4DMHA 3P32A 2H6EA 1FXWA 4L4RA 4ZRMA 3EMOA 3OP1A 3BJEA 4YV0A 2WKRA 4E2ZA 1JJ7A 3JR7A 4US1R 1Y7LA 1LB1B 1XN4A 3JQ7B 1NQOA 5ER6A 5CXQA 4IMPA 1R9GA 4FSXA 4NC9A 4B83A 3G6WA 1T2UA 1V9CA 2NG1A 2X14A 3TLXA 3AR5A 1WMEA 1PT5A 2Y6VA 3OQIB 4OHPA 5ALKA 1P1IA 3TUJC 3CTPA 2PGDA 1NF9A 4DG8A 2GCOA 1EP9A 1R0LA 2BUBA 3S1AB 3MTQA 1S7GA 1CRWG 3KWFA 1EJ0A 2BF4A 3PHLA 1WMDA 3PQFA 4KPUB 3V8MA 3X3HA 4C0QC 1TQ2A 3OPQA 3QLUC 4ZV7A 5KOYA 1D7OA 1YUNA 1P0FA 1E66A 1SK9A 5BUQA 1DWOA 3N86A 3VKWA 1ZKMA 3H5LA 2YDYA 1S2DA 2NSHA 1GZDA 3M9LA 4JLBA 2BKLA 5COQA 3RJMA 1N36B 4A27A 1T9ZA 2DWUA 3ICPA 1P1KA 2GCEA 3F6EX 4QAQA 5G53C 1BHQ1 2ORYA 3PPXA 3VKGA 4YCLA 1U1EA 2OBMA 1AKNA 3R7AA 1IY9A 4Z0HO 1DPFA 5BPHA 4FQ5A 1BKDR 1JEOA 4N82A 4CFZA 5KQMA 2D74A 1I1NA 5D3KA 1V96A 4ZD6A 2J4DA 4A4DA 4RX1A 3A04A 5TGZA 2F3RA 4NXMB 3L02A 1UIMA 3K92A 4BMPB 4OAPA 4L6AA 4AWXA 2IEAA 2ZVQX 5BW6B 4CCAA 1I7LA 3VX4A 1DV2A 4OUDA 4X64B 3QFCA 4YR9A 2WU3A 4G67A 1Z6ZA 4JFRA 1XKLA 1PRYA 3PCTA 3IQGX 3DVLA 2EBHX 1KVRA 1E6CA 4ZQIA 1TAHA 1ZDMA 5M29A 4UHBA 3DHYA 1OT3A 2LR0A 4KOEC 4XRGA 5IKPA 2VG8A 3LDHA 3GJ7A 3ZR4B 5DYGA 3REQA 5TQ0B 3GPIA 3KZCA 1WQ4A 1XHLA 3H16A 1VTKA 2B1RA 1N25A 2EKPA 2J0SA 1ZLYA 1ZK0A 3DBHB 3IHKA 1VIMA 2O8DA 2CV2A 3LU1A 3KPUA 1IBMB 1VLJA 2BFDB 2EJBA 3LZDA 1L5HA 1QOZA 4D0GA 1T9GR 3VFDA 5JXHA 3F5SA 2R87A 4H1UA 2VAVA 3GOHA 2WD9A 4GEGA 3ZHQA 3QVGA 1ADBA 1KGDA 2D7CA 5FNVF 1HF3A 2YWHA 1BVHA 3HB4X 2YBEA 3QWIA 2LXNA