2I52A

Crystal structure of protein pto0218 from picrophilus torridus, pfam duf372
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
121
structure length
115
Chain Sequence
SLYDPAEKYFNCTDIQRAFFEAGIKLGAIFHQYTGIPVNSENASMAEEFIERSTMIQPFVENVRISINNVYSYSSLNEKMLHAEVLINYNGKKVLGVLNYDEGLDYPVMYAKEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Structure of hypothetical protein PTO0218 from Picrophilus torridus
rcsb
source organism Picrophilus torridus
molecule tags Structural genomics, unknown function
total genus 32
structure length 115
sequence length 121
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.2.25: Dihydroneopterin aldolase.
pdb deposition date 2006-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04038 DHNA Dihydroneopterin aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.20 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 7,8-dihydroneopterin aldolase (MptD) 2i52A00
2IECA 2OGFA 2I52A
chains in the Genus database with same CATH superfamily
1N2EA 1N2GA 4FZJA 3INNA 1N2OA 4MQ6A 3IMCA 2G5ZA 4DDHA 3QTTA 2IECA 3IUBA 3EMOA 3MXTA 3Q12A 3UY4A 4BHRA 2OGFA 5KWVA 1V8FA 3COYA 3COZA 1N2BA 1IHOA 4IXJA 3IODA 4MULA 3CI0K 5HG0A 3ISJA 3IOCA 4MUKA 3LF4A 3IMEA 2G16A 4G5YA 5BW0B 3CFHL 3N8HA 3AG6A 2A56A 3MUEA 2G3DA 2A7XA 3Q10A 4MUJA 4DDKA 2A84A 3IMGA 3IOBA 3IVGA 1N2IA 2A54A 3IOEA 4MUFA 1MOPA 1UFVA 3IVCA 4MUGA 3UK2A 3COVA 4DE5A 1N2JA 2GR7A 2GW4A 4MUNA 4MUEA 3CFIA 5G2FA 2RETA 4EF6A 2A52A 2A53A 2EJCA 3CI0I 4MUHA 2X3FA 3AG5A 3CFFL 1N2HA 3HL6A 4EFKA 2A86A 2G2SA 5EXCA 4G5FA 3IUEA 2LMEA 2A88A 3COWA 2GR8A 3LE8A 4DDMA 3IVXA 2I52A 3UA0A 4MUIA 3CFAL 2A50A
chains in the Genus database with same CATH topology
2IECA 2OGFA 2I52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IEC A;  2OGF A;  2I52 A; 
#chains in the Genus database with same CATH topology
 1N2E A;  1N2G A;  4FZJ A;  3INN A;  1N2O A;  4MQ6 A;  3IMC A;  2G5Z A;  4DDH A;  3QTT A;  2IEC A;  3IUB A;  3EMO A;  3MXT A;  3Q12 A;  3UY4 A;  4BHR A;  2OGF A;  5KWV A;  1V8F A;  3COY A;  3COZ A;  1N2B A;  1IHO A;  4IXJ A;  3IOD A;  4MUL A;  3CI0 K;  5HG0 A;  3ISJ A;  3IOC A;  4MUK A;  3LF4 A;  3IME A;  2G16 A;  4G5Y A;  5BW0 B;  3CFH L;  3N8H A;  3AG6 A;  2A56 A;  3MUE A;  2G3D A;  2A7X A;  3Q10 A;  4MUJ A;  4DDK A;  2A84 A;  3IMG A;  3IOB A;  3IVG A;  1N2I A;  2A54 A;  3IOE A;  4MUF A;  1MOP A;  1UFV A;  3IVC A;  4MUG A;  3UK2 A;  3COV A;  4DE5 A;  1N2J A;  2GR7 A;  2GW4 A;  4MUN A;  4MUE A;  3CFI A;  5G2F A;  2RET A;  4EF6 A;  2A52 A;  2A53 A;  2EJC A;  3CI0 I;  4MUH A;  2X3F A;  3AG5 A;  3CFF L;  1N2H A;  3HL6 A;  4EFK A;  2A86 A;  2G2S A;  5EXC A;  4G5F A;  3IUE A;  2LME A;  2A88 A;  3COW A;  2GR8 A;  3LE8 A;  4DDM A;  3IVX A;  2I52 A;  3UA0 A;  4MUI A;  3CFA L;  2A50 A; 
#chains in the Genus database with same CATH homology
 2IEC A;  2OGF A;  2I52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...