2A54A

Fluorescent protein asfp595, a143s, on-state, 1min irradiation
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
HGSASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GFP-like non-fluorescent chromoprotein FP595 chain 1
publication title Structure and mechanism of the reversible photoswitch of a fluorescent protein
pubmed doi rcsb
source organism Anemonia sulcata
molecule tags Luminescent protein
total genus 9
structure length 64
sequence length 64
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.40 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 2a54A00
2A53A 2A54A 3CFFL 3CFHL 2A56A 3CFAL 2G2SA 2A52A 2GW4A 3LF4A 2G16A 2G5ZA 5EXCA 2G3DA 2A50A
chains in the Genus database with same CATH superfamily
1N2OA 3UK2A 1N2EA 2GW4A 3COZA 2G5ZA 1IHOA 3IOCA 3IUEA 3AG6A 1MOPA 5G2FA 2I52A 5HG0A 3EMOA 3IODA 2OGFA 3CFIA 4G5YA 5KWVA 3IVXA 3N8HA 2A7XA 2G3DA 4MUFA 3AG5A 3COVA 1N2GA 2RETA 2A52A 2IECA 3IOBA 2LMEA 1N2HA 3CFFL 3IMEA 3HL6A 3CI0K 3IVCA 1N2IA 3CFAL 3CI0I 4MUNA 2A53A 2A54A 4MQ6A 1UFVA 3LE8A 5EXCA 3UA0A 4MUGA 4EFKA 3ISJA 2A84A 2A56A 4MULA 3IMGA 2GR8A 2A50A 3MUEA 4MUKA 4BHRA 3INNA 2A86A 1N2BA 3COYA 2A88A 2EJCA 4DDHA 3Q12A 3LF4A 3UY4A 4MUIA 4FZJA 4DDKA 2GR7A 1V8FA 4G5FA 4MUEA 4MUHA 3CFHL 3IOEA 3MXTA 3QTTA 3Q10A 4DE5A 3COWA 4MUJA 3IUBA 2G2SA 2X3FA 4EF6A 2G16A 1N2JA 4IXJA 4DDMA 3IMCA 3IVGA 5BW0B
chains in the Genus database with same CATH topology
1N2OA 3UK2A 1N2EA 2GW4A 3COZA 2G5ZA 1IHOA 3IOCA 3IUEA 3AG6A 1MOPA 5G2FA 5HG0A 3IODA 4G5YA 5KWVA 3IVXA 3N8HA 2A7XA 2G3DA 4MUFA 3AG5A 3COVA 1N2GA 2A52A 3IOBA 1N2HA 3CFFL 3IMEA 3HL6A 3IVCA 1N2IA 3CFAL 4MUNA 2A53A 2A54A 4MQ6A 1UFVA 3LE8A 5EXCA 3UA0A 4MUGA 4EFKA 3ISJA 2A84A 2A56A 4MULA 3IMGA 2A50A 3MUEA 4MUKA 4BHRA 3INNA 2A86A 1N2BA 3COYA 2A88A 2EJCA 4DDHA 3Q12A 3LF4A 3UY4A 4MUIA 4FZJA 4DDKA 1V8FA 4G5FA 4MUEA 4MUHA 3CFHL 3IOEA 3MXTA 3QTTA 3Q10A 4DE5A 3COWA 4MUJA 3IUBA 2G2SA 2X3FA 4EF6A 2G16A 1N2JA 4IXJA 4DDMA 3IMCA 3IVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A53 A;  2A54 A;  3CFF L;  3CFH L;  2A56 A;  3CFA L;  2G2S A;  2A52 A;  2GW4 A;  3LF4 A;  2G16 A;  2G5Z A;  5EXC A;  2G3D A;  2A50 A; 
#chains in the Genus database with same CATH topology
 1N2O A;  3UK2 A;  1N2E A;  2GW4 A;  3COZ A;  2G5Z A;  1IHO A;  3IOC A;  3IUE A;  3AG6 A;  1MOP A;  5G2F A;  2I52 A;  5HG0 A;  3EMO A;  3IOD A;  2OGF A;  3CFI A;  4G5Y A;  5KWV A;  3IVX A;  3N8H A;  2A7X A;  2G3D A;  4MUF A;  3AG5 A;  3COV A;  1N2G A;  2RET A;  2A52 A;  2IEC A;  3IOB A;  2LME A;  1N2H A;  3CFF L;  3IME A;  3HL6 A;  3CI0 K;  3IVC A;  1N2I A;  3CFA L;  3CI0 I;  4MUN A;  2A53 A;  2A54 A;  4MQ6 A;  1UFV A;  3LE8 A;  5EXC A;  3UA0 A;  4MUG A;  4EFK A;  3ISJ A;  2A84 A;  2A56 A;  4MUL A;  3IMG A;  2GR8 A;  2A50 A;  3MUE A;  4MUK A;  4BHR A;  3INN A;  2A86 A;  1N2B A;  3COY A;  2A88 A;  2EJC A;  4DDH A;  3Q12 A;  3LF4 A;  3UY4 A;  4MUI A;  4FZJ A;  4DDK A;  2GR7 A;  1V8F A;  4G5F A;  4MUE A;  4MUH A;  3CFH L;  3IOE A;  3MXT A;  3QTT A;  3Q10 A;  4DE5 A;  3COW A;  4MUJ A;  3IUB A;  2G2S A;  2X3F A;  4EF6 A;  2G16 A;  1N2J A;  4IXJ A;  4DDM A;  3IMC A;  3IVG A;  5BW0 B; 
#chains in the Genus database with same CATH homology
 1N2O A;  3UK2 A;  1N2E A;  2GW4 A;  3COZ A;  2G5Z A;  1IHO A;  3IOC A;  3IUE A;  3AG6 A;  1MOP A;  5G2F A;  5HG0 A;  3IOD A;  4G5Y A;  5KWV A;  3IVX A;  3N8H A;  2A7X A;  2G3D A;  4MUF A;  3AG5 A;  3COV A;  1N2G A;  2A52 A;  3IOB A;  1N2H A;  3CFF L;  3IME A;  3HL6 A;  3IVC A;  1N2I A;  3CFA L;  4MUN A;  2A53 A;  2A54 A;  4MQ6 A;  1UFV A;  3LE8 A;  5EXC A;  3UA0 A;  4MUG A;  4EFK A;  3ISJ A;  2A84 A;  2A56 A;  4MUL A;  3IMG A;  2A50 A;  3MUE A;  4MUK A;  4BHR A;  3INN A;  2A86 A;  1N2B A;  3COY A;  2A88 A;  2EJC A;  4DDH A;  3Q12 A;  3LF4 A;  3UY4 A;  4MUI A;  4FZJ A;  4DDK A;  1V8F A;  4G5F A;  4MUE A;  4MUH A;  3CFH L;  3IOE A;  3MXT A;  3QTT A;  3Q10 A;  4DE5 A;  3COW A;  4MUJ A;  3IUB A;  2G2S A;  2X3F A;  4EF6 A;  2G16 A;  1N2J A;  4IXJ A;  4DDM A;  3IMC A;  3IVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...