1IHOA

Crystal apo-structure of pantothenate synthetase from e. coli
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
282
structure length
282
Chain Sequence
b'MLIIETLPLLRQQIRRLRMEGKRVALVPTMGNLHDGHMKLVDEAKARADVVVVSIFVNPMQFDRPEDLARYPRTLQEDCEKLNKRKVDLVFAPSVKEIYPNGTETHTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLVQPDIACFGEKDFQQLALIRKMVADMGFDIEIVGVPIMRAKDGLALSSRNGYLTAEQRKIAPGLYKVLSSIADKLQAGERDLDEIITIAGQELNEKGFRADDIQIRDADTLLEVSETSKRAVILVAAWLGDARLIDNKMVEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PANTOATE--BETA-ALANINE LIGASE
publication title The crystal structure of E. coli pantothenate synthetase confirms it as a member of the cytidylyltransferase superfamily.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 90
structure length 282
sequence length 282
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2001-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 1ihoA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1ihoA01
4MUFA 3RK0A 1NUPA 1JEEA 1WOYA 3ELBA 2CT8A 1NI5A 1YUNA 4KPUA 4R2LA 5KHAA 2XRZA 1F4LA 1LI7A 1OD6A 2DR2A 2O5RA 1KR2A 2CV2A 1K97A 3CLSD 2J08A 4U7JA 4WNYA 3CLTD 3IMEA 2QUJA 1WZ2A 2E89A 2D54A 1K92A 1IH8A 1O0CA 3INNA 3H9BA 4ND7A 1O96A 1NP7A 4YMIA 1I6KA 5LLTA 4PBSA 2QJTA 4PBTA 4A91A 2RD2A 1QQTA 4R0NA 4WSOA 1OWNA 1KKUA 2OV4A 1PG2A 2DETA 3IMGA 2AZXA 1KQOA 4U8HA 2H2AA 1YUMA 2J09A 1GTRA 1N3LA 1JZSA 2WQ7A 1Q77A 3SP1A 3H9CA 4MW0A 3U1VA 4EGAA 3AL0C 4XFJA 1TYBE 3TQIA 3PXUA 3X1JA 4J75A 1IFXA 3TS1A 2A7XA 1PFUA 3P0HA 1JIJA 4MVCA 2AG6A 3CLRD 1OBHA 1MBZA 1Q11A 1GZUA 4DJAA 1QU2A 3IDFA 4MVWA 4NDAA 4YP7A 4MW5A 1ZH0A 1ZJWA 3FHJA 3L93A 3RHSA 1EFPB 3MLAA 4ZT4A 3IODA 2DERA 3QE4A 1WQ3A 4H3SA 4RPIA 3H99A 2IJGX 4G6ZA 2CYBA 1EUQA 4DDKA 1IRXA 5KCMA 1JGTA 3COZA 4KR9A 2J5BA 5LFAA 1WXEA 2WSIA 4OJMX 4ZT2A 5TEWA 1N77A 3CLTC 4ND6A 4MW2A 1N75A 3HL4A 2QTNA 4EFKA 3ND5A 3SZ3A 2CSXA 1WY5A 3KT8A 3H97A 1IVSA 3F3MA 5K0SA 3LCJA 4EG8A 1N1DA 2GOYA 1M8JA 2IP1A 2E18A 1ULHA 2AKEA 4KR7A 4Q93A 3JXEA 1V47A 3RBAA 2O8VA 3VRHA 1EUYA 5EKDA 4MUNA 4ZT3A 4CT0A 4G5YA 1MJHA 2QJFA 4CDNA 1OWPA 2A4MA 3DPIA 2ZUFA 1N2GA 3DV2A 1BS2A 2E21A 3X1MA 3L92A 1G59A 1IQRA 3D6UA 4MW4A 1EFVB 4YP5A 3HV0A 5DEOA 3CLRC 4AQ7A 2YXNA 2PZ8A 2Z09A 1M8KA 1PG0A 3N8HA 3FI0A 4J76A 4MULA 3IUBA 1ZH6A 1JMVA 1MRZA 4NZPA 3UY4A 1N2EA 1VBMA 2QTMA 3CLUC 3NBKA 1I2DA 3PNVA 4MUIA 2X0KA 3MXTA 1COZA 5AHWA 1WQ4A 1VL2A 4ZT5A 1JILA 1SURA 4NX2A 2V0GA 2QUKA 4OUDB 4CQNA 3FETA 5JBNA 1OWOA 5DK4A 2VTBB 5BNZA 3D6VA 3AKZA 2H29A 1QU3A 2QUHA 3H05A 1KQPA 1WXGA 4HPWA 1WXIA 2HMAA 4MWCA 1V8FA 4RUKA 1KQNA 1WXFA 3TNJA 5J58A 1TFUA 4MWBA 3N2YA 1O97C 1GAXA 1PFYA 3IOEA 2X3FA 5TS2A 3IVXA 1I6MA 3A4IA 1XJQA 4L2IA 3TZLA 1R6UA 3MUEA 3PNBA 1N78A 4ZCSA 4DE5A 4PBRA 4ZCTA 3HZRA 3ND6A 4EG7A 1N2OA 4U63A 3N9IA 3NBAA 4DDMA 5H16A 2DXIA 3AFHA 3P0JA 3MLBA 4EG1A 2CV0A 4MW6A 5FO1A 2CYAA 1Q15A 3KT6A 1RQGA 3CR8A 4MUHA 1O0BA 2CV1A 1I6LA 4AS1A 1KAMA 4KPUB 3P52A 3AG5A 1MAWA 2X1LA 2Z08A 4F4HA 2A1TR 1KAQA 2C5SA 4R2MA 1MAUA 1XNHA 3ZXSA 1VBKA 2V0CA 3BL5A 3RFFA 3E27A 5LM3A 1T6YA 3I05A 5IJXA 3K32A 1N2BA 1NUSA 4QBTA 4BWVA 4MUJA 1QJCA 3CLSC 1QRUA 1O96B 5J5AA 3K9WA 4JYZA 2X1MA 1FYDA 4GRIA 1J1ZA 1UFVA 3G6KA 3PNYA 1FFYA 3IH5A 1KORA 1GPMA 2A1UA 4F3RA 2PG3A 1HYBA 3CVYA 3ZJTA 3COWA 1J09A 4X0EA 1M1ZA 3G5AA 1JHDA 4K0RA 4NAUA 2DPLA 4MQ6A 3PRHA 3CVXA 1PFWA 4HJXA 4MAFA 2QUIA 2B7LA 3M5WA 3NV7A 1JEDA 3FIUA 2CFOA 2ZUEA 1JIKA 3DO8A 2JANA 2PFSA 4MW1A 4FZJA 3C8ZA 3IMCA 3G59A 1MB2A 4CDMA 1P7PA 1M83A 1A8HA 2WB2A 3MMXA 1TYAE 4ZCRA 3KFLA 1K4MA 1NUQA 3LE8A 3CA8A 2PZBA 1O6BA 5FO0A 5F23A 1R6XA 3SEQA 2GM3A 4DNXA 4MUGA 1MC1A 4XFDA 2DLCX 2GKSA 1JZQA 4MWDA 1EJ2A 1KP2A 3S3TA 1OWMA 2JAXA 4E1AA 4EG4A 4HK4A 2NSYA 3RJZA 1D2RA 2ZP1A 1O94D 3QTBA 3KT0A 5FNZA 2WQ6A 1J70A 3VU8A 2RE8A 1K4KA 2D13A 3IOBA 1NUTA 1NUUA 3FDXA 1EXDA 3IOCA 1KH1A 1G8GA 4MW9A 3Q10A 1U3DA 2PXHA 3GLVA 4PY2A 1GN8A 3HMQA 3FNRA 3A05A 3TZEA 3ZIUA 1IQ0A 1TYDE 2J4DA 3RK1A 3VGJA 1OWLA 4ARCA 4KKVA 1KH2A 4ZCPA 4ZCQA 5KWVA 1TQ8A 1VLHA 1EFPA 3KT3A 2A1TS 4MW7A 5HUHA 1F7UA 4JXZA 5DASA 4DDHA 2CYCA 3A04A 1J1UA 2YWBA 2NZ2A 1MB9A 5DB4A 3FH0A 1T6ZA 3SYTA 1YIAA 5H7XA 1O95D 1S4MA 2EJCA 1H3EA 2G36A 4HJRA 2QTRA 1H3NA 1M8GA 3HFJA 1G8HA 3QTTA 4YBRA 3ZJVA 1NYLA 3FG9A 1WKBA 4QRDA 3A2KA 3IVCA 1CT9A 4ARIA 1X6VA 1XNJA 2YWCA 3FOCA 2EL7A 1T9GS 2PIDA 4QREA 4DLPA 1N2JA 2HGZA 2A86A 1JECA 1U0BB 4ZT7A 4MUKA 1LW7A 3ND7A 1O94C 1U7DA 3ILVA 1YI8A 1T6XA 1OBCA 1H3FA 3P0IA 1F9AA 3UMVA 3ZJUA 2R5WA 1PFVA 3DLAA 3N05A 1G8FA 4MVXA 3LOQA 4EG6A 4EG5A 4YP6A 2BTEA 1R6TA 1B6TA 4GU5A 1EFVA 2OQ2A 3HGMA 4NATA 3AG6A 3SZGA 1J20A 4JZYA 3GUZA 4G5FA 2YY5A 1NURA 4S1OA 1F7VA 1KP3A 1XNGA 2A88A 2BYTA 3CLUD 1H1TA 4XSVA 1WJGA 4NAHA 2CUZA 2IELA 2HZ7A 4MWEA 3OTWA 4L2IB 4I6EA 4JFAA 4K03A 1EE1A 4I6JA 1T9GR 3COYA 1YULA 1QNFA 3X1KA 1Q19A 1QRSA 3ZXIA 3Q4GA 5HUJA 3COVA 1QRTA 4P2BA 1LI5A 1IQUA 1O95C 3FY4A 1KH3A 1U7XA 4OUDA 3ZGZA 5IHXA 1WXHA 2I1LA 1ZUNA 5TGTA 1X8XA 4I6GA 2VTBA 2TS1A 4TS1A 3AIIA 4JXXA 2JA2A 4EG3A 2DEUA 1MOPA 2VXOA 1GLNA 2QJOA 3FWKA 3IUEA 4MUEA 1Y42X 3CVVA 1QTQA 1O97D 3CVWA 4KR6A 5J59A 4UZFA 1VBNA 1N2HA 1U3CA 3SEZA 1O5TA 1M8PA 5TEVA 1N2IA 4ZT6A 1DNPA 1GTSA 2PZAA 2DUMA 3IVGA 2Z3VA 3UOWA 3ZUGA 3ISJA 1ILEA 2D5BA 3SDBA 1TEZA 1YIDA 1TYCA 4UZEA 4EF6A 4MLPA 4Q16A 1JIIA 2A1UB 5K0TA 3GMIA 1IHOA 2XRYA 3UC5A 3OP1A 3Q12A 1NZJA 1J21A 3CVUA 4MVYA 3UK2A 5HG0A 2A84A 1M8FA 2E0IA 3TQOA 1NSYA 2J07A
chains in the Genus database with same CATH superfamily
1M66A 4JI4B 2GEFA 2WVHA 2QV7A 1RWVA 3JYPA 1GVHA 3OE1A 1JEEA 3HJTA 4EY8A 1W5EA 3EQ9A 3PR2B 3ELBA 1SIBE 4EY3A 1UPCA 4KQKA 5F7OA 1X7WB 4KE7A 2WPDD 3R9XB 2DTDA 1YNOA 4BLRA 3LHFA 1K97A 1UJBA 4GH5A 4E7OA 5TIIA 5BN1A 2CV2A 4YMVA 3F5SA 2R1TA 5KO2A 2PE5A 4GVPA 3RTEA 2E85A 2IU0A 1QBGA 5KNCA 3DMTC 2Y27A 2ZJ8A 4MV4A 4CI0B 2F4VB 4V03A 4ND7A 2QN2A 1AZTA 2IHKA 3TX6A 2P4HX 1HLFA 1PJSA 3DL7A 3F1LA 4LY6A 4UEJA 2LE0A 5KQSA 3WWOA 4HTAA 2WTXA 4KW7A 1I2ZA 1TZ2A 3KXLA 1QK5A 1T5BA 3AIKA 5K1ZA 3ZZMA 3NYRA 3RANA 3N74A 2FQQA 3LY7A 1AQNA 2HT1A 3S2UA 3V9PA 4BTLA 4XVCA 4QTTB 3LPCA 3IALA 3U2QA 2O6HA 4ZHQB 4DR6B 3T1HB 3W05A 3PXAA 1UKCA 2DETA 3HB1A 4AJIA 4D5GA 3JD2A 4HGNA 3W04A 2I71A 3R0XA 1F38A 4RSMA 1QDLB 2UAGA 2BJWA 5AOBA 2RH8A 4NABA 4MRMA 5IBQA 4DKXA 1T9BA 2GD6A 5C7LO 3NO4A 5LZ7A 4M0EA 3QHQA 3EZGA 3U1VA 1YJQA 2ZXFA 3M0EA 4YT4A 2Y8EA 2G8LA 3GBSA 5C1BA 1NZDA 1XWIA 4LI3X 5HUQA 3U13A 3UWDA 2MOKA 3TZQA 2UUBB 2ZIVB 2KW5A 2YUIA 4L0MA 4ZK2A 1WMEA 4L57A 3CLRD 1Z7EA 2XH8A 1Y3AA 4ESOA 1O3YA 4C0SA 1JSZA 4HLDA 1ZM2A 2ZYGA 5JRZA 1M6EX 3DG9A 1PS0A 4RHCA 4BLTA 4RVDA 3CZCA 5CG1A 3ABZA 5CITA 2A94A 2ATVA 3TDNA 4ZT4A 3EARA 3U4IA 1UODA 2IXDA 3IHTA 3T0FA 2REBA 3Q11A 1AHIA 1O2DA 1VPDA 1X19A 3JQ7B 4O25A 1LJUA 2X8LA 1PJ8A 2VBGA 2IJGX 3X1WA 4WXHA 2B0CA 1Z0UA 5DNVA 3DE6X 1YZKA 2I87A 2VBFA 4M9QA 1HQDA 3RYIA 4B6FA 3DBHA 3VAAA 3K4HA 5BV2P 4BGEA 1N77A 1NOIA 2GLXA 4ND6A 2GZRA 3TN7A 4R40A 5T3YA 2HMYB 4XB1A 1KL7A 1LPPA 4JELA 3E70C 4GKVA 3HV2A 4N03A 5HIJA 3W06A 4CLOB 1R0XA 4H3HB 3D6AA 5HCNA 3PU6A 1Z5GA 1FQWA 2C2GA 5JD3A 1M5RA 4IJVA 5TQ2B 3BJZA 3OZFA 3O7WA 5JFOA 3JQFC 5DSTA 3B53X 2BGIA 3FWPA 2E18A 3GJXC 3H65A 4ZU1X 3HU2A 1HNZB 3H2BA 4KFTA 2D06A 3O1IC 4NBTA 4XQCA 5FOSA 3SE7A 1T1RA 4Q1DA 4UTOA 2QX6A 1UXKA 2Q6VA 4C2UA 2JAPA 2BFWA 3GT7A 2Y66A 3PDIB 1JDSA 3UJ9A 5AUPB 1UQRA 1GGEA 3VV3A 1F4VA 1ZCZA 1Q95A 3ONEA 5FWAA 3ZWMA 3AM1A 4MVJG 1TUGA 1NQVA 1TI7A 2ZBQA 3GGGA 1YRWA 4HEJA 1QSGA 4RF3A 1N9GB 3UF0A 4TTTS 1ZNQO 4MGYR 4CLEA 1IN7A 1O8BA 1U1DA 1RAEA 3FPAA 3B5JA 3FD8A 3MPOA 2F8TA 1SBHA 2ZULA 4JUFA 1UK8A 4EHKA 1SK8A 3SVZA 3N2GA 1RAFA 1MJGM 3KB1A 2W4MA 1Z2DA 4CTOA 4JHXA 2G17A 1PL6A 3GJZA 3NXKA 1KOFA 5F5XA 2ZOSA 2V7UA 3GFSA 2HO5A 2Q5OA 2D3WA 4PYRA 2OLKA 3P26A 1Q3HA 1RWXA 4IIUA 4FM9A 3V1LA 1J1IA 2QN8A 2R86A 4YEDA 1E6MA 2RIPA 3T0GA 1H93A 3A9UA 2VZ0A 3L05A 2JAHA 3BILA 3ILYA 3CPSA 5EHQA 4DZZA 4QBIA 3OIGA 4ZVKA 5JJIA 1USIA 3VYSB 1ZU4A 2P3LA 4S0ZA 4J0HA 4FMCB 5HWSA 3OT1B 2H0RA 3T5GA 2X0KA 4A03A 4D3SA 2WV7A 2OC4A 1SCAA 1M3SA 1N2CB 1Z29A 1OASA 2O4CA 3H18A 4WT7A 5LMNB 4OBXA 2JGFA 2M2IA 2AFIA 3EYWA 5TVKA 2NW6A 1EFRD 2QUKA 1S7CA 2I4IA 1GPLA 2YWGA 3G0GA 1ZRMA 4M6WB 3V8BA 4HWGA 2XYHA 4WWHA 4Q39A 2QA5A 3ZUPA 5CA1F 2V98A 1BVHA 3KDAA 1JSRA 4JR1A 3N86A 4DUZB 3T4UA 3CFHL 2HX1A 3VZPA 4CVNA 5B5SA 2GK4A 3DOHA 3LL7A 2XUAA 4BTVA 1SHTX 3DAGA 3ZBPA 4KPEC 5B58T 3JPWA 1XTTA 4Q01A 4DJEC 2PGOA 2OGZA 1EESA 3IAFA 5C32A 5C4GB 2DQ4A 2XNHA 1C7RA 4MWBA 4Z4CA 4K3UA 4PPFA 1YDWA 1YJBA 2NVBA 5A6VA 1U2EA 1TA4A 2WVAA 2KLBA 1FRFS 1LFDB 3O8DA 1JQ3A 1E1NA 4HYTA 4O2BB 1BQ4A 2BGKA 1L7XA 16PKA 3NQ41 4GRAA 3T5MA 5LQDA 3TBHA 2E5FA 4CKCB 2VO1A 1QJ4A 4FEEA 3ADDA 3FSRA 3PNBA 5AK4A 2CSUA 3O1HB 3TM5A 1C8VB 1NJ2A 4R1OA 3UV6A 1DOAA 2B3DA 1P2DA 1MW9X 3FRJA 4R6XA 5E3IA 4EG7A 2PPVA 4RCZA 2I2FA 3B9PA 5CDFA 5C1PA 3WNCA 4RMJA 5DCLA 3NX4A 5IP5A 1TKRA 1YI0A 3NTUA 1CFJA 1VHQA 3NFRA 1KY2A 2TYSB 4XVHA 4E94A 5BWOA 1DUIA 2EYQA 1W85B 1EDZA 1S8AA 3B13B 4YAOA 3KQSA 3VV2A 5FPKA 5EQDA 4YUVA 1GEEA 2H5EA 2I78A 2JJ1D 2RHOA 3WJ1A 4ZEMA 2XKJE 3NHBA 3Q7TA 2JVKA 2AB0A 1YRQA 3A1VA 4BO8A 1NPDA 4EPTA 1XFDA 1CW2B 2I4NA 3AOEA 3C6ZA 1ZK1A 2I6UA 5EERA 1LTKA 4WVFA 1TU0A 3E27A 2V5VA 1T6YA 4DG5A 4V1CB 4G0PA 1S2OA 1JFSA 2X15A 4KTVE 4OHOA 1D1PA 1U1IA 3OFNA 2JFOA 3DW3X 2BZ1A 2YJ4A 3L46A 3OAAD 1YBAA 5EYPB 2DBVO 3GJ5A 4DR1B 1LU9A 1L5MA 7GPBA 4RW0A 1CUEA 1E0SA 1UBMS 3ANTA 3IO3A 3UUWA 3W5DA 3WIEA 1ABEA 2MSDB 3NGXA 4PINA 4FYPA 3RASA 1VG1A 2BBSA 2PZFA 2YJGA 3NHKA 4DZRA 5AW5A 1C9EA 2HV9A 3BFPA 1M7GA 1XRMA 2IHUA 4QBGB 2QZ9A 4D41A 1RKXA 1Z17A 3B8HA 3DE2X 3DFUA 1RDFA 1AKTA 1RVV1 2MHCA 3IBYA 4FMPA 3VNBA 1M1ZA 4UBOA 4IICA 4N6NA 1G8MA 4WN9A 1HSZA 2GK3A 2PT5A 4PAMA 2JFFA 1XU4A 5DGCA 3KTFA 1BDMA 4QT0A 5CVUA 1A8UA 2O2DA 4YAEA 5D01A 5DE3A 3A9RA 3RC1A 1D1SA 1W4BA 3M1LA 1BWPA 1UP7A 5FKJA 1XK7A 3HN7A 1QWOA 3OZ7A 4FT4A 2HGSA 2GN2A 4TMKA 4UPEA 4W1PA 4KN9S 1CQIB 1YR2A 2IYNA 2G4LA 2ZKIA 1AKVA 1ZG3A 3PHLA 5J5CA 3P2YA 1NLFA 2Z9BA 4L28A 1O5OA 1WMFA 4RM3A 1Q0LA 4Q47A 1NQTA 2IZOA 4ZFNA 1F2VA 1MEJA 3DT6A 3K9CA 5JT1A 4R83A 4F9EA 1RM4A 2HZBA 3D3EA 2V6IA 2G0AA 3GL9A 4HUJA 4M3NA 4LV8B 4M1MA 4R2KA 4B71A 4BO7A 4ECEA 4EHAA 1USUA 1JQ5A 2VQFB 4MTCA 4Z5XA 1Z8FA 5TY0A 3HCFA 1CR1A 3QXCA 4FNGA 3PK0A 3IILA 1XALA 1TEHA 2W00A 4GBMA 3T7RA 2C9OA 1UBJS 2WJ6A 5JSFA 1VI6A 1UZUA 4ZU3A 5FTJA 1W19A 1R6XA 3BMNB 4IINA 3D8UA 5EGSA 3UMGA 1PT6A 5K09A 3ZHCA 4V2IA 4ATNA 1QVZA 1FFWA 2WWFA 4YXFA 4H18A 1EWYA 1UXOA 4MWDA 4PZUA 2J6HA 5EE3A 4CTKA 6PFKA 2X8JA 3DOIA 1OWMA 4GBGA 4GMGA 3V2IA 2VHEA 2GYVA 4NOMA 4XWTA 3VSAA 1P9RA 2ORWA 3C39A 4IDBA 5C51B 3KYJB 1AG9A 2E6UX 2V55B 1JJVA 4I4TA 1PEYA 4OQQA 3ZZTA 4E13A 5CIYA 3GDHA 3PE4A 1CJSA 2V7WA 4G9GA 3PCRB 1F8UA 1NFFA 1GYRA 3PA6A 4TWIA 2FFAA 3D8NA 4KX3A 4RKWA 3ETJA 5JCOA 4B5KA 5IASA 2RARA 4MW9A 4O8ZA 2GBIA 2PXHA 3C3DA 4U39A 1KEKA 2C4HA 4RF4A 1XIVA 3LJKA 4BQSA 3K6SA 4IIHA 3AR6A 1ZK3A 2I62A 1PI3A 2CD7A 4M49A 3VKWA 5BSTA 3JZMA 2R6AA 4Y6LA 3DF7A 4KKVA 4CHGA 3ZOKA 4RTMA 2Z6VA 1QDUA 2XDQA 3G2MA 4MGEA 2JLRA 3OMWA 1A5BB 4EY5A 2X5KO 3IT0A 3KCNA 5FOQA 2WEKA 1YFJA 4TTAA 3R6WA 4CEIA 1JIVA 1U81A 4MUMA 2PZKA 5DASA 4DDHA 1CY6A 1Z2CA 1EUCB 3CH7A 3O1LA 3ZTTA 4KXLA 1XHFA 2QUBA 4I1OA 1YMQA 2IYWA 4L78A 4LA4A 4OSOA 2W22A 1AA6A 4OVKA 3TOZA 3II6X 2IPLA 2CVQA 1DL5A 5LP6A 1KDVA 1UQTA 2SECE 3ZDDA 3TVDA 1NJFA 5CUQA 5LQAA 3I8OA 5ARBA 1K88A 1S4MA 2BDUA 4RIEA 3DBLB 2ZRFA 4KK3A 4LDAA 1IOZA 2VSXA 4M0UA 2W5UA 3JZDA 1R18A 1ZVQA 1DKNA 2C83A 3HKEB 4JJZA 5CNKA 5FHRA 3DHNA 3H0KA 5FUBA 4Z1MD 4NF2A 2GCPA 1NYLA 4PC2A 2FPIA 1H2AS 3CIFA 1FS4A 3L7JA 4NK4A 4J1QA 1RRCA 2VATA 1CT9A 4JS0A 2P0AA 1VE5A 3PFCA 5KNBD 4XJTA 3FOCA 4XYLA 1KYWA 1P29A 4QFMA 5HF8A 5DHUA 1XD2B 4TROA 3IVAA 2HGZA 4YMLA 1ESNA 2OLJA 2IVFA 3DMRA 4GSLA 1VFPA 3F4BA 3VU3A 5KQMA 4MUKA 1Z88A 2EV9A 4JBNA 4C4XA 3G8DA 3ILVA 3ANYB 3B1FA 1N8KA 2EVWX 1LJLA 2FEXA 1JLHA 5KQPA 4MXDA 4IGEA 5T3UA 3UMVA 3N8GA 5JD6A 3IDSA 2Z3ZA 4YUZA 2B4QA 2HCTA 2OYCA 3JTMA 4FHEA 3DLHA 1VP9A 2BTEA 4M0KA 4O2AA 4FFLA 3FCCA 1THTA 4XJSA 1JP7A 1LS1A 2YOGA 3BIJA 1IVYA 5PGMA 5AVVA 2ZSHA 4J29A 3REFA 1E92A 3M4NA 4YI5A 4OI0A 1ZWKA 2OYRA 2WP0A 2QROA 3INRA 4CV0A 1I33A 1LK5A 2O3UA 2X2FA 3OFJA 1PWZA 5HQJA 4AO8A 3TLYA 2VYCA 1TUEA 3B5IA 2FFRA 2P9FA 4Q4DA 4EO4A 5HIKA 5HX7A 2BH2A 1DBSA 4FYXA 5ALTA 3JQBA 2BFFB 2Z30A 4MWEA 3TIXB 1KI6A 4RTNA 1JV2B 3IQIX 1PE0A 1DAOA 1Z6GA 3NPAA 5G3YA 1E7QA 4CU2A 4HDMB 4QTYA 5ADVA 5LD2C 4HQ6A 4HDRA 4L4RA 4W9MC 5HR5A 3PC8A 4F6CA 1B8NA 1GY8A 4IQGA 3W4IA 5BOSB 4URVR 5CYFA 3QVWA 3VPFA 1GZHB 3E8MA 5HZKA 1O95C 4NVRA 5TR9A 3WWDA 1I5RA 2VP9A 3U6KA 1JLLA 4OU4A 3KV1A 4UVGA 3I53A 5TXGA 3DUFA 4UQPA 4I6GA 4KDCA 4IOLA 1P7YA 1DXQA 2QLLA 4UUAA 1XQXA 3QBDA 4IJMA 4QUKA 2CF6A 1M34A 3F7MA 2GCGA 3ZU3A 4JXXA 1USVA 1VCMA 4O59O 1OB2A 1ISMA 3UJDA 3EFOB 2J1LA 1AS2A 5E4JA 4EQ6B 1PAUA 1Y42X 3CVVA 1L7AA 1KI8A 3WLOA 2C99A 1Z2AA 1VMEA 4PN7A 1I4EB 2HRCA 5EJ8A 5JJKA 4X84A 1XK6A 3K1AB 1XZAA 3LBAA 3MOSA 4HAWA 3S1AA 3ZCRA 3FCEA 4B7UA 3ESRA 4NBRA 1O87A 7REQB 4RK1A 2E4WA 2P41A 3KTOA 3WG9A 1Z4JA 4U7DA 2G76A 5H3LA 1QG2A 4BGDA 3HBJA 4FR5A 1ZOSA 2YMLA 4L5CA 4M0MA 4C2BA 2BJHA 1D0SA 4D3FA 4KQJA 3VJMA 2BRUA 1L8OA 5KOHB 3F8SA 2XGJA 4HKTA 3ZHTA 1UPAA 3QLVC 3CEPB 2RSLA 5JNUA 3DMTA 2PFKA 1J2TA 1RLMA 1SIUA 5ERGB 2DKOA 1Y1LA 5FDFA 5DYTA 5K0TA 4OYLA 2Z2YA 3T1OA 2J46A 3B9QA 4FDMA 3GNQA 2LD4A 3G9UA 1X1DA 1BVRA 3AMVA 2CMHA 1IWOA 1RJDA 4LYJA 3PGXA 2HOQA 2FKNA 1ODCA 2FQWA 2ZIZA 1CV2A 3GZNB 4RNDB 1L6IA 2B7BA 2NACA 3RUFA 3WGQA 3R7FA 3GCXA 3LHDA 3UH0A 2BKLA 3H0CA 4BP9A 2PKWA 2VDJA 4MAAA 5FI0B 3KD2A 5KMGA 5IK2D 2A53A 4GS5A 4W5OA 3AF5A 2VH2A 1E6WA 2WMYA 3NTQA 4HSGA 1NI5A 2P8JA 4JT8A 1CUDA 1LI7A 2JIMA 5AXCA 2CK3D 3FA2A 4K46A 5C37A 1IN4A 4GL4A 3CLSD 1RBZA 3CS3A 2Q1UA 3OQ1A 3PTAA 1JJFA 3WYNA 5J40A 2D54A 1LVGA 4C0BA 5JSUA 4WLVA 4P35A 3SIWA 4XWWA 1US8B 1YJAA 4LSZA 1IJEA 2DB3A 5IG2A 3H9BA 4RPLA 2W2KA 1FQOA 1HKHA 1PK7A 2CMKA 3DBRA 3RVSA 5IPFA 4UU1A 5DCYA 3T4XA 4O4HF 4UDOA 2UZ3A 2RD2A 4YV2A 1HE3A 1WMBA 2Q5CA 2WABA 4ISBA 2Q29A 1F20A 4LIPD 3DDHA 3PKZA 3VA7A 3L1UA 4OHFA 3VPAA 2GXSA 1SPXA 2OV4A 4QVKA 1VHTA 1L5GB 3RKSA 1H94A 2V59A 4M1TA 3BREA 3ME5A 2OHVA 5EUQB 4G4GA 2YJ3A 1VG8A 5A3QA 2BEWA 3TMAA 4C6SA 3KQKA 1NWCA 3CRRA 1H8HA 4RY9A 1GGHA 3C8UA 4H1WA 1EK0A 1Q0SA 1Q7BA 1TIBA 1EFHA 4TSFA 4FI3F 4L08A 5HKAA 2BL4A 3EAQA 4E6PA 2IKSA 3C7DB 4QUDA 3P4UA 3QVKA 1DFIA 1KZ9A 1WVMA 2IFTA 3NC4A 4KWCA 4TMWA 4A5OA 3ROFA 1CR6A 5JO0A 3IBSA 4HQ0A 1F6WA 3NGLA 1Q0TA 1HM5A 2F1IA 4J75A 1IFXA 2CNBA 5F2OA 3CUYA 4ZU6X 5G40A 1W93A 3AWIA 2FY8A 4GYWA 3GA5A 2I99A 5DBGA 1Q0ZA 3D1JA 3H3FA 3MUNA 1Q11A 4QUIA 4RC9A 3JQFA 5ALZA 2QB5A 1HNNA 1JFVA 5CNJA 4KN8A 3V55A 3NBYC 4V38A 4HDNB 1ISPA 2VDKB 1J8DA 4U7FA 1YZQA 3KLNA 1NW8A 3VKUA 3CG0A 4YQZA 2XCSB 4P3KA 1C5KA 3T3MB 3GU3A 4Z3OA 5K0CA 1GPUA 3HLTA 4UHKA 4LHEA 3Q98A 4F0JA 5BSWA 5GWXA 1H1DA 1ZW6A 2GZAA 1FUYB 1JBEA 3UUFA 3W5BA 3OP4A 3W0LB 1K7XB 2XX3A 5DBIA 2HU7A 4ED9A 1J7KA 5BVHA 5LKRA 3BMQB 4JEHA 2GILA 2WLSA 3KEOA 4OJMX 4ZT2A 3RC2A 4NAVA 5CVJA 4MW2A 4V0KA 1Z12A 4AYXA 2BVNA 2J85A 1E6LA 2CDRA 5ELLA 5K45A 1IBKB 3OA0A 4ZOLA 1EP2B 2ISSD 4IXNA 3VPXA 1XYVA 4PZPA 4E70A 1QV6A 5AP9A 3CEMA 3L8YA 1QANA 2JVJA 3LT5A 3OLVA 3BDAA 3TSYA 2W37A 3MCZA 1YR7A 5I7OA 3LVBA 2EHJA 5CM8B 4IV5A 2IP1A 2H4JA 4XASA 2NXEA 5E4TA 3KQNA 4KFCA 1YQEA 1LPSA 1Y4DE 1MABA 1JFLA 4YJ3F 1DKQA 3WL3A 1JLSA 3JQRA 5T64A 4J1NA 3WKBA 3N76A 3PUHA 4KLNA 2R751 2R7KA 3RBAA 1YH3A 3AHFA 1PV2A 2OCKA 3PFWO 4FNMA 4B75A 2EDCA 4CMKA 3FBTA 1UM9B 1C4WA 1J0DA 2OK8A 3IV9A 4QYSA 3KR0A 3EDRA 4NHEA 3CO5A 3TSOA 4JBLA 3WNDA 4NYJQ 2IBTA 1UZMA 1DIRA 3C6QA 2V1UA 2FPMA 7MHTA 2JZNA 4DIKA 2WBLC 1XO1A 1ZS9A 2J87A 1I4LD 4CW7A 3L4JA 3RC8A 3ZX5A 3QQ5A 4OY3A 3W1VA 2JGAA 2J0EA 4QU0A 2WWXA 3P2IA 3GUVA 1PNRA 3F98A 2DFLA 4C4OA 4X63A 3JQGA 5TPZD 1FS6A 3UAZA 1M8KA 3EGCA 3HEBA 1TCVA 3LW8A 2WJYA 3ORRA 3QKRB 4KGVA 5KVQA 5AUNB 3R20A 3UMJA 4XB6B 5C35A 2DQKA 3R1IA 4NZPA 2VSOA 1E3WA 3ENZA 3VHLB 1ESMA 3FOZA 3AO0B 2YZKA 3QEOA 4EHIA 2FR0A 2WG1A 4IKEA 3E3AA 1FMTA 5BPHA 2PKYX 1COZA 1ZRSA 2AFIE 2OT3B 4ACAA 3AVUA 5ALUA 3CLVA 1GG8A 1P2GA 3ZE2B 1XZKA 3IEUA 1I0IA 5JI3E 2Z2ZA 1XLTC 2W2MA 4MCIA 3BWXA 4UUQA 4QFCA 2AHRA 2R8RA 4BVEA 4ZK6A 1JVBA 3LLCA 3OZCA 3A11A 4NR0A 3B9RA 3UZUA 3ZNPA 5JCPA 3RF7A 1BE1A 1C9JA 2R8EA 5CM9C 1HYGA 2WAXA 1JDPA 2DZDA 2H29A 5CHEA 5MDHA 3T1VA 5BR8B 2GZ3A 4L74A 2OV1A 4J6EA 4PYOA 1VTKA 1BA2A 2G5PA 3L3BA 1ETHA 1M2VB 2GQ0A 2I2DA 2R6DA 4KC0A 4YR9A 1KA9H 2XE4A 2FN3A 3B3JA 3OQOA 2UVPB 2D6FA 1MB3A 4R1QA 2V58A 3AJDA 3PDWA 3B3GA 5ECGC 2N42A 3FCUB 3BZWA 3X1DA 2ZTSA 4IHQA 4O4LB 4V2UA 2Q9AA 4F8YA 5EGNA 3JD4A 4E4TA 4JLDA 5TF0A 2X3FA 2J5KA 3DR3A 1ICEA 4MVJA 3GXBA 5GZ6A 4EMTA 1K8ZB 4JV5B 5CVVA 1V5WA 3MJVA 4CFYA 1UK7A 4E5VA 3A4IA 3U4GA 1G60A 1Q91A 1X87A 4IHJF 3L4BC 4N7JA 4EO7A 1SOVA 1WHTB 1LW6E 1ZMRA 3O4IA 1EFKA 2XUJA 4IQ8A 3O9VA 3X43A 5JZMA 1XPUA 1FTSA 1UJ4A 1G63A 2CBXA 3MTEA 1I2CA 3FGOA 3LWZA 3N9IA 2DXIA 3P9ZA 4YRTA 3WK7A 1U3WA 4YCSA 3LA6A 1M7HA 2H2DA 3DNMA 2P11A 5C8XA 2PANA 5AK0A 5KHLB 5KTPA 1KIAA 1NMXA 4J0JA 4PZLA 2CDBA 4YJ2F 4WK2B 2PNJA 3UJ3X 1EM8A 4JDPA 2VHWA 2GXAA 1T3HA 4S3MA 2ODPA 4ZEVA 5GTDA 3KT6A 3QP9A 5FWXB 1EUDA 2D2FA 4PZYA 2CV1A 3C1UA 3KOWA 3E3MA 5ED0A 1KVQA 3ONNA 1T15A 5K0JA 4WUVA 2Q3FA 1YV9A 1IBMB 2GVDC 3QF4A 2H06A 4PXSA 3GUYA 4BFZA 1MAUA 3ZXSA 1H1LA 1GL7A 1SXHA 1Y37A 4UDNA 2O3RA 1RXSA 3MJHA 4F6LA 3F78A 4IILA 2C5AA 3PQFA 3RRMA 5EIWA 5K8TA 3H2JA 3OQ6A 1WVIA 2BFDA 2E4XA 3RS7A 4N5IX 3MF4A 3FYSA 1XPJA 4A23A 4YRSA 4ARAA 2SKDA 4EJ0A 1QGYA 1P1FA 3PIRA 1WU8A 3FFBA 1P0IA 4DBZA 4PX3A 8ABPA 2AOTB 4FGLA 1V11B 3F2VA 5HKBA 5K0BA 3EK2A 4XRRA 1UFVA 1LTQA 1N6LA 5NULA 3FMGA 4R1LA 3DAFA 3QFHA 1WF6A 2YC4C 2HF2A 4G5SA 2I3AA 2YX1A 3WYGA 3HNOA 3VH3A 2A1UA 4BATA 3C3JA 2KI5A 3COWA 4O4LF 4FWBA 4OBBA 5LVAA 3QEKA 4GKJB 4J0EA 3GJRA 1I51A 2XE8A 1GQOA 1U11A 4F5YA 4KZPA 4AZSA 4NKRA 3SJ7A 4BNHA 1OTHA 5LQRA 3VX3A 3U7QA 1UWLA 4MEAA 2WSSA 1LRKA 2A9JA 5FTMA 4XQ9A 2VSFA 1UDWA 2GEJA 1TB4A 4IL5A 1RYEA 1GNVA 3QLUC 4JHLA 4AZVA 5BT8A 3IP3A 1Q7GA 1EQ2A 2BFCA 2HA4A 3FIUA 3KVOA 1UL1X 4M76B 2EYUA 4OHBA 4OSPA 1J06A 4I4LA 5FTNA 2QYOA 5C5EA 2REQB 4TTSA 4MYUA 4Z3KA 1D2GA 2A54A 5DU2A 4GKKB 3IXQA 5AK3A 4DMUB 2L0XA 1N3BA 3PYMA 4OREX 3D4PA 2GPBA 3ZNQA 3W3AD 1SU4A 1IHPA 3TR6A 2WF7A 4R8RA 2QMQA 3IT1A 1Q1BA 2W6JA 3O94A 5FPQA 3T3GA 3WVNA 1E1QA 3TKAA 1V5EA 2WYHA 5BSGA 3V8RA 1EGAA 1XDZA 4N54A 3SEQA 3QVTA 2JHFA 4QXAA 5GMOA 2RHWA 1T8PA 3ZWNA 2H51A 1Z25A 3E53A 4X1KB 1G5HA 3L7YA 5HS6A 3S3TA 5BYBA 3TLKA 3UHFA 3R24A 3ETEA 3GLQA 4TV9F 5A4MS 5I51A 4F9GA 1R0RE 2C1ZA 2PX2A 3R0JA 4L4YA 2D5IA 1C3OB 1H9AA 4AJHA 3JQ9C 1VKZA 1E8DA 1AVTA 4KQ1A 1ZW1A 2EQBA 4W7SA 3JZAA 3LK6A 3MN1A 3OD5A 1MIOA 2ZTMA 1UKVY 4Q3OA 3AY3A 4UBMA 3UFXB 3VU9B 3W34A 4DREA 4PR3A 4DDTA 4KMRA 3UTDA 2EKLA 4TX1A 1XRJA 3GLVA 1SCKA 3CCFA 4PY2A 4XXHA 4C6HA 3MUOA 1TM3E 5JWHA 4MKZA 3E2IA 5EXPA 3TBKA 4AJOA 1CUIA 5FAXA 3T99A 1WEKA 2P30A 3RK1A 4NOJA 1AX9A 1W5AA 3GDOA 5A3JA 1AGNA 3G3EA 3P5SA 3PITA 1EFAA 1P81A 4WFQA 4YT8A 1DT5A 3SQNA 3FFAA 3OUTA 2VWQA 1KEPA 2ZYAA 3IDAA 1NVVR 1RIIA 1VMKA 3FNEA 3QKTA 4DLUA 2P2NA 3LM8A 1OV6A 1YT5A 2GX6A 3H04A 1C0EA 1E2EA 3HZZA 2BKVA 2EGGA 1B6RA 4ZVNA 1JRLA 3B6EA 5J5VA 1E2NA 1ZU5A 4C9BA 1TCAA 5B4UA 2NUAA 1BXZA 2HSGA 2NZ2A 3AUFA 3H0EA 1R16A 3L0BA 5DB4A 3UG7A 3FHLA 3MWDA 4CGYA 1NRIA 4HVLA 3TRHA 3VH1A 2BN4A 3CGWA 2X23A 3C8DA 2PMDA 5B2ZA 1YS2X 1GG5A 4QLOA 1XJ5A 4QXOA 1HA3A 4C3VA 2QIOA 4WOCA 2VS1A 1BE6A 4TS3A 3SDSA 3ZKWB 1A4IA 5H83A 4LCBA 4H27A 4NP6A 4QOHA 3TSAA 1Z73A 4EVSA 1YJ8A 1KEEB 4BUJA 3DJFA 1DV2A 3DZBA 5E6RB 2BM1A 3HXKA 3KTAB 2FWJA 4V24A 4FGJA 3C5WP 4CKYA 5B6PA 4IJ5A 5FBHA 1T3ZA 2ZSAA 5L3QB 1D2AA 2VCEA 3AI2A 2XWPA 1Z28A 4FB5A 1G8AA 5IARA 2IEGA 1E2GA 2PH1A 4DRZA 3MWLA 2XCRB 4J90A 3AUKA 3GEEA 4B73A 3HE3A 3I92A 4PG6A 1ZP6A 2J9ZB 4R98A 5DWQA 3DMGA 3RUAA 1XRRA 2GEKA 2ATCA 3P5BA 3ZG6A 3GZJA 5CR9A 3MT8A 5JSQA 3FCYA 5DSZA 2H65A 1PFVA 3DLAA 1AIPA 1NLZA 3IV6A 4LISA 4A8JB 4XRGA 4ZIRB 1TZBA 1U5CA 2ATEA 4JEIA 4ZYVA 3G49A 2HWUA 4LBZA 3TEFA 2IP4A 1DTEA 1JAHA 4NOKA 3RAJA 1ZMBA 3IR7A 1XQ6A 4EKIA 4DARA 1J20A 3GUZA 4UXIA 4JI2B 2B30A 3DMDA 4EGQA 3N8DA 4S1OA 2FCRA 5ENDA 3CPJB 5JCJA 2OXCA 2PLRA 3A6DA 5LUBA 3R7WB 3V34A 4D92A 1GZ5A 2QAJA 4LHYA 4JBIA 4XSVA 2CVPA 2V7QA 2NTVA 2W2LA 4RYDA 3IHLA 3D3WA 1RABA 5DFAA 4CYMA 1V8ZA 1ISHA 3F2IA 3NUQA 4K03A 4PGHA 3ZDEA 1EE1A 3RVOA 3IJ5A 3COYA 2E1PA 3EBOA 3PF9A 3ECSA 3F6EX 1CUHA 5F21A 2VNJA 3HJUA 4NCHA 4CKWB 4D43A 4D42A 3RSZA 4PX5A 3NDRA 1QTIA 5FYDA 1LI5A 5AVTA 1E77A 1DIAA 1PT9A 2VRNA 2WFMA 3FJ1A 3FY4A 3KUUA 5I7EA 2QYTA 3NHPA 4AP9A 3ONWA 2Z0MA 5GAJA 3AVYA 4RADA 5TGTA 1E1RA 1Q12A 2CHFA 4K9NA 3K94A 5K8UA 3EEFA 4QFDA 4B3MB 2CGEA 1Y3FE 3QYFA 4MV3A 2PSEA 3G0BA 3B2QA 4KBYA 3KKQA 5C0OE 2K2QB 1R5JA 1XA3A 4FHFA 4FONA 1N0HA 2BCGY 5J2UB 1JAYA 3C3CA 3WHPA 1PNVA 5KTYA 2PRKA 1X9IA 4MP3A 3UA0A 2O8EB 5G0VA 5AVSA 4RA9A 3SEZA 4CKEB 1BH2A 4AZ0B 2ODBA 3D4BA 2F9FA 4ZQHA 3ICQB 4QODA 1XTSA 4M37A 1FSGA 1NXSA 2CXTA 2JFQA 2QRGA 2A57A 2Z2IA 5EESA 3UT5B 4C1BA 1L4EA 3IVGA 1QHHB 3AW8A 4QPCA 3CRMA 3RC3A 2W90A 2Q4OA 4QDXA 1LBIA 4A0SA 4DB2A 4PN3A 4NG5A 1W52X 2Q0HA 1YZGA 2B4AA 2TMGA 3LCRA 1O7JA 2JH9A 3PLAE 3B20A 1Z74A 2ZQ5A 4RV5A 1XQ1A 1U9YA 3OCWA 3EQ8A 2JLAA 4H1VA 2M6SA 4CIYA 2ESRA 3CT4A 4LTMA 3H9QA 4BV2A 3TGLA 1VDZA 5I7UA 5MN5A 1A5ZA 1Y9DA 3GK3A 4G09A 1AO3A 2J9FA 4XIJA 4HO1X 2E0IA 4J3JA 4M1QA 4PQFA 1E9VA 4ND3A 4PR0A 3TRFA 4MV5A 3AUJB 3K09A 4N0QA 3OQNA 2A52A 1TQDA 5AOVA 3A1TA 4RIGA 3S6JA 1S1CA 2ZSDA 4M9RA 3ICPA 3PWZA 1QIHA 2B78A 2R8PA 3GQVA 4L72A 3JYLA 3IDQA 5DDIP 1VXRA 3N0WA 1CULC 1ZIXA 3CTMA 3NWPA 2ACVA 3PE6A 1ZUWA 2ZU6A 4OKSA 1C0PA 1GO2A 4ZXPA 3UGTA 1OGJA 4NCAA 3PUVA 3ABSB 4E32A 4L9WA 3P9KA 3UJBA 2Q45A 1S7GA 4OD0A 3ITEA 5LOVA 5JPIA 2PGLA 4YCCA 3FPLA 3O4GA 1QQ6A 1NC3A 2PT6A 2JAOA 4NFSA 3PB3A 3I6QA 1I7LA 4HBZA 3EJ6A 4MX8A 2C77A 1IJKA 1KPIA 4OYYA 2HLDA 1E2LA 2O8CB 1AQIA 4YUWA 3PQCA 3R44A 1PYOA 3Q88A 2WJGA 3GRRA 4AZ3B 4D4GA 3MHTA 1GJRA 1EWRA 2WC1A 2X0DA 5J2UF 4J9UE 1DKUA 4H7IA 4HL6A 3GRCA 5FB3A 3WMGA 2X3UA 3HJFA 3VKGA 1A9SA 1JU9A 1DXOA 3OESA 2PXAA 1XTZA 1KEVA 2N0SA 2VYFA 4MRNA 5P21A 4DYDA 4OX9B 1CVIA 3VTFA 4UTNA 5FPHA 3MGCA 4NWIA 3PHCA 3AIMA 1T1GA 5EJ9A 3LY8A 2C4NA 4E1VA 1IOLA 3O8RA 2WAAA 1I1OA 3H9CA 1GRNA 1YVEI 3DM5A 3AL0C 3NBXX 1E9BA 3NETA 2JLYA 5DF1A 3QFFA 2PWYA 4R8VA 3MTGA 5L40A 1W88B 2WU4A 1CF2O 4LOAA 4WE3A 2AH5A 2B5VA 1CNEA 3DD1A 2ORED 4K8OA 4PW0A 3FTCA 4WASA 1LLQA 3C1AA 3IDFA 4M7OA 2CJWB 2WYVA 4E03A 4PC7A 4WKGA 5IDYA 4CUZA 3O7MA 3NV9A 4AICA 4RTOA 4JLJA 5KNDD 2HDWA 4Y1GA 3UW3A 3ENVA 5FUMA 4NLLA 4PG5A 5C80A 1RADA 4CM5A 3H6GA 3DBIA 3NYWA 4KPYA 3H99A 4G6ZA 4P7KA 2A9VA 4Y30A 5BWCA 4HQOA 4AU1A 5J47A 3VR6H 3L8ZA 2RGWA 5IABA 1EG7A 4AKSA 3H1TA 1ZIOA 1W47A 1FNMA 3I76A 3NIBA 1HORA 1KYTA 3N6VA 4OKNA 4J4TA 4U2BA 3T9BA 4ZO7A 1A72A 3RYTC 1NQOA 4DJFC 1C1XB 1R64A 1ZA2A 4WPGA 2BR4A 2ZIUB 4AG5A 1JN0A 3UATA 4ID9A 4KLZA 2GB4A 4GLJA 2VDWA 4EHDA 1N7JA 3GUHA 4EG8A 2IH4A 3ZH9B 3SSAA 2IU4A 2IYZA 2H4XA 2IHYA 2NXJA 3G79A 1H4SA 1M0TA 1I8TA 4Q93A 1Y4SA 2IPOA 4NECA 3RWBA 4EARA 4BRWA 5T4FA 4TQUS 5CCXA 4ZYUA 3VBEA 4Q02A 4Y9SA 1QAQA 1XX6A 3OPVA 1CUUA 1P75A 3GN2A 1JJAA 1P60A 4OQZA 3SYRA 3V32A 1EX7A 2B1IA 4GYJA 3ER6A 5JE8A 5K4HA 1U4OA 4AN0A 2P9EA 3O8QA 3I61A 3U56A 3IP5A 4JLOA 2ACKA 3BCSA 2Z95A 3LXRA 4TTJA 5LBIA 4AZTA 3EQ6A 4LXHA 2VYVA 2P40A 3OECA 1NM5A 2BEVB 4DY4A 2ZI3A 1TQ6A 5DEOA 4F4CA 3PDUA 2RONA 5A0VA 2BM0A 5IWCA 3ZZNA 1E59A 2Q6IA 3HUUA 2B1RA 4B3IA 3IPYA 2Z09A 4TXNA 3QJYA 2PGAA 2I33A 4Y1FA 4BVKA 4BQNA 1NULA 1H8EA 2BTQB 3IVRA 2IYYA 4LS3A 2IH5A 2MMGA 1G5RA 3HCOA 4L16A 5AYVA 3LI2A 1OX4A 3NBUA 1RZVA 3BX1A 4US0R 4XX1A 4DDUA 3NBZC 2GNOA 4XUDA 1Q6ZA 2N1MA 4HPXB 3Q0IA 4OK6A 3U7HB 2QTMA 1YBFA 4H0CA 2V7XA 3W4KA 4Z49A 3U60B 4J07A 4S2UA 5D6NA 3V4VB 3TFQA 5E1MA 3HP4A 5JZSA 3MXTA 1J42A 2SCUB 1GUFA 3KE8A 1KI7A 3NT4A 4JX9A 2PWPA 4MMYB 4TOIA 3CVJA 1RMQA 3IE0A 4G1EB 3OM8A 5D1NA 1MAVA 4YLEA 4WGFA 4V0SA 3TR5A 3K9FC 1GUBA 1QG4A 1RWWA 3NHAA 1IRIA 2GD1O 2WW8A 4OHVA 2X3YA 4H7HA 4V0QA 5AH0A 3M2TA 4M7WA 5L3ZA 4R16A 1DP4A 1JQDA 1PN3A 4RD1A 2Y0EA 3R0VA 5FPYA 4GDMA 2PUCA 3AKZA 3O91A 2G4VA 3DFIA 1QO0D 4NV3A 2R8XA 4OGGA 4YAFA 4FP9A 2MR6A 4DPKA 2A1IA 1NKTA 4IF6A 4LOHA 4BN5A 2BBWA 2RGNA 1YKSA 2GDJA 1MQ8B 3IKVA 2FP4B 1WXIA 1VSUA 3EX7C 3CFIA 2PRSA 1TZKA 5GOZA 1LF5A 3FPCA 4BNNA 3RTBA 5BQPA 1IMJA 3DMNA 4ESEA 2OWEA 5A5GA 3AJ9A 4MVJE 4AYTA 4QHYA 1L7BA 3KSRA 3RBVA 4FN5A 3ZCPA 2Z4RA 1KI9A 1K6XA 5DOVA 3AVQA 1RFGE 2XF8A 1JVNA 3QPDA 2LMEA 3EXFB 5BYKA 2AD5A 4ZXFA 1EINA 1I0ZA 4J2TA 3TLGA 3ZHQA 2H59A 1V43A 4HDKA 3LUCA 4BWYA 3EGDA 3I04A 3OQHA 3F3YA 4MQFA 1HETA 2EKQA 5HF5A 4C08A 4INJA 4AY4A 4WK6A 1V1RA 1T6BY 2W6PA 1OFVA 3KIPA 5CLGA 1X42A 4ZJZA 3NAGA 5KYWA 1O9HA 3D59A 1C1HA 3K0KA 1Y9AA 2CLOB 4PO8A 1ZHFA 4NC9A 2PZJA 1ZJZA 1WNTA 2CYAA 2QAGA 1FX0A 4TSRA 3U7FB 1N0UA 1XLUA 1Y9EA 2GCIA 1EVYA 2W2PA 3B9BA 2QQEA 4Q3KA 1I6LA 1WB9A 2CY0A 2IV2X 1SWVA 3I9OA 5WRFA 4RTQA 5J4YA 4NBKA 3FVTA 3AG5A 1BROA 4D3ZA 4N76A 1PP4A 1ID1A 3VYTB 2PGJA 3QFCA 1RWQA 1V4NA 3WGHA 1G2OA 5JPDA 1TF5A 2HK7A 4FOPA 4MLCA 1FK8A 3LD9A 1YJXA 4MH0R 1N2BA 4INAA 4MQBA 4QBTA 4ZZ1A 2ZRHA 3CSUA 3MCAA 4KLAA 5HBGA 1UPUA 2OZPA 3ILSA 1QP4A 1WSDA 4X62B 3IAEA 1NUAA 1TC2A 1OC2A 1S02A 1UMDB 2OFXA 3SOPA 3TRDA 1Z2EA 4P4SA 3C5HA 4RGBA 4YXWD 3LBFA 1PSZA 4JSYA 2DBYA 3V2HA 4O8CA 1G6Q1 3RM3A 1Z0JA 4MQEB 3CX4A 3ONVA 2Q4BA 2A0UA 1NX9A 3A6KA 1GPAA 3BMCA 2YVLA 1KU6A 1JDUA 2AKAB 2FUCA 2J3JA 5LA6F 3VYVA 4AJKA 3OZGA 1T43A 5COBA 1XAJA 4B74A 3RJ9A 1VSTA 1B16A 2AQIA 3UICA 3V48A 5CDHA 3CNEA 3OOSA 5E8RA 4WI1A 3ZE1B 1X1EA 1D2NA 1UANA 4LHVA 1T35A 3LRPA 3IPLA 1PBTA 3M5WA 2RHBA 4Q1FA 1PL8A 4PGMA 4WOKA 3T1QA 2E49A 1I14A 2JKZA 5E3HA 4Y2RA 3SQDA 4C4SA 3EIHA 3VVBA 1JIKA 3HXQA 2NTJA 4EDHA 1VL6A 2QD3A 3D0KA 2X9LA 2PFSA 3KZOA 4MW1A 1ONNA 1ZNXA 1IUPA 1EGQA 4B2LA 4FI3C 2MJLA 5E6SA 1TJYA 1HG0A 4FMDF 5ALWA 4YACA 5ER6A 3L07A 4WV3A 5EKUA 1A8HA 3EDCA 3LLVA 1GGVA 4GAEA 4I14A 5AI8A 2O2IA 2P2ZA 4E4YA 1UFKA 5ELXA 3D6HA 1Z56C 1GU7A 2TECE 4UAVA 3QKSB 3TEJA 5IFKA 3AQ4A 3GEBA 2XRMA 3ZBTA 5CDUA 1APBA 3F96A 3IAXA 1BHQ1 4QRIA 5B7QA 3E7FA 5MGBA 3OFVA 3A1CA 2RBKA 3LT2A 3OKPA 2VTEA 2ZWOA 1E7WA 4IH4A 4RFSB 3S2GA 1P7WA 1Y7IA 4K7JA 4R69A 5L8VA 1JG4A 4PO1A 1Z0FA 2Q6OA 4B33A 2B98A 4K87A 3CN9A 5HJ2A 5AVYA 4DCUA 2AR9A 5HBRA 2AOUB 1NUUA 2CLCX 1SKYE 4KACA 3WHLA 1IY2A 3TVTA 2X0IA 4WCFC 3BCHA 2XUHA 3ZWQA 1GGNA 2PSFA 4DIMA 1F12A 2FOXA 4NICA 5EXEA 1L5FA 3MINB 4UAJA 1R0KA 4GXTA 4AG3A 1RXYA 4D8WA 2P0EA 4RTLA 2GAOA 2ICAA 2WZCA 3MGAA 5LR6A 1Z7BA 3OQMA 3UIEA 4TGLA 3WB9A 2IVZA 4CV1A 1BEZA 1OY1A 5BT9A 4MIYA 2GCOA 4AJ9A 2JGRA 4QQ8A 5I7VA 3K0BA 3EPJA 3G1UA 2DWPA 5JALA 1IBLB 3HPQA 4P6VF 4XM1A 3PHJA 2PCJA 3JQ7A 3HUFA 1ZEMA 4AUEA 4GWLA 1XHLA 4F2WA 1NW9B 1VJ0A 3HO6A 4KL8S 3MM4A 3STHA 3TIVA 1YE3A 4UU8A 3AB3A 1Z35A 3CW2A 4Z0HO 4G0NA 1VLZA 5EEGA 2E3JA 3MQFA 4GMDA 2NQ8A 4MUAA 5DKFA 2IBMA 1O95D 4QUAA 2YH2A 4X24A 4Y2VA 1ORRA 3Q85A 2G1PA 3BWCA 5F9FA 4TKUB 1FNSA 1WVGA 4CLOA 1H0RA 5JS8A 2BD0A 4DLZA 5CA1A 3O75A 2YIVX 4GGPA 5HF9A 1ZK0A 3CKLA 5TQ2A 3ROZA 5KBYA 1QPZA 1DJNA 4FILA 1PG5A 3L6UA 4KXVA 5FORA 3EYAA 3PHHA 2BBOA 3B51X 1R0LA 3ZHVA 1E9AA 2A4KA 3E22B 2M1ZA 1GPBA 2C92A 4CMJA 1KK3A 3UWOA 4G67A 4L0DA 2HCRA 4GL2A 3I1YA 4II2A 1HDEA 4NHOA 3UUEA 2IE0A 4JA2A 3ND7A 1LW7A 2QXYA 3IDOA 3JX9A 4FNOA 1PQYA 2OA0A 2CL5A 5KINB 1LQ2A 3GLUA 1DG1G 4RKYA 2OQVA 1IAQA 1PDOA 2HL6A 1P9NA 4RPCA 5JAZA 5JMWA 3E6AA 3BFKA 4YP6A 3EZLA 1CVLA 3SXUB 2JGJA 4W5QA 4G85A 2ZYTX 1NSTA 1C7QA 1DCKA 1NW6A 1X7XB 5DYNA 3T1NA 2IPNA 2AD1A 3AM5A 3F9IA 4JZYA 1U2ZA 2G28A 2HUPA 2PS9A 3NASA 4KXYA 1XTBA 2QI9C 2QRZA 5ECWA 2WMOB 3NCHA 3JW8A 1BDIA 3AEKA 3QX9A 3IIKA 4KO1S 3H7AA 3KKMA 3RROA 3S40A 3UN1A 1R7RA 3E5HA 3LW7A 2GN8A 1U7WA 1SVUA 3AJ8A 3MYRA 4MS1B 1W59A 2SNIE 2X1VA 1Y7HA 3H2HA 4BQOA 1YIOA 1X7GA 4IO0A 3FHTA 1SC4A 4Z1OA 1P9OA 2FPGB 1EVLA 2PQMA 3QWHA 1T2NA 5DN9A 3A9WA 4D57A 5EKXA 1NOKA 4YALA 1Y80A 1E9CA 5LNK6 1HBJA 1OCEA 4URZR 4UM9B 2H8KA 3S0JA 3DOJA 3EVNA 1SC1A 2QXTA 1B73A 1U7ZA 2O0KA 2ZAOA 3GJQA 1BOFA 2D00A 2QQFA 3UV7A 2I1LA 2JBHA 2B2XA 1A7JA 5I7FA 4GHWA 1PT5A 1TJ3A 1ZD4A 1I2BA 3C3PA 4W8HA 4WVLA 4IIBA 5E7QA 5EAIA 1UIMA 1ZD1A 2ODTX 1O4WA 4XIFA 4XCVA 1GCAA 4E4RA 4XX0B 1G3RA 4GSKA 3WLRA 1DQYA 3W6OA 5A9SB 1K7CA 1UDBA 2EKBA 2FUG1 3L0ZA 4MQ5A 2VT7A 1D6JA 3THXB 1FF9A 1L7NA 1QYCA 3KEMA 3E15A 4C0LA 1JKJB 1J8VA 1P45A 3OOYA 5C7IO 1C7EA 2J3KA 1QO9A 1XDWA 5FUWA 4TXMA 3H7IA 3NTRA 4KO8A 4LZZA 4HNQA 4WW0A 2ATIA 1TRHA 4KQMA 4ZT6A 3OF2A 4HZGA 1P1RA 1RIFA 3NH6A 4HNUA 3V7UA 1RNLA 3ZUGA 3AM3A 3OMXA 4XPZA 4CKCA 2IYRA 1EBFA 1Z75A 3ADBA 4NENB 4NE2A 2VF5X 1CEQA 3KUDA 4TYYA 1GKYA 2X5NA 3PSAA 3W3ZB 3DH0A 2G77B 3IL2A 1QO7A 3LHIA 4LKRA 4HFNA 5TPZA 1F6DA 4CPDA 4UARA 1DEHA 4YLYA 4H7FA 4QYTA 3RHZA 3W9BA 4G0OA 4P98A 3ZGNA 1ISJA 1W85A 2QLTA 3WTBA 1WPRA 2GN6A 4YRGA 3OZWA 2GVNA 4GNRA 1II8A 4WADA 4OXIA 5GOTA 3GLGB 3OSZA 2H11A 2X0NA 4C01A 2P0YA 2Q8NA 3QRWA 2WFAA 4LZWA 5BRAA 3GMDA 4DC0A 3MW8A 2J08A 4MIKA 1ADCA 5JVDB 3U4HA 4V1CA 5TT1A 3G5UA 4MGIR 4MICA 1F14A 3ZI7A 1GZ7A 2DHCA 3FDJA 4PLCA 5D5HA 3I1FA 5AXDA 2ZJ6A 1DRUA 5EYPA 2P4QA 4D9EA 2IITA 4X65B 3KSDO 4EM6A 1G9TA 2WHXA 2ZB7A 4GI7A 1FU4A 5ALXA 3W2GA 3WAGA 3LUGA 1EX6A 1TQHA 5DTEA 4ZD6A 5HE8A 3VTKA 4AMGA 2NTYC 5FLXA 3O4VA 2JW5A 4KYVA 4MARA 3T3HA 4DWWA 5CJ2A 1VKHA 5IN5A 2PXCA 1XPRA 3AESA 1HC7A 4GX1A 2EWWA 3W8DA 4KRYA 3T3DA 5K8IA 4EA6A 1OU4A 5BQ5A 4DEXA 3HSYA 4EPWA 2CDAA 2VF2A 4LXTA 3WY9A 4ZICA 4ZMSA 2QTFA 3U7EB 2J09A 1VPEA 1NYTA 4Y8VA 2HBRA 4NULA 1K08A 3IAS1 2UZ4A 2Q2NA 2WJAA 1N0WA 1DBQA 5FCDA 1OUMA 1BSVA 2PM8A 3FDZB 4Q34A 5A3RA 1FP7A 4BEWA 5IDWA 1QP8A 4HVCA 3K9HA 2OG1A 1HFEL 5I4BA 1JI0A 3ER8A 1CQIA 1NMZA 4AN4A 4EEZA 3KVVA 3LYUA 1SM4A 2DBRA 5CNIA 5THKA 1QYXA 2V4MA 3AP1A 1JXOA 3AZOA 4NDAA 4XYGA 3EXEB 2IQIA 1ZJ4A 2XUIA 4KGDA 1RBYA 1BG6A 1CY8A 1XTPA 1WUYA 2NO4A 3L93A 3MJEA 3O8BA 1U6IA 2G8NA 1Z9BA 4K5QA 1T2FA 2CWDA 3RHSA 2WKRA 5FPSA 4BGVA 5JS1A 3ET5A 1Q22A 3H83A 3SAJA 1Q1AA 3FNHA 1T0BA 3MIZA 4ALNA 5KTSA 4RPIA 3HDJA 1UBTS 4BPBA 2WHYA 4YQEA 1EUQA 5CT5A 3CE9A 4F2GA 3BMNA 1QLWA 3B2NA 3RU9A 2EF0A 2GYUA 5ICGA 4E6EA 5DYWA 4IKPA 3GH3A 2WHRA 1X2EA 4DC9A 3HCEA 1W6UA 1EXNA 1ATZA 1M33A 1DC3A 3HEMA 1W2WB 3A1FA 4JLAA 4S12A 1S6YA 3AI7A 4J4BA 3O8LA 4B40A 1R9MA 1NJ5A 3RC7A 3DR5A 3K5PA 5ESWA 4BE7B 4YPVA 2CSXA 1A4XA 3L8EA 3VZSA 3FBWA 1JE0A 1SXIA 1XZPA 2GOYA 3QVJA 4AMVA 4JBHA 1ISFA 4RWEA 1JT2A 4CQJA 3AKDA 3RD5A 2CHGA 3NHFA 3QKIA 1QTRA 4KBGA 4KVAA 1O9GA 3IDZA 5EZSA 4DAOA 4HDOB 3IB6A 2WYUA 1A5AB 3RUIA 5FUQA 1C1DA 5CW2A 5KPDA 2YNMC 2I2AA 3N39C 2JA1A 4OIMA 5TSDA 1Q21A 4PRYA 4BE4A 1XZEA 4JLSA 3AVXA 1KHHA 5DMHA 3TSWA 5EJEA 3BSSA 4GIBA 1A2OA 2EFDB 3RU7A 1Z7GA 3V9AA 1U0TA 2VHTA 4F86A 1TW3A 3C41J 1QH0A 4NFHA 3W5JA 4DV7B 3ELYA 2AW3A 3CCBA 5FHQA 5H5JA 3VR4H 4AF7A 1KGDA 4NJOA 2ZJOA 1IXYA 5CB0A 4ND8B 1Q1GA 5HHTA 3DVSX 3R40A 5F9HA 2OO5C 3G7UA 4TL6A 1IUOA 1FDUA 2OORA 3KJGA 4Q7MB 4HLNA 5MN4A 1V2GA 4MB2A 3RCBA 4OHZA 1ZVKA 3CIOA 2BISA 2CBGA 1KZ1A 3K6RA 2F8MA 4EKDA 5BWLA 4I1PA 3HP1A 3KLOA 2GA9A 1NVAA 2MINA 5BUSA 2VH5R 4L8GA 1QS0A 1A9TA 3E9DA 1QZTA 1MFPA 2JIDA 1T6NA 2MSKA 3HKEA 4GI2A 4L75A 1KE2A 1SKUA 2HV8A 4KFRA 5L6MB 1HXHA 2GVZC 5D51S 1L3BA 1RYNA 4I9GA 4I3FA 3ACBA 3WTCA 5IULC 2BTOA 1IXSB 4JJGA 5AKJA 3HXTA 4HWTA 4P1ZA 4ZODA 1SUFA 2OV8A 3DV9A 4CQNA 2QRVB 4Q7KA 2FPXA 1E9DA 3B78A 3CEHA 4OJKA 2QV0A 3FETA 5DW0A 2LCQA 3UAWA 1VPWA 3BB3A 3A8TA 4NE7A 2VNAA 4W1SA 4BQRA 3PEWA 4X20A 3FF1A 3G2QA 2B6NA 3B1YA 2P5UA 2UYCA 5F1OA 1G2PA 3T95A 3ZU5A 5DLPA 2R7NA 4HZUA 4PC3A 1SQ5A 4KI7A 4I9NA 3AB8A 1KQPA 1OHHA 2F59A 1HDRA 1R8JA 4JZKA 2IS4A 4P36A 5FLYA 4IBOA 3GRYA 4IHKA 2B34A 1E89A 1WSWA 2R6R1 1TMKA 2JASA 3GD7A 4EZEA 4FYYA 1MC8A 1HYQA 2UYOA 2MYTA 3IOEA 1TMOA 1EB9A 1W25A 2ZWVA 2IYAA 3E3LA 4RBNA 4UBNA 1H2HA 1WKCA 3LFUA 2XVAA 4NV0A 1Q2XA 1XRQA 2XMQA 3I9FA 4KUEA 1Z33A 4U00A 3R7SA 3SU8A 2EQ5A 3T41A 4YCBA 3UHOA 4BEVA 5KYXA 2PWAA 4AD8A 3EDYA 3TZLA 4LY9A 1E58A 3X44A 1KRWA 2AJ8A 1EEXB 3RYFA 2IYTA 3D2CA 2R79A 3ES9A 4RSHA 2VCYA 3R4CA 4TTIA 2GPTA 5BWMA 3DS8A 5BOSA 1ZICA 1N2OA 1BX1A 3EW9A 3DT9A 3IUMA 1ML3A 3RSFA 4JBYA 4JJAA 4OFBA 1GKIA 1VHLA 1BKDR 1QLJA 2NO6A 5EN4A 3ZEAA 4HGOA 4C88A 1BXRB 2AFVA 3GOHA 5I8ZA 1EAMA 2R5NA 3PI6A 4XVRA 2FSFA 1U6JA 2VFAA 5IAJA 4F3NA 4YX9A 1DPGA 1RQGA 2B92A 2LIPA 2W8ZA 4OJYA 3UXYA 2FQYA 1RCFA 1RW4A 2R6JA 5IM4F 3H1FA 3OE7D 1T8SA 1H05A 4DY6A 4YAKA 3HCWA 1JXQA 2PV7A 3HJCA 4O4HA 2I52A 2CKMA 3MEQA 4RDIA 1VFNA 3RIEA 1DS6A 3TQSA 4EQ6A 4ENSA 4DV6B 3WLLA 2V0CA 3F5QA 4J03A 4CF4A 5EE0A 1E5LA 2Y1OA 4CLHA 4UNPA 3MS4A 3FYUB 2CFIA 3K32A 4P58A 3SI7A 3BE5A 4LXXA 1B1CA 1LDNA 1DC8A 3DFFA 3HN2A 3KVRA 3DYIA 3MTIA 3N0RA 4TYQA 2G09A 3ABOB 1SUSA 1CG6A 1P1IA 4GM0A 1VECA 1TX4B 2BGUA 1GPYA 3PQ4A 4GPD1 4JI6B 5J5AA 5KYYB 4HRAA 3K9WA 3STTA 3EWSA 3P94A 2OHXA 4MI1A 4BU1A 2BZSA 1PS8A 3KU1A 4DPMA 1QIJA 2PRIA 1J1ZA 3LQRA 1MO2A 3NWEA 2GH1A 3NVDA 3PNYA 5CBPB 1GV1A 5KOHA 4UQOA 4Y2SA 4LI0A 1M5TA 4HZIA 3TI9A 2BZ0A 4X6UA 4XLZA 1V4BA 2Q41A 1YGYA 2BMJA 2C4TA 3CLKA 4YYEA 4ZYTA 1SMKA 4YP9A 2WILA 1FDSA 1GTVA 1V8DA 1TKCA 3G5AA 3FDIA 3Q15C 4OL9A 1Z0SA 3RYCB 4OXQA 4N6OA 1BMFD 5ALVA 2JFGA 2NZVG 3NHMA 1NUHA 3RVKA 1YFZA 4PEVA 4YDHB 5A2GA 3FOFC 3DE7X 2PY6A 5DP1A 5TMDA 3KLBA 3RU3A 4D56A 3G2OA 4GGMX 1BW9B 4GI3A 5SYNA 4AY2A 3EF0A 4TLCA 5AI0A 3C15C 1EBBA 3WLTA 1EVKA 1E5VA 2YDYA 1PX2A 2IF2A 4ZVQA 4MGZR 4F1KA 1NJSA 2ADFA 5HRCA 3IMCA 1SBYA 1GIAA 2IX3A 2J3DA 2GN4A 2H1RA 2B37A 1LWOA 4U7TB 4EX6A 1US8A 1T36B 2PZBA 5JZOA 2EBUA 1TUBA 1Y9ZA 1Y0BA 4OQLA 4FFSA 4BQFA 4EUNA 1B3BA 4GI1A 1QGUB 4MUGA 1MC1A 2FRXA 3PNLA 3DVRX 2DLCX 3FOEC 1TK2A 4HGRA 6GPBA 4YJ3A 3ZZ0A 2GHTA 5DISB 2Q50A 1L4FA 3H1GA 4O1HA 2JAXA 4M86A 5H3HA 4YT5A 3WO1A 2RKWA 1CXZA 1DFGA 4P4LA 1FJ2A 1SQ0A 4MKIA 2ZP1A 3RTCA 4R05A 1GZVA 3N6XA 4ZJPA 2C9YA 1KMCA 2QMHA 3LOUA 4ND1A 4CFSA 2LVBA 2VPQA 1TECE 3JV7A 3FPJA 4GMHA 5DPMA 1Z39A 3FDXA 2X5OA 1POWA 3B1WA 2IX9A 3LPLA 1FP4B 4X8OA 2XADA 4P7JA 3PC3A 1F0KA 2O9JA 4WCFB 5E95A 4DC1A 1TJ5A 2ZUCA 2VF7A 3U4DA 2C3YA 3KHKA 1NIPA 2OCPA 1VJDA 1A4UA 4HXGA 3H2IA 2Z8ZA 1K6MA 1YDMA 3AC0A 1D4ZA 4WRRA 5L4SA 4JI7B 4HV4A 2GNPA 3I37X 3X3HA 3B6JA 3CUSA 2IRWA 4KVZA 3UAXA 3BSWA 4EJSC 4GICA 5BSFA 5HJ5A 4OYHA 2Z5LA 4HDNA 3JRWA 1RWMA 1I13A 1VLHA 1YL7A 2JIZA 1WXWA 2OM2A 4ERNA 5AIAA 1J2UA 3ROMA 5IZCA 2AC4A 4PQYA 5D3MA 1S96A 1G18A 5AQEA 1VA4A 4AUMA 3IBCA 1KJ9A 2ZRAA 2IU6A 3D8BA 3DE5X 4YAUA 1UADA 2HHLA 4Y2PA 5D86A 2XSZA 3DZJA 3QA3E 3QELB 4YRRA 5CDYA 4QG3A 4N5MA 4LNAA 1FBNA 3BMQA 3MTDA 4OHMA 3WJ2A 1U7UA 3L7KA 2PGIA 4UM9D 1KC1A 3I0NA 5E0OA 1WCXA 1P5HA 2AI3A 4O2LA 4LQCA 4P22A 1RHJA 1MOSA 5HQTA 4AG6A 1WB4A 4HJRA 3IPCA 3P97A 1H3NA 2G67A 4MPRA 3KQVA 3QWIA 4XOUA 1G5FA 5AW9A 1KQ3A 3BXZA 2QD5A 1WKBA 1A8SA 1OBOA 3JPYA 3GGSA 3K9LA 4B6QA 5KPJA 4HBGA 4CWAA 2VP4A 3KDPA 3PEVA 1WUKS 2GHQA 5IZ4A 1A82A 1FMJA 4KAAA 3EVFA 3UMFA 2OL4A 3K9QO 3LDFA 4BMVA 5FULA 2EL9A 1BWRA 2D7JA 4LWQA 1COWD 3LCCA 1J07A 1UKYA 2OV6A 1H42A 2FJPA 2OBBA 3AR5A 4KG7A 2QL5A 4YO8A 5F1YA 3T0IA 1V5GA 2I3DA 3TGWA 3V7NA 3WMRA 4B6OA 3AW9A 3MAJA 1GG2A 1GPNA 1ONPA 2ZUWA 4FGSA 1H0HA 1DG3A 3ESQA 4WZAB 2ZRCA 1KS9A 1CUWA 1PJ3A 2UUOA 2VPPA 3LP5A 4J1TC 5DX8A 3DCJA 2F90A 1KGSA 2F3UA 4D26A 2C2WA 2ZJ4A 4EG6A 2HF9A 2ZBPA 1MW8X 5AW3A 2FPWA 4GU5A 4IHJA 3VAYA 1L7VC 5KTMA 2JLSA 2J5XA 1BHSA 1LK0A 1MC4A 2PUTA 4H4CA 4J94A 2J4FA 3V8QA 3AVVA 3N07A 1M76A 3HR7A 4U3JB 4FMBB 2QX7A 5BO5A 4AX8A 3UJ6A 1V7CA 2JFUA 1WX1A 3COPA 5J2TF 2CWWA 3A06A 4ZMBA 1SD1A 1KMHA 1U2TA 3G9QA 3VR6A 4QOEA 5E1DA 1ZN2A 4Z86A 2IV7A 1CJMA 2HZ7A 3SE0A 4YJ2A 2B25A 5FADA 2XAAA 4KDRA 1OXKB 1A9XB 1C8LA 3QY9A 3GD5A 4L2IB 1BMQA 5ALMA 4BRUA 5EJGA 5EE5B 4DSUA 4MHTA 3JQAB 4HLUC 4GOKA 1NX6A 1ULAA 2CL7X 1W49A 3CEJA 3PA8A 3MWEB 5DOZA 5U4XA 3OQVA 4KE9A 1U4SA 1J33A 1PUJA 4URYR 3SX0A 4H6XA 4PLGA 2C04A 5AVXA 3BL6A 1ZUIA 4MRSA 4WBNB 1H2EA 2RH9B 5CM2Z 4KREA 2F7SA 2E4VA 1JQKA 1YASA 4YAWA 1XU7A 2A0XA 1BHJA 1N1MA 3BMOB 3PDCA 4BEBA 3CUKA 2O8BB 5C8YB 2C0PA 3KQTA 3V46A 3IIJA 6Q21A 3L6CA 4E2YA 5DHAA 1A7AA 2W2VA 3DDUA 2FDXA 3ANXA 1DE0A 2QOEA 1W0JD 2OG2A 1PL0A 3A58B 2DKNA 3MERA 3A6EA 1ZIYA 4LJ5A 4CL0A 5IJ0B 3JRXA 1LV7A 5K51A 2UVPA 4D0SA 3DM9B 4MDFA 1M1NB 2XHEA 2Q5FA 4HDCA 3M9LA 1O6GA 1Z3CA 4G0YA 3KB8A 4O4LA 2PSSA 1LSOA 2YXBA 5JCZA 3TOSA 3RUPA 3IEMA 4GMXA 1F0NA 3PBKA 3K0AA 4NPAA 2KM1A 2DQZA 2D0OB 1WPXA 2VN8A 3D02A 5BUCA 5J43A 1Z4LA 4RLHA 1EM6A 2Q27A 3SDBA 1HYHA 4CR6A 5JMTA 3KTDA 3IT2A 4MJ7A 4N5LA 3CMMA 3H1BA 2FWIA 4Q1BA 5DV9A 3T8YA 3WI7A 4BP3A 3QXXA 2PU7A 2B83A 1YC2A 3VNSA 3GMIA 1CETA 3BKWA 4KV7A 4XUGB 2OHHA 2XRYA 2F8SA 1WZIA 2RI6A 3GHYA 4ARSA 2C7BA 2QLBA 1BVUA 1KFBB 2IYVA 1H6DA 2YN0A 3SKVA 4OLBA 1IM2A 4UHDA 3IIEA 1QIDA 3UK2A 2I7VA 3FPKA 4Y2XA 1ZR2A 4G63A 1UBCA 4N5HX 1HL7A 4B3RB 2JBAA 4FFBA 2QG9A 3RK0A 4RAOA 3KFVA 1D4FA 1P61B 2WTNA 1MG5A 5H80A 2NU8B 1JLMA 3I72A 2NU7B 2PEZA 1J0EA 2AEMA 3CW9A 2B0JA 2PTHA 3FZGA 4J16C 1Z45A 2ONJA 4A3SA 1HRKA 4DQKA 1MEEA 4WBNF 4UDXX 5DXAA 3E9RA 1GAEO 1T2EA 3L7MA 3DTVD 1IOVA 1GYPA 1L5WA 5TRTA 1GZ4A 4RJKA 1WWKA 4M8KA 3LGXA 4LYDA 1GT6A 5F9MA 4QSHA 4CM8B 1Y1RA 5DHQA 1KDYA 4FYHA 2B8JA 3KX2A 2PWBA 4IGFA 2O52A 3BQNB 4U7HA 4K9SA 4Y6QA 5FUVA 3RJ5A 3T7CA 4BVBA 2ROQA 5T57A 4TUYB 6YASA 1P2VA 2R00C 4GKBA 1MO3A 4H7KA 4Y0AA 4C4YA 1EK6A 1B0UA 4BVGA 2VYQA 2C7QA 4F9TA 2DVMA 3MAGA 2A33A 3DKVA 2PA0A 3HKBA 1O4VA 2FK8A 4JBWA 4QTXA 4R3NA 4Y7DA 3KE9A 2X4GA 3HU3A 2A5FA 4A0HA 2IKQA 1X80A 2HJGA 1KYVA 4BJHB 1H4QA 3D7MA 4XYMA 4RDHA 3U7RA 1KQOA 1N8SA 2A5DA 2FSHA 1JDNA 4K6CA 2XBMA 3QBVA 1XA4A 2FDCA 1DTSA 1N3LA 3K30A 3O9MA 3O21A 4IZOA 3G2KA 4JX8A 4DLNA 3H16A 3HDTA 4JC8A 2DYKA 3CE6A 3K72B 5HDQA 1ELOA 1AKWA 2VHCA 4L4XA 3UHPA 3NHZA 2AZTA 4JQZA 3TS1A 1YA4A 2EDAA 2D0PB 3MIIA 3QFTA 3SYNA 1K3UB 1BC5A 4MVCA 5A04A 2F1HA 1T1JA 3ADPA 3EOAI 2QX8A 4DM7A 1PW7A 4OXNA 4QVIA 4FQ5A 4MW5A 1FQKA 2H2IA 2PNFA 2PYZA 2V7VA 4DGSA 4IIJB 1MB4A 4CEHB 1KFJB 1KOJA 1M9NA 2H4YA 2NNLD 1NBAA 2R48A 4OTZA 3VU1A 2Q5QA 4GGOA 2XVYA 1M0EA 2JD1A 2Y71A 3I2FA 4IH1A 5EP1A 4EY4A 5LWHA 1E1YA 1Q5PA 2CYBA 1Q7EA 1GGMA 4PLVA 1QP0A 4FBGA 4MMZB 1T3GA 4HDSB 1G98A 1THZA 1X1RA 3PT5A 4P83A 2JJYA 3GX1A 1MR3F 4Q3DA 3VO9A 3WLSA 1FX1A 4Z4GA 1YR6A 3CZPA 4I1IA 3UT6A 2BFBA 2C9MA 4H17A 1JDZA 3TIIA 3U3XA 3LDUA 2CNNA 5A5EA 1JQJC 2YMPA 3WNBA 4EY6A 2YYAA 4FFRA 4IQ0A 4YH1A 4UZSA 3OZEA 2C94A 3O73A 5FOTA 3TB6A 4FS8A 1E1LA 3HB5X 4GQIA 4L5JA 4V0MA 1BZYA 4D9JA 5EY5B 1ZNYA 3RC9A 3F3MA 2NAPA 2LW7A 3H6HA 5AESA 1Y3DE 2VC2B 5CPBA 3ETNA 4JP2A 4UVEA 1PTJA 4YCMA 1WBDA 1Z37A 4C7MA 4HN4B 3T15A 1U0JA 2Q9UA 3F47A 4RD6A 3ZGOA 4EMUA 4AF6A 3MG9A 4F46A 2QZ4A 3D2AA 3NH9A 3PYXA 1H65A 2FOIA 2W6CX 5TX7A 1R4NB 1W0CA 4AWBA 2J59A 5D85A 1FNCA 2EGHA 3EA5A 1UBGA 3DV2A 3RJMA 1PQPA 1SOAA 1K1EA 2E21A 1E3JA 3JD3A 4GOXA 4PIVA 2DWOA 4ZRNA 4DA0A 5KB3A 4I50F 2HA0A 2W83A 2WHPB 2BUBA 2C3PA 4FFOA 1U2QA 5YASA 4CMIB 2XNKA 3M83A 1WG8A 2XBLA 1X7YA 2A30A 4D96A 3PICA 4YP5A 1H2ZA 3HLYA 2WWGA 2GPJA 2YOHA 1MNQA 1G7SA 1WCYA 3ZLTA 2C2XA 2PZ8A 5FI1B 2QTVA 4KNWA 2Q1WA 5GJBA 3RF6A 1SXJC 1XCMA 2LXNA 5E0KB 1NONA 5G2FA 1DDOA 1NJ6A 5CMLA 3MBOA 3QLTA 4IIJF 5H8WA 1EIZA 5BSVA 4UNSA 2ANBA 5ECYA 1RRPA 3N53A 3ZKWA 1B8OA 1E79D 3C45A 3UY4A 1SBIA 1KEEA 1VP3A 3LOPA 2C88A 1A9QA 4IDEA 3FXAA 5ADUS 4PYKA 4DIBA 3A6FA 4EZBA 3LKVA 1P18A 3GZTB 5FA8A 4EUSA 2IDMA 1XEXB 2LDXA 1VL2A 4ALKA 3WIDA 3PFKA 4CQLB 5IF9A 1PHPA 2HMUA 3L7LA 1DC4A 1I3MA 5ALDA 2XZLA 1SD2A 1YSCA 2MYPA 2ZT7A 1FW8A 3RAFC 1FDTA 4Z3DA 2ZAGA 4Z0PA 1Y8RB 4XEUA 3KJEA 5BNZA 1J8MF 2R85A 2GPNA 2R11A 1PFQA 3E03A 4TRNA 4W6QA 3WGMA 2NZ8A 2WUGA 4JL5A 1RWPA 3LPNA 4A8JA 5JAPA 4BVFA 1PU2A 4ZIRA 3LVFO 1WCIB 3NIWA 4KR3A 4XWKA 5T8KC 2HFJA 5AKLA 1NVKA 4PCVA 1X74A 4F4FA 1V8FA 3H87A 5JAHA 1X9HA 4RUKA 4QPJC 3G02A 5LDGA 2LRHA 5FBRB 2WTEA 4L1KA 5EXDA 3SBXA 5A62A 4GZ5A 1BE8A 4R5HA 3DZHA 2WJZB 5DULA 1WZCA 4FINA 3R7WA 1ZKDA 3UWPA 4DRXB 1RAHA 3U3DA 3ESYA 3QTLA 4ETNA 3EOBI 1I6MA 4Q9HA 3IEPA 3T52A 3HEAA 2G9QA 1GWNA 1JH8A 3GB9A 1GTZA 4CTMA 1SG0A 3HH8A 1KMIY 2FHPA 1I3OA 3F7NA 3TMYA 2VG8A 4BNJA 4DIUA 3KYCA 1G42A 1E20A 1P31A 1HSOA 1ZMOA 1FVXA 4X7RA 3EJWA 1IB0A 3EEBA 5SZHB 1QB7A 3SFVA 3C3YA 1CVRA 4MR9A 4R8MA 5EHNA 3PHGA 4IS2A 1DU4A 3KHUA 4OJNA 3P0JA 5B7PA 3K20A 4R2WA 4EG1A 3S70A 3G5MA 5G0WA 1WW8A 1PR6A 4Q1CA 5BVGB 2R65A 1WHSB 2ZPTX 4IKOA 4WEQA 1YR1A 4Y9DA 5KX5B 3R6LA 1DJQA 4NDNE 4C7OB 2ZCJA 4JVLA 3HYRA 5IC6A 3UGKA 2VAMA 1XKXA 3G68A 3MQ2A 1G9XA 1VCOA 3T7KA 3L1VA 3HBAA 2X1LA 1KJYA 2JRLA 3HR8A 1MXHA 5J2UA 1NW4A 2BMAA 2CUKA 3HS3A 4RKFA 4Y67A 2J3EA 1RAGA 2IUYA 4X7PA 4XOIA 1GGJA 1PR1A 2QPAA 2L19A 4CKEA 2H4HA 3UTCA 4AZ0A 2H4WA 4OAOA 4P86A 1R9GA 2FPPB 1ACJA 2WF8A 2PMFA 3UT5A 1XL1A 3O38A 4I7EA 4JYZA 4FD2A 4TYNA 1QHHA 1YTUA 3D7KA 2AX3A 3A36A 4U9UA 5JNTA 5AVZA 1N5IA 2X0RA 2ONYA 2IY8A 1ZJ5A 1TU4A 3QPWA 2GAJA 3L6EA 2PG3A 1HYBA 1UBUS 1OSNA 1A77A 3BIXA 3MBKA 1N7GA 3OETA 4I9HA 4RZ2A 4DV5B 1NVUQ 2ZVJA 4YS6A 1ZN8A 3FNBA 4NAUA 5CD9A 1BYIA 1DB3A 2DPLA 3E61A 1KI1A 1NI4B 1X1AA 4IGIA 1Y8ZA 3DXXA 3AI3A 5FL7A 3Q1LA 3AGPA 3D0RA 4QEKA 2JFVA 2ENWA 4QICA 5BUQA 2MSEB 5ICCA 2A2ZA 2WSLA 1LS6A 1T9AA 1TO6A 3GRPA 1T8WA 2XKAA 1LA2A 4M1EA 4IX9A 5FAKA 3PQEA 2VKQA 2IEZA 5LWQA 1SCBA 3BJMA 3Q40A 4NS1A 3UT0A 3PXCX 4QBFA 4UEKA 4XDHA 4NXNB 2YHAA 1LI4A 1E0JA 4FZJA 2H1IA 3GIWA 1U28A 3QX8A 1D2EA 4JP3A 3UPDA 1ZVVA 3OM1A 4MI6A 3SFZA 3CY6A 1J25A 3JVIA 4ZAFA 4CDMA 2VQSA 2WB2A 1TYAE 4A27A 4U0JA 5FJIA 1SVMA 3HRKA 3KYIB 3AVWA 2VL7A 3LE8A 1KK2A 2FLVA 3CA8A