2GR7A

Hia 992-1098
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
101
structure length
101
Chain Sequence
AVAKGVTNLAGQVNNLEGKVNKVGKRADAGTASALAASQLPQATMPGKSMVAIAGSSYQGQNGLAIGVSRISDNGKVIIRLSGTTNSQGKTGVAAGVGYQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the outer membrane translocator domain of the Haemophilus influenzae Hia trimeric autotransporter.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Membrane protein
molecule keywords Adhesin
total genus 32
structure length 101
sequence length 101
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03895 YadA_anchor YadA-like membrane anchor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.30 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 GSPII I/J protein-like 2gr7A00
3EMOA 2LMEA 5BW0B 3CFIA 2RETA 2GR7A 3CI0K 3CI0I 2GR8A
chains in the Genus database with same CATH superfamily
2GW4A 1N2IA 3AG6A 2G3DA 2I52A 3IOEA 3LE8A 4DDHA 2A53A 3CFAL 3COZA 3QTTA 3Q10A 3MXTA 3COWA 3EMOA 3CFIA 5G2FA 3IOCA 4MUIA 3COVA 1N2GA 2G5ZA 2X3FA 3INNA 2LMEA 4G5YA 2A54A 3CI0I 4IXJA 2A86A 1N2EA 3IUEA 2EJCA 4MUFA 3CFHL 3IVCA 1N2HA 3IVGA 4MUKA 3COYA 1N2BA 2GR8A 3Q12A 5BW0B 3IMGA 2GR7A 1UFVA 2A56A 3MUEA 5KWVA 3CFFL 4MUNA 1IHOA 1N2OA 3UY4A 5HG0A 4MUGA 4EFKA 3LF4A 2A50A 3N8HA 4G5FA 3ISJA 2RETA 2G16A 4DDKA 1V8FA 2G2SA 1MOPA 3CI0K 2A88A 1N2JA 4MULA 2OGFA 5EXCA 4FZJA 2A7XA 3UK2A 3IMEA 2A84A 3IVXA 4EF6A 3IMCA 3IODA 3AG5A 4BHRA 4MUEA 3HL6A 3IUBA 2IECA 4DE5A 4MQ6A 4DDMA 2A52A 4MUHA 3IOBA 3UA0A 4MUJA
chains in the Genus database with same CATH topology
3EMOA 2LMEA 5BW0B 3CFIA 2RETA 3CI0J 2GR7A 3CI0K 3CI0I 2GR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EMO A;  2LME A;  5BW0 B;  3CFI A;  2RET A;  2GR7 A;  3CI0 K;  3CI0 I;  2GR8 A; 
#chains in the Genus database with same CATH topology
 2GW4 A;  1N2I A;  3AG6 A;  2G3D A;  2I52 A;  3IOE A;  3LE8 A;  4DDH A;  2A53 A;  3CFA L;  3COZ A;  3QTT A;  3Q10 A;  3MXT A;  3COW A;  3EMO A;  3CFI A;  5G2F A;  3IOC A;  4MUI A;  3COV A;  1N2G A;  2G5Z A;  2X3F A;  3INN A;  2LME A;  4G5Y A;  2A54 A;  3CI0 I;  4IXJ A;  2A86 A;  1N2E A;  3IUE A;  2EJC A;  4MUF A;  3CFH L;  3IVC A;  1N2H A;  3IVG A;  4MUK A;  3COY A;  1N2B A;  2GR8 A;  3Q12 A;  5BW0 B;  3IMG A;  2GR7 A;  1UFV A;  2A56 A;  3MUE A;  5KWV A;  3CFF L;  4MUN A;  1IHO A;  1N2O A;  3UY4 A;  5HG0 A;  4MUG A;  4EFK A;  3LF4 A;  2A50 A;  3N8H A;  4G5F A;  3ISJ A;  2RET A;  2G16 A;  4DDK A;  1V8F A;  2G2S A;  1MOP A;  3CI0 K;  2A88 A;  1N2J A;  4MUL A;  2OGF A;  5EXC A;  4FZJ A;  2A7X A;  3UK2 A;  3IME A;  2A84 A;  3IVX A;  4EF6 A;  3IMC A;  3IOD A;  3AG5 A;  4BHR A;  4MUE A;  3HL6 A;  3IUB A;  2IEC A;  4DE5 A;  4MQ6 A;  4DDM A;  2A52 A;  4MUH A;  3IOB A;  3UA0 A;  4MUJ A; 
#chains in the Genus database with same CATH homology
 3EMO A;  2LME A;  5BW0 B;  3CFI A;  2RET A;  3CI0 J;  2GR7 A;  3CI0 K;  3CI0 I;  2GR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...