2I52A

Crystal structure of protein pto0218 from picrophilus torridus, pfam duf372
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
121
structure length
115
Chain Sequence
SLYDPAEKYFNCTDIQRAFFEAGIKLGAIFHQYTGIPVNSENASMAEEFIERSTMIQPFVENVRISINNVYSYSSLNEKMLHAEVLINYNGKKVLGVLNYDEGLDYPVMYAKEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of hypothetical protein PTO0218 from Picrophilus torridus
rcsb
source organism Picrophilus torridus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein
total genus 32
structure length 115
sequence length 121
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.2.25: Dihydroneopterin aldolase.
pdb deposition date 2006-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04038 DHNA Dihydroneopterin aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.20 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 7,8-dihydroneopterin aldolase (MptD) 2i52A00
2OGFA 2IECA 2I52A
chains in the Genus database with same CATH superfamily
2A7XA 1UFVA 2A56A 2G2SA 3IODA 3IVGA 4MUHA 3COYA 3MUEA 3IMEA 4MQ6A 4MUFA 3AG5A 4MUIA 3INNA 1IHOA 2A84A 2X3FA 4MUGA 2IECA 3UY4A 2A52A 2A54A 2GW4A 4G5YA 4G5FA 5KWVA 4DDMA 2GR8A 1N2BA 3IOEA 4DE5A 3IVCA 2A88A 2A53A 2I52A 3IMCA 1N2GA 1N2HA 3LE8A 3CI0K 2A86A 3IUBA 3HL6A 2G5ZA 4DDHA 4DDKA 3Q12A 4MUKA 1N2OA 2G16A 3N8HA 1N2IA 3QTTA 5EXCA 3CFHL 4IXJA 4FZJA 3UA0A 2G3DA 3AG6A 3COWA 3MXTA 5BW0B 3COVA 2A50A 3COZA 3UK2A 3CFIA 2LMEA 3CI0I 2RETA 3IOCA 3LF4A 1MOPA 4BHRA 4MUNA 1N2EA 3IOBA 3ISJA 4MUJA 4EF6A 5HG0A 3CFFL 3IMGA 3Q10A 2GR7A 3CFAL 3IVXA 5G2FA 3IUEA 2OGFA 4MUEA 4EFKA 3EMOA 1V8FA 2EJCA 4MULA 1N2JA
chains in the Genus database with same CATH topology
2OGFA 2IECA 2I52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OGF A;  2IEC A;  2I52 A; 
#chains in the Genus database with same CATH topology
 2A7X A;  1UFV A;  2A56 A;  2G2S A;  3IOD A;  3IVG A;  4MUH A;  3COY A;  3MUE A;  3IME A;  4MQ6 A;  4MUF A;  3AG5 A;  4MUI A;  3INN A;  1IHO A;  2A84 A;  2X3F A;  4MUG A;  2IEC A;  3UY4 A;  2A52 A;  2A54 A;  2GW4 A;  4G5Y A;  4G5F A;  5KWV A;  4DDM A;  2GR8 A;  1N2B A;  3IOE A;  4DE5 A;  3IVC A;  2A88 A;  2A53 A;  2I52 A;  3IMC A;  1N2G A;  1N2H A;  3LE8 A;  3CI0 K;  2A86 A;  3IUB A;  3HL6 A;  2G5Z A;  4DDH A;  4DDK A;  3Q12 A;  4MUK A;  1N2O A;  2G16 A;  3N8H A;  1N2I A;  3QTT A;  5EXC A;  3CFH L;  4IXJ A;  4FZJ A;  3UA0 A;  2G3D A;  3AG6 A;  3COW A;  3MXT A;  5BW0 B;  3COV A;  2A50 A;  3COZ A;  3UK2 A;  3CFI A;  2LME A;  3CI0 I;  2RET A;  3IOC A;  3LF4 A;  1MOP A;  4BHR A;  4MUN A;  1N2E A;  3IOB A;  3ISJ A;  4MUJ A;  4EF6 A;  5HG0 A;  3CFF L;  3IMG A;  3Q10 A;  2GR7 A;  3CFA L;  3IVX A;  5G2F A;  3IUE A;  2OGF A;  4MUE A;  4EFK A;  3EMO A;  1V8F A;  2EJC A;  4MUL A;  1N2J A; 
#chains in the Genus database with same CATH homology
 2OGF A;  2IEC A;  2I52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...