4MUEA

Crystal strcture of pantothenate synthetase in complex with 2-(5-methoxy-2-(4-(trifluoromethyl)phenylsulfonylcarbamoyl)-1h-indol-1-yl)acetic acid
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
287
structure length
276
Chain Sequence
b'PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 93
structure length 276
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4mueA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mueA01
3CLUD 1VBNA 5K0SA 3PNVA 3FDXA 1O95D 4MUGA 4K03A 1KQPA 4I6EA 1NUUA 4PBTA 4KR9A 2NZ2A 5HG0A 1O96A 3G6KA 4ZT4A 2E0IA 4Q16A 3COYA 1I6KA 2E89A 1KQOA 4QRDA 2QJOA 1KQNA 1IHOA 3FHJA 4QREA 3SP1A 1YUMA 4HJXA 2C5SA 3A05A 3COVA 2VTBA 1QU2A 3ZXIA 4EG7A 1LI7A 4MVWA 1YULA 4RPIA 4ZCTA 3COWA 3FH0A 3NBKA 3IVXA 1ZUNA 4DE5A 3UY4A 4MWDA 4YBRA 1X8XA 3KT3A 1TYBE 5FO0A 2AZXA 1H1TA 3ZJTA 2JANA 4DJAA 3C8ZA 4HJRA 4JXXA 2ZUEA 4EG6A 4EG3A 3E27A 1KP2A 4MVXA 2AG6A 4MUFA 1G8FA 4EG5A 1QRTA 1IFXA 2QTRA 2QTNA 4MW5A 1OWOA 1EFVB 2JAXA 4RUKA 2TS1A 3U1VA 3N8HA 2HGZA 4R2MA 5EKDA 4EF6A 1WOYA 3FY4A 1O6BA 3D6UA 3NBAA 2RD2A 1G59A 1P7PA 3CVVA 3QE4A 3CVYA 1OBCA 1G8HA 1QJCA 2QUIA 1F9AA 3ELBA 4L2IA 1F7VA 3GLVA 3Q12A 4OJMX 2ZUFA 2CFOA 4DLPA 2X0KA 4MVCA 3S3TA 1WY5A 4HK4A 1FYDA 3IH5A 1SURA 3KT8A 1OWNA 3FIUA 1JIIA 2GKSA 1MAUA 2YY5A 2A1TR 4ND6A 1PFWA 1MB9A 1OWPA 1U7DA 1NURA 4PBRA 4MUKA 1H3EA 4UZFA 2DERA 2J09A 3HMQA 1H3NA 2D5BA 4F3RA 1NYLA 3ND7A 4NX2A 3UMVA 1QNFA 1IQ0A 4ZCSA 2R5WA 1GLNA 2V0GA 3TS1A 4NAHA 1D2RA 1CT9A 3IVGA 1I6MA 4MW6A 4OUDA 4ZCPA 3A04A 4TS1A 4EGAA 3CLRC 3GMIA 4MW4A 3F3MA 3PNYA 5J58A 1COZA 4U63A 1IVSA 3IOCA 3CLSC 1NUSA 3INNA 3IODA 1MBZA 3CLTC 2J07A 1R6XA 2QJFA 1U0BB 1M8PA 2YWBA 1EFPB 4MW7A 2QUHA 1T9GS 3RFFA 4MUNA 3FG9A 3G5AA 1NUTA 3DV2A 2AKEA 1N2GA 3HL4A 1T6YA 5J5AA 1K97A 1VBMA 1TYCA 4EG1A 3TQOA 1GTRA 5LFAA 4G6ZA 3IUBA 3ZXSA 1LW7A 4GRIA 1N78A 1PFYA 2PXHA 2WQ6A 4MUEA 3CVUA 3LCJA 1RQGA 2E18A 4ZT3A 4K0RA 4G5FA 3N9IA 4R2LA 5FNZA 1T6XA 3P0HA 3FETA 1O97C 3TZEA 2J4DA 1J1UA 3SDBA 3IUEA 3PNBA 4CDMA 1TYAE 1O96B 2XRZA 2QTMA 4EG8A 2O8VA 1H3FA 1T6ZA 2DXIA 1HYBA 5F23A 2V0CA 3H05A 3COZA 3QTBA 3X1MA 1KAQA 3BL5A 3LOQA 2PZBA 1WXFA 2DPLA 2VTBB 1O5TA 1OBHA 4H3SA 1GZUA 3RBAA 4MWEA 1KH2A 4JFAA 3AFHA 4JYZA 1U3CA 1R6TA 4FZJA 4G5YA 1WJGA 3ILVA 3K32A 4HPWA 5KWVA 1KR2A 2Z08A 2DUMA 1ZH6A 4X0EA 5AHWA 2IJGX 2CYBA 1YIAA 4Q93A 1M8FA 1ILEA 1MC1A 2OQ2A 4MWBA 1N3LA 2PZAA 1F7UA 1K4MA 3CVWA 2HMAA 1Q15A 1IQUA 1JIKA 3N05A 2A1UA 3AG5A 4NZPA 3OP1A 2A88A 1J70A 3CA8A 1JEDA 1U3DA 3ZUGA 5TS2A 2CV1A 1MRZA 4ZCRA 2A86A 4YP6A 3HGMA 2J08A 3MUEA 2PFSA 3X1KA 1VBKA 3H99A 4P2BA 2JA2A 1MAWA 4ZT6A 4BWVA 2H29A 1J21A 4ARIA 1N2JA 4EG4A 1UFVA 1TEZA 1WKBA 4I6JA 4KPUA 1FFYA 1IQRA 1NI5A 1GTSA 3IMGA 1M83A 4JZYA 1QU3A 1IRXA 5IHXA 1JHDA 3IMCA 3TQIA 1KH1A 1O94D 2I1LA 3TZLA 4MW9A 1PG2A 3RHSA 3AKZA 3QTTA 4ZCQA 4L2IB 1OD6A 4ZT7A 2YXNA 3MLAA 2DEUA 4WNYA 2QJTA 1EUYA 4MW1A 3X1JA 2CUZA 5TEWA 3IOBA 3UK2A 5H16A 2PG3A 3HFJA 3L92A 3M5WA 4YP5A 1U7XA 3AIIA 5TEVA 1NP7A 1T9GR 4J75A 1JEEA 1XNHA 1JZSA 3I05A 1WQ4A 1I2DA 3ISJA 1MOPA 3CLRD 1V8FA 3FWKA 3P0JA 1NUQA 1QRUA 3H9BA 4R0NA 5KHAA 1JECA 2X1LA 3DLAA 1G8GA 1GPMA 4YMIA 2E21A 4NDAA 3L93A 2CYAA 5KCMA 2CV0A 3MMXA 4MQ6A 1M1ZA 3KFLA 3RJZA 3RK0A 1EUQA 3HZRA 2A1TS 2IELA 4OUDB 3AG6A 3ND6A 1YIDA 1WXEA 1IH8A 3AL0C 1N2OA 4UZEA 3K9WA 3PRHA 2O5RA 3SZ3A 1M8GA 3ND5A 1QRSA 2ZP1A 2QUKA 2WSIA 4DDHA 4EFKA 3CVXA 1J09A 3CLUC 3OTWA 2CSXA 1O95C 5LLTA 1QTQA 4F4HA 1N77A 4AS1A 1O97D 3G59A 1Q19A 3UC5A 5K0TA 2VXOA 3H97A 2IP1A 2B7LA 1TYDE 4NATA 1GAXA 2OV4A 4MUJA 3FOCA 2A84A 3A2KA 1YI8A 2XRYA 1KP3A 2RE8A 5DASA 1OWLA 4CQNA 3GUZA 3IOEA 2H2AA 3MLBA 4KR7A 4J76A 3SEZA 3N2YA 3FNRA 1EE1A 4MW0A 2GM3A 3JXEA 3SEQA 1BS2A 5BNZA 1WZ2A 5H7XA 4CT0A 4MULA 3IDFA 4ZT5A 1N2HA 1X6VA 3DO8A 4DDKA 3HV0A 4E1AA 5JBNA 1N75A 1N1DA 4GU5A 3IVCA 1KKUA 1EFVA 3MXTA 1NSYA 3RK1A 1M8KA 1I6LA 2PIDA 1NUPA 2YWCA 1F4LA 2WB2A 2DLCX 2A7XA 2Z3VA 1MJHA 3PXUA 1J20A 2CT8A 4ARCA 3VU8A 3P0IA 1TQ8A 1LI5A 2CV2A 3DPIA 1MB2A 3Q4GA 4U8HA 4MWCA 1WXIA 4XFJA 5DB4A 1ZJWA 2D13A 4MUHA 1J1ZA 1PFUA 3ZGZA 2J5BA 4XFDA 4KKVA 2CYCA 2EL7A 5HUHA 2A1UB 3H9CA 1ULHA 1TFUA 4QBTA 2WQ7A 1O0BA 1Q77A 1YUNA 4U7JA 3FI0A 5LM3A 2X3FA 4MAFA 3D6VA 1PG0A 1KH3A 1N2EA 1EXDA 1M8JA 4CDNA 4NAUA 3Q10A 4WSOA 4ZT2A 1KAMA 2A4MA 1JMVA 1NZJA 3P52A 4PY2A 3SYTA 3KT0A 1QQTA 4ND7A 2NSYA 1V47A 1JIJA 4KPUB 3ZJVA 1WXHA 5IJXA 4MUIA 2BYTA 4MVYA 1O94C 1N2IA 5DK4A 3CR8A 1O0CA 3SZGA 2HZ7A 4DNXA 1GN8A 4KR6A 1JZQA 2Z09A 1K4KA 2DETA 1JGTA 2D54A 3IMEA 1K92A 3VRHA 5DEOA 5TGTA 3CLSD 1WQ3A 3CLTD 2QUJA 1JILA 5HUJA 4MLPA 1Y42X 4YP7A 3KT6A 5J59A 1XNJA 1EFPA 1OWMA 1B6TA 1KORA 4I6GA 1A8HA 3UOWA 1XJQA 2BTEA 2PZ8A 2DR2A 1ZH0A 4MW2A 2EJCA 4S1OA 3VGJA 4DDMA 1PFVA 1XNGA 1Q11A 2X1MA 1DNPA 4PBSA 4A91A 3A4IA 2GOYA 2G36A 3ZIUA 4AQ7A 3TNJA 1R6UA 4XSVA 1VL2A 1WXGA 4JXZA 3NV7A 1N2BA 5FO1A 3ZJUA 1S4MA 1EJ2A 1VLHA 3LE8A
chains in the Genus database with same CATH superfamily
1VBNA 3QWFA 3PJDA 5BR4A 2C4KA 2Z1DA 4OHCA 1U2QA 4PZCA 2DJ5A 3KJGA 5IVPA 3OQ6A 4F6CA 3RUPA 2UYOA 1NDQA 1LBTA 3WI7A 5THKA 4ZT4A 4AROA 4CEHA 4KPYA 2Z5LA 5AR1A 1CNEA 5BPHA 1FEZA 1KQOA 3AOGA 4JGIA 1EFHA 2YWGA 2Q9UA 4YJ3B 3KQKA 3HCRA 4D6PA 1AF4A 2ZI5A 4IXDA 3R3SA 1QS0B 5KDLA 1FUYB 1MB3A 1I4EB 1N6LA 3MGBA 1NE2A 4G01B 1IK6A 2F17A 4RFLA 5FBZA 4YDSA 2H1IA 1G1AA 3MYYA 4NFSA 1E7MA 3ENVA 2R1TB 4Z49A 4E5KA 4WERA 1TJPB 3L0BA 1T3ZA 2V7XA 5FB3A 4HYEA 5IJ9B 4EHHA 3L8MA 2C95A 4AK9A 4ZALA 3DF7A 4RPJA 5D00A 2WP8J 2Z6VA 3IVXA 3NBKA 4ITVA 4CG1A 2AMYA 4OG2A 3IUNA 4JDUA 1YFJA 1XTQA 1GZVA 1BOOA 1E7QA 3PHLA 4E94A 4JJ4A 421PA 4NH4A 3E4DA 4L51A 3VZBA 1PQPA 3L1UA 1Q95A 2OE2A 2YC4C 3HO6A 3LQKA 1V3UA 2ADFA 4INZA 4YLGA 5ENDA 2NYVA 2XGJA 4Z4GA 2QG9A 4TT3A 3PTLA 4V0OA 1LTHR 1QVZA 3EGXA 1FFAA 3MT0A 1GFSA 3PX2A 5KYYA 4EVSA 1QAOA 3OT4A 4JXJA 4GXNA 2ODAA 3P71T 4DDVA 3OZUA 3GPLA 3HPQA 1M2WA 3LC7O 3MTBA 4LC0A 1UP6A 3GK3A 4NBUA 1A8SA 1Q7TA 5JW6A 4XE5A 3VU1A 1PZHA 4R84A 4O2AA 4Z8YA 2VKTA 3D59A 3HB1A 1NV9A 2DBRA 4D9GA 4HR7A 1S1CA 2JIMA 1WUHS 3BXHA 1SCNE 4L3VA 3KEFA 4OATA 3E03A 4HPJB 1EBUA 1Z2DA 3KJNA 4TL8A 1G8HA 5DNAA 4IDCA 1QJCA 4ALKA 1QCCA 4Q19A 2VRCD 1BKSB 5B6JA 2GESA 3DJFA 5JUWA 2B30A 3ZGOA 1J0EA 2IT1A 2O52A 1JHPA 1R16A 3ELBA 3EZ2A 1KJJA 1R0CA 1UOOA 1KI4A 4AZTA 3C3JA 4TQUS 1S3GA 2WU4A 3U7EB 1SXGA 1OASA 5EE3A 1ZSVA 3M6MD 1V9SA 3GEDA 3MWEA 2YICA 3A6DA 1E6LA 1UZLA 4DBVO 3A9VA 4IZ6A 3BFJA 5UKDA 2O06A 2ZBVA 1ISFA 4YQFA 2EWVA 2X3UA 5H02A 1V1MA 4C88A 4ZEVA 4QNRA 3U3KA 5MN6A 3RQIA 1QMGA 3T0FA 1QNLA 4JP3A 4LA4A 2WKSA 2ZBFA 3C4JA 1AQLA 2D5IA 4RADA 4W7IA 3I92A 4W8OA 4EPRA 5AVRA 5HJEA 1XQWA 3P4YA 2D3TA 4X54A 2P62A 4J7CA 1EWQA 2PFKA 1L5KA 5CTJA 1ORDA 3CSDA 3ETNA 3HSKA 5JCPA 4Q9IA 5H68A 1ZVKA 4JKIA 1GLNA 4LQDA 3DLPX 1P5HA 3TS1A 5FFNA 3R8CA 2C4TA 3QJGA 3QKSB 2CBXA 5EVCA 2SKEA 3SF8A 4OHFA 4TKVB 2C2BA 2Z9CA 5DOZA 2PCLA 4OMCA 2VBGA 4BB9A 3Q3HA 5FWXB 1IONA 3H42B 3PSAA 3C97A 1TCAA 4IH9A 2JLBA 2CVFA 2HBRA 3W8EA 1HNZB 3CLSC 4BFXA 1VYHA 5C51B 4F5YA 3BDAA 3PXCX 1Q0UA 3RW9A 3DBIA 3AHDA 2QSJA 3EVAA 3GQBB 3ROZA 5L6MB 5TXGA 2O8FA 4HAOA 4REQB 3TRDA 2PGLA 1HV8A 3NNDA 1PEAA 3R6DA 4LJ4A 5DBHX 3U44B 3WLMA 2GTPA 1U2ZA 3V4RA 1F8FA 1MO5A 1KVSA 2O6LA 4PG6A 3EVTA 2XCUA 4HX9A 4DEXA 3UAYA 3ZE0B 5HZHA 5DTQA 4WFJA 3D0QA 2QAJA 1P5RA 4ZYTA 5IKEA 3BX1A 4K9RA 1DADA 2FN8A 4J0HA 3O8LA 4AN4A 4QASA 3U44A 4NNJA 4FYPA 4L15A 3KKNA 5CB6A 3UJHA 4PC1A 3CFAL 1ISSA 2E55A 1VL6A 1YZLA 2AEJA 3HNRA 4G5FA 1NC1A 3BD6A 3P9PA 3GP8A 3IBGA 3DLBA 1PK8A 3AVWA 1S0UA 1YF3A 1J4AA 4XYBA 3J81A 1YQDA 4KPFC 1Z38A 2G3DA 2I3BA 4IXMA 3UYLA 4WOKA 3I01A 3MBOA 5KYVA 4BWYA 3DWGA 4ZP1A 1KXJA 4P4TA 4TVKA 3AK4A 3UC9A 1FU4A 2XCRB 1KFBB 2GVDC 3IQGX 3QLVA 1AKQA 1QDEA 2VZ0A 4L6IA 4EJSC 2EWWA 2JI4A 4QPDA 5DHTA 2JZCA 5J9FA 1KO1A 2XEDA 3HCEA 4JXKA 3ROMA 4FNMA 3BHMA 1KO4A 3AEZA 2WIDA 1NIPA 4KFUA 2XTAA 3R2JA 1IN7A 2YZMA 4MMZB 2OFWA 1E9EA 1JNXX 4JYZA 1XTIA 3WQRA 2WV9A 1TI7A 4G0MA 3NASA 4PZ0A 3WL5A 3AW8A 3HLYA 4XLLA 2O50A 1MA3A 1ZUD1 2EOAA 3HKCB 4S1NA 2NYUA 5J43A 2FN9A 3OLCX 1G18A 4RK4A 1O8CA 1GFIA 3LY5A 3OE5A 4ZAZA 1UXOA 3KZCA 3E61A 3QXGA 1NPYA 3JYPA 4QTXA 5ALNA 3L3BA 3ZU4A 3ONDA 3IT2A 5B7GA 1FTSA 3ST7A 2X22A 5L3VA 2Q4TA 3RASA 2J3LA 1QYIA 2CHEA 4QBFA 4FB4A 2HRCA 3HI6A 4EITA 1J70A 4TLAA 3CRRA 4J3FA 5B1SA 3R6WA 4WZBA 1C9KA 3SMQA 4F04A 2RCYA 1JAHA 2PKRA 1KR5A 3VR4H 1J5XA 4L02A 3DUFB 3MMNA 5AOBA 3UB2A 1NBOA 2OBMA 3N6RA 3GZJA 4PTYA 4J43A 2BR4A 4IWNA 1DBRA 5K6AC 3WIUA 1M1XB 3RAFC 3EZFA 4MJLA 3EPLA 2QMQA 4QO8A 1MD9A 1Z63A 1VG8A 3KB1A 3U7IA 1ZRHA 1C0LA 4PR0A 2WZQA 3QE3A 3N87A 3PE4A 4KBGA 1U2TA 1E4VA 1QFYA 4KMMA 4M46A 4PCLA 3QKWA 3TVYA 5DI9A 4N03A 4RD3A 5DGDA 4QVGA 1V4BA 1XA0A 2W43A 3HVKA 1KH1A 4I9GA 2FSPA 1Z5NA 2JG3A 2FPLA 2GLXA 4MPDA 4BDTA 4XR4A 2I8AA 2Q49A 1ONNA 3NNSA 4IOMA 2CHUA 5GMOA 3FPSA 3BPSA 4MV4A 3W4KA 1BEZA 4EX7A 5B36A 1DX6A 1ZJYA 4WNYA 1UWKA 4H7HA 1GL6A 4MCIA 4N0EA 4NCAA 5TEWA 1E79D 4R1UA 5ELMA 4MYDA 3T7SA 3JPWA 3L7IA 5AI4A 5CJJA 4IXWA 4ON9A 3G23A 1RQPA 1W36D 3I1FA 3WVNA 1P2TA 2R1ZA 3GVPA 2WD7B 2RGEA 2WSMA 1CUXA 1W29A 2NADA 2OAEA 1B3RA 4DHEA 5TQ2A 4LJLA 4KK3A 1OOEA 2G04A 3D4IA 3M6LA 4X8MA 4ARAA 1IUKA 1IWBB 4DQVA 3MBKA 3QF4B 5LQNA 3K09C 2CWDA 5JCJD 4E2ZA 3ZGXA 3FHCB 3U40A 3IQDB 3CBGA 2P78A 4LXHA 1DBIA 5AM3A 1MAHA 3WG9A 3KFLA 3LO8A 3MAGA 4ZQHA 4INJA 2I3DA 3O8DA 4P7JA 4I14A 4KXWA 4MR9A 2GJ4A 4ZO9A 2JIDA 4YQEA 3TRJA 3AL0C 3VSCA 5CX4A 1R9MA 3DOFA 3FM9A 1OJLA 1IZ7A 1JSLA 4RTPA 7GPBA 4U1RA 1QFXA 3L0PA 3T4PA 1IIBA 3NZEA 4TSFD 1FIUA 4WXYB 1E7WA 2VUHB 4G8BA 4JX8A 3B6IA 3FWNA 3G1UA 1KJ9A 3LAWA 4IDGA 3O3NB 2Q4BA 2VF2A 3RVPA 5K0GA 1VLMA 4KKXB 5ECDA 5IZCA 2H4ZA 3EPKA 3AEQA 3NVMB 1CUBA 3OLQA 3EEQA 1GZ3A 4JHXA 5JO9A 1E2BA 3ZCQA 5THQA 1L6IA 1DJMA 1JL3A 3WMFA 2C2GA 4L0CA 3W3AD 5BV1A 5DLDA 4MR8B 5AVTA 5HZGA 2MSCB 2OQVA 2Q9CA 4L1KA 1UJCA 2BHLA 1YBHA 2PT5A 4BRZA 1NVFA 4IL5A 4Y9TA 3X2FA 4HD8A 4YT2A 1WMDA 4NATA 2P8JA 4C7MA 1S2LA 3EEIA 4MVJD 1YI8A 3UXMA 5C53B 1QMPA 4XGRA 5A6SB 2LUOA 3CSSA 1Y3DE 4G1FA 3KUUA 4FLFA 4IFTA 3VO8A 2RJOA 3IOEA 3R5HA 3VNUA 1ZVQA 4Y2TA 1LWNA 2ZITA 2NTVA 3H18A 3WQBA 1AGYA 3A4MA 2BFDA 3HJTA 2RHDA 1LUAA 3KOUA 3AI3A 3HUEA 5K3CA 2F67A 3EJ6A 3PQCA 3IDFA 1L5GB 5EA2A 4QFMA 4FR2A 4GX5A 2LMEA 4GE0A 2QXTA 3SHFA 4CE6A 1C80A 1CEYA 3ELDA 1EZ4A 1JA0A 2PH7A 3HV0A 2ISQA 5TMDA 1ZA1A 5TT1A 1N1DA 3IVCA 2G63A 2FNAA 1OLXA 3PKZA 3VPCA 4O4IA 4OMFG 1F6WA 1UMDA 6PFKA 1E1CB 4EJ6A 5TMPA 3SDSA 1FY2A 1ZS9A 3AYXB 3L9XA 5T6BA 4Q48A 2AYZA 1QH9A 3V33A 2Y0EA 2W6JD 1MB0A 4K8OA 3PNLA 3WK9A 3PGKA 4B6OA 4RL4A 1DIOB 4I19A 2PX3A 4MARA 2JCGA 2PKCA 3WYCA 1GKKA 3FVRA 2BJWA 1J0AA 2WF9A 4JSYA 3DV9A 3K1TA 3NBFA 3PDCA 4DR7B 1S6YA 3MHPA 1RW4A 3PJGA 4QQRA 3E2MA 1T0BA 4J0JA 4DWJA 4RFVA 3TW0A 1K8RA 2OGZA 4Q9KA 1HT3A 2HOQA 4XA8A 4EX6A 2GXQA 2FJ0A 4U7JA 5TPZD 2Y4OA 5MDHA 4W4TA 3B9BA 3D6VA 2P77A 3WGVA 2C2WA 1LPSA 4XIJA 3EFOB 2ZGVA 4IJVA 1ULBA 2Q3EA 3NFYA 1XZKA 4C21A 1NJGA 4LN1A 1NA5A 8ABPA 1L5SA 3A1DA 1EWYA 1E9BA 3TGWA 3FVVA 3GNTA 4RTMA 4GNRA 4F8JA 3QX9A 1XVIA 2FR0A 1NF9A 4DLUA 4JWTA 4QOEA 5EIHA 4N5LA 4RGVA 3SZRA 3V2GA 2VR1A 4Y1GA 5LCXA 4EEXA 2YKGA 1PS8A 5J5VA 5K3FA 2A2ZA 2C7GA 1NSFA 4UEKA 3HJRA 1SUBA 1KFCB 2YZNA 2YIJA 5EJAA 3U3MA 1HLPA 2C2YA 3ES9A 1VKOA 1EGQA 4H3HB 4XQ0A 3WFIA 2C8VA 1O94C 4JLNA 1XQYA 3WIBA 5A4FS 5DLPA 1RYEA 2GZHA 1FYFA 2IDZA 3PUVA 4JI8B 4EYQA 2HPAA 4M1TA 1JZQA 3B1WA 4KSYA 4R81A 1DJLA 4X95A 4K40A 4PO1A 5KIAA 1B1CA 3OIDA 2R3SA 4W9NC 1TLLA 4KXQA 2YQZA 1D2CA 4EKEA 2QU8A 3NHYA 1OFUX 4I4IA 5AM5A 1DKNA 1GV1A 4PSUA 3WBJA 1I7PA 5KJCA 3GLGA 1PCXA 3SE7A 7REQB 4YCNA 4RMHA 5T67A 4G8CA 4KWTA 1W47A 4BZQA 1FFSA 2FRDA 4P3NA 2QWXA 2C7VA 4KPGA 1TM1E 5IBPA 1O08A 2JAUA 3V6MA 2VAPA 1G8YA 4XIFA 2E82A 3GV0A 1ZR4A 4P4SB 2X1HA 2YQ5A 3GLRA 2PRKA 3AB7A 3K6JA 5AD1A 2ZFUA 3ESZA 4MUXA 2YNMD 5DCLA 1ZOLA 5COBA 1AUOA 4K46A 4XDYA 3W6ZA 2WD8A 3QHAA 2BMDA 4E31A 1N2XA 3TQQA 2C77A 1PRYA 1MFPA 2D1QA 1M34E 2B94A 2DGDA 2JAQA 3A0UA 1GR0A 4AYTA 3N2KB 4QGAA 3PV0A 4DIOA 2UDPA 1G2OA 2DUUA 3GARA 5JDIC 2WT4A 3Q9LA 2Y76A 3HXPA 3SFVA 1H69A 3D2CA 2J3DA 4L7QA 1EJ2A 1VLHA 2VJMA 5C7IO 4EB8A 1ZNWA 3W3ZB 1J06A 1YJBA 1GARA 2I03A 3WLJA 5IC4A 2QYTA 2QT0A 5D1NA 4B32A 2Y0DA 1WMBA 4BP3A 4P22A 1DTWA 2X6QA 5G0UA 4MUGA 3A6KA 4RWEA 1XK6A 8ATCA 3EZXA 4AO7A 1NUUA 3IILA 2GWHA 1J33A 5LMZA 1GPAA 4WLEA 3EGDA 3H19A 5DHQA 4P3XA 1D6SA 1XDGA 3OKFA 2B4YA 1ISHA 4JBYA 1L7XA 1DTSA 1XO1A 4WXPA 2P7HA 4TXMA 4B17A 2PZKA 2XEXA 3M5CA 3M9LA 1QH8A 3M6XA 2QJOA 4IVPA 3EQZA 4KWHA 2E4AA 5TDHA 4RPHA 5L51A 1ZEJA 4NZYA 2KX7A 5G2OA 3X0DA 2PD4A 1UOEA 1G8SA 4AICA 4U2BA 3S68A 4UU1A 3ZXIA 1Q7RA 2IEGA 3DPUA 4HWOA 2ZXFA 3W5AA 2CL5A 2HDWA 1AM4D 1V5EA 2KS6A 3DC7A 4MV8A 5F21A 3EMOA 1A71A 5GJCA 4BJ1A 1VYVA 1NRXA 4URZR 4GQAA 3SFTA 1QG2A 4OGWA 1LPMA 1RQ7A 2VRNA 3E8MA 5DULA 3FH0A 2V4ZA 4FBGA 3QENA 3V1MA 1BCSB 1J5PA 3U80A 4WASA 1FQOA 2P6NA 1S8FA 4AKTA 1Q0SA 1X8XA 1HTWA 3MRVA 4D7AA 1XDZA 3NUGA 3FPHA 3HBJA 3C8ZA 1RWPA 1LY1A 1G20E 4QG3A 3R23A 4EG6A 5KBYA 1PI3A 2COUA 1M3SA 1H2EA 3SZUA 2B8EA 1CUUA 2BMJA 1FTQA 2J30A 3BFKA 3NTXA 3PR2B 4RWZA 2EDCA 2QJWA 3WGLA 3CF4A 1MX9A 2C88A 4RK0A 2NZ8A 2VF4X 3K0CA 4MV9A 2VZ9A 2FXIA 2QE6A 4GS5A 2Y1FA 3PFKA 1SCUA 2A5YB 3CG0A 5FUXA 3AU9A 1SVSA 4YXWA 2FPRA 2QTNA 1WSAA 1AF7A 3LUDA 3DYIA 5AVXA 5CYGA 1FDUA 5HVNA 1Z16A 3R75A 1Y7TA 7AT1A 3V4PB 4P4UA 3STHA 2QTFA 1S02A 3GP5A 3IPYA 3WL8A 5J47A 1NJ8A 3KDSE 3H0KA 4PAGA 2OK7A 3ZV6A 3AY0A 4B6SA 2A5DA 2RD2A 5A4DA 5I7HA 3IR7A 3G0HA 4RVHA 3WMRA 2GK4A 5HKLA 3UF0A 2VRCA 4EB6A 1EPUA 3W5HA 5KC9A 5KJ6A 3K70B 2CCGA 2UYYA 4N5MA 1AY0A 1DIGA 1XEFA 3S2EA 3WKBA 1R00A 1GLVA 1TDJA 1ZOSA 4CYMA 4ZMRA 3IO3A 1AQYA 1QYDA 1R0YA 4XM2A 2X0KA 5FTKA 4HK4A 3KHTA 5LPNA 1FYDA 5BVHB 4C07A 3L7JA 1R3UA 4PZEA 4X8HA 4W99A 2VTKA 3SU8A 2YJZA 4RAOA 1NXPA 2PKYX 2QYSA 3ZVRA 5KNDH 4CCYB 3SOPA 2GX6A 2J3KA 2OMKA 2PUHA 3V4VB 2HEIA 1JH9A 3R76A 1Q1EA 2UKDA 3GJTA 2BEWA 5ESXA 4POOA 3ENKA 3QLEA 4LNUA 4MDFA 3DVAA 4OHYA 1F8UA 4C7VA 1E9RA 2GASA 1I30A 3DE5X 3E0QA 4C43A 6REQA 2AG1A 4JBXA 5AJVB 5T6MA 1DDIA 4C0LA 4D3DA 5U4XA 1A8PA 1ZP6A 3V4FA 1CDEA 3A9WA 3PU6A 4FGLA 4R0MA 4OHXA 5LZ5A 2V0GA 4PIMA 4E33A 2WIGA 3PX7A 4HDMA 2ZPTX 2VDLB 3D0KA 3RUDA 2YHBA 3R0XA 4W5TA 1T9CA 4PSDA 2ZJOA 1SCDA 3CUUA 1I10A 2EBWA 2IV2X 2HMSA 3HA5A 3E84A 3WO0A 2ZIZA 4AFNA 4DRXA 2GTHA 4CLDA 3MSCA 2ZSEA 1HZJA 1ZI9A 1JT2A 2QRGA 3A6EA 1JDZA 3LDUA 4AJ9A 1ZL2A 3TW4A 1W49A 2HRBA 2VDWA 3DEFA 4P80A 5CCXA 1KYYA 5DGHA 1WP4A 1XJ5A 4LHZA 5GY7A 2IUTA 3EMBA 2CJFA 5FUMA 1ZM4A 3C85A 3AHHA 3JV7A 3F5SA 1XL1A 5ANRB 5LQSA 3CT4A 4D81A 4ZEMA 3TQHA 1ZEMA 1NBEA 2NU7A 2P3SA 2QBYA 3MPOA 1K97A 1ZI6A 4NV1A 5K3AA 3CX7A 2HSWA 3DYVA 1PJCA 3DPSA 3R7DA 1IHUA 2R66A 2J87A 1QRRA 4Y1RA 4CLRB 3AH8A 4DF3A 4KX3A 2EJTA 1XK7A 2LRHA 3H4TA 3RFVA 4MIOA 1ULAA 3RTAA 3ZY5A 1U1IA 3CNQS 4QIHA 3N7AA 2C5LA 3NEYA 4O8ZA 5CPFA 4NAVA 4B8ZA 3GZ4A 4I9UA 1CSEE 2DH5A 4O4LB 5EHXA 2PZJA 3CZPA 3TZCA 1HE4A 5LYJB 2CLKB 4LGMA 1OAAA 1FUIA 3E1GA 4RLQA 3UN1A 4EDHA 4CKYA 3UJPA 2VJPA 1QIGA 1GFWA 3DXFA 1VQ1A 3K6KA 2HRRA 1NVUQ 4KE7A 5ESWA 3RIGA 1A2KC 1V5IA 1T29A 5TGZA 4IEEA 1H3FA 4NDNE 2EZ4A 3N2GB 5SYMA 3BH0A 2N42A 4RPCA 4OK3A 4GOXA 3JZFA 3JWGA 2P69A 3S27A 1SWVA 2ZXEA 2YHAA 3OY7A 4BRSA 1RWNA 3K4QA 1VG9B 5LL6P 1I33A 4YX9A 3GU3A 4DLAA 4ALIA 3VI3B 3RKRA 1N4DA 2D4AA 4R31A 1BXGB 1UXHA 4XD7D 1Z5ZA 1P2FA 2OCIA 3B36A 1YK0A 1Z36A 3KVOA 5GJWC 1W4BA 2AK3A 4ERXA 2CNWD 4AMUA 2WIAA 2VQEB 2AOVA 5IN4A 5AHWA 3OPXA 3RS7A 2XCOA 3NOOA 5BN4B 1NVTA 3EODA 2EBHX 2VHCA 5DVZA 3UWKA 3ORQA 2IOYA 2KM1A 4IJWA 4WTOA 5J2TF 2PR7A 2VJOA 4YONB 3RFTA 2I4OA 2ZJBA 1OXTA 1QR6A 3GUVA 4JP8A 4ILKA 4ZVQA 1C9DB 4GP6A 1N2CE 3GT0A 1JE1A 4Z7JA 3G8AA 1ILWA 3JVEA 1FZTA 3RVBA 2AFIA 3RS2A 1UQTA 1DZIA 1LPAB 4AKIA 4PYLA 1MRZA 3T5AA 4MEJA 3AKEA 1N5JA 1VCHA 3HN2A 3KVRA 1GKLA 2WRZA 2FEOA 1TT7A 3BOSA 3C2QA 3CNEA 5F7ZA 2CZGA 3PS9A 3R0ZA 4JY7A 2I66A 3CG4A 4OH1A 1J21A 1RACA 1VJ1A 3IP9A 3RODA 4HMOA 1Z0UA 2J4CA 1Y6GA 1I0ZA 4DWWA 2HFJA 3KVVA 4RPKA 3IQEA 1N5OX 4FT4A 1VP3A 2X9VA 5IJ0A 3WGKA 1UBLS 2ZIEA 1YVUA 1JDBC 1N1MA 5KU7A 2OCLA 2COEA 1FW6A 4JI5B 1M2JA 4OLFA 2IUYA 3H5AA 4TTRA 4Z9XA 4M1YA 4KVZA 3GMDA 1ACJA 4L2IB 1RWWA 3IERA 3JSAA 1P9RA 5I7EA 3ETJA 4WDQA 1P8JA 1WDMA 3STXA 1PHPA 4F97A 2GYYA 4FN5A 2V58A 4KOAA 3T5BA 5B4UA 3EVDA 4M1QA 4MW1A 2IP2A 1JAYA 4YIHA 2A53A 2OG2A 3IAM1 5LN1A 3RWBA 2C5GA 4N8SA 4CG0A 6ADHA 2PG3A 1TIBA 2PBZA 2PVSA 3QZUA 3RLFA 1YS6A 2MMGA 4DCSA 1XALA 4PNEA 1SOMA 2ZRHA 4X85A 3W78A 4JQCA 3BJZA 2P68A 1RC1A 2W7TA 2NZUG 2IFTA 4FHFA 5FD8A 5DM70 2NIPA 2CY0A 3QVXA 3TR5A 4NEQA 1DBSA 1HT2E 3KSBC 4DC0A 4U2KA 1E8MA 2Y0CA 2Z5FA 2R8PA 4HP8A 1ORVA 3UMFA 1P74A 1SD2A 1A97A 1W5SA 5EXXA 2HIMA 3SQLA 1G8GA 2W4IA 3VJKA 4LF8B 2HK8A 2PR2A 2Q5CA 4HDNA 2YXBA 4NDAA 4MKIA 3REGA 1JLKA 1KEEB 1KMCA 4IDPA 4TLMB 3S44A 3ORHA 5E4TA 4MQ6A 5B1DA 3KD3A 4OB7A 1PAUA 1U2RA 3FUWA 3OJEA 2ECPA 3QV1A 5F5LA 4DLZA 4ENQA 1WSBA 1GILA 1IH8A 1KZ4A 4RAQA 4EIWA 3T7RA 1YBVA 4EGJA 3K9WA 3KTDA 2FQYA 1YD7A 2C58A 1NW8A 2QTGA 5FOVA 3TD6A 1WSDA 3PHHA 4K9QA 1FQJA 1CUIA 1M8GA 1UDWA 3V8MA 4KQXA 4ZJPA 3S81A 2QT9A 2AUTA 3RYTC 3EFBA 3SGLA 2ZYVX 4MEBA 3QEAZ 4X8LA 2CUTA 1UPUA 2O57A 4XDGA 1U5BB 1V0JA 2W2PA 3PLRA 3HH8A 4RA9A 4RH1A 3MAJA 5L40A 1Z15A 2JBWA 1F48A 3M4JA 4BLOA 2FWJA 4C4PA 1QH0A 1ZITA 4I4LA 5A05A 1Q19A 1XMSA 1LX6A 4JLPA 5K0TA 2YFYA 3AGQA 3HJGA 3IESA 5CM9C 3OQMA 4ESOA 4LGVA 4OX9Y 5EHGA 1M5TA 2G76A 1BHJA 4MVJA 3MWYW 2O7RA 1DQSA 3ENZA 2AQHA 2BM8A 1QOQB 2OV4A 3KVNA 1FZQA 4IVNA 2V59A 1LSUA 4YTEA 4DIEA 5JXHA 3L8YA 4KQFA 3ON5A 3QXXA 5DASA 4CM4A 3MXOA 3PUHA 4E30A 1SR8A 3R3XA 4MWTA 4TWAA 1U31A 1V6SA 3KPWA 3JQ9C 3LPDA 5CHYA 8LDHA 3PFGA 5FV4A 3OUZA 2W2KA 2QD5A 4UHFA 1DAMA 3CBQA 5DHPA 2W98A 1IAVA 3R3YA 3ZQUA 2IH5A 2MCFA 4LJ8A 1WE2A 1AX9A 3H0CA 1VGVA 5JBNA 1DB3A 5JYCA 3KQSA 3LYAA 5HILA 3KBOA 1Y6FA 4BBAA 2QUBA 2GARA 3CURA 4Y9RA 5PNTA 4ARVA 2DYKA 1IOZA 1RSZA 2W6JA 1VJTA 1B41A 2H1CA 1OGIA 3EXHA 5J2UF 2EKQA 3P0IA 5KQRA 3LCRA 3KP1A 1RAIA 4NBSA 2PRSA 3RK0A 3S1AB 2SNIE 5GZ6A 1LLUA 4MQUA 1QQAA 1UEIA 1AHPA 2QQFA 1J07A 4KEAA 1ZWLA 2WI8A 4BEWA 2BFEA 3JQEA 4UHJA 3RBVA 2ZAYA 3ZGZA 4LOKA 1PHRA 4M60A 4O63O 4RQUA 4YRCA 1JHRA 3ABIA 5JJKA 5TPZA 3ZDXB 1KPHA 4FOOA 2WQ7A 4YMTA 1ND6A 1YRLA 1YR8A 4V1CI 3QVSA 4RULA 2X3YA 4DV0B 4IDDA 4NV3A 4Z9FA 3DBLB 3ESRA 2ORVA 3L82B 1BDMA 1B0PA 1GZSA 1YB5A 3K5WA 4HAUA 4L5IA 3QUBA 4N48A 1R37A 1W4LA 2E5WA 4CV3A 1VB5A 1OZFA 3D4LA 3GIDA 3LKVA 1W87A 2REQB 3R6GA 1NZJA 2VQ6A 4O1HA 4FFBA 3PDUA 1R0RE 2X19A 3FAZA 4E5NA 1INLA 4GL4A 4DA6A 5CT9A 1PVOA 2Q0QA 1LZKA 2FV8A 3D3QA 2BGTA 2FQQA 3TOSA 5IABA 1X1AA 4M38A 5DTJA 4PZDA 1NKTA 4JEMA 5MFZA 4MVYA 4ABTA 1BRMA 5CURA 1A1VA 1XXLA 4UHBA 2HNKA 4I8DA 3B12A 3PJEA 1ZUWA 5BW0B 2P0YA 3NGLA 1RZRA 3PEVA 2C4HA 1SG6A 2HADA 5FPSA 4RXTA 1OLOA 3DL0A 3RTCA 4QUDA 1XZDA 4D9EA 4GE3A 1NMEA 1KEZA 1X7WB 3EZNA 3JQRA 1PZFA 2ZVPX 1K92A 4Y6GB 4F60A 5HW0A 2DPYA 2UUOA 4IV5A 2FZEA 1ZVVA 3ABOB 1MC5A 3PHJA 1ECCA 2WB4A 4OLBA 4Y98A 2WJ6A 2H6EA 4BKPA 2X8AA 3KE9A 2A9PA 4ZZ2A 4B46A 1EXWA 1JEAA 1A8HA 2XWQA 3UOWA 1XJQA 1Z4MA 2ODBA 2PNJA 3ZW8A 3GJSA 3QMPA 3UUGA 4DC9A 2VDKB 5ERGB 2J48A 2K2WA 4L28A 1M2HA 3W5IA 4J6FA 1Z2CA 221PA 2X4IA 3T4UA 4B2IA 1XDBA 5H80A 3O21A 4YREA 1YMUA 3CZ4A 5GQSA 2FB9A 4PBSA 2O59A 5CB4F 1L7NA 2CKDA 4WOBA 5H70A 3B1KA 1VI6A 5IP5A 5KX5F 2FMTA 1T25A 1DBVO 1R6UA 4GZ6A 3THWA 2WVJA 2NVWA 5IXSA 4FKBA 4I1IA 3EUAA 3O4IA 5AJTA 4M3NA 1H4QA 5KWJA 3JR7A 4MQFB 3U3RA 2HF8A 4Y6OA 2GR8A 5G1NA 4JC4A 1ODTC 4BEVA 1WBDA 1PF7E 3VC2A 5EFZA 2G09A 1JPJA 3GVCA 5EMKA 4CKCA 3DZIA 2Z2YA 3QPBA 1UT6A 2I99A 1DELA 4ZV4A 3PXDA 2C7OA 3VR2D 2F1RA 3GJ7A 5EIWA 3Q5DA 4MNTA 1UINA 3PKIA 5D5PA 5BY2A 4WOPA 5LR6A 1Z4PX 2O48X 3INTA 3TR6A 4I3HA 1HNNA 2JJ2A 1R9GA 4HDRA 4C89A 3ZDBA 2XITA 5MF6A 1ADFA 2W6OA 4FHDA 1SRQA 3MBIA 3DP9A 4N6OA 2JFFA 3FHJA 3SP1A 1XC7A 2B4RO 4HJXA 4EL5A 4G1BA 4HN9A 1V8DA 4MYUA 4UATA 1OREA 4I55A 3BWEA 2PEZA 1E2DA 5AKEA 2QU7A 3BZWA 1ZN9A 5JI3E 4WKPA 4OFXA 1NR1A 2EYUA 3D6TB 3Q85A 1CUAA 4AO8A 1U8XX 3ITDA 2WFLB 2OBNA 1VE7A 4ZU3A 2AUMA 1ECLA 1HFKA 2BKEA 2QVYX 2YDXA 1G3IA 3KQPA 4K6OA 4L5JA 4CU2A 4Y67A 4UM9B 4HADA 4EL0A 5JANA 1A3CA 2BFNA 4Q3LA 3MGKA 3CF0A 3G2OA 2VNHA 4F0JA 2PLWA 4B34A 2ZBRA 4XWOA 3H11B 4DJAA 5KZMB 2OKGA 2HL6A 3VVMA 4EW1A 1RM4A 1Q3HA 1S96A 1O87A 4UC0A 3I5MA 3UM9A 1UDBA 2BCGY 4INOA 3IVMA 4B7XA 2PZMA 4OCZA 1XD2A 1RLTA 3LXMA 5I7RA 1QGOA 2A5FA 4QOIA 5I4BA 1R64A 4OXRA 3JD2A 3OICA 4B6RA 4YXFA 5J2TA 3F73A 4Q4CA 3VC7A 5G0SA 3PQEA 3PE3A 2JD1A 1R10A 4HFMA 5DMXA 4W82A 2WWVD 1D9ZA 2XUIA 3K9QO 4ZQIA 3ZDCA 2ZUVA 3NVKI 2QRNA 4R40A 5ADWA 3O8NA 1PEYA 1VZ2A 2HGZA 1WKVA 2PGDA 2QVZX 2F43B 1OKKA 2XUPA 5ITVA 4YCCA 1I94B 5CYPA 1MRNA 2RGYA 3FY4A 4MKFA 1B8UA 3G7UA 1N4AA 3RU3A 4Z8XA 3UJ7A 3IV7A 2AEEA 4B74A 1THGA 1RCFA 4NU5A 2ZTMA 3FYDA 2G6BA 5AHKA 1FFBA 3AEUA 4PYMA 1T9DA 1QV7A 2PZEA 1M1YE 3EC1A 3OLYA 4KQWA 4RY2A 1KEWA 2DBQA 2G16A 4X3CA 1IXKA 1SKAA 2FSVA 3KTAB 4WECA 2HUNA 5D3MA 1IZ0A 1B15A 3OOJA 1FP4A 2IOFK 3WTCA 5LZ9A 1U11A 1XTPA 1PQYA 4MVCA 3EIWA 1ODJA 4MWZA 3MYRA 2YV4A 4XLZA 4XQCA 4EHJA 1SD5A 5ERYA 1Y1LA 5J1SB 1P5FA 2BHNA 3KYDB 4F6RA 2H08A 5AKXA 1IBMB 2A1TR 4I4TF 1YXMA 1TUBA 2X4GA 1O9GA 2QPOA 1PFWA 3QVKA 3Q3GE 4A6EA 3LJKA 1CQWA 3QU5A 5K8UA 1H93A 1E2EA 1K0FA 4EHDA 1EESA 2YJGA 1W34A 2JJ8A 4IKOA 4JQSA 4REMA 3UMRA 1MZVA 4HWTA 4XM0A 3VR5H 5EQJB 3LTNC 1DGQA 2R48A 4A16A 4NX2A 2G5CA 1S9DA 2DFKB 2VZ8A 1IQ0A 4XJXA 3SMVA 2HRQA 1ADGA 3IAM6 4L9SA 1QZXA 3REFA 5GIPE 2NO0A 3JZAA 2GO1A 1F1BA 1V35A 2P9ZA 4L73A 3RC2A 3SYRA 3W77A 1Z2EA 1VHJA 5GVRA 2EVWX 1XVVA 4GL2A 4F3TA 5COAA 2WICA 3A7DA 3PGVA 1PZGA 4QXPA 1AKRA 4DYDA 1ZCZA 4B76A 4JI6B 4ZICA 2HDOA 1AB6A 4J1QA 1NKVA 1DC4A 1GEGA 4K9OA 4IZOA 1NHWA 1QFMA 1YWGO 4J49A 5AXDA 2HU5A 1JBQA 2J07A 1HRDA 1RQLA 1GADO 4KQEA 4MPRA 3RYFB 1SIOA 3A9TA 3BTOA 5YASA 5E6RA 2OYSA 5C5DA 3L0DA 1XXHB 3GXBA 3QWHA 4IUBS 3CCCA 4Z3DA 2FW8A 3C7AA 1MO6A 2AJTA 3OCYA 2Q2QA 3MQ4A 5ECYA 1D09A 5JCZA 1N7GA 1YMVA 2BT4A 4LJ7A 1NG9A 2HLDA 2FPGA 1P1RA 2FWIA 5JMWA 4FZRA 1MLDA 3FOWA 3GOHA 4R1PA 1FLDA 5BXQC 3ZXSA 2HMTA 5IDYA 4B09A 4HGZA 4BNZA 2CCJA 4N39A 1UEXC 4UBOA 5GONF 2GZ2A 3T3EA 1TAGA 4ZOLF 3I53A 1EWTA 3PX3A 4NU0A 5A1TA 5IBRA 3I0ZA 3QSYA 2ZE7A 5ALZA 5AHXA 2Y66A 3OA2A 3IB3A 2CVHA 2J3MA 3OPYA 5AKGA 2R6DA 5EYPA 3PPWA 4RIFA 3SJZA 5JQWA 1UPCA 2CXRA 1XZLA 2Q4EA 3TZEA 4RV5A 5CA0B 1VL5A 2NM0A 1QVRA 3MCWA 3T61A 2CXNA 3HR8A 2NUTB 4YFYA 2XF2A 2CUKA 2IYXA 1B6GA 2Q6OA 4TQAA 2I4TA 1X7YB 1Z6TA 2YV2A 1QF9A 2GBLA 1CX9B 4H18A 2Q3FA 2ZE8A 5T3UA 1ZQ1A 4I1RA 3R8FA 1A9QA 4NZOA 1E2FA 4YEDA 1VMDA 3AP1A 5JEDA 4NPCA 3FTQA 1WXFA 2DPLA 2EARA 3M1IA 3MINA 3PNOA 4TQ9A 4E07A 3W2FA 5DLYA 5K5EA 1U7PA 4XD7A 3GF4A 3KSMA 3I9OA 4JOBA 1DQZA 4E08A 3HU1A 2B1GA 1GEEA 3AUTA 1R8XA 3KKOA 4UU0A 4OXNA 1AKTA 2AFHA 1A77A 4DWVA 3VKHA 4B4DA 1ZUNB 3D8HA 3T7EA 2FN3A 1CYDA 3GQVA 5FJIA 3AI7A 5J2UA 1RBYA 2EATA 2AZ4A 2OQ2A 5IAGA 1X8KA 3G2KA 4F84A 5B12A 3QMWA 5DDIP 1ZIYA 3P94A 4NU8X 2O0MA 1Q15A 3OCXA 1IM8A 1IQUA 3ZIAD 3KQNA 4OJTA 1TQ6A 2WMNB 2ZYRA 4K3UA 4DBZA 1GQRA 1D0SA 3T1QA 3WNQA 3TNLA 1H2WA 1CNFA 3DHWC 5FI1B 3NDIA 4N0MA 3P2JA 2RGBA 1WXWA 1U3DA 3CNOA 4ISCA 4MP8A 1C3XA 1YNOA 1PJSA 5KTNA 5B3LA 4MOWA 1W94A 3OM1A 3SYNA 3T15A 4EFLA 4EENA 1KBQA 2ZW9A 3HU5A 4WXHA 5KB3A 1TW3A 4R69A 1NOIA 2QTBA 2AG0A 3N07A 3PFBA 3H99A 1S89A 3EXIA 3BMNB 2PS9A 4FYJA 4J1TC 3UJNA 4WXEA 2GZSA 2EJUA 3K2BA 1Z6XA 3V1KA 1LK5A 4QSHA 4JD5A 2RG1A 1QAQA 1Z6PA 3CE9A 4EW2A 3LLSA 3JQPA 3W7AA 1ZD1A 4H3KB 1WXQA 3MJDA 1IATA 1G4HA 4LV5B 2WTBA 1YVEI 3WLAA 3LPMA 1Y1PA 3V8QA 1SIBE 2FCRA 3TW8A 3DV0A 3B2EA 2ONJA 2QLNA 3MN1A 1HK7A 4A9AA 2PYDA 2D1FA 5ISMA 1NXVA 5AJYA 1FU7A 5FWYA 1G63A 3F90A 5AM2A 1U1CA 2AC4A 3K9CA 4LZAA 5E6SB 4CWAA 5D84A 2AR0A 4NP6A 5I7AA 1RRFA 1T36B 3NYQA 1G6HA 3LY7A 1W2WB 3T5PA 1E3TA 3G9XA 1WTAA 4QA9A 1DT5A 5CIQA 2ZR0A 4JL5A 3UKJA 4LUCA 3HFJA 2HU8A 2QUZA 4ARZA 4UZSA 5AW4A 2OFOA 2A3NA 3IHTA 4XB1A 1C9EA 3LHSA 4BZPA 3ZHVA 1U0HC 3NIDB 2XMQA 4WJKB 4CTMA 1XNHA 4E51A 4DLYA 5CBPA 4ZAYA 3OU6A 3W8DA 3FR7A 3T9EA 3CLRD 1GITA 2X9NA 3W2IA 5FH9A 4NMHA 3ADDA 4OPMA 2X1LA 3IR5A 3OPQA 3DLAA 3C98A 3KWJA 2C9DA 2DVMA 5DOVA 4L3OA 2ODPA 5IAKA 3RTGA 3V4LA 5KPDA 2CYAA 1J97A 2G4LA 5CXSA 1ODKA 5P8WA 1L5ZA 3HCWA 4MS4A 4EKDA 4N0PA 1M1ZA 3OOWA 2TRSB 1HNXB 1K9SA 2GLTA 1IC6A 2IELA 4Q6WA 4PX3A 4W8GA 4CM6A 3LHKA 5CVVA 1X1SA 1EVZA 1M2NA 1V4NA 2QLJA 3IQWA 5CMLA 2NU9B 4FEAA 4Y2JA 1EVKA 3F5DA 4CM1A 2XPCA 1ZCBA 3OA0A 4GQBA 2LGJA 5ARBA 2RCNA 3FF4A 2O5RA 2E5LB 4MZXA 1ZESA 1JHQA 4RELA 1VCNA 4D0SA 1KY5A 3RVSA 1NP6A 4R2HA 2GM4A 3NBMA 5I51A 1EXNA 2P2YA 3DM9B 1FVOA 2DOKA 4JQZA 4H7PA 2GFHA 5EXDA 1PLLA 1EP9A 1QONA 2WEKA 4XDHA 4YJ3A 2G9ZA 2P2CA 4DPLA 3D6FA 4QGGA 1ZMXA 1IMJA 4TMXA 4KQ2A 1QS0A 2F9LA 4XPIB 2IYQA 5DK6A 5JXWA 1QX4A 3AM5A 4H6WA 3VKWA 4AKHA 2GAJA 5L3SB 1Q1AA 2MSKA 2PJUA 3NH6A 4QDKA 1T9HA 2R1TA 3AY3A 2YHIA 3Q7QA 1DBWA 4KDEA 5E1DA 3CRW1 3KQLA 2SICE 5IJ9A 1P73A 2I1QA 2J3EA 5FHQA 1S3SA 4MUJA 4YMSA 2A84A 5IYZB 2RHGB 2CVPA 2ZBUA 1KP3A 5CNJA 3FCAA 4ZKEA 3PIRA 3R3WA 4UTPA 3NRBA 3MLBA 2UXCB 3QVGB 3AESB 3KDPA 4ZN6A 1R5NA 2PGIA 3GELA 3I5AA 3FNIA 3N2YA 4MW0A 3J7AC 1WLSA 2ZATA 4B6GA 4JJFA 4WFKA 3EVZA 2ZJAA 3HN7A 3OIUA 1KTIA 4BBJA 3PQ8A 3LVQE 4H1TA 3FRIA 3X43A 5CDYA 4TYQA 1N25A 2PUCA 1D1SA 3G2LA 4MWGA 5IHPA 3LBNA 3I5XA 4FJ2A 4YCDA 1SVIA 1U6KA 4RXUA 1BKYA 3M4XA 5DN9A 3ZS9A 3VA7A 4K2HA 1UZNA 2ORYA 4KR0A 3HSYA 2Y1GA 2CLEB 1ADBA 1R6BX 4WACA 1G8MA 1XEAA 5HR5A 3NV9A 3HDTA 2GPAA 4CGYA 1J20A 3DMYA 4CJXA 1C3EA 3LKZA 5FPHA 3OHPA 2J0VA 4KLZA 3D6AA 3MK31 3BKWA 3K5PA 4MO9A 4EJ2A 3VR6A 1QP4A 1S7CA 3K92A 1PFUA 1Y3CE 3CUEF 1BN7A 1KMHB 1UPTA 2A78A 2ZPUA 1T1IA 1EUCB 1JWBB 2CYCA 2GCGA 3SHOA 3C4QA 3W06A 5GJBA 4IO1A 1SVUA 1KQGA 5JMOA 1O0BA 1Q77A 2DT8A 4FXOA 1JV2B 3HJNA 2D0OB 4NQRA 4MXDA 3ZHQA 1HY3A 5IDWA 3NUZA 2BFPA 3N7UA 4NCKA 4MTLA 4RIIA 2PE5A 3JQCA 1LNZA 1CJCA 3ENNA 1U3UA 1W44A 1B26A 2OESA 4QLOA 2PWPA 4IDEA 4HVLA 2I7CA 3GD7A 4ZEWA 3PZBA 4GMFA 1MJNA 2V7WA 1IM5A 4NLLA 4B4WA 4ZZ3A 3M2TA 3HFSA 3UT0A 4O2RA 4ND7A 2ZZMA 2P1DA 3ZD6A 5DX0A 2VH2A 4Q9AA 1Z8FA 2Q8NA 1W2GA 5GM1A 2IXGA 2OOSA 2NO1A 2ZI7A 4MQ5A 1Z13A 3HYCA 4DLSA 1J90A 3V4OA 2V7TA 4YLYA 1I9CA 1I5RA 3ODGA 2A9KA 3QKSA 4LJSA 1SBZA 4H6PA 4TKMA 3BRSA 4JLSA 1PGOA 4TKVA 1IEVA 4ZEOA 1TE2A 4PYQA 2JGJA 4D99A 5LQCA 3EVCA 3CZRA 3L6OO 5TE9A 5TR9A 2XV1A 2MR5A 1WPXA 3II6X 3UGJA 1LZLA 4HFJA 3KHSA 2PWZA 1TM2A 1E5VA 5D5QA 3EH2A 1MPTA 2B1IA 5CCBA 1GP2A 1WQ3A 4ZK2A 5IFLA 2QUJA 3UVEA 1LDEA 1C3LA 3DBHB 2I4IA 1T3GA 1HMYA 2H65A 2I1VB 3QU2A 5HUJA 4BVBA 2P4UA 1ADCA 2Q5HA 3DCIA 3GQBA 3AX6A 3OFKA 3D8UA 4I6GA 4REQA 1SBIA 1NBMA 4IGFA 1XCLA 2RHBA 2W4QA 4JC8A 1UJ5A 1GG2A 3A6FA 5BQ3A 3WB9A 1F5SA 1AKVA 1SBHA 3NOQA 4W5QA 1J56A 1Q44A 1QIEA 2PRYA 5FBVB 2Q1UA 4IZIA 1KAGA 1P1CA 2FSUA 4ER3A 5A3QA 1NXSA 4K7JA 1EK0A 7YASA 3GVIA 1PG5A 2HCBA 2FQWA 3CZ9A 3ENWA 3WNZA 1LVUA 1U7HA 1CS4C 1C3VA 3IIKA 4NDZA 1NBHA 2IGBA 1JFRA 3LZDA 2IHZA 3UT6A 2H06A 1KJIA 2QZPA 4XIYA 1E7SA 2GZRA 2Z4RA 3K5IA 4BAZA 2LP4Y 3CTMA 3K94A 4KQMA 5ALLA 5FO1A 4JI7B 1KYWA 1L1EA 2ACVA 3FUTA 4FGJA 3DE7X 3E2IA 5JS8A 2R47A 2RHTA 4F1JA 4BFVA 2NV2B 2EIHA 4YCLA 2YCBA 2BTOA 1O95D 1W6RA 2H1HA 4DCOA 4OLHA 3VR2A 3RVKA 4I6EA 1OVGA 1RAAA 1DWUA 4CEIB 3IQIX 1NMZA 3PC2A 2QZZA 5HQ3B 1NQWA 2EKZA 2ZYSA 4JQYA 1U8TA 4YRQA 5AKZA 5BPFA 1G5PA 4C2UA 3REQB 4Q16A 3PD7A 1TVMA 3NHSA 4EPTA 1KAEA 4QYMA 3I3OA 2XCTB 4YRBA 5G4KB 4QTTB 5D3KA 3OLWA 4J0KA 3DGEC 8OHMA 4DJTA 4PICA 2J5KA 3CC8A 1PT6A 1R0KA 1V8BA 2SKCA 4N5NA 2NXJA 2FI1A 4B7AA 3FWPA 5CDSA 1QF6A 1MX3A 2XAAA 4MKZA 4YI3A 3ZE2B 3T0IA 4XDZA 5DNVA 1QPGA 4IAOA 3VKUA 1ZKMA 1ZBDA 5JH7F 1V6AA 3GHHA 4I46A 2ZIVB 4TM7A 1JX6A 1YBFA 4MWDA 4YBRA 3ZCSA 4EGCB 1V7ZA 4DEVA 3ZWWA 5LLSA 1W1UA 5BW8A 2J0SA 3IDOA 5ULLA 5GWXA 1AA6A 2G83A 2WYVA 5FOUA 3SM3A 5JPCA 1KP2A 3E9NA 3G8DA 2LBPA 4G65A 5A04A 5IASA 2HDHA 4LDZA 4WKGA 2EGHA 1NVDA 2PL3A 2O2SA 3CF4G 3ZZNA 4ZZ1A 4O2BF 1Z33A 3AONB 3CGWA 5JCOC 1G8FA 4RPGA 4TWBA 1RE0A 3ME5A 4WNIA 3VYSB 5C18A 1WB9A 3M8KA 4EG5A 2DFVA 2FFJA 3C3WA 1XCPA 2JLRA 3CWZA 5E9WA 4B3MB 2WKPA 3DUFA 1V96A 2QTRA 2ZRQA 2XYPA 4N6GA 4YN3A 4AMBA 4QZVA 2YV3A 4MW5A 1OWOA 1LNSA 1XMPA 4ZTZB 1CULC 3LFTA 1GGFA 2V45A 4YJKA 2QN6A 1PTJC 2Y1LA 4BNUA 3ZVMA 1JR6A 3IAS1 3NEAA 3HWWA 4MICA 4QUAA 5CGZA 5LNK6 2NVUB 1SC6A 2MDTA 2O4UX 3N0VA 1CQZA 4JEIA 5ALDA 3UPUA 1WOMA 5D86A 1PW7A 2VP6A 1NBIA 1VRVA 2QK4A 4WCFA 4CLOB 1GQOA 3UA3A 1ULTA 3OQNA 5FFMA 4QVIA 4OHVA 4ZA2A 1D2MA 1Y37A 4QM6A 4MV5A 4KWCA 2H7YA 3Q12A 4RBNA 5I9BA 2ZUFA 3UCEA 1IN8A 2OBBA 4A0GA 1ODIA 1RZ3A 1NX6A 1P4SA 3C70A 5SV2A 2P40A 2IV7A 3WRYA 1ZD2P 2JEOA 2PUEA 1RPNA 2Y1OA 2YTZA 4HWKA 3O94A 3GB9A 2WTNA 3A2MA 4P4LA 4GI3A 4UTXA 3RAJA 3NIGB 4F9EA 1EXVA 1UJ2A 2QTWB 3DC2A 2HPZA 3NT4A 1K1EA 3NHZA 4HLQB 4BZWA 3T3DA 5JNUA 5AVVA 1DAIA 5EXEA 1NURA 4I8XA 2G9VA 1MEEA 3GEGA 1UOPA 1T1SA 3N3BC 3D43A 5LIPA 2V7QD 2WD7A 3EWIA 2CD7A 4BDSA 2JHGA 4N5HX 4QOGA 2PM8A 2WABA 5CVDA 3W2EA 4WT7A 1H3NA 2KJQA 1SELA 5TF0A 3QF4A 4MRMB 2GM9A 3D4BA 2XUGA 3UMVA 1N6NA 2DKNA 5H4HA 3S2FA 3JCZA 4ZCSA 4GDFA 1UR5A 1VM6A 3T5TA 1LS1A 3I9LA 1ELOA 5H3CA 4YCJA 5K01A 4FDUA 1RWBA 4J0FA 3LUCA 1Y4ZA 4HNAB 1HH4A 1JHZA 1QKKA 3ANNA 4IIXA 3EDYA 1I6MA 3GGCA 4PRYA 3NDPA 1N2ZA 1L3IA 3H5OA 3E3OA 2B5WA 4KIFA 4MK4A 4MMYB 4RFSB 1DAGA 4C6RA 5JTTA 2IYAA 5EWJB 3KKEA 3MB8A 3PF9A 1WNTA 4DIDA 1C5KA 3ACDA 4RYLA 3MTEA 3TZHA 2J5QA 2WA2A 5TSDA 3KZMA 5ALMA 3Q8LA 1K6JA 1XRLA 4DAEA 5P21A 3H13A 4RSMA 3ETCA 3WLQA 1K9VF 3RROA 1UDRA 2VPQA 4PLHA 2UZAA 3VR4D 4A36A 1JP7A 3RSQA 2JH9A 1KMNA 3UMBA 5K0EA 1OR8A 3TNDA 1HEUA 1KETA 3OETA 2QX7A 1C1YA 4UAUA 2JGKA 1L7MA 1IY0A 4PZLA 2FPWA 5CW2A 1TYCA 3CJRA 3NAMA 4NH0A 2AH5A 4B1FA 3KQVA 1ACLA 1XPRA 1X7ZB 5FL7A 4MR8A 4U7FA 3P5SA 2EHJA 1N78A 4A2WA 4DM7A 1QYVA 1H4VB 3QVMA 2W42A 1E3EA 1VLVA 3VTZA 3EAQA 1RRCA 3X1YA 4Z4CA 3CVJA 1NLUA 1KEVA 2O5VA 2ZI6A 1YQGA 1DWQA 3AUXA 4HRYA 2OFFA 2FYTA 3HUFA 5KSZA 3GEMA 3O47A 4A5OA 4FJ0A 2X0DA 5CNKA 3DCJA 4P32A 1MT3A 1DEAA 3PUJA 1L8XA 4JLAA 4FGZA 3T9CA 2V7PA 1QVWA 3ZBPA 3RC9A 4HNRA 4XUCA 5EERA 5HRUA 2Z2KA 3K9LA 1D4FA 1SN7A 4R1OA 3HJBA 1WLYA 1T6ZA 3ZKWB 4BAUA 9ATCA 1C3JA 2HD4A 5ALYA 2VKQA 3EWAA 3MF4A 3BYZA 1G21E 5K0BA 1WXDA 3I1IA 3K2IA 4KE6A 1OF1A 2X6TA 1FX0B 2QOEA 3PWSA 5FNVB 2NYAA 7MDHA 4GRAA 1PL7A 5JNVA 3TINA 5A4MS 1HG0A 2WTUA 1JZTA 2J45A 1TGYA 2QMYA 2FZ5A 2XCQA 3MOSA 4K6KA 1B8OA 1E1CA 1RQXA 2FUCA 4N8DA 4FE4A 4RH3A 3U13A 4BNGA 5JROA 3HDGA 5D1HA 3ECSA 1K88A 4CL8A 1OZHA 1N5KA 2P6MA 3BORA 5E7JA 3DVLA 1NM5A 1Z3CA 2BFFB 4JUAA 4L75A 1E5QA 2OC9A 4NULA 5EIOA 4NE9A 3MTGA 1DQPA 1VOTA 1M2VB 3NWJA 3GFQA 4GMDA 4YMWA 2Z6QA 4RO0A 3O0TA 3GJYA 4Y0AA 4ZC1A 1D04A 2NZJA 4WLUA 4RTNA 5A7FA 5IXYA 4RK6A 4BL5A 1PEKE 1JIKA 3D7KA 4BQNA 1GPBA 2AHOA 1E1YA 1QJ4A 1RXIA 1X2BA 2AQIA 2Q1SA 3NIBA 2DM6A 3GL9A 3LGSA 2IBTA 3EFOA 5FUVA 1QIKA 3TX6A 2ETVA 2JARA 4UCQA 4C0JA 3DEAA 4A2CA 4P2BA 4KBYA 2ZYGA 4TT8A 3ZOZA 2K87A 1EGMB 3KFXA 2PNFA 1ESMA 4JBWA 2QRMA 2AF3C 2I4MA 4TTVA 4D80A 2WK1A 4R2XA 2QORA 2WE7A 3NRJA 4I6JA 3DZDA 4M0EA 2KHZA 1P29A 3DE6X 4B35A 1Q0TA 2B9EA 1NTRA 3D4NA 2D7DA 3WWOA 2VYFA 3DHVA 4JZYA 4C06A 2ZULA 3OQBA 2V4UA 4ZEXA 3DJYA 3A28A 4OV6B 3LT4A 4I3FA 4OXYA 2CE2X 3C3BA 4LCEA 4N7RA 4LWQA 4G0YA 4NRDA 2F3PA 3OJOA 3ZU5A 4B4KA 4QFBA 1PD0A 4A5SA 4BFZA 1WKCA 1LSSA 3OZFA 4L4XA 4OGFA 4RJKA 4ANFA 4F86A 1PS0A 3QQ5A 2H2WA 3MLAA 5F12A 1TK2A 1W0KA 2M6RA 3WRVA 1UKEA 2FSHA 2ZDGA 3U2QA 3PA6A 2Q5EA 4BO6A 5DYNA 2CSUA 1RYMA 3DQPA 4KIWA 3G2HA 4X6YA 3BTVA 5CA1F 1PGPA 3MEQA 3WHKA 4B43A 3I45A 3GAAA 3NC4A 4G41A 1ONSA 4P4SA 3IDZA 4ZVNA 1DIBA 1U0TA 3FLMA 5J5CA 5A9TA 5AXCA 3EGEA 3ZNPA 5DN6A 2R00A 2Y1EA 3QYAA 4I2NA 1FRQA 1UMBB 3CZQA 3P0JA 1YCFA 4IGKA 3QXJA 2A50A 1RXEA 3PGJA 1DRUA 5DXFA 2C99A 5KYKA 1XAJA 1SVWA 1EVEA 2WHPB 2Y1KA 2Y1DA 4U2GA 5KTOA 2PXAA 3MMZA 1F2TB 2P30A 4Q5IA 2PX6A 1HYEA 2X2FA 4JT9A 2CV0A 4MRNA 1NRWA 1NRIA 2IHVA 1LCIA 1UK7A 2A1TS 2AF4C 4NECA 4R41A 4UNSA 3F3YA 5EP3A 5C80A 3SBDA 5I8ZA 3PCRB 1I9GA 4XRRA 1J00A 4PAOA 4FMDF 5B1EA 3B9PA 3DT8A 5CHEA 2GBCA 3W05A 3DA8A 3TQCA 2O4CA 3ROQA 1S1MA 1KYZA 2YX1A 3COJA 1EG2A 3HEAA 3B5JA 1CJKC 2C2ZA 1H22A 3HBLA 1CQIB 1XWIA 1THTA 3NTLA 4DMHA 2PYIA 1XELA 2VUTA 1EP2B 3C7KA 5AI6A 3O38A 1DC6A 2J9YB 1BE6A 4GPTA 4OLJA 1KVQA 1BVRA 1AXEA 4GZ5A 2XKBA 1IDN1 5IKOA 1NJ2A 4Q4HB 1FVXA 4I9FA 1USIA 1WV0A 4EVQA 4O5AA 3TZKA 2OCDA 3QPDA 1K6EA 4O1MA 2KI5A 4HEQA 3C1UA 4CODB 5B4TA 1Q84A 2JFNA 3JQGA 3KPJA 3RS9A 3F2VA 4MVJG 3GRVA 3K4PA 3SBOA 2C5FA 2ONCA 4HQOA 4FOLA 4LE1A 2Q8QA 3LWDA 2YOHA 3U4HA 1T1EA 3NWPA 1V5FA 4GLFA 3RUFA 4IRUB 3AETA 1BCSA 2WA1A 1SXJB 4HSGA 3OE7A 3SWWA 1G5FA 1OQAA 3NC0C 1UXKA 2H2AA 3DEZA 3DWIA 4QBGB 5AW5A 2X5OA 4RMGA 5J1TB 5CCEA 4LIPD 3Q98A 2WYIA 2VF7A 3O91A 1A76A 2X5NA 4M1EA 1RWVA 1P7WA 1MX5A 3HWX1 5KOYA 2OLEA 3LK6A 3NETA 1RKQA 5KPJA 3AV0B 4EW3A 4HUJA 4ETMA 4AUMA 4IO0A 2OVBA 4DDKA 1BWPA 4X24A 4CTKA 5IKMA 1QIIA 3KAQA 1HE1C 1VL1A 4INAA 3AV3A 4KYUA 1NT4A 4H15A 4L9AA 5ALGA 3W0LB 5JC1A 3KAPA 4BMSA 2C59A 2GZ1A 1P0CA 2YS6A 4YRLA 3TEMA 3W9SA 2A35A 1Z7EA 1HMPA 5EWLB 4DZTA 1LVGA 2O9JA 3Q5GA 4RENA 4K6FA 3WHLA 2JATA 1T0PA 1TZJA 3GLGE 2V03A 4JGGA 5EUQB 5IYZF 1XA4A 3L01A 2FP4B 1LJUA 4R5MA 4EHBA 5DNYB 1YU6A 1XNQB 3Q0IA 4LYDA 4MUHA 1J1ZA 3I6BA 1Q6ZA 4O8CA 4A8TA 3ZZTA 2ECQA 2HSDA 2MMCA 2J5BA 1RS0A 1FK8A 2JFGA 4ZHQB 2NO5A 3PKJA 2ATEA 2W11A 4IIYA 2GCIA 4IDOA 5JLJA 3H04A 5SY6A 3H65A 3RYIA 3T38A 3V7YA 1NVBA 1EDZA 2C9ZA 4MLDA 5K03A 2GN2A 3KU1A 4M8IA 1P3Y1 3IAS6 3NEPX 1BS1A 3MT7A 5DMHA 2F9FA 3H5WA 5H9VA 4DG8A 4ONEA 5CAEB 5JSZB 3L6EA 3DEYX 4DUGA 4CCYA 4LJAA 1DCMA 4EGFA 2DBVO 4UDNA 2ZDHA 1MH9A 4AN1A 1FSGA 2XTJA 4JI2B 4JI0B 3R5JA 3VC1A 4DSTA 3QX7A 1UKAA 2ZVQX 3RADC 4HAWA 1R9JA 1VPTA 1JIVA 1V71A 1PFKA 2NSYA 5CLGA 2ZTVA 5AXBA 1C7IA 3EMDA 1V16B 3RJTA 1I2MA 2R68A 2BYTA 4XWAA 4WE3A 3AZOA 4YACA 1YVDA 2FKAA 2LVBA 4BJ3A 4EBFA 1ATIA 1GPYA 3D0RA 4BE9A 1DAKA 2CUNA 4O0MA 1GTVA 1DG9A 3OF5A 1RMTA 4G84A 1ONPA 4P5EA 3JQAB 5CT6A 1KFJB 4YGXB 3TXXA 4WFIA 2Z9DA 1W46A 3OWXA 2EIXA 2OGWA 2VH5R 1R50A 5DHFA 5EGSA 5H3LA 3HEBA 3UJAA 4HV4A 1I24A 1J7KA 4L0DA 3OO1A 2Z57A 3QPUA 5AO9A 3SN6A 2BZ1A 3CIFA 5HE8A 2OHHA 4N0DA 2QG6A 1PQ4A 1WVGA 2QQGA 1QH1B 3AZPA 5T5QA 3UENA 5HIAA 2I71A 1DQYA 1G60A 1W35A 2IDJA 3KOXA 4X45A 4XASA 5K3BA 4WKOA 1ULUA 3F6SA 1W59A 3PHBE 3RABA 2W22A 4XIIA 5FBLB 5TMEA 5C1IA 3FHOA 2OAQ1 3A1VA 2BMFA 4UBLA 1FDVA 1RT9A 3NEJA 1B6TA 2XYQA 4LRTB 4X1OA 2OV3A 3BSSA 3I23A 2HWYA 4UE2A 2BFBB 2IPXA 4GNKA 2G67A 1CU1A 1GKYA 1QV6A 2EZUA 3H1GA 3SC3A 1LFAA 4RVSA 3CPHA 4QNNA 5KYWB 4AIIA 4BNIA 3QEJA 1BHQ1 4FMBB 4QWWA 4EFNA 1VHQA 1TEXA 1H9CA 2HHAA 3LP5A 1NXXA 3MCTA 4M1OA 5CYOA 3A4IA 4XVUA 4YUYA 4OQYA 1JR3A 1SIUA 3A9UA 3ADOA 1H94A 4Q03A 4PVCA 4CLRA 4DC1A 5IULC 3GJ4A 2O1SA 1N3YA 1PDVA 1PYOA 3HFRA 4RY8A 4XR9A 3MHTA 4N1AA 1EJBA 1MQ9A 2GNAA 1N8NA 2X40A 1N7IA 4O4LA 2ZJ8A 1NWHA 1Z07A 2YJTD 5E4YA 5LYJA 3A0RB 5KJ1A 4MYTA 1ZOOA 3ELYA 4GI7A 1X39A 2IZ6A 1PWYE 4J4BA 5DI3B 3LP6A 2OHXA 4QPZA 3S70A 1UJ6A 3ET5A 4YDHB 2R11A 2JJYA 4YJ2B 3GCXA 4O08A 5JYDA 3HO8A 4YUVA 1GZ5A 3A1TA 1QANA 2OECA 2Q99A 1RAGA 2XF8A 3BD7A 3N2GA 3CX6A 3QIAA 2WBLC 4H1UA 3N75A 5GV8A 3R3HA 5KNDD 4US2R 1VKRA 4WW0A 4YAUA 3V1YA 2VRWA 1JXAA 1TPYA 5EKTA 5EUBA 2Q9BA 2C5SA 2QTHA 4OQQA 2ADOA 5AW0A 1ZYUA 2IZZA 1JHVA 2Y1CA 4BGEA 3VMMA 2PVCA 2BZSA 2GM5A 1PJZA 1WY7A 2O3JA 1BXGA 3BIFA 4RPIA 3KR2A 3IBSA 1D3AA 4EHAA 4M7RA 2XXAB 2GK3A 2OV8A 1IHDA 2JCYA 1ZVMA 3LT5A 3VV3A 3ZJYA 3DTVB 3LBAA 2ZPAA 4OL0A 1P2BA 1XZQA 3ETLA 2ZYDA 3UY4A 2Q7XA 2VJAA 2JVKA 3LHFA 3NVAA 3KRTA 3R0QA 2HF9A 4KR2A 3EISA 3L1HA 3AR9A 5BN4A 4GWKA 1PT8A 4AP6A 1HETA 3VU0A 3RVLA 5ALVA 4NFYA 5F9HA 2V4MA 1YDWA 4RMJA 4EG3A 1ZJJA 4AP9A 1DE0A 4WFQA 2EFDB 2B2CA 2OHIA 1WA5A 3N8GA 4G9BA 1CVIA 1EMDA 4WCVA 4D8UA 3IHKA 3Q87B 2GJ8A 4U9HS 3FUVA 3IBTA 3TBFA 3DHYA 3IE0A 3W5JA 3IV6A 2H1LA 3LX6A 1QFJA 1CUFA 2DTXA 2IYUA 3C0KA 4OP2A 2APJA 3TTUA 4A6XA 1K5GA 3ZVKA 2EKBA 2FMHA 3V5NA 3DHEA 2CMHA 2ZS7A 3ICOA 4IS3A 4ACBA 3N8HA 4BMPB 1ZA2A 5EKDA 1DL5A 5JG7A 2DY0A 3B85A 2XNSA 3H0EA 3I2HA 2RHCA 1Q1NA 2ZUUA 3HB5X 2CL0X 4NENB 3B51X 1QIDA 1Z39A 2XTMA 4ND5A 4LFAB 4RM3A 2JDID 3WRXC 2YWFA 2WJAA 4U6SA 4YR9A 4GLLA 2QUIA 4PLTA 4Q24A 5DIFA 4MV0A 4PXSA 5LMUB 2FWMX 4CR7A 2D1YA 4L2IA 3H86A 1QDLB 4MWSA 3D7MA 4PRZA 1Y5LA 4N41A 5CJPA 2ZJZA 1H0SA 1NL3A 3DLIA 3H75A 5EEHA 1YCHA 3LUFA 2VWHA 4GPD1 1E0KA 1FDTA 4ZD6A 1L8OA 1SVNA 2IZ0A 3RD5A 2O14A 1CS0A 3O74A 4PHHA 5BSFA 1GAQA 2PSHA 3AR3A 4QL3A 1XEWY 1JIUA 2GEKA 3MJRA 4D8TA 2EV9A 4OXIA 2PH3A 2XGGA 1KE2A 5CB0A 1W2HA 4QLBA 3FVQA 4MUKA 1NU6A 2I7XA 1D8TA 2YJNA 5A62A 2JFPA 4LHXA 4OOEA 4FOPA 1Q20A 2GD2A 1CUGA 1T8YA 4YT4A 1AQ6A 5I5EA 4X3PA 3ND7A 4CG2A 5B7PA 3JQFC 1LJLA 1PT7A 1E9DA 4FBMA 3TLGB 4ENSA 4Z4QA 3BFXA 3BXFA 4UBJA 1M0EA 2YINC 3ICWA 4M0MA 5C31A 1KEEA 1KJ8A 2EDAA 1LKZA 1IY8A 4IFBA 5BV8A 4WCDA 1VLLA 4MW6A 2EFGA 4QEDA 4Z53A 3MW8A 2P9CA 1DUVG 2AMVA 2QA5A 3A04A 4J8PA 1WD5A 2B4AA 2ZSJA 5E3IA 3K8YA 1P7VA 2AEFA 5HKKD 2FMXA 2I65A 5FR2A 2HIGA 3FCCA 4TV8F 4AY3A 3CF2A 2IH4A 4E6EA 3MIZA 2ODQA 3EVNA 3EYWA 4Q1BA 3WQQA 1IVSA 3NWOA 1FVHA 2ORIA 4E21A 1W85B 3FGNA 4QPPA 4B44A 3T7KA 3VR4A 2AXEA 3AUYA 4QD3A 4L4UA 4HT3B 1U0BB 3Q40A 1A04A 3FYTA 3A11A 4MKHA 4KPEC 1J24A 3CMMA 3QBTA 4GC9A 3V8NA 3K0AB 4P38A 3AQ4A 2AV6A 3L7BA 4ZANA 1PS9A 1BQEA 1H2FA 4HVAA 1U5BA 1EVLA 3I9KA 3DE0X 3SX2A 3VMFA 3WWZA 2OBXA 4CMEA 2GN9A 2AJDA 3P27A 1SIWA 2I0FA 2OC4A 2PN1A 4EUEA 3ZDEA 3PTZA 2BH2A 1ZL0A 3SI7A 1A8IA 2B6HA 1M9NA 1UQRA 2O3TA 4LOIA 1EGHA 3AVTA 4YC7A 3IPLA 2FE4A 5CEFA 3UT5B 2GR9A 1FSZA 2B7CA 4LC1A 4YUWA 2MHCA 2IY7A 5BWNA 2IIPA 1FFXB 1HZZA 3C1OA 4KRYA 4AJOA 1UC9A 3P0HA 4M8NE 1DIHA 1VPVA 1X13A 1NWCA 4GKBA 5C3UA 4EQ6B 3AHJA 1OTXA 4GM0A 1G16A 2M1ZA 3V1UA 3GUYA 1O0SA 3FTEA 1FL9A 5M7EA 3TD2A 3KQHA 2J7PD 4ARUA 1C0EA 2QTMA 4Q3OA 4D5GA 2JFWA 1CZOA 3OU7A 3UNXA 4LOJA 2CMGA 2ZSUA 4E22A 3LU1A 3Q72A 2CNDA 1JAIA 2DT5A 1U99A 2WY2D 1Z4NA 4ZK6A 2VP0A 3GNQA 1RTKA 1KTVA 2X8JB 1O5TA 3PXBA 4PGAA 1GZUA 4OK5A 3IPRA 1UWLA 3TN7A 5DIZA 4ZQEA 2FW6A 2IU4A 4OH7A 3WGTA 4JWKA 3H87A 3WWPA 3EC2A 5I6DA 4Z3KA 5KEIA 3UW1A 2ZM5A 1C41A 4PLYA 4UULA 1AT1A 2Q5IA 4Q1CA 1KR2A 3JZDA 1UDAA 1YASA 3H1FA 1LVHA 3LC1O 3VVBA 3ZCTA 3UXEA 1DAPA 1DOHA 4GI2A 2R5NA 3EXAA 2AE1A 4HQLA 2FUKA 3RM3A 4BX2A 2O0HA 2Z5GA 1F7UA 4CHGA 1SHZA 4DJEC 1L7DA 1G0OA 3LX4A 3F97A 1XYVA 2HNAA 1VYUA 1P6XA 4DG5A 1ZGZA 1SB8A 2B5VA 2A0UA 2OOKA 3HDHA 4HZIA 3HPRA 2A9QA 1JMKC 4Y7CA 1B8VA 3T94A 3GLQA 4A8HA 3OZIA 1TA4A 2V7UA 5IDQA 3EXEB 2EW2A 4QXQA 1AN0A 1Z28A 2Q27A 4HGPA 4IHKA 4TGLA 5EUMA 2XOKD 3TOXA 1UKBA 4KLNA 1FPMA 3LQ2A 4M86A 1R2QA 2AW5A 3R0JA 4B2PA 1XZAA 2N0SA 2OORA 1CLUA 3VH3A 1XOIA 3OMWA 1PL8A 2REQA 5ALFA 2JA2A 4NYIR 4D4HA 1NLYA 3K05A 3LHIA 3C3DA 1EH5A 2ZCVA 2C96A 3M1YA 4ARIA 1WUTA 2QTAA 4MQMA 2X5KO 5A0TA 5JJIA 1WKBA 2JRCA 5B57C 3AJ8A 3N1UA 1IRIA 3TYXA 3H5TA 1OYVA 5CIWA 1KF0A 1C0KA 4FFLA 4RE5A 4YRSA 1E89A 2XUDA 3A32A 1W73A 2WYOA 3NQ41 4EMBA 3C5HA 1JDPA 4Q1FA 1PT5A 2B8NA 3FPBA 4QULA 1O03A 4LE0A 1EVIA 3DVSX 1ZK1A 1ZRSA 2IA5A 3MT9A 4F4CA 1LNQA 3MRSA 3WDKA 2RI0A 1YU9A 4C9BA 3D6NB 4MV1A 2YFHA 5BQXA 1I7NA 2C98A 4NMMA 1X7WA 1EA7A 5FL3A 3BCSA 5KUTA 1SM4A 2QGZA 3KXDA 1HSZA 2IXBA 1MJGA 3L84A 4A26A 4B6FA 4PPQA 4OY3A 4RCZA 2ZRMA 2PU5A 5HJ7A 5AKKA 5B58T 5FDFA 3GLFB 3AUUA 4AIRA 1L4BA 2CJXA 3FLAA 4ZTUB 1KJZA 4ZHSA 1FXUA 1WDKA 1MCZA 1BG6A 4MVJE 4Y2RA 2Q3LA 3D81A 4I50B 1D6MA 1NMXA 3RUHA 4GC5A 4LXXA 1R4NB 3VZSA 1AS0A 1R0BA 2HLHA 1I2DA 3DWFA 3PNMA 4QRIA 5FI3A 1YRAA 4EM6A 4F93B 4YJDA 5TRTA 1UBSB 3Q7TA 1SUWA 4ZO8A 5ALJA 4YMIA 1GN9A 4NPHA 3STVA 4ENTA 3V2HA 4AXBA 4X5OA 1EVQA 3KZOA 4LXIA 3U49A 4AU1A 4HNSA 3QVJA 4LHYA 2R6R1 4CIDA 3VDMA 2PKEA 3EA0A 4A0FA 1J2RA 4Q9NA 3DOJA 2A9FA 3OEEA 2XDWA 4IDQA 5SYNA 2R7NA 1SCAA 1SHLA 5FFFA 5I7UA 1B16A 2YCLA 3FPFA 5I5GA 4EA6A 3ZLTA 3UANA 1XPJA 4K1LA 1RLUA 4M4SA 1TXGA 5JCXA 1QGUB 4F38A 3EIEA 4KXUA 4AI6A 1WF3A 5EY5B 1VI2A 3A1SA 5TY0A 2Q1TA 4XWKA 2ZUSA 5JC8A 1MNQA 2JB9A 2X9GA 4NYMQ 2Z43A 3OT1B 5TQ0B 4EJFA 4XJVA 4AJJA 1RQ2A 1JWLA 2IYFA 1GQYA 2C8LA 1OI3A 3F6CA 1OU0A 4H60A 4A0RA 1Y8ZA 2FPIB 1JU4A 2OD9A 5DYWA 2VTDA 3WNBA 1J8VA 3AP3A 3MFQA 2J3HA 2O0KA 2XADA 3S7TA 3ZQ6A 6GPBA 2OHGA 4QYWA 2ZM6B 1NPTO 4DR2B 4HQ6A 3GEEA 1NI4B 4BCCA 1USWA 2EFHB 3ETHA 4TL6A 1YZVA 2ZRJA 4LZNA 2WFLA 5H83A 1K2WA 2H5EA 3G1WA 1ORWA 2YHUA 3IE2A 1I2BA 2WM8A 3KUDA 2R7MA 3HK2A 2XKAA 3D7LA 1ENZA 5T8KA 5J3JA 1XWWA 2FE1A 2F8SA 2P9TA 2VNAA 3DTNA 3VFDA 1JDJA 4OBXA 1KI7A 1LI4A 2XR1A 3BRCA 3H11A 4J7AA 1W88A 5K8CA 1F8GA 3ZWYA 2ODTX 1OY1A 3BIXA 3CISA 1Q2UA 1X7HA 1LRKA 3QRWA 1S2GA 2I76A 1DLIA 4P58A 2SCUB 1UKVY 4X8OA 5HGXA 3I01M 3KQOA 2Q7OE 1N5MA 1JKFA 2H9IA 3FOBA 3O8RA 1QG4A 3I32A 2PAFA 1DX4A 1M6EX 1WZEA 2VA9A 1JIXA 1N75A 2I4LA 4NIMA 5E3JA 3IAXA 4HTAA 4ID9A 3MXTA 1M34B 3Q3IA 1EFKA 2PIDA 3WGIA 1F3LA 4C6HA 3QOXA 2OENG 1XDSA 1VA4A 1JVSA 3PXUA 1OIWA 4PVDA 4IGAA 4Q0MA 1E3QA 2QENA 4LVOA 3AVXA 3CKLA 4R98A 3DDHA 4OBWA 1ZM3A 3LY9A 2WV7A 3AUJB 4GH5A 1LJ8A 1C2TA 1V1RB 4BKRA 1JB9A 1CJMA 1CIJA