4MUEA

Crystal strcture of pantothenate synthetase in complex with 2-(5-methoxy-2-(4-(trifluoromethyl)phenylsulfonylcarbamoyl)-1h-indol-1-yl)acetic acid
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
287
structure length
276
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 93
structure length 276
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4mueA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mueA01
1JIKA 3CVUA 1MAUA 5J58A 2XRZA 1T6ZA 3I05A 1EUYA 2JAXA 4Q16A 4G6ZA 4QBTA 1KH3A 3IDFA 1R6XA 1WQ3A 1N2OA 3DPIA 4K0RA 4DDKA 2A86A 3TQIA 5J59A 1T9GS 1NYLA 4ZCSA 1NZJA 2Z3VA 4DLPA 1PG2A 3SDBA 3A04A 1VLHA 2V0CA 3CR8A 3ZJTA 3CA8A 4PBRA 3MMXA 2O8VA 1J1UA 4ZT2A 1P7PA 1I6KA 4EG4A 4NAHA 3ZGZA 2B7LA 1PFWA 4ZT7A 1M8GA 1H3EA 1KQOA 2E21A 3JXEA 4R0NA 4S1OA 5AHWA 1TYAE 1J70A 1IRXA 4MUJA 1WXEA 5K0TA 1GN8A 4ND7A 1JGTA 1NI5A 3C8ZA 4UZEA 1J1ZA 3TQOA 1O96B 1QRSA 1WOYA 3UY4A 1MJHA 1YUMA 4MUHA 5DEOA 5KWVA 2GM3A 3RFFA 2AZXA 1U3DA 4ZT3A 2E18A 4ZCQA 2WB2A 1O95C 1XNGA 3RHSA 1PG0A 1ILEA 3H97A 4AS1A 3GMIA 4R2MA 4PY2A 4CT0A 2QTNA 3MUEA 2DETA 4MW0A 3RJZA 2XRYA 4CQNA 2CV2A 1H1TA 4EGAA 3D6UA 5FO0A 5LM3A 2CV1A 4P2BA 1M1ZA 3TZLA 4MUGA 5DB4A 3COZA 3PRHA 3SYTA 2ZP1A 1KKUA 1A8HA 1J20A 4OJMX 1GAXA 4EG6A 5H16A 1U0BB 2QUJA 4MUIA 2H2AA 3D6VA 3MXTA 2DERA 1GZUA 3AFHA 3OP1A 4KKVA 3AG6A 3LE8A 1NUSA 3FG9A 4F3RA 1ULHA 4G5YA 3SZ3A 4DNXA 3NBKA 3PNBA 4HK4A 1EFVB 1PFVA 1F4LA 1Q11A 3FY4A 4ZT4A 1KQPA 1N1DA 3N2YA 2YWBA 4NATA 3UOWA 4JXXA 3NV7A 4BWVA 2CSXA 2D54A 4JZYA 5TEWA 1UFVA 4J76A 2DXIA 4MWEA 1M8KA 1K97A 1IH8A 4JFAA 1WJGA 4I6GA 4ZCRA 4MWCA 3IMGA 4E1AA 1N2EA 1QQTA 1PFYA 2VTBB 1JILA 3IVGA 1O0BA 1O95D 3VGJA 3PXUA 2HGZA 3IVCA 5K0SA 3RK1A 1O97C 1OWMA 1NUUA 1IHOA 3TS1A 4U8HA 3U1VA 1HYBA 2X1LA 4G5FA 5HG0A 1KR2A 4QRDA 1JIJA 4OUDB 1EJ2A 3GUZA 2A88A 4MVYA 1O5TA 1EXDA 3N8HA 2D13A 2G36A 1G59A 2A7XA 2CUZA 3CVXA 2WQ7A 3BL5A 4GRIA 2PXHA 4JXZA 4RPIA 3KT6A 1MAWA 1N2HA 4MVCA 4OUDA 3P0HA 3IOCA 1XJQA 3FOCA 1IQRA 3KFLA 3FDXA 3ZJUA 3X1KA 4WSOA 1QRUA 2AKEA 1Q15A 3VRHA 5HUJA 4F4HA 1G8GA 3A2KA 4DJAA 1M8FA 2Z08A 2WQ6A 3F3MA 4ZT5A 3NBAA 1NUTA 3FI0A 5J5AA 4FZJA 4MWBA 4HPWA 1N75A 2C5SA 4YMIA 1LI7A 1KAMA 2GKSA 3Q10A 2NSYA 3ZXSA 4PBTA 3L92A 1EFPB 1YI8A 4A91A 5BNZA 3L93A 2HMAA 4XFJA 3OTWA 3QTTA 1WY5A 2QUKA 1ZJWA 1ZH6A 1TYDE 3G59A 1N3LA 1N2BA 1JEEA 3ND5A 1EFPA 1PFUA 1F9AA 1LW7A 2DUMA 3P0IA 4YBRA 3CLRC 2QUIA 1WXGA 4MW2A 2GOYA 1KQNA 2CFOA 3SZGA 2PFSA 4PBSA 2YXNA 4YP6A 5IJXA 1T6YA 3IOEA 3P52A 4EG1A 3Q12A 2H29A 1O6BA 3DLAA 1MBZA 3S3TA 2DEUA 2IJGX 3MLBA 4U63A 2BYTA 4MUEA 2CYAA 2J07A 1N2GA 4UZFA 4CDNA 2I1LA 4NAUA 1NSYA 3IMEA 4KR7A 4MVXA 2X1MA 1ZH0A 3IOBA 1JZQA 4EG3A 2A1UB 2YWCA 2TS1A 3RK0A 3CVVA 3Q4GA 5FO1A 3CVYA 1G8FA 2PZ8A 3HV0A 4J75A 1YIAA 3KT0A 3K9WA 1I2DA 2RE8A 1M8JA 1OWLA 3FNRA 2NZ2A 3KT8A 1EE1A 2A1UA 2J5BA 3A4IA 5LFAA 1MRZA 4GU5A 2VXOA 4MQ6A 3FH0A 3IVXA 1OD6A 5F23A 2QTMA 1MOPA 3ND6A 2J08A 3SP1A 3ISJA 3HMQA 2OV4A 1GPMA 5JBNA 2D5BA 2PIDA 2IP1A 2J4DA 4AQ7A 3ELBA 4MWDA 1KP3A 2JANA 4R2LA 1BS2A 4JYZA 1N2IA 2AG6A 1K4KA 3CLRD 1M8PA 3CVWA 3E27A 4X0EA 1Y42X 3FWKA 1KH2A 1KP2A 1RQGA 3ZJVA 3K32A 2CYCA 1IFXA 3FIUA 3UK2A 3ND7A 4ZCPA 1JIIA 1D2RA 4ZCTA 2E0IA 3N05A 1M83A 3IH5A 2DPLA 2QTRA 4MW6A 1MB9A 4ARCA 1JZSA 2A84A 1IVSA 1QJCA 4ZT6A 3QE4A 3CLSC 3X1MA 1QTQA 1DNPA 1JECA 3UC5A 1JMVA 3HL4A 1R6TA 1JHDA 4HJXA 3FETA 5EKDA 1O94C 1K4MA 2QUHA 5IHXA 2IELA 1VL2A 1X8XA 1YUNA 2CYBA 2HZ7A 4TS1A 4YP5A 1F7VA 1TFUA 1J09A 4CDMA 1WKBA 2PG3A 2BTEA 3INNA 1GTSA 4DDHA 1V8FA 1KH1A 1U3CA 1OWOA 2X3FA 1COZA 3A05A 1R6UA 1ZUNA 1N77A 1IQ0A 1TYCA 1WQ4A 4KPUB 3QTBA 3IMCA 3MLAA 2O5RA 1YULA 1NP7A 1OWNA 3TZEA 4KR6A 4H3SA 4MW9A 1YIDA 4MLPA 1F7UA 2ZUFA 1WXFA 1Q77A 1O0CA 1VBMA 4DDMA 1EUQA 1O97D 5LLTA 1QU2A 4KPUA 4Q93A 4MAFA 1GTRA 3H9CA 1KAQA 1CT9A 5TS2A 4MW1A 1LI5A 2RD2A 4HJRA 4MVWA 2ZUEA 1FFYA 5KHAA 3IUBA 1J21A 4EG7A 5H7XA 1KORA 1GLNA 3CLUC 4YP7A 3COVA 3CLTC 1VBKA 1OBHA 5TEVA 1H3FA 2DR2A 1O96A 3PNYA 3CLSD 1N78A 1NUPA 2WSIA 1N2JA 1WXHA 2YY5A 3RBAA 2EL7A 3HZRA 1I6MA 4XFDA 1X6VA 2QJFA 3COYA 1O94D 1MC1A 1XNJA 3DO8A 1VBNA 2V0GA 2E89A 1V47A 1TYBE 3VU8A 3AG5A 4L2IB 3IODA 1U7XA 4EF6A 3X1JA 3AKZA 4EFKA 1B6TA 3PNVA 4NDAA 3AL0C 2J09A 2QJOA 4MW5A 3IUEA 3SEZA 3ILVA 2QJTA 1Q19A 5HUHA 1SURA 3G6KA 3GLVA 4MULA 4MW4A 2A4MA 5DASA 2A1TR 3AIIA 4KR9A 4L2IA 3ZUGA 1NURA 1I6LA 3HGMA 2Z09A 1OBCA 3M5WA 1G8HA 2DLCX 1WXIA 3G5AA 2CV0A 2X0KA 2PZAA 1TQ8A 3H05A 1S4MA 4MUFA 5DK4A 2A1TS 3KT3A 3DV2A 1H3NA 4MUNA 3HFJA 2JA2A 3H99A 2CT8A 1XNHA 1NUQA 3UMVA 4MW7A 4EG5A 1TEZA 1EFVA 4U7JA 4XSVA 2R5WA 3ZXIA 3P0JA 4I6EA 4K03A 4ND6A 3ZIUA 5TGTA 4MUKA 1MB2A 4EG8A 1WZ2A 3LOQA 2PZBA 3FHJA 1IQUA 1T6XA 3CLUD 4RUKA 2OQ2A 4DE5A 3CLTD 3H9BA 1K92A 1FYDA 4ARIA 4NZPA 3LCJA 1QRTA 5KCMA 1QU3A 4NX2A 2EJCA 5FNZA 3COWA 4QREA 1OWPA 4I6JA 4WNYA 1U7DA 3TNJA 2VTBA 1JEDA 3N9IA 1QNFA 3SEQA 1T9GR
chains in the Genus database with same CATH superfamily
1FS4A 1KJQA 1N6HA 4RD4A 1T13A 3L0DA 3GA0A 4FBGA 4KLZA 4D3YA 1ZQ9A 2HYIC 3RUEA 4KWIA 5CURA 4GWLA 1UC5B 3NTVA 3SSAA 4AY6A 4HEA6 2JAXA 1M67A 4M88A 1Y7TA 2YVKA 3WQQA 3CKMA 2WIBA 2EZUA 1BXRB 1N2OA 2XNDA 5ECDA 5HHTA 4DV7B 1OXKB 1ABFA 3N2ZB 1MAAA 2A86A 1ISSA 2GHQA 2GSDA 2GPAA 4KMSA 5IMSA 3PIRA 2PBRA 1IHUA 4LISA 5HF8A 4QJ4A 1CQPA 5ENDA 2O1SA 2V55B 1WCXA 4QIHA 4ZYYA 1YD7A 2B20A 2H54A 3ZV4A 4AO7A 2SICE 4M9RA 3K6SB 3ENKA 2BGTA 2GJSA 2I76A 3RT1A 1BXRA 4U7WA 4KQ1A 1XKLA 2R8RA 1P7PA 4TRNA 5JJKA 2ERCA 1PFWA 1SFRA 2IPMA 1VCIA 3H5OA 3IMKA 2BMVA 3E7XA 5D3KA 1PT8A 1TXGA 1W9HA 3GG2A 5SV2A 1JYSA 1G5IA 2DPYA 5KQMA 4OXRA 3I8XA 5A62A 5MFPA 2BGJA 3F97A 1SULA 4FK8A 4I4NA 1DXOA 4QWWA 3JXEA 4ZYLA 1U8XX 2QW1A 2A1IA 1FF9A 2AQ8A 3A1WA 3K6SA 2ZR0A 4B74A 1DDIA 1E1KA 4AC9A 1AQLA 3BE6A 121PA 1J1ZA 1UC8A 1P2TA 1YCHA 3YASA 4A1OA 2AJTA 5A5EA 1A98A 1FLAA 4JC4A 1ZW1A 5J2TF 3S55A 1QAQA 3L40A 5JNLA 4URYR 5KKAA 3S8YA 4ZT3A 3A6EA 4NNJA 3WVNA 1DOAA 5BXQC 4MNTA 3CEHA 4L9RA 2BHNA 4ABYA 5KJ1A 2GCNA 1K63A 1MJFA 1U9YA 1I33A 5E4YA 2DWCA 2FA9A 2OHJA 2FPOA 4K9RA 5T4BA 1UJMA 1FZQA 4RKWA 2D2FA 1H5UA 2JKZA 3S7TA 2I91A 3FB1A 3W2EA 1UWLA 3I42A 3OETA 1MH1A 2GNAA 2YMMA 3TQCA 2ID4A 4HDQB 4KPGA 5BYJA 1TCAA 4JLUA 2RI1A 5IKXA 2VPQA 3QWHA 1RYFA 2PR2A 1MO4A 1FFXB 2C7VA 3F5FA 3S7ZA 2NYAA 2FMUA 3BH6A 1KFJB 4LQ4A 4ER7A 2VA9A 1ZK4A 4OHKA 2H16A 1HNZB 1K8RA 2VRWA 4PC1A 4WCVA 2XX3A 3L6CA 1PZFA 3ZHYA 4AJIA 4C4TA 2HFJA 4XDYA 4OF4A 3WLKX 3LPLA 5ICFA 5KYVA 4B3FX 2Y6UA 4G3XA 4G1VA 1DO0A 1V3TA 1FFXA 2Y1KA 3E9RA 3FNQA 4G8DA 3U3XA 3I5MA 4O4HB 3K0AB 1N5RA 3KXKA 4OTZA 2P2NA 4RF2A 1E2HA 1YGYA 2FSSA 2XUGA 5ALKA 1LNQA 2QB5A 1YVRA 3MMPA 4QBIA 2NVUB 4UNIA 2FQWA 3DZHA 4BGIA 3DFUA 3B8HA 3UBMA 3X1YA 4DCCA 1H4TA 1R5BA 2AFVA 2GZ1A 2V7PA 3AVWA 1GZ4A 1XYVA 3L4BA 4BECA 4IHJA 1VJ1A 3K0AA 4UJ3A 3EX7C 3PLNA 4DYHA 2HF2A 2QPLA 3HC7A 3HVJA 4CQLB 3GMSA 1WJGA 2GXAA 2NVUA 1CDDA 3ORFA 4MWCA 5FWDA 3E4DA 2ZSKA 2I52A 3O8DA 3ZBPA 1WXDA 1NV9A 2YFQA 2ZSHA 1NVEA 1H93A 1XVVA 2V3WA 3C97A 2JGIA 2QXYA 3KKNA 5E6SB 5ARDA 5HK8A 4IJQA 5DZSA 3ZY6A 3LW7A 2EW2A 1D9XA 2IBTA 2I2XB 1Y4DE 3WADA 1NUUA 5FR1A 4J2TA 1JG1A 2HQ1A 3AI3A 3OE5A 4CQLA 1T4CA 4YXWD 5KC9A 4OSEA 1L5NA 2Z8YA 2QTVA 3GVHA 3N8DA 1HC7A 2R47A 1JAHA 4CMCA 1RAFA 3N28A 4LS3A 1SXJC 5E6SA 4BN0A 1QHGA 1L7XA 1HY3A 1U7UA 2C2BA 2IYXA 3NC4A 3RD5A 4B5KA 3FNFA 2PUFA 2AMFA 3T5TA 3MIIA 1VGRA 4YDRA 5CA1B 5LOVB 1DSSG 4UTNA 3RK4A 3EEBA 3RYCB 1RP1A 2IS6A 1QE0A 1BJKA 4D56A 1XU7A 5FWAA 1V1JA 1SPXA 2IHJA 3MQ4A 1CY2A 1QF6A 5JZSA 4MVCA 2RHMA 1YZ3A 1YQWA 3FOCA 5BUSA 3EF0A 1ITZA 1XQ1A 1E1RA 2DSNA 3DWEX 1U3VA 1NKSA 4HLCA 5CA1A 5KNBD 3PNSA 5LOVA 1E4OA 2QQ5A 2V7WA 2IXGA 3MYYA 4DXAA 5ARBA 1BGVA 2AXNA 5LP1A 4D6PA 3RYCA 2DJIA 2ZAOA 1M8FA 2QL7A 1WW3A 4I1SA 4I5EA 1GTMA 1Z13A 5B1SA 3D7MA 3LNTA 4MVJI 3NBAA 5BPHA 1R6BX 5MN6A 3E3LA 3RC3A 5BOVA 3FCOA 2G5GX 3GJ6A 1MO3A 3GRPA 4HH0A 1KAMA 4K88A 4TQAA 4EZEA 1I3NA 2AJLI 2NSYA 3BPSA 4CMGA 3AR6A 5FOTA 4BWFB 1BGXT 1J0DA 1K6EA 3KWFA 3SBDA 1GCUA 3DAHA 4NNOA 3AB7A 2C3MA 1BZYA 2R8YA 4W4TA 3X1ZA 2I5PO 1EU1A 1L1RA 2V6FA 3KXPA 3OTWA 4N9QA 1QVVA 4MJ7A 4H0CA 3KQUA 4WFQA 2YHUA 1NYTA 1KRXA 1OXTA 1U0TA 1K6MA 2C59A 1M33A 2BMDA 4RPHA 1TCBA 2DHQA 2E7ZA 3PXBA 5K3AA 1P2FA 3UXHA 3ITKA 3D7RA 4DLTA 4JBNA 5AICA 4HVLA 1YZNA 4GX0A 2J87A 5JVDA 2VZ9A 4MWGA 3QXGA 2X7HA 2REOA 1G8SA 2G4LA 2EZ8A 3L6DA 1XA3A 3WGKA 2IU3A 4DT1B 4EYSA 4HS9A 5K8TA 1H0KA 2OFPA 4DLUA 2WTXA 4MQ5A 2NQ2C 4II3A 5HWSA 4PO1A 1LPAB 1F48A 1EK2A 2GBLC 2ZYHA 3KAKA 4IIVA 4UPVA 4V0ME 3GG9A 1SIUA 2WHYA 3NANA 4PGAA 1E6KA 3U19A 1GITA 1QYDA 4QAJA 1XQ9A 3ZCUA 1NTOA 5JXJA 3IUPA 3JYHA 2RAVA 4G8JA 4R2JA 2XD4A 2RHCA 4MUAA 4OKIA 2HMSA 5AHOA 4YREA 1QV9A 1FQWA 1Q22A 2J59A 4M87A 4OU5A 5K1ZA 3LW8A 4XM1A 1U80A 1VGQA 2JFNA 2Z56A 3OM8A 2X0IA 4CUKA 3SC6A 3CRMA 3HYRA 1UDXA 1ZM9A 5JQWA 4HCJA 2DFNA 1M2VB 3R1IA 1EH5A 4DBLC 1W8DA 1WTAA 4R31A 2VUTA 2Z04A 1MQSA 2O7NA 2QVXX 4KK4A 2QPTA 5EJIA 3VR2D 1YR3A 6LDHA 3EPKA 5G3YA 4CGZA 3X43A 5FO1A 5FUYA 3U37A 4Q9NA 5I4BA 4R51A 1G8FA 3B3AA 5FUQA 5GVRA 1XAJA 5TVGA 2WR8A 3AR7A 4F3KA 1QUEA 1W581 4EUKA 2QHXA 1M2VA 3H0EA 1M8JA 1OWLA 3DC2A 2QVGA 4A0HA 4RZXA 4J7CA 4YMWA 3PIIA 1C14A 3IEKA 1EBFA 2FKAA 3N7UA 4DCPA 1O54A 3LUBA 4Q34A 4E3ZA 2BFPA 4QUKA 3MGBA 5LB2A 2QMZA 3A6GA 3QJYA 1P5FA 3WMEA 3TL6A 4EA7A 1AHHA 2WUWE 2A0WA 3K30A 2GB4A 3V7WA 2X8JB 4EF4A 4K2AA 3AGQA 1JTVA 3KC2A 4UUOA 2SBTA 4GD3Q 3C8UA 4HWKA 4R6XA 1TEHA 2EZTA 3NTOA 1KZHA 4B3IA 3TTSA 5GJCA 4UBOA 1MIOB 2BP7B 4BRWA 1X80B 5CLLA 1LX6A 3RUCA 4QOIA 3FM9A 4XE5A 3WGOA 5C5DA 2NPOA 1C8LA 3ZOKA 3I5UA 1ULBA 3ELBA 1LH0A 2A59A 3DKRA 2GRUA 4RKQA 3I6IA 4BQOA 4E21A 3BZBA 1E4VA 3OIGA 4F93B 2VDUE 2X8JA 3OEHD 1FFDA 1G5RA 5AKKA 4LZNA 3DV9A 3BHNA 1K4KA 5FPYA 3WBKA 4TMFA 3L0CA 2VPWA 3CUTA 1T5LA 2PUTA 2W6ID 3QLTA 4QOEA 2A52A 1MIOA 2BP7A 3BREA 1X80A 2BZ1A 1KH2A 2Q6TA 2YXLA 4MJXA 4RLSA 4IWXA 4JJ4A 2DECA 1SXJB 3CF6R 2W0SA 4XWTA 5IAKA 3TUIC 4ARBA 3I39X 3ZJVA 4ZOBA 4ZCMA 1D2EA 3FKJA 4PLYA 3M6VA 1VL8A 5T64A 5ADHA 2BJVA 3G9ZA 1EQ2A 3CF4A 4C4PA 5DN9A 1S9DA 5LYJF 1KDOA 1N6LA 1MP0A 1O08A 1VRVA 2GK7A 3KVNA 1P4AA 5LDGA 4YJFB 1SXJA 3VGPA 3ZHZA 1V8OA 4AO8A 2FLWA 2R68A 4XCXA 3RS8A 1OZHA 2FRDC 1NONA 1T29A 1A5TA 4GUAA 1ZNQO 3E9CA 4RHCA 4RQBA 3KJEA 1G9XA 2CE2X 2M32A 4HJXA 1QHIA 1V16B 2JATA 1N5KA 3VC1A 4AX8A 2PLWA 1ORRA 3LUFA 4RM2A 4B9AA 4RADA 2J5RA 1KEEB 3A9TA 5K3DA 4DBLE 5HW0A 1XMOB 1YUNA 4FMDF 4XJXA 1N0HA 4CTMA 2GFIA 4YJFA 3WGIA 4D8VA 1P18A 2C2HA 2C5LA 4IO1A 4BQEA 2ZWOA 5FUBA 3BMCB 1MQAA 2FMIA 1AUOA 3A06A 3A26A 1XMSA 3IXMA 2BTQA 1LRLA 1P9RA 2ZI6A 3GRAA 2O1XA 3IKJA 1L3IA 3L6UA 4WLEA 4P0QB 1COZA 1R6UA 4KJZA 1CZNA 1V16A 3C7DB 1QIGA 1AXRA 1YJ8A 2ZTHA 3LC1O 1WQ4A 3HDJA 1KEEA 3WK7A 2J31A 3NH9A 1N6IA 2XTMA 1GZVA 2QVBA 4GYWA 1YR9A 5EQJB 3BAZA 3B7WA 1U6KA 4C3OB 4OU4A 1XTJA 3BMCA 4DLVA 5SYMA 1EDOA 4KPEC 3FWPA 1ZOSA 2IEYA 3SJAA 1WXFA 1FUUA 3WR5A 1LBHA 2YC2C 5HQ3A 3IVRA 4FFDA 1K9VF 3FB4A 4DLNA 4OKNA 1M0SA 2DHDA 4OQFA 2UUAB 1C9MA 5G02A 1QYWA 1KHTA 3DDZX 1U2GC 5J1TB 1P3JA 2XWBF 1VPVA 2H4HA 4IJ6A 3IVAA 4JEIA 4ER6A 4Q39A 3OC0A 5IVIA 3LYLA 4O6VA 3BH7A 1BRTA 1THTA 2APJA 2NXNA 4FCVA 1AG9A 2J7PA 4H9GA 4L07A 2BGKA 3NHJA 3GRRA 5FXMA 3ZWOA 5HCIA 4R71A 5DNVA 2QRMA 1TO2E 2H5IA 2VBGA 3A9RA 1IJBA 2AUNA 1SKUA 4WD3A 5EIXA 1PG5A 1GSAA 3SY8A 2OGTA 1SBHA 2VYCA 2H9AA 3MC1A 5E38A 4KI0A 2DR2A 2WV7A 4JI5B 3GLFE 5KZMB 4D0RA 2RGRA 3OTGA 1RI2A 1DX4A 4NENB 1HM5A 1T9HA 1EWVA 2H1RA 3L7LA 1EK6A 4QXOA 4YASA 4BOYA 4ROSA 2FMKA 2JRLA 3HVIA 1U0FA 2WKSA 3QFFA 4HB4A 2XWQA 1WZUA 5F7ZA 5H02A 1ZRNA 1SNYA 3K70D 1NP3A 1GJRA 3E9ZA 5FI1B 2OBBA 4C5BA 1JBKA 2R5FA 2AZDA 3DO8A 3AUFA 1IN4A 5EXDA 3U3RA 1FDIA 1R15A 1WMFA 3TOCA 4U6NA 5ES4B 1A4XA 4AUMA 1WABA 5ICEA 2ZR8A 1IM8A 2VG8A 1XMPA 4NENA 2PV7A 3K92A 4HUJA 4IIXA 5CK4A 4EF6A 2UUOA 1HI9A 2ZS9A 4QPPA 1B6TA 2HHAA 5KAMA 3LUCA 2O8EB 1C1DA 2R84A 3K1JA 5H3HA 3GD5A 1GADO 4KIFA 3WG9A 3G6KA 2Q5LA 3KOXA 1ADGA 1KDPA 1Q0QA 1VL5A 1RQLA 1ORTA 1G7RA 2VFAA 3CNQS 3E4CA 3NFRA 5IWCA 3VU3A 1PWXA 1NURA 3TSYA 3BKWA 1UPFA 1BD3A 1E18A 3LKDA 2Y1FA 1V2GA 2WWIA 4PC6A 3BRWD 1ORHA 3R0ZA 4HRAA 4TWJA 4YJ2F 3PI6A 2O8EA 3AEYA 1Y5LA 4MXDA 1EHYA 2X0RA 4Z6KA 4OGGA 2CCJA 1UAYA 3K16A 3DT8A 2B1IA 1L4EA 4HSEA 3CKKA 4RAQA 2IW3A 2HDOA 3EVNA 1ZM4A 3NOVA 2ZZMA 2AQKA 2AUTA 3VKVA 4JL6A 4H3KB 1C1XB 1OF1A 3DEJA 3HXLA 3FNEA 1E3WB 3OJFA 4XSVA 3V1YA 4OQPA 2FSVC 4P9NA 4CCSA 2ZJ5A 4IINA 1FYVA 5KHOC 1D4FA 1OXMA 1R0CA 2P75A 3TGPA 1E6MA 4QHSA 1VOTA 4UXHA 1UC9A 1MB2A 2PZLA 3OCVA 4Y1EA 1I4TD 2GFQA 3S27A 3F90A 1FW8A 3ISTA 4K1XA 1KAEA 2W22A 2MINB 1YB1A 4KDFA 5CLQA 3ZUPA 4BAUA 2B3DA 3OCUA 3RS5A 4D2IA 1C1XA 4BO6A 3EOZA 3LZDA 2QW8A 1LQ2A 2L0XA 1E3WA 5KOYA 1JU4A 3RKSA 1O89A 3TDNA 3F98A 4Y2RA 5FNVB 1LBSA 3IMFA 2P8JA 1OWPA 2C04A 3AR2A 4OLAA 2ZJ4A 1P0MA 2AFHE 1PX2A 2ASEA 3R5SA 3P19A 4LSZA 4M76B 1U9CA 4EH1A 5K99A 1K08A 5DH9A 4ALMA 1A4UA 1GQSA 1LPSA 1ZOLA 1ZD5A 2MINA 1SO8A 2ZJ0A 2C2GA 2OHVA 2M6KA 3TR0A 1CV2A 3GNTA 3UGKA 4B82A 1R8XA 2YWRA 3UQYS 2R8ZA 5IC5A 2W2NA 3L02A 4M1ZA 5FNVA 2QN1A 4I4LA 9LDTA 1CWUA 2B5OA 2BKEA 1VA5A 2C2XA 2FRDA 1JSRA 3FPEA 4G1UC 4ZTBA 3OOWA 2W4QA 4RPKA 1ODTC 3IERA 1T34A 1KZ9A 2A8YA 2IOHA 2J46A 1S2OA 2QN8A 4U1RA 1EFDN 1NFRA 2DULA 2FW1A 1TECE 5A0VA 1UM9B 5CXQA 3MRSA 4A7PA 1G63A 2Y1DA 1SHZA 2C7BA 2PLFA 3L06A 4I9HA 4ZI7F 2F3TA 1UBKS 2QD1A 3B5EA 4H6XA 2OVFA 3L1HA 1XZLA 1Z5NA 3SM9A 1N3BA 3N75A 2W6OA 4OFZA 3TPCA 3I9KA 1KQOA 3JQGB 2QOEA 2CMFA 2VOJA 1M1XB 3CNOA 3HDGA 1A5SB 2G07A 3BUSA 4WXRA 3DB2A 5K05A 2ZJ3A 3I4CA 4ZYUA 2HSGA 3GFFA 3BS4A 1XD9A 5KQGA 3PS9A 4JU8A 5EGNA 1YDWA 1CX9B 4GDMA 3VDMA 5K0TA 4JHLA 3EFOB 4E88A 4WY8A 3KD2A 3M5PA 3TLKA 3SJUA 2F9LA 1DAIA 4OQQA 3M7IA 5A1TA 2FSPA 1SQSA 3UHAA 1QBKC 2E5WA 4A73A 3JQGA 2VNKA 2VHQA 2A9JA 4RK7A 3LU1A 5EP1A 2X22A 1ZCBA 3D9QX 4IV0A 1QF7A 1RXYA 4V2UA 5JEEA 3DA8A 3ZU3A 5IM5A 1TADA 3DNMA 3P2EA 1UXKA 4P7GA 5K0NA 3U13A 5EHZA 2G5ZA 2RIPA 2LDBA 3ER9A 2JAHA 1VSVA 4J0KA 3EJWA 1U2GA 3EFOA 5JWHA 4ZMRA 4LSWA 4PZYA 5C81A 3BTVA 4DMMA 4LIPD 1VLZA 3K0HA 3PJEA 1X1QA 1N8NA 4XRRA 4B4WA 3GLIE 1VB5A 3DAFA 4KZKA 4NECA 4O8ZA 4RY8A 1RE0A 1RXSA 4HDRB 3W5AA 2HIGA 1Z0JA 2EHJA 3BJMA 3NP7A 3TN7A 3HU2A 3NP9A 4G0VA 3U3JA 4EZIA 2PRYA 3RPEA 1W2HA 4YCCA 2UYCA 2XJ4A 3HNOA 1NQXA 3HL0A 1NW9B 4LXTA 4NVRA 1VYTA 1XT6A 3PJFA 3D4LA 4FFMA 4MARA 2J9RA 3NM4A 2F3UA 1QGZA 4V39A 5KSPA 3CZ5A 2V5VA 5DLPA 3ZWCA 5C8DA 5KO2A 2BD0A 3IELA 1UT6A 3JZDA 5JSFA 4OMFG 1RXUA 4HDRA 5E3IA 3HCRA 4JUAA 3TJRA 1KJ9A 2JBWA 2GXQA 4LOKA 3TL2A 4F1WA 5TSDA 2QRZA 3D3NA 3ASUA 2QTWB 2NUAA 1R12A 1RW4A 1AKNA 2R44A 2XQJA 2D1TA 3CZAA 4GSKA 4IX9A 3IE1A 5JMPA 3I2HA 3FOBA 3AG6A 1AX9A 3A28A 5FT9A 4C1BA 3GLHB 3HK2A 4Z4CA 3QPCA 3FLEA 4CKZA 3RF6A 1Z4MA 1KQFA 4IM7A 4C04A 1Z0AA 4G5YA 1I2AA 4KLAA 3LCCA 5BV8A 2FQ1A 1OIVA 3VPDA 3TO5A 3T54A 2FWRA 2FCAA 3OZRA 4QXRA 4ZT4A 2XQGA 1Z47A 3GCGA 3UV3A 5EMHA 1EUCB 2R85A 1G6KA 1Y3DE 5JARA 1OZGA 1R0LA 1V71A 1I4EB 2DBVO 3QVXA 2Q5IA 3ZC3A 4EW1A 1QRRA 2CF6A 4AT1A 4F5DA 1D7AA 3UHPA 3MT7A 5BSTA 3G9TA 1LKZA 1P5ZB 1U9ZA 2GCEA 3D0KA 1OA1A 1YDHA 1OW3B 2H6EA 2ADFA 3CX6A 1TK9A 3GLUA 1U2SA 1QX4A 3MQ2A 3LQ4A 3P9RA 1S2IA 4ZQIA 5FCDA 4D8YA 4PPFA 4ZJZA 2HRQA 1H42A 3C4JA 4DJ5X 1VKZA 4V1CI 2IPNA 1EUCA 2FFQA 4HTFB 4DCTA 4CTNA 3P97A 4ZJPA 4TMVA 1XPJA 4ZICA 1P19A 1QTRA 1EWKA 1T25A 4PV7A 3N2LA 4KXQA 3VGJA 1UDBA 3T9BA 3R09A 3AM3A 1TKAA 1T0BA 2KS6A 5I01A 1VKRA 2GRAA 4ETMA 3INYA 2UV8A 4P34A 4F8EA 4LOHA 4X66B 2FSVA 2PJRA 2YN4A 2Z98A 1FCJA 3QYAA 1BJRE 3QI2A 4M1EA 1EFUA 4WDRA 2RAPA 3LLVA 4P7JA 1U99A 5LMCA 5HZKA 3KTDA 4GNRA 2H8GA 4LOAA 1NUAA 2Z8XA 4G89A 5ELXA 2NZJA 3PXDA 3NHLA 1GZ6A 2QY9A 2G36A 1JJAA 5BN3B 1DIHA 3T6KA 2HIMA 1AKMA 1HQYE 1S2NA 4OJTA 3H7IA 5JROA 4YJHB 3GXOA 1IK4A 2ISCA 3LGXA 1VKJA 1UXIA 1F14A 1XBTA 4ZOEA 2YZNA 3T95A 3I2YX 1BKDR 2VZ0A 3D1LA 3H9UA 1UBSB 4OP3A 3R3JA 1E2FA 1X1CA 2Y68A 1AV6A 2CFSA 2F55A 5FA8A 2XMBA 1SVMA 3LCVB 5BN3A 1FBNA 4FX2A 4F4HA 3NHKA 3A2KA 1AK2A 4KO1S 5D6NA 3BF7A 4Z4GA 1PT6A 9MHTA 5ILQA 3K94A 2ZXUA 4YJHA 1H4VB 4MWBA 2CCGA 4AB1A 3RVMA 1MNAA 2GN6A 2IDMA 4JIGA 4FGJA 2C2YA 4BCDA 5YASA 2FB9A 2AEFA 4LY9A 2JIPA 5AT1A 1J9GA 2R751 3N0XA 3Q5GA 2CVHA 5JIBA 3HO6A 2ZZNA 1ZXLA 4KYVA 3QXCA 1Z56C 1XQVA 1GPUA 1G2OA 2GR9A 2X7JA 5THXA 2H2DA 4DS3A 4DWWA 3PUZA 4WKCA 2CJFA 2QRGA 3WYEA 3D3EA 4UBJA 2AC4A 2YNMD 4S1TA 3B6KA 5B6JA 3K8YA 4PZZA 3BVPA 4C4AA 4RFLA 3OQNA 1NF9A 4ZGGA 1P7WA 4HS4A 4L8YA 3U49A 1GKKA 2H92A 4GKBA 9ABPA 3W2IA 1I9GA 4YPVA 1MORA 1JFRA 1R88A 2FETA 3D7SA 1DCKA 4DC9A 2QUIA 1GQOA 4QQKA 3DEFA 1UODA 3GIWA 1L3BA 1D6JA 3IPYA 4JA2A 1EZ4A 2G9NA 5K0EA 3QSYA 4NEGA 1GNVA 1CUZA 4EJSC 4YP6A 5IJXA 2ZYDA 1GGNA 1X70A 3OF3A 5JAQA 3S40A 5CEFA 1P4RA 2VAWA 4F5WA 1EYZA 1Z45A 1DOZA 3WNCA 2OM6A 1ZGHA 1I7PA 5BWBA 4U63A 3A32A 3ECAA 3LY8A 2W2KA 3AM4A 4NJEB 1VMAA 3H3XA 2GO7A 3R7BA 2VWPA 4UZFA 2I1LA 4U0JA 4V3BA 5JCJD 2ZE7A 1VLVA 1JKXA 4R8MA 5LQNA 3D4NA 3S2YA 1GZSA 2X8WA 4DA7A 4ZVQA 3L84A 4TRRA 3NBFA 1UEXC 2VRCA 2Y93A 2TS1A 3G8DA 2Q3LA 3H1PA 5TQVA 1WAMA 4D9CA 4CM6A 1GCAA 3ZIDA 4N49A 3P9YA 4NJEA 1L4NA 1FMLA 3B9QA 4J75A 3VI3B 2Q07A 1YIAA 3ABIA 4Q19A 4V24A 3B3QA 5BY2A 1RWWA 3BXHA 3FBWA 3DVAB 5LMZA 3DW3X 1W1WA 4OHMA 3KUXA 2J5BA 5A9RA 3WHIA 2IPOA 1EEXB 4XYMA 1N8KA 4JL5A 4Z1OA 3WAJA 4ALIA 3N6RA 2J5KA 3UO8B 5LFAA 1X1TA 1N25A 4LTNA 5BUCA 4OX9Y 2PPLA 1NR5A 3H2ZA 5HUQA 2PYDA 4G1MB 4U5XA 1V5WA 1K88A 4DM3A 2P4SA 1MOPA 2QTMA 4H6PA 2M6LA 5CD1A 1VI6A 1XEWX 3CFFL 1Z82A 3H3FA 5EIBC 4TM8A 3HYCA 3U0VA 3ZHQA 3R41A 3OO0A 3ROKA 1IEWA 1UK7A 1I1NA 4Z7NB 4PRYA 1P39A 2BHLA 4X95A 3TLGB 3WA7A 4DABA 1G0OA 3A4TA 3F5DA 2AA3A 1MHPA 2W2VA 4ZA2A 4MWDA 3LFHA 4EAQA 4OYHA 4WXMA 4IGFA 3L5KA 2ZG6A 3R23A 1M8PA 2PSDA 2WIFA 3A3YA 1UCFA 3EA5A 4IZOA 3P32A 4D4HA 1RWMA 1Y42X 5EIHA 1VCOA 2EW8A 2WNSA 4X8MA 3CLKA 3WZLA 1XZMA 1AS0A 4FILA 3ZI7A 4EABA 3TLGA 2C9MA 2HMVA 3FIUA 1HT0A 3BD6A 5KIAA 2DAPA 4EQZA 3H0CA 2EAUA 4QDXA 3L3BA 1HORA 2ZRNA 3DXFA 3UHOA 2E0IA 2HXYA 2H31A 1L4FA 4Z3OA 3V2HA 5C80A 3TM5A 4WJLA 4J7UA 2AMLA 3EIOA 3ZWAA 2XYHA 1PSZA 5I4IA 5CUQA 3LL7A 5KEIA 3O2QB 2HIAA 1EHCA 2VDMB 4Q4DA 1SCBA 2ORYA 2WFAA 3OWOA 5IULC 3QGMA 1RMQA 1ZMTA 2WWTA 3AF2A 3VO8A 1UM8A 1PJ4A 1QZZA 1XE3A 5A4KA 4OP2A 2OA0A 2QVLA 1RYMA 2Q1TA 1Z8HA 1QR2A 2AN3A 5H83A 3Q7EA 2A9VA 5I4CA 3DLHA 2XYQA 4Q48A 3M70A 1WKBA 4FFOA 1GTL1 1JG7A 5AM4A 4TVOA 3AETB 1A7AA 5TJ9A 1T3LA 1SHJA 4M9QA 4QHYA 3X2SA 3VX4A 4ZZIA 5KJFA 3O8RA 1W76A 3A6PC 4K87A 1SOWA 2E55A 1ANKA 4BP1A 2WSYB 3BXGA 1SK9A 3DDHA 3B2EA 4YHHB 4QVIA 4F91B 4F04A 3IXLA 1I7SB 2QM8A 1KXZA 2ZROA 4MP8A 4DRXB 1XR3A 5IAAA 2PJZA 2CZGA 3GPIA 3IOMA 3WBJA 4H4CA 5FORA 1EJ6A 3O4JA 4LDZA 4UOZA 4PYKA 3RHTA 1VBMA 2W98A 2NYRA 13PKA 2PL3A 4HNQA 3S5UA 4C20A 4M1KA 1QFZA 1Z29A 1S2GA 1SY7A 4EELA 2P9YA 2D1SA 1URPA 1VG0B 3SXUB 2YASA 4DRXA 1GTRA 1EVJA 3PA8A 2V4UA 3VXKA 4Q47A 4AY3A 2XOKA 4DIKA 3K05A 3ZY2A 3AINA 4A10A 5HZMA 4GWKA 1LI5A 3BILA 1IEVA 3DOUA 3ZTTA 5LP6F 1WP4A 2VHCA 2JBHA 5HKLA 4EJSB 4O4HF 3ZE2B 1J42A 4Z7JA 4DEVA 5BV2P 3DEKA 2Y0EA 4JOQA 2F9MA 3F1KA 1V96A 1SUPA 1GRQA 2K87A 1XJCA 4IDFA 5AW5A 2OYCA 1BA2A 4OM7A 3VYSB 4EG7A 4MLCA 3SXUA 3R5HA 4BC0A 3JWEA 1P2SA 4Q12A 1SC4A 5GINE 1B41A 4R1TA 5JQGA 2IIPA 2IL1A 1DDGA 4ZRNA 2QM0A 4DPKA 4HWGA 2IW1A 4NR0A 3PVZA 4EJSA 3UKOA 1RMYA 5LDDC 4CEHB 3TTVA 3EAGA 4ASUD 1EVZA 3K5PA 1A82A 4RWZA 1FQOA 1FYXA 3OE7A 4IV5A 4QASA 1I6MA 5D87A 3O2JA 1O94D 3CFYA 5I48A 3SBOA 2V0GA 3N6XA 1WG8A 3S2GA 5FRDA 5IH3A 3BE5A 2ES4A 3VPCA 1UT8A 4LVCA 1IVNA 5KNCD 2XAAA 4DNFA 3S29A 4CEHA 4UU0A 2RHTA 1B2RA 1FNDA 2MOKA 3A6ZA 4YK7A 3WDMA 4PQRA 2QMUA 2XYPA 4HVAA 4D81A 2FZ4A 3SZLA 1NF2A 1TCUA 3EOBI 5BOSB 1DQSA 1Q19A 2EGGA 3GLVA 4MULA 4MW4A 2HLDA 1P44A 3FDJA 4BX2A 4TKLA 4RVUA 3HGMA 1U0JA 4X63A 4ZVLA 1RJGA 2VSNA 1ZCZA 3GT4A 4RPJA 4YMUA 1OH5A 3P45A 4RHFA 1E6CA 2PANA 2YOHA 3KO8A 5AFSA 5CA1F 5LOVF 4E5PA 4GDFA 2VTVA 5AHXA 3GCDA 2ZBFA 3ZQUA 1TW2A 5BOSA 4LTMA 4TLMB 2IX9A 1GVNB 4BP3A 5JZBA 2HTFA 4EFNA 5AW0A 5ICMA 3MWGA 3RSOA 1QORA 4L5IA 4D25A 2IZ0A 2G82A 5BN4B 1OY1A 4HWTA 3L46A 4B7XA 1VJGA 4ZPJA 1PEKE 5E7QA 3MW8A 1ORVA 1W52X 1ADBA 4XVRA 5K3BA 5CLJA 2QD5A 4TV8B 4HH3C 1I3KA 1G4AE 3E70C 3GRCA 4GZMA 1ZJZA 3VOAA 1M54A 3CH7A 2QLLA 3KXIA 5EZ5A 2GWHA 3QW2A 5DTRA 3BWBA 4MI3A 2PMCA 1GA4A 5BN4A 2XSZD 1XKTA 2NWQA 5D5HA 4K7JA 221PA 1LBEA 3U1TA 2BSAA 4U7PB 1Z2PX 1OC4A 6PFKA 4FZ5A 4I4TF 1HSOA 2EBWA 4TV8A 3TL3A 2OHXA 4RK6A 4DLWA 3DPSA 5GQSA 4YV1A 5GVSA 1UL1X 3BSFA 4C22A 1T9DA 4G4SP 4JN6B 3ZV3A 1QB7A 2HF7A 2D3TA 3JSAA 3MSCA 4B7AA 1W36C 3TG8A 3T35A 3RRFA 4EMTA 1IY8A 3SQWA 4X7MA 2R65A 1EVQA 4EY3A 2XUIA 1ZXBA 3CSSA 4GI2A 4NCXA 1NW3A 2OL4A 1IYZA 5C0OE 3R76A 1WMAA 2OESA 4RD1A 2FK8A 4JI6B 4P31A 2BJWA 1ONOA 3PFWO 3JZFA 2Q2WA 2IUUA 4BX9A 1YB2A 4ZMSA 3RHFA 1M0EA 3QV1A 1TA9A 2VPYA 3NHSA 1GAQA 4LYEA 3ORYA 5BVGB 4GGPA 3DGFC 1M5UA 2UXDB 3NHPA 5IW8A 5K2MA 3WLSA 3OQJA 3WGUA 3EG9B 5IJAA 4CM3A 4DSZA 4JI4B 3BB4A 1EJBA 2MHCA 2PN1A 1F1BA 3T1OA 3TFQA 1PR2A 1SHUX 5TPWB 3LTEA 5I8ZA 4BB6A 1VDMA 3U7EB 1IDOA 2ZT6A 4V02A 4LDQA 1FU7A 1LDBA 1YVDA 2B8JA 2J6IA 3NFYA 4MX8A 4TPKA 4R0NA 4FGLA 4MGEA 3WLOA 1JYEA 5BVGA 2YIJA 3OJOA 4GM4A 1HLFA 2OSBA 4JGBA 1DC6A 2GN1A 1KU0A 2HA6A 2W83A 3EG9A 2F62A 3JAWB 4R1QA 3PTAA 2YOFA 1ACJA 4C03A 5IC4A 2C4TA 4YX9A 1QRSA 5AI6A 5TPWA 4BZZA 1CJCA 5THKA 1JSXA 2XE7A 4MHSA 3I37X 2PH5A 2WQZA 4CFSA 5CVVA 4XGNA 4YRNA 4ACAA 1H23A 4A0QA 5IEBA 4KXLA 2ZYUX 4G97A 4IDAA 1RRGA 4B8YA 4JA0A 4FEGA 3SE0A 1PW5A 4CTJA 1I8TA 2JGRA 2LMEA 2W9XA 4GMKA 1YVEI 1ISGA 4MRVA 2WMOB 4XTCS 3LG2A 3JAWA 2NUBA 2Y66A 4ETWA 3FRIA 3LDGA 1PZEA 2NU7B 2RFLA 4JD5A 4KH0A 4F2WA 3RRBA 3PJGA 1R8QA 2EKDA 1EXMA 4WIAA 1KJIA 2GAFA 5DYIA 4YR7A 4Z4EA 1ACLA 3THXB 4Y2GA 3LGSA 4TSKA 2N0SA 1TMKA 1V6SA 4RKRA 4YRZA 1VE9A 1A9OA 1LVUA 1PGNA 4TXMA 2J32A 2PA0A 2GXSA 3QWIA 4PRKA 1JXMA 4AP5A 3AUXA 4BB9A 5FH9A 4AL4A 3EUEA 3D4OA 4C05A 3DLPX 5LBIA 2GERA 4UD6A 2JLCA 2OC4A 4ONEA 4BP9A 3NS7A 1P1KA 4NCAA 2LBPA 2BFWA 2NU7A 3GAFA 1QLJA 2F4NA 2FN3A 1ODIA 1RM4A 2P4UA 2ZB4A 3IHLA 3OLZA 3ZWYA 5BP7A 3THXA 3UXMA 4RD6A 3G9QA 4C7MA 5AXBA 3H75A 4YYZA 3KDPA 2QTGA 4JP8A 3AFHA 1WNTA 4YP1A 5JYDA 3Q11A 5JDIA 4L8FA 4PLCA 2PZJA 2I3ZA 1AZSC 3USZA 1KYTA 3CRVA 4G86A 5IJ9A 1EUZA 2O57A 2I55A 1JXOA 4FSXA 3UT5B 4C7OB 1HH4A 1QDLB 1GSOA 1CHNA 3GRYA 1NXTA 3EA0A 3IQZA 2MSKA 3LA8A 3QKWA 2LCQA 2NU9B 5AM1A 3RSHA 1Q7TA 1XPUA 3TR5A 2ZJ8A 3VPXA 2CNLA 3JQQA 1R3DA 1Q0SA 1SU8A 4MYTA 5CFZA 1NYQA 3Q72A 1YFLA 1MFPA 4EPXA 4FNAA 4NFYA 3NAQA 4XIFA 1WUKS 4JBLA 3PKIA 3JYQA 1RCTE 2YS7A 4GMXA 4RSMA 1G4HA 4W82A 3UT5A 4DW8A 4C7OA 1Y1SA 4IZ6A 5ALDA 1Z25A 2IC5A 2XQIA 2FTKE 2HZBA 1K97A 3H65A 5E7MA 4C08A 4E2FA 3INTA 1A88A 4E1AA 1YK0A 3I53A 3TIXB 4L4UA 1OBVA 4FHGA 1J1IA 4LPKA 1ST2A 4RJLA 2D0PB 3OTOB 3LOUA 4TXHA 4UM9D 2W7TA 1DPGA 5GONF 2VWQA 4PVCA 2W6QA 1ZD9A 2JFHA 3IEXA 4FHDA 1UPXA 3U40A 3I3OA 1B8VA 4HAUA 4Y2TA 1H8HA 4Y2VA 3BWYA 3EBPA 3W7VA 4BUZA 2X5NA 1BG6A 4PZCA 3UWMA 2DU8A 1WEKA 3REGA 3TXXA 1MDFA 4DUGD 2DMRA 1XRPA 3HYNA 3QOYA 5CB4B 4UOQA 1W36B 1GDTA 2FYTA 3UJ8A 3KQYA 1GUBA 3P2MA 4F60A 2Y1OA 4MYSA 2O2GA 1Y3CE 2DE0X 1BIFA 3OF5A 4TLEA 5FBKA 2D13A 5JBQA 1JIQA 4QTTB 1F8FA 3W5DA 1YHNA 2HMTA 5BNFA 1D07A 1VIVA 2OV2A 3P0EA 4ZQHA 4YN3A 2XA1A 2R1VA 3ZJ4A 5A5GA 5HRUA 4JXZA 3ZWKA 3QMMA 2EZ4A 1YS6A 3V1MA 3AUTA 2RSLA 2VC2B 4UUPA 3JQAB 4QPCA 5CB4A 1VL1A 2B99A 5E1DA 3UTDA 4P3NA 1L1EA 3KFLA 3T3GA 3EVGA 3LRXA 2LKCA 3C98A 2FFJA 4MJ3A 4KPYA 1XZPA 4JEHA 1R9MA 3JASB 1QRUA 2Y2UA 3MRXA 1E5LA 4HWPA 1ZM2A 1L3CA 1N33B 4P3YA 2OFXA 2XB2A 5FWXB 4FZJA 3E9QA 2Z4RA 3F5SA 3JQAA 4KGZA 1GT6A 4LA4A 1KEZA 4NABA 5J4HA 5HEKA 5FBZA 2IGBA 4A8PA 1ZVKA 1DBIA 1CEEA 3WAKA 4B85A 1EFKA 2KHZA 1F0PA 3JASA 4EG0A 1J7JA 2PWPA 5SZHB 4F3CA 2QBYB 1BEEA 3WIEA 2PO7A 2PS1A 2CLMB 1RS0A 1DEOA 3EIUA 2BW0A 4QRHA 1PJ2A 2R8EA 1IZ9A 1XRRA 2G83A 3FWZA 4HI0E 5H68A 5TGZA 4YRDA 1YMQA 3UXYA 5JBIA 2EWMA 2PGIA 4FJ2A 1SG0A 4QARA 4G4IA 2FEPA 4QBHA 3WLEA 4DZTA 2NSLA 4FYHA 1CR0A 5GGYA 4OK5A 2XLBA 5KOIA 1UMCB 1I5RA 4ZQBA 1ZCJA 4ANFA 1EZZA 4K6HA 3ZI4A 5IU6A 2NG1A 3N2EA 4UDNA 3UK0A 2QBYA 4HB3A 1M1YE 1PV1A 4TL6A 1GOTA 4FEEA 5LLDA 5B53A 4ZOLB 1EVLA 2KMLA 3GRVA 4L9AA 3VAAA 5GIPE 1WQ1R 4LYDA 1G20E 4X44A 3GPBA 3SC4A 4XGQA 3VOTA 5J5CA 3Q8MA 3VNVA 1UXOA 4S1WA 2ZI9A 2CFOA 2A9OA 1Z9BA 3PL1A 3CRZA 4H6VA 5M29A 5GAJA 1UMCA 2POQX 2WP8J 3IIEA 3T7IA 3QVGB 3M4YA 4IRXA 5EFZA 3H4IA 3I92A 2G5TA 1A1SA 3RKUA 3WX0A 4JYAB 3UAXA 3QPWA 1ZMXA 2O6LA 4KQ9A 3D31A 4QUEA 4ZOLA 4MV0A 4NCJA 5D1NA 3DL0A 5KX5B 5DV9A 3OX3A 3A2MA 1YE8A 1GAEO 3AFIA 3LHSA 4G9GA 1E6EA 4BU1A 1ZPDA 4WK0B 5EMLA 2FLKA 1W73A 1P91A 4HADA 3RLFA 2JLUA 1PV4A 2V5UA 3GNSA 3QVGA 3WMFA 3AVYA 2X1MA 6Q21A 4RGVA 3JW8A 5F64A 1JE0A 3TLJA 3VH2A 2X9NA 1OTXA 1UZMA 1YJQA 4O4LB 3AVXA 1K9SA 4XIIA 1J5EB 5KX5A 4OHYA 4WFKA 4DG9A 1XXHE 2XF8A 5E8RA 5AW4A 1ZIPA 2GZRA 1NQAO 3UYLA 1MH9A 3BXFA 3OLVA 3B6MA 1BTOA 1WLYA 1GTG1 2HO4A 1XWIA 1NBOA 1DFHA 2OKCA 1ZCFA 5FPKA 1JBEA 1VG8A 4YUWA 5C37A 4O4LA 1DQPA 3F7NA 1BX3A 1L5SA 1G5PA 5EOVA 1YQXA 2O6HA 5EXXA 3I52A 5C4MA 2FQQA 4P4SB 3HUDA 3EGVA 1XUOA 1U7HA 3KQVA 3QIVA 4Z7QB 5KQLA 3FH0A 3WL3A 3G13A 1D04A 5BMOA 1J8MF 2GEFA 1M66A 5E1BA 1ZK3A 2GA9A 3EQ8A 2AEJA 4QEDA 5EPOA 3NIFB 5T6BA 4AO6A 4ZOQI 3EXEB 3V8QA 2CL7X 1GPMA 5JBNA 5I7RA 2O8NA 4BDTA 1H8ED 4NS1A 4D0GA 1S8NA 1YWGO 1EBUA 1JV2B 1NXVA 2PIDA 3GNQA 3HN7A 4P4SA 2IECA 1FA9A 1C5KA 3PD7A 5EJ9A 1M5RA 2ZYVX 1BE1A 5KJ6A 2JNWA 1BYIA 2JANA 3GFSA 4RK0A 3KXDA 4GXQA 5CDSA 3U5TA 1Q0HA 2ZJ7A 2G63A 1PQWA 5GPBA 4ZXFA 1BU8A 3EA4A 4GAEA 1Y8QB 2WJ6A 1IG3A 1L5VA 2WD7B 3EXEA 4G81A 4OPMA 3K1AB 3TFWA 4DA6A 4POOA 3AF4A 1Y5RA 2VQFB 3WGTA 4CETA 1QHYA 3CPSA 4TXLA 5LSAA 4RZIA 4JITA 3ND7A 3TZCA 2PJUA 1I0LA 1QO9A 1DE0A 3NHUA 3PF8A 4AKTA 1J8DA 3HEBA 1UK6A 3D8UA 3HFSA 2JIDA 1QDUA 3V2IA 3DE7X 4GLJA 2CDAA 1TU3A 1Y8QA 2WD7A 3WA6A 2YXBA 1GP2A 3AU9A 4I1YA 3K1AA 2XNHA 4H60A 1F20A 2OCIA 2YWHA 3KQNA 4DLYA 1COWA 2Z6VA 5K8IA 3VQTA 3U7HB 3MTEA 3TKYA 1U4OA 4F9FA 3GEGA 4NP6A 4ZC8A 1THMA 3SKXA 1CY0A 5G0TA 5L7YA 1ZUNB 2FMTA 1XYGA 3I5AA 3KSBC 2FHSA 4WZBB 3L07A 4PE5B 3SR3A 5L3QB 3IJRA 4YP5A 1NRWA 5I7SA 1KZ1A 3T1VA 3C70A 1DQYA 1ZN9A 2PG3A 2W2PA 3C39A 1QFXA 3GDOA 1V7PC 3WK8A 4CFYA 4TKVA 1JLHA 1MPXA 2O19A 4NU6A 1M2GA 3C5HA 1PGPA 3BWCA 2ETVA 1YDFA 3ITEA 3KUCA 1ZUNA 3DZGA 1DB3A 3I12A 3L7NA 3ONDA 4N12A 2IWRA 4BEWA 1GTJ1 5EJ5A 4WZBA 3OOJA 1RJ9B 3VU0A 1ILWA 2EF1A 2XE6A 3ML1A 4AMBA 3RUIA 3ZS9A 3CX4A 4DLZA 1D2GA 5L3QA 2QP9X 4DEYA 2R96A 3WGVA 2DWUA 1NMXA 2H4FA 3UNXA 3D0RA 4NG4A 4F5ZA 2BLNA 1YIDA 4I50F 4MLPA 2Z2IA 2JA1A 2WV9A 1RKVA 3JRNA 3LY7A 4PAGA 5AVTA 5CR9A 5ITZB 4LE2A 3WTBA 1QHEA 1R7RA 3LVRE 4DVJA 4EJ0A 2ZOSA 3IP6A 1RJ9A 1XMVA 3NBXX 4O0LA 4D99A 4ZO7A 2NTJA 4OHWA 4OG2A 4RVGA 4WKGA 1SC3A 5AKYA 5L4LA 5P8WA 1RC1A 4PNEA 5SZIA 5AVYA 4BLTA 1MJNA 4D5GA 2WYWA 1E20A 1PLKA 4MW1A 1TZMA 2JS7A 2Q99A 3GZNA 1AQIA 3IRVA 4HJRA 2RBGA 4URHA 4O5AA 1GWNA 3LC0A 5JECA 2DUJA 2MTBA 2W6NA 2IGTA 4FC7A 3SQLA 2ODTX 4BJ6A 1BKYA 1WXQA 3EIEA 3IBGA 1AIPA 1IN5A 3KZNA 5E2BA 3UMCA 1Y7HA 3FTNA 3ZCPA 4YO7A 2P69A 3RWOA 1V4NA 2WICA 2GPSA 3EVDA 3WYGA 1H3FA 5B6PA 4F92B 1AJEA 3ASYA 4ECEA 1NLMA 2XNDD 2IS1A 5SY9A 1Y3AA 3UBTA 5BR1A 4DFDA 4RLFA 5ALEA 1RHRA 2H4YA 1DQNA 4UCWA 2ZWPA 3X44A 1ONSA 3WRVA 1S9HA 3WIDA 3H2IA 2R11A 1NQ5A 1KC1A 4LMAA 1E89A 3HKCB 3KSRA 2R6AA 3DAYA 3NDJA 1NWHA 1PR4A 2HWXA 3R0VA 3ZU5A 3P9ZA 4E30A 3CE6A 3PV0A 1SCDA 2NPFA 4TQGA 3GGJA 1GLGA 3GXBA 4XKJA 3K70C 4L7VA 5C3UA 1T2FA 3WLPA 4EKIA 1E0AA 1U28C 3ZE0B 3HMKA 1PJCA 3UAOA 5A6VA 2GYVA 5U4QA 5HUHA 4GR4A 1YJCA 2QTAA 4BMZA 3HKCA 4GXTA 3IEPA 4Q01A 1UAGA 1KL7A 2REXB 4N7MA 4S1NA 1LF0A 1P6XA 3AF3A 1AGXA 1HT3A 3CWCA 3EZ2A 4Q00A 1EA5A 2XCLA 2VBCA 3E5HA 1MVLA 2ZGVA 5KC8A 1K8QA 3F9CA 3LDAA 2OLJA 4Q4AB 4UMEA 3FWHA 5M34A 4IHAA 1J99A 1X7ZB 3DWFA 4MKHA 4GR9A 1IB6A 1CY4A 4BHRA 1HEIA 2R6JA 4QO8A 3KVOA 1Y9AA 4AS3A 1UPCA 1FX0A 5IASA 2CLEB 2AX4A 4OQXA 4CL0A 2I1QA 3N6VA 4TT8A 4YRIA 1VKOA 3ACBA 2QU8A 4DA9A 3IAM1 4EF5A 3KT3A 1LK7A 2BISA 2OUKA 4Q1AA 1BEZA 5JHGB 5F76A 1PL0A 2XHZA 4EJ6A 4Q05A 5CFMA 1UZNA 4Q4AA 1AMUA 1Z18A 2GEKA 2I8AA 4G8BA 1G6OA 1EFVA 2BBSA 3QW4B 4IW3B 3ASVA 4CKCB 2ZBUA 3U7RA 1KY2A 4G2NA 3SEFA 4N03A 5TGTA 1PUJA 3ZZNA 1Z0FA 3L1UA 3RSFA 3M6UA 2DFVA 2E2WA 1KYZA 4OXNA 1JT2A 1NJFA 3OIUA 4I4IA 3K15A 2PRIA 2OBLA 4RANA 3AEQB 5F2OA 5IDVA 3SM3A 1WCIB 4G67A 4JLJA 1KYWA 3HVHA 5AW9A 3G2QA 1YOVB 4MO2A 4M0CA 2EBUA 1QU3A 4CKCA 5FNZA 2X4DA 1NBIA 3OKFA 5CPFA 1XGKA 3UANA 2ZJYA 3O8QB 5E9AA 5KYXB 3OQ6A 1WW8A 1H0HA 4K6KA 4ZZ1A 3GRZA 1C9DB 4IFEA 1Y7IA 2RHDA 4MQMA 5DISB 1WCIA 1FTGA 1NASA 4OD0A 4CLOB 2QPAA 2GHRA 4D6XA 1CNFA 2GPWA 3KJGA 2RK4A 1YOVA 4QYWA 3ZX5A 4C0QC 4BFUA 5DGIA 1R6XA 4OYYA 3LBIA 5EJGA 5TNXA 4N5MA 1CPYA 1TZBA 4DXHA 2OMEA 3ORQA 4CM8A 2QIOA 2ZZKA 1B8NA 2HHJA 1EKXA 3VNBA 3ZBQA 3EGOA 3O8QA 5J4LA 3AF0A 2VHTA 5IAJA 5JNTA 2Q27A 5KYXA 1NYLA 3T3PB 1CLUA 3HVUA 2JVKA 1BQ3A 3GJ7A 1HMPA 3A04A 3B20A 3G2HA 1UZUA 2HC9A 3JD3A 4QQ8A 3NVAA 2WA2A 1VLHA 4CLOA 3PNLA 4I99A 2X0FA 3DPUA 4Z5XA 5KINB 3D6HA 3LY9A 3DAPA 1XTIA 3EVAA 4J4TA 3NHFA 2C9BA 4O08A 4CIAA 5DM0A 4V0NA 3ZGZA 2O2CA 2P68A 1VHQA 2WSLA 2Q2VA 4RXMA 4CU5A 1JIVA 1R0BA 3Q7PA 5KQRA 2CVQA 4HXEB 4Y9SA 4QQRA 5AUQA 1I1OA 4ITRC 1RFGE 2IV3A 2HDNB 2HCJB 4ZV9A 2RKWA 4LVUA 1QVAA 1SVIA 3HYSA 1HFJA 3ABQB 4UBMA 2VXBA 1OX6A 4D45A 3AP2A 3ZIAA 3PUJA 4A1FA 2OZPA 4F3NA 1PW7A 1A8PA 1R0SA 1R5NA 1ZI6A 2HPZA 4JS0A 5JJCA 2OPBA 3AU8A 1I7DA 4NOLA 1X39A 3ZY4A 4DLSA 3K4HA 3QVVA 4TUYF 5CCXA 2WB2A 4N8DA 3TNYA 2YWEA 4G9EA 4WY2A 3DVLA 2ZE6A 5HBGA 3W5UA 4B3HA 4DZRA 3COSA 3QFRA 4AICA 5FEMA 1N7HA 2AD1A 2OHOA 3TSWA 2ICAA 3CZRA 2FV8A 2PK3A 4MW0A 1C3OA 2VRNA 1O87A 3V7NA 4CQNA 2ODAA 4UULA 5F33A 1O1YA 3ENQA 5D7BA 4KKXB 1HE4A 2NM0A 3CV3A 1B3RA 3IBTA 1JHYA 1T6NA 1T4DA 3EQZA 3NVMB 4Q15A 1FDRA 3KKLA 5B1IA 2C8VA 1BXKA 3ESQA 3IE0A 4I0WB 4NH4A 4R8LA 1CRZA 3B7GA 4TYNA 5DB4A 4MPPA 1I2MA 4JI0B 1E1RD 3O9MA 3H16A 2ISQA 5DIZA 1XZAA 2H1SA 3LA6A 1NU8A 4Y6QA 4BRZA 4URWR 1Y9JA 2JFVA 3IIJA 2J3JA 3VSBA 1G3IA 2Q8PA 5JWOA 4QOHA 1GVHA 4NE7A 4JROA 4TXNA 2B7CA 1A9YA 1TJ4A 3ZGYA 1XTSA 4A2WA 2E4VA 1K6JA 1HE3A 4G4GA 1M2JA 2O0KA 1T36B 2L42A 4DCVA 1HQKA 1RT9A 5M5BA 1NR7A 2WWFA 5JJIA 3PFBA 5HF6A 5FI3A 1C1HA 3SX4A 4PYNA 1YS4A 5LIPA 4NBWA 2G2SA 1R50A 2YQ5A 1Z6TA 3FVQA 3PXXA 3QENA 4OQDA 5IH7A 1F4LA 1Q11A 2IKQA 1T0HB 2H5EA 2PKWA 1QK4A 2YFHA 4PQGA 1ABEA 1BVRA 4X7RA 3T5PA 1ZOOA 5D00A 4KRYA 2Y1XA 1T36A 4AM8A 2X6RA 4G65A 3T41A 4E5VA 2Z8ZA 3G0DA 1X42A 4N1AA 5TE9A 3C3JA 5B3AA 1YDMA 3STUA 3PC2A 4FFPA 5LMNB 4JZYA 4JQCA 2ZIEA 3NBUA 2FZCA 3HI4A 3PEYA 1I0ZA 1LS6A 3DVQX 4JUIA 4OXYA 4E5YA 2V0NA 3P94A 5FP0A 1S1CA 2CJPA 2O3UA 4E5NA 1XCBA 3SR4A 5KHLB 4DG8A 2AR9A 2DT5A 4CUZA 5F2KA 1E8MA 2YWGA 2FG7C 5EE9A 2GETA 3KJNA 3AVUA 1O3YA 4PYMA 3IVCA 3RK1A 3R77A 3B2NA 1NW4A 2DLDA 1CF9A 1F8UA 2KE5A 2FPUA 3LPDA 3FJ1A 3WFJA 4NG5A 4AZ3A 4GIBA 4MO9A 2SKEA 5U4XA 5ITSA 1XMQB 3WZ2A 4OHOA 5HP4A 5DWVA 1A2BA 3VKGA 3M6MD 3NBZC 4AS2A 1ZOIA 1NXPA 1KR2A 2BY4A 2VZEA 1GZ7A 1OASA 2IH5A 3LWNA 3ID6C 3PDCA 3DO6A 3SSOA 3VC2A 2YWDA 1WBDA 2DH6A 3MPUA 2PLRA 4XASA 3TEFA 5JU6A 5FTWA 5BMVB 3I5XA 3P9KA 4V0LA 3KIPA 3EMBA 2HA5A 4MMYB 5CVJA 1Q1QA 3BL5A 4K6GA 4Q7KA 2WLSA 2DT8A 4HXGA 3CH6A 4UVGA 5GM1A 3A0RB 2OBMA 1QCZA 3IUSA 3R9KA 1U6IA 4G23A 1BA3A 2FH5B 4R2IA 2CGEA 3EBLA 2ZTLA 2RK6A 3G68A 3C48A 3CUWA 2QWXA 4BVJA 3ZJUA 1SU7A 5KYGA 5BMVA 2GHTA 1FFCA 4IJMA 2VI5A 1G8GA 3GJRA 4HZUB 1IXZA 3RG8A 2GCGA 2Z08A 3IEIA 4UVIA 3UV6A 4W7SA 3QU5A 1IHDA 1UWCA 1NDUA 3HB7A 5I9TA 2ZM6B 1TVEA 1G1MA 4ZQGA 4N0QA 3SBXA 5CJ2A 2PX3A 4E4RA 1NG9A 4YV2A 4AQYB 1NT4A 1XJ5A 3JQDA 1XJWA 2N9UA 4IOMA 3LDHA 5EXTA 4JT9A 3D2LA 1MX9A 3WKEA 3MS7A 3RSGA 2YYYA 4HZUA 4JP1A 4NEQA 1YU9A 1FJGB 1YI8A 1XCOA 1U81A 2HSWA 5K4GA 4QYIB 1KJYA 4KQIA 5HJ5A 4LNAA 1LK0A 1E2NA 3R5TA 4PZ0A 4URVR 3U7FB 3QHQA 1AE1A 4B09A 3GLGE 2PKRA 1U9JA 4FE4A 1MJGM 1GFSA 1UJ5A 2H7XA 2WNHA 3G88A 1KVRA 3GJSA 4ZDJA 2IH4A 2AI1A 4KXWA 3ZEIA 3AVVA 4LE1A 3SEAA 1KK1A 3BQMB 1K4YA 4JJGA 2RGUA 2ZUWA 1L5MA 2JCSA 4QYIA 2OAGA 5G4LA 4XJVA 3ADBA 1WXGA 2DCUA 2NO6A 3OTHA 2EKPA 3Q41A 5JG7A 3C3WA 2GW4A 3LJKA 3SZGA 3VR4A 4LWOA 5F2NA 2C7QA 3JTMA 1SXJD 1W0KA 4FFBB 4CIDA 3B12A 1J8VA 3PX2A 4TMXA 1QH8B 2B5WA 2QIPA 3K6RA 4FW9A 4GI7A 2DJ5A 3RFXA 5JSHA 4X6YA 4LJ8A 1ZUWA 2ZSFA 2FDXA 4FZRA 4XYBA 1UJ4A 1D03A 3WWEA 4RMIA 3GWZA 2BN4A 2R7MA 3OY2A 4IOJA 3DFFA 4WKBA 1E1CB 2I1WA 4Y6PA 5DBFA 4CM5A 5BQPA 3FD8A 3EJ6A 1YVUA 2OCGA 1MCZA 4TT3D 1Z0ZA 1OFGA 1QH8A 3FPCA 1R27A 4DNOA 2OOKA 4ERXA 1XRNA 4I8XA 1ZC4A 4TV8F 5TVKA 3RANA 4R68A 5C7OO 2O3RA 1RWPA 2VZLA 3ZYZA 1E1CA 1HE8B 1P5RA 3CU5A 3GGCA 2CXOA 4N3CA 5DYWA 2B8TA 5AD1A 2O2YA 1D09A 5T8KC 1R37A 2MJLA 2XCQA 2XGMA 3QLVC 1NLUA 4KN8A 1N6NA 4H15A 4WN3A 4AECA 1X13A 1O7JA 1RRPA 3EVTA 5JAUA 2Y4OA 3F5MA 4HYQA 4S12A 2F3RA 4U2DA 4YO8A 4BJHB 3PD1A 3H6KA 4UNPA 3HBFA 2H2IA 2J3DA 2HAEA 1HQCA 4GU5A 5E8JA 5K01A 2F7SA 5KQSA 4PCAA 3PQ4A 1RYZA 4WH0A 3HCDA 4LHEA 5AKEA 2R6R1 2C98A 1B93A 2X4GA 3T99A 3JPYA 3AHGA 2C8JA 4FXPA 1KAHA 3K1ZA 1DMRA 1YS1X 3BRCA 4QEZA 3SP1A 4EJFA 3VDQA 3UG7A 1DLJA 1DRJA 2H5JA 1EBBA 1AURA 5C9ZA 2CEKA 1OJ7A 4U8GA 1KPGA 3DR3A 1ZM7A 2F8LA 2D5BA 2J7PD 2NSHA 3CHYA 4ZO9A 4A2CA 3NWPA 3FLAA 2XKJE 4WNCA 1OU4A 3WKDA 2RGEA 3JQEA 2BUAA 4Y0AA 4NV1A 4R2LA 2AFRA 3PHHA 2H65A 2GS9A 3HGQA 2CJXA 2WSMA 1Z38A 2C1EA 3CJQA 2Q5EA 4B75A 3PGA1 4F9TA 2O2ZA 4ZIRB 5IBRA 4BKUA 4ZYTA 4HVCA 3MJDA 3F3KA 1SKQA 1T8UA 3L8ZA 1Z0KA 3OIFA 2HJVA 2PR7A 2ZSEA 4JENA 4K6FA 1ZD2P 4ALJA 2A9FA 3JVUA 4D4KA 3AEUB 1E58A 1P2GA 3L7DA 4ZCPA 4HV4A 4I5DA 3SKYA 3OPVA 1AGYA 2GK3A 1KRWA 5BNIA 2VAMA 2XR1A 4G5SA 4ZCTA 3RADC 1QO0A 1NWCA 4NBTA 2IFTA 4BB5A 3RJ5A 1AN9A 4B6QA 2XAUA 4YAEA 1LDYA 2H1HA 5FPPA 4L28A 4OVKA 1M73E 3D59A 2AMVA 3JSXA 4JBHA 1NRJB 4MV8A 4EUHA 3IGFA 1L5GB 1ECGA 5AKZA 1IL0A 3LUDA 3NQ41 3A36A 2AF3C 3AEUA 1SUEA 5G4KB 4BYGA 5L45A 3KR1A 4B73A 1WXXA 3TTTA 4A6PA 1R6TA 1T9KA 4OV6B 1SCJA 4NIMA 3V1TC 3K4PA 4C76A 4O2AB 2QNIA 2Z43A 4XDHA 3TNDA 3O1JC 2RGBA 4GUDA 2CYBA 4YUYA 3KUKA 3TVDA 2P1DA 3GMTA 2RGGA 1OHHA 5G4KA 4DA4A 1SCQA 4B3MB 4QG3A 2VH5R 3A05A 3I2JA 3M1AA 1O8CA 4P7KA 2QLNA 3NNSA 1TUGA 3HB0A 1IN7A 1AGRA 1Z37A 4FDVA 4XDZA 3UA3A 4KR3A 3G5MA 3O3MB 3PF9A 5MF6A 4MVJP 4KPUB 4K9OA 3NPAA 3LS2A 1QE5A 3X0DA 2BMAA 5AVZA 1K7YA 1LLUA 2IZOA 4JJAA 1UC4B 5KVCA 2A78A 5EL0A 3CNBA 2J4FA 2ZLBA 3CMMA 621PA 5GJWC 3ZI0A 5CFRA 1JVNA 3BC1A 3C5WP 1O97D 1N5IA 1UP4A 1OAKA 3SQMA 3DE4X 2JCGA 3ZHVA 3LTNC 1K27A 4KPUA 4YFYA 5ENZA 3CNHA 4K46A 2XLCA 4ZV7A 5EJ2A 5BSVA 3G5UA 3MCUA 3GB9A 2G40A 1IHPA 1UBUS 3H9CA 3I2KA 3KR0A 2HY7A 1RQNA 3SDSA 4G0NA 1T1SA 3RGGA 1G18A 1SKMA 4MS3B 3G0BA 1TC2A 1PK7A 2VQ3A 3WIVA 3I2IA 3UMGA 3GN2A 3JQFA 4LC1A 3OE1A 1SXJE 4WKNA 3WIBA 1H5NA 4G9BA 4EO9A 1YTLA 2ENUA 5CK5A 3IV9A 4U39A 5C8YB 1U2DC 1ZN8A 3A2NA 2QDKA 4I81A 5D5QA 1QMGA 1D6SA 2OENG 3CSUA 3OZGA 4RHTA 3W8EA 3F6PA 2VNAA 4BE7B 4M22A 3IQEA 1RXVA 4ZI5A 2X0NA 1NT2A 3BHJA 2XDAA 2QRUA 2ZI7A 4MS3A 5CFQA 1ARZA 1YZUA 1SWWA 1V35A 3QG1A 4O02B 3B51X 3UXEA 4EFLA 3U61B 5TQJA 4PNHA 4HRVA 3QX7A 2GBIA 4S3MA 5DRTA 1OCEA 3FLBA 4JJ6A 4L4RA 2QZSA 5H5JA 2QMOA 2CFCA 1KK2A 3ANXA 4NYJQ 1DLIA 2YY7A 1ZG3A 3I3SR 3AK4A 5AI5A 1RZ3A 2OVBA 3U39A 4BFWA 2F3SA 2Z6AA 4R0MA 3KYCA 4IHQA 1G3MA 2XUHA 1UDRA 3CTMA 5B4VA 1GYRA 5U9CA 1L7AA 3TE7A 1N5JA 4Y9UA 3V3KA 1GYPA 1KZGB 4CUJA 5EMJA 2FWMX 2ATEA 2Q7DA 1YC5A 1WF6A 1C3VA 2AE1A 4UJ5A 3E8SA 4IDOA 3KQKA 5CB4F 1GFZA 2Q3MA 1I6LA 1RKQA 2NAFA 4K9QA 4MKGA 5TXGA 5T8KA 3QTLA 2XT9A 4MYDA 4EATA 3QLVA 4E4YA 3RV4A 2DLCX 3BERA 4CT5A 4D8WA 3LRPA 4PR0A 2PZAA 1R0RE 3F47A 4KE9A 4ALKA 3EH1A 2GAAA 2WE8A 1JQLB 4MUFA 2ZATA 1R9GA 1A4IA 3P71T 4LUCA 3VAZA 2BI4A 3N39C 4O4JB 4UVDA 1XZIA 3JWJA 4AN1A 1ZNXA 5DHTA 4D0NA 1KFCB 1PU2A 1ZICA 2J9FB 2W0MA 2DFTA 3INRA 4FMCF 4HLUC 3U0BA 4EFDA 4P81A 3RYFA 4BLOA 4KGVA 4FB5A 1TEZA 1IY1A 1JB9A 4GXRA 4HYYA 4I6EA 4M2LA 2W71A 4JLSA 3Q2OA 3FPGA 4WBXC 4NMXB 3OO1A 4O4JA 5T4EA 1EUDB 2MMCA 2EGHA 2IYWA 2FX2A 3EVFA 4JELA 1P74A 2YV3A 4JR0A 4N65A 4X8HA 1TU0A 5T4FA 1HLPA 2J9FA 3H9BA 3T4PA 3KLOA 4DGQA 1HE1C 1VJRA 4ER0A 4ACBA 3C16C 1G3UA 5JI2E 3RABA 1Z6ZA 5IABA 2QSZA 2C58A 2VKTA 1GY8A 3RJTA 2FKNA 3COWA 1ES9A 2HEGA 3LD9A 3RV3A 2IZ5A 1CBUA 4AI6A 1P2VA 4J0IA 4LQLA 3ZXUB 3GDFA 5BRJA 4I8DA 4OEHA 1K6XA 4DT1A 2BT4A 5CCBA 1BWPA 5LQRA 4YT8A 1KOGA 3WGQA 3GUCA 3EC1A 3PE4A 1S02A 3NUQA 3QU9A 4TYMA 2BRUC 5FLXA 2BPOA 4JYMA 3OUTA 2J30A 5IKOA 3RS2A 4B8WA 1DEAA 3NHRA 3H6GA 3IJPA 1E2QA 3NDPA 1BC5A 1ZEJA 4V0MA 1NZJA 2JIQA 5DNEA 1KOFA 4YLGA 4DLPA 4OHVA 1USWA 2H1IA 3LBYA 3BWVA 3OKPA 1A2QA 3AC0A 5DTIA 1NJ1A 3GJ4A 2XMQA 3BKXA 4Y3UA 5EESA 3ZLUA 1JIXA 3T1NA 4C7KA 2VK4A 1VE3A 3PI7A 4IQFA 4Q9AA 3TRKA 1MFZA 2VUHB 2J4CA 4HDKB 1L4LA 3I4LA 3JRWA 1UBGA 4LJSA 3FPAA 3L7YA 5U1PA 3TDMA 1Z4KA 4TTTS 3MOIA 2E4ZA 1T1RA 2FFBA 1IUKA 1TFRA 4GLOA 3V9PA 3ETJA 5COBA 5LPNA 4O4LF 3C8ZA 2VRBA 3LM8A 4Q3DA 3MPOA 4QBKA 3GP3A 1ZHHA 2EJWA 1GQRA 3N7AA 3RCBA 3TQOA 3RWMB 5IUNC 3RNOA 4BE9A 4KQ6A 1NLFA 2C5BA 4GM1A 3CT6A 4HDKA 5SZKB 4MUHA 3L8YA 2GM3A 4FYMA 1HT2E 4LYGA 3UMSA 4BMVA 1E77A 2G1KA 3GNLA 3SDZA 1EP1B 1XNGA 2K2WA 2A3RA 1SQGA 4BNLA 3F6EX 4XLZA 3NT2A 5HK9A 1UADA 5EUBA 2DETA 1H0RA 1IMJA 4KHPB 3RJZA 6REQB 3I30X 3HXKA 1DP4A 4JBWA 1GARA 5TMBA 3F9RA 2Y0BA 2O2DA 3L79A 1SVWA 5FQNA 4E5KA 2QUAA 2G06A 1U2DA 3MLEA 4HT3B 1XRMA 1Q83A 4N40A 4A82A 2IUEA 4OFXA 3GCZA 4X5OA 2IWHA 2BV3A 2O1WA 3WWCA 1QFSA 3R20A 3R9WA 1BDIA 2F6RA 4B8ZA 4BV2A 3GVIA 4YXWA 1J4AA 1DJPA 2VHVA 3B48A 6REQA 2YCLA 4GKAA 4EG6A 4M89A 3P9QA 3BN3A 2XUJA 3FMFA 1ZGCA 4JEUA 1AF4A 4XSHA 3EMKA 1SUFA 3JX9A 1MG0A 2EKBA 2G25A 3P9CA 3OPYB 1DOHA 1QAMA 1KS2A 1GZUA 3AGPA 3QA3E 4E14A 4ZJUA 3PEVA 3NOOA 5CT9A 1QG6A 3B5JA 2A35A 2XNSA 3ECCA 2UVDA 1XTQA 4RF4A 4BPRA 3DO5A 1U1EA 4AZSA 2AGVA 2CVZA 3FUWA 8OHMA 3AI7A 2QDXA 3NBKA 4TMKA 5C1DA 3AL2A 3RKRA 2OAQ1 2XADA 2E37A 2GTHA 4HZGA 4EWLA 1K2VN 1U8AA 5JATA 3I28A 3OPYA 1U7PA 2WTMA 4OREX 1DXQA 1RC8A 4PSUA 2DX7A 2RB4A 1ATIA 3NKLA 2Z3WA 2AJCA 3NYRA 3Q7SA 5KSZA 5LU9A 1G3RA 3GBSA 1FRNA 2BUBA 5KNBA 1OXBB 2P9ZA 4Z53A 4GI1A 2H8KA 2AN9A 1RPJA 1RM3A 1I80A 2Q1SA 3B52X 3L9WA 2Q9AA 4OAQA 3TCNA 3TSAA 5JADA 4UHHA 3T3MB 1ZVMA 1Q3HA 3WJ1A 4GICA 4L1KA 1JDJA 5A05A 1KQGA 3GY0A 1YACA 4O29A 1UJBA 3P8ZA 1XVAA 2VSYA 4NZYA 2GEVA 2UZ1B 1JR3D 2UZ0A 3D4IA 5TDHA 4F5EA 3LFTA 4XCVA 1ISPA 3DDSA 4RZUA 4ZEVA 4PHGA 4RMJA 2DWPA 2IDKA 2CXSA 1CXZA 3RBZA 4HLUA 2Y77A 4S1VA 4ISCA 3TTYA 4GEKA 1YBFA 2PBFA 2ZDGA 4RHXA 5HGXA 5IJ0B 2HT6A 3RUPA 5KTTA 3WE7A 2VHJA 4E3WA 2H2HA 3QFHA 1NR1A 3GOHA 1I0IA 1WV1A 3QPDA 2J0QA 2UZ1A 3L8EA 4L4YA 1UOQA 2IPLA 1CP3A 2YQZA 3LHDA 3B78A 4MEBA 1AT1A 2IKSA 4X1YA 2ZVQX 1F12A 4M1TA 4PZAA 4R41A 3NV9A 1T8WA 4U5QA 1J2EA 3PDIB 4V0RA 1CJTC 1DKOA 2BZ0A 1HG0A 4RNDB 5IJ0A 1CRQA 2ID8A 3DDCA 3JYPA 1KOLA 3ZE1B 3ESCA 4EHJA 1QAOA 1PR6A 3ZV7A 3C6YA 4UAUA 3GLFB 4O59O 3TLXA 4LHXA 1U2EA 2IYSA 1QKKA 3HYTA 4LRQA 3AWIA 2OHGA 4E5SA 1TM5E 2Q2QA 1R8YA 3EGIA 4IH4A 2QRJA 5I8WA 1X19A 5T57A 1XJQA 4JCCA 4NPHA 3PDIA 3PXEA 2JDID 3NXKA 1E64A 1QOQB 3OX2A 3MTGA 3G6WA 2J67A 3BL6A 3O95A 3GLHE 2Z6QA 3E05A 2BRUA 4NYJR 2A30A 2CWWA 2OILA 2NQTA 3C41J 3NPMA 3GLFA 2F1HA 2PZKA 4FHCA 2GZAA 1T9BA 4M1SA 4NMMA 5FBWB 5HS6A 2YXPX 2WY2D 3VH4A 2GHIA 4MDYA 2D4AA 3EEOA 1NU6A 1U7WA 1YBAA 2GYWA 2HH9A 3IV7A 4WZZA 3UJ7A 4DSTA 4W9MC 1GNQA 4ZODA 1IZ8A 3KQOA 2OD9A 1HDXA 2CDNA 3I8SA 2GPJA 1SCAA 1KI4A 1L4YA 1WKVA 4EB6B 3ME5A 5IUKC 3O83A 1EVKA 4A0RA 4NBLA 1JRLA 1JS1X 2W2TA 4ZEWA 1RXIA 1T8YA 2VXCA 1VSBA 4RV9A 4CQJA 1HKUA 2G0NA 2GJKA 1QRAA 1ZJWA 3R3UA 1U0HC 2V7QA 4Y7DA 1F8GA 3ZHTA 3FKQA 5A4AA 2W42A 4BZPA 1JG2A 1BVYF 2DTDA 4B3TB 4EB6A 2G70A 4C0XA 3L0BA 2EBFX 1ZX1A 3TTWA 2HA7A 4O0MA 1RU3A 4IPTA 1L7MA 5LQMA 3K9FC 5F1OA 3SFVA 1YZLA 4INOA 5HRCA 5KYKA 5B2EA 2X2PA 5KU1A 3WWYA 1J2YA 3HDQA 4GVPA 3DFZA 3FTFA 1RYNA 2ZT8A 2XZTA 2YTZA 5JJLA 1I2BA 4X62B 2DBZA 1P1IA 1JQ3A 2I22A 3ABOB 3EQ2A 1MDBA 3GI1A 2VNIA 2ZRFA 3QOFA 5JLAA 3R2JA 3USES 3ZHRA 5JS6A 2ZUSA 3QBJA 3SU8A 4C0AC 5KSYA 4FKBA 3UV7A 5IT0A 3OEHA 2UZ3A 4FFWA 3S1LA 1MX1A 3PDHA 3MLBA 4A2PA 1V39A 1Z0SA 2E9SA 4QZVA 1MAVA 4L8WB 3V8PA 2XYRA 1PEYA 2F00A 2W6IA 2ODNA 2WAMA 3IMEA 1C4XA 4GVXA 2YV1A 2AFHB 3SNHA 2VZ8A 4JY7A 3QBTA 4U2EA 2XEDA 3MJFA 4QUJA 3IILA 2A1UB 5AVXA 5LVAA 4U9UA 4IRMA 2BSXA 1V5EA 4IVPA 4QECA 2A56A 1RRFA 2HQBA 3KPJA 4QYMA 5CDHA 1KK0A 1SUSA 1ZGBA 1DIAA 3GVPA 4WADA 3CH5A 4PX9A 3LP8A 3U3KA 4RESA 4PSVA 3QEJA 4J1NA 3T8YA 2AFHA 5F5NA 4G26A 1W2GA 1CUAA 4BKPA 3WLTA 1G9SA 2DBYA 3FSEA 2FPWA 3WKBA 1P0PA 2A1UA 2V6BA 2BCJQ 1GPWB 3CI0I 1NE2A 1EGAA 2R4TA 4AJEA 4MQ6A 4MV7A 4AFNA 4B1FA 2PLAA 4XD2A 3L0ZA 4XEUA 4LOIA 1U65A 2OCAA 1SEPA 3GFBA 2JAOA 3B13B 5SYAA 1G5QA 4ARZA 5F23A 2XOKD 3N0TA 2BGRA 3D1JA 3F2VA 1QYRA 4V3CA 1OC2A 1JLKA 2XA2A 2M1ZA 2D0OB 1ZN2A 3FZQA 2PH7A 3II6X 2DPHA 2GI4A 1NMEA 3H04A 4MKXA 1JR3E 1KZ6A 4DUZB 1RAHA 2YFYA 1S4QA 1PJ8A 1KO8A 1OVGA 2XEXA 3GDHA 2IPAB 2XCUA 2ZJZA 3FGZA 4PGMA 2IV2X 4JYZA 3NIWA 2MSLA 4KITB 1JX6A 3DEYX 3ENWA 2ZI5A 1D0SA 3IA7A 3LIIA 3RVRA 5HKOA 3E27A 1II8B 3A14A 4J4BA 4KJXA 5FA5A 1OFUX 5D5PA 1C9YA