2GR7A

Hia 992-1098
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
101
structure length
101
Chain Sequence
AVAKGVTNLAGQVNNLEGKVNKVGKRADAGTASALAASQLPQATMPGKSMVAIAGSSYQGQNGLAIGVSRISDNGKVIIRLSGTTNSQGKTGVAAGVGYQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the outer membrane translocator domain of the Haemophilus influenzae Hia trimeric autotransporter.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Membrane protein
molecule keywords Adhesin
total genus 32
structure length 101
sequence length 101
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03895 YadA_anchor YadA-like membrane anchor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.30 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 GSPII I/J protein-like 2gr7A00
3CI0K 3EMOA 2RETA 3CFIA 2GR7A 3CI0I 2GR8A 5BW0B 2LMEA
chains in the Genus database with same CATH superfamily
4BHRA 4MQ6A 2A53A 2EJCA 2A84A 3CFAL 2X3FA 4G5FA 4MUNA 5KWVA 3CFFL 4IXJA 3IMCA 3MUEA 4MUIA 2GW4A 2A7XA 4MUGA 3HL6A 3EMOA 2A52A 2A88A 3UA0A 3COZA 2G5ZA 2GR8A 4DDMA 2RETA 3COVA 5EXCA 3Q10A 3LE8A 3IUBA 4MULA 2I52A 2A56A 3IOCA 1N2JA 3ISJA 3IVGA 3IVXA 3CI0I 2G2SA 2LMEA 3INNA 3IMEA 1UFVA 2A50A 4DDKA 2A54A 1V8FA 4FZJA 3UY4A 3AG6A 2IECA 1N2BA 3AG5A 3COYA 1MOPA 4MUHA 1N2HA 3CI0K 1IHOA 5G2FA 1N2GA 3IVCA 1N2OA 3Q12A 4EF6A 3IMGA 2A86A 3CFIA 2GR7A 3IODA 1N2EA 3MXTA 3N8HA 3LF4A 4MUFA 1N2IA 4MUJA 2OGFA 3UK2A 3IUEA 3QTTA 4MUEA 3IOBA 2G3DA 2G16A 4G5YA 3COWA 4DE5A 4MUKA 3IOEA 5BW0B 4DDHA 4EFKA 5HG0A 3CFHL
chains in the Genus database with same CATH topology
3CI0K 3EMOA 2RETA 3CFIA 2GR7A 3CI0I 2GR8A 5BW0B 3CI0J 2LMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CI0 K;  3EMO A;  2RET A;  3CFI A;  2GR7 A;  3CI0 I;  2GR8 A;  5BW0 B;  2LME A; 
#chains in the Genus database with same CATH topology
 4BHR A;  4MQ6 A;  2A53 A;  2EJC A;  2A84 A;  3CFA L;  2X3F A;  4G5F A;  4MUN A;  5KWV A;  3CFF L;  4IXJ A;  3IMC A;  3MUE A;  4MUI A;  2GW4 A;  2A7X A;  4MUG A;  3HL6 A;  3EMO A;  2A52 A;  2A88 A;  3UA0 A;  3COZ A;  2G5Z A;  2GR8 A;  4DDM A;  2RET A;  3COV A;  5EXC A;  3Q10 A;  3LE8 A;  3IUB A;  4MUL A;  2I52 A;  2A56 A;  3IOC A;  1N2J A;  3ISJ A;  3IVG A;  3IVX A;  3CI0 I;  2G2S A;  2LME A;  3INN A;  3IME A;  1UFV A;  2A50 A;  4DDK A;  2A54 A;  1V8F A;  4FZJ A;  3UY4 A;  3AG6 A;  2IEC A;  1N2B A;  3AG5 A;  3COY A;  1MOP A;  4MUH A;  1N2H A;  3CI0 K;  1IHO A;  5G2F A;  1N2G A;  3IVC A;  1N2O A;  3Q12 A;  4EF6 A;  3IMG A;  2A86 A;  3CFI A;  2GR7 A;  3IOD A;  1N2E A;  3MXT A;  3N8H A;  3LF4 A;  4MUF A;  1N2I A;  4MUJ A;  2OGF A;  3UK2 A;  3IUE A;  3QTT A;  4MUE A;  3IOB A;  2G3D A;  2G16 A;  4G5Y A;  3COW A;  4DE5 A;  4MUK A;  3IOE A;  5BW0 B;  4DDH A;  4EFK A;  5HG0 A;  3CFH L; 
#chains in the Genus database with same CATH homology
 3CI0 K;  3EMO A;  2RET A;  3CFI A;  2GR7 A;  3CI0 I;  2GR8 A;  5BW0 B;  3CI0 J;  2LME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...