The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
32
|
sequence length |
121
|
structure length |
115
|
Chain Sequence |
SLYDPAEKYFNCTDIQRAFFEAGIKLGAIFHQYTGIPVNSENASMAEEFIERSTMIQPFVENVRISINNVYSYSSLNEKMLHAEVLINYNGKKVLGVLNYDEGLDYPVMYAKEVL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of hypothetical protein PTO0218 from Picrophilus torridus
rcsb |
molecule tags |
Structural genomics, unknown function
|
source organism |
Picrophilus torridus
|
molecule keywords |
Hypothetical protein
|
total genus |
32
|
structure length |
115
|
sequence length |
121
|
chains with identical sequence |
B, C, D, E, F
|
ec nomenclature |
ec
4.1.2.25: Dihydroneopterin aldolase. |
pdb deposition date | 2006-08-23 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF04038 | DHNA | Dihydroneopterin aldolase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Pantoate--beta-alanine Ligase; Chain: A,domain 2 | 7,8-dihydroneopterin aldolase (MptD) |
#chains in the Genus database with same CATH superfamily 2OGF A; 2I52 A; 2IEC A; #chains in the Genus database with same CATH topology 2A88 A; 3EMO A; 3AG6 A; 3Q10 A; 4DDH A; 3COW A; 3ISJ A; 3IMC A; 1N2E A; 1N2I A; 2A52 A; 1N2H A; 4DDK A; 3HL6 A; 3IOE A; 3MXT A; 4BHR A; 2X3F A; 4MUE A; 2GW4 A; 2GR8 A; 4MUG A; 5KWV A; 1N2O A; 4IXJ A; 3IVC A; 3AG5 A; 5EXC A; 2RET A; 5HG0 A; 3N8H A; 2LME A; 4MUL A; 3UK2 A; 3CFI A; 3IOD A; 4MUK A; 2A50 A; 3COV A; 3CI0 K; 4DE5 A; 5G2F A; 4MUI A; 3IUE A; 2G3D A; 2IEC A; 3INN A; 3IVX A; 3UA0 A; 3UY4 A; 2A53 A; 3LF4 A; 3LE8 A; 3MUE A; 4MUH A; 2A54 A; 4MUF A; 2G16 A; 2A7X A; 3IME A; 4MUJ A; 4G5Y A; 2GR7 A; 3IMG A; 4EFK A; 1IHO A; 1UFV A; 2A86 A; 3CFA L; 3QTT A; 2A56 A; 4G5F A; 3CFF L; 4DDM A; 3Q12 A; 2G5Z A; 2EJC A; 3CFH L; 3COY A; 1V8F A; 3IUB A; 4FZJ A; 3COZ A; 2G2S A; 2A84 A; 3IVG A; 3IOB A; 3IOC A; 1N2B A; 1N2J A; 5BW0 B; 4EF6 A; 1MOP A; 4MQ6 A; 2OGF A; 3CI0 I; 2I52 A; 1N2G A; 4MUN A; #chains in the Genus database with same CATH homology 2OGF A; 2I52 A; 2IEC A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...