1IHOA

Crystal apo-structure of pantothenate synthetase from e. coli
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
282
structure length
282
Chain Sequence
MLIIETLPLLRQQIRRLRMEGKRVALVPTMGNLHDGHMKLVDEAKARADVVVVSIFVNPMQFDRPEDLARYPRTLQEDCEKLNKRKVDLVFAPSVKEIYPNGTETHTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLVQPDIACFGEKDFQQLALIRKMVADMGFDIEIVGVPIMRAKDGLALSSRNGYLTAEQRKIAPGLYKVLSSIADKLQAGERDLDEIITIAGQELNEKGFRADDIQIRDADTLLEVSETSKRAVILVAAWLGDARLIDNKMVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords PANTOATE--BETA-ALANINE LIGASE
publication title The crystal structure of E. coli pantothenate synthetase confirms it as a member of the cytidylyltransferase superfamily.
pubmed doi rcsb
source organism Escherichia coli
total genus 90
structure length 282
sequence length 282
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2001-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 1ihoA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1ihoA01
2H29A 3CLTC 3CLRC 4KPUA 2PZBA 4MLPA 1JECA 3F3MA 2EJCA 4MW1A 1KH3A 4YBRA 1O96A 2YWCA 3CA8A 4F4HA 1GTRA 1NUUA 3DPIA 3FNRA 3QE4A 4U8HA 1MAWA 1NUPA 5DEOA 1NI5A 3DLAA 2A86A 1JGTA 3BL5A 3SEQA 1G59A 4GRIA 2CT8A 4MUJA 2Z3VA 3ILVA 2HMAA 1K92A 1U7XA 2QJOA 5TS2A 1F7UA 3FH0A 3UC5A 1G8FA 1WQ3A 2TS1A 3MLAA 2QUHA 5DK4A 4ZT4A 4L2IB 3ND7A 3NBKA 1IQRA 2BTEA 1U3DA 4R0NA 2DXIA 1O94C 4MW9A 1N2EA 1U3CA 3VU8A 3G6KA 1JZSA 3N2YA 1SURA 1KQNA 4DDKA 3KT8A 5LFAA 1U0BB 3OP1A 2CSXA 3A4IA 1I2DA 1X6VA 3VRHA 1MAUA 1YULA 1H3NA 4OUDB 1N2JA 3FIUA 3TZLA 1WXFA 3HV0A 1TFUA 4DNXA 1H3EA 4J75A 2RE8A 2XRZA 3OTWA 3CLSD 3IUEA 1Q15A 4NDAA 4DJAA 3H05A 3MUEA 1G8GA 3RBAA 3AG6A 4EG5A 3AKZA 3I05A 1TYDE 1N1DA 3FETA 1M8FA 1NP7A 1JIJA 4MUEA 4UZEA 1MC1A 4RUKA 1KQOA 1NUSA 1GTSA 1KH1A 2IP1A 3N05A 3PNYA 1K4KA 5BNZA 3MLBA 2JA2A 3KT6A 4XSVA 3HL4A 3CR8A 2NZ2A 1MRZA 4L2IA 3COYA 2JAXA 5KCMA 3L92A 1QU2A 4QRDA 1VBKA 4MUNA 1M8PA 4YMIA 4FZJA 3Q4GA 1CT9A 4MAFA 2CUZA 1U7DA 3COWA 4OUDA 2DERA 4KKVA 3K9WA 3P0JA 3CVYA 4HJRA 1GLNA 1NZJA 4EG6A 2QUIA 4QREA 4R2LA 1Y42X 1YUMA 4MVYA 5IHXA 1O95C 4OJMX 2R5WA 1M8KA 4MWEA 3H9CA 2BYTA 4DLPA 3COVA 1N2IA 3ELBA 3SYTA 4JFAA 1WJGA 1MBZA 1WY5A 1KORA 4CDNA 4ZT2A 1PFVA 3UMVA 4AS1A 1YI8A 4HK4A 5EKDA 2PIDA 3FI0A 3M5WA 1XNHA 3ND5A 4MUKA 4MQ6A 5LLTA 1N2BA 4EGAA 3TQIA 5J59A 3LCJA 4PBRA 3HFJA 2RD2A 5LM3A 1KKUA 3X1JA 1Q11A 1R6TA 4EFKA 3A04A 2PXHA 1BS2A 3IH5A 3IVXA 1K97A 2V0CA 2A88A 3G5AA 3RFFA 2HZ7A 1XNJA 4I6GA 5F23A 4X0EA 1I6LA 1M8JA 1VLHA 1KAQA 1NSYA 2E18A 2WSIA 2G36A 1IFXA 4BWVA 2OV4A 4CQNA 3S3TA 4ZT3A 1H1TA 2O5RA 1LI5A 3UOWA 1IVSA 4G6ZA 3RK1A 2B7LA 3KT3A 3CLUC 1JILA 3IMGA 3VGJA 1WZ2A 1YIAA 3IMCA 4NZPA 5FNZA 1EFPB 4NX2A 3CLTD 1EFVB 1QNFA 5J5AA 4MW6A 2VTBB 3FDXA 2DETA 1R6XA 2CV2A 1TYAE 1EJ2A 4PY2A 1N75A 4NAHA 5TEVA 3RK0A 1N77A 1M8GA 1F4LA 4YP6A 1XNGA 4MUIA 2H2AA 2OQ2A 3INNA 3C8ZA 3SP1A 2J07A 1PFYA 4CT0A 3G59A 3ISJA 2XRYA 1F7VA 1KQPA 2X1MA 5KHAA 3H97A 1TEZA 3D6UA 4Q93A 4ARCA 1ILEA 1O0CA 1ZH0A 2PZAA 1OWLA 4ZT7A 3ZUGA 5TEWA 3ND6A 3Q12A 2A1UB 2A7XA 1B6TA 1JMVA 3CVWA 2DUMA 3PRHA 1DNPA 2EL7A 4U63A 3K32A 1OWPA 1VBNA 1M83A 2CFOA 2DPLA 4PBSA 4ZCPA 1T9GR 2D13A 1IHOA 3ZXIA 4AQ7A 3JXEA 3IVGA 3QTTA 1WXHA 4DDMA 2GM3A 1EFPA 3IDFA 4MW5A 3N9IA 3SZ3A 2V0GA 1KR2A 1RQGA 4QBTA 5J58A 1I6KA 1EFVA 4MULA 1JZQA 1N3LA 3COZA 1MJHA 2VTBA 1EUYA 3SZGA 4ZT5A 3ZGZA 1QRTA 2X1LA 1N78A 1GN8A 1JHDA 1EUQA 3IMEA 1JEEA 4DE5A 1JIKA 4CDMA 1GAXA 1J1ZA 3FOCA 4A91A 1O5TA 1OBCA 2CYCA 4E1AA 4JZYA 1YIDA 2C5SA 3P0IA 1J1UA 4H3SA 5HUHA 1QTQA 2J5BA 5IJXA 4GU5A 3FWKA 2J4DA 3HGMA 1ZH6A 1QRSA 2DEUA 1V47A 4MWCA 2JANA 3L93A 4MUGA 4NATA 4MW4A 2A1UA 3NBAA 1N2GA 1WQ4A 2AKEA 1GPMA 4XFDA 1WOYA 2QTNA 1YUNA 4JXXA 3ZJUA 1NUQA 3AIIA 1ULHA 3X1KA 4MWDA 4DDHA 2QUKA 1R6UA 4MVXA 4MUFA 1UFVA 3DO8A 3TQOA 4NAUA 2A1TR 2YY5A 4I6JA 4EG3A 2O8VA 1OWOA 1NYLA 1J21A 3MMXA 2ZP1A 3IVCA 4ND7A 5JBNA 3MXTA 2HGZA 4G5FA 4YP7A 1LW7A 3H99A 3PNBA 1J09A 1OBHA 3FY4A 1VBMA 1MB9A 3U1VA 2DR2A 3LOQA 2AZXA 3FHJA 4UZFA 4G5YA 1IQ0A 1T6ZA 2IELA 1O97D 1T6XA 1OD6A 1KAMA 4MVCA 3AL0C 3RJZA 2GOYA 1Q19A 4PBTA 1NURA 3IUBA 5KWVA 4JYZA 3AFHA 2J08A 1TYCA 1K4MA 1WXEA 4P2BA 1MOPA 3KT0A 1O0BA 1LI7A 3CLRD 1J70A 1XJQA 2WQ6A 5H16A 4ZCTA 3HZRA 1KH2A 3Q10A 1QU3A 3SEZA 2CV1A 3PNVA 3QTBA 4ARIA 2QJTA 5K0TA 2QTMA 4MW0A 1F9AA 3P52A 1JEDA 1A8HA 1I6MA 5TGTA 2X0KA 4XFJA 2E0IA 3AG5A 1COZA 3CLSC 3HMQA 2GKSA 4K0RA 3CLUD 3ZJTA 1O6BA 1H3FA 1OWNA 4MVWA 5FO1A 1PG2A 4EG4A 4K03A 2QTRA 3CVUA 4F3RA 1O94D 1IQUA 3NV7A 1IH8A 4ZCQA 4ND6A 1VL2A 4MW7A 1J20A 2NSYA 4MUHA 4EF6A 3RHSA 4I6EA 5AHWA 1EE1A 3UY4A 4RPIA 1X8XA 4EG1A 3GLVA 4HPWA 2PFSA 3E27A 5FO0A 1HYBA 4JXZA 2QJFA 2Z08A 1T9GS 4WSOA 3X1MA 5H7XA 1ZJWA 3TS1A 1QJCA 1MB2A 5HUJA 2WB2A 4ZCSA 4EG8A 2CYBA 3SDBA 1V8FA 1N2HA 1KP2A 2IJGX 2A84A 4J76A 1OWMA 3A05A 1P7PA 1PFWA 1T6YA 1KP3A 4S1OA 2X3FA 4MW2A 4WNYA 1GZUA 5HG0A 1NUTA 3GUZA 3P0HA 3LE8A 4HJXA 2DLCX 4KPUB 4KR6A 3ZXSA 1G8HA 4KR7A 1TQ8A 1O96B 3GMIA 4ZT6A 1N2OA 1PFUA 1WXGA 2VXOA 4YP5A 2I1LA 3ZIUA 4ZCRA 3TNJA 3PXUA 5DB4A 3CVVA 3DV2A 2CV0A 1Q77A 2AG6A 3IOEA 2ZUEA 1M1ZA 3ZJVA 4TS1A 3TZEA 1PG0A 5DASA 1O95D 1ZUNA 1JIIA 2PZ8A 1IRXA 1FYDA 4EG7A 3IODA 4Q16A 4KR9A 1WXIA 1QRUA 4MWBA 3KFLA 1EXDA 3IOCA 2CYAA 2YWBA 4R2MA 3CVXA 2A1TS 1WKBA 2ZUFA 3D6VA 2D5BA 5K0SA 4U7JA 3IOBA 1O97C 2Z09A 2WQ7A 1S4MA 2E21A 1QQTA 1TYBE 3N8HA 2E89A 2J09A 2PG3A 3FG9A 3H9BA 1FFYA 3A2KA 3UK2A 2D54A 1D2RA 2A4MA 2YXNA 2QUJA
chains in the Genus database with same CATH superfamily
1GZ4A 4CUJA 1E6UA 3IBFA 3A2MA 2PVCA 3MJFA 3RT7A 1WTAA 4ZK6A 2FZ4A 4F4HA 3FW1A 4P38A 4C2TA 5KKCA 4UKDA 2ZETA 3WWOA 4JEHA 1KEUA 4U8HA 5HMMA 3U4GA 4HC4A 1J56A 1KYXA 1M54A 3CWQA 4WJKB 2C0QA 5GVSA 1BXZA 4MLCA 2QT9A 2QB5A 3B1YA 1CV2A 2H9YA 3JQGA 3DTTA 5KJEA 5GIOE 3E35A 3H5OA 3NDPA 3EXAA 4I1PA 1CUIA 1IB6A 5HTOA 2Z2JA 2XEDA 1OT3A 3EAFA 4NEHB 3S8MA 1ECJA 5JZOA 3DBLA 2W6MA 1MG5A 4XVQA 2QV7A 3ELUA 1TU4A 1AQLA 2R1TB 4KLNA 4ZT4A 4DDTA 5JC8A 3L49A 5JARA 3BWCA 3ND7A 2QMYA 4KQJA 5AVUA 3HRKA 1LPBB 4W1RA 1P44A 1RYBA 4R0NA 3QEMB 2BAGA 4ROTA 2WM2A 1RLOA 4GIBA 4YJ2F 4PICA 3TAUA 1G7CA 2IW1A 1LTHR 3DFMA 5HKBA 2Q2WA 3G6KA 5INTA 3VPFA 5ICGA 4XWOA 2AN9A 3EZYA 4QXQA 1PJ3A 3C6QA 4PLZA 4EITA 3ADBA 5D2CA 3D0KA 2J0QA 4E31A 5A5EA 5FDFA 1U1IA 4C4XA 3NCTA 1JFVA 3F9CA 2RHJA 2Z2YA 3R20A 4KNWA 1EQAA 5EPUA 4IDAA 4L95C 3VPHA 5LQJA 3DL4A 3HDHA 4A6EA 5CDTA 2X2FA 2FFBA 2FVXA 2GZHA 3Q9SA 4KVAA 2B1QA 3ZWPA 3ZZ1A 5IFKA 3T4PA 1ZAKA 3TH5A 5P21A 1ZJYA 1IONA 1EE2A 4CU2A 5KYXB 2W42A 5IAOA 4NBTA 2FW0A 5G0SA 1YQQA 4BQFA 3PF9A 4J0GA 3IEPA 3ESDA 4PLPA 3U39A 1Z4JA 1QOQB 1L5HA 4D96A 5CD1A 1FZQA 5HOEA 1KH1A 2C4NA 1TA4A 3T7JA 4BS9A 2HA0A 5KVQA 4IFTA 3ZW8A 2E4VA 1WVIA 3PG5A 2JA2A 4FDAA 4K81B 4DF3A 2CKDA 1CVRA 4O2AF 2OCGA 1A69A 5DCWA 1LXCA 5ADHA 3KSZO 4IJQA 1TF2A 4JKIA 4WD3A 3JQ7B 2WWWA 3COYA 2BY4A 4DLAA 4Z51A 3I2FA 1MHPA 1J7KA 2F3QA 3VA7A 3B3AA 4YMIA 1DKLA 1E9DA 3ORHA 4MA0A 5JSYA 2ZU0C 1B1AA 2OUKA 4BLPA 5C46F 1D4OA 3WJ1A 3SM9A 4HZIA 4X00A 1YL7A 4IIDA 1G4AE 3G0CA 3K20A 2C2KA 2IEAA 2ZJ6A 3KQMA 3V34A 3PC4A 4GRDA 5F76A 2NU8B 4C89A 4DLZA 5I01A 5LOVA 3PEWA 5DBIA 1MU0A 1AIPA 1YOBA 2NO0A 2RBEA 3QOFA 4FU0A 1TCUA 3U1BA 1GPLA 3JY6A 4I99A 1O95C 2RB5A 3ETLA 4I4TF 1FDOA 4MWEA 2R7MA 1T3LA 5LP6B 4KP7A 2OG1A 1OB2A 1T0JB 2B4AA 1RYYA 2NO5A 1C7FA 1DTWA 2WFLA 1NF9A 3ORFA 1QGYA 4HQLA 5K3DA 5C35A 1RQRA 3KCNA 1U0TA 4L3VA 4TXHA 3P97A 1UDXA 3QFCA 1NW7A 3P9ZA 2N9UA 3F8WA 1Y9EA 2KSQA 3WVNA 1RM0A 4ER3A 1F8YA 4S05A 1WMDA 3BRCA 3RAPR 4FUTA 1D9XA 1SG0A 4JX9A 5BWOA 2PX8A 2WWIA 3QE3A 1S8OA 4EUKA 3W0LB 121PA 3LPCA 2VWPA 3QPAA 4TKVB 4LOHA 1FDWA 1FNDA 3A31A 3LNTA 1UT5A 4YUZA 4A0GA 2BGMA 4F4CA 4CT5A 3THXA 5G41A 1MJGM 1GV1A 2V7WA 5EIXA 4NJEB 2P9YA 1SBHA 1B8UA 1JVSA 2CE2X 1CR6A 2FWRA 4Q4CA 1XI2A 1A3CA 1OJ7A 2BF7A 1QCCA 2J85A 5AJTA 2HMTA 4KXQA 3RSCA 3WLHA 5ALUA 3HUDA 3ZE7A 2C5BA 1G7SA 4JROA 1TUBA 1U3TA 1UKCA 5JOQA 2FF5A 5D84A 2XZTA 1W2GA 2ECOA 4ZC8A 4AJOA 1K27A 3B12A 1L4LA 3S3TA 5LQAA 1A2BA 4OB8A 3FPKA 1FRNA 1Y5NA 4G1CA 4JA2A 5JH7B 1P4SA 3NV9A 1NVVQ 1X94A 2FX3A 1ZYUA 3BA1A 4HV4A 3IMGA 4DR1B 1KDPA 3CT6A 3CFFL 4WCDA 4I1UA 1AGYA 1FE8A 1NVVR 4E0BA 2TECE 4E5NA 4LMRA 1Z74A 1ZESA 3BQ9A 5IP5A 2W2XA 3L02A 1E2LA 4JN6B 3IKTA 1U9CA 3VKUA 5ILOA 2K87A 1XZCA 1F4PA 3C7CB 4QGAA 4WKPA 2C2GA 4QJ3A 1OTYA 5JRZA 4YACA 2DY1A 4CF4A 1EJ2A 4P54A 5ICEA 3NGLA 3RK0A 2O0MA 4MJ3A 4D8UA 1OFHA 2LCIA 3Q6MA 4MUIA 1PJ2A 1HC7A 2RHHA 1KGSA 1PBNA 1DBVO 3A7DA 1U9IC 1HMPA 2R48A 1PFYA 4ND4A 2YV4A 2GNPA 2C92A 3LBNA 5D8DA 5FBQB 4OHYA 1J5PA 1EPUA 2WF8A 1B42A 1B93A 1T8UA 2HQSA 4UTZA 2G88A 3D1VA 1SU6A 3IJPA 3NDJA 3KJGA 3QRWA 2VP3A 2JBAA 2VHXA 1T8YA 2WAMA 3CPEA 2ECFA 3FYDA 4OIFA 3LT4A 2IPXA 2X7HA 4KYIB 4MR7B 1QH1A 4URFA 5DLQC 4Z53A 4Z9BA 2EG9A 1P2FA 2P9BA 1AXRA 1LLUA 5EUMA 3WRYC 4NU8X 4URZR 1NU6A 1VRVA 2PZEA 2YZ2A 4B6EA 1E69A 1HG1A 3WY9A 2C7PA 3UG6A 1Z2AA 1NFFA 3GQVA 2CDBA 1KAHA 2PMWB 4DYVA 5KNBD 2IX3A 2WF9A 1HBJA 3CB4A 1QIFA 3ZWKA 3BWDD 1Y4AE 5L4LA 2AMFA 3WOHA 2ZLBA 4YJ3B 2G72A 4EBFA 1FIUA 1E2BA 3K6JA 4U63A 3UCFA 3LYUA 3G9UA 1UR5A 3BQNB 3MTQA 1Y98A 4LK2A 1PSDA 4QXPA 2ZYSA 2J3IA 1GNQA 1WXHA 3DJFA 4AJHA 3L0ZA 2IYUA 5IKMA 1CNMA 3MINB 3P2JA 5J58A 1D09A 4Y2PA 4I08A 2R7KA 4JT4A 5FYDA 4EARA 1D4FA 2AK3A 2O5EA 1HRKA 1P1IA 1UZAA 1NVUQ 2PXAA 3WAGA 3A6HA 1N78A 2DLCX 3A9WA 2E5LB 1DIGA 2XOKD 3MC1A 5DIFA 3TR6A 3L3BA 3RAGA 5T41A 4RENA 3OX2A 2XMCA 3SIWA 4DE5A 4BE4A 3W5VA 3H4IA 1NJ5A 2VPZA 2IVFA 3X1WA 2FQYA 3M1YA 4E5DA 2C5SA 4KKXB 2FTKE 2VTVA 2P7IA 1EGQA 1Y1KE 5LYJA 4BHTA 4NYMQ 3L4KA 4MNTA 4GU5A 2FE4A 2JJ1A 4B7AA 1SY7A 3E9EA 3HLKA 3PQ8A 3N7TA 2IYZA 2FR1A 4FYPA 2RHRA 3AW8A 1PD0A 2CNLA 2DFNA 1MQ8B 2QUZA 2VRWA 3NDIA 1SUCA 4GBMA 5IBRA 4C07A 4NYMR 1NKSA 1Z16A 4RESA 5DJ5A 2IGTA 3D3NA 3QU7A 4XX1A 4Z4CA 1SOAA 1MORA 5IT4A 3JU3A 3EXEA 4GOKA 1Z0SA 4LNUB 4M0MA 4EKNB 4ZOEA 4UUMA 3PQFA 1Q95A 2IHUA 2JAHA 3CB2A 4FFMA 4L8GA 4MV4A 3DA8A 1YZ3A 4KGXA 3ESRA 3STTA 3C5VA 4BJHB 2KYRA 2G3DA 4DDHA 3M3PA 3U7JA 4H6VA 5TR9A 1W4BA 1Z62A 1IU9A 4W5NA 4A5SA 2Q1WA 2WMNB 2A1TR 2G9RA 1JEAA 5KC8A 4GPIB 2WWGA 4KHPB 2KHZA 4OAOA 3T4XA 1G21A 2UUBB 4X7PA 1CBUA 1UBCA 4BE7B 4A8JC 2E9SA 2QUBA 4V0LA 1J09A 1OBHA 1WW8A 2P35A 3MHTA 3FY4A 2VJLA 1IXKA 1YV9A 3O0DA 4Q00A 4UEOA 5EWMA 1KI8A 1ATZA 3EUWA 4X8OA 4BE9A 1C41A 2V7XA 1ZMOA 1V37A 1A8SA 2OOKA 4KIUA 1YT5A 4KXFB 4OF4A 3I4CA 5FUQA 4ILEA 2GKGA 1ZEMA 2I2DA 2OKGA 1YB6A 2QKYA 2WG0A 1JSXA 3MXOA 1SXIA 4J1TA 5F1PA 2VJDA 5ER6A 1Z9BA 4Q7EA 4Z4GA 3IIEA 2PDAA 5EIBC 5KI6A 3AHCA 3QX7A 3VPAA 1Y3AA 2IPOA 2ZE8A 3INTA 3FYCA 4PHGA 5KU1A 1C81A 3IR6A 3OF2A 4N5HX 3PDCA 2ACWA 1V7CA 2AOTB 4JC8A 4F3KA 4RE5A 1TYCA 4UREA 1FDTA 5BQPA 5A4FS 4M8LA 1MABA 3MWGA 4BO7A 1L4UA 3IAEA 3RRFA 5U1PA 5FBLB 1GILA 1CQJB 1RRVA 3E3MA 1C50A 3CLRD 3LCCA 5CA0F 4NXMB 2VA9A 3ICOA 4OXNA 4TQGA 2G9UA 2DQZA 4O4LF 2CJWB 1BXRB 4AMZA 5LZ5A 3OPYB 3PNVA 2IYQA 5DLDA 3BRWD 2JPDA 4DS3A 1M2EA 1X42A 4WN3A 3M1LA 2C5LA 4EFLA 3DDSA 1I6MA 5BSVA 1MT3A 4WXMA 3GGDA 3AGQA 1SCUA 3LXUX 4L8VA 1P8JA 3MF4A 5GY7A 2A3NA 8ABPA 3CJTA 3CLSC 3IAS6 4XUGB 1CC1S 4REQB 3DOCA 1IAVA 1QE0A 4EOGA 2GEJA 1KIAA 3FNQA 2QBYB 3C3CA 3E05A 3DDHA 2ZXFA 2JAOA 4MVWA 5C51B 5FI5A 4FB4A 2CFCA 2B9VA 4BJ6A 3KQUA 1ESMA 1V5FA 2XCIA 3IXQA 3O1IC 5CFPA 3NRCA 2CFTA 2E6UX 3HN2A 2IS6A 3JALB 1I3LA 3QEOA 2P2GA 1E8NA 1JSZA 4EA8A 1JPNA 1WVGA 3MAAC 4X91A 1NVMB 4H7DA 1EM6A 2Z30A 5J4YA 4MKZA 1VL1A 4TTRA 5A0TA 4QUHA 4B4KA 4OM8A 4HVLA 3K15A 3DR5A 3G1TA 3WBKA 1XRQA 3GPLA 5AHWA 2R9VA 3CT4A 2GHQA 1U28A 3NT5A 4G2NA 4ND8B 4RPIA 4C3UA 1X8XA 3DHYA 1TADA 3R3WA 4TT3D 4U6SA 2O2IA 1X7XA 1JMYA 4OY3A 5CXUA 3GLVA 5AM0A 2XBMA 4U7WA 1SWVA 1MXFA 1D3AA 1VKNA 3E7XA 3BS4A 5FFMA 5LJLA 2F48A 1BE8A 2YC2C 2I6XA 4HLUC 4EO4A 3VKHA 1C9YA 3JATA 3GOHA 3RGWS 3UJ6A 3DAOA 2ECKA 4FOOA 4UBLA 2HNBA 3FPJA 4G1BA 5H7XA 1KDTA 4N5NA 4OKSA 2OCLA 1KPIA 3QUBA 3KE8A 2QGNA 1F8UA 1MB2A 2D5CA 3DMTC 4S1TA 3QE9Y 1IATA 4G67A 4Z0PA 1DAEA 2XT9A 3ROTA 1KI9A 2PGAA 1QVZA 2ZWOA 3C3YA 5TARA 2IYTA 3WADA 1U1DA 1XNRB 2ZKLA 3KWMA 5GONF 4BRUA 1KR5A 4LF7B 2X8JA 3AF1A 4MYRA 4IV8A 5K6AC 4FILA 3A3PA 4D82A 1V43A 1I7NA 1EK6A 4QNMA 2PGXA 2A6PA 2WOOA 1OLUB 1TAHA 3EXFA 4PX3A 4TMYA 2EX1A 3ITDA 3U7QB 4Y3UA 1T9ZA 3KR9A 5JANA 3WGLA 1OLSB 3Q7SA 1F0NA 3PFIA 1FDRA 4ZJUA 3T3PB 4DV4B 3CF6R 2XVAA 3EA4A 3NJ4A 4HHEA 4IFEA 5C34B 5JE8A 3TI7A 3ZDRA 2BMVA 1CUWA 1L4KA 1I2ZA 3A1SA 4IFBA 4R8MA 1QSGA 2AI2A 1PJQA 4LRUA 4CRWB 4YH1A 3ZDFA 1C7EA 5D3MB 3U9SA 2CV0A 1TYZA 4Q3AA 4GVLA 4OEHA 3E82A 3PJGA 4MV1A 4KYTA 1US8A 5D51S 4CF5A 1WXQA 1C9KA 1VJ1A 4D9FA 1XKLA 4EG7A 1SBCA 1QRUA 4LDZA 4BP8A 1YMVA 2BOVA 3KFLA 2X8BA 4HH0A 3R8FA 3RC2A 3CVXA 1YS6A 2A1TS 3HSYA 1FEZA 3F4KA 5GV7A 3IOBA 4DABA 3TSCA 2OE2A 2ZBVA 3NUQA 1RXSA 2MJLA 1ST2A 4YWHA 4PAGA 3FTEA 4CN9A 1UJBA 3E7WA 3FHTA 3R7FA 3DEFA 1E5VA 1GTJ1 1NM5A 3RTGA 4B47A 2F3RA 2AVDA 2GAAA 2ZUDA 2OVBA 3EQ7A 2QK4A 3BULA 3EGWA 4TV8B 4BZPA 4HEJA 4BJ1A 4CVNA 3HB0A 3KKQA 5JDCC 2XWJI 3H84A 4IDDA 1RKQA 2QUJA 5F78A 4EL5A 2I33A 3D0QA 3VYTB 1X2BA 1Q7CA 5HW0A 2H06A 4JJEA 2VNSA 4KPUA 4EPVA 621PA 3I92A 3BSWA 1M34B 4YI3A 2E2WA 1J07A 4CQMB 2A9KA 2W7TA 3G5MA 4JFRA 4LDRA 1DVRA 1KJ9A 1MGPA 3MTEA 2FG6C 3FNRA 4X84A 1Q17A 3VOTA 3QE4A 5KYNA 2Q4RA 1E7SA 2CCKA 2G82A 2IIVA 1AF4A 2HQOA 3MWJA 3PWZA 4JA0A 1F0YA 1LS1A 1NI5A 3EEYA 5DTQA 2ODBA 2AA3A 3I2GA 5IHPA 5LL6P 1G9XA 4R41A 4GRIA 5A5VA 1IXZA 1JLMA 1SUIA 3U7HB 2PH5A 1QP7A 5BN3A 4NXNB 2GBLA 3IKVA 2EFGA 3TE7A 2QT0A 3UC5A 1KI4A 2AQIA 3UUWA 3RFXA 4NCAA 3F3SA 2WSMA 2Q1UA 1QH8A 4HGYA 2WV9A 4J8PA 3T4EA 4WNCA 2OORA 2PSJA 3K8OE 2C3PA 3KU4A 1OKKD 3L8HA 5AIAA 1QBKC 1U3CA 2C9DA 2CLCX 3LYAA 4RO0A 1XQ6A 2CSXA 4OX9B 2OR3A 5BV1A 3TK1A 2PRIA 1FW8A 4N0PA 1O03A 2CVZA 1QOPB 2ONZA 2JAQA 3QWHA 1SCAA 2TMGA 4JLBA 4DNXA 4RDXA 1LPNA 3MJCA 5ISMA 3IVMA 1G16A 1M7HA 3THOA 3TQQA 4K8RB 4DYDA 3IIJA 3NNSA 2BV3A 2HZBA 3FPBA 3WGMA 4CEHA 5FPYA 1OH8A 1VCMA 2IHKA 2VNJA 1R1DA 1CY0A 2PBZA 4MPRA 4F3RA 3ADCA 1EB8A 4JP1A 2A50A 4GNKA 1FPQA 2FFAA 3BICA 4PC3A 4Z2AA 3VDMA 2FOXA 3MVEA 4QVGA 4F93B 1Z17A 1SC1A 1ACMA 2WR8A 5I3ZA 1KTIA 1Z0KA 5CYOA 1TL7C 2C97A 3HKBB 4ZU6X 3RVSA 4BLRA 5CH5A 4GS5A 2WWVD 1GTSA 3OLVA 5DOZA 5HK8A 1TO2E 1Y5LA 3IAAA 2RHLA 2BFMA 3DZHA 5C1OA 2DQ4A 3A1NA 2VLIA 3F6PA 4G09A 4V3CA 2EJVA 4XYBA 4EKEA 3GRKA 4I4IA 5HFNA 3WKDA 4IMPA 4E2XA 4EUFA 5AVSA 4MPPA 3V4OA 1H5UA 3CR8A 1REQA 3VSBA 1X3LA 4A26A 5I9NA 1QF9A 5FOWA 5IXJA 2OK8A 4RVSA 3JZIA 1OMOA 1XDSA 3FWYA 4LZOA 3SZMA 5JNSA 2WPDA 3VJMA 4E21A 1Z22A 1TE2A 1EWQA 2BGNA 2FZEA 1MC5A 2XVZA 3PXEA 4RM2A 1P72A 2BSAA 4KQCA 5HXAA 3PVCA 3UIEA 1I7PA 1JVBA 2CVFA 2UKDA 3EXIA 3VSCA 5CCXA 5CR9A 2DH6A 2D2FA 3ASUA 4RZ3A 4GM0A 4UDNA 5BSWA 1CQIA 2VF5X 4IEIA 4U4AA 2H65A 1TOAA 5LPNA 1Z5NA 4GMFA 4DSZA 4OI2A 2PLAA 3M81A 4ZVLA 4TMKA 1TM4E 1V2HE 1VOTA 2PGIA 2Q3HA 3OECA 2ORVA 3FNFA 3QNWA 4I4LA 5CURA 1EDEA 4UCXA 4V1CI 5IDWA 3AKEA 3K1YA 4I9GA 2YOGA 1X8JA 4N0EA 1VLJA 2FZCA 1WJGA 1ZA2A 4OQMA 5GJWC 5LQDA 5IC5A 2GEDA 1H0RA 2OY0A 2HWWA 4P7FA 4IKPA 2N1BA 3PWTA 4Q5IA 1T3HA 4EJSA 4CM4B 2B34A 1ZEJA 3R6WA 4NFYA 4RF3A 5ENDA 4DCMA 4FWTA 4ZJZA 2FMIA 1OH6A 2UVQA 3CPSA 2YR0A 3K2IA 1I1OA 4KUHA 2G09A 3V48A 4DRXB 4Z7OB 1Y8AA 4EGAA 9ABPA 4LVUA 3THWB 4DB4A 1JYSA 3HA2A 4ZU1X 1P2VA 2R4TA 4A2PA 4DPKA 1A4IA 2HU7A 4E5YA 3O26A 4AM8A 1NNI1 1NY5A 2FZ5A 3L6UA 9LDBA 1N33B 1CLEA 5EVCA 2R8PA 3MGGA 1GKYA 3T38A 4KU4A 1YFZA 3ZHRA 4EG0A 1RI2A 3TR5A 2PANA 3IE1A 3A1VA 2GB4A 3K6RA 3WNDA 2OXEA 1ONNA 5DXAA 4AT1A 2WT9A 1TAUA 3UAWA 2PR7A 4JL8A 4QWWA 5THQA 1XAIA 3ITNA 3MB5A 1PT6A 1GGFA 4H4EA 3MW8A 4ZYLA 4RD3A 3VPXA 5BOSB 2DWPA 5IVIA 4FXPA 1F2DA 1C1XB 2VJCA 2JIZA 1L7EA 1KXZA 3G8BA 3GV0A 3Q7EA 3R4VA 4NARA 4N3AA 4V38A 5K4AA 4DV2B 3EHEA 2PA3A 3PD7A 1U8TA 4LHVA 2BBOA 2B7LA 3RK1A 3PNMA 5JRDS 1XCGB 4J43A 4IX9A 3UVEA 1MX3A 1YO6A 5FT9A 5G3ZA 4B5LA 5LA6B 1GXSA 1BXGA 1WHTB 4MO9A 1IJBA 4M1MA 4HGOA 4XDGA 4N01A 2HX1A 3M70A 1XZ8A 1KDYA 2O20A 4WQMA 3VJLA 2FMHA 2Q28A 5J5AA 1DJNA 4PCVA 4M1WA 1R9GA 3V4VB 4BQOA 1MT0A 1DAIA 2OGWA 2Z95A 3ZVNA 1FFEA 3AETB 2QAGC 4N54A 3JASA 2JHGA 2H1RA 4WI1A 3TQTA 4AWAA 4EY4A 1F3OA 4XGRA 3GFTA 4M46A 3VO9A 1CUUA 2AKYA 1OI2A 1G5IA 3C8ZA 1DC7A 2EGHA 2VZLA 2AXNA 4Y1RA 5K0ZA 3G59A 4WESB 5KEIA 1V2GA 1B3RA 3QKTA 2JEZA 4GXRA 4UNSA 2ZQYA 4RXMA 1XVUA 2WD7A 1PL7A 4HNAB 4MV6A 4WACA 3WGIA 3JQFC 4PLWA 5TVGA 4Q7QA 1PKXA 2GXQA 4D9GA 4EL0A 5BUZA 3OLZA 3L1IA 4R2WA 4FBGA 4N7BA 1T9KA 3W2FA 2KM1A 4XPZA 2BONA 2HQRA 1ILEA 1R8YA 3N0RA 1M2JA 3N2EA 4BN0A 1ARZA 2BFWA 1OWLA 2HSJA 3VVBA 1K66A 1U5CA 2OD2A 2FUCA 3SLKA 2JLQA 3CVJA 5E9QA 1J9GA 5SV2A 5KNBA 4CXMA 3CVWA 1W29A 2GO1A 4MS1A 5FTKA 4DADA 5C32A 4DA0A 4NP6A 4NAVA 4PAWA 1MEJA 5HQ3B 4EB6B 4HS9A 2P9EA 3CRZA 1JU4A 3LL7A 3IDQA 3R5HA 3DP9A 3KR0A 4OXYA 2VHTA 2P0EA 1X1DA 1CEEA 3UWOA 4XWYA 3DL2A 3QTTA 4DDMA 3PHIA 1FDVA 4C0JA 1X9GA 2MSDB 2YV3A 2V0GA 1C4XA 1OBVA 3ZHYA 4YT5A 1BX1A 1DJOA 1YCHA 2XMQA 1T2VA 3UH1A 4WCFB 2YOHA 4QUDA 1LQTA 2IDZA 3RIMA 3U3JA 3OCWA 4CTMA 2ODTX 3T3MB 2G04A 2BMAA 4INPA 4JIGA 1IK4A 4F3CA 2CLSA 4UAVA 4P3NA 4C01A 2YZMA 1JEEA 4PINA 4JI0B 4CMJA 3G23A 4WNIA 1Y8QA 1NRWA 4AD8A 4BLWA 3NLLA 5KOHB 1F8XA 1Z5WA 1PS8A 1NVKA 2PS3A 3R41A 1YJAA 4RJ2A 5BMVA 1OGYA 1CRPA 2VJMB 4W4TA 3CFHL 5KKNB 1GQOA 3DEJA 3GEGA 3GRUA 5KWIA 5LUAA 1IBMB 2YJ5A 2JJMA 4TSFA 2FRXA 1ZH6A 2PUWA 4RADA 3ENVA 5DBHX 1IZZA 1ZM2A 4C9BA 3KJQA 4ILKA 3RTDA 1GKKA 2CW5A 5EUCA 2ZRCA 3V42A 5E0KB 4P34A 1WOYA 4JZKA 4F6RB 3ADDA 1FX0B 3OVMA 3KVVA 1GP2A 1ULHA 1SVMA 3L1JA 1NBEA 1L7QA 2D2IA 4RU1A 2OBLA 2V6IA 3PUHA 3W5HA 1R6AA 2YYZA 1O54A 1T1RA 3L6BA 4MWDA 4UTXA 4Y2JA 3CNLA 5KU7A 1Y8CA 1UP7A 1E2EA 2YN4A 1EVIA 3RVKA 1T5TA 5KDDA 1BCSB 3HCRA 4XB6B 4M60A 4MR9B 2B25A 4OI4A 4D9KA 3I9V1 1BE6A 1BQ3A 2ALJA 1UBMS 1UPFA 5A5DA 4J1SA 2G80A 4HLQB 1Q6ZA 4FHZA 5F52A 1F0PA 4U3JB 4GSKA 4GAEA 1COWD 3A4YA 2Q1SA 2WZDA 4NPCA 4JI1B 1GPNA 4ACAA 3HR8A 1QGUB 3Q3JB 2WIKA 1A8PA 2VSFA 2I66A 3G8DA 3GT0A 2H54A 2XQFA 2YBEA 2GDJA 4ZOQI 2I8AA 3PXBA 4KVFA 1WSBA 1WZIA 1MJ5A 2LDXA 3I5MA 3LGXA 5IDQA 1T2UA 4TXMA 2RGYA 3EZ2A 1K8YB 1CEQA 4U9UA 1JIVA 3EZXA 2QG4A 1ZCJA 5FR1A 2PRZA 2FQQA 3I6QA 4B6GA 1YDHA 1Q19A 3AUXA 5B30A 2J1LA 3O8QB 3GBSA 2O8BB 4LJLA 1H93A 5C4GB 2EGUA 2H51A 2LWIA 4K6FA 2A5FA 4G0NA 1QKIA 3L1KA 4UHJA 3DH0A 1G3RA 4CMGA 3IJ5A 1KH2A 3DEKA 2PKXA 4LCEA 4LX0A 1KFEB 3AR5A 4DFDA 2ZSUA 3PI6A 5BQ5A 3TUIC 3V7UA 4JVOA 2HV9A 1BD3A 1KU6A 1TEXA 5BYKA 5HZGA 5H8WA 1WHSA 1AS2A 1ZOLA 4PG7A 4QICA 4R05A 1T1GA 1F9AA 1VSBA 3E84A 5TGTA 4ALKA 1ACJA 2VCHA 4YBZA 4OBBA 3KB2A 4KDRA 5AKGA 4BB6A 3AJ9A 4FYMA 1TQ6A 2ES4A 3HMQA 1DTSA 3RHTA 4AN4A 1T9AA 1PT8A 1OTHA 3F5FA 4PQGA 1Z06A 2ET6A 3F90A 1KI2A 3KXDA 5HM8A 3C7AA 1A2QA 1RSZA 2Q5OA 3G9XA 3UJ3X 1ZX1A 4OH7A 1RHMA 2XW6A 1IUOA 4G65A 4J4HA 2JVJA 3CYFA 4MB0A 5FO1A 2H2IA 4AAYA 4RHFA 1F12A 2OAQ1 1JQBA 4IDCA 1UPCA 2DC1A 4EUNA 4F1KA 5HP4A 4D42A 4OI0A 3BF7A 1YNSA 4LPKA 1IBLB 5LJIA 5JS1A 2RGEA 3EARA 2VJNA 4FDTA 5EZYA 3ACBA 4HNTA 4XIYA 3IAS1 2IZ0A 1T0HB 3HKEA 4UHKA 3ZUPA 2C83A 1MENA 4IO0A 3S5JA 5B6PA 1RM3A 3H8JA 1IN6A 1PI3A 1B74A 2MSWA 3EBOA 1QK4A 1OFUA 1SCKA 2BZ0A 2FJ0A 2G76A 4HAXA 4Z9XA 4DY4A 1EVKA 4YUWA 4XGQA 5JSKA 4RTSA 2QX6A 4U9IS 4KO3S 4MYDA 5I6DA 1ZLXA 2PFSA 2ZATA 1M5TA 1EXWA 1GFZA 2EG5A 3JR7A 4GDMA 4R9UC 4Z0NA 3RUFA 1RPAA 4PZYA 3K1TA 4MP3A 4JBYA 3ONNA 4AY3A 4LMAA 4RIEA 1QS0A 2A3RA 5I4IA 3TS1A 4Q9DA 4OHPA 1WEKA 1VJDA 2C07A 4GGOA 5E7JA 3ZEIA 4DSTA 1YDMA 2VDWB 4HAIA 4RK6A 4X71A 3TLEA 3U4DA 5IKEA 2AJ8A 1E5TA 1S1MA 1YR1A 4ESOA 4JLVA 1XN4A 2POCA 3JAKB 4B4WA 1H4SA 2J48A 1PLJA 3EUEA 5AKKA 1TM3E 2OBBA 3VYUB 1RPNA 3EA5A 1DI0A 1Z33A 1FXSA 1KP3A 2ZVJA 3PE4A 1VMKA 1SUDA 5D1NA 1CHNA 1PZGA 2I8CA 3VM6A 2WJ3A 2JI6A 2CSUA 2J32A 3BJIC 3PZBA 1RLTA 1P4AA 1UK9A 2HB6A 4YV1A 4UPDA 3K9FC 3O3MB 4OSPA 4J91A 4RPGA 1UMCB 1CUEA 2NPIA 2UDPA 3CKMA 4JDUA 3GLSA 2P3QA 3WJAA 3ZC3A 2VTKA 3E3NA 1OXTA 1YS7A 3NYWA 1VIVA 3AY6A 4DAOA 2R2AA 1W85B 4PZUA 4C0BA 5T57A 2XYGA 4TQAA 3RS8A 4NENB 3S4YA 5E4TA 1BG6A 1N2XA 1H6AA 1DAFA 4P2GA 3OLYA 3PTZA 2UZ4A 3O1LA 1LVGA 5F9MA 3TRFA 1W4AA 4TV9F 5EXXA 3GVXA 1YS4A 3ESAA 5BPFA 5FWNA 3M1AA 3VVLA 1SXJD 1A9QA 1M6VB 3QXJA 4DQUA 2WZBA 3ZVMA 3SQLA 2CYAA 4FGLA 3GH1A 2NUTA 4TTJA 1Q0ZA 4Y2VA 1O89A 2CF5A 2PEYA 3EQ8A 5DIZA 1O97C 1E7YA 2O3QA 3O8OB 4JMLA 4BX2A 4BYMA 3G2PA 4AZWA 3BH6A 4GVPA 2PJRA 2A0FA 1BEZA 4HWRA 3UJCA 5IX8A 4G0VA 4BVBA 2B2CA 5E1BA 4RH0A 2JDID 4DMHA 1ZBQA 5LKAA 4X24A 1KYQA 3TQHA 5IUKC 5C8YF 4FFRA 4K1LA 5JDIC 1H2YA 1QB7A 3UK2A 1U6KA 3H1GA 1CVLA 2G5GX 2XBUA 4LI3X 4BNGA 2R25B 1QQ6A 2XDQB 1GSIA 3MWLA 1I4WA 3BTUA 3DWIA 1FUUA 3PYMA 4OHKA 3T41A 1VPWA 5KWEA 2BI7A 1QX3A 1HRDA 4FGSA 3DB1A 1EM8A 2GA9A 2W6OA 1QYDA 3LUHA 2HDWA 2V6FA 3O03A 1PEYA 5K3FA 3EUAA 5I3CA 2YKGA 1KMHB 1R37A 1SQ6A 2XDAA 4OA5A 5JC1A 3ESXA 2JLXA 1W0JA 1NF2A 3NBUA 4URYR 4B4OA 2Z3VA 3OCCA 3EQ6A 3B52X 2BDTA 2QJOA 5C3UA 4ASUD 3N8KA 2CNOA 3DLIA 1FYEA 3UPTA 3KDAA 2QUHA 3T5DA 5CT8A 2ZR7A 1OXXK 3GU3A 5AI0A 3GLQA 5H70A 3U31A 4CM6A 1FP2A 4P0QB 5I51A 1XCPA 4P98A 1SCQA 2DPXA 2WTNA 1XT6A 1VG1A 1E6MA 1SU8A 2C4KA 2IIBA 1XZBA 1W75A 2IBSA 1UXIA 2OA0A 3HDJA 1AQYA 5AW6A 3OP1A 1XBTA 221PA 3EPJA 3A4IA 2X5NA 4K9KA 1N7JA 3PPVA 4QGGA 2C20A 2QSUA 3I73A 1K7CA 2RAUA 2YMQA 1KEVA 4GOND 1IOWA 3AP2A 2GCEA 3NVDA 4Q0MA 2ZWMA 5AVXA 3ASYA 3FSEA 3GZNB 4QOHA 4I7EA 3VTZA 1T1EA 2X0IA 5AKIA 3R75A 4IKEA 2EX0A 3V8EA 4BC1A 1UC8A 3FFBA 1G5QA 3GJXC 3K0BA 2OP1A 4J75A 3H18A 3GLKA 4UUQA 5IH7A 1PJAA 1RR6A 5AOCA 3WIVA 1H2FA 4ZAYA 2XZLA 1DOAA 4R2KA 1DKQA 1QQ5A 4RLHA 4R5HA 1BHSA 4WGFA 1R5JA 1SC3A 4IMRA 2NO7A 3JV7A 1YR2A 1E3SA 2PKYX 1C5KA 3FKQA 2IUTA 2V98A 3UXHA 4NG5A 3VZDA 2EGGA 4UXIA 5IK2A 3MMPA 1QDLB 2P6MA 2Q29A 1ZINA 1XNQB 3ETEA 3T1NA 3LUPA 3NHPA 4AJPA 3EXHB 1W5FA 3CG0A 4QVIA 1ZQ1A 5DW3A 4KXVA 5J4HA 1USWA 3LHIA 4EECA 5TJ9A 4KR2A 3KT6A 1KDVA 3AB3A 1NW6A 1XZEA 2B99A 3PL1A 4XWTA 2J8ZA 2I1QA 1NTRA 4XLZA 1PT9A 4RVHA 5F33A 4C0WA 5KCMA 2FR8C 1N6NA 2C95A 2YZ7A 2AFIE 3ZH9B 4UUAA 1M8PA 2FWMX 1HL3A 2EATA 2UVPA 4FZJA 2FMUA 5JJ5A 2ZR8A 4GZ3A 2QV0A 3CI0I 1P29A 2H0AA 2PKQO 3HJBA 3Q9LA 3C3PA 3B36A 4J1QA 3HS3A 1SB9A 1ZSYA 3OZFA 3C70A 3ROFA 1L7XA 2FE1A 3P0JA 1XEWY 2X0RA 4MITA 2NOAA 3QYPA 4YAEA 2HAEA 3BMQB 3ETJA 5IW8A 1ISFA 2JK0A 5EY5B 3H9QA 1XZIA 4D8YA 3PP8A 5LDGA 3R6TA 5F98A 1L4YA 4IHJB 1DE0A 1PLKA 3PEYA 5BQ3A 3GLIB 3I30X 2YIVX 5T6BA 5JIBA 4EFMA 3AHIA 1UXHA 1C0PA 3SC2A 1DAKA 1GPJA 4I66A 1W6RA 2HBZA 3G2IA 1KORA 3A4MA 1FVFA 2AI3A 3IURA 5DTJA 1NOKA 4P3KA 4EKGA 5CBPB 1JRLA 1SBZA 2F3PA 2CXUA 3KX2A 5KAPA 5JYBA 1IXRC 3MWKA 2OC4A 2WFZA 1SZPA 3FWNA 3RVMA 4DKXA 2PIAA 4CIVA 3F8SA 1TTPB 3HK2A 4UM9D 1HFKA 2B8EA 1Y1SA 2Q62A 4MQ6A 1JI0A 3C3JA 4LYEA 4JY7A 4QE3A 1E96A 2Q9UA 5HR5A 1ULAA 5K3AA 5B6IA 1AZTA 2IYLD 4RQTA 1QTNA 1XV5A 4C4YA 5DI3A 3RBVA 2WYIA 3M6UA 4J0DA 1ENZA 2IHVA 3G49A 3TPZA 3X1JA 2NAPA 1NI4A 4P83A 5D86A 1YU9A 2VPIA 4YMTA 2QX7A 3ZYCA 3NFRA 4AY2A 3EJ6A 4RTLA 5BSKA 1T8WA 3T1TA 5DM60 3JVDA 4JUIA 1M1NA 5JHGB 1TT5A 2X1HA 1T4BA 1VJCA 3IQIX 4IQ0A 3SQMA 2B61A 4BO0A 2ZJ2A 1AURA 1AT1A 4I6GA 3FSGD 2MR5A 2RCYA 4Y2TA 5HNKA 2IYWA 4I1RA 3N8IA 1BVRA 3O83A 5ERYA 4HMPA 3CR3C 3TR0A 1MPXA 3TQCA 5DX8A 3ZK8A 3GZJA 3PQ3A 2GXAA 4MV0A 2ZYAA 1LI5A 2B0CA 1QIKA 2EWVA 3LDUA 4ENVA 5G2OA 2G5CA 3BA6A 4HTFB 2B5OA 3DMRA 3H9JA 4D4IA 2M32A 1Z15A 1H6DA 3AJDA 4JLNA 4JBHA 4XPIB 5TPWA 3HC7A 2PD4A 3GJ3A 1A77A 3VPDA 2HY7A 4XRGA 3EDOA 1GRCA 1UWLA 4YRMA 1MH9A 2GR7A 1JQEA 3QU9A 2W6JD 1L3IA 5JXWA 1LDGA 4Q9JA 4QDXA 5FFNA 3L6OO 3E5HA 3F5SA 4OQFA 3Q8WA 1N9KA 4K6MA 2R8RA 4WOKA 2BR3A 2OCPA 3I53A 1V4VA 4BMVA 3AL2A 4UCWA 1ZM7A 2ZYRA 1K9SA 4TS9A 4WFKA 3M8KA 4LFBB 4LQLA 3HJUA 3V00A 3ZKWB 5IZCA 3DV9A 3GLGB 1N0WA 4EHDA 2E3JA 5K09A 3IPLA 2NO1A 1YGPA 4C20A 3W5BA 3RSLA 1E9BA 1LSUA 2ZQZA 4M99A 4MKIA 3CUWA 1K63A 2Y68A 3CF0A 1XRPA 4XFKA 1O0CA 1ZW1A 2R2GA 1D6JA 4EY6A 4ARAA 2WZCA 5EZ6B 5K3EA 2R7NA 3PR1A 4QHSA 4FD3A 3TO5A 4DARA 1SBQA 2H4XA 3VH2A 4JWKA 4XE5A 5AI6A 4JXKA 1U8XX 2AMJA 1Q7EA 3NALA 4CR6A 1KJQA 1XA4A 2RGNC 1J22A 1H6BA 4GMXA 3STXA 1DNPA 4EHNA 4K87A 4ENTA 5IF3A 3H8VA 1E1DA 1ADJA 2VHVA 5AKEA 1W36B 1P9LA 2PGDA 2ZSIA 5EQJB 4B6QA 2VJQA 2JA1A 4HEA1 3QVUA 1PJTA 1UJMA 4ZP1A 5CA1F 4UULA 2QRNA 4JGBA 1N36B 5EMKA 3OWOA 5K01A 5JNVA 1E6KA 2WRZA 1XWWA 1P9RA 1ZONA 2QTLA 3EE6A 1GKIA 4LRTB 1GGKA 3FZGA 3BQMB 4AXXA 4ON9A 3L40A 1SB8A 1EJ0A 3LHFA 4XCVA 5J5VA 1WZEA 1GUBA 5DYWA 4BATA 2ADOA 4N48A 1G9SA 3C0KA 1EA7A 1QYIA 2XTAA 3EGDB 2J9GA 4JUBA 3RI3A 1Z26A 4MEAA 3ROGA 5B5SA 2ATVA 1J1ZA 1DB3A 3M2TA 1XP5A 4C6TA 1FW6A 5ALYA 1NXQA 2VJKA 4W5WA 4H4CA 4BASA 4JJZA 2QR3A 1E2GA 2HI0A 5L3VA 4DLUA 4AZ0A 2Z3WA 5E6UB 2R7LA 3G8CA 4PM4A 2HPZA 2IOQA 3LJKA 3RVPA 3WGOA 2DEUA 4EHIA 3E61A 4DCNA 3L93A 1JH9A 4R1TA 5AK6A 2ZRDA 5EJEA 2CJXA 5D3ZA 4DV3B 4IHKA 1NW9B 4QODA 3KQWA 1N2GA 5BYAA 1BVYF 3AHEA 4CUKA 3L4BC 4XFDA 3SVTA 4GYJA 5F5LA 3RS0A 2YASA 3CPHA 2QL7A 3DAFA 3N2NA 1BD4A 1VMAA 3L05A 2FSVC 1S2OA 2DSNA 3DT6A 4JCCA 2RAFA 4OBWA 3ZHSA 4E7OA 5JSZB 1NVDA 2PO5A 3A26A 5COAA 4FMCF 3DO8A 1BKDR 2FGKA 1N6OA 2VBGA 3TTTA 1KPHA 1Z0ZA 5K0FA 1MRNA 5GV8A 3IVCA 4LOAA 3E1KA 1V6SA 2YBDA 1U2EA 3EIWA 5JHHB 4D8WA 4FGWA 4Q4AA 4B80A 4BO8A 2GCOA 1UBLS 4LOJA 3KKLA 4NESA 4EMBA 5E9JA 3UAXA 4GE3A 1UDBA 2BFFA 5DXJA 3KE9A 4TYMA 2IHTA 4ZZ0A 3UV6A 4RWZA 3DLPX 3M82A 5TVKA 3I2IA 4CQJA 5CJJA 2Q5EA 2JGAA 2PWZA 1U5BA 4PLFA 5F7JA 1B0ZA 1J2YA 5HCNA 1UMBA 3TI9A 3AL0C 3VU9B 5LCXA 4ED9A 4I55F 3ENNA 4BNDB 1QP4A 5DXFA 1IY1A 3L7DA 1JJ7A 1KSHA 1L5NA 4EB0A 3TKAA 2FK7A 2AXEA 2IFTA 4DJDC 3IRVA 2J08A 4QVKA 2P75A 1GU1A 2JIBA 3ELDA 3MWYW 3NR2A 4FOPA 2QL6A 4M7WA 2WUDA 3T9AA 4CM1A 4BVAA 4BXOA 3MZ0A 3C3XA 1P75A 1QAQA 1SZDA 4YO7A 1NQWA 3RVDA 5AM5A 5EHXA 3I5YA 1O6GA 1N2ZA 5F5NA 2W2KB 3QLUC 3UHJA 4C7KA 4DSOA 3TIVA 4S1PA 1ODKA 2B94A 3LLUA 5GJVC 1G1AA 4TXNA 3RYFB 2XUZA 4PU0A 5KQSA 4UMFA 4HR7A 1G64A 2O2ZA 2YXEA 3JYHA 3N8NA 1KMQA 1DQZA 3CHYA 2Q1TA 5CIQA 5AI9A 2GXUA 5EKTA 4ZEMA 4Z1OA 1GRRA 3PT5A 3KIPA 4A5OA 1COZA 1ZVMA 2GJSA 4UU7A 3HEBA 1S3GA 2W8ZA 5ESXA 4NU6A 7AT1A 1QLHA 2LKCA 5EGNA 4WW0A 1SD5A 4OUKX 3P0RA 1A04A 1L5FA 1ISMA 4JR1A 4B7CA 1NX6A 2O50A 2XUOA 1PK9A 4X1OA 1CLUA 1P77A 3ZY4A 5FPTA 1Y5IA 4P4UA 3OIGA 5TQ0A 2PUFA 5DM4A 4F2WA 1P2BA 2QTGA 3WWEA 5B64A 1GZDA 3LRPA 2WD9A 1NNEA 3B8EA 3EEQA 3G9QA 4FDUA 2CHUA 4YAIA 4LDAA 5BVHB 5HZHA 1N57A 3O75A 2NTNA 5EHIA 4CKBB 1EWRA 2D1SA 1VSQA 2ZI6A 1PDOA 3RHSA 1JMKC 3KLNA 1IOLA 1DUSA 3DW3X 4IZIA 4KXMA 5HRCA 1WSDA 2Y9MB 1H0SA 2QM3A 3N8GA 3D2LA 3SC6A 3OY7A 3T15A 5ALSA 3CZMA 2ZREA 3GRAA 1T1SA 2H08A 4QD3A 4QOGA 2P3OA 1T5DX 4BLSA 1CE8B 4LG1A 3PXXA 2E1PA 4C30A 3FDZB 1WMAA 1GVNB 3GP3A 1HYBA 3WJ7A 3ZCRA 1N7GA 1NOJA 2V7VA 2QJFA 5EIAA 4HGZA 3OZVA 1MO2A 1R16A 1WB5A 1YVDA 1NBMD 1L5RA 2W11A 4JKOA 4F5YA 4PGHA 1TQ4A 1KTVA 1NJFA 4KZKA 1NVWQ 5J9FA 1VJ0A 1XELA 1T9DA 3SHWA 3U7EB 4FR5A 4CMEA 5SYAA 1Y1TA 5AJYA 4X1KB 5EI5A 3DMHA 2WC1A 1FMLA 2IJGX 4E15A 4F1JA 2I2BA 4GI7A 4ZQFA 1Q14A 1CQWA 3VPBA 2LKDA 5EFZA 3S44A 2PUDA 3T8YA 4D79A 5IM4A 4LYAA 4XJSA 2CXXA 1KC3A 4GICA 2FVYA 2GN4A 4LXUA 1J0EA 1CY4A 1NW8A 3N2GB 4GPD1 3T6KA 3LV8A 3QA9A 2DQSA 3P0HA 1XZJA 3AP1A 3NOVA 4H0NA 4I0WB 2AH5A 5FA8A 5JD3A 4CR8A 1FXWA 3EBPA 4WBNA 3UMSA 2XMBA 4RF4A 2JC3A 2P77A 2QZZA 5ALDA 2FPKA 2YHSA 2N3ZA 1MW9X 3LY8A 4XCXA 1XYVA 3RRXA 2Y27A 1HDXA 4IVNA 2OVFA 3VOBA 1C9EA 5LQNA 2O2HA 3K70D 5EEGA 1L5GB 1GR1A 3E3AA 1C8KA 4RHTA 1JG2A 5F35A 1TCAA 2IYPA 2JFBA 2VDRB 2IOHA 1J0DA 4DIKA 3EEOA 4GT1A 3VO2A 1P6XA 1V11B 1RXEA 1TRHA 1X3SA 1R4NB 5FNVB 1E3WB 1OLXA 3CSUA 4EF5A 5EUBA 3AZOA 4K8OA 2ZS9A 5LBTA 3IODA 3AT1A 1WXIA 2CFRA 3PEFA 4BFYA 5L7WA 2DBQA 4JQOA 2SNIE 4RJJA 3U19A 4FFDA 1MHTA 1EXDA 5DWDA 2FMTA 3ZHQA 4N47A 4FGUA 3KOMA 3QE2A 2P9TA 3WDLA 4G01B 1N2CB 4B76A 3M33A 4GE0A 4KQ9A 4MWGA 2FLWA 4R84A 3NI2A 5BOVA 2Y1WA 3HXMA 5DLEA 4ZDWA 1S4MA 4YAUA 2WMDA 5CB4A 5F3WB 3PSAA 3GFQA 5F7ZA 5JG7A 2VR1A 1XEXB 2V6GA 4CMIA 3FG9A 3V33A 4PW0A 3VAZA 4ZTZB 1G2OA 1W6UA 3B1FA 5JAIA 3LK6A 3OEYA 1UFQA 1JQ5A 1C3OA 1DXQA 1E1LA 1JEYA 1ZCBA 1JS1X 2C57A 1XZFA 2QTVB 4CQLB 1J2UA 4PZAA 4LV6A 4W7IA 4Q05A 3Q2IA 4E2WA 4A2CA 3CW2A 3ZNQA 5JSQA 4OAPA 3VDNB 3N76A 3LFUA 3ONVA 3PF8A 3GPDG 3GG9A 1L7RA 4QUGA 2HT1A 1T6NA 4MW1A 3ZJ4A 1F2VA 2IIPA 2YWCA 4LRYA 2QA5A 2I6GA 1FU4A 3JVUA 4YT4A 4M8KA 1ZGHA 3K5PA 4YMHA 7MHTA 4PCUA 1V7QA 3KJZA 2ZUTA 2JRLA 3AERA 4FHEA 2HCTA 2NZ8A 3OZRA 5E4YA 1AB5A 2FFRA 2QAJA 1MW8X 2GFHA 3E5MA 3VV3A 1BFDA 4MPJA 2DPMA 5JY6A 3K5WA 2FCAA 2ZTVA 3DZCA 5EE3A 2AJBA 2V5UA 3NTXA 4BMDA 4TYNA 3AUFA 2SKEA 4R8KA 4NKRA 1XRRA 3COSA 1TEHA 4OL0A 4ZQEA 2ZYUX 5KX5B 5LOVF 3WB0A 3L7CA 3QVGB 3ZU6A 4IBOA 4OFZA 3GJTA 2XWQA 3ED5A 1IQRA 1GEGA 1AN0A 3QWFA 4F2GA 4ZV7A 1D6MA 4ZOLB 2JGDB 1ZMRA 3KAPA 2XIJA 4J3FA 5IEJA 1OXVA 1VIDA 4BFUA 2GWHA 3EMBA 2JFQA 2DUUA 5F2EA 3SXPA 4YP9A 3D3KA 1U0BB 3QWAA 1I30A 2HSGA 4FNOA 4LISA 3NVKI 4AU1A 5PGMA 1YULA 4PTLA 4OUDB 1I7SB 2XODA 1N2JA 1RE1A 4EVQA 3GLHB 1WXFA 2KE5A 2YXPX 4YQYA 2NX2A 1I24A 2QP3A 2ZOSA 2BEUB 4WKNA 1JPUA 2X15A 4L5IA 2RE8A 1GHTA 2VTDA 5DWQA 4H6PA 3DR3A 3L84A 4GKJB 1WPRA 3TW8A 5FI0B 4KEAA 1DPGA 4FOLA 1SXJB 1Y8ZA 4AY4A 4B35A 4PZCA 1EVQA 1G8GA 3RBAA 3ILSA 2VH2A 3R0QA 4KN6A 4OHVA 5KTKA 2BSQA 4R8SA 4CFYA 2ID9A 1X77A 4WNAB 2LGJA 4QQRA 5B1DA 3W34A 2JJ2D 2HIAA 4GP9A 4BV8A 5CCEA 5A6SA 3AFIA 2XUJA 3TKYA 1C4WA 1ZD2P 2OZPA 5A0VA 5AP9A 1M7BA 4HPXB 4YLGA 3O4RA 5I7EA 1G6Q1 3IKJA 2UYGA 4ZMRA 4EYGA 1YFLA 5KNLA 3JARB 1ULTA 3FOBA 1XYGA 4ESEA 3MAGA 3RU3A 4LY6A 2JAXA 4HAOA 1RC8A 4RZSA 1VE9A 4U8GA 1OILA 1PZXA 2D1RA 2ZI3A 4RMIA 2G67A 4QJ4A 2YINC 1CIVA 2Q5QA 4FNMA 2ORWA 3Q4GA 4I5GA 1Q7BA 1VE6A 4DDWA 1P9OA 2O1SA 4R8VA 1FP7A 1W52X 1X0XA 4QU9A 4D9HA 3KL4A 4Q47A 4QBIA 1QHGA 4UD6A 1K7YA 4HOYA 3E03A 5HJ5A 3G0DA 5IG2A 3VPSA 1ETUA 3A9RA 2QUIA 4QREA 4R2LA 1R88A 3H42B 4U2BA 1TIBA 4BQEA 1RQXA 4OK5A 2X58A 3H0KA 3H0EA 3KYDA 1T36A 1SBYA 3QFSA 4DLPA 2XCQA 5KNCH 5M5BA 4G0QA 4JP5A 2NVUB 3RIYA 1USGA 2C78A 1RAEA 4PYQA 2D0OB 1WY5A 3CW8X 2EEPA 4JNKA 4F4UA 5K6TA 4PV7A 1N5OX 2I3GA 1QCZA 1ZWKA 2B1RA 2NUPA 2Y1EA 3BSSA 3HDYA 3EAGA 4KQ1A 1F38A 1TM5E 1XU4A 3SWWA 3AHHA 4MIYA 4BBAA 2V65A 4B74A 3U5ZB 2WF7A 3I9OA 4YMGA 3G2HA 2ZIEA 2DYKA 3ADOA 4TWJA 4XUCA 1QTRA 1VHTA 5BV2P 3AI7A 1DAMA 3UXEA 4UE3S 3V1YA 5CVEA 4K46A 1LPOA 2H7CA 1D04A 4OX9Y 4NC9A 4CM8B 3GJ4A 4FFBA 4PLHA 3SXUB 1ML4A 4ZZIA 2NZXA 1P60A 3MLEA 2J3EA 2BGRA 4FFSA 4PQYA 3REGA 1ZHOA 1XFAA 3PQ5A 4XQEA 5JNLA 2DCUA 2EF1A 4QOJA 1NGSA 3GJ6A 1K97A 1UT6A 3PDWA 2LV8A 3E1GA 1KAOA 3T0IA 1SCJA 4JR0A 3VHLB 4KOAA 1TGYA 3EK2A 2CD9A 1OAOC 1I6LA 1V16B 3DBIA 3MCTA 2XUAA 3K0FB 4PHFA 4OBEA 4RZIA 1GWNA 2IYSA 3AEKB 3WGZA 3L2OB 1YQTA 2OV4A 3HPRA 5E8RA 3ND8A 3TJMA 4EMSA 2R3SA 1G291 2WIGA 3HA3A 3S8YA 2DQYA 1L5WA 1S2IA 1IEXA 1AX9A 1Z2OX 2AFIA 2PX0A 1RBMA 2WM3A 3DUFA 3N75A 4EP1A 4DA4A 1HTTA 1T2FA 3ECCA 2VPPA 3EH1A 3HI4A 3O84A 1BCRA 1AZWA 1EKXA 5KJ6A 5JZVA 4JHXA 1JKXA 2BF4A 3HU2A 4M36A 3QH4A 3PR3A 5K3SA 4W1QA 2D8MA 3WDKA 4PGMA 2UUAB 1AKEA 4ACBA 2PLRA 4L7QA 4RS3A 3ESZA 2BZSA 4C22A 3CE6A 1JR3D 2EARA 2X8LA 3I1YA 1E18A 3LRTA 1Y0BA 3K0AA 2AZMA 3AWDA 1JEQB 3FZNA 4PR3A 3WLLA 2E87A 2EKZA 2DVMA 2XX3A 4A0RA 1U9ZA 4C76A 4H7EA 4MTLA 3VKGA 1GYRA 3AI1A 2H2AA 3DKVA 2DLNA 3FHCB 4M9ZA 5BO5A 2OQIA 1KDZA 1ZCFA 1U7TA 3QVKA 1AUOA 1L8XA 1YJBA 3U09A 3D8NA 2H2DA 4WZ6A 4GNRA 2F1OA 5ADWA 5DTRA 4KLZA 1U04A 1N8TA 2GVZC 2YHBA 5KCZA 2WE7A 3D6UA 2FDRA 2Y66A 2Y77A 3D54D 3N39C 1VLLA 4YGXB 3REQB 2PZAA 3UHAA 2FZKA 2Y1XA 2OLJA 1R10A 3DEAA 1E2HA 3KRTA 3LVQE 3QKUA 4FMDB 2XV1A 1BSVA 3GPBA 2Q2OA 2ZIXB 5TGZA 5C37A 3U7FB 1RC0A 3NHSA 3SIXA 2IODA 2VNAA 4I46A 1ZGCA 4PHTA 5GWXA 2PFKA 3NAGA 5JBNA 3CGWA 3DQZA 5DNYB 2NPOA 1U8YA 4QOEA 3C3BA 1IRIA 2G25A 3AKCA 3O9ZA 1G3QA 3RSHA 2DUMA 1QX4A 4UM9B 3H1EA 4UNPA 3ZV3A 3UO8B 4PYOA 3G2MA 3B6EA 5FRDA 3OJ0A 3I2HA 3K6SB 4X85A 2JH8A 2WLTA 4MKRA 3K32A 4OU5A 4J90A 1CP2A 5DN6A 4Z54A 3CIOA 3DCYA 1PQYA 2VQEB 4KIFA 2V7BA 3P5BA 3UWDA 1GG8A 1MB4A 4JI2B 1MO3A 3V6MA 4OU4A 3OWHA 2HQ1A 2PUEA 1C3EA 5G1PA 3B89A 4AUMA 1MJHA 4WLNA 3EMDA 3A10A 4ALMA 1P3Y1 3ILYA 4B9EA 1ZSVA 1QRTA 1QZ3A 3E1SA 4LJKA 2TYSB 3QTLA 2I91A 1Y6GA 1XAGA 4KI0A 4EPWA 3AEUB 4TM7A 4B87A 4BX9A 4Q4JB 1XVVA 1HFWA 4OQPA 4QPDA 2ZIFA 2HMYB 4TQUS 1H2AS 1PKEA 1GCUA 3OQIB 4M9CA 4P6VF 4Q9KA 1HDYA 3DKKA 4A92A 4YIHA 1J1UA 3JQAD 4H3SA 1CETA 5L4SA 3IR5A 4K9NA 3VYWA 1LFDB 4URWR 1KVRA 2KLBA 2W6CX 3V7WA 3KEFA 1G3IA 1NJGA 3DFZA 2QTHA 3FBTA 3FLEA 4Y2YA 5TC4A 5LQKA 4BV2A 1CFZA 4OLBA 2WU3A 2ZRNA 1OE0A 1YB7A 1EEHA 4MUGA 1JH8A 1QHXA 5YASA 1WZCA 3S28A 3D6AA 2GD6A 4ZEXA 1QH0A 2WSSA 4C4TA 2X5JO 1JQJC 1E89A 1MQ9A 1QIEA 4JOBA 4X5OA 4QJIA 4YRQA 3CSDA 2O1EA 3DV0B 3JVVA 3USZA 3ETNA 2BP7B 2XBLA 3F1LA 2J9XB 3N1UA 3Q8XB 3PXGA 3ZPXA 5I5EA 4B6FA 2YNMC 2O7SA 2GS9A 2Y0BA 3HABA 3KFXA 5BYJA 4BWGA 5DHUA 4EKIA 1JQ3A 4NICA 5K7SA 4R3WA 4DA7A 2HNAA 3PFWO 3HY3A 5MF6A 1VGVA 1FFBA 3MXTA 1WB4A 3DTYA 4S24A 1RQNA 1ORIA 2C4HA 2O9JA 3WS7A 2J3JA 4Y6QA 4C2AA 4D9IA 3GP8A 4P4TA 3KLMX 2C59A 3AR3A 4D92A 4YUYA 2W6ZA 4Y98A 2YIJA 3IEXA 1GTZA 1QE5A 4ZMBA 2GW4A 1B41A 5CTAA 4KACA 2QD1A 1GGVA 3IO5A 1BGWA 2HIGA 5CEFA 4KIWA 4WA8A 2BBTA 4ZYTA 3Q3GE 1NXTA 1K0UA 4EGCB 1FZTA 2PQ6A 2ATEA 5CG1A 4BFLA 2PCLA 3RBXA 3RUHA 2IY7A 3O2JA 5LP6C 2NXCA 3WV4A 4ER6A 3GPIA 4IJKA 1T4CB 4DNQA 2LTAA 4AP6A 3GRPA 3AFHA 4M55A 5DHPA 4BTLA 4ZDKA 4JYZA 4Z9AA 3ZU4A 1AV7A 1BQ4A 1RZ3A 3RVLA 3V9AA 3X3HA 4C6SA 4DCGA 3KB6A 5JJLA 2A9PA 4FNAA 2VUHB 4RHCA 5A62A 3DBVO 3J80A 3EWNA 3BT7A 2IXDA 3AM4A 2L82A 4CV2A 2L2QA 3RS7A 1OI4A 3A1FA 2HKIA 4GKBA 1BHQ1 1LBHA 1NZFA 3DCJA 5ABPA 5HJ7A 4RZXA 1Y1QA 3SE7A 3CWZA 4YT8A 1TTTA 3LQKA 1ADGA 3OPVA 4DVGA 3TF5A 3EN0A 4X8HA 2VPTA 2ZR0A 1HORA 1HA3A 4JC5A 3B1VA 1W8IA 3LAWA 5K8LA 3X2EA 4Q4DA 5JFGA 1IMJA 1E3IA 3VGPA 3ZDYB 4B79A 1OTXA 3SI7A 4HNHA 4CKWA 1B8PA 2CY0A 3JWHA 2OZVA 5BNIA 1E7RA 5FX2A 1EZ1A 2KMLA 5JWHA 5NULA 3SSOA 1LF5A 4M88A 3C3WA 2E4AA 2XSZD 1QZZA 6PFKA 3MIIA 1TF5A 3W06A 2CC2A 3I6ZA 3R7LA 4QG3A 1YZVA 2ZUSA 1TI7A 1Y4UA 1ZK2A 3C3DA 2WTMA 3I9FA 5LYYA 1E4EB 1MX1A 1RQ2A 3D7RA 4G89A 5EL0A 4O4JA 2JGIA 1VL2A 4BLOA 1L3BA 2QD3A 4QL3A 3RYCA 2O0JA 3OZXA 4GW3A 5AXBA 2CHVA 1JJIA 2IKSA 1C2TA 3N7AA 4KGZA 4UQPA 4CGYA 2RG1A 2IHZA 2BFBB 1QDUA 3UY4A 2F43A 3KVYA 3RIGA 4RTMA 3C6BA 2RKBA 2UVDA 2CK3A 1OI7A 5B53A 4BKRA 1HURA 1T2EA 2OAGA 2H63A 1GD1O 2XTJA 5LMNB 2YN0A 1ODLA 4M9RA 5FO0A 5LIPA 2NSHA 5E1MA 1V25A 2EX4A 4OL9A 2D3WA 2QW1A 1IOVA 3QQPA 4OXIA 1G4HA 4LV8B 2FP4A 4L4ZA 4M3NA 3TIFA 2Z1NA 4JB8A 3BMOB 2A0KA 2MSCB 1ODSA 2JVIA 2XMPA 3LO8A 4LMBA 5IN5A 4K7JA 3U6KA 2WB2A 5EKUA 2GVNA 2EYQA 2F9LA 2ZWPA 3PIDA 4ZDIA 3EDMA 5TGDA 4Z4QA 2B2XA 3SDSA 3NBYC 4O2BB 1LNZA 3VHRA 5F3RA 2YW9A 3NHAA 4R83A 3S2IA 2A30A 3WBBA 3HY4A 3OQVA 4MS3A 3BD6A 3H75A 5ERXA 4KR6A 2VHWA 5G53C 1SVOA 2VNIA 5DNEA 2P9JA 1XQWA 3VZBA 2OB1A 5JFTA 4JT2A 5G02A 2G5ZA 4NPAA 1QFXA 1USIA 3GA7A 4PC7A 4U02A 4EATA 3FYUB 2FSIA 5I9MA 1AMUA 4U2FA 1GAQA 2R65A 2N0SA 2G1AA 2EDAA 2WVJA 5DHRA 3VR3A 1AKVA 3FGOA 2Q4DA 4DYHA 2REQA 1PK8A 1GY8A 2EDCA 4ZAVA 4K0KB 4HH3C 1GPBA 1KK2A 3T0FA 1CUFA 4HXYA 5K20A 3TZEA 3TUZC 5B1IA 4RKWA 5FOXA 1ZNYA 4KWCA 1I2AA 3FA2A 3BIOA 2NZJA 4NZNA 3IX7A 1ZR2A 2VT3A 2ZTMA 4F4DA 5K51A 4YAOA 2WA1A 1QGZA 1XD2A 4GFDA 5F2NA 4OXKA 4XTRA 3UGTA 5G4LA 5FH9A 2QXYA 3FWPA 4KUGA 1ICEA 2O8DA 4C21A 1BAPA 3TCXB 1YRQA 4GPZA 5JS2A 5I7HA 1M3SA 5CDFE 2QR5A 4M6WA 2P30A 2VP2A 3N86A 4Q7LA 5DTEA 4RH1A 4F6CA 1M33A 2QMZA 2ZAMA 3LC2O 1PTJA 4XW2A 3SR3A 4CLOA 4XWKA 2ODPA 5DLYA 4AUEA 4G1UC 2VDMB 4DUGD 2H29A 4J9UE 1KI6A 5LXTA 1P4GA 3BGWA 1IBCA 3V5NA 1K98A 4HRXA 1XXHE 4O1MA 1ZK3A 1HQYE 4Y2UA 4MIKA 2FLKA 4LSWA 4ZO9A 3PHBE 1LDNA 4C7XA 3WKAA 1ZR4A 1YZGA 1CDEA 1PGQA 2O1WA 2PY6A 3OPXA 4H3HB 4Q03A 5AO9A 5J2UB 4QC2A 5DBGA 3SAJA 2LDBA 4W9NC 2IL1A 1M2OB 4JJGA 3NXKA 2HHHB 3HB1A 1TVMA 4DIOA 1RVDA 3A32A 4MUJA 5LZ8A 1SMKA 1LJUA 1BH6A 1TD9A 5FAXA 1JKMA 1U7XA 2BHRA 5TS2A 2BRUC 3HDVA 1QIDA 3GRZA 1YF3A 1EDZA 3N28A 3F4BA 4M0KA 3L4JA 4MV5A 4KSYA 5KKAA 1YZFA 4MI1A 5CFZA 1DKOA 1JDUA 1RLUA 5ERGB 4BNIA 1L5ZA 1VYUA 4HF7A 5EFOA 1Z7YA 3BK1A 5TSDA 2ZJ5A 5ALZA 4FT2A 5F21A 4B6SA 2ZYIA 1VKJA 3JYPA 3IVRA 4L0DA 3DZKA 4H6XA 3D4PA 4TYWA 3WGKA 1KQNA 1IVNA 4DDKA 4CCSA 2BGLA 1EU1A 2O2SA 2QE7A 2YV5A 4IIJA 4PYNA 1G17A 3H1PA 3RC8A 3K70B 3F8TA 1RDFA 1CFJA 3OSUA 5E6RA 4DG5A 1E9RA 4PQFA 3UB4A 5JEEA 1Z08A 5IVDA 1MLDA 4RQBA 3T0GA 3U0BA 4RVFA 2JD1A 3ZY2A 2AW5A 4F3TA 2F00A 3UYLA 1NX9A 3AVXA 3H83A 4YJ2B 3SR0A 1T13A 2V3VA 3QVTA 4MRMA 3HXQA 3IUEA 4ENRA 2CVHA 2JGNA 2JGLA 3F49S 3P1JA 3FPHA 2Q27A 4EEKA 2ADMA 3R9XB 1C9NA 4F8JA 1SXQA 3ZGYA 1N3IA 1VSTA 1WVMA 2X7XA 3H2HA 3O47A 4J7XA 4LRQA 5EN4A 4AZVA 3NAZA 4PWZA 2SBTA 2XI4A 1PVDA 1DKPA 1A9XB 4OMDA 4OLJA 4TKLA 1JQDA 3H2YA 3JQPA 3F0TA 5LZ2A 2XNCA 3WWZA 2XCSB 2XT6A 3BE6A 1F0KA 3N05A 3PTLA 4YXFA 1FYXA 5T4FA 5EKSA 4FLFA 3EQ9A 1ZIYA 2I1VB 3FCEA 5JS8A 4AJLA 5KNCD 4OXXA 4AKSA 2YJNA 4ROSA 3UMMA 2DQKA 1MAAA 4S04A 3I2KA 5IUNC 1TPYA 3QELA 5B3JC 3K30A 4WN9B 2Q9CA 1TVKB 4YTEA 1Z8FA 5JS7A 4Y2QA 3UAOA 3LT2A 5A7HA 1J8FA 4EPYA 3MELA 3HWSA 1X70A 1L7NA 2R5NA 4B75A 4IQFA 4JAVC 5LMUB 3EMOA 2C5GA 4AZTA 3ICWA 3K0CA 4C7BA 4DL9A 2YDYA 4O2AB 4CT4B 3LI2A 5KQPA 4XQ0A 1DOHA 4CI9A 3T3OA 1ONSA 1U1GA 4YREA 3O8DA 3P2KA 4EG6A 4KZPA 4O2RA 5J23A 1Y42X 1YUMA 1CQPA 2QMHA 4RK4A 5T5QA 3ZE1B 4EAQA 3E0XA 3TDKA 4C5AA 4ER5A 5AVRA 2BSXA 2UZ1B 2BEWA 3H9CA 3NIGB 3IBSA 1SBTA 3HB4X 1Y3FE 1AQUA 2CF6A 3LWZA 3OCZA 3UMCA 2EQ5A 4EHAA 3SBEA 3EQZA 1ACLA 1ZN8A 4LZNA 3GVPA 4OYYA 2BT4A 2XUFA 1HDRA 3VU1A 2OWDA 1PFVA 2B30A 2RGDA 1GPYA 2PT7A 1N32B 2GYVA 1U0GA 3DLTA 3CJRA 3EIOA 3PEUA 3IVAA 3R6GA 4QNRA 1YU6A 4A6PA 5DEIA 5HVNA 2AOUA 1H0HA 1MRSA 2AXQA 4JJKA 2UXDB 4LQDA 3TSYA 1ZPDA 2O59A 5D6OA 2YWRA 3NPMA 5AH0A 3VDRA 2IDKA 4DNFA 3UPUA 2O3JA 4KFSA 1CJCA 1PGJA 3S2GA 4L4XA 5AM2A 2HSZA 4IH1A 1L5QA 3PC3A 4RHUA 1U2GA 2XMRA 3NTVA 3PVZA 2IHYA 5DN9A 2Q3LA 4JNCA 1T0PA 4K6OA 5F51A 2OPBA 3CMCO 2HLHA 4G5SA 4ZGWA 1RYZA 4RHXA 1QMPA 1BWPA 3PUWA 1P17A 1YI1A 1H66A 2W2MA 4PRKA 4KRGA 3UJHA 1XCJA 3OOSA 3ZXUB 4INZA 5E8JA 2ODAA 4ZAXA 4RVOA 2BI4A 1GEEA 1DLJA 1E4OA 1UPXA 4DRZA 2PUBA 1NV8A 2W0SA 4CIAA 4HS4A 5ECGC 5HKKD 2QSZA 2OGZA 1S2MA 2P41A 1YE3A 4G6ZA 1E8MA 1T0BA 2FWNA 2IWHA 1VG9B 5DBEX 1WPQA 3H5NA 2Q8NA 3AU9A 1LTKA 2H92A 1PJSA 1SHTX 3W1EA 1FL9A 3IILA 2E82A 4FYYA 3ZWAA 2OOSA 3G68A 3GLHE 3GCGA 4NZYA 4Y6OA 2M6KA 4ZAWA 3UBMA 2WKPA 5FNZA 4Z3DA 4FT4A 3WL4A 5SZJA 5FB3A 5KYTA 3NVAA 2PNJA 1EFVB 3SEAA 1JR3A 4MB6A 5KVCA 2I78A 4IWNA 4PAQA 4HYTA 4KFRA 1QPBA 1V5EA 1QIJA 1FSSA 3MRXA 1T34A 4JJAA 3UW3A 1Z6TA 3R5KA 3TTSA 3C6ZA 1FNCA 2OAEA 5COQA 1UT8A 1IB0A 4MZDA 3NKLA 5AVOA 2C2ZA 1BW9B 4DCSA 2NSLA 1YRYE 2V7QD 1O5IA 3I3SR 3Q88A 4F7DA 3WSVA 3BIXA 3WK5A 1M9NA 1K75A 3DO6A 4BVHA 2Q41A 4NIMA 4QDJA 4PX5A 3O1JC 1U2SA 3PK0A 4PANA 5B7GA 2H5EA 3RTBA 1EVLA 4QPCA 4E5SA 2JFVA 4QYWA 1Z25A 3M6WA 3PLNA 5CNJA 4YIKA 3TOCA 4F5ZA 4H1WA 2DHEA 3PEVA 4WFIA 3EPHA 3C7DB 1IMOA 3JAWB 3WGVA 4PZLA 4R2HA 1R0KA 5TEWA 5CW2A 3AR2A 2C2WA 5ALIA 3UMBA 2B4QA 2A7XA 1D6NA 2FEOA 3EZ7A 3KLPX 5I4KA 3JYQA 2W9XA 3Q85A 4N5LA 1WRBA 2RG7A 1PR3A 4G36A 1FP1D 4X1IA 4YAFA 3WXMA 1RXVA 1Y6ZA 1P45A 4Q37A 2G70A 1QF6A 3JQ6A 1P5RA 2HDHA 2QF7A 2OGTA 5C8DA 4CLRA 3UA0A 1ZVJA 1KI3A 2WY2D 2J6IA 1RJEA 1QO9A 4PBSA 1T9GR 5AI5A 5EE9A 1CULC 3V97A 1FFXB 1T4GA 3KLBA 4DZTA 4G5QA 2G5PA 3AVTA 3BK7A 4IX1A 1CYDA 2Y1FA 3C1TA 1RQGA 2O48X 2Z5LA 3FJYA 1U4SA 3C2QA 2VTBA 1GCGA 4ZT5A 4Y2XA 2J5RA 3G7NA 3UBTA 3RS9A 2CLMB 3ZCSA 2XGMA 2WJZB 1NPYA 2G77B 4WECA 4Q4HB 3LQRA 3STYA 1ZGAA 2R8YA 4OA8A 1Z7BA 2FEWB 4HI0E 3A58B 3R7AA 4OQNA 4WJLA 3BFVA 2Y0PA 1WF6A 5BVGB 1NDUA 1JIKA 1Z35A 2AC2A 5T8KC 3S2EA 3IQWA 3JQAA 4E1AA 2FN7A 4BFXA 3ANYB 3C7KA 2J9ZB 3D3QA 5HUHA 3R8CA 2QTWB 1W30A 4P5PA 4BNNA 5K05A 3DXFA 4EJMA 1YK0A 2WT8A 3GR6A 2PT5A 1V47A 3BXEA 1ZOIA 2B5VA 3OTHA 3C43A 1VHDA 3E4CA 3BHNA 4L9AA 1DAHA 1SQ5A 1TB4A 4HBZA 4LTDA 2BKVA 4QZVA 5GAJA 2RHTA 3TM4A 3U61B 1Z28A 3SSMA 3LLSA 4KIJA 4MQEA 2OAP1 2I4TA 1DUVG 3I5UA 1MEOA 2VZ8A 3PQ4A 1SIOA 5TMBA 1IXYA 1ULZA 5KMGA 4GL4A 3W8RA 5DF1A 1TPZA 4BMZA 3OFJA 1U63A 3LDFA 3KSMA 1HEIA 1QAMA 3HZOA 5THKA 5G0WA 5C8ZA 3GLFB 1CUSA 3D0RA 4XOIA 5IBCA 4UBOA 1RLMA 2BL4A 1JW9B 4W99A 5C9ZA 1VPDA 4MCAA 2W0MA 4DR6B 5EZYF 3HUEA 1E6LA 1E0SA 1ZFNA 3IUYA 5IM5A 4TTVA 4EB3A 2MU1A 2PXXA 3L7KA 4GLJA 1SU7A 1K89A 3H99A 2AZTA 3OURA 3IULA 4II7A 5AHRA 1KZ6A 3GEIA 4OV6B 4CKCB 1YRLA 2I2CA 2QL5A 1VB3A 2YZGA 2HO5A 1PWYE 5D01A 3DE2X 4KQ6A 4DJFC 3ISVA 1CDZA 1WMSA 3MM4A 1V71A 4I1OA 4UJ3A 3PX7A 1Z6QA 2XZOA 2XCTB 2ZSEA 5BR4A 3ONDA 4RHEA 4NFSA 2PQ0A 3HCCA 1FF9A 1X1AA 2IA5A 2Y6VA 1JHVA 4MVJE 4D9NA 3HKCA 2BGIA 4CMAA 3VR6H 1KSFX 2GDZA 3AUJB 3Q3HA 3DCIA 3L41A 1G20E 5AJVB 3UYKA 2NU9B 3GD7A 8MHTA 5K9ZA 1II8A 2CEAA 3D1LA 3ZHOA 1R0RE 3ZGXA 4CG1A 4G5OA 5ALMA 3VZQA 4C14A 3SQNA 3VNUA 4NL4H 1QUFA 1MOPA 1ATIA 1EFRA 1GRVA 1Y89A 2GYUA 2YFQA 3H1BA 4LRXA 4P5EA 1SUWA 5BR1A 6AT1A 3NS7A 4NCJA 1HT2E 3TL6A 2VPXA 4P4SB 1SC9A 4B84A 5BWBA 2C7VA 1ADCA 1U2QA 4DIMA 3EZNA 4FEEA 3QI2A 1CJSA 4EQ6B 5KBYA 1GKUB 2G6BA 3X2FA 4RABA 2C00A 1VHLA 2LUOA 1PO7A 2RHBA 5AI4A 2QJTA 1XLWA 2VEDA 4L0CA 1OJLA 2W5UA 4HSEA 2OO5A 5KYUA 2X0KA 2XYRA 4HG2A 1OB5A 1OZAA 1E2DA 2KBFA 3OM0A 2OHXA 5E2IA 5CA0B 2H1CA 4OB7A 4N7MA 3RARA 3U40A 1QPGA 4JLKA 2XSZA 5FUMA 2PGNA 4K9OA 4MQFB 4O4LB 2VP4A 2VT7A 3JYOA 3VUEA 5E7IA 1LVHA 2HPAA 3QVVA 2W8BB 4IYRA 1THGA 3RRNA 4D9EA 3B82A 4R71A 5DO9A 1TRKA 4PSDA 1E4VA 2I52A 4XVHA 4RCVA 1XG5A 2NTJA 1GFIA 3RC1A 4P5DA 1KMCA 5EWJB 1N0IA 1NKVA 2QS9A 5J3JA 1IN1A 4TRJA 3JCZA 1V45E 2FXVA 1XMSA 1HZJA 1Z8HA 2PX3A 2QD5A 4I6EA 1I01A 3VO8A 4CNQA 4EGJA 1VIMA 3I9LA 2B8NA 2XVMA 1QJ4A 2YS7A 1QB8A 3BZWA 1QV6A 1MTOA 2RDMA 1EQUA