4MUEA

Crystal strcture of pantothenate synthetase in complex with 2-(5-methoxy-2-(4-(trifluoromethyl)phenylsulfonylcarbamoyl)-1h-indol-1-yl)acetic acid
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
287
structure length
276
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Pantothenate synthetase
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 93
structure length 276
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4mueA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mueA01
4NZPA 3BL5A 4XFJA 4U7JA 1TEZA 3COWA 3N2YA 3K9WA 1N2OA 1K97A 5TEWA 3A4IA 3AIIA 4MUGA 3ZGZA 5JBNA 3RBAA 1BS2A 4ARCA 1JIJA 3COVA 1XNHA 3N9IA 3MMXA 4U63A 2WB2A 4RUKA 1SURA 1Q77A 2GKSA 1MAUA 1B6TA 1OWNA 3ZJTA 3CVVA 4JFAA 4KKVA 4K0RA 1NYLA 1X6VA 1U7DA 4HJRA 3PRHA 3G59A 4H3SA 1N2BA 5KWVA 3AFHA 1MAWA 3FY4A 3TNJA 4CQNA 4ND6A 1EFPB 1O5TA 2H2AA 4EG7A 3KFLA 4NX2A 5HUHA 1N2IA 1KAQA 1M8FA 1V47A 1U3DA 4ZT2A 1N2HA 4XFDA 1KAMA 1IHOA 1ZH0A 1JEEA 1NUQA 1P7PA 2Z09A 1WQ3A 1GLNA 2CV2A 4MWEA 1IFXA 1MC1A 3ND7A 3CVUA 3OP1A 2IP1A 1I6MA 1QJCA 1LI5A 3MUEA 4MW1A 1ZJWA 1QTQA 1F4LA 2H29A 1KH3A 1R6XA 3SZGA 3VRHA 1U0BB 1U7XA 1WXGA 3P0HA 2A4MA 3TS1A 3RHSA 4JYZA 3KT8A 3FHJA 1O96B 1LI7A 1VBMA 1KR2A 3PNBA 3AG5A 4PBRA 1O94C 3RFFA 4MW5A 1J1UA 2PZAA 2DERA 1KQPA 4MW9A 4MWCA 4CDMA 1N75A 4DLPA 2CSXA 1U3CA 2ZUEA 2R5WA 4G6ZA 1N3LA 3LCJA 2PG3A 4MW6A 3FG9A 4NAUA 1NP7A 4GU5A 3TZEA 4EG1A 3TQOA 1WJGA 4TS1A 5K0SA 1JHDA 3N05A 3FOCA 4MW7A 1EJ2A 1I6KA 3FH0A 1NURA 3C8ZA 4MQ6A 3LOQA 1GTRA 2YWBA 4DDMA 1IQ0A 3QE4A 3G6KA 3AL0C 2D5BA 3DV2A 3PNYA 4PY2A 2HGZA 2E0IA 1KKUA 1VBNA 1O6BA 1KQNA 1H3FA 3CVXA 3DPIA 4WNYA 3KT6A 5H7XA 4S1OA 3CR8A 1F9AA 2YWCA 2CFOA 3CLUC 1A8HA 1TFUA 1TQ8A 4MAFA 2WQ6A 2A1UA 4DE5A 4L2IA 2HZ7A 3H97A 4KPUA 3ZXIA 2JAXA 3PNVA 3U1VA 3N8HA 3UY4A 5DEOA 4ZT6A 4HPWA 3L93A 3MLBA 3FNRA 2J09A 2X1LA 1G8GA 2WQ7A 1K92A 1WXEA 4MUHA 4EG3A 4ZCRA 3IVXA 3P0IA 1NUTA 1NUSA 5TS2A 1Q11A 1MJHA 4EG6A 4MUEA 3SYTA 1EXDA 3E27A 1YIAA 3K32A 3MLAA 1QRSA 1QRUA 4MWDA 4MVYA 2QJFA 2O5RA 4J76A 3CLSC 4MUIA 1EFVB 4P2BA 1IVSA 5HUJA 2JANA 1COZA 1TYBE 3S3TA 1QQTA 3IUEA 4DDKA 2QUHA 2TS1A 5H16A 2A7XA 2J5BA 4I6JA 4E1AA 1PFWA 3ND6A 1YIDA 3IH5A 1K4MA 1GN8A 1GPMA 2Z3VA 5DASA 1F7VA 1T6YA 4MUFA 2J08A 1NZJA 1OWLA 2QTMA 4EG8A 4PBSA 3X1JA 4MWBA 1VL2A 1FYDA 5LLTA 4JXZA 3IOEA 2CYCA 3HGMA 3F3MA 2QUKA 1N1DA 3CA8A 2J4DA 3D6UA 3IMCA 1XNJA 4UZEA 2E21A 1M8KA 4NDAA 5EKDA 5J58A 2I1LA 1ULHA 1IQUA 1WOYA 4X0EA 2VXOA 5FNZA 4ZCTA 2AZXA 1N2GA 1H3NA 2XRYA 3DO8A 4HK4A 3IMGA 2QTNA 4ZCSA 1O96A 3UC5A 1PG2A 3GLVA 1UFVA 2YY5A 1JZSA 1M8PA 4EGAA 5TEVA 1OBCA 1MOPA 3LE8A 4MW2A 3UK2A 2VTBA 3COYA 1EE1A 1MBZA 3I05A 2DXIA 3ZJVA 1NSYA 1WXFA 2DR2A 4MLPA 2RE8A 1N77A 3ILVA 3HV0A 4EG4A 4HJXA 1XJQA 3SEZA 1WKBA 1G8FA 2QUIA 3CLRC 4MW0A 2NSYA 5K0TA 3DLAA 3MXTA 3SDBA 2BTEA 4F3RA 2G36A 2V0CA 1J09A 3KT3A 4Q16A 3AKZA 1OWMA 1IQRA 1O97D 2AG6A 3P0JA 1Q15A 1O95D 1KORA 1MB2A 1Y42X 1V8FA 2QJTA 2C5SA 4JZYA 5TGTA 1EUQA 4OUDB 4YMIA 3QTTA 4OJMX 4Q93A 3H9BA 3RK0A 3H05A 4GRIA 1O0BA 1G59A 1KH2A 4MUKA 4R2LA 3CLTD 4NATA 1H3EA 4QREA 4A91A 1GZUA 4DNXA 3A05A 3SZ3A 4MUNA 4MVCA 1RQGA 2CYAA 3VU8A 1R6UA 3NBKA 4DJAA 2QJOA 5HG0A 3ZIUA 2DPLA 3IVCA 1WQ4A 1WY5A 1O94D 2HMAA 4YBRA 1GAXA 1WXIA 3M5WA 2Z08A 4EFKA 1KP2A 2CT8A 1DNPA 1YI8A 3X1MA 2CUZA 4G5YA 1QRTA 4J75A 4ZT3A 3ZJUA 1M8JA 4K03A 2BYTA 2A1UB 1JIIA 5KHAA 2RD2A 2EJCA 4MULA 4L2IB 3RJZA 1OBHA 3SEQA 1CT9A 1I6LA 2PZ8A 1EFVA 5FO0A 5LM3A 1VBKA 3NBAA 3QTBA 1NUPA 1M1ZA 1MB9A 2NZ2A 3UMVA 3ELBA 5IHXA 4EF6A 1R6TA 3D6VA 1J70A 3G5AA 1K4KA 1EFPA 2GOYA 1ILEA 2XRZA 3P52A 2EL7A 4F4HA 1T9GS 3H9CA 2O8VA 2D54A 3IMEA 2WSIA 2A1TS 2PXHA 2CV1A 3NV7A 3ND5A 3FIUA 1TYAE 4PBTA 2PZBA 1X8XA 1VLHA 3CLUD 5J59A 2A84A 3FWKA 1MRZA 1ZUNA 1OD6A 1N2EA 1KP3A 4ZCPA 2IJGX 3AG6A 3PXUA 4MUJA 1J21A 3IVGA 2DETA 3X1KA 2J07A 4ND7A 1KQOA 2X3FA 4KR7A 1JGTA 1O97C 2ZP1A 3Q10A 1NI5A 1J1ZA 4R0NA 3IOBA 1O95C 4R2MA 2E89A 3IODA 2IELA 4ZT5A 5DK4A 1T6ZA 4G5FA 3HMQA 1GTSA 3FDXA 4DDHA 4JXXA 4CDNA 1QNFA 4YP6A 1WXHA 3Q12A 3FETA 4YP7A 4ARIA 2PIDA 3IUBA 4MVXA 5F23A 3CLTC 4ZCQA 4UZFA 4QBTA 4ZT4A 1PFYA 3CLSD 1T6XA 4EG5A 1N78A 1M8GA 1HYBA 2QUJA 1NUUA 3TQIA 4XSVA 3FI0A 4YP5A 1PFVA 4ZT7A 1O0CA 4QRDA 2CV0A 4AQ7A 2CYBA 5IJXA 1JILA 2DUMA 2DEUA 5DB4A 1YUMA 2A88A 1JIKA 1PFUA 2VTBB 1OWPA 3L92A 4RPIA 1TYDE 1I2DA 4OUDA 4BWVA 3ZUGA 5FO1A 1FFYA 1JMVA 1JEDA 3Q4GA 2V0GA 2OV4A 2D13A 3TZLA 3A04A 2X1MA 1LW7A 1KH1A 3IOCA 1S4MA 4I6EA 3JXEA 3RK1A 3COZA 3KT0A 1IH8A 1Q19A 1QU2A 1M83A 1WZ2A 4WSOA 5BNZA 2B7LA 5KCMA 1YUNA 1G8HA 1J20A 3UOWA 3VGJA 4CT0A 1EUYA 1TYCA 3CVWA 3HZRA 2QTRA 3HL4A 3OTWA 1N2JA 4FZJA 1QU3A 3SP1A 3GUZA 3ZXSA 2YXNA 5AHWA 3INNA 1T9GR 5LFAA 3ISJA 5J5AA 3GMIA 4MVWA 4I6GA 4KR6A 1OWOA 1XNGA 2A1TR 4KR9A 2JA2A 3CLRD 3HFJA 1ZH6A 1F7UA 3CVYA 1D2RA 2AKEA 3IDFA 1PG0A 4KPUB 3H99A 1IRXA 4NAHA 2GM3A 2PFSA 4AS1A 1YULA 4MW4A 2ZUFA 2E18A 1JZQA 2OQ2A 1JECA 2DLCX 2X0KA 2A86A 4U8HA 3A2KA 1H1TA
chains in the Genus database with same CATH superfamily
1MUUA 2Z2JA 1R15A 1I0LA 4UNNA 4F12A 1G8PA 1PEYA 4MWOA 2IXGA 1Y1LA 4J3JA 5EHXA 1MABB 2FFQA 1J07A 1RLUA 5KTSA 1JKFA 3E5HA 1RRGA 2Q3LA 5DTEA 4E1BA 2ECKA 2IEIA 1FRQA 3EUFA 3GMTA 3D8TA 3E8XA 3IXMA 3ONWA 4GWKA 4CBVA 1GVHA 4DIFA 5I7EA 4RJJA 2OBMA 4D41A 3IKTA 5HGJA 1G8YA 3PI7A 4LDPA 1KMMA 3O91A 4JB3A 1QVAA 1DAPA 3VQTA 2FF5A 1RJ9A 1UKYA 1YVRA 1EX6A 2IE8A 3JSAA 3NYWA 4DARA 5KNBA 3K9CA 2JKVA 3FCCA 4K7JA 2VDWB 2ZJOA 5AXCA 3RFXA 4I8XA 1XTUA 1O9BA 2FVYA 5EHGA 3ZXXA 5M34A 2VSQA 2CUNA 4YUAA 3G85A 1IK4A 2X5JO 6CHYA 1OW3B 3ODGA 3VPXA 1G21E 4IPTA 1E2QA 4H3SA 2RBEA 1Z4NA 4ND6A 3SX0A 4KWCA 2G4VA 1Y81A 2FPXA 2D0PB 3FA2A 1EQUA 4QTZA 3S2GA 3CIOA 4H0FA 4DLNA 1C7QA 3LA8A 3QW2A 2E1PA 1E3DA 2W37A 3WB9A 3SHTA 2ZM6B 3ZN2A 2HBYA 4JC5A 4KQFA 4Q1EA 3WZ2A 4M1SA 4DMLA 4EK9A 4YRIA 2BHNA 2NXWA 5JQWA 5EWJB 2C99A 3C3MA 3CGGA 1J7JA 1T9DA 5HCNA 3THXA 3QQPA 2NACA 1KZHA 3W6UA 1FFXA 2CLOB 2Q2NA 3CVUA 2H5JA 4UBNA 1N5IA 3FUXA 1I6MA 3F90A 1GUDA 2G7MC 3WS7A 4N8EA 3DDNA 3H19A 5BW8A 1Z5VA 1S2OA 2H29A 3C6KA 4NS4A 3A70A 4Q4JA 5AXAA 3D54D 3ZHTA 1BMFA 2GEUA 4DUGA 3CCFA 2CHUA 1Z0SA 4PYOA 4FXOA 4EVRA 3NHFA 2OPHA 1XAIA 4S2UA 2C7GA 3V1NA 1A4XA 2IT1A 4DLRA 1O6CA 2ZSHA 1M1XB 5F5NA 3N2KB 1DPGA 5EJEA 5DTJA 4LF6B 1VRCA 1Z5UA 2O2IA 2BSXA 4X92A 3CZPA 3T8YA 4F45A 4DLUA 4RULA 5C80A 5C4IA 4UUPA 3CPJB 4M0PA 4ZOAA 2A7QA 3GW8A 4EKEA 4JBYA 2XXJA 4TL9A 3K92A 3GUUA 1CD5A 2Z5GA 3KQSA 1QH1A 1RKUA 4O59O 2OO5A 2XDQB 4IQFA 4U5QA 1YS1X 4EHNA 4ZTUB 2WSBA 1Q0TA 3IYLW 3Q8KA 1MRNA 4H1UA 3FG9A 3KPVA 1RAFA 3LBHA 2Q7DA 5K6RA 2QY6A 3SNHA 3UAXA 3S7ZA 4YEDA 1QHXA 1Z6GA 4LSZA 2A35A 2QNBA 3FI9A 3GFQA 3N87A 5DTRA 3T5MA 1EJ2A 1XEXA 3IAS6 3MNFA 4IHJF 3OE4A 2R3SA 3PKZA 3NC4A 1ZM7A 2TMGA 2PRKA 4H4DA 2YC4C 4IF4A 4LRWA 3DOJA 3TW8A 4DEYA 1QR6A 4LYYA 5DNAA 5C9ZA 4LY9A 1WF3A 2ILTA 3IQHX 1XZIA 4Q3CA 3TL3A 5L3VA 3PUWA 3M3DA 3R9XA 5HEKA 1KKUA 4Q39A 4WIAA 4XTRA 2JHCA 3DWGA 4LC0A 5CDYA 4J6EA 1T4CB 4QUGA 4GPZA 4B7AA 1QCZA 5HS4A 3CVXA 2NYVA 5T5QA 2I78A 4KN5A 2LGJA 5IWAB 1RADA 4OJKA 2GJ9A 1KEWA 2FCRA 2VCHA 5F33A 1BXZA 4H6PA 3IE2A 2REQA 1I0IA 4BL5A 4NR0A 1I4EB 2WMNB 2X13A 1IZ8A 2J45A 2V7WA 3NRCA 4KTVE 1P33A 4OMUA 4Y0NA 4CV2A 4EF5A 4WECA 3A6FA 3NW9A 5KWJA 1IPEA 3AI1A 3DZBA 3PWZA 2WQ6A 3SSNA 5B37A 3L8MA 5EYPB 3MCZA 3U61B 4YRFA 3UGKA 2W6OA 2A0WA 2QG4A 4NECA 2PL1A 2VN8A 3PNVA 4KLNA 1OT5A 1DAOA 1TM5E 4R4JA 4OQFA 3UMYA 1XAHA 2ZTLA 3UY4A 4L73A 4CMEC 3MJCA 3O7MA 2C2ZA 2R6FA 3I2GA 2Q1SA 5BW4A 5C81A 2XCSB 2GSWA 3K0FA 4GPBA 3G5MA 2VTDA 2QMQA 1G41A 5C37A 4KGZA 1EVYA 3K9HA 3UV6A 4REQA 1KJIA 1TF5A 3WAKA 1UJ2A 4DWOA 1QGUA 2G9ZA 3GT0A 4DWWA 4N12A 4YAJA 6Q21A 1EWYA 3KBBA 1BHJA 3M70A 1ORTA 3NCHA 4S1VA 1L5YA 1T2DA 4NE2A 2C2YA 2O1WA 5EJAA 4EJSC 5L6LB 4ZAFA 1H1LA 3DCNA 2YRFA 1I9CA 1HDIA 2FSUA 1JB1A 1D7OA 2J5RA 4YGYA 2Q29A 3TG2A 2O23A 2HYIC 4G07A 4MLDA 3K1ZA 3V8RA 2FWBA 1UBMS 2DKOA 2FAXA 3CLSC 4GDMA 2WYOA 4ZRNA 2HI0A 3A6LA 3T15A 1DHTA 1E0DA 5TY0A 2G5GX 3NT2A 4YXWA 4YHBA 3VAAA 2WZBA 3D6MA 4WBNF 5I7RA 2JH9A 2OZEA 3QYJA 4V0QA 1U7WA 3G79A 1QQTA 4Q7MB 4HYYA 4TZTA 1SVLA 3BULA 2P5UA 1QF6A 2Z98A 3JTMA 2KWIA 4NQRA 2MIIA 3F5MA 3W6PA 3PRJA 1LTQA 4P38A 3LQ1A 4E07A 3DOOA 4DEXA 4J4TA 2WKQA 4M1EA 1QK4A 1XZFA 2VBFA 2YFYA 4JKIA 1K6XA 2CVQA 4GC9A 1ECFA 5ITVA 2W2OA 3TJZA 1B0AA 2C4HA 1G6HA 4FFSA 1JR3A 3PIRA 3ZNPA 2J9FA 2IWHA 1T5HX 4MUFA 1P1RA 3QKWA 1AKUA 1ZIYA 2YWHA 3AW8A 3KTOA 3KYDA 3NDJA 4GLBA 3GRAA 4MKGA 2BMAA 1HG0A 4P34A 1NUHA 1RIFA 1A9OA 4PHGA 4TKVB 3V4SA 3WA7A 5ENVA 1JLRA 4I9FA 1HUQA 4NHEA 4REMA 5LB4A 4D9BA 1N6PA 5HUQA 1JLSA 4JU9A 3KL2A 4YDRA 4F9FA 1WW2A 4KN8A 2W6CX 3GOHA 1E77A 5T41A 2X77A 1CQXA 1FDOA 1UZNA 5ELMA 1WUTA 1PF7E 2XI4A 1GA1A 2HNAA 5I4CA 1YB2A 1CJKC 5I5GA 5ICCA 2QTNA 3S1SA 1S9HA 1O96A 1JKIA 2H4XA 2J46A 2J3MA 3PNMA 4TX1A 2XT9A 3B1FA 3PGXA 3KXDA 3HO8A 3BKXA 2GCOB 3GLHE 4YV2A 1XKQA 2XUJA 2AG0A 3HXPA 2CNWA 4XUEA 2HRCA 3R5FA 3W5IA 4MEAA 3NCTA 4JQYA 2PYZA 4J0GA 4D43A 3H5IA 3V1YA 3ZJVA 1KJYA 1WXFA 2AE1A 3K0CA 4AP9A 1AS3A 2CL6X 2R5NA 1MRSA 4CRWB 3M1LA 2O2EA 2Y66A 5AO9A 3RODA 1PGQA 2CDRA 1WU8A 1RVDA 1YB7A 2QAGB 3OZAA 4QO8A 1IAVA 5CG2A 4IW3B 1O89A 2YYSA 4G0ZA 3QUAA 1F14A 2KHZA 1QS0B 2GNAA 3LQRA 4CCYA 2PE5A 2VH2A 3P4XA 1SKUA 5BNWA 4O33A 2P2CA 3AHHA 1SZCA 5ALQA 3MXOA 1J5XA 4MUAA 1YNOA 3P9QA 5DISB 3GLFB 2P2YA 3R0JA 1JHXA 2VLBA 2JFXA 1J09A 2D1FA 5IKMA 1Q1NA 4FQ5A 3JD2A 5FA8A 5JDCC 1PHRA 2QR2A 1TUEA 1SXIA 2RHCA 4IEIA 1OLSB 4K46A 4B6EA 4F84A 1O95D 2WICA 1UQTA 1C0IA 2JATA 2QJTA 3EWSA 2C5SA 2X5KO 4DLYA 1EGMB 1V9SA 4JZYA 5TGTA 1G1MA 1X7WB 1D1QA 3G7NA 3AVTA 4BKUA 4OJMX 3H9BA 4HWPA 1OX6A 5AP9A 8GPBA 2QVGA 3LAWA 5KB3A 2RHWA 4LYJA 1C3OB 4MOWA 3Q7SA 1GCAA 2XMDA 3EPJA 1GZ7A 4XIJA 1UJ5A 1H3EA 1XWIA 1Y1QA 5LDHA 2XSZA 5KX5B 2BI4A 5F7OA 1H42A 3A4YA 2E4AA 4G89A 1WV0A 3AEUB 2BTQA 1YZGA 5I9SA 1DWQA 5COQA 1YBAA 3D8NA 1XZCA 3P2JA 4C0SA 3OZBA 5LBIA 2AF4C 1J39A 3DOEA 4XD7D 3DTTA 5BV2P 3IEXA 3S2EA 3N5CA 3ZH2A 5LQMA 1R37A 2NVWA 4X45A 1GCIA 1RI3A 1U9IC 1WXWA 2VDOB 1NT4A 3E8MA 5G4KA 5C34B 4TYMA 1MHTA 2A5FA 4TTPA 4FFLA 4UW9A 2XGJA 1EM8B 2CW5A 1A0OA 4HS9A 3I76A 3NRJA 4ONEA 2L82A 4XAQA 4FGSA 1AG9A 3PHIA 4KMOA 2Z08A 4C6SA 2AIRA 8MHTA 3C5EA 4FYHA 5F4ZA 3OHPA 3ZHBA 2R25B 4RKYA 4EMTA 1HTBA 3GA7A 4WCFB 5BPFA 1OBOA 4LXGA 3N2NA 2FGJA 1FXUA 1FP4B 5TVGA 2BYTA 3SU8A 3ZE8A 3UA0A 2D5AA 5JWOA 3L8EA 4UXHA 1C9EA 4L2IB 4E2XA 1VA5A 5B1DA 1IJFA 4TRJA 4K8RB 1H4QA 1H23A 1WSBA 4FR2A 3N8KA 1MB9A 5JJIA 2GN4A 3BWXA 4YV7A 1QK3A 5IHXA 4OHKA 1R6TA 4CV0A 4D3DA 2Y4NA 1SWVA 3FOWA 5K6TA 5KNDD 1ZUIA 3KOMA 1KK0A 1O54A 2XRZA 2NG1A 5KPDA 3K9FC 3OI7A 4DSZA 3PWKA 3TBFA 3RTAA 3ZHCA 2WT4A 2PUTA 4TVBA 3A6DA 3ENWA 3GJ0A 1AF4A 4N8SA 2QN6A 3NV7A 4HO1X 5C1IA 2FQWA 1P7YA 2D2FA 1TYAE 2G67A 4KPGA 1R2QA 2WNIA 4C03A 5I9TA 3KQOA 2AV6A 1LSJA 2AOUB 3MN1A 4I50F 2WIJA 4RAQA 3VO2A 3I1IA 1CK4A 4Z5XA 3T4UA 2ZYRA 1CVIA 1A1VA 3IE0A 4FOTA 4HWKA 1ODCA 1EKXA 3LFTA 2WNSA 4KAXA 6ABPA 1VLVA 3KE9A 4FEEA 2FEWB 5CW1A 1VPWA 4I1SA 2ZT5A 3F7TA 3U7GA 4DC1A 2EAUA 4MV5A 3IDAA 2GDZA 4MROA 3RT1A 2MYUA 4NJMB 4JT2A 5E38A 1YZ3A 1VKOA 3R6LA 3RROA 1QYVA 2ZYWX 1ODJA 3E3OA 4LA4A 4ZT5A 1IEQA 3SS9X 5JECA 1T0PA 2B1QA 2B61A 4JL6A 1ZKMA 2VPQA 4H9GA 4QJBA 4RCYA 1OI4A 1D4AA 2EKPA 2IYEA 2RHJA 1JQLB 3F3YA 4JJKA 2OM2A 1SCDA 4BLUA 3QX7A 4KQMA 3Q0TA 4PE5B 2IA5A 3LMKA 3PJRA 3IIEA 3NVMB 1OH6A 3AK4A 4Q9LA 3D8UA 4ML3A 3E5RA 1NDQA 1T2CA 4X8MA 1WCWA 3VR4A 5IJZA 1L4FA 1ZG3A 4AN0A 2W6ID 4P3PA 1YJQA 2X6TA 3AR3A 1GDDA 1M8GA 1D09A 3DLPX 4AZ3B 2YL2A 1ZKDA 1MAVA 4J0EA 4XSVA 3ZDRA 4E32A 5EVCA 1WUJS 4HAVA 1M2FA 3STHA 5EERA 4ZT7A 3DOCA 3JQ8A 2VJBA 5IJXA 5A6SA 1SKBA 3P20A 4FWTA 4AQYB 1VMEA 3QX9A 3L9WA 3SDSA 3RAEC 1E94E 3U26A 2YHBA 3H6GA 1KDYA 1ZXLA 3TL6A 1AB5A 1OWPA 2YFHA 2CL0X 2FP4A 2IPOA 1Q20A 2RONA 2WUGA 4K6KA 5EJFA 8LDHA 5JAPA 5F4BA 4JJFA 3WYFA 5AM5A 1WPGA 1DO0A 5DNWA 3C3PA 5U4XA 1HDXA 4BRSA 4KSCA 2VP6A 3JTEA 3UENA 4OHZA 5AW1A 3VVMA 3O0TA 1YJBA 3EXFA 4GKBA 2O2CA 4OJNA 1YZVA 3TZLA 5IN5A 2IE0A 3VKUA 1CJSA 3OCUA 1ELOA 3KDSE 2ZJ5A 1Q0HA 3MOSA 2F3UA 1D1TA 4GBMA 4EVIA 1NWHA 1UOOA 2BRUA 3CUYA 4HNGA 4IF6A 4B6SA 4E5MA 4IJ5A 3STUA 1SG6A 1M83A 1UZAA 1UP4A 3BDVA 3U4QA 1JW9B 1RPZA 1XTZA 2Y1KA 3TKAA 1U94A 3EDRA 1YC2A 4XQ9A 3WLAA 2R6ZA 1L5OA 1R64A 3NFYA 4OCZA 3I6YA 5TQ0A 1QG2A 5J4YA 2I1VB 5KVAA 3D0RA 5J1SB 1NBMA 4R5HA 3OF2A 4M0CA 5LQSA 4BGUA 1R4NB 3P9YA 2GA8A 5T3UA 2AWNA 1E9SA 2GTIA 2GO7A 4NU0A 4TLLB 2DKNA 2G5CA 2ST1A 4BNHA 4DF3A 1N2JA 3H2YA 3N86A 3BMNB 1LX6A 1D2EA 3SVTA 4W1RA 2EGUA 5A06A 1U4OA 2IUSA 2PBRA 4HXFB 4U3JA 1CR4A 4YGXB 3KPWA 4DC9A 2AW3A 4L0MA 3BFVA 5J5AA 5JS2A 1E2IA 3R3YA 3HXQA 5B12A 2B9VA 4FLFA 2AZTA 3LIPA 5AMXA 5AOAA 3A10A 1T36B 1IN4A 3BSSA 1CZHA 4DL9A 5FPHA 2WHQA 4MVJM 3JU3A 2PKXA 4NG4A 2Q3FA 3TLMA 1VGRA 2A6PA 3W6OA 2EQBA 4RF4A 1F7UA 3DZJA 2VA9A 3STWA 2ZYHA 3SC4A 4GPIB 1DTSA 2G0TA 3V8MA 3KP1A 2ZRHA 4G36A 1NWCA 1EIWA 1O87A 3WOHA 3FCYA 2OQ2A 2XMPA 3GJ3A 2P69A 2X0KA 4ON9A 2ZRGA 4W5WA 5KKNB 4XDHA 2Q6TA 2PGIA 2I8CA 3FX2A 3G2MA 4HPJB 4X7PA 4KVGA 1TEZA 1FRZA 4O3MA 1ODFA 4LMPA 1NW4A 4XUDA 3U4IA 4V3CA 2X8BA 4JLJA 2PRYA 3N8DA 1NAIA 3N7AA 4UOEA 4U7HA 3OMLA 2VRWA 1BU5A 4HXYA 4QUKA 5J5VA 2GPYA 3TTWA 2VPZA 1E59A 2YYZA 2QMEA 4LY0A 1O03A 2FUNB 3HQ4O 1I10A 3LHKA 4BLQA 3SMQA 2EG5A 1Z7YA 5JZSA 2VHVA 1YBMA 2QIOA 5HK8A 1MAUA 1XMQB 4CKEB 1B43A 1JG3A 2JL1A 3DOFA 3MA0A 3T7CA 1EFAA 1HT3A 3VX4A 2MSNA 4R69A 4QJ5A 3L79A 1KI2A 3VC7A 1Y5MA 4B31A 1A96A 2VJMB 5DX1A 4Y3UA 4OY3A 5FUVA 1QZXA 1VP9A 2IYVA 2I33A 3AFNA 3D2AA 1J0BA 5FNVA 2G1PA 4UBJA 4NX2A 5HUHA 3FYUA 3KTAA 2XJ4A 4QOEA 4RCVA 4TV9A 4YS6A 2GUWA 3W9BA 4U9UA 5U9CA 1ESDA 2I22A 2ID9A 2JBAA 5K8UA 5KYXB 5DN9A 1G8MA 5I3CA 3HNOA 4I5FA 1K1EA 1N4DA 4Q7KA 2KB0A 2YWEA 3W1WA 3STTA 3E2MA 2C4WA 2C7PA 5JUWA 1Q7GA 5K3FB 5GTDA 1ZNXA 3D3WA 3UGTA 1Q22A 3VXKA 3JQ6A 3KSDO 2GRJA 4MO2A 2E82A 4C20A 3T5GA 2BT4A 1U7OA 2HDHA 1CB0A 5EXXA 5AUNB 3P2KA 1GA6A 4WXEA 3IOYA 3T3OA 2XZPA 4RIGA 5IASA 1V7PC 5EJ6A 3MS7A 4L4XA 4EARA 5AUPB 5FA6A 3ZJYA 2XCQA 5F1KA 1FJGB 3R23A 4NE7A 4E13A 5HKKA 2W9XA 5JQGA 4BU0A 2VYFA 1NG9A 1NSFA 2HYDA 1WZNA 2X9LA 4LF9B 4NYJQ 3ZDZB 2R5FA 4L85A 1FBTA 3RO7A 1A9RA 3IKJA 1SBHA 3WLEA 5BORA 1GCOA 3L07A 4KX3A 2B69A 1JF8A 1ESCA 3C2QA 4MW5A 1EYZA 3HHEA 4JQSA 1FFDA 4OV6B 4Q1CA 2CHGA 2OVFA 3KELA 4AN1A 2O8NA 3ITEA 1FY2A 1YQ9A 3NASA 4JUDX 3VYWA 3WNQA 3WYAA 2B83A 2R5WA 3C15C 3QYPA 1Y3CE 3GNSA 4TL6A 2OILA 5CFQA 4KVZA 1M0TA 1OCEA 4J6FA 4KH0A 4OATA 4K9KA 1P8AA 3EC7A 4EJSB 2PVPA 3DLTA 3TVDA 5DSZA 3Q3HA 5IDYA 3CW9A 5CRIA 5ISMA 3TMAA 1DPFA 3AF3A 3NTOA 4BNLA 4R8LA 4MGKR 3BFXA 4AJJA 5TB5A 5G0WA 2YFKA 5ALNA 3WKCA 4EW3A 2M6LA 1OAOA 2O7VA 1HT1E 2XNSA 1YFLA 3H4MA 3AHFA 3DEIA 3RC8A 5C5DA 2Z1NA 1GRRA 1WUYA 3G6KA 5CM2Z 1RFGE 4QOIA 2AUNA 2QUZA 1BU8A 1J7KA 4OGGA 1FEZA 4PZDA 4W9NC 4UVEA 3ZPXA 1ETHA 2XITA 1EQAA 1HTTA 4C7KA 4CYMA 2ZZMA 5EE5B 4MV7A 6YASA 4OXYA 3THYB 3PGVA 1TRKA 1N36B 2QL7A 1E1DA 2ZQ5A 3OCZA 3SJUA 1ACJA 3BILA 5D3MA 2W5UA 5F12A 1NLZA 2PGNA 2WUWE 3UMRA 4N03A 1C7EA 2JI7A 5DHUA 3OMWA 3JAKA 3JAMA 2BFDB 3RYHB 3AGQA 4MLCA 4EA9A 4ZCIA 3BDAA 4LGYA 1BO6A 1KMQA 1PL0A 3EVNA 3JQCA 4UHCA 5FOXA 1P0QA 4A8PA 3BERA 4NL4H 2QL9A 5FOUA 2ZAIA 3K2BA 1VB3A 2ANBA 1IK6A 4JXJA 1T3LA 3UJCA 4HAZA 4AK9A 4KQ6A 4KXMA 1QLJA 4DR5B 2BMWA 4C9BA 3SFZA 2QRGA 5BVGB 2WF7A 1QV7A 4TWAA 4YV0A 1ETUA 4ZOEA 4G86A 2I3AA 5JCJD 1U28A 4E6EA 1R0CA 2EJWA 2P1DA 2I4MA 2A53A 3BMQA 3PLRA 2VJAA 4G5HA 4HX9A 4Y6QA 2FK8A 4UM9D 2OLEA 3F2VA 4WGGA 3ER6A 2IDJA 3DAGA 2ACEA 2R1VA 3GLTA 3INRA 2XQVA 3DTVB 5CD1A 1L8OA 1E7YA 3ADBA 1T24A 4U2DA 4LZPA 2FH5B 2XUQA 2YXPX 1U2EA 3IAM6 3QXGA 4YMGA 4MUEA 1J2UA 3N6VA 3QVKA 2HRZA 1GDTA 1C8LA 4BN0A 1IN1A 4EHDA 4B4VA 1L4YA 1UDRA 4GD3Q 1NMEA 1OC4A 3HH8A 1NVWQ 4LAFA 1JTFA 3DW1X 4H60A 4ASUD 1H0KA 4DQLA 5G02A 4L4YA 2PGAA 3O8DA 3HCCA 5B58C 2GFIA 2QNRA 3NJ8A 1WP9A 2G82A 2JD1A 1DP4A 4M86A 3TH5A 4KXNA 2BONA 1M6VA 3AVYA 1CUZA 3WSVA 2ZDQA 1ZW6A 2PRZA 2GF2A 1I14A 3PTZA 2O9JA 3GRCA 4RA6B 2JIOA 1QONA 5EMNA 5BW6B 1LRKA 1XTVA 3TKLA 4HDRA 1D4ZA 3IH5A 4OHCA 4D42A 2ZR0A 1WM1A 2Z3VA 3U7EB 4B9AA 4UM9B 4UCFA 3VKVA 4LZWA 5DCWA 1Y5RA 2GBIA 5FUXA 4DNQA 3PIIA 1VL2A 2REXB 2JGIA 1JLKA 1AC5A 3IOEA 2CVZA 2MOKA 4HGQA 3SZUA 3VH1A 4URVR 1EXVA 2R0QC 4CIYA 2BFWA 3AETA 2Q7XA 3VDQA 1G3IA 1BHQ1 2FETA 1JQAA 3A4MA 4NDAA 4IIJF 3W2IA 1VKNA 1FXWF 2QV7A 3A0RB 1XO1A 3PXCX 3NR2A 4GXNA 4NENB 1ZFNA 2Z58A 1ONSA 2W22A 4MDEA 4ZU6X 2NSLA 1AKQA 3GJ7A 3EG9B 2HQOA 5DLEA 3CNQS 3PD7A 4KK3A 1JA0A 1RXIA 2EDAA 2H3EA 3ZQ4A 4TQUS 3FNIA 1ZNYA 4D4MA 2Q0XA 5INTA 4TRRA 4WNAA 3LP8A 2RI1A 1F3LA 2GCPA 3N58A 1V41E 1OYOA 2L19A 1Z6AA 2XNDD 3H2BA 4XIFA 3ROQA 1QCDA 2XXBA 3Q8XB 4BNVA 1I2CA 4RTJA 4CKZA 4B3BA 2ZU0C 2HTEA 1XR3A 1H2EA 2PVCA 4I08A 1G2QA 1MT3A 4BVFA 4YRGA 2WA1A 3NPMA 3RSOA 3EVZA 3WIVA 1JG7A 3SEFA 4GHWA 2JEZA 3QMVA 1G21B 2PANA 4ZQCB 4J0CA 1AGYA 2O59A 4RSHA 2ZSIA 4A5SA 2PJUA 1P77A 3PD1A 2PA0A 3LUDA 4H7FA 2BZ1A 2BGLA 2GYYA 4O4HB 4B46A 4MW0A 3F7NA 1PBNA 1LK5A 3K4PA 5K0TA 2O2XA 2XTMA 1MAAA 4YMTA 4TUYA 4ER0A 1E5XA 3T7IA 4HNQA 1QE0A 1DQNA 3IELA 1RTTA 3OFSA 2Q3BA 4MP6A 2UYCA 3RSSA 3ADDA 3EZ6A 3IBSA 1CQJB 2D1YA 1UC4B 4X64B 1GGHA 3OA0A 1NP3A 4A7PA 1T26A 1L5NA 3MCTA 1KORA 3HZOA 1M5RA 1CUIA 1T3HA 2G08A 1TQDA 1T9CA 5YASA 4B3FX 3KQUA 2HDWA 2O5EA 1E8MA 1FSZA 4IWXA 1HLGA 3ST7A 1RRCA 3AHGA 1K0UA 2V6GA 1RRMA 5HQJA 3WIOA 1T3ZA 4LYEA 3E48A 3TLYA 1WCYA 2EDCA 2WP0A 3BYZA 3H0EA 2BOVA 4YJGA 4IDQA 4NMLA 1SY7A 1F6DA 4BJ3A 1BCSA 2L69A 4FBGA 5E2AA 5FBHA 2A9VA 1CDZA 1K6MA 3HA7A 3IHLA 2GNPA 1NSTA 3OFJA 2KMLA 3P5BA 4H7EA 4PTYA 4YJ2B 5AXBA 3TRHA 4XWTA 4IMRA 4YCJA 1RQGA 2MYPA 2NQ8A 4HLNA 2FX3A 5COAA 3ICQB 1NBHA 3AJAA 4ZZ2A 3A0UA 4URUR 4ETWA 1JZTA 5FAXA 4RKWA 5LKRA 3BH7A 1JLHA 2BJWA 4RNDB 1Q7BA 2DWQA 2DPYA 2VYCA 2RGEA 4NQZA 2A9OA 3ORQA 3OCWA 2EV9A 3GPLA 1LPOA 2OXIA 1L6IA 1N2CE 1MO5A 3FWYA 3I2KA 4FBLA 3LK6A 1K06A 2HCJB 2NX2A 3HUDA 3RFUA 2GJSA 3UT0A 3E5NA 4O4LF 3H9GA 3OLYA 5JD3A 4MRVA 1UKZA 1GTZA 1OI2A 2ZJ3A 4J75A 4LNUA 1SUSA 3I0ZA 1NVFA 4E12A 5FUWA 4MA5A 1SC6A 1RWOA 1Y82A 1HMPA 4K03A 2HBQA 3UH1A 4DNFA 3ICEA 1WXQA 2PT5A 3SGLA 5AXDA 2EJCA 4V03A 1X7HA 1PL7A 3FCUB 2V98A 5KKAA 3I5XA 2WYWA 1PNTA 2PZ8A 3KLMX 3N0XA 2OFPA 4P08A 1RVV1 3WGOA 3NBAA 3H4TA 2GBPA 4AF8A 2FUCA 3W1VA 3ZXUB 3G5LA 2VZLA 4FT2A 5JBQA 2P3SA 1UT6A 4TMYA 3ZI4A 2HA7A 4CMJA 1C9DB 5KVQA 1WVMA 4GM4A 3SYNA 4EMUA 4WK6A 1UOPA 2WSLA 1J70A 4X60A 4YCCA 5HIMA 2GOYA 3C8HA 1G55A 1Z12A 3EVCA 3P52A 3MD9A 2E87A 2B8TA 1XP8A 5EMLA 5D2CA 2HCBA 1XC7A 3NHWA 3F6YA 4JELA 4UULA 3N3BC 2PUEA 1ZJ6A 2CL5A 2R8PA 1EGAA 1GU7A 3NNSA 1S2MA 1Z2EA 4ZFNA 2X0FA 2PZBA 1STOA 2GX6A 3A3YA 2GAOA 3FPSA 3UB3A 2C8LA 5ALSA 3E7XA 1TZ2A 3ECSA 1Q0ZA 4KBGA 4R1QA 4FXPA 4RENA 3QBVA 5CB6A 1ZA2A 2QLTA 3UMJA 1UK6A 1FYVA 2XLBA 3CV3A 1PUXA 1YQUA 4JB8A 4MYHA 5E6RA 3VTZA 2C2XA 1LSOA 4I66A 3OOYA 4ZQBA 2DRIA 2X3FA 2I7DA 3DZCA 5CVUA 4HAXA 1Z6ZA 1I3NA 5AVUA 4HNAB 2G72A 3OZSA 3A1SA 3HZZA 1TECE 2AFHA 4RK4A 5ALPA 4HYQA 1KWGA 3DF7A 4WOKA 3IODA 4G63A 4M46A 3ZK7A 1W4RA 4W5HA 2IELA 5E4TA 1W5FA 1W19A 3NHUA 1JXAA 3MEQA 1ZH8A 2HJRA 4W63A 1H4TA 3HP1A 4FHEA 2IQ5A 4XW2A 3OWHA 1YHZA 3W4IA 1CZUA 3C7CB 1F2VA 4HRAA 5BR1A 3Q12A 5C2JB 1FK8A 4QRIA 3D3QA 4PZYA 4ZAYA 1XBTA 3ZOKA 3ZU2A 2AE2A 2FE4A 2REOA 3GNTA 3D3NA 5DTMA 2BJHA 1JAXA 2Q2QA 3OOEA 4QBTA 4PX5A 4ZCQA 3T54A 3TLGA 5CITA 3A7EA 1V8BA 3LPMA 2BEKA 4QXRA 1J56A 4H0CA 1HYBA 1XF9A 4PFJA 3AUJB 3U7QB 5MGNA 1UKCA 4ZAWA 4PG5A 5KSYA 3PPWA 4FLEA 3G0CA 4LF8B 2C3PA 4YJDA 2Y76A 2CV0A 4QRDA 2Q21A 5GOZA 1V3TA 1XGKA 3LKBA 4KE7A 4OQXA 3C7DB 4QHYA 3OQMA 3R5JA 2ODAA 4OGWA 1NOIA 4OQYA 2NSHA 1L4BA 3V2GA 5KAPA 3HC7A 1SWWA 1JL3A 1NJSA 4RYLA 2ZS7A 5AI9A 5E4JA 2O6LA 3GNLA 2AHOA 2ZBGA 4DIUA 3CXRA 2P6MA 1IZ0A 1SOUA 2GZDA 4ID3A 1KEEA 3K30A 4JWKA 4MH0R 9MHTA 2WE7A 3BZUA 3AQ4A 5B1SA 5H68A 4C0QC 2R48A 3G49A 4D96A 3QK7A 1WMDA 4NONA 2CXOA 2H18A 3X1WA 2E9SA 2NW6A 4HNSA 3DG9A 5TPZD 5CNKA 3EDQA 4ZVPA 1DCMA 2BCEA 3V2UA 3VHLB 4E15A 1GNLA 3SYMA 3BCUA 2QRHA 3QXSA 4KVAA 3C3DA 4QBGB 5EP3A 4ZVSA 5B6IA 4CEHB 4HCJA 5IVPA 1OFHA 3F6EX 1UBOS 1QFSA 3KYCA 1Z2DA 4NCXA 3M5CA 3SD7A 4U2BA 3HCAA 1PZFA 2H4HA 2MINA 1XV5A 3G9TA 3RBZA 4I3GA 3ROKA 3UOWA 2HCFA 4JLDA 2O50A 5A3JA 2V8OA 2EQ5A 2WIDA 5IJ9B 1VL0A 3GFOA 5F64A 3PE6A 2JI4A 4EYKA 4ENUA 1EUYA 4R31A 2PS9A 4JI5B 2IU3A 1GCGA 1NVVR 3CX6A 3FOBA 3OTWA 1DLJA 5BV8A 1QZTA 4EJMA 1YU6A 2C3OA 4QGBA 1XHFA 5HF6A 1E8DA 4FTWA 3HB5X 1OKKA 3OZDA 3HKEA 1JKXA 2OG1A 5JFOA 5REQA 4PV7A 4LX0A 5KYGA 1FNBA 1VDZA 2P9ZA 2DWOA 2JGFA 3CWZA 2FFAA 2GI4A 3CLRD 1WMAA 5THXA 1DBWA 2P9HA 2IY8A 3RV4A 3F8WA 3T3DA 3W1EA 1YS4A 2QTWB 3A26A 1SELA 2POQX 2B99A 3DEFA 5ITZB 1SU7A 1TJ4A 3CO5A 5LCXA 4AS1A 2F43A 2J85A 4MW4A 5B57C 3KQPA 5BQXA 2CFSA 1PSWA 2DBVO 4DLXA 2XQKA 2PD6A 3HU2A 4K9RA 4QNMA 2NMVA 2X8JB 1MTOA 1GG5A 1TE2A 1XMXA 2VATA 3BWCA 3TRDA 5A5FA 5JH7B 1I7PA 2VXBA 3AF4A 1A4RA 3TI9A 1TLTA 3NEAA 1MO4A 3VISA 5IKXA 4KWTA 2WU1A 4BNUA 4R1MA 1XK6A 5I9IA 3IIMA 4PXAA 3MGBA 1PCXA 2I4OA 2QRLA 3LQ4A 1TK3A 2PX2A 3KD2A 1LNZA 1NNI1 2MSEB 3WKAA 2X0EA 3DDZX 3QU2A 2ZATA 1Z38A 2ZAOA 4J91A 3R0IA 1ODIA 3QUCA 4D9NA 4WVFA 3HKBB 4RY8A 2BFOA 2BFBB 3ZE6A 1WDMA 1OWNA 2IOQA 2JFOA 1OV6A 3EAQA 1C0PA 1GUYA 4CG2A 3OOJA 3AKDA 1X6VA 3R75A 3MM4A 3NHRA 4GZ5A 3DAHA 3PRHA 4N6NA 4DPKA 4TZ6A 3AFHA 1I80A 3FY4A 1VG1A 3ZCRA 1DTEA 4P33A 1R5NA 1DG3A 3ZLBA 1NYRA 3D7LA 2QXTA 4PSKA 4JOQA 1DXQA 3GAAA 3I42A 5EXEA 3ABOB 3TG8A 2CDCA 2AI1A 1LLUA 1O5OA 2ZKIA 4S35A 3AHDA 3PR2B 3KEMA 1T2VA 5JS6A 1T34A 2C58A 3PDHA 4M8SA 2C0CA 5IXYA 1DIAA 3DOIA 3O4GA 2FZWA 4QPCA 2DFTA 2Q0HA 3I4LA 4V3BA 1R0ZA 3RS0A 1S4QA 4L8GA 1HMYA 1NQ5A 4II3A 4P5DA 1J9ZA 2WY2D 4RTQA 3NPAA 1RXEA 1X39A 3AB3A 3LBNA 2DUUA 1DAHA 2GSDA 3H5RA 1GV1A 1GKIA 2GHIA 1NVXQ 1VHWA 1X2EA 2D00A 3EMBA 2R87A 4G41A 5ANRB 3HVIA 5DGXA 4E30A 5AVWA 1DRWA 4P9NA 4JUBA 1K9VF 3U1BA 1DOZA 2AB0A 7AT1A 1DKMA 2JJ2A 4JUFA 1BTOA 1FYEA 1HSOA 2V74B 1W2GA 3EVDA 3QHAA 1I3KA 2RKOA 1SKYB 2VC2B 3CF0A 3U3OA 4OX9Y 1M1YE 2ILVA 2VF4X 1VBMA 2OC4A 3BSFA 4AICA 4AXBA 4EMSA 1XD9A 5EXTA 5BSTA 3UAOA 1O94C 1C30B 1GO2A 1PV4A 1GDHA 4BQOA 6GPBA 1L4GA 3GC6A 3K2EA 5JE8A 2FJPA 5TMBA 3RSLA 1N75A 2CN1A 4IILA 4NJEA 2CFCA 3PIDA 1LWOA 6AT1A 4R1TA 2YVKA 3EXHC 1A9ZA 4NNPA 1HFKA 4D4JA 3D43A 1QBGA 1TZBA 4UUNA 2EWVA 1BEEA 5LMCA 1TXGA 2BFCA 4EPWA 1U8FO 3BDIA 4AKTA 4WUVA 4OYHA 2CCKA 2SCUA 2BEWB 1QP8A 2DB3A 3KVOA 3V8BA 4YAWA 2ATXA 1EP1B 2X0RA 3AOEC 3BE4A 3K6SB 3L0ZA 1NURA 1YZUA 4P58A 2OMEA 1GIAA 1W34A 1JDSA 1XEWY 4YLEA 1YVUA 2EFYA 1JWBB 3I37X 1JB9A 3D4PA 1Y9AA 4P35A 3KQTA 1BC5A 1I8TA 3I5AA 5DXFA 4EGJA 1F1BA 4R2WA 5BYJA 5MF6A 5IC5A 5EIAA 1C4KA 4M6WB 2POCA 4J0KA 1XCLA 3RIHA 4KQCA 5IUJC 1E4VA 4L15A 1TPZA 2Z9DA 4HX2A 1FZQA 2CXPA 1NASA 4O1MA 3CF4G 4WNYA 1IB0A 1J4AA 1U5AA 1JEOA 1KETA 1US8A 2GZHA 3EXIA 5H3HA 4XJSA 1FYXA 4CLEA 4IJVA 1VLZA 5AYVA 1UJ4A 1FDIA 3KJFA 3N7UA 4RKEA 5T64A 4C4XA 1FMFA 3U17A 4FFVA 1HRKA 3FJYA 4IMIB 4BZXA 1ZAKA 1GUBA 2X42A 3BS4A 3K9BA 3IOMA 3VVLA 4Z4CA 3N59A 4P3XA 4QTUB 2Q1WA 2HLDD 5EJMA 2RGCA 4YQZA 4PHCA 4TYWA 1ODSA 3S2YA 5DEOA 4YRKA 1ICIA 2YHSA 5ALHA 1XLTC 2ZE5A 1Z45A 3IA7A 4H27A 3D7MA 1SVMA 2A5LA 9LDTA 4W9RA 4P2GA 2CEKA 5FUBA 2WQ7A 4KEAA 5LJIA 1NL3A 2H65A 4G84A 3I1FA 3ESQA 5DSXA 4OVKA 3IHKA 3ZCQA 3KPJA 1E1YA 3HXTA 2QVBA 3RC7A 1JLLA 4FYIA 1F0PA 2SKCA 4D8VA 1USVA 2NU6A 1ZN9A 1JBEA 3ECAA 5ED0A 5HJ7A 1GKLA 3LL4A 3KSBC 1G17A 4IG4A 1E3MA 1TF7A 3T0IA 3FTEA 3LGXA 2OYRA 3TINA 3C3EA 3GGOA 4HWGA 3V6LA 4C5AA 5CT4A 3LPNA 4YFYA 4FR5A 4Z9BA 2HMYB 2QX7A 1PJRA 3DE0X 4UHBA 5CVJA 4B2YA 3O3MB 3L4SO 3A1EA 2WF9A 3A1NA 2XB8A 4XM2A 1ECGA 5F21A 4WW0A 3RVBA 3B6KA 4JUCA 5DLYA 4NSNA 4OQNA 5HF9A 3LOPA 2GJ8A 3U3KA 1UPBA 4DAOA 1FFHA 4WK4B 4BFVA 3PD0A 2A7XA 1E9DA 2GM5A 1GXSA 3EZYA 4M7RA 4EUSA 1JYEA 1PYGA 2ZVPX 3O2NA 4BQPA 4D9HA 1E58A 2PAAA 2QTAA 3T9AA 1KIAA 1H2RS 1SHKA 3ENNA 3AMVA 4DCCA 2JI6A 2V7PA 1NLYA 3K4HA 5AOVA 1ZIPA 5CTJA 1GPMA 5BWOA 3RNLA 4KFSA 1KYWA 1P1CA 1P4JA 5DASA 3V7UA 2BF4A 1II0A 1H93A 3A6KA 3IILA 1GPH1 1NQXA 3G02A 3PEEA 3ZK8A 4YT8A 2V7XA 3PITA 2AR0A 3D8SA 2FKAA 4IZOA 2LRHA 1E64A 1VE1A 2QSZA 2WI8A 3OTGA 1MR3F 4M9QA 2G7ZA 1UBRS 2KX7A 3CA8A 2IOYA 1VIVA 2R00A 1CEXA 4B2PA 1F2TA 1ANKA 2NYAA 3DHEA 3O83A 1FQWA 1E7QA 4IL5A 1RAGA 4U9IS 2JG3A 1L2TA 2IZZA 2JRLA 4KTTE 3GLKA 1VHJA 3L1HA 3MTEA 4ZCTA 1Q3TA 2FF7A 4QYTA 2XRYA 1B26A 4L72A 3ZDXB 1MIOA 3BMOA 3GJ6A 4JI1B 4EG0A 1EVIA 1B23P 1Z7EA 1R8JA 5HKLA 3GLVA 4EUFA 2AK3A 3HKDA 3LXUX 3QE3A 1YONA 2I6QA 4MPRA 1EDDA 1EWKA 4XXHA 5TEVA 3LF4A 1GQOA 2AQHA 4G9GA 4DSUA 4FYMA 3UK2A 4E46A 1I32A 5FOTA 3LV8A 1BEZA 1FOEB 2YHUA 1P9LA 4I5GA 5EZ6B 4YQFA 2Q6KA 4K28A 4LRUA 1OPXA 4A6DA 4C5BA 5HZGA 2X2PA 5SZIA 2O8FB 3TTSA 4ZV9A 3KKOA 4XQCA 3WRVA 3U37A 2DPHA 3RADC 1RXUA 1VMAA 5E4FA 4CU5A 4A03A 2DPMA 4G1BA 3W06A 2BH9A 2FMXA 2ZPTX 5HIJA 2HB6A 3T41A 3JYOA 5LP6A 2XVMA 2IECA 4E2FA 1AGXA 3VV2A 2BBTA 1BRMA 3HB1A 4UEOA 4RX1A 1GILA 5BSFA 1SCUA 5KINB 1U65A 1KGDA 3M8KA 5CBKA 4F3RA 2V0CA 1JHZA 4Y9SA 4O2BA 4PN7A 4TMZA 5AKHA 4GYKA 1M5UA 1B2LA 1UJCA 4XLLA 4QQNA 2CLKB 3FNHA 4EHHA 3BHJA 1CBUA 1AZTA 3G9UA 3L7NA 1JIXA 2IVFA 2VRCD 3OA2A 1L5GB 4DWVA 1BOFA 1EVQA 1ORIA 1FDRA 3CH6A 5J3JA 1Q83A 3OJEA 5CPBA 2FTKE 2FR1A 1YI1A 1Z56C 1NIPA 2Z95A 1QR2A 2J9RA 3C24A 3CRVA 2ZOSA 4LE0A 3HP4A 4OFWA 2ZWMA 3CUUA 3V4FA 4LSWA 1ZSVA 4S0XA 4XGKA 4WKPA 1LLDA 2CLEB 3UPUA 2D7DA 1BE8A 4QFDA 3VDNB 2PL5A 2ZUSA 3VR4H 4BNDA 2XLCA 5KIAA 4R1SA 4NXNB 2BHLA 4PR0A 3FCXA 3DQPA 4WINA 1CLUA 3W5CA 1JI3A 1KDRA 4MVJG 4WL0A 2JZOA 1FNSA 3LDFA 2GTPA 3GDOA 3PJDA 4GPD1 4JAVC 3S6JA 2PQMA 2IBSA 3M0EA 1YQDA 3OCYA 1QDLB 3K5IA 2XBMA 4LBZA 3MMZA 4X71A 1K3TA 5EXCA 3KL4A 3TJMA 2J0SA 3CX3A 4JASB 3WQSB 1Q0PA 3OFKA 3VI3B 4YBRA 3JARB 3VPBA 3WB2A 1X1AA 4NZYA 4S2EA 5JMOA 3MRTA 4K3UA 4Z9AA 1AGRA 1EVJA 1MVOA 2OGFA 3BXFA 4NZMA 4J1SA 3ZTWA 4F04A 1V5IA 1IY8A 5CXQA 2PUGA 5K0GA 1WABA 4YK7A 4YHHB 2JKZA 2C8VA 2JIDA 1OOEA 1Y98A 3ETNA 1VSQA 1LUAA 5FHQA 1DINA 3IAS1 1JR4A 1YZHA 4QUBA 1ZD5A 2HY7A 3IP9A 4N40A 1U3TA 1UXKA 2PZFA 2B37A 2RGXA 2ZI9A 3QKRB 5AK3A 4D3SA 4F4UA 3GJZA 2FDRA 4CM8B 1JAZA 4YJKA 4BPRA 4NC9A 4E3WA 4CM3A 4D25A 4A2WA 3HWWA 3LL7A 1JSZA 1AT1A 3DMPA 5LM3A 4X44A 5CM8B 2JGAA 1AU9A 2VDWA 4PXSA 2EKQA 1XLUA 3B82A 1MQSA 2BGKA 3E1GA 1GY8A 1JXOA 3VO9A 3AEQB 1WVGA 2NP7A 4EM6A 2JGLA 3RIGA 1ZI6A 1KYZA 4XWOA 4WY8A 1Q1GA 5JAQA 3D64A 3KAPA 4LHXA 3A3OA 1BA2A 4A0RA 1H66A 4U7DA 3T99A 2ESRA 1CUVA 1ND6A 3RS5A 5BUSA 2AXQA 5DBEX 2E2WA 2GJKA 2QVLA 4WJZA 1NVMB 5FI3A 5EZYB 3S70A 1USGA 2UYGA 1R5OA 1U04A 1NF2A 1VXRA 2WSIA 3BWMA 3PP8A 1F38A 1VHDA 2FWRA 4L51A 1MV8A 4KOEC 5IN4A 3NRBA 5LR6A 5EWJA 1PJ2A 4BNYA 1A69A 5L9AA 3G5UA 1HDCA 1U3WA 3WRYC 2P77A 3CLUD 3G1WA 1Q0RA 1AF7A 3KSRA 2WWYA 2RG1A 2FLWA 2JJMA 3MUOA 1UZLA 2GETA 1G9SA 1NQWA 4YNBA 3ZU3A 3KR0A 4RNCA 5KC8A 4QVKA 4TTRA 3YASA 2IPAB 1JJAA 2PRSA 3DPSA 3ON5A 1MC8A 2JFNA 4MQEB 1IM2A 3VR3D 4EY7A 5LQCA 1TW2A 5I7OA 2W4IA 3CFIA 4IS2A 1YO6A 1D07A 4MV3A 1NI5A 2GLUA 1MC4A 3M9WA 3IOBA 2GF0A 5T6MA 1GZ3A 2C2GA 4LHWA 4OXRA 1NJGA 3HB4X 4HSEA 1PNRA 1J9GA 3UCFA 1T6ZA 1M76A 1CQIB 2J0EA 3EEQA 4DDHA 1P9RA 2YJNA 3DWEX 1IXZA 3C5VA 3D2BA 5TPWB 4C7OB 1PR3A 2QM0A 4Y6OA 2ZYUX 2BTOA 1N5MA 3I2HA 3WL8A 3KXIA 2XDQA 5HCIA 4MVXA 3UFXB 1DEAA 1ZA1A 2OD7A 3LNTA 2XTAA 3AY7A 3IQIX 4GOJA 4MRSA 4DTCA 4RZ2A 2Q27A 1M2OB 4MX8A 1N8KA 2B5WA 2DSNA 1AO3A 2VQ3A 1MX1A 1XTQA 3DNPA 4LZZA 4MITA 1BMQA 1N78A 4NBNA 2VAXA 4F1WA 1ABBA 3PJGA 1M72A 5D6OA 4UMDA 5CDUA 2MR6A 4UARA 2O0KA 2R44A 5BQ3A 4JQZA 5D5QA 3BIOA 2XVAA 4AQ7A 2GK6A 1ST3A 1RNLA 2GHQA 3MTJA 2I87A 4KYTA 1XDGA 1WLYA 1JG2A 2W2PA 2XHZA 1M2NA 3GB9A 1U9CA 4FBMA 2VTBB 1IMOA 2PX4A 1XTJA 3LUJA 5EG5A 4O8CA 4D74A 1ZISA 3M6LA 4NWIA 5E7JA 3RS9A 4LZNA 3CEHA 1ZC4A 1FUYB 3BB1A 4IMPA 3MINB 4BNMA 1U4NA 1T4CA 3V42A 4H1VA 3AY0A 3K1JA 3BXGA 3Q4GA 4LQ4A 5BRAA 1VB5A 4WBXC 3PENA 2OKGA 3E5MA 1P6UA 4L78A 5AI4A 3L6RA 5FX2A 3STVA 2CWWA 2FPPA 2XMSA 1ZVVA 2DQYA 4XX0A 1NMXA 3WLOA 4EJFA 2IXAA 1MJGM 1ENOA 2GVZC 3EE6A 3RU2A 4Z7JA 4MKIA 3ENVA 5CEEA 4PSCA 2DCMA 1DBPA 1UFQA 2IEAA 5KSOA 2NU9A 1L8XA 3LO5A 4JVLA 1Q6ZA 4PO1A 3VNBA 5EY5B 1Y4UA 4C30A 4C7VA 4Y2PA 3EOBI 1J20A 1FNNA 3DBLA 5JC8A 2C5AA 4CT0A 2DQKA 1U6KA 1Z2PX 3ORSA 2UUOA 4CTOA 2WTNA 3KJIA 3Q9SA 5IARA 3OPYI 5ILGA 4B85A 2V03A 1HEIA 3QPBA 1R8QA 2E4YA 4N3CA 1TYCA 4Z54A 4GI2A 4QPJC 4B7ZA 5JJBA 2FG7C 1U2RA 1KMNA 4Z0TA 1IUPA 2GR9A 4CJXA 2CNLA 4EWLA 2I7TA 3KC2A 3ZXSA 2XDAA 4Z8YA 4ZVNA 3ISJA 4IRXA 4WBSA 2WM3A 4US0R 5B6PA 5HK9A 3V4ZA 1OR8A 3U31A 3FTQA 1CRQA 5IT5A 3T1YB 3LBAA 4NP6A 4KR9A 5K9ZA 1ITZA 4PZZA 3EXEB 5FBQB 3G0HA 4IDGA 4Y1RB 1W7AA 4H77A 3CTMA 4KRFA 3DV0A 1XRQA 2HGSA 1VL5A 3EZLA 3IDOA 3KB1A 3H99A 3WKBA 1EESA 1BDJA 3GARA 1OXVA 1PX0A 2FPGA 2R7LA 1YULA 1Z18A 3R0QA 4UFOA 3G13A 3BSWA 4CLRA 4BU1A 2ZUFA 3OIGA 4B0PA 1AUXA 3KCQA 4ESVA 4I55F 3T5TA 4N54A 3OTIA 1F06A 2P0YA 1ZPDA 2Y0DA 3UANA 1B93A 5IT9A 1YTLA 2GCNA 3BL5A 3EUAA 4C0LA 1ZH2A 2B78A 3F3SA 1N2OA 3HVUA 3QY9A 1K97A 4NY1A 4OYYA 1C2YA 5IVHA 2DG2A 3MRVA 2HF8A 2V7BA 1LFAA 3HKCB 4MUGA 3WFJA 3L6UA 3DYBA 1BS1A 3LTNC 3E61A 3ED1A 5AW9A 4GUAA 2BL4A 4Q9IA 1H05A 1L5WA 1LU9A 2NUAA 3CG0A 1AN0A 1DX6A 5ICFA 2GZSA 2EGHA 3EXHB 5FEUA 1DC5A 4P86A 4L8WB 4MUXA 5LKAA 2OOKA 1Q16A 3EASA 4JFAA 4KKVA 2JIZD 4ZAGA 3X0DA 4L16A 3V7YA 2DBRA 3BC1A 4W99A 2HSDA 5IDXA 1RCFA 2JZCA 5C8VA 4E22A 1A88A 4IJQA 5HZHA 4EG7A 3L1KA 1BE0A 3Q2KA 1KAQA 3G1TA 2I4RA 4DR1B 2JGDB 1YOVB 1NNSA 3D2LA 5BN3B 1JEQB 1QJ4A 4PSUA 3HM9A 5D3QA 2JLAA 2V7EA 2XMCA 3CO0S 1R0RE 1OH5A 1U5BA 4BVBA 1JEEA 1M34E 5LQNA 3L4JA 3EH2A 1J00A 2WIBA 4JUIA 5C8DA 3RS7A 1RTKA 3E22B 1SC4A 2PZMA 3QKSA 4XWAA 4FMDB 3PI6A 5JZ9A 2P3OA 2ZB7A 2LIPA 5BUZA 2ZROA 5IK2D 1D03A 4O4JF 1AHPA 2PXXA 3L1IA 3OFND 4MARA 3WP1B 4OXKA 1WBBA 4O2AF 3H5NA 5KNCD 2WG0A 3IDZA 3BREA 4G4SP 4A9AA 2A4MA 2NZJA 2P9BA 2PCLA 5CB8A 5LYJF 3VBCA 1LPAB 4KBFA 3VJMA 1K3UB 2ONJA 5AVKA 1FLVA 4BVAA 5E1DA 4D97A 2ORVA 2Q9CA 2Q6OA 2QVXX 2BUCA 1P8JA 3RLFA 3B3GA 1VZ3A 1ZVKA 1G3RA 3WHPA 2BD0A 4ZZ1A 1X7XA 3A06A 3EPRA 4G9BA 1OLSA 4RD1A 1PJAA 3T7EA 4Y2QA 3V5NA 3W2EA 1OTXA 4MWCA 1IVYA 5AVOA 4AS3A 1XA0A 4RE6A 4GR4A 2FJ0A 2J9GA 2G4CA 3JQGA 3AWDA 4TV8A 4XGNA 5KVCA 3ASYA 2AN9A 2VWHA 4R9NA 3DBIA 3JATA 1HL3A 2XCIA 3ZQUA 1NP7A 1C3OA 2HHJA 4EAAA 2MDTA 1EGQA 3E7WA 3USCS 4OLFA 1ISIA 1K0FA 3RYFB 1XN1A 4YJGB 5HA5A 5I9NA 3MOIA 1YS6A 2F17A 2JA1A 4FK8A 2B4YA 2GWRA 2NZYA 4KJZA 3RQSA 3WK6A 1R0WA 1QTNA 3K8YA 1IB6A 4DEVA 2P9JA 4ZQHA 3ZBUA 1G18A 3LF2A 2AYZA 5DI3A 1E6WA 2MU1A 4MQ6A 2F1JA 3CUEF 2WHRA 4DDMA 3N0WA 1KFBB 3LQQA 1QIIA 4I5IA 4G1UC 1CFJA 4I19A 2IUFA 1L7OA 1VGQA 4CPDA 1SIBE 3L4BA 1YR2A 2IL1A 2JCGA 2PCJA 3LUPA 1C3EA 4LWPA 1D0SA 3F5SA 3I1YA 2H2DA 5CLLA 5GWXA 1JU4A 5HYVA 4F71A 1NU8A 1DT3A 5ITSA 1V71A 2VAWA 1ZS9A 4RMJA 3KT6A 5IKOA 3V3KA 3QLJA 4KACA 4S1OA 2AI3A 3WDSA 1PBTA 2PR7A 1RPJA 4WCFA 4FKZA 2VRNA 1QIFA 3OY2A 4Q37A 3GVPA 3EUEA 3AF1A 3K9QO 3T9CA 3ZQ6A 2SICE 3H1EA 1OI3A 2FEPA 4K9MA 1EDOA 1TJPB 3IJPA 3DEKA 4L2IA 4OQMA 4NYIR 2F64A 3ZXIA 3MTQA 1OFIA 4MHSA 5H02A 4TLCA 4FILA 5KO2A 3QJYA 4YO7A 2QD1A 4LYDA 3MAJA 4FOPA 5FORA 2YICA 1X42A 3MLBA 3Q9UA 3U49A 2RJ3A 1Z37A 3DFFA 1XP5A 3SQWA 3U19A 1Z0AA 4ZCRA 1E1LA 2VAVA 1JI0A 4KQGA 1RAHA 4OGLA 4UVHA 4ERXA 4J7XA 3WGVA 2IZ1A 1P0IA 2QPOA 2H2IA 1QZ3A 4J9VA 3D8HA 3DOUA 1KYXA 3K32A 2ZULA 4JNCA 5A7GA 4IXWA 2IP2A 4R8KA 4X3CA 4EYOA 1LJ8A 2AOUA 2FNAA 1XKLA 2XAUA 2B7BA 3B5JA 1P1FA 1TD1A 1EINA 2ORYA 3FKQA 5AIAA 3D0QA 3R74A 2X3YA 5K45A 3NWOA 4C07A 3H9EO 4LV5B 4G5QA 7REQA 4FD3A 1RP7A 2QMHA 2BEJA 3JWGA 4ZOLF 3A1WA 3B78A 3EPPA 1I24A 1WAMA 2BC9A 2WU0A 3HDGA 2IH5A 1VJTA 4JBHA 1Z0KA 3E3NA 4B2LA 4B3SB 4AAYA 3UAYA 4E1AA 1AUOA 3WWYA 3DB1A 2X4IA 3BGSA 3U4HA 3C7AA 2NXNA 4OGFA 4B84A 3DNFA 3GJ5A 1VI2A 1W4ZA 1QQ5A 4O3FA 4UUOA 2IS2A 3KZOA 5EP4A 4GMGA 1W0CA 2XZDA 5BWNA 1OV4A 4WEQA 1RJGA 1Y8QB 2WTEA 4ENRA 2H0QA 4X54A 4LZJA 4FKMA 2CNOA 3H2GA 5IJWA 5L4SA 2VXCA 2WD9A 3EIWA 4RVNA 4UBLA 1BE1A 4RK7A 3C70A 2ZANA 3HGMA 5IAKA 5EJ7A 4XE5A 4IHJB 2JIQA 3WYCA 4H7KA 1T2FA 3SY8A 3ZJ5A 3GFBA 4QEDA 1J23A 2J6BA 4AZ3A 2QTVA 2OSVA 5GJWC 1SPBS 1OJ7A 2RAUA 4RTRA 2PNFA 3QMPA 3OJOA 4K6CA 4NRDA 3SQDA 3GF4A 4AJHA 2OHIA 2G3DA 3OESA 4JKOA 4R3WA 1JE0A 3NHPA 3M6MD 5L95A 1JNYA 1FP1D 3AHJA 1UFVA 1NC3A 1OLXB 4LJSA 5PGMA 3EPHA 4UTXA 3LT1A 1IZZA 3ZZUA 1MOPA 2JAQA 3COYA 4RLFA 4WJKB 1Z3IX 5LB2A 1D2HA 1A82A 3EGCA 5A2GA 3T1TA 3RVPA 2JASA 3ZD6A 1N1EA 4O63O 4LVUA 4TMVA 5KS2A 2AOVA 4M1KA 3PFKA 3UK1A 3O4IA 1QRAA 4QT4A 2Q4TA 2QTFA 1XJQA 2BKVA 1Y7PA 1QKIA 1ZRSA 2Q41A 4GRAA 1T2UA 2GK3A 1G8FA 3HR8A 1KDVA 3RIXA 4OLBA 4IZ6A 5MGBA 4IQ0A 2FZ5A 4ND3A 1MOQA 3JS5A 3SDBA 1UT5A 1IJKA 2W6IA 3OCVA 3KT3A 4FMBB 5EIBD 2I8LA 1I2ZA 1YQQA 3WGYA 3WSTA 1L1RA 3BRQA 4C4RA 2N42A 3FSGD 4RVCA 4ABYA 4BO2A 1QQ7A 1CZNA 1JHAA 2WU3A 1R4NA 1U4SA 4QG3A 4JDUA 4K88A 3L3BA 3ANLA 1NLMA 4X8HA 3QEMA 1JHUA 5KSWB 2XECA 3UA4A 3BMNA 2J87A 2VH5R 3AVOA 4QBIA 4BASA 4WBNA 3CFFL 3H8VA 1G59A 4JBGA 3SHOA 2HO5A 3P5SA 1Y6QA 3OIVA 4E11A 3AKYA 3G2QA 3T1VA 1T36A 2L42A 2ZSKA 4RZHA 2OCBA 2C9ZA 4WXHA 3JQBA 1AA6A 3P2OA 5I01A 3ENKA 1U8UA 1PU2A 1XFAA 4M1MA 4COOA 1VCMA 2CNBA 1U0TA 1E5DA 3NBKA 4KSYA 1U3UA 4DJAA 5CT6A 2Z8ZA 4O4IB 2FV8A 1Z0DA 4KAAA 1EJ6A 4M3NA 2JCSA 2C98A 1E3QA 4KDEA 4DCMA 3EEIA 4BO4A 5KJFA 1BWQA 2ET6A 2Z43A 4H7JA 4DMHA 3WRXA 1HRDA 1NMZA 2XWQA 3TUJC 2HLHA 2F4NA 4XD2A 4D0RA 3P9KA 3RRFA 5AIBA 2EJTA 3ESYA 1ISJA 3L04A 2C1XA 3PFFA 4DR7B 2X22A 1C9NA 1IHUA 1XWFA 3ICVA 3IULA 2AG5A 1Y37A 4OAOA 4PYKA 5F98A 1E5VA 2Q5JA 3A9RA 4FGZA 2F6RA 4PEVA 2Y1GA 4UFNA 4ZGWA 2AXEA 1KJNA 221PA 4ZT3A 3ZJUA 1GGVA 4XB1A 1IY1A 3OZ7A 3E9MA 5BOSB 3DMTA 1M7BA 3OH8A 4IDCA 1CUSA 1L4KA 2QGNA 3KIPA 2FEOA 1C8VB 4NPAA 1YUBA 1VE7A 4R1UA 1EFVA 1GGEA 1T91A 2KJQA 2O0LA 4CKEA 1PX2A 1SQ6A 3B7PA 3H6HA 5DHQA 5EI5A 3L7AA 3RS8A 2EU8A 2Z5FA 1WZCA 4ZYXA 5C1OA 3I9KA 2VJMA 3RQIA 4AYWA 5F5XA 1H4SA 1NI4A 5ALXA 1EGHA 2E4VA 1V1RB 3G5AA 1UPFA 3VOBA 2QRVA 3ZEIA 4AP5A 5HJEA 3IBFA 4WI1A 2WJ4A 1Q57A 2Z8YM 4DZTA 3MWEB 1DJMA 2QU7A 3GQBA 3TRIA 3JW8A 4DQXA 4BJHB 3CX7A 4B9EA 4F38A 3B5IA 3LHDA 4DW8A 4BFLA 4DR6B 4FLMA 5B7PA 3PC4A 2WKPA 2PQ2A 1MQAA 4FEYA 1AKTA 4GYYA 4QNRA 1JQEA 5K3FA 4XQGA 4G0WA 5AOBA 2QTTA 4FCTA 1II8B 3HEBA 2ZRCA 3GVHA 1UAYA 3KLPX 1MO2A 2DETA 1TTHA 3KLNA 4YVFA 4TTAA 2TMKA 4M87A 4WE3A 3CVJA 3LT5A 4DY6A 3Q10A 3IAM1 1SU6A 5IBRA 3VOTA 4FT4A 1LJUA 3QI2A 3FZEA 5DYYA 3VAYA 1QWOA 3RJ5A 3Q0IA 4CN8A 1EA7A 5TSDA 3FVRA 2E1RA 2DFVA 2PKYX 3AI3A 3P0RA 3GCGA 4IV8A 2JFGA 4D3FA 4MV6A 4G5FA 1MIHA 3NATA 2RGWA 3MB5A 2OK8A 4Z9FA 5GJCA 1K8RA 3EX7C 3ER9A 2OAP1 1HZZA 3FETA 3I6QA 2I2FA 3JZDA 3KEFA 3T3HA 2NPOA 3KUXA 3G8BA 2J3JA 1T9ZA 5EIXA 2JJYA 3KO8A 1N2SA 2W0SA 1UMCB 5HXAA 4A1OA 4GT1A 3UCXA 4YDHB 1V1MA 3ZV6A 3QU5A 3NOOA 2HREA 4C7XA 1QO0D 1U7PA 1X1TA 4CLXA 4CF5A 3VYSB 2AC4A 1XJWA 1N6HA 5HE8A 5IXSA 2FZCA 2QENA 4XEHA 4BS9A 3T9DA 2DWUA 1OQAA 5EPUA 4DC0A 1Y3HA 3OZXA 4MIOA 2R8ZA 2Y1EA 2WAYA 4QOGA 4XIYA 3HVKA 5EQJB 3FCEA 3H1TA 4B47A 1ZP6A 3JRNA 1EUDA 5AQ1A 1K27A 4ENWA 1XVAA 3AJ9A 4IEEA 4BFCA 1T2EA 2GN1A 3EHEA 4C0KA 2OUKA 2DTDA 1I2DA 2R6DA 4B4OA 1XCJA 3OT1A 4RL4A 4OA8A 4IG9A 3R6TA 2G1KA 2O7SA 2WWWA 1PZEA 1KOLA 3VR0A 1A8UA 3PQ8A 1IL0A 1JFFB 2OR3A 3DT6A 4IAOA 3VKFA 3WNDA 4RZQA 1NV8A 3FM9A 2DTEA 1TQHA 2ZT7A 2PZLA 4I1YA 4BP1A 5KOIA 2OHOA 1KH1A 3EA4A 2BFDA 2XUOA 3HS3A 3RYHA 3USES 4I8DA 4Z49A 1M0EA 4AJEA 1MF7A 2LDBA 4IX1A 1ZWLA 4HR7A 3CFYA 4PAQA 5CLJA 2AC2A 1YR9A 3DUWA 3FKSD 3HABA 4NE9A 1ILWA 1P5RA 1TVMA 1ZH4A 1OB2A 3FTFA 1B6GA 1ATZA 5BVGA 1AGPA 3HGTA 2QJWA 3C3JA 2EZ4A 3GDWA 2WA2A 4ZOQI 2Y1WA 4JK3A 1CHNA 2ADOA 2PV0A 1Y9JA 1E3TA 3CH5A 1Q84A 2VYVD 4PLTA 4F06A 3DZHA 1L5LA 3S2IA 1BYIA 1QPBA 3P2YA 3ASUA 3THSA 2WSSD 4Y0AA 2WD7B 3GUZA 4FE7A 3ZYZA 4CIDA 1GU0A 2WVHA 3W8DA 2IIPA 1TJ3A 2EL9A 3D3JA 3V8EA 3DHVA 1W9HA 3TX2A 2R8XA 1UFRA 2M6SA 5A4KA 5CIQA 3D0KA 1NQOA 1P7WA 2PKRA 1OASA 3M9LA 1FNMA 4ITRC 5KTYA 2BW0A 1DAIA 4AY5A 1P5JA 3NGMA 3QVGB 3U9SA 3NDBB 4QYIB 4GLOA 1LA2A 3QG5A 4XSGA 5HKBA 1IWOA 2YUTA 4N39A 1ZJYA 3ZWKA 1WUKS 4LDNA 1KQ3A 1ZK3A 5BSEA 2C2OA 2EWWA 4NXMB 2B2CA 3LK7A 4WZBB 5AI0A 1K7FB 4ETMA 2XUGA 2A94A 1OZGA 1RFLA 1N3IA 3ROFA 1H1TA 2GN0A 2BZSA 5C7IO 2ZU6A 3HUUA 4FFDA 4CHGA 3HHPA 1CUDA 4JOSA 4YAIA 5FV7A 2I1WA 2HRRA 1Q7CA 4U2KA 5DPMA 4JJ4A 1KAOA 2JGNA 2QLJA 2YINC 3K9WA 1WSDA 2AVNA 3R3ZA 4U6QA 5FR1A 5HBGA 3CW2A 4UCQA 4URZR 5JCJA 5BSUA 1H9CA 4BZPA 3II6X 1PNQA 3LM8A 4PFSA 3O4VA 4XOIA 4K6MA 3RNOA 1G20B 5JZVA 1H6DA 1N92A 3ZTYA 4R01A 5CXUA 4U63A 4I4TB 3AXTA 2LCFA 4HP8A 3WK4A 4D9JA 2G70A 1PUJA 5WRFA 2IY7A 5C3MA 3MK31 4JODA 2LW7A 2I4TA 1E9EA 1Z4JA 2OLJA 1RWQA 1X0VA 3DBVO 1HURA 3KXKA 3O8CA 5CDHA 4J0JA 1Y6GA 4KHPB 1PR2A 2JFUA 1Y34E 3RSZA 3EH1A 4RTPA 1RRKA 2O5VA 1PUIA 1G5QA 3L0DA 1ZN2A 4INPA 1XLWA 4DQUA 5A7HA 1DL5A 2XOXA 1L4LA 1JPUA 1N2IA 3P7MA 4A73A 1NVBA 1X3SA 3ANTA 4TKLA 2H92A 1LPPA 5GGXA 3UEOA 1Z6QA 1U3DA 3HJGA 4E3ZA 4OAQA 1R8SA 1T35A 1W0JD 1KAMA 3DBRA 3N76A 1VYUA 2KLHA 3VC2A 5ESXA 1GLNA 2RHTA 3O0DA 3O8OB 3OZIA 1VIYA 3CWCA 3OLZA 2ZRAA 4L02A 1RYZA 1SIUA 3GIWA 5K0CA 1NLUA 5KJCA 4G4JA 4EHJA 2PKQO 2XE6A 4Z3DA 1Z8HA 2IU6A 1LI5A 1KF0A 4I9NA 1E4YA 4W1PA 3M34A 2XAAA 3UW3A 4CR6A 4FM9A 1RRVA 3GEHA 2Y71A 4FCVA 5EJ2A 5HDQA 3IXQA 4QPPA 2W43A 4UAJA 3RSGA 4JP1A 4O4HA 2A9JA 121PA 4XRGA 3QUTA 3G8AA 3FN4A 1XPRA 3NFRA 1XL1A 2WNHA 1UXIA 4F2GA 4CL0A 3CCCA 2HIHA 1E6KA 2RCYA 2VO1A 4F9TA 1KVSA 1J8YF 2AOXA 4KJXA 3TRJA 5HPYB 3O5AA 5T67A 3IKLA 3NX4A 1CQJA 5NLLA 2WYUA 3R7SA 1Y7LA 5JASA 2H51A 1VIMA 3ORYA 4HEJA 4C4SA 2ZIWB 3MFQA 3E2PA 4CDMA 2OBBA 1DCTA 4FIDA 3FMFA 3M5DA 3TFQA 2YKGA 1UQUA 2ZSAA 5LA6B 2NO6A 4IUDS 4RD6A 5CFPA 1COWD 4V02A 4IH4A 4PZLA 3R20A 3QHPA 2WJIA 3MOGA 2XNDA 4INZA 5AKLA 1OA0A 4KC0A 1QYDA 4B4DA 1USKA 2VP3A 2WFMA 3FYCA 5CLHA 1HETA 5C8XA 2B3DA 3GN1A 4ZWNA 1SVOA 3TZEA 3VH4A 5IABA 4G4SO 1E3WA 3QWBA 3TAUA 3TDKA 3RD5A 3VSDA 3IQDB 1PD0A 3FOCA 3RARA 4R54A 2I5PO 2DQSA 3WL4A 1Q1EA 1C4OA 2GPAA 3X2FA 4Q4HB 1D2MA 1PS9A 1X1BA 1H5NA 1XZHA 1XMOB 2ZR7A 4AY4A 2D5BA 1T3TA 4M99A 1U1EA 4WVLA 2WABA 3WB1A 3ZWWA 3A8TA 4KR0A 5BNFA 3AERA 1HNXB 5CTAA 4ZEVA 5BWBA 3O8QB 3VR2D 1QV6A 3IUYA 4C6TB 1E9FA 1KQNA 2B5VA 5EA2A 3U81A 4PPQA 4R98A 3V2HA 5A62A 3I52A 2UYQA 2PR2A 3SHQA 2Q4RA 2G9NA 3DZIA 2X2EA 4LRXA 1XTSA 4BX2A 5CDGA 2NZ8A 2Q5EA 1RCTE 5LJLA 1AS2A 1S9DA 2WFLB 2G07A 4LWOA 2SHKA 4A16A 3H2IA 1V96A 4IDOA 4CV1A 2A59A 4AN4A 4EGAA 5IF9A 2JAWA 5K0ZA 4MO9A 3W6ZA 1ORVA 2AQ8A 4AVYA 1U0GA 1YRWA 4R84A 4RU1A 5IJ0B 3WLPA 4JLKA 2BCJQ 3FNRA 3PKJA 4X9XA 5F2NA 1K92A 2A50A 2W6NA 3N8GA 5HMMA 3UH0A 1YMVA 3AP2A 1NQAO 4P0TA 1S5PA 2YDYA 3DKKA 1PK7A 1QIDA 2PFKA 3L6EA 1NP6A 4WXYB 3D4BA 1RLMA 2ATCA 2GM9A 1CE8B 3GOQA 4QGHA 4FFPA 1CUWA 2XYVA 5CHYA 3VZRA 3JX9A 2IHYA 2H59A 2DUJA 3DMDA 2QRKA 3ETEA 4IZHA 3IRVA 2P6NA 3KR1A 4BE9A 4BIIA 3DMGA 1DUIA 2MT9A 1HK7A 3DS8A 4EHFA 1W8IA 3HR7A 1MZPA 1W6RA 1GVNB 1UM8A 5DMHA 5HUJA 4G4IA 2DHQA 4LXXA 3ONEA 1BSVA 4FP9A 4NABA 3S3TA 3TLXA 2F1HA 3QV1A 1EA5A 3MAAC 2O0JA 3ESBA 5THKA 3IUEA 4GI5A 3TR5A 4IIUA 3BE8A 3G0BA 2G09A 2J5BA 2PMDA 2ZSJA 3JQPA 4B8YA 4CV3A 3PL1A 1WMSA 4HNAA 1J9EA 4EITA 1RQRA 1VECA 4C3VA 1WMFA 3C5HA 1QBKC 1ZQ1A 3K15A 3NIWA 3FMVA 4M21A 1QNLA 10MHA 4WXMA 1P75A 1E5TA 1N5RA 1Y9DA 2VJYA 5F52A 1KDZA 4QNNA 3BRCA 2YMPA 1KEVA 2PKWA 3B2EA 3L0CA 2J3EA 4OI1A 3GDHA 3HJTA 1T3SA 2B0JA 2RHLA 3BICA 3F9CA 3JRXA 3EDMA 5AI8A 3CU5A 1N1DA 3V55A 1OSNA 2VYQA 2J4CA 4X63A 4FQ8A 1E18A 3A2KA 3E3AA 3JQEA 4DIOA 4MV1A 3PCXA 5JMPA 1PTJC 1BVRA 3RSCA 4BP9A 1C8BA 5AK4A 5DYGA 1ULHA 1U0FA 1ZCFA 1ABFA 1T9KA 2ZKLA 4QDUA 4D8WA 4M1ZA 2X6RA 4JI8B 3PFNA 4FYPA 2H1IA 4CQLA 1ZMBA 4IIVA 4I1RA 2YBEA 2MSCB 3MT7A 4YAEA 1XDZA 1XB2A 1KE1A 4RKFA 2V7QD 1IOWA 3L0BA 4DCTA 2O2GA 3RUEA 1KFKB 1TX4B 4UAUA 4P32A 5HQ3B 2V7TA 3OQ6A 1Z4MA 1OXUA 4FCWA 4UNIA 3GLGB 1JFRA 4QQFA 4TSFA 1K2VN 3I05A 1SCKA 3CISA 1NSYA 2OLKA 2RGDA 3JQAD 4MLPA 4B6FA 3M1AA 2BUBA 3L7YA 3PNQA 5IVIA 3UQZA 2BPOA 3NBUA 2FUKA 2YZMA 3TIXB 2QN9A 2LKDA 3ICPA 2PM8A 2ABWA 3EK2A 2PDAA 3JQDA 5JS8A 1YHNA 3KM0A 4RM3A 4DKJA 1ADJA 3CFHL 1QOPB 3ZY4A 1TT7A 2B98A 2WV9A 3UV7A 5GONA 4CCAA 5LU9A 3FCSB 2CJXA 2JFFA 2R8EA 2C5BA 3OQ1A 4CEHA 2XWJI 1H2AS 1SC1A 4WERA 4UQPA 4AF7A 2AHRA 1M34A 1BOOA 2G36A 1P7ZA 2W8BB 3TQCA 5FFFA 2RGNC 3O84A 2OBFA 1IQRA 2VPYA 2D7JA 1GSIA 1YQXA 3COPA 4KX5A 2Y0CA 4ZANA 2I9KA 2RHBA 1GLVA 1GSOA 1H2XA 3G9ZA 3WMGA 1IZYA 5FNVF 3QP9A 5IJ9A 3K4QA 3QJ5A 1RWVA 1MP0A 2I80A 1UJMA 3KKZA 3RAGA 3KOWA 3VPAA 3U6BA 2B1JA 2ASEA 2Y3IA 4NPHA 4V0KA 5KYWA 1QIEA 3T3EA 4YT4A 5LNK6 2WQZA 4I4NA 4EHLA 1AQNA 3GLIB 1KEUA 4KYIB 2P4SA 1O8BA 3ZNNA 2QRPA 1JVBA 3UK6A 1KQFA 2XCUA 4H6VA 5J4VA 2H0AA 4CEJA 3NTXA 1QHNA 3RFCA 2HO4A 3MWDB 2EFHB 3IP5A 4OMFG 2JFZA 5TPZA 3B8EA 3JWHA 2QBYB 5ITZA 4NULA 4HNTA 3AC0A 2H57A 3V1LA 4PIVA 1BX0A 4R9UC 3OPYA 1QVWA 2GPJA 4ZQFA 3BE6A 4IVRA 4U7WA 3UIEA 2HH9A 3BXZA 1EVEA 4I2VA 5EE3A 4JCOA 4OB8A 1TDJA 4FHDA 2V5UA 1F17A 1P60A 2EC5A 4XLTA 2F90A 1G5HA 3DYIA 3AH8A 4KNYA 2P41A 2ODTX 5CLGA 4BMZA 4ODIA 4CFSA 1LC3A 1P1KA 3QPAA 3SNKA 1FXWA 3VNQA 4BFWA 3TVYA 3PQ7A 2FZVA 1KDOA 1CF9A 2MMGA 1J0AA 2RHRA 2R8YA 4XJXA 1XCOA 3GG2A 4LRTB <