3IOBA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.80 ang resolution in complex with 5'-deoxy-5'-thioadenosine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
287
structure length
287
Chain Sequence
b'IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
molecule tags Ligase
source organism Mycobacterium tuberculosis
publication title A Fragment-Based Approach to Probing Adenosine Recognition Sites by Using Dynamic Combinatorial Chemistry
pubmed doi rcsb
total genus 93
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3iobA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3iobA01
5K0SA 4MWEA 3NBKA 3VGJA 3CLUD 2DERA 4EG6A 1X6VA 3AFHA 3ND6A 3MUEA 3QTTA 2IP1A 1NUQA 3NV7A 1QQTA 4MW0A 4R2LA 3P0HA 1OWOA 4YBRA 1J1UA 4AQ7A 2JAXA 2XRYA 3FOCA 1VL2A 1WJGA 3MXTA 3PRHA 4MQ6A 1O95D 1JIJA 2E89A 4PY2A 4EG4A 1EFPB 4CDMA 1JZSA 4MW6A 4Q93A 4OUDB 1NYLA 2NSYA 4ZCTA 4PBRA 1PG0A 3AIIA 3HZRA 2AG6A 1EE1A 3HGMA 3HV0A 3GLVA 3ZUGA 4YP6A 1O94C 3TZEA 4GRIA 1KH1A 3H99A 1F7UA 1IHOA 4MW9A 4EF6A 1J09A 3FDXA 4G6ZA 2X1MA 2PFSA 4A91A 3K9WA 2CV2A 1V8FA 3LOQA 1IQ0A 1LI7A 1O96A 4DDKA 2DUMA 2QUJA 2H2AA 4EG7A 4PBSA 1I6LA 3AG5A 4ZT5A 4DNXA 1KP3A 1KKUA 2D13A 1EXDA 2OV4A 3ND7A 3SZ3A 1I6MA 1PFYA 2PZBA 4MVCA 3CLTD 1EFVB 2ZUEA 5DK4A 4OUDA 1A8HA 1U3CA 1Q15A 1I2DA 1LW7A 2O5RA 4MVWA 3TQIA 2JA2A 4TS1A 2VTBB 4NX2A 3CR8A 2J5BA 5JBNA 4MW5A 3ZJVA 5KHAA 2A7XA 3IODA 2WQ6A 3IOEA 1TYBE 3ZJTA 4KR7A 2PZAA 1O97C 5DEOA 3SP1A 3CVVA 4XFDA 3CLTC 1O5TA 1WXEA 1KP2A 4MLPA 1X8XA 5KCMA 5TGTA 3X1MA 4MAFA 3HMQA 1S4MA 3A04A 1OWMA 1H3NA 3MMXA 4JYZA 2PZ8A 4MVXA 4ZT4A 4DDHA 1M8JA 1D2RA 2B7LA 2OQ2A 4L2IB 2A1TS 3FH0A 3FI0A 4WSOA 1EUQA 1J70A 3OP1A 1RQGA 1WOYA 2EJCA 3IH5A 4MW4A 1EUYA 4F4HA 1I6KA 3LE8A 3Q12A 4HPWA 1MAWA 2EL7A 5DASA 4ZT3A 3RHSA 1F7VA 1B6TA 1GZUA 4ZT6A 4I6JA 1YIDA 2J08A 1G59A 3CLSC 1NZJA 1JEDA 1KH2A 2A1UA 3CLRC 2CFOA 1O95C 2HMAA 1NUTA 4HJRA 3H9CA 2VXOA 2R5WA 2QUIA 1T6ZA 3GUZA 1V47A 1KORA 1O97D 4EG3A 2RD2A 1GPMA 3E27A 1Y42X 4CT0A 3CLSD 4I6GA 4ARCA 2QJOA 3FETA 3RK1A 3N8HA 1KQNA 1XNJA 4MUFA 1NP7A 4R2MA 1NUUA 1N2HA 1MC1A 1OWPA 2PXHA 3L92A 5K0TA 4CQNA 1O96B 1ULHA 1COZA 1J1ZA 3TQOA 4U63A 3X1KA 1EJ2A 2WQ7A 1HYBA 4G5FA 1J20A 4YP7A 3COVA 4JFAA 3RJZA 1JGTA 3IVXA 4MUEA 2A1UB 1H3FA 1MAUA 2CYAA 2A1TR 1JECA 4NATA 3AKZA 1F9AA 4MW7A 2E0IA 1OWLA 3A2KA 1PFUA 1WXHA 1WQ4A 4Q16A 5TEWA 1XNGA 4DE5A 4U7JA 2BYTA 4QREA 1WZ2A 2X1LA 2QTMA 3CVUA 1Q11A 2PIDA 2QUHA 5TS2A 1OBCA 1WXIA 1MRZA 4ZCSA 1GLNA 1N1DA 2CV0A 2CSXA 3FHJA 3UC5A 3ILVA 1O6BA 1XJQA 3QTBA 3UY4A 4MUHA 1N2GA 1JEEA 2AZXA 1U3DA 4CDNA 2E18A 3COYA 4NZPA 3TZLA 5J58A 4KR9A 3JXEA 1PFVA 3P0IA 4RUKA 4MWDA 5BNZA 3H05A 4MW2A 1VBNA 4K03A 4PBTA 3VU8A 3SZGA 2VTBA 1Q77A 1EFPA 1TYCA 1M83A 3KT3A 1YUMA 4G5YA 2J07A 3DO8A 3MLAA 2I1LA 1R6TA 2YWBA 3X1JA 5HUJA 4MVYA 4F3RA 1VLHA 1J21A 3UK2A 3CVYA 1QRTA 3CA8A 3MLBA 3PNYA 5FO0A 4JXXA 1M8KA 3CVWA 4S1OA 3D6VA 5LLTA 1WQ3A 2PG3A 2QJTA 2D5BA 3CVXA 2BTEA 1N77A 4ZCRA 1KAQA 1T9GS 2J4DA 1U0BB 1TYDE 2DETA 3INNA 1M1ZA 2XRZA 2V0CA 4DDMA 1K97A 1TEZA 2YWCA 3OTWA 1IH8A 5DB4A 2YXNA 1KH3A 1YIAA 2HGZA 1QNFA 4K0RA 3AL0C 1IQRA 3L93A 4I6EA 1O94D 1JHDA 4GU5A 3IMGA 1YULA 4ND6A 3U1VA 1NURA 3UMVA 4R0NA 1KQPA 1ZH6A 4MWCA 1LI5A 3CLUC 5HUHA 1K92A 4KPUA 1N2JA 1N2EA 3FWKA 1TQ8A 1VBMA 1QRSA 2QTRA 1BS2A 5KWVA 1T6XA 2A84A 1IRXA 1FYDA 2RE8A 4MUJA 2GOYA 1MBZA 3M5WA 1JILA 4WNYA 4MULA 4MUGA 1MJHA 1K4KA 4QBTA 2YY5A 3K32A 4NAUA 3G5AA 5IJXA 1KAMA 1G8HA 1O0BA 5AHWA 3VRHA 3HL4A 5FNZA 3KT0A 1N75A 3QE4A 3LCJA 3TNJA 3GMIA 3FY4A 4YMIA 1N2BA 1T9GR 1QRUA 1F4LA 3IVCA 4KPUB 1ZJWA 2CUZA 3P52A 4KKVA 5TEVA 4RPIA 1H1TA 4EGAA 4NAHA 3IOCA 2NZ2A 2E21A 3N2YA 4BWVA 1ZH0A 5HG0A 1NUPA 3G6KA 3FIUA 4NDAA 5J59A 1QU2A 3G59A 4XFJA 3CLRD 2DEUA 2Z09A 3Q10A 1QJCA 3H9BA 3ZXSA 1N2OA 3F3MA 1MB2A 1NSYA 5LM3A 1OWNA 4J76A 4FZJA 3P0JA 5IHXA 4ARIA 3DLAA 3SDBA 2GM3A 1GTSA 3IOBA 3D6UA 3S3TA 3AG6A 3I05A 1QTQA 1EFVA 1WKBA 2H29A 2IJGX 1N2IA 2J09A 1M8FA 4MWBA 2G36A 1Q19A 4EFKA 4YP5A 1ZUNA 3N9IA 2Z08A 4HJXA 3N05A 1QU3A 2DXIA 2A88A 3SEQA 2ZUFA 3NBAA 1WXGA 3KT8A 1IVSA 1KR2A 3SYTA 1WXFA 2O8VA 1CT9A 5EKDA 3ELBA 2X3FA 1DNPA 2QTNA 3IVGA 1JIKA 4MUNA 1N3LA 2CYCA 4ZT7A 3FG9A 1KQOA 3KFLA 1TFUA 1YI8A 3DV2A 3DPIA 2JANA 3PNBA 1GTRA 5J5AA 1G8GA 3IDFA 3BL5A 1JZQA 3RBAA 3IMCA 1YUNA 4JXZA 3SEZA 3PXUA 2CYBA 1IQUA 1G8FA 4MW1A 1K4MA 4J75A 3RFFA 4P2BA 1MB9A 3ISJA 1NI5A 2A4MA 2ZP1A 3H97A 3ZXIA 1R6XA 3COWA 3COZA 4HK4A 4JZYA 2WSIA 2V0GA 2DLCX 4H3SA 4QRDA 5LFAA 2QUKA 1WY5A 1VBKA 4EG8A 3IUBA 4ZCPA 4OJMX 1OBHA 3ZJUA 1MOPA 1UFVA 1JIIA 1TYAE 3KT6A 3FNRA 4DLPA 1IFXA 1U7DA 2GKSA 2HZ7A 2WB2A 1GN8A 3RK0A 1SURA 2IELA 4KR6A 1GAXA 2C5SA 5H7XA 4X0EA 1M8PA 1H3EA 5H16A 2AKEA 1OD6A 2CV1A 1PFWA 1FFYA 4UZEA 3ZIUA 3Q4GA 2D54A 1R6UA 2QJFA 4ZT2A 3ZGZA 1PG2A 4UZFA 1O0CA 3HFJA 1U7XA 1JMVA 2X0KA 4ND7A 4XSVA 1NUSA 1P7PA 3A4IA 3IMEA 3ND5A 2DR2A 4AS1A 5F23A 1XNHA 5FO1A 4U8HA 4MUIA 1M8GA 3TS1A 2TS1A 4ZCQA 2Z3VA 3PNVA 4DJAA 4E1AA 2A86A 1N78A 4EG1A 3C8ZA 4MUKA 3UOWA 3IUEA 3A05A 2CT8A 4L2IA 2DPLA 1ILEA 1T6YA 4EG5A
chains in the Genus database with same CATH superfamily
5IC6A 2B2NA 4A27A 4DR6B 1J23A 3AF1A 4D46A 2P6PA 1M2NA 2R2AA 4QRHA 3R24A 5IJ0B 3JZDA 4WOKA 3O9MA 3RG2A 4ANFA 2OZLA 2G5TA 2HU5A 5K8CA 4IF6A 4LBVA 4OQLA 5I9SA 7REQB 4ABTA 2NAPA 1N3BA 2ZB7A 4YBRA 4US2R 2OAQ1 1BH2A 2A3RA 1DQSA 5KBYA 1VPWA 4O4LF 4MQ6A 1O95D 2Y1EA 3JQGA 4H1UA 3ZWAA 4DR5B 3EPPA 4QJ4A 3AH8A 4LY6A 2AC2A 4QTUB 3VHXB 2I6TA 2P8SA 4QBIA 2FW8A 2I4TA 4GPAA 4PBRA 1A7JA 3PUYA 3RVKA 2WIFA 5I7OA 1QQ6A 1BCRB 2WF5A 2F43B 4LRWA 1J8MF 4UVDA 4X9XA 3T3OA 2X4DA 5HTKA 1PV2A 2EV9A 4Q4JA 3PUKA 3A9WA 2IYNA 2X14A 5ESXA 3EPLA 5D3MB 4YLYA 4D9IA 2EZ8A 1M2OA 1RKQA 2UUBB 3AUXA 4OU5A 2IYTA 2CV2A 5G0WA 1KDRA 4HMPA 2B4KA 3ZNNA 4PGAA 1OFUA 1UKCA 2Q4DA 5EVJA 3EXHA 3C6QA 5JG7A 3GFBA 3P9XA 2X41A 3CU5A 3I5AA 2JLSA 1TQDA 3L07A 3QVUA 4NOMA 4TKLA 2O8EB 3JAKA 3NG1A 5G4KA 1CRZA 2NUBA 3P9PA 4XM1A 2L2QA 1N2CB 1WR8A 1EXDA 3EVGA 1HORA 3Q8WA 1R00A 3UV6A 621PA 2G72A 3RKRA 4Y9DA 2BUBA 3QWAA 16PKA 4GKBA 2FA9A 3S2SA 4L0DA 3K6SA 1ZL0A 4ER6A 1VJRA 1X94A 1T3TA 2OENG 1KIAA 2KSQA 1V11A 3GFVA 2HPAA 3M4XA 5AW9A 5A4MS 1G66A 2OKGA 4EQ6B 2VQDA 3P0FA 5CUQA 1XZNA 4OHWA 3Q9SA 5BN1A 1JPJA 2ZRKA 4DM3A 2X9GA 5CT9A 1OSNA 2JATA 3RVSA 3K9FC 3P9IA 4DCUA 1JH8A 4UU8A 1EP1B 4R1OA 5KCMA 3UOGA 3ZLTA 4MAFA 1Y1SA 2ATEA 4EB3A 2VWHA 2I7TA 5EL0A 1EWKA 5LOVB 4UAJA 1JBQA 1OWMA 3ZY6A 1CS0B 1W4RA 3FB1A 3URKA 3OOHA 5J23A 4Q1DA 2PUAA 3LZDA 3UK1A 3FPAA 3ZZ1A 1AH2A 3HXKA 2GAAA 1TD1A 2OQ2A 4I4NA 4DTCA 2NUTA 3FH0A 1DAPA 4MYHA 4MPJA 1V43A 4WL0A 5JY6A 4O2BF 3UPDA 5LZ2A 2IEZA 4L72A 3EQ6A 3KCNA 3TW0A 2FRVA 4QHYA 3HC7A 5CVVA 1EGMB 5B1EA 3GJTA 4F4HA 1FB5A 2L17A 3UWDA 4DIEA 4XWGA 4PZ9A 1HYQA 3GX1A 3Q12A 2W4IA 2NW6A 2XTZA 3BYZA 4JX9A 4NZZA 3ZE1B 1KEPA 1Q3KA 4HYQA 2CLOB 5I45A 4LW8A 5F7XA 1XU7A 2O3JA 4LDJA 3GGOA 1HY3A 4RADA 2A50A 1KH2A 2VNAA 4QDKA 4OYRA 4XGKA 1C30A 3LUKA 1KEEA 2ODBA 1XXLA 3WLHA 3CRZA 2QVCA 3VU1A 2I99A 4H7JA 4R41A 5FPYA 1B6RA 3EGIA 4ZZIA 1D0IA 3JVIA 1JA1A 5E1BA 1FVOA 4EMTA 2PS1A 3O1LA 3EDOA 2ZQYA 1V47A 2EFEB 3C5CA 5C5IA 1JWLA 4B0OA 1E4EB 3I32A 2DUWA 3HB4X 2VCHA 4LGYA 4BBAA 2C0QA 4OKNA 4LZAA 4YRSA 3L46A 1II9A 3CYFA 1L5RA 1N57A 3U0BA 2OPBA 4MIOA 3EDMA 2C7GA 1Q2XA 4H7DA 2QY6A 1RACA 4Y2UA 4WZBA 3LUAA 1OWPA 2O59A 1S3FA 3R5KA 1N4AA 1OC4A 1XG5A 1RTTA 2LRHA 2P1DA 2PX0A 3S1AB 1UFRA 1NBEA 3L40A 1C1DB 2C4VA 3C8HA 4KWCA 4NFHA 2FZKA 1QHHB 4LYFA 4WEQA 5ELLA 5JAUA 4I1PA 1D4ZA 3LTNC 5JMPA 3I8SA 3LTEA 4U7PB 3DH0A 5LQAA 2QAGB 3TIXB 4FYYA 4CMCA 1PV4A 3KVOA 4MYSA 1OUMA 1VJ5A 4FB5A 3DPUA 1LXCA 2R85A 4FGSA 4UE2A 3COVA 4XX0A 5K0LA 5KI6A 5KMGB 4IDHA 4JC5A 3AY7A 4CM9A 4DV1B 1JU9A 3JQ6A 4P32A 3ZKWA 3E18A 3WYAA 3KZVA 1G6KA 2F1IA 1DKUA 4OSOA 3MWDA 4PNEA 3AUAA 8ATCA 3IEVA 2CBGA 3C85A 3AW8A 4OHCA 4RDIA 2JFOA 1AKNA 1ZK4A 4BV9A 3EWNA 1NOIA 2YJZA 4MUXA 4E5KA 2AHOA 3QWFA 1PGOA 3K1TA 3TL6A 4RTQA 4HH4A 5JECA 1NU8A 4J0IA 1VMIA 4AMYA 3UFXA 2QUHA 1R18A 4S1TA 5J3JA 2PUGA 4LVUA 2XB4A 1GLNA 3HSSA 3OQOA 3DXYA 3KQVA 3HUFA 2PUCA 3ILVA 2ZEJA 3PQ5A 5KSZA 4EKGA 1SCBA 2X8JA 4I4CA 3SD7A 4YMHA 4MVJP 5AD1A 4KDRA 4TRNA 1Z2DA 1T9CA 2D4AA 2F67A 2ZAMA 1P81A 5EUMA 5JSHA 1TF2A 2PUDA 1CQZA 1SVNA 1T3ZA 4KIGA 1SC9A 5ADWA 1SKMA 4D02A 4DA9A 4K03A 1J00A 2NP6A 3FNHA 5AXAA 1JRLA 3HRHA 4F0JA 4L0QA 4YRPA 4PIMA 5KYYA 4WOBA 1DAEA 3REQB 3V1NA 2AFVA 1XROA 1WZCA 3PQ4A 4LDAA 2GCPA 2IBSA 3KEQA 3RPEA 4G5XA 2BI4A 1V39A 1CUIA 1ZUD1 4Q7EA 3LC1O 3ZVMA 1M75A 5PGMA 4IKOA 1I3LA 1QTRA 1PEKE 3UCFA 3CE6A 5L6LB 3KZKA 2XB2A 4GECA 1YXMA 2BP7B 2X4LA 4RSHA 4DL9A 3CVYA 2D0PB 3UAGA 1YUBA 5C7YA 1FXWF 3FPEA 1GGHA 4IFEA 1FSFA 1W25A 2PCLA 3LLMA 4TMKA 4WKPA 1L5GB 3I0NA 4PO3X 1XLUA 2CLLB 4F97A 1AHPA 1M8KA 2PXXA 4P93A 3JVEA 5LLTA 1GGMA 4CL8A 1ZG3A 3NPAA 1UPUA 3I8OA 1R0LA 4AG3A 2I3ZA 1K7EB 2AH5A 2BMDA 3B52X 1KSGA 2PXAA 5C52B 2WD7B 1ZONA 5D7BA 3RF6A 5U4QA 3HKCA 2LV8A 3HPRA 4XZ3A 5KWEA 4X24A 1LSUA 3V7NA 5DB4A 2FH5B 3IALA 3GJRA 4JXJA 2F43A 5EQJB 3EAQA 4XWWA 4REQA 2BGIA 2YJTD 4CFSA 2ZSEA 4CLRA 1TLLA 2VJBA 2WP0A 3BA1A 4NNJA 2CCKA 3GJXC 2IXEA 4UU0A 2R751 4EVIA 4AJJA 1YCFA 5FI5A 1Y5NA 1S1MA 4Y0NA 1IWPB 3HYNA 1OVGA 3QITA 2QTRA 4I9UA 4CQLB 4NZYA 2AN3A 5JH7B 1I5RA 3THRA 3ZOKA 2DULA 2EQAA 4IW3B 1ENZA 3DW3X 1PP4A 4F4IA 2C9OA 5ECWA 2Q1YA 1JILA 2GDZA 1LPPA 5KREA 3DHNA 5ARDA 2DWOA 4MUGA 3IUSA 1K4KA 1NN3A 2FR1A 3PQDA 2AYZA 4U2DA 1C1XB 4IIFA 3ZHTA 4KXVA 4XPZA 2QM3A 3PWTA 5J2UA 3GLHA 2G9NA 1GXSA 1CU1A 2EW2A 3I23A 1KY4A 1H2RS 4ZAFA 4K6MA 5ICEA 4I2NA 3SBEA 4ZJYA 1J2EA 4FZ5A 5CX1A 5K3AA 3QF7A 4RZSA 2IY8A 2MMCA 1TOAA 1IK4A 1I0IA 1U0OC 1P8JA 3PC6A 3QG1A 4LWPA 4UUPA 4BU1A 4YXWD 3V9AA 5JHGB 4MKHA 1US8B 3BWDD 4R98A 1I9GA 5CAEB 3WMFA 2PEZA 3PTLA 3AF6A 4OMCA 4B4UA 4A2QA 5CB4F 2C78A 3E70C 3TNYA 2V9CA 4ZV4A 1AMOA 3VHLB 4MAAA 5IAEA 1QF7A 3O4VA 3BXHA 1G3IA 2VUSA 2ABWA 4I4TF 4C3VA 1H9CA 1OJ7A 3FSEA 3RYTC 3D31A 5MF6A 1RS0A 2ZUWA 3DD5A 2AMFA 1HE2A 1L5ZA 1MO2A 2FPLA 1HLFA 1XRRA 3FMVA 2VO1A 3IQZA 3LQRA 3OCXA 3TEMA 4DIOA 2NO0A 5C1DA 2G9UA 3DFUA 1CXZA 3S55A 4UEQA 4LC9A 3W6OA 3JWEA 4Z4QA 2QSYA 2WFZA 4TZKA 4X91A 3OPMA 1V2GA 2A4KA 2BEJA 2H4WA 1IMOA 1NVVQ 3R6WA 1F2UA 3EQ2A 4UQLA 5JR3A 4V03A 2FVYA 3JQ8B 5AOCA 1V4BA 3ZXSA 4D97A 3JYNA 4IIJB 3LAWA 4J7AA 4JA0A 2VHXA 4CDRA 4IYJA 1BMFA 1P9NA 2V6IA 2COEA 3DULA 3K5WA 2BE9A 3MINB 3QU2A 4HI0E 4K6GA 1QE0A 1EVIA 5ALIA 3TTSA 5ALLA 3SQWA 2G80A 3RVQA 4P5EA 2NXJA 5BR4A 4BE4A 5JYCA 3Q7IA 1IJFA 2FQXA 4G0XA 4DUZB 3HCDA 2YC4C 5DBOA 1AXEA 4B3CA 5IS2A 5BQXA 4IIXA 1GUBA 2JFZA 4ARSA 3K0SA 2Q9CA 1L8AA 2HKIA 1OTXA 3I0ZA 3ORRA 1I2MA 4G01B 3LH5A 3PFWO 4LDNA 5E6RB 2MSDB 5LA6A 4C7KA 5E8RA 4F8JA 3TUZC 1GCUA 3SDSA 3B82A 4WX2B 4B35A 1A77A 1XA3A 2I34A 2R8ZA 1PW5A 2D2VA 3L8GA 3PC4A 4XD7A 4OGWA 3CHYA 5GJVC 5C1IA 3WADA 2A88A 1CEEA 3ESXA 2EDAA 3H7IA 3OESA 2QTWB 3DUFB 5C4GB 3RRMA 5JEEA 1B0AA 3OPQA 2KQUA 2RJ3A 2X2FA 3D8UA 4GZ6A 1G4HA 1XN1A 3O8NA 2R1TA 1ES9A 4IVRA 2QN3A 2P5UA 5EKDA 4EY3A 2WVAA 2Q45A 1D6NA 4MICA 1UBJS 2A5YB 4AYWA 2ST1A 3KSDO 5I7EA 2P65A 2C94A 3VPCA 1HDZA 1KY2A 1QQ7A 2VDUE 3ICCA 2VDVE 1P3Y1 1PGNA 2RG7A 3A4NA 3F6EX 4J0CA 4L74A 4ZU3A 1W5AA 4BV8A 5LWHA 1PJLA 3W5DA 2MSWA 5HTOA 3A9CA 3C3WA 3Q6MA 2C5BA 3AR6A 4CIYA 4H7PA 1MNQA 4YV0A 2GGSA 3MHTA 3PNBA 4EYGA 3EXIA 3D3NA 3I4FA 5J5AA 4RHCA 3W5VA 4NCBA 3CUVA 4JXZA 1YZVA 1NT2A 2QQGA 4B8ZA 4DILA 1X7ZA 2FSHA 2C98A 4B44A 2WQZA 1R6AA 4QYMA 5KYXA 3BMQB 3FPFA 4NHOA 5KINB 3K4PA 2ZIXB 3OM8A 1AQIA 1OAOA 3ECSA 3SJZA 5C4MA 1JQJC 1PS8A 4GKAA 3WLSA 4ZALA 4X62B 3PXDA 3ZV3A 4AICA 1ZHFA 2JHCA 4PHGA 3BD7A 4L3VA 1RR6A 1Z8HA 1CHDA 5K6RA 4X6XA 1N7HA 1RMQA 2IOHA 1GYQA 2QXUA 4KREA 1T8YA 2I4NA 4EI7A 2C5HA 1RP1A 3BIWA 4WNAB 1U8AA 3H9UA 1T0IA 1M1YB 1GVHA 1KR5A 4YAGA 3MCAA 1G9SA 2WM2A 1IYZA 5I9BA 3WIDA 1UFVA 1MIHA 1QX4A 4BVBA 8OHMA 1ULTA 2G6BA 1P6UA 1TYAE 4RAQA 1W0KD 2C29D 5IJ0A 1E7MA 3I45A 5HR5A 1FFXB 2GRJA 3MFYA 1GN8A 2XWPA 2H1CA 1ADJA 3O94A 5AJZA 3PYMA 3BFKA 1PZHA 1U8YA 3U5ZB 1GGJA 3A9SA 6REQA 1PJSA 3E2MA 3SS9X 2DUJA 2J0VA 4F46A 1PK9A 2ZRPA 5IVHA 1W2HA 1V8PA 1LDBA 5EFOA 4BQFA 3C8UA 3NAZA 1KBOA 4WLFA 1J0CA 4RIIA 1DTWB 3GJ0A 3E84A 1IEVA 1IHPA 3IPCA 4JDPA 2JJ2D 4RTJA 4X8OA 2DPGA 5FHQA 1PR2A 4B3SB 1U7XA 4RXUA 5HGJA 2V6GA 2FETA 3W8EA 2R87A 2ID7A 1FUIA 1UQTA 4ADSG 2VDWB 1XNHA 1TQ2A 2QG4A 4JGBA 5FO1A 5JDIA 4TS9A 1I6WA 3MTAA 3HVHA 1OXBB 4QARA 5DGCA 3ZLBA 3C0KA 2YV2A 1RYBA 1TCUA 2C2KA 3WFZA 1L3IA 4H7FA 4N18A 3ZBPA 4ZRDA 1XPUA 3GT0A 5L3QB 3DHYA 2KPOA 1IG3A 1LFDB 2IHKA 4X1KB 1JLLB 5JWRA 1HYHA 3LK6A 2JGEA 5A06A 1Q22A 4JWTA 3BH6A 2DYKA 2ZBRA 4LDRA 4A15A 2R79A 3Q7PA 4DCOA 2CE2X 1ORIA 4FCCA 3JAWA 1UMCB 4GWKA 3KQHA 4MS3B 3KEFA 4XIIA 5EZ6B 1C9YA 1QO7A 1SVOA 4AS3A 3KLBA 1RXIA 1GGVA 4I9FA 4EG6A 1VTKA 3TQQA 3N0XA 1QP8A 2F2TA 2OZVA 5JC1A 1T5LA 5IP5A 2W93A 1WCIB 5JZMA 2R62A 1KS2A 4XJSA 3T1TA 1P3JA 1YJAA 4FWTA 2N0SA 1D0VA 3ETHA 4LXXA 3VU3A 4EDFA 2R25B 2XRYA 2PUWA 3FOCA 3KKLA 1GQOA 3SHQA 4E32A 2PWPA 3NTVA 3K71B 4RYLA 3DNPA 3W5HA 3LT1A 4PQFA 4PY2A 4EHKA 1KS9A 1CIPA 2A0FA 1SPXA 4MV8A 1LDGA 3KJFA 3F5DA 3KZCA 1L5WA 3D3KA 2LGJA 4MW6A 4JI7B 1A9OA 4X5OA 5BNFA 3TZHA 1LJUA 4EEXA 5IYZF 4H7IA 1KK2A 3UYKA 4EW6A 4MDFA 1PG0A 2F9LA 4PNPA 4AU1A 1Y6FA 4M7PA 4WA7A 2P4SA 5IUKC 3HGMA 2GD1O 2I2XB 4YQYA 5LIRA 1NQOA 3F5FA 3ANXA 3L4BC 1HGXA 3JD3A 3EG9B 1F7UA 3LQFA 3DLIA 1E2QA 2ODAA 3ZC3A 4OH1A 3RK4A 5ED0A 3TOSA 1E5DA 1PZFA 2YVAA 3L7DA 3H9JA 3BULA 1PT9A 1US8A 1NFQA 3LOQA 4OPMA 4DIDA 4OXNA 3EGDA 3JTEA 3M89A 4OXIA 3K35A 1NLMA 1FP2A 1Q0LA 2F17A 2Q7XA 3KPJA 1ISMA 3L84A 1GRRA 4FBGA 4PBSA 1X19A 2H5EA 2QGZA 1B0UA 3NDBB 2EG9A 1L7BA 1OV4A 3JQQA 1WDKA 2BCJQ 1J4AA 4OB6A 1MC8A 3GAMA 4CODB 4YAKA 2F4VB 1NQTA 3D2AA 3TH5A 2ZM6B 3CNBA 3PGMA 4CMEA 5IUNC 2UZAA 2CHQA 4UMEA 5B4UA 2VRWA 4JLAA 5EXSA 4Q3NA 2VWQA 2OO5C 1TZ2A 1E6UA 1P31A 4D81A 3ICPA 5HF5A 1GEGA 4X84A 5T3YA 1PZGA 2E4XA 5MGBA 4PLPA 2FPRA 1NATA 3UA0A 4MVWA 4KE7A 4A0QA 721PA 2JA2A 2AD5A 3A1DA 4YECA 3AM3A 4KO2S 3ZHOA 3Q7RA 1JEQA 1FUUA 4MS1A 3SYNA 4G0ZA 3G0GA 1RWMA 2MSNA 2BY4A 3QF4A 3O4HA 4NIMA 3R3VA 4Q7QA 1QLHA 4BO7A 3RYCB 3QVTA 3DOFA 3B7WA 3PKZA 3K6SB 1JB9A 5BMVF 2DFKB 5F35A 2BZSA 5JSZB 4M7RA 1JDBB 4H4EA 4L6IA 4EUEA 1Z75A 3S8YA 5C1BA 2RMKA 4B73A 2FP3A 2FG7C 1Z25A 2R8YA 4PCVA 2CLIB 2Q27A 2WNIA 3DMPA 4MI6A 1KAEA 4ZOEA 1KFJB 4Y6PA 3QUQA 4ZYYA 4MMZB 2C2MA 1DXHA 3B13B 2C8LA 1KO8A 1CG6A 2PGIA 4I08A 5ITSA 4MQEA 2H8KA 4XQ9A 3A1FA 1OGIA 4XCVA 2OV2A 3ZNQA 1EUQA 1DGQA 3INRA 1RSZA 1WOYA 3OP1A 5EZYB 5CIYA 2EJCA 2EBWA 2WWHA 2Z1DA 3EVBA 4CV2A 1MVNA 4KNWA 1EUYA 2CD9A 2WJHA 3FNGA 4FDLA 1T15A 3JVVA 5D3MA 1EUCA 2VUTA 5JROA 3INTA 1RAIA 5DXAA 4BUZA 1GA1A 1L4FA 2YZ7A 1VB3A 3D2LA 2XUFA 1TT5A 2Q9UA 3AVWA 2QE6A 4WFIA 1IXZA 2OFXA 2ZAOA 5IANA 3K6RA 3PEFA 2WLTA 3QLJA 4K6HA 4LWZA 4HQNA 1LJLA 1T6ZA 3B5JA 2F7SA 2ROQA 2J9YB 3PICA 4TKUB 2HQ1A 3GN2A 1FS5A 3LDUA 1EJ0A 3PFGA 1KORA 4RD1A 2XCUA 4YUAA 2XCIA 2HXSA 4B3RB 3W3ZB 3GLIE 2XA9A 2E48A 3D43A 4A2CA 2FVXA 2OVFA 2WOOA 2QJOA 1NVVR 2BFBA 4PFJA 2BKXA 2RHLA 221PA 2W48A 2HJGA 3BDVA 2ZR7A 1TO1E 1N2HA 2X1VA 4IG4A 4JIGA 4LK3A 4R54A 5IEJA 5IVKA 4UFNA 2V74B 5A9SB 4TYWA 1FTNA 5BSHA 4WOJA 4ZVNA 2IECA 4D6YA 1SY7A 1N8NA 1OPXA 3IBFA 2QMOA 1Z8DA 3DA8A 2J3LA 3P1JA 4I36A 5NLLA 3KQKA 2D1FA 2ODEA 2CW5A 1XZPA 4WFQA 2RJNA 4N47A 3V1TC 3J7TA 5AKZA 1D1QA 5BY2A 4J1QA 3OICA 1T3SA 2AN1A 1RI3A 2NNWB 2MT9A 4U2EA 3E7XA 4NULA 4KH1A 1X1EA 2IIBA 4OB7A 4PLVA 1H3FA 1Z47A 5ADHA 1MAUA 4DV2B 4WVLA 4J9UE 3WAGA 1CQJA 3LNTA 2M6KA 3UOAB 4BPBA 3IR6A 4CM9D 5AKJA 1NLYA 3G5UA 4LE1A 5ANRB 1FNSA 2QAGA 4C3ZA 3B12A 3BWMA 3LPLA 4DE5A 2PS9A 2WFLA 1NI4A 4TYMA 3WXBA 5DHTA 3ZDDA 5KYGA 1HTBA 1U81A 4B80A 1X39A 3EOBI 1PJBA 3QOYA 2HIAA 3NHUA 1N34B 3AY3A 4MGZR 2VP6A 2QVLA 4OKIA 5AXCA 2HCBA 3N8KA 1HDXA 2J4FA 1NC1A 4E88A 1P33A 1S89A 2VDLB 3HJBA 2E2WA 3FN4A 5GWXA 4E08A 1HFEL 1O9BA 3TX6A 4OOFA 2CEKA 4KFUA 3U37A 4BRZA 4DT1A 5J58A 1JHQA 1O94A 4IEIA 5CH3A 3H05A 3OT1A 3VAAA 1XVUA 2NQ2C 4CMJA 2H0QA 3SZGA 2DH5A 4IHKA 4ZAGA 4BKRA 2D2XA 4CETA 1GAWA 1E4EA 1TYCA 4HWRA 4TS4A 1XX6A 2AK2A 2D00A 2PWBA 3KT3A 2D2EA 5AK6A 5ALGA 1YRAA 6AT1A 2PRIA 3DVSX 5I6DA 4H4DA 4CR8A 4OX9Y 3UJCA 4YGYA 3ACCA 5L4LA 5C8DA 4QG3A 3I61A 1RRCA 3D8SA 1LCIA 3RBXA 3T7RA 3K8OE 4X54A 2GLXA 3HCCA 5BN5B 5L3SB 4DV0B 3RROA 5A1TA 4IXJA 2IZ5A 4S1PA 1NG1A 3QU7A 3HLTA 4GBMA 4MVJF 4CG1A 2F3PA 2AX4A 1G21E 4LS3A 5ABPA 2GYVA 5CFRA 5LDHA 3A9UA 1NW3A 1SCJA 3B6KA 3DJFA 1MP0A 1Q7BA 1RRMA 2NUTB 2FG6C 2P3LA 1THGA 2VXBA 3DS8A 2B1QA 3QK7A 3TM5A 3IDQA 2XRFA 3DWIA 4QDXA 1HTWA 2AW3A 4XDZA 2J6HA 3IQFA 3IQIX 4UTXA 1LK0A 2XMQA 4GW3A 3AERB 5H81A 4BO4A 1NW9B 3INNA 1ZWKA 3AF5A 3FZNA 1NPDA 2OD7A 5HIMA 2V0CA 3LCCA 4DJFC 4GYKA 1Z8NA 3PEUA 5DNCA 2WTXA 5TLSA 2AD1A 2C99A 2I22A 2O2IA 4I2VA 1IQRA 3WK9A 1UZLA 4LHEA 1K1EA 3RRYA 4B6RA 4W4TA 1YZUA 1JHDA 2PR7A 2YHUA 5DGHA 2I4IA 2YV3A 4E15A 3AR4A 4HDKB 4OATA 4MWCA 3L0CA 1J7JA 3HBJA 4A8JB 3CCBA 1CQXA 4D3SA 3HEAA 2HADA 1N2JA 1DB3A 4TKUA 4BLPA 1LI4A 3B5EA 4G0WA 1NVWQ 2BGNA 1ZD5A 3P4XA 3IKLA 4O2RA 4X00A 3CF4A 5DYGA 2B5VA 2C5GA 2NUAA 5L8VA 4LXQA 1OB5A 4OFZA 3L5KA 2UUAB 4Q9AA 4OM8A 4WXHA 1W5SA 4N5DA 4CT4B 3PHCA 4MUJA 2ET6A 3GZJA 4MJLA 4RQTA 4DLUA 5DTRA 3EVTA 3UXEA 5DSZA 2DECA 3HB9A 4YRLA 3FMIA 2G5PA 3FPBA 1FP7A 4UFOA 3JQ7A 4CJXA 5JYBA 3KZNA 3MWYW 1PEDA 3G5AA 3GLFB 1FDVA 3NI2A 1XZJA 2CVPA 3OBIA 1Z2NX 1TMYA 4AN1A 1EK5A 5E6UB 2IXFA 3P0RA 4WN3A 3I0MA 4NECA 3LPAA 2XUGA 2P2ZA 1P4SA 2ICAA 1L7RA 4FNMA 3G8AA 2YL2A 1Z16A 1GTL1 4QUIA 4ZEXA 4P8RA 2IWHA 3THWB 2DJIA 2ZK7A 4LPSA 4M60A 3M6FA 3E3MA 1TJYA 1QTNA 1C4OA 2O0LA 5LQCA 4DYDA 1HLGA 3FY4A 3U1TA 1VOTA 4HXEB 2IX3A 1OH8A 3GA5A 4Q66C 4GWGA 1KZ6A 3G5LA 4IXDA 1CUVA 3KS9A 1UWCA 1M76A 2B7CA 1VQ1A 2Y2UA 3AWDA 2X77A 1DJOA 4JOBA 4N0DA 4P4NA 4C2BA 4UNRA 3CX7A 1OH5A 1QOQB 3PC8C 4K9OA 4PRZA 2P9CA 4LXUA 4XWYA 3T5BA 2CFCA 3IO5A 2W2TA 3IJPA 3OM9A 3U7IA 5HKKA 4YQZA 4KDEA 4RORA 1HOXA 3WA7A 1NULA 4HVAA 4R8VA 2LR0A 4DR4B 4P31A 2O4CA 1FQWA 3QBEA 1HTTA 3A4VA 4HSEA 4U1RA 1AGRA 6ADHA 1LDMA 3A4TA 4HAIA 3RC9A 1P4RA 1A8QA 1GVNB 1R6DA 3WGOA 2QT9A 3L4EA 4F6CA 2VPYA 3IKVA 3T3PB 1PCXA 1L4UA 5CDSA 3P2IA 2JDIA 2R00C 1Z63A 3VMMA 4ARIA 1HMYA 2PHZA 3O4JA 3SDBA 4MQ5A 1GKLA 1NVDA 3K0KA 2DPHA 2IEAA 3C48A 3FUCA 3IOBA 2XOXA 4PX3A 3CVOA 4YN3A 4HGYA 4K9QA 4L4RA 2X76A 1CUEA 2JKYA 2X8BA 3T95A 3WNVA 3I05A 3L6EA 1K7SN 4KRFA 3HCFA 3SG0A 3UMMA 2P2GA 3J81k 1Z7WA 3ZDCA 3D4PA 2D74A 1YU9A 4G0UA 1GCIA 2C3OA 4ZVTA 4TN1A 4NCAA 1U9ZA 2BMEA 3L7JA 3DTVA 5ALJA 3K0HA 3OZVA 2Y27A 4D43A 3EULA 3BERA 1BDIA 1U2RA 4EMBA 1ESNA 1ZJ6A 2P91A 3N2IA 2VYND 3TQSA 3RJMA 5GZ3A 5JZVA 5LKAA 4BAUA 2QT1A 3VTAA 4XEHA 5KMGA 3F46A 2VJYA 1V1JA 1P39A 1RHMA 4OKSA 4B74A 4BEJA 4BEWA 4TLAA 4CN9A 3O8QB 3UM9A 4NV0A 1ZVQA 3UW1A 4UTRA 5B12A 1SBYA 4RGBA 5DI9A 4C4YA 4XE5A 1QZTA 4KQ6A 4DHWA 3WIOA 1HUQA 4IX1A 4JLSA 1RM4A 3CH5A 4KN8A 4KQFA 2OFWA 2X6RA 3H1FA 2PX8A 5K3FB 2FWPA 2LWIA 3F5SA 4V0KA 2CXXA 3RU9A 1VLJA 2Y68A 4J94A 2YQZA 5FOWA 3CF0A 4FW9A 4JC4A 5J4LA 2VBCA 3MRSA 4QXAA 2ZWAA 1TB4A 4FJ0A 3ZU3A 3UCEA 5IC5A 3G2LA 4AUEA 2BT4A 4JI0B 1AUOA 3GQBB 1IPEA 3NWOA 3VX3A 5I7VA 1SN7A 1T8TA 3E5RA 4MB0A 1O8CA 3TXYA 3K8QA 4K3UA 1OROA 3SC2B 3UH1A 4CKXA 2X4IA 1DHRA 4UBLA 1G8FA 2IZZA 3BTUA 2OK8A 2X7HA 1TPYA 3N58A 3CH4B 3R4CA 3H2HA 3V46A 3ZV4A 2R1VB 5KTSA 2XV1A 4YYEA 4OLBA 1SQ6A 3T0GA 1VI5A 4BEVA 1U80A 1IBKB 2XBUA 1Y7LA 4FGUA 3PHIA 4BXOA 3MINA 1JI3A 3UW3A 2QIPA 1DL5A 2J3MA 4PTYA 3OWHA 4D4HA 4E6PA 3NV9A 2G28A 5CJ2A 2PKXA 1G5FA 1DEXA 1MQ8B 8ABPA 3EDYA 3E9EA 2C9MA 3LQKA 2JKVA 5A5EA 3EODA 3F6CA 4X1KA 3LCUA 2IHVA 3WHKA 4M1SA 3IUMA 2FWRA 3A3KA 2IDKA 4PG4A 3GFOA 4GVLA 2KLBA 2AR9A 1MO4A 3RLFA 3ZE0B 2Q6LA 4YJDA 1TUBB 3VOTA 1DTWA 1EHIA 4DA8A 2HZ7A 2QSJA 5FOXA 4IMRA 2WE7A 2M2IA 3ZU6A 1UOPA 2ZIZA 1ZM3A 4EAAA 2HQRA 2UZ3A 2O8BA 3JU3A 4HUTA 2PKEA 3EQ7A 5JJ5A 1ZW6A 2HY7A 4FFDA 5A7FA 5H16A 5EZ5A 4JSYA 4DIUA 2ZETA 3O73A 4EEKA 1E79A 3Q7SA 3M83A 2Y1KA 4EI2A 1RWPA 1GG5A 4Q19A 4WCDA 5AM0A 2XTJA 2PV0A 4OVKA 5FORA 4F6RB 5IBCA 1Z6PA 2BH2A 1KZ9A 5B53A 4Y98A 3NHPA 4RHXA 4BP3A 1EGHA 3LDAA 2W5UA 2OR3A 3QFRA 4R1LA 4TTJA 2HPZA 3A4IA 2G1JA 2J3HA 3D7RA 1RM5A 1XIVA 6REQB 4X93A 3DLHA 1YHZA 4QYIB 1UANA 4JI5B 1XCJA 1CKEA 3ADPA 4LYEA 3PL5A 4P86A 5DHRA 3RJ9A 1P2FA 2JGIA 2PZFA 2XIQA 2HNAA 1ESMA 2WHXA 2PVPA 2QKYA 4HVCA 3AEUA 5LD2C 4DMHA 4BQEA 1MTZA 4LYYA 2IIVA 2BFPA 2LTAA 5EG5A 4YUXA 4U2CA 1N5LA 2W0SA 4L2IA 1NVKA 2HCJB 2EX1A 3FPLA 4ATNA 2CHFA 3IAHA 4XARA 3R3XA 3BE8A 1N0UA 3A10A 3O31A 4RZXA 1ANKA 1CUGA 4J0GA 3WICA 3CLHA 1SR8A 2XUIA 1TA4A 3CLUD 2PH7A 3WL8A 4E4YA 4WINA 4AZ0B 3VH3A 2DERA 2JIBA 2Z04A 4KN6A 4M3NA 2XHZA 4PZEA 1C4WA 2C1ZA 2N47A 2QLFA 1CUBA 1THMA 4AAYA 3LYLA 1PYGA 1JE1A 1YL5A 3AM1A 3W9BA 3OJWA 5JNWA 1LLUA 3M2PA 3OF2A 3QI2A 3VZDA 4CE6A 5B4VA 4Z51A 2ZYTX 5HILA 4L4ZA 3C43A 1JIJA 1XL1A 1K6MA 2J7PA 2ZR0A 2HSEA 3PA6A 3EPRA 4R1MA 4WY8A 1EFPB 3T12A 2RK4A 3IBGA 4RMNA 2QBYA 2ZXUA 4HB4A 2FZLA 1CRLA 3H0EA 2XSZD 1J33A 1TTQB 1U7ZA 2EZ9A 2ZBUA 3ZCVA 3WAJA 5H8WA 4R2IA 2I7XA 3TDNA 1EP2B 3G2NA 1U02A 4ZCMA 5KOJA 2V59A 4CEJA 4II3A 1HEIA 1Y4ZA 2KJQA 5HNKA 1UODA 4YP6A 1XKXA 2QENA 2PM8A 1NI3A 4HH3C 1W2WB 1NP6A 1RBZA 5DM0A 5E3HA 3AY6A 1G17A 4BX2A 2IW1A 1EESA 5IJ9B 3LCMA 3A6EA 4G6ZA 1VFNA 4NBUA 5DXJA 1JQ5A 3G0BA 4BNLA 1J5EB 1CEXA 3E9RA 4IH4A 4K05A 4KE9A 3ETEA 3SC6A 4ENVA 3H13A 3PQ7A 3CSDA 3QLVA 4RVOA 1FYWA 4JZKA 3KWMA 3DE1X 2H31A 1IZZA 4D4MA 2JVKA 3GJ6A 1U8XX 3ITNA 1Z6YA 2FP4B 2J59A 1DRJA 3KB2A 1XQVA 3LUCA 1YR3A 4F9GA 4R40A 4XVRA 4WE3A 4ZVSA 1CB0A 1QIIA 3ML1A 2P6UA 3PLAE 1EM8B 5EAIA 2DX7A 5AVKA 3KR9A 5IULC 4CKYA 2FWJA 2PAFA 4MVCA 4B3MB 1A3CA 1JHUA 1H2FA 3GLHE 3OFND 2HLNA 1DZIA 2JH9A 1FOEB 1XUOA 3EEBA 3K6JA 2OAEA 4GAEA 4U02A 3W90A 3DSRA 4C6SA 2OCDA 5ARCA 5KYVA 3S5UA 3P45A 3UH0A 3V4RA 1R5NA 3ELUA 4S1WA 2O2DA 3C1AA 4TXNA 4MGIR 2WG2A 4NBRA 1XRQA 3WGTA 5CFLA 4TYQA 2P40A 4QXPA 4X61A 3W7VA 5E1OA 3H4TA 3FVTA 1PJZA 2RG1A 5CD9A 4NR0A 4F5EA 1YS4A 3FOFC 4XTCS 3GLGB 3LBYA 2V7BA 3BRCA 2XDQA 5LA6F 3ZG6A 1H05A 1V8DA 3IS3A 3ZZNA 3VKUA 4YX9A 2DT5A 1V16A 1ZLXA 3MTQA 4GH5A 4MMYB 3MTDA 2APJA 2PX6A 4FHCA 2C00A 4DLWA 3AESB 1DAIA 2QL7A 4NPCA 5D2CA 1ZJZA 5J2UF 1E2KA 2ZJ1A 3PFCA 4AJ1A 1QDUA 4WZ6A 2H1VA 4WKCA 4DDHA 3CNQS 1BKYA 5A03A 4LF8B 3G0HA 4LYHA 1EM8A 3EX7C 4R7TA 2DT8A 1ZIOA 2OGUA 4JN6B 2DBVO 1UXKA 1ZN9A 5FTLA 1F4VA 3NHJA 5JT1A 4WIAA 5AM3A 3QMVA 3E1SA 3E7DA 5CYOA 3DB1A 5DXFA 4QLBA 2AEJA 1TDJA 2RB4A 2BLNA 3FCXA 4DDWA 3L49A 1T36A 5KHOC 1GZSA 1AQ6A 3HM9A 4I55F 2ZU0C 1U3UA 2LDBA 4I6JA 4EHHA 4PW0A 1C7ZA 4EY7A 1Z7GA 5DLQC 5CFOA 2BRUC 4NQZA 3RODA 2HMAA 2ZWIA 1KP9A 1L4YA 2OTCA 4C05A 2AFHE 1XDZA 5P8WA 1GWNA 2REBA 3U7EB 2RIRA 2HNBA 2ZBEA 3DE4X 3GUZA 3H1TA 3I1FA 4TLCA 3MMPA 4J43A 1Z88A 2CVOA 5FA5A 3W5SA 2L18A 2QTFA 4DZRA 4M8NE 2RD2A 2PEYA 3DMTA 2IGTA 4WBNF 4W5OA 2VDOB 1GPDG 1Y5IA 4PFKA 4K0KB 9ATCA 4GXRA 1Z7YA 2VDQB 3STUA 1M6VA 5JDCA 3PX3A 1BWRA 4KQWA 2JI8A 5D00A 4H2DA 1FIUA 1F6DA 3SVLA 4UCWA 1UWLA 3OFSA 5AW3A 1KFEB 4PO8A 1MC1A 2H0AA 2OOKA 3QFSA 4CCSA 4OHYA 3QF4B 4TKVA 2DWPA 1O96B 2GB4A 5F9MA 5D87A 3AVVA 3T7JA 3WZ2A 2ERXA 3MAAC 3TQOA 1O87A 1S2IA 3MJTA 4D26A 3PUVA 1SU8A 5AUOB 4PS0A 3HJAA 1YCDA 3NC0C 3AF3A 4JI3B 2BMWA 3ZYZA 3FPCA 4M0LA 4OHMA 4KI7A 2Z2XA 1BHJA 2W90A 3KOXA 1LS1A 2CE7A 4Y2XA 3NCTA 4JFAA 4CL0A 2HF7A 2IPAB 2ZWOA 2YW2A 3BDIA 4GSKA 4IMJB 2AMJA 3S2IA 3ZWMA 3IVXA 3L8DA 5I7HA 5C0OE 4NS4A 3DDSA 3EK2A 4J29A 3U7JA 4JP3A 1IXRC 1RWWA 1DAGA 3AZQA 4MEBA 3WGGA 4P08A 4TZ0A 3WO0A 5M2QA 4EKYA 1PVDA 5FOUA 1W85B 1OKKD 2EFCB 2QW0X 1CY1A 4D8WA 1GFIA 1WZ2A 2X1LA 3JQFA 1W581 2EBUA 3EVFA 5IYZA 1AS0A 1SQ5A 1XQXA 1N3YA 1DAMA 3NXSA 1MRZA 4HDCA 2ZTVA 1N1DA 4WY2A 3HCBA 2RHDA 4MYDA 4X95A 2MYUA 4OHXA 2PA0A 3RYCA 3CGWA 2ZSUA 1ZLYA 2GNPA 4GL2A 4JJEA 5T4BA 2Q46A 3QTBA 3IAS1 3TE6A 1SMKA 1K66A 1U3DA 3OSUA 2E18A 5AUNB 2IFTA 2VJKA 3JXEA 4H08A 1PFVA 3F5MA 4RUKA 1DC4A 2DLDA 3TW8A 3PFFA 2H1WA 2GPTA 4MINA 1QWSA 1VBNA 4MS1B 3PJRA 2B6HA 3U49A 3OPNA 4MUAA 5K0FA 1FFSA 1U1GA 1V4NA 2OWEA 3AEUB 4IY1A 5F7ZA 4NL4H 2BMVA 4LOAA 4HUQA 2VFAA 2VUUA 2VRCA 3WJ7A 1UKYA 3D0KA 3UXMA 1PZMA 1R6TA 2YNMD 2JGMA 3UANA 1F3OA 2MJLA 1KYXA 1CJSA 1RAHA 3LW7A 2P2CA 4JKOA 4X60A 2R8BA 5ALNA 2K7ZA 3FLEA 4RTRA 3I2HA 3HFSA 1WKCA 2KE5A 3BWVA 5THKA 3TZCA 4CKBB 2AX3A 4P0TA 3RFUA 3TTWA 2JJMA 5EHGA 5HGXA 4U2BA 2BHRA 1E77A 4JXXA 1RWVA 1A95A 1SCUA 5FD8A 1XJ0A 3OTOB 1NDQA 3PT5A 4BVLA 3CVWA 2Z9DA 5ES4B 4PIPA 4PXYA 4YACA 5BO5A 2VSNA 4FIDA 4LHZA 1FMTA 3GC6A 4P4TA 4ZYVA 1M34E 1PS0A 4FYJA 4GEGA 2VSXA 2HWXA 3OURA 1AA9A 2VHYA 3R9IA 2QRQA 3Q5DA 4DMRA 5JRDS 5IAGA 3CPEA 4EP1A 2B5OA 1CD5A 2LBPA 1KDVA 1SG9A 3WQQA 3I39X 4BB9A 1J8YF 4AW9A 4YCBA 3MAJA 5SYMA 4K5QA 1CZLA 3ONWA 3ZVNA 4DM7A 4CIAA 1Z45A 4I6EA 4BQIA 2V1UA 1JQKA 3C3DA 3IMGA 3U1VA 5EJMA 4ZICA 3QJ5A 4IH1A 3T41A 1W6RA 1M1NA 1E1RD 1JJBA 3MIZA 1JYSA 1N1EA 3AERA 4FX5A 4W5QA 1USWA 3NCHA 1N2EA 2IYXA 3DOIA 3PZBA 4B75A 1CW2B 3R5JA 4D96A 2ZU6A 2F55A 1R5OA 1BS2A 2MWMA 4M9QA 4ISBA 3NT4A 5KSPA 4V1CI 2QD1A 4C20A 3HKBB 4LHYA 2WJPA 4L5AA 4QM7A 1JDZA 1L9KA 2DJ5A 4FU0A 1ACLA 2ZTMA 2XT9A 4O08A 4FGWA 4NCXA 3QNUA 3QMWA 1XTJA 2SKCA 4J0DA 2J3QA 4EPRA 1G8KA 2ZIFA 2ADOA 2FUNB 3H9GA 5FYQA 2WWRA 4D45A 4RDXA 1FLVA 1OB2A 2V6JA 3WA6A 1I4WA 2CUNA 3PF9A 2VHVA 2RGNC 1VE3A 1PDOA 1P2VA 2WZDA 3KT0A 5HF8A 5HW0A 3U3RA 3OQ1A 1WXQA 5ADUS 3I12A 1E2HA 4B48A 3HUEA 4URXR 4DR2B 3JD1A 1EKXA 3FWYA 4TLLB 4PU0A 4YCAA 3N2LA 3N3AC 4NOJA 4KGVA 5F4BA 1NVUQ 3WX0A 4M1EA 1GTZA 3QEMB 1YRHA 2H4JA 4F4CA 1Z5GA 1WBBA 1Q7CA 2WF9A 3E05A 2ZI9A 5KTNA 1D04A 2Q4RA 2DBQA 2MHCA 3X44A 3NH6A 3PGXA 1HFWA 4GX2A 1J0XO 4K9LA 4A0RA 5G1PA 1RQ7A 3IOCA 3K2QA 3CZQA 3HK2A 3P27A 1W44A 3IV7A 1ORTA 4QHSA 2NU6B 4FCVA 3BHIA 3V8BA 4BGIA 7ABPA 4BWVA 3EIWA 1R4ZA 4YUVA 2HR1A 4NMXB 4MRSA 4QUBA 1EUDB 4G8BA 1YQQA 4F7DA 4QT0A 2H3EA 1DE0A 1E7SA 2VHQA 3OF5A 5CG1A 3NUZA 2QUAA 3K0FB 5CDFA 2PUHA 5E9JA 1CY2A 1CUCA 1MN6A 1F8YA 1LW6E 2V7UA 4JEIA 5EN4A 2D7JA 3NKVA 2HW8A 1PG5A 3QYJA 4J76A 1WZEA 3DAYA 2QD4A 1KI1A 2J0UA 1ONOA 4B4KA 4W9MC 2AIRA 4I50B 3TI7A 4R84A 4DR7B 1EQAA 3HJGA 1N8KA 5IN4A 4DQUA 3DV9A 1TTPB 1RQLA 2G4LA 4M6WA 2Y66A 2ZPAA 1X0VA 1H4TA 3E5HA 4LJAA 4O29A 1DX4A 3ZZ0A 2VYCA 4BWFB 4R1PA 1N9KA 3PV0A 3V8EA 4DBZA 3AFGA 1HMPA 4A23A 1UP4A 4EGJA 4IIVA 3EZ2A 5AIAA 3LF1A 1XK7A 5DFAA 1YVPA 4C7BA 4HS4A 3NORA 4CEHA 1Z2PX 2X7JA 1O0SA 3Q7EA 2UDPA 2XX3A 4HNAB 4XYLA 2YZKA 4QSMA 1QANA 4O3FA 3KEGA 3TKAA 1TM7E 5I9LA 5GOTA 3UUWA 3NIBA 5DN6D 4KBYA 4WZBE 1DIAA 3NHMA 1EFRA 1TUGA 1N6IA 2WSMA 3HXTA 3JALB 3NJRA 1XMJA 1G5HA 1M34B 2QQEA 3KB8A 4U39A 4YROA 3KKQA 5J1SB 2GVZC 1Q2UA 4KRYA 1QB7A 1CT9A 3ANSA 2FW0A 3ED1A 2R6JA 3ELBA 3GEBA 3LUJA 4F3TA 2CB9A 4RGVA 4Z99A 2ZI5A 5IASA 1RKBA 4M87A 1GGEA 2PPVA 4O6VA 2YYAA 3QU5A 3V9PA 2R6FA 5C1PA 1MIOA 2WSBA 3ENWA 2AG5A 2VYQA 3B6IA 3O26A 1KMHA 2R6DA 2NSHA 4WLNA 1KQOA 1DS6A 4FKZA 2C54A 1GL9B 3RVNA 4OYLA 1H2EA 1U3GA 5K4AA 1Y8AA 3DVLA 2PL1A 3CWZA 2M1ZA 3IJEB 1L4MA 3SNHA 1WSDA 1X7XB 4PYKA 5KYTA 1MU0A 3KTAA 5AI6A 2WU1A 3IAEA 1N92A 2VZ9A 3IO3A 4HDSB 5TR9A 4S1VA 1NPTO 1NRXA 3ONDA 2NZUG 5JDIC 3RFFA 1HDOA 3FDFA 1T2AA 4FB4A 1NJ1A 1KQ3A 1SVUA 4CLDA 4D4JA 4DR1B 2CJXA 1X15A 2BFAA 2P9YA 2Q2WA 2XAAA 3G02A 4XYEA 5C34B 3MQ2A 4MO2A 2UAGA 2YFYA 2IU4A 2WTMA 4R9RA 1A72A 3FHOA 2WWYA 4QNMA 1XPOA 1O6CA 5E0OA 1Y8RB 3LPDA 4I3HA 3AJDA 3OO1A 4G65A 3VPHA 1WLYA 2QR5A 1VBKA 1E6LA 1Z5UA 2LCIA 1P7ZA 3EFOB 4S0ZA 1OBHA 2ZIGA 121PA 3T7EA 3TNFA 1QP7A 2DB3A 4ENWA 1UBNA 2BEVA 4IGFA 3EQ8A 3FNRA 2IV2X 1E1QA 2X15A 3L9XA 4GMXA 3KOWA 5H3LA 1X80A 3SHFA 3F7TA 2YY6A 2VRCD 1C3JA 5TF4A 1X7GA 1SURA 4UHEA 2JIRA 3ES9A 4EH1A 4NMMA 3H8VA 3TSYA 5H7XA 3EWIA 3QENA 3NWBA 4H7KA 3U3JA 1A2OA 1KZ1A 3U1BA 5CGQB 4B32A 4ZMSA 1A5BB 2ZSKA 2JGLA 5KQRA 2GBPA 2PKCA 3Q4GA 1R6UA 5IT0A 2CT8A 4P35A 1KO7A 2O2XA 4ZV7A 4ODIA 4BTVA 4RMJA 4X7RA 3ZDFA 2XWBF 2IS6A 2XYPA 4HAZA 2IUEA 2QRZA 3GIWA 4Z53A 3VKVA 1JEAA 4BO0A 2Q0QA 3NEYA 4EWLA 3AQ4A 1OXMA 2HB6A 3A6FA 3O3CA 4GI1A 4J1SA 2RKBA 1M8GA 4MRAA 3OZBA 4EB6B 1W9HA 4XVHA 3RNOA 5J40A 3PNVA 4KQEA 4E1AA 5B1YA 4DN6A 4EENA 3ROFA 4G5OA 3WMEA 3UOWA 1U8EA 4KMMA 3F8WA 2GEKA 5EGSA 4CQMA 3A1WA 3R2JA 1CB7A 2JVJA 2RGGA 3NYWA 1GUFA 1SUDA 2FRXA 4R83A 1NJ5A 1OLXB 4X3PA 4DC0A 1LF0A 2AYYA 1R4MA 1VGVA 2QN2A 3GO4A 1V2HE 3O7MA 5FA8A 2PZGA 5ELXA 3PNOA 3GT3A 2V7QD 4XUEA 3AL2A 2R6ZA 3T4EA 1F14A 4D3DA 3UT5B 1AKUA 3PRJA 2ZUDA 3ZI4A 4QPPA 4U5XA 1AB6A 4IWNA 1DFGA 1KU0A 1J1UA 2GAIA 2D3WA 1K7YA 4DTIA 4YDSA 4Z9BA 3HB5X 5I4BA 4Y0VA 3OCZA 1GYRA 2VT3A 3W9UA 3SHWA 4L16A 1T0BA 1WMFA 2QQ0A 3AZOA 1Z74A 4ALNA 3GVIA 1ZIDA 5CJPA 3O8LA 3WGYA 2QTZA 4DIKA 2XTAA 5DYNA 4LDPA 3GFTA 3TN7A 3Q41A 4HZIA 3SX2A 1LPAB 1NRJB 5FTWA 1CC1S 5JZBA 5LN1A 2Z2JA 5HIIA 4B83A 1JAXA 1E3QA 1DARA 4P2GA 3EJWA 1ORDA 5LNK1 5KX5B 3DGFC 3HKDB 3GCWA 1R9MA 3ELDA 3OETA 5KC8A 3GPDG 4BBZA 3NBUA 1NIPA 1IIBA 2X5OA 2FZGA 3CZAA 3NT2A 4NFYA 4Q7JB 1CUFA 1SH7A 3CEMA 2EEPA 4KH0A 4RS3A 1QIKA 2X40A 4UUMA 2QXTA 3DBRA 4IWYA 4O4IB 1I6LA 2HJHA 3RS3A 3PD7A 1UINA 3DBHA 1P5ZB 3AM5A 3KNZA 3OE1A 1OXVA 3JTMA 2J9ZB 3FMGA 3VHQA 3UK7A 5IT5A 3DE5X 3PF8A 3Q0IA 3UHJA 2P9JA 5H9VA 1H85A 1O8BA 3B1YA 5JSYA 4F5WA 4G5RA 4HZGA 4MDYA 4KMSA 4NYJR 4RY9A 4N0MA 1A8HA 3TVDA 1GSAA 2Z2KA 4CUZA 1BYUA 2BJWA 1K8XB 1UBMS 4CEJB 3P19A 5CM8B 3NOQA 1LZLA 1T0HB 3JWGA 2NO7A 2AJDA 2R97A 4XWKA 1XJ5A 1XZBA 5JBNA 1USKA 5EE9A 1IOZA 1ZD9A 3VAZA 2WJIA 2YC2C 3EEIA 5CLJA 5DP1A 1ZJYA 4D9CA 1KVTA 1O9GA 1WXEA 2VQ3A 2YOHA 4W1SA 4DQKA 2ZIEA 4F4DA 3H0KA 1A8SA 4Z8YA 4C87A 1KETA 1F8XA 1UMKA 4NAVA 4DUGD 2GPYA 4X94A 1X0XA 1RZ3A 2VI5A 1S4MA 4EVRA 3RIGA 2OZPA 4IH9A 3K4QA 4WQMA 4Q9JA 2IEDA 2KBFA 1GPNA 3D8BA 1P4AA 4RPGA 5MDHA 1YQGA 1A9QA 2HHJA 3JR7A 3KZOA 1NRIA 1ZGGA 3OI7A 1U0RA 1D2RA 2Q6KA 4L2IB 3FI0A 1NR5A 5F1KA 4RS4A 1SD1A 2XMCA 4I55B 5FBKA 4AFNA 3E22A 4ZDIA 4JR2A 1JN0A 1LY1A 1BRTA 1H2BA 2PT9A 2EWWA 1DPGA 2RB5A 1TU3A 4F71A 5HXAA 1W7AA 1JG4A 1I6KA 2QTLA 3AB7A 5BWCA 2WILA 1NAHA 2A7QA 2WUGA 1IIRA 4KFCA 4RESA 1E2EA 5EWJB 4Z0NA 1YIDA 4PYNA 4RK5A 3P26A 3VSEA 3ILHA 1KGDA 1RYEA 3ZS8A 1NE2A 2ZJBA 4GQBA 4TXJA 2JBHA 4KPEC 1NXXA 3BB3A 1EP3B 2GYWA 2MYNA 4FFBB 1I80A 4H1HA 3O95A 3GLTA 4RF4A 3UT6A 3PEWA 4D9MA 2J0QA 4PX9A 1F2UB 2QL9A 1IEQA 2TRSB 3QKRB 4MCJA 3RC8A 2ZATA 5EERA 1OAOC 4DQDA 4AJ2A 1GUYA 2L82A 2EKQA 4BHRA 2OQIA 4D4KA 2H17A 1YBHA 3VA7A 4CT0A 2O06A 3SX0A 4EO7A 1YDFA 3N75A 3ENVA 3PP8A 1JIUA 2VF4X 4JNKA 3TG8A 3UPTA 1JE0A 2FSPA 2I2CA 3RJ5A 2ZBGA 4WI1A 5F5XA 2F6RA 2PXHA 3C97A 3U4QB 5A62A 4CM4B 1RXWA 4R3WA 1K8QA 3DVQX 3QUSA 4V0ME 4CQLA 2D6FA 1HSZA 2FFHA 3E48A 1XHEA 2PWYA 3DTYA 4N01A 2OB1A 4P58A 2QL5A 4K2HA 2AV6A 3MILA 3NHYA 4MARA 4F5ZA 5BSFA 1NG9A 2OC4A 4RHYA 4YONB 2BCGY 4W9NC 5JNVA 1FFWA 1U7TA 3QSGA 3ZH2A 2KHZA 3NEAA 4DCTA 4QU8A 4RE5A 3HWSA 1QV9A 4HNSA 4FOLA 3TJZA 3M1YA 2RAUA 3LBIA 4CKEA 1L2TA 1U8CB 1WQ4A 2GDJA 1P19A 2DCUA 2QP4A 3PWKA 5KAPA 5KYUA 4DCPA 5K6TA 1SOMA 1E62A 2CGEA 3DP7A 3DHWC 3FJ1A 4FOPA 4W5WA 5DBHX 4G07A 3VKHA 4YAIA 2FP4A 1MJGA 3EDRA 4M4SA 3JPWA 3QIVA 4TYPA 5TS2A 3TEJA 3TIVA 3C6ZA 1M6WA 3A1EA 3DAPA 4LX8A 1F60A 3SE7A 2VVTA 4CHTA 3CXUA 1X1CA 2J9RA 3G2QA 4KXYA 3OFKA 1WXWA 1FNBA 2BKVA 3U4QA 4DPMA 3TAHA 4PONA 3UY4A 3OEYA 1YMQA 1R9JA 2ZAIA 3W2GA 2NXCA 3DO5A 2SICE 1BD4A 1PNRA 3MUOA 2XUKA 1P75A 1W4BA 5G1OA 4HEA6 1C50A 3RSQA 2RH8A 2BPOA 3A1VA 3AJ8A 1G8PA 2FEAA 3SLRA 1ZGZA 3VU8A 1FDUA 1A7AA 2QAGC 2ZYUX 3Q5EA 1Q77A 1I7PA 4PLHA 3WB0A 4BGVA 4MHSA 1PGJA 1GGNA 4DFDA 2G63A 3O4GA 1CTQA 1ZN7A 3GEEA 5AK0A 3RU3A 3ZU4A 4GPD1 4L51A 2QMHA 2ZKIA 2AZMA 5JRZA 4JI8B 3M5PA 1ZGBA 2ZJOA 3H9QA 1K8YB 1KI3A 2XVYA 3FW1A 4P7FA 3CGGA 4X92A 3N1UA 4AZVA 1OW3B 5GGXA 2BBTA 2JFQA 2WVGA 4YWJA 5A0VA 4AURA 3MWLA 4ERXA 3DXXA 4UE6A 4JD5A 4DBLE 3VDNB 4MVJA 3HWX1 3CRW1 1L1QA 4L0MA 2X5XA 3D6VA 3CZPA 1P2BA 3CZRA 2ZS9A 1LPOA 1UPXA 2DFNA 1Z12A 3ESRA 4HHEA 4I14A 4DS3A 1B0PA 4OLAA 1U0BB 1E1KA 4R16A 1M2OB 5F1OA 1E1NA 4WCVA 3EZFA 3IP8A 3JQ9A 2A5LA 3R3JA 4LJ4A 4U9IS 1TKBA 2ANCA 3AP2A 1MO5A 2XRZA 3VSDA 5T7BA 2YMLA 1TF7A 4B0PA 1EGVB 1K88A 3B89A 3O7WA 4MKZA 1ZW1A 3OIWA 4NNOA 4KITB 4M1YA 3KUUA 3HP1A 1DEKA 2JASA 4JI1B 4RACA 3LWBA 1D1TA 4JBYA 2AI2A 3KHUA 1A97A 3LCRA 4R0NA 2DQSA 3CW9A 2X6TA 2D5IA 4BCDA 4WBSA 2PUFA 1ZIPA 1B6SA 5J43A 1JEJA 2ZJ6A 3K30A 4WXEA 3QBVA 3VZSA 4F5YA 3PG5A 4ALIA 1M0WA 5ICGA 1VLZA 4CVNA 3V8RA 4F5DA 4Y1FA 1I9CA 3DDUA 3DZIA 4L75A 2ARKA 3V80A 3P9YA 3TGLA 2MINB 4XR4A 2GEBA 4FQ7A 4ZRMA 1FP6A 1O1YA 4MIYA 2RI6A 1PSZA 3O8DA 1HH4A 4ZIRB 4MULA 4N8EA 1JDBC 4ESEA 3G8BA 2OE2A 4Q4AB 1EVLA 3CI0I 1B2RA 4C6HA 1JDTA 5TMPA 1G8HA 2CMHA 2NTYC 2Z30A 1GR1A 3UHFA 1K5PA 3R7WB 1E98A 1UDWA 1ZH8A 4G0QA 1Y89A 2IYWA 1DG1G 4JBXA 4WLVA 4WMLA 3U6KA 2O54A 1IN6A 2A52A 2IXGA 3W7BA 1JT9A 1XAGA 2Q3EA 4MKIA 4XIGS 4JUCA 1HM5A 4OQZA 4ENQA 2LIPA 2M98A 3EB9A 2BBWA 3HR7A 1QWOA 3KKZA 4QVGA 1OREA 4YMIA 3ZD8A 3A1TA 3LHFA 3Q2IA 2FHPA 1CZOA 2BL4A 5FPQA 3WQRA 4A26A 4L4SA 5E2AA 2IHUA 4B7XA 1O03A 4DV3B 2WYIA 1QYIA 3GARA 1QRUA 4R9VA 4ALKA 4BZWA 4CMGA 2ZWVA 2ZVDA 2QZ9A 4MKGA 1GCOA 5TARA 3N8IA 4DV6B 4YP1A 2QF7A 2Y93A 4KQJA 3ROMA 3K9BA 1UBOS 5UKDA 1GILA 2JAUA 3EFBA 5KU1A 4YCDA 3VNQA 3ZE7A 4AQYB 1MPTA 4O1MA 3BHNA 5GTDA 3RS4A 4LC1A 3HDJA 4Q39A 2VAPA 1Y8CA 1E99A 2OLKA 1WXDA 4PLGA 4FZRA 2G0NA 5LCXA 1QH1B 5HKKD 4INJA 3IAS6 3UBTA 3EZNA 1UKVY 1MF7A 5KVSA 1S9HA 2OAGA 3ZK9A 1CR1A 2P9ZA 1DDGA 2PUVA 4DGSA 2GR7A 2GZMA 2GXUA 5G1NA 1WE2A 2FCAA 1SRRA 2JGJA 2M1XA 2UYYA 5DMHA 1UC4B 4FHGA 4Z6KA 1X74A 1K89A 4XLLA 2O8DA 1IWOA 2RGBA 2QMQA 1JG1A 3AEZA 1SZPA 2CLDX 2DSNA 1KJNA 1RRGA 1XYGA 1RXSA 2WJWA 1PEAA 1U7UA 3C5VA 3B70A 2DBYA 2X0IA 3GU3A 4Y2GA 3THSA 4WRRA 4IZOA 4PZ0A 3PSHA 3F9CA 3ZHQA 1GRNA 1M8FA 2JFVA 2J31A 4IKEA 3EGOA 2QNRA 8MHTA 4IJWA 1RYMA 4RXTA 5TRTA 4POOA 1II8B 3QP9A 3KBBA 1LNQA 2QPAA 1N4DA 3MG9A 4FZ3A 4MA0A 4UMVA 5L3RA 4DA6A 5AW4A 3UPUA 1G63A 2BFDA 2F48A 4MWGA 4AZTA 1CBUA 2RIPA 3BEOA 4NCJA 5E2IA 2ACVA 2YCBA 4J0FA 4HOYA 5FWYB 5P21A 4GM4A 1CE8B 1A76A 1GYPA 1CDOA 2C4MA 3EXAA 3H2JA 5EMJA 2V5VA 2VP3A 3EISA 1KMHB 2EXXA 2FK7A 3RQSA 3T5TA 1UKAA 1Z5NA 1ZSNA 3B3FA 4L9AA 5AYVA 4V1CA 2O14A 2OGZA 5JO0A 1T5OA 4Q21A 3GGPA 1NVXQ 3T7AA 1E1MA 5HQ3B 2GPBA 1GL6A 1NQAO 1L0BA 3V4FA 3W78A 1X70A 2XGOA 1NTOA 1U1IA 2RDMA 3FWHA 2QLLA 3W9YA 2GJ8A 3O4RA 4RHTA 4N5NA 4KIUA 1BXRB 2B2CA 3LWDA 2E4YA 2BGUA 4IDPA 3R3HA 1GRVA 2D0IA 4RJKA 1LV7A 2AFHA 3HI6A 1SOVA 4X90A 1HETA 5F76A 4DRXA 4NZ9A 4XCXA 1BH6A 1QK5A 1JZQA 5HYVA 5L3ZA 2J46A 5E38A 2X9NA 3CZ4A 3FFWA 4M76B 1UBSB 4HNGA 4EO4A 4ROTA 1ZR2A 4CMAA 3LKVA 1IPHA 2E4VA 2WU0A 1T91A 1U8TA 2Y0CA 3LDFA 4LFCB 4NH4A 3SY8A 1P1FA 5AXBA 4C88A 3H5OA 4EITA 4YR7A 6LDHA 2XVAA 1WMSA 3UMJA 3A6DA 1PJCA 5K3DA 3PCTA 4P7GA 4XAQA 2XIJA 4IINA 4HK4A 4DJDC 4B71A 1RW4A 2C77A 2C2BA 4P3OA 1KYTA 2IYPA 4GS5A 3ROEA 1Q0SA 3EW9A 4PFSA 5M3BA 1BEEA 4F1JA 1WY5A 2M9MA 2QTBA 1QJ4A 3V2GA 3Q0EA 3S2ZA 3RUPA 3ZJUA 2C5AA 2MMGA 4Z0TA 1XP5A 3JZMA 4RPKA 5JD3A 3K70C 1YRWA 2H2FA 1VKRA 3QVKA 3MELA 3RK0A 1KK1A 3NEPX 1XMOB 2HA2A 1ZNWA 2IKQA 4H4CA 1MUUA 2SECE 3ZJ5A 2NU7B 3QKWA 3G9XA 2HYDA 1YZGA 3CVJA 4UM8B 5H3HA 4ZOBA 2ZROA 2CF6A 5T6MA 2LCQA 3W5CA 4OK5A 2VYVA 3ZWDA 1OD6A 4Q82A 1VMKA 4RJLA 1EG2A 4KQKA 5J1TB 4GD3Q 4HNVA 2FE4A 3DTNA 4ETIA 3DLTA 4ABYA 2WG1A 3GP8A 5DI3B 3R6LA 4ZT2A 2OBXA 2HEIA 3RUIA 1UKEA 3FBTA 1CVLA 4ARAA 4ZYZA 2CLMB 3SI7A 4C07A 1LQTA 2FX2A 1P7PA 3QNMA 3IMEA 2ZQZA 2O8FB 3KELA 1EVEA 2XMRA 4AS1A 3HV2A 1HSOA 4RYDA 3TTUA 4JJIA 2AR7A 3FNEA 4L15A 1N9GB 5AH0A 5F23A 3QPUA 3PX7A 3G9UA 1Y3HA 3QWHA 4ZEWA 3VX4A 4N40A 5IPFA 5C46F 5ICSA 3G9ZA 1ZHHA 1SJ9A 4GLFA 4OGFA 1W94A 1AB5A 3RG8A 2DPLA 1YS1X 4F72A 1PAUA 1O4VA 1IZ7A 2XVXA 3ON5A 4X3CA 3PC3A 2COUA 5GV8A 1ZR4A 4BFXA 1EBUA 4QATA 3GCGA 4D0SA 4CQJA 1AKQA 1DPFA 5TVGA 1AQNA 3NVMB 2AHRA 1RKUA 5HCUA 3EGDB 4E33A 1OI2A 1QQTA 2RONA 1VCOA 4DANA 1OWOA 2H5IA 2YTZA 3S0JA 5DBEX 5G2FA 5LR6A 3AVQA 3R9WA 1VKHA 1ZXXA 3EAFA 4UQPA 3V7YA 4D57A 3WZMA 1T5SA 4YT8A 4I81A 4R8RA 1T4CB 1Y1PA 3L6CA 2GO1A 3RF7A 4GKKB 4P3YA 5IVIA 2AOTA 3FFAA 3WLFA 1AQUA 2CXSA 3LX5A 4MA5A 1AV7A 4XYBA 2XXBA 3ZQKA 2NSYA 3ZGLA 2ZBFA 4KEAA 5JSKA 2AJBA 5T4FA 1K9SA 2FKNA 4XUDA 3AIIA 1QHGA 2WPDD 2WT9A 3TSWA 5ALTA 5CDUA 2W42A 4ZQBA 1ZGCA 2VZ0A 2CMKA 3DMHA 4GZMA 1VIYA 5BV2P 1E0KA 2QZPA 4EBFA 1O94C 4H60A 1ZOLA 3QUAA 5DNUA 1UL1X 2R66A 4NBLA 2A0YA 4PAQA 2F4NA 3UAOA 1GNTA 1KHHA 3C6KA 1A9YA 1OLSA 5AKXA 5ESRA 4EHAA 5CCEA 3AYZB 2QVYX 3OMWA 3H5NA 2X1MA 4A91A 4QSHA 1KJQA 4I1VA 1YS6A 2GVNA 1CQWA 3HVKA 4MV6A 2DUMA 1WM1A 5D5HA 2DQZA 4RVHA 1O58A 3UT0A 2HHCA 1BJKA 3ABOB 4PYRA 2J32A 5BV0A 3EA0A 5JPCA 3ZWBA 1WOMA 4DNXA 2C7RA 2J3KA 2EERA 2JJYA 4C08A 1ADGA 1LRJA 1F8UA 2OHGA 2I4MA 4LJ9A 1E2BA 4POAA 1KKUA 3VVBA 3F6RA 3IILA 1JPVA 1FMCA 1OI7A 1PFYA 1XEXA 2CK3D 3L05A 4YWHA 1GXSB 4A6EA 1EVKA 2NTJA 4RM2A 2PK3A 2WF8A 3U39A 4NU0A 5J4YA 2NVBA 1VKOA 2XNHA 4A16A 1JP7A 3ZY4A 3RC7A 5T57A 1R9GA 3HDYA 5E4JA 3C3YA 2OESA 1KJ9A 3GFQA 1E3MA 4N3BA 2VTBB 4LDZA 4EI8A 1PLLA 1TNDA 4EECA 4XASA 4K81B 3ZJVA 3LNCA 4RKRA 4WLOA 4BFUA 1DVRA 3GRCA 2DAPA 1GFSA 2WUWE 4JJ8A 4B6GA 3CIOA 1OJLA 1B14A 3EGXB 1WDMA 4NEGA 3CLTC 5HZMA 4JYAB 4BNKA 1NFFA 3EVCA 1JF8A 1N6NA 3ESAA 3U48A 4CLEA 5M04A 1LQUA 1TMOA 2V7WA 1JG6A 4FGJA 4KRGA 3W3AA 4UOQA 4ZAYA 1WAMA 1Z22A 2ECQA 4DSAA 1JKFA 1T2FA 4ZJPA 2VLBA 1XVLA 3L4SO 1YZ3A 1K27A 5KNDH 3QUBA 3ABSB 5FOQA 1NBME 1HI9A 3F47A 4H6XA 3Q2KA 3SJCA 3OMXA 5IM5A 1HNWB 5F98A 4BOYA 1DRKA 3QGMA 1V37A 1SM4A 1UQRA 1RP7A 4LMBA 1ZQ1A 2CXHA 4WK0B 1Q7EA 1JBEA 1YV9A 2XB8A 4WNAA 2B4AA 2JAPA 2D1RA 4JI4B 2WD7A 1EE9A 3IEPA 5JJBA 3LXMA 2O1SA 3N8NA 1K6IA 2Z8YA 3TCXB 2C4HA 2ZRFA 3Q85A 4PYLA 3CTMA 1XZEA 2Y71A 3C24A 1PQUA 3JY6A 4HPWA 1AD2A 1DV2A 1PWXA 2GETA 1S02A 1PRYA 2UZ1A 2PGNA 3E3AA 3I6ZA 1XN4A 3JD2A 2YZNA 4G1MB 4IZHA 5ICFA 2ZYSA 3KYDB 4RA6B 2BF7A 1KI2A 2ORVA 2IHJA 1SWWA 3A6HA 3MQ4A 3H16A 5DH9A 1O95C 1D2AA 3LUBA 2AUMA 3P71T 1MGOA 3KZMA 4MIEA 2I78A 3T5PA 4OU4A 1EFUA 2HQBA 2ZJ4A 2I9KA 5LQRA 3HL0A 2XLBA 1DWUA 3DZ8A 3EXIB 2H85A 3F9IA 5K3OA 1QPZA 1QONA 4ZARA 1J5XA 1QS0B 3KHTA 5EY5B 1M6EX 2CCGA 2R6HA 3NW9A 4RJ2A 3BIJA 2BISA 5EC8A 1N7JA 2O7RA 5D5QA 4I50F 1P0CA 3T1VA 4Z9FA 5BW5A 5JQGB 2YIVX 3SIXA 1CF9A 3T7CA 3I5YA 2R5FA 2G08A 4RTPA 5AJWA 3IUQA 1VE6A 1K3FA 3HRIA 1R74A 1RKVA 1VCMA 2IGBA 5IK2D 3K0AA 2JF0A 1UBRS 3ENKA 4C29A 3KX2A 5J4HA 4PRYA 2DG2A 2AW5A 3HU5A 3W2HA 4RW0A 1AUQA 1ZSVA 2A5JA 3RGGA 3WLMA 3OLZA 1GGFA 2KBEA 1U28A 2QHXA 1JMKC 1HE8B 4KWHA 4LE0A 3TIGA 1V9LA 4A2WA 5C8VA 2JHFA 5HJ7A 2XRMA 4H0CA 2AF3C 2AXQA 3BT7A 4UDXX 3SBDA 4ER0A 3SJBA 1GNPA 1WPGA 4RK4A 1JVNA 2HREA 3FJOA 4L22A 1JAHA 4ALLA 3QOFA 4IYRA 1JGTA 2Z5LA 3Q8XB 3OTHA 4A73A 1XTBA 2R4TA 4O4JA 1ZA2A 4W5JA 4BQRA 2WUEA 3LY5A 4IJUA 5EPUA 2Q9AA 3QH4A 3RIYA 4BMVA 3OJFA 5I47A 3WP0A 4IOKA 3DMFA 3I72A 1M0TA 3ABQB 3INYA 1U04A 4O4IA 1T10A 1E3SA 4C43A 2XD4A 4E5YA 3K1ZA 3H7AA 1U1CA 4CRWB 4OJKA 4TRJA 1YZNA 2JIMA 3G85A 1QNLA 1QZXA 1Z29A 1LDNA 4HNRA 1XKLA 2RH9B 1WXIA 4ZCSA 4M8KA 3RTCA 1G0NA 1YB1A 1O5OA 5D84A 3W1VA 2C1XA 2JCXA 2Q3FA 4IFBA 2JJ2A 4OG2A 5FCDA 4CM4A 3LPCA 3FOZA 1EH5A 1XZLA 4O63O 1TI7A 3COYA 2UYOA 5KU7A 2DUNA 2ZE6A 1VHQA 3WGHA 2YOFA 2VNHA 3EG9A 4CIXA 2WTNA 5BNZA 3LG2A 3OU7A 1E18A 1T2VA 2EGHA 2G25A 1GKUB 2OHXA 3L0YA 4PBTA 4QDUA 4TTRA 4UUOA 1Y5MA 3Q3EA 2DHCA 5SY9A 4BLSA 2G16A 2VTBA 2ZJ7A 1AZSC 1DQNA 1DEAA 1I1HA 2I8LA 2FSUA 3O0DA 1EA7A 1I33A 3P9ZA 3PNMA 1Y1QA 3QTLA 4K1XA 1GZVA 3ZVRA 1Y1RA 4FSHA 1AOXA 1W0KA 2P3QA 1T1IA 4W9NA 1GPYA 3CPJB 3OIFA 1IWBB 2HWWA 4LF4B 4F1KA 1YK1A 4O0LA 3MWEB 3K1AA 4LXIA 4RKEA 2XZLA 1U1EA 4UJ3A 3S44A 4YCNA 1Z4LA 2Y0BA 4B7AA 1D2EA 1HLDA 3W4IA 4UD2A 2HOQA 4LWOA 4DLLA 3U60B 2ZTSA 4K28A 2Z1NA 4X6LA 5DTEA 2IUUA 5ISMA 1UMDB 3DYIA 3CX3A 3MCWA 4JJ4A 3ST7A 4EIWA 2FI1A 2IXTA 3OE7A 1GEEA 2HD4A 2H16A 5KTYA 3MZ0A 3AV3A 2R5NA 1IN7A 4JP1A 3B9QA 4YJ3A 2VUIB 5L3QA 3FWPA 4EHLA 2RBGA 1CNEA 1OAKA 2YXNA 2EX0A 2ZRGA 5DKFA 2EG5A 2BOVA 3BKWA 1SK9A 1E0DA 1ZGHA 1A8UA 4KN5A 5D1NA 1E2GA 1PR0A 3PGJA 5F5NA 3V7UA 3WHIA 1FLDA 3Q6NA 1Y1LA 1CFZA 5B4TA 3A37A 3CFAL 1ZNZA 2H7YA 4QRIA 3IQHX 4K6OA 3GAAA 3AMVA 3SVZA 4G1EB 3AWIA 3BQ9A 1NNI1 1NW4A 3LVFO 1J8FA 3SQXA 2FN7A 5LD2B 4Q12A 1ZK0A 2NTVA 2PWAA 2XAUA 3JW8A 4ZO4A 4P98A 5F33A 2I6UA 1I5EA 2XMPA 4UHBA 2PU7A 4US1R 5AW6A 1XHFA 1UBGA 4IIDA 1XJCA 2WWWA 2CXRA 2ZSBA 2B1IA 5IMSA 3N74A 3KQPA 2GN2A 1C0LA 2YY5A 3PXBA 4TSRA 1RJ9B 4KL8S 4NMHA 4I1YA 3O4IA 5A7GA 4YO7A 3LHSA 1D2GA 2ERCA 3LP6A 5CA0A 3N70A 5G0TA 2AFIE 2R2GA 3VRHA 4K7JA 3TBFA 1BQ3A 1JHOA 2WK1A 1YBVA 4RQBA 4LZNA 2GRAA 5TY0A 1SULA 4M37A 3GHYA 2XMZA 1FDOA 1GG9A 3SIRA 5LYYA 3TQFA 4D98A 1TQHA 1ZN2A 2WFAA 5TC4A 3M9XA 4M0KA 5LQJA 1YZFA 1TEVA 3GMIA 2EEZA 5GPBA 1QX3A 4L07A 3X2FA 3FFXA 3WRXA 4KLCA 1N2BA 1HQCA 4IRMA 1R0XA 2C2YA 1W46A 3GP3A 1QLWA 1ZJWA 3UIEA 1G21B 2G04A 2QMYA 2VJQA 4KZKA 4F21A 4IGEA 2ONZA 3V32A 1L7XA 4ALJA 1I0LA 4CG0A 2QVXX 3WIBA 1U3WA 3DV0A 1NMZA 4DQLA 4EB0A 5EZYF 2GWRA 3V8QA 3ISTA 2YVLA 4UHFA 5MN6A 1DIOB 3IP3A 3PQFA 5FUXA 2NZ2A 3N2YA 3QYPA 4OY3A 4DZZA 1ZH2A 1WTAA 1RYZA 2I6XA 4EUSA 3C1UA 4CKWA 4DV5B 3I2FA 3G6KA 2QQ5A 3B1ZA 4DC9A 2B92A 2W2QA 3GLFE 4NOLA 2B35A 2ZCVA 5KQSA 2H1OA 1NVGA 4DPLA 4B3GA 4QEKA 1E5LA 3RM3A 4FDUA 3ZNOA 1OWNA 4I5EA 1YE5A 1FU4A 2WUDA 3PHHA 1NBOA 4RLHA 1DOHA 2R7MA 1XRJA