4DDMA

Pantothenate synthetase in complex with 2,1,3-benzothiadiazole-5-carboxylic acid
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
289
structure length
289
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Pantothenate synthetase
publication title Integrated biophysical approach to fragment screening and validation for fragment-based lead discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 92
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4ddmA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4ddmA01
3NV7A 1MOPA 3E27A 1XNGA 1PG0A 4MW7A 2WQ6A 1J70A 2EL7A 2QTMA 5TEVA 2QJOA 2OV4A 3IVGA 1KKUA 1M8GA 3MLBA 1WXGA 1OBCA 1EUYA 1N2EA 3PNVA 2CSXA 4EG4A 3FG9A 2X1MA 2CFOA 5TS2A 3TQIA 2J07A 3AFHA 4MW6A 4CT0A 1F7UA 4GRIA 1V47A 1G8HA 5DB4A 1WXFA 2H2AA 1T6XA 1NI5A 2QJTA 1DNPA 1QRUA 1OD6A 2JANA 5J59A 2QTRA 3G59A 1WZ2A 3RJZA 1YULA 3IOCA 3KT8A 4CQNA 2V0CA 3Q10A 1O97D 4MULA 1MC1A 2DUMA 1M1ZA 4ZCRA 1N2IA 4MUGA 1P7PA 3N2YA 3I05A 3ND5A 4G5FA 3KFLA 4P2BA 5F23A 2DPLA 3KT6A 3TS1A 3HMQA 2XRZA 3GLVA 3N05A 1I2DA 1F7VA 1Q77A 1KH2A 1O94C 4KPUA 1ILEA 2QJFA 4NAUA 1U7XA 4MUJA 1HYBA 3AKZA 3CLSD 3ND7A 1I6LA 3ZJUA 3CLUD 4MW4A 4KPUB 1H3NA 4ZT3A 1G59A 1JZSA 3RK1A 1O0CA 5KCMA 3H9BA 5K0SA 3UOWA 1ULHA 3DLAA 1KH1A 3G6KA 3K32A 1M83A 3IVCA 2PZBA 3ZIUA 2D54A 4MW0A 1OBHA 3G5AA 1KQNA 3CLTC 1MJHA 2B7LA 5HG0A 1K4MA 1WXIA 3X1KA 5HUJA 4MWBA 1EFVB 1XJQA 4U8HA 5DEOA 3IMGA 5BNZA 2A84A 1B6TA 3SYTA 4KR7A 2A1UA 4KR6A 5TGTA 4MUEA 1WJGA 1D2RA 3VGJA 1PFVA 4JYZA 4ND6A 1JECA 3INNA 1OWLA 1ZH0A 2GM3A 3COZA 5IHXA 1IVSA 2X3FA 4J76A 3UK2A 1XNJA 3RFFA 2RD2A 4S1OA 2CYBA 1MB2A 3COVA 2Z09A 3FETA 1JIIA 3D6VA 1OWPA 3P0JA 1FYDA 1EXDA 4WSOA 4YMIA 3IOEA 4U7JA 4MWEA 1NP7A 3X1JA 2CV0A 4HPWA 3IMCA 3U1VA 1KR2A 4L2IA 2DXIA 1VLHA 1WQ4A 3A4IA 3SZGA 3N9IA 2PZ8A 3UMVA 1KP2A 3K9WA 3DPIA 2QTNA 1QNFA 4YBRA 4EF6A 3CLRD 3ZJTA 2ZUEA 1H3FA 1EE1A 1M8PA 2C5SA 1NUPA 1LI7A 3FDXA 3IMEA 1IRXA 1O95D 4QREA 3COYA 1X6VA 1X8XA 4KR9A 2VTBA 1YUMA 1I6KA 1ZH6A 3GUZA 3A05A 1KAMA 1N75A 1N1DA 3AIIA 3HGMA 1PG2A 2O8VA 1EFPA 2E18A 1JEDA 3FNRA 4XSVA 4MUIA 4CDMA 2DEUA 4ZCSA 2YWBA 4QRDA 4ARCA 2A88A 4PBTA 1N78A 1T9GR 4PBRA 1G8FA 2G36A 1KORA 2HMAA 1F4LA 1K97A 3JXEA 1Q19A 4I6JA 3CA8A 1EUQA 1IFXA 2PFSA 2WSIA 2A1TR 2HZ7A 1SURA 1QJCA 1MRZA 3LE8A 2OQ2A 1Y42X 4QBTA 1GZUA 2JA2A 3COWA 3CLSC 3DO8A 3CLUC 3ILVA 3QTBA 4NAHA 3SZ3A 2XRYA 1ZJWA 1R6XA 4MUFA 1ZUNA 4AQ7A 1JMVA 2WQ7A 3SEQA 3CVXA 5H16A 1O96A 1VBKA 3OTWA 4U63A 3VRHA 4EGAA 4UZFA 4PBSA 1O94D 2CUZA 5J58A 4ZCQA 4EG8A 1H1TA 1K4KA 1J09A 4F4HA 1QTQA 3NBKA 3FOCA 2BYTA 4EG1A 5EKDA 3PRHA 2YWCA 3MMXA 3D6UA 1IQUA 5FO1A 2ZP1A 2WB2A 3CVVA 1TYAE 1GTRA 4H3SA 2IP1A 1TEZA 1WXEA 1V8FA 2QUIA 2HGZA 5H7XA 4RUKA 3RHSA 2YXNA 3P0IA 4YP7A 2BTEA 1YI8A 3F3MA 2A1UB 2IJGX 3CLTD 4ZT6A 1G8GA 4MQ6A 3PNYA 4MW9A 3IVXA 3Q4GA 3ZJVA 4K0RA 1N3LA 1KAQA 4G6ZA 1GN8A 2Z08A 2QUJA 4R2LA 4PY2A 3M5WA 1U3DA 1JIJA 4F3RA 4I6GA 2RE8A 3FY4A 4ND7A 4EG7A 3DV2A 3HV0A 4MW5A 2QUKA 3C8ZA 3KT0A 3ZXIA 1MBZA 2NZ2A 1IH8A 2E89A 2CV1A 1TQ8A 3IDFA 1N2BA 3TZLA 3SDBA 4MUKA 1U0BB 2DLCX 3A04A 4L2IB 4ARIA 3TNJA 3S3TA 1M8JA 3H99A 1IHOA 1YIAA 1LW7A 5DASA 3IUBA 2X0KA 2GOYA 3CLRC 2NSYA 1JILA 5TEWA 1GAXA 1U3CA 1GTSA 1RQGA 4CDNA 3FWKA 2GKSA 1QRTA 3CVWA 1VL2A 1O95C 1TFUA 1JEEA 1T6YA 1YUNA 2YY5A 4XFDA 1XNHA 5LM3A 4OJMX 4OUDA 4A91A 2PIDA 1OWMA 1PFUA 4ZT4A 2VTBB 3HFJA 1T6ZA 1WQ3A 3QE4A 1IQ0A 2DETA 3MUEA 4OUDB 1N77A 4HJXA 1J1UA 4ZT2A 3ISJA 2VXOA 4MW1A 1KH3A 1WOYA 1TYCA 3LCJA 1QU3A 4EG5A 1EFPB 3P0HA 1O97C 3FHJA 1MAWA 4BWVA 4DLPA 2J09A 2E21A 4MLPA 4NATA 4R2MA 1N2JA 1N2GA 1OWOA 4JXXA 3AL0C 4XFJA 1OWNA 1N2HA 4MAFA 3IH5A 3LOQA 1NUUA 3H97A 1WKBA 1R6UA 3KT3A 5K0TA 4MVXA 3PXUA 5KHAA 1MAUA 4JXZA 5AHWA 2R5WA 2PZAA 4YP6A 1MB9A 5FO0A 4HJRA 3IOBA 5LLTA 4NX2A 4ZT7A 1VBNA 3ZGZA 1YIDA 2TS1A 2AG6A 4MVCA 1U7DA 4MWCA 3Q12A 1O96B 1PFYA 1WXHA 1A8HA 3L93A 4MWDA 4R0NA 3QTTA 3ZXSA 3IUEA 4KKVA 4G5YA 1WY5A 1Q15A 2Z3VA 3ND6A 3A2KA 3VU8A 1S4MA 3CR8A 1Q11A 1N2OA 3SEZA 4GU5A 2DR2A 1M8KA 2J4DA 3HL4A 1T9GS 3N8HA 2IELA 2QUHA 2CYAA 4TS1A 3FI0A 3MXTA 1J20A 1NYLA 2D13A 4MUHA 1IQRA 2AKEA 2DERA 3H9CA 4Q16A 2CV2A 4HK4A 1TYBE 1NURA 3UY4A 4JZYA 5J5AA 4DNXA 2A1TS 1FFYA 3MLAA 2O5RA 5HUHA 5DK4A 1KQPA 3OP1A 1EFVA 4K03A 2J5BA 1JIKA 3P52A 1I6MA 4MUNA 4J75A 3UC5A 2ZUFA 1QRSA 1KP3A 1O0BA 1EJ2A 2I1LA 2CT8A 1J21A 1R6TA 1NZJA 1JZQA 1COZA 1LI5A 4DE5A 4X0EA 1F9AA 3FIUA 4YP5A 3BL5A 1NUTA 1TYDE 2J08A 2X1LA 4DJAA 3FH0A 4ZCTA 2PXHA 3GMIA 4EFKA 4Q93A 2CYCA 3ELBA 2AZXA 1QU2A 3AG5A 1O5TA 4DDMA 3CVUA 1NUSA 4FZJA 1O6BA 3HZRA 2EJCA 4AS1A 2E0IA 4UZEA 3RBAA 1GPMA 4WNYA 1KQOA 4I6EA 2JAXA 3NBAA 4MW2A 4EG3A 1NSYA 5JBNA 4DDKA 5IJXA 1J1ZA 2V0GA 1JGTA 5LFAA 2A4MA 1PFWA 3CVYA 4MVWA 1GLNA 4NZPA 2D5BA 3X1MA 1H3EA 1BS2A 4JFAA 2PG3A 1K92A 3ZUGA 1UFVA 1VBMA 3PNBA 2H29A 4DDHA 5KWVA 1QQTA 2A86A 1M8FA 3RK0A 4E1AA 5FNZA 4NDAA 3TZEA 4ZCPA 4RPIA 4EG6A 1NUQA 4MVYA 3TQOA 4ZT5A 3H05A 1CT9A 3SP1A 3L92A 3IODA 3AG6A 1JHDA 2A7XA
chains in the Genus database with same CATH superfamily
1U65A 2YBDA 3H2JA 4J3FA 1C50A 1XNGA 1QO9A 2C5FA 3T5MA 3SHTA 5I8WA 2Q29A 4HLNA 3HB5X 2BTQB 3QNUA 1MOZA 3IDAA 3TI9A 4TZTA 3KQUA 4PX5A 2FWAA 1E0AA 3F4BA 4DV3B 1W0CA 5I9TA 4F91B 5C46F 4AZSA 1QIGA 3HLKA 4QQNA 5BMOA 2EW1A 4F93B 3Q8XB 4G56A 4B6QA 1UMCB 4FGJA 4ZQBA 1LK5A 3I6ZA 3ZU4A 2D62A 4FMPA 1ENYA 3TVTA 1K27A 1VKZA 3CWZA 3IHKA 3LPNA 1XU7A 3WGVA 1Q7CA 4PQYA 3QJYA 2X9LA 1RYMA 4MWTA 5B2FA 3ELUA 5IYZA 1RQPA 1E66A 4H6WA 3Q7SA 5B3JA 1JPVA 2CJWA 1OA1A 2DRIA 3QOXA 5LMZA 4A73A 4WBXC 2C4TA 2GEBA 2NX2A 3QBTA 1TC2A 2PVSA 3UFXB 1TTPB 1N0UA 2YN2A 3WBFA 1HLFA 1MXFA 4MULA 2C96A 4MJ7A 3SMQA 1YVPA 1R9JA 3TLMA 5AJZA 3SZOA 2AKAB 1CQJB 1KMNA 3TJZA 4BX9A 1TA4A 2ORVA 1P73A 3UMFA 5KNCH 5FT9A 3CO0S 3WDKA 1V7CA 2HWYA 1MC8A 1YE3A 3R8FA 3C3WA 1BCRB 5LDHA 1Z12A 3U4CA 2J0UB 1G17A 3HBLA 3NTOA 2IEIA 4CUJA 3ZY6A 3PQDA 1KH2A 4ER6A 1Q2UA 1Y5IA 3V1UA 3W5UA 3HP7A 2Z3WA 2G40A 1TRHA 1U7OA 3AKZA 4D41A 1LBIA 1QHGA 3B2QA 2LW7A 2IKQA 3GV0A 1YKGA 2XNDD 3B5EA 3LPAA 4JCCA 2PA0A 2OB2A 1K8QA 1VJDA 3GFPA 4MVJP 4RV9A 4N7MA 4YRJA 4KZKA 2O07A 1PJBA 3BG5A 1D2CA 2RK6A 3PU6A 4OSEA 2AXNA 3HM2A 4Y0VA 1ADFA 2D1SA 3C74A 3FCXA 3QQPA 2GF2A 3N3BC 3H1BA 4GD3Q 4IUDS 3U26A 1ULHA 5BWLA 2I52A 4GZ5A 2GS9A 4R8KA 5KYUB 1ZMOA 4MVJM 3PJFA 1Q57A 1KDZA 3RGWS 2LE0A 1SUBA 2LRHA 2XNCA 2YYYA 3MJHA 3WHLA 2IIQA 4XX0B 2FN9A 2XNSA 5ITZA 1O6GA 4XZ3A 1R16A 2D2VA 4JYMA 4KFTA 2Z6AA 4LKOA 5EE3A 1VCHA 1ZR4A 4AXXA 3VR5H 4GPTA 5AVRA 1OFHA 3OQIB 1WNFA 3MIIA 3X44A 4UD6A 1GNPA 1TGVA 3FYUC 2VA8A 1VLJA 3IKLA 2JLWA 2XTNA 3T5DA 1IPEA 3IEKA 4MWBA 3WLQA 1SUAA 1T2CA 1XJQA 1NL3A 5BV7A 2ZBDA 2A7QA 1U4NA 4H08A 1EGHA 1N1EA 4HDCA 2DUUA 2XTJA 1XX6A 2JGRA 3AFNA 3IBSA 1BE6A 1ZISA 2PKCA 5EE5B 1BDHA 1W4BA 2HRZA 5LYJF 1AGRA 1NZDA 5HP4A 3M9XA 2Y0PA 5A5DA 5KOJB 5A5FA 4E6EA 3HBJA 4MKIA 4IFEA 1QP0A 3KD2A 1OWLA 4OLJA 2I1WA 2DBYA 3GLQA 2VK8A 3HC7A 2DQKA 3OMXA 1KGDA 3WGLA 4QDTA 5HEKA 2FSGA 1G66A 4J0CA 1P1IA 2JAHA 3U49A 2A92A 2BFFB 3L06A 1NLMA 3HG7A 3MFQA 3TMYA 3PKJA 5SZIA 1EFKA 3ROEA 3NDJA 3VO2A 1NLYA 5EE1A 2IY7A 3IURA 3EBOA 5E3HA 1NR1A 1R37A 3L40A 3KR0A 4YAUA 1LH0A 3ELYA 3QF4B 1FDTA 1NMQA 4LQ4A 3QF7A 4I19A 5KOHB 4LHZA 2BGGA 1J39A 1UJMA 2NTJA 2OGSA 4ND1A 3FUUA 4AMUA 2G9VA 2GBPA 3QVKA 5HJ7A 4IQ4A 5C8DA 4L4RA 1KEKA 3HK2A 1Z26A 1X7YA 3N9IA 5EZYA 1IHUA 1CJMA 1VBFA 4DA9A 2LGJA 3I9NA 2PGOA 4J1TC 5GAJA 3TIGA 5AR1A 4KIFA 1XJ0A 2R47A 2WFAA 2Y4OA 3DPIA 4GLFA 3KSBC 2FKNA 2P5UA 5ENVA 3HVRA 4XH9B 5BSMA 4PINA 4XUGB 3V48A 2OMEA 1DPFA 3EMVA 5B53A 3R44A 4Q1EA 1WP9A 3GRRA 4FFBB 1GGHA 1SBNE 2G63A 3IPXA 3DMRA 1PFKA 4WK0B 4TN5A 2ILTA 3RFVA 4NZNA 4PX3A 5B64A 3FDXA 4RY0A 5JV5A 2ZIEA 4UCFA 5KSPA 1ABBA 1G291 1EJ0A 5IMSA 2CXXA 4JLUA 1GUAA 1HZJA 1E5DA 1I6KA 1LWOA 2FQYA 3V8RA 1CU1A 5JAOA 3A05A 5EESA 3EW9A 1X1AA 3CRVA 1OZGA 5IBRA 2RH4A 1T1SA 4N6OA 1ZD2P 5AI9A 5E1DA 5FBLB 1PL8A 2KB0A 3TTXA 2H4XA 2YYZA 4K86A 1TO2E 3VC7A 4RGQA 3EZFA 1QHNA 2E18A 4WCVA 1LVHA 1YR2A 4IMPA 1AJEA 2WKPA 3PX2A 1AURA 3D8TA 1CQIA 3HVHA 3DDOA 3IUPA 3PL1A 2GEVA 3LNCA 3LWDA 4G5QA 4PHHA 2HBRA 2Q8QA 4NZZA 3WMEA 3D1VA 3DOJA 5B6IA 4PPQA 1NHGA 1QH0A 4PBRA 5AVVA 3CISA 3QPDA 1HDGO 1PJCA 2WBLC 1V11A 4NHOA 1PJTA 3RTEA 4AF8A 5KCZA 1K97A 4P92A 2RBEA 5BSUA 3EXEB 2COEA 1WLSA 1J0XO 3DV9A 3NGXA 1E6CA 1P9NA 3MWDA 4P32A 3U2QA 1U1GA 2CBZA 2A1TR 2HZ7A 3UA4A 2OHJA 5H80A 5ED4A 5U4XA 1R0XA 3PZBA 2B7BA 3KTOA 1A9PA 3PEFA 3TL3A 4R41A 3ME5A 3FFBA 3GYGA 2C2GA 1IBSA 1Y42X 3COWA 3I2GA 4GW3A 1RVDA 1IEWA 2DB3A 4F0JA 5TQ2A 1SIWA 3ESAA 1A72A 1C7EA 2W83A 3IAS6 4LHYA 2JVKA 5B7NA 2XCLA 2DMRA 4ZI7A 4MUFA 2BHNA 2FW8A 2O50A 4YRQA 4NJOA 2FCAA 5FUBA 4P4NA 3VXKA 4DCJA 1POWA 2WQ7A 2NPFA 3M7IA 2CF6A 3EX7C 3RRMA 2VF4X 4AIIA 3KZOA 2ZE7A 1LEHA 2ZRIA 3OIFA 1Z4IA 3W34A 1KO8A 2FEPA 4LJ9A 3AUXA 1T0PA 5T3UA 2P9ZA 1AV7A 2DTEA 2VAPA 3JQ7B 4AJIA 3YASA 3VU9B 2I4IA 2HEIA 2JCXA 3UGKA 4EK9A 1OPRA 1JHMA 4X1KA 3BDVA 1GZ3A 4C4YA 2JLUA 3CIOA 1JA9A 1GA6A 2JFGA 4V0OA 3WHKA 2EZ4A 3DEFA 4G0XA 1HKUA 1SZCA 2GD1O 2ZYVX 4PF1A 5EKDA 5I4BA 2F4NA 1W36B 3AVTA 1RR6A 3A4MA 3D6UA 1NVAA 4CCSA 3V4RA 4YCCA 3P71T 5K09A 2R0QC 1ZNYA 3SQLA 4MVJF 2OCYC 1TYAE 2FTKE 2CXPA 2VXYA 3DAYA 3IB3A 4PFSA 2GJKA 3T7RA 1TEZA 5IEJA 2PMCA 1PZEA 1EA7A 3R7LA 5K20A 5EQDA 3L1IA 2YV3A 2ZYIA 1V3VA 2IXGA 1H9AA 4ZQFA 6Q21A 2E85A 4Q7JB 4RD3A 5AKXA 1YHNA 1A88A 2JASA 4NCIA 4H1WA 1TQ2A 3SK0A 2AOTB 1H94A 3GPCA 4AC9A 4IKEA 4MH0R 3WAGA 3ZHZA 1Y89A 5H70A 5A7HA 4POAA 3WKAA 4WLFA 1SD2A 1U1IA 2F55A 1KJQA 1UOQA 1B3BA 3NIDB 4JJFA 5BVGB 5LQNA 2QZ9A 1EA5A 1DRJA 4G65A 4LE2A 4QICA 3GGJA 4G0YA 1YJ5A 3GGGA 3NHJA 2G5TA 1JQJC 3BGVA 4WH0A 5EMHA 2BEUA 2I2FA 3DAOA 1JLLA 3OE1A 4GF5A 4P2GA 4HGQA 4Z3KA 2E1PA 2RC5A 4JR1A 1JVSA 4GI7A 3JAKB 4CU2A 5GONA 4F3RA 4OXQA 4ND7A 4TTVA 4NYIQ 1MO5A 2B21A 3RNOA 3UPDA 5K03A 1SVWA 3JQAD 4L27A 2C78A 3PNOA 4TWZA 1GIAA 1L8XA 4AURA 3IPYA 3OUZA 3KOUA 1LBEA 1DRWA 1M7BA 2AR7A 1KRHA 1X7XB 3N5CA 1N2BA 4ZKDA 1DO8A 4DZRA 5JAPA 1QK4A 1A5AB 1AN0A 3QKUA 4ZZ0A 4LZAA 3UATA 3S3TA 2EX4A 1JSCA 1U7ZA 2G25A 3VPGA 1W2HA 1XZ8A 2WQZA 2LCQA 1JFLA 1JN0A 1GTL1 1KAGA 1E6WA 1T2FA 1C81A 3IR7A 5KVQA 2WV9A 2YXPX 2YY6A 5IARA 4OCZA 2HY7A 3W5BA 5AXCA 4XB6B 1EQUA 1DXHA 1PUJA 1CR1A 2P2SA 5E8JA 3EIQA 4KRYA 4OBXA 1F14A 3AM3A 2ZS8A 3CF4G 4OHMA 5DX8A 1KHHA 5J1SB 3OMLA 3TCNA 2JJ2A 2Y6VA 3G2JA 4UU8A 2PXXA 2QT0A 3DTNA 5JCZA 5LPNA 3QU4A 1S2IA 2DWCA 2Q3DA 2G4CA 3RYCB 4R9VA 2R68A 3QE4A 2XCUA 1TW2A 2OILA 4I4TB 4KYTA 1W4CA 2GLXA 3L49A 1V9SA 3LI2A 3TWOA 3WL8A 4DIMA 4JP3A 1E8MA 3DOHA 3IAS1 4RDIA 2OM6A 1AKUA 1RTKA 1JLMA 2ZAIA 4FTWA 3VUEA 3PUKA 4P3YA 1G18A 1WB6A 4ZQEA 3GJTA 2AEJA 3ZGLA 3T12A 4C78A 1ZCBA 3TKYA 3UBTA 1RLJA 1GTJ1 1JU4A 2FMXA 3FHJA 3G5TA 5JEEA 1JEYA 3IXLA 1Q0SA 1XTVA 4CM3A 4KVAA 4PYLA 3SHQA 1TPZA 4IS2A 3DMDA 3FZEA 4X7RA 4F7DA 4FGWA 5L3SA 1XNRB 4XR9A 1FYEA 4HDNA 2JHAA 3K0EA 3K2QA 4JSTA 4DT1B 4HQLA 5L3QA 4K2HA 3D4OA 1DKLA 4LX0A 4DCCA 3B7PA 1Y9JA 1M66A 1CUVA 1R66A 5K9ZA 3P2OA 4UM9D 3DSRA 3BRSA 4CHTA 2JJ2D 1KI9A 1WZNA 1QKKA 1YS1X 5SZJA 2NSJA 2VHUA 3OMWA 1WCV1 1RWBA 2MSCB 2O20A 3EAQA 4B3JA 2C82A 3U7GA 3MWKA 3SYKA 4FDVA 4JOQA 1FC0A 1TQDA 4OF4A 2RSLA 5HDBB 1NAHA 1E58A 1O9HA 4P8RA 1QGYA 3BWBA 3HCFA 1SR8A 2NVBA 2A9OA 4LC0A 5KQMA 5FUVA 5FWXA 3C16C 4S1VA 4L73A 1IN6A 4MWCA 4RENA 1P0QA 5CITA 4LWQA 4E3WA 2FG5A 1I4LD 1NVVQ 4O8ZA 3WGZA 2J46A 1VFPA 3O8BA 2GN1A 3GA7A 3F6SA 3MJFA 2FZ4A 2B8EA 1Z8NA 2BFBB 4UTRA 3WGMA 1BMTA 2NVOA 2VTKA 1DJOA 1JKJA 3DYVA 3UAVA 3IT1A 4PC6A 3KQPA 5LOVA 2IW1A 1E1QD 2FJPA 3B3GA 5IEBA 3UCFA 4YHBA 2EJVA 2G80A 1E2GA 1JAXA 2DERA 2PMKA 2EERA 2B4TO 1M7GA 2AIRA 5AI0A 3JVVA 4JX8A 3PPIA 3HP4A 2COKA 1DBVO 3KB6A 4OBBA 2HK9A 3B82A 3WZMA 2O7RA 1JKXA 4BNMA 4C2TA 3DNMA 4Y1FA 4FGSA 3ZCPA 4BBAA 2AMLA 1O0BA 1EJ2A 2IHVA 3F5FA 4JJ8A 1J21A 4JENA 1NZJA 2XUAA 3G9UA 4YRLA 4CF7A 3IP3A 4YJ3B 4GOND 1FMFA 2YIVX 3NR2A 3O74A 2WUEA 2HJGA 1T6NA 2R6CA 3OA0A 2RIPA 1LJ8A 3FH0A 4IZ6A 2DTXA 2VYQA 2C1EA 4UBLA 5IXJA 2PTGA 1EZ1A 2ZYWX 3KL2A 1QAOA 5EIFA 1Y34E 4GI5A 1UJ2A 4TT8A 4BX8A 4BFLA 1GTG1 1YK0A 4FC6A 1O6BA 4OLFA 2QN2A 4YMTA 4GO1A 1KPHA 4LUCA 3RUFA 3HXTA 4G8JA 4HDMA 3ZCUA 1NNLA 2WFLB 2GBCA 3QNWA 3GCGA 3OIUA 1GPMA 1YU6A 2W4QA 1L6IA 3BJZA 4KLNA 2WWGA 2G70A 1TECE 4WNYA 1X7GA 3ZI4A 1DDOA 3ETLA 5LB2A 4ZYZA 1IEXA 1E6UA 2P3LA 2C2KA 3UANA 2IFTA 3D3EA 1MDBA 4YLGA 2YHIB 3T61A 2GBLC 3VDQA 3NEPX 2N75A 4BEVA 3KRTA 2H1IA 4G5RA 3T9BA 3A3OA 1M54A 2V7GA 3OM9A 3RSHA 4O6VA 3E48A 3GG9A 4QDOA 3AFIA 1N2XA 3DDWA 1LZKA 1CUCA 4JB2A 1GQQA 2GCEA 2JFVA 2RK4A 4US1R 1YCHA 4F84A 2VR1A 2EV9A 4H1UA 4MVYA 1DSSG 4TN1A 2IGTA 3T7DA 1CT9A 4G0WA 2XOEA 1QS0A 1T2DA 4J0IA 3QKIA 1GTRA 1WQ1R 3STXA 3R3JA 2AFIB 4G67A 2PCLA 2IITA 2ORYA 5AK3A 1ZK3A 13PKA 1JHRA 1Z6ZA 3ND8A 4AW9A 4CMEA 3EF3A 1HDZA 4YMSA 3DMPA 4IDCA 3IO3A 3UB3A 1DHTA 1YH3A 3RYFB 3W05A 1K8XB 3UJ9A 3C7CB 3U17A 2VRCA 1U9IA 4QAJA 1MO2A 1ISRA 3AW9A 4FHZA 4FOSA 4E5UA 4CKEA 4P7JA 2OLKA 4NJEB 4Y67A 2X5JO 1X86B 1XVUA 5FLKA 4JAVC 3WB2A 4EW6A 5ECYA 2JAPA 2ACKA 3FG9A 3V46A 2PL9A 2YWEA 4JA0A 1PWXA 4XLLA 3WL5A 1ZI8A 1I2MA 3TZHA 5LZ8A 2PUBA 5CDSA 5IWAB 3JTEA 3RAEC 2VQDA 3IJRA 4EW1A 1IK6A 1TUBA 1THMA 4PXAA 4CIAA 1N6KA 2RJNA 2EEZA 2RCNA 4F21A 1NLUA 1O4VA 2IYZA 2G82A 4N5DA 1XL0A 2ABWA 1J7JA 4O2RA 3AUSA 1E8DA 2W2QA 3VSDA 4M1OA 4BQQA 1O97D 3CWCA 4QGGA 4ZCRA 1M33A 1MRSA 2ZBGA 4OP1A 2A56A 4CKXA 3G79A 1CE8A 3CE9A 2YVUA 2HCFA 4MS3A 3LXMA 4JQYA 4BVEA 4EX6A 3J81A 1TZBA 2OC4A 3ZE7A 1A69A 4P4LA 2ZRDA 3BFVA 1AT1A 3W3AA 1TKRA 1JWLA 2YKGA 1PR9A 1KVRA 2VF8A 1ILEA 2R48A 1X87A 3DTVA 2AUNA 2WHPA 2NTVA 1F8GA 5EJ2A 2WZQA 5BWNA 4BP3A 1XLWA 3H2HA 1UBEA 3PDUA 3MGAA 4I46A 4WA8A 4CKBB 5EIEA 1N36B 3Q6IA 3CLUD 4YV0A 3GWGA 1U63A 4NIMA 5SY4A 4W99A 5DBEX 2CNOA 2MYUA 4RTMA 1UWVA 1JZSA 1V3QE 4V0NA 5DMHA 4HDKA 5KNDA 3AJ9A 3O0DA 2NU6A 2YY7A 3UOWA 5B58T 5K0NA 5C3UA 3ZKWB 2HQ1A 3BSYA 1CZOA 3IOYA 4QGAA 4EHAA 5K0ZA 1Q7TA 5KX5B 1DJNA 2VNKA 4UBNA 4XWYA 4DR1B 1GADO 5JS8A 2D54A 4MW0A 2ZXUA 1TUEA 4XB1A 3SQDA 1MO6A 1HF3A 1Q7EA 1RDFA 4RLSA 3G5AA 3B20A 1RZVA 3PIIA 3JVUA 2RBKA 1VE6A 3E7XA 3PT5A 1T91A 4JLPA 2NU9B 2P6MA 2O57A 4TLDA 4WN3A 2B4KA 1WXIA 3W3AD 1NLZA 2VEDA 2H0RA 3FMVA 3H4MA 4G8BA 5E0OA 2JLZA 4U8HA 2WEKA 4XVRA 5DEOA 1Z4NA 3OJCA 4HAVA 4CV2A 1IBLB 4C4RA 5CJ2A 1U8ZA 4HNAB 3SC4A 3EMOA 5BSKA 3DWIA 1H22A 5D6NA 3U4MA 3I2KA 2BGJA 4I8IA 1H8EA 2X2FA 4BQNA 3EWAA 3RUDA 1CX9B 1II8B 2QQFA 4R9RA 1Q16A 2QL5A 3QEJA 4KLZA 4LE1A 1EP9A 3ROGA 1QZTA 3EF1A 1ECBA 1W19A 4F5ZA 4JYZA 3ES9A 4FEYA 3C7DB 1AKNA 3OOSA 5AW9A 3TSYA 3G8YA 3E9CA 1ZY2A 2V7QA 3IL2A 1JDTA 1I3CA 2Q46A 3FLBA 3BKWA 4XSHA 2B7CA 4DSAA 4HX5A 3G2HA 3DOIA 4WK4B 3FETA 4JXKA 4LTMA 3C39A 1XC7A 1NMXA 1C0EA 2FWBA 2IPOA 2IVZA 1F2UB 2QQGA 1IPHA 3WSVA 1OI4A 4LWPA 3SYMA 1U0NA 1FPQA 5I9IA 4WKCA 4K6HA 1VI6A 3H9UA 2R4UA 2CK3D 4OYRA 4QQRA 3I4FA 4UMFA 4LRSB 3QPUA 5ALWA 5A62A 3U7QA 2HF9A 5JD4A 2J9ZB 4EPXA 4L8LA 2V1UA 1CUSA 1GG2A 4U2GA 2R751 3X1JA 4HT3B 4QVKA 4HTFA 2CV0A 3FA2A 3VVLA 1A2QA 1Z62A 2CC2A 1K8RA 2H57A 3ZN2A 2HJWA 3AVWA 2QUBA 4R81A 4R84A 2QW8A 3A4IA 2FSVA 1AG9A 2F17A 3U3OA 5KHOC 2IOQA 4FOPA 2YV1A 2H2DA 1KERA 3D6AA 3QX7A 4YT2A 4GC5A 4OBWA 3ILSA 3DZDA 1M6VA 1OH5A 5M2QA 4ACAA 4G89A 2REBA 1EUDA 2QRQA 2QRZA 4IGKA 1UBUS 3F98A 4TUYF 3DL7A 5KWSA 3HUDA 1QLJA 2QAJA 2R8OA 2VT6A 3I4CA 3QBVA 1DJMA 3KNZA 2V7QD 3EIUA 4MRMA 3WL3A 3PEUA 5BSTA 3WK7A 5KNBD 1X92A 5G53C 1N3IA 3EBLA 3IEMA 4URUR 1JT9A 2I2DA 3A37A 3DE0X 4FYWA 4W6ZA 1QHXA 1BYUA 2BWJA 4OIFA 3W5CA 4OBEA 3V80A 3LT5A 2AN4A 2ESRA 1ZXBA 1I4WA 1C9YA 3AO0B 3OQBA 2VP9A 4JT4A 4QOHA 1QNLA 3MWGA 1EFCA 4P82A 5SZHB 3W8RA 1ICEA 3C24A 3AYZB 1E20A 4XSVA 3EWNA 1K5DA 2WJZB 3QV2A 4OJYA 4RYLA 2DEUA 3KYCB 4K6CA 1K0FA 3OU2A 1JFFA 3K0FA 1HFJA 2Q8NA 2QB5A 2XKJE 2OO5C 5DHQA 3S28A 2CB9A 3VHXB 4DAOA 3VR4A 2HMUA 1KORA 4AROA 1CRQA 2XCTB 2YWHA 2B1JA 4CG0A 1IN4A 4CZ2A 3NJ4A 2CL0X 3CA8A 3T3NA 4F1KA 2MINB 1Y7TA 1FK8A 4HFNA 3D4BA 1XMQB 3J7AC 4GI2A 5ECWA 1AZWA 3H5IA 4INAA 4DBLC 1MPTA 2CWWA 2OQ2A 2C0QA 3KVYA 4IKOA 3HJGA 3TE7A 5JATA 4JV5B 2R6AA 5JAUA 3GLIB 2JA2A 3MWDB 4Q47A 4DR2B 2GYUA 5DM1A 3AP2A 1BU8A 1WR8A 3V7YA 2DTDA 1PNVA 2IBMA 3I12A 4IO1A 1GAWA 4NAHA 5IN5A 3SZ3A 4CEIB 4DREA 1R6XA 1MEJA 4QKQA 4M7OA 4AQ7A 1Z7GA 2ZBUA 5HRUA 1X7DA 3BK2A 4X41A 1MABA 3NIFB 5LYJB 1GPKA 5I7OA 3CB4A 3LQ2A 1BKYA 1EX1A 4IXWA 3UJAA 3E9RA 2BI8A 4AIRA 4BVFA 2J9RA 4A36A 1E32A 3RQIA 3GNSA 3MUNA 3D3QA 4C01A 2PV0A 2CDCA 4REOA 3GDOA 3ADCA 3PQ6A 3VR4D 4NU0A 3VZSA 1B42A 5IKOA 4O08A 3W0LB 1JQEA 3E8SA 5IT0A 4LXXA 3A1EA 1L3BA 3ML1A 2A0WA 5FOWA 3GPBA 1QAQA 3QEMB 3MCUA 3BMQB 4I4LA 4QXOA 1WXEA 4D9FA 3FTNA 5AOCA 3H86A 4BMPB 1Z0SA 2YINC 2OFWA 3LHIA 1WEHA 2OCBA 2QRVB 5I4CA 1UIRA 3I8OA 4DSTA 1G8AA 3OKFA 3RVSA 4QOIA 3NORA 4XVQA 3WTCA 4X6YA 3DZHA 4E5KA 2VCYA 1PQPA 3VKUA 1FP7A 3A9SA 1UJ5A 1EE2A 4QLOA 5BVHA 2Y68A 1ZM7A 1D3AA 2ZTLA 3QE3A 3SIWA 2ZM6B 1YQDA 2FSPA 2YXDA 4S04A 2FP4A 3Q4GA 3AHDA 2W00A 3U16A 1T5BA 2ZWMA 2P78A 4L0QA 2H4ZA 4I99A 1N5MA 1BVYF 4NBLA 3SJ7A 1I01A 4QATA 3T1YB 4CEJB 1D6JA 2XWSA 4KEAA 5HCIA 4BRZA 1U3DA 2QG4A 5EJ5A 2FMUA 4I9FA 4OAOA 3KYIB 1YAJA 2BCJQ 3B3JA 3HSYA 4L02A 4U2EA 1SUWA 3CX6A 3M6WA 3F2IA 3JR3A 4XD7A 3PE6A 4MITA 1D09A 2XQJA 1P7CA 3HKDB 3H5OA 3OLVA 2H0AA 5CNIA 3NNNA 3CF6R 4GMFA 4Y1RB 2JCGA 3DAPA 1ZD1A 1YB2A 4PNHA 3TNJA 3X1DA 1DAFA 2ADMA 2N9UA 1HT0A 2RHWA 3JWIA 2JRLA 4TLMB 1H2ZA 1VCMA 4B3FX 1YE8A 1AQ6A 3DGEC 5KYXB 3GFTA 3RHZA 4BU1A 2NSYA 1IB0A 5A6VA 2D5IA 1ZN8A 3BL6A 1U7WA 2MSWA 3AR7A 4OQEA 2X0EA 4BQIA 7MHTA 2XQGA 5F2KA 3E61A 4P81A 5ABPA 5LIRA 3KK0A 6REQB 1JA1A 3E7WA 4Q3LA 3RF6A 3TPFA 2P1ZA 4OU4A 4XFDA 4LXQA 1DX6A 3VI3B 1UUFA 2ZZMA 1IY1A 1CETA 4FKZA 4QXRA 4IJVA 1OVGA 3JYOA 2PRJA 2PIDA 1VCOA 5LQMA 1OLSA 4BMYA 1Q0ZA 2R62A 1CRPA 5CFNA 2EXXA 2HJ9A 4PGHA 4BHTA 4BVJA 4UNQA 3MB8A 3EVTA 4OJTA 4U3JB 1J25A 5DW0A 3T5BA 1NXTA 4YT5A 3FOAA 4ZEWA 2PLAA 2D4HA 1D7AA 3OSUA 4JYAB 4N54A 1DMSA 4PV7A 4AJ1A 4K0KB 5J4VA 1J9GA 2ENWA 3GEHA 4BVGA 4L1KA 3OEEA 5FFFA 3N3AC 3WO0A 2IY9A 4GLOA 4ACBA 1EJBA 3ZDBA 3OC0A 1VKRA 3G9TA 2BHTA 1BS1A 2WTUA 2WD7A 1B73A 2Y76A 4D2IA 4YQFA 4C2AA 2OXFA 1XXLA 2VPXA 3MWJA 3OAAA 3L0OA 4KNVA 1RZRA 4TLLB 2GJ9A 3L8FA 3KEGA 2R6DA 1IDOA 5JH7B 1K6IA 5BUZA 5IH7A 1JB9A 3CUTA 3OCCA 1Q7GA 5L7WA 4B31A 2ZE5A 4DG5A 1GHTA 3Q7EA 3JW8A 3O4FA 4W9NA 5C5DA 3KT3A 1K68A 2I87A 2O8EB 1MVLA 4IIHA 1NC3A 3HKCB 3FNGA 2W2TA 2WOOA 2FR0A 2X0FA 3FMOB 4X6LA 3BCUA 2HQBA 4YP6A 1ODFA 2O7NA 3KKOA 1DDGA 1EEXB 3BERA 5ED0A 2VSQA 3ZUPA 2IYPA 3EXFA 1E7QA 4ZD6A 2E4WA 4L4ZA 2VUUA 1YR8A 2OCAA 2Q3HA 1C8BA 1T3LA 1PX0A 1U7DA 1O5IA 1AHNA 1XZHA 4C0BA 5IS2A 3P19A 3CX8A 1IB6A 3PGVA 3ZY2A 3U48A 2GVNA 4JUAA 4DANA 1GEGA 2HXGA 1KAOA 2RKBA 3LUFA 4X9XA 5BN3A 4F4JA 1GUYA 1LUAA 4PAQA 2VNSA 4EAAA 1EVZA 1XYVA 4MGZR 4ZXPA 4P0TA 2YJGA 5LP6F 2J6HA 2YW2A 1XEFA 5LP6C 3MXTA 2H2FA 2QY6A 5CTAA 2CXSA 4AMGA 3EXG1 4L9WA 4WOKA 3TXXA 3HRKA 2RH9B 2AKEA 3HI4A 1UZNA 2FEXA 3F5QA 1ZIOA 1PEDA 1IJEA 1QFJA 2JEOA 4QG3A 1ECGA 4DNXA 2EZUA 1UFQA 1NR7A 4Q9NA 3PYMA 2L2QA 4FX5A 5HMMA 2NIPA 1N9GA 4LOJA 2B6NA 2VF2A 3IV6A 1KP3A 1P39A 2WUWE 4PQRA 5KKCA 1RRKA 1EU1A 1W75A 1ZI6A 3P27A 1C9JA 5C34B 2JGLA 4DLRA 1F4VA 1ZLXA 4DMRA 2HU7A 6LDHA 1COZA 4LOIA 1FNCA 3OETA 2Y77A 1P5ZB 4BUJA 2CE7A 3GMIA 4OLHA 1DP4A 2O7QA 3STVA 1EFLA 2GILA 3K9BA 4OPMA 1MV5A 4BV8A 1QU2A 3KZXA 3QPBA 3CSDA 4KRFA 4HX2A 1N1MA 3P1JA 3ZE1B 2YMQA 3DOEA 2W6NA 2I80A 4YMUA 2A9KA 4W5NA 1VFNA 4HLUA 1D07A 4F1WA 9ATCA 2UZ0A 4PX2A 4DSZA 4AS1A 1RFLA 1Z63A 4PLTA 2PSEA 2I6SA 1HM5A 1YBFA 2CDRA 1SELA 2I03A 4R9SA 5BOVA 2Q07A 4R1OA 4U9UA 4HGNA 2ACWA 3ORQA 4YT4A 3CE6A 1OT5A 2Q6KA 4N18A 3CO5A 2JW5A 3F8SA 1HOTA 4K6GA 4YJHB 3L0SA 3UMCA 1SD5A 4EFNA 5B5SA 2A4MA 2GRJA 4LSWA 4K9RA 1U0LA 3VISA 1RYFA 3PRKE 3OZWA 4JFAA 2PG3A 3SQWA 3ZUGA 1G42A 5GTDA 1NG1A 2AL7A 2Q4TA 2ZSHA 3DCIA 4PG4A 1JAZA 2P27A 1EG7A 4G0UA 1KHTA 2GPAA 1QPZA 3RYIA 1RHQA 3JQ9A 1CERA 1I9CA 1PT8A 4OQFA 3VH2A 5L51A 3VNVA 4EG6A 1FU4A 4MTCA 4TT3D 4EHDA 4Q0MA 2W2PA 4PPGA 4UQOA 4CCAA 1LDNA 4KDFA 4C22A 3L92A 4OHBA 3BFPA 1JHDA 4HR7A 1E1YA 2QTGA 3EZLA 3U60B 3MJRA 4LYAA 1VPEA 1Y8RB 1E89A 2YZKA 3L0ZA 3TLCA 3DTYA 4XI9A 5LZ7A 5ALDA 4GX0A 4HGPA 4P4TA 5AO9A 1ZW6A 3KTFA 3VSBA 4BNNA 4OK3A 1QO0A 2GF9A 2OQIA 3L8YA 1E59A 1Z74A 1KVQA 1PG5A 4R8MA 4ZDWA 5ICFA 3SVZA 2J1LA 3GDHA 2BR5A 3VX4A 3WIDA 1U8CB 1Y3IA 1XTTA 1Y98A 3PPVA 1WXGA 5CIWA 2VYCA 5HBGA 1U8UA 4NQRA 5E7MA 4JCOA 3FVRA 3L0YA 5AW1A 3UK6A 3C97A 2R6FA 3IV9A 3UEOA 1RT9A 5KSZA 2D0IA 1D1QA 3OE7A 3RC2A 3EA0A 1VCNA 2HO4A 2EL9A 1OBFO 5CNJA 1LJLA 5DI9A 2XXAA 2F3UA 5DTMA 2WILA 1YZNA 1G9TA 2EP7A 3HE3A 3I9KA 4JJKA 4W5RA 4IICA 3UJHA 1DIOB 4F5WA 3A10A 1EWQA 2VSFA 3VHLB 1EX7A 3STTA 5JBQA 2QSYA 2NXNA 2ZJ8A 3E5HA 5A6SB 5TDHA 1Z8FA 2EP8A 3KT8A 3SCZA 4E33A 4QXPA 2IH4A 5D6OA 4CQNA 1I7DA 4QWMA 3HCBA 3QPAA 1MX1A 3KWJA 1AZLA 4B17A 1J7KA 4TVOA 3KKNA 5AK4A 3TOXA 4D4LA 3CF2A 4FT2A 1LVGA 1MH9A 5AM5A 4DKXA 4WCFC 4ZHQA 4BNXA 3HMQA 1KBZA 4AN1A 2WAOA 2Z3ZA 4KPUA 1O94C 1Z6XA 2Q5CA 4GBMA 2HSWA 4NFSA 4PNPA 4TMKA 3RARA 2AK2A 1WHSB 4Q9HA 1ZEJA 3M4NA 4HWSA 1KAEA 4N03A 4ZI2A 4R2WA 1DEKA 2QTBA 4PZ9A 4DMMA 3NUGA 1KY2A 4I36A 4UEJA 2WIAA 3OE7D 3L0PA 2X0IA 4P33A 1O0CA 1W0JA 3HBMA 3A1VA 3GFRA 3RBVA 3C3CA 3QYFA 3EODA 2NUPA 3NQ41 3OZDA 3OU7A 4IIYA 2HB6A 1SO8A 4B5LA 3RTBA 2NAPA 1Y8ZA 1PBTA 1PKEA 1RJ9B 4R7GA 4MQEA 2PZEA 1RAAA 4WW0A 1YB7A 1N32B 2GNPA 4FDMA 4KQCA 1W87A 1ZYUA 3TRHA 2XQKA 2GN0A 2A67A 4C14A 3EQ2A 3DKIA 4Q19A 1VRVA 1RE1A 1X38A 3OPMA 4GVXA 1K1EA 2GEDA 3EDYA 3QU2A 4ZANA 1Y3DE 2ZI4A 4WJZA 3IMGA 1OZFA 4LNUA 2NZJA 5CT4A 3TD9A 3Q8WA 4H3KB 4LNHA 1GZ6A 1EXNA 4K6FA 4WOPA 4AB1A 5C5EA 1KEWA 2O2GA 2YXLA 3P2KA 4P53A 4ENTA 1E2FA 1X42A 1WJGA 4G09A 1SQ0A 1ORIA 1GQ2A 1HKHA 4S2EA 1JQ5A 5CMLA 1OFUA 1R74A 4OSPA 1A5BB 2BFEA 3BZBA 1W0JD 2EFYA 3INNA 2Z1MA 3SQNA 4O4LF 3NANA 4Z2AA 4M37A 2EEPA 3CT6A 3WRYA 3RS0A 4DY4A 1Z4KA 2Y27A 3OG9A 2ANCA 2ZAOA 3BSWA 1I94B 2XUFA 1CUZA 1IAVA 2GHTA 2V4ZA 1NVUQ 1RXVA 4RA9A 4TTAA 2Z4SA 2RGWA 5C1IA 1XL1A 3L8HA 1T9CA 2W2LA 5A4KA 5IJ9B 1LPPA 4NESA 1A4IA 1QFSA 5P8WA 1UP7A 1A8SA 3EC1A 3IBYA 1DI0A 2VOEA 2NWQA 3OF3A 4PPFA 1TCVA 3IAAA 3SF8A 2WTAA 4LCJA 4C76A 3E9EA 2GA8A 4BZQA 1PDOA 2BH9A 2C94A 1GA1A 2FUCA 2JJ1A 3A06A 3DBIA 4KI7A 4TLEA 4UAGA 5DWDA 1J6UA 1S2DA 2QVGA 2WZCA 1EUYA 1OHHA 1S2LA 4LKRA 1C7ZA 1FX0A 4TSFA 2GETA 4JOBA 2A5YB 2WP8J 4KV7A 4PONA 3I61A 4J0GA 1VL8A 4ZCLA 2IPXA 3S6JA 5K4HA 3UMVA 3ZWVA 1XB2A 2RHBA 3C6BA 4HH3C 1KKMA 1WSAA 4J1QA 4P7FA 1T4BA 1KI6A 5E6UB 1DS6A 1RAEA 4YBRA 3BMOB 4Z7JA 4EF6A 3ZJTA 1YB1A 3UJ6A 1M8PA 3A25A 3B89A 2XB2A 1TLLA 1ZXXA 1SOMA 5MN6A 5NLLA 5K4GA 5AJWA 2PJRA 4YXWD 1L5MA 2Z8YM 3RAFC 4Q02A 5C80A 2XLBA 3ZDXB 1ZM3A 2JFHA 1G6OA 3BE5A 3R74A 1SXJC 1XLTC 1DHRA 3A26A 2W2LD 2WAXA 4ANFA 4MKZA 1XAHA 1I10A 3BRWD 4HDQB 3FE2A 3HRHA 4R2HA 4RJKA 1N1DA 3M89A 4BNUA 4JP1A 1R4NA 3EVFA 2DFNA 1X1TA 3F5SA 3K1JA 1P29A 2JJ1D 1PWEA 3QNMA 4J3JA 4C7JA 4F8EA 4B3RB 2LWIA 2C00A 1NWCA 3AESB 1VJ1A 1HI9A 1OHHD 2Z4TA 3HI6A 3NT5A 1OF1A 4Z4CA 2YJ6A 4JUBA 3NOOA 1WV1A 5A5GA 5K8VA 2C4WA 2YWBA 4ARCA 1M10A 1ZVQA 2GM5A 1LNSA 3NJRA 4AECA 5LP1A 1N78A 1FXSA 4AU1A 4PHTA 2JI9A 2ORIA 2Y0BA 3HWWA 4A6PA 2X8LA 3TZCA 4EAQA 3TFWA 4R54A 4RGBA 1DELA 2VZLA 5FCDA 4CBVA 3B5JA 5ALPA 1N2CB 5JAIA 1R4MB 3HJRA 4EKIA 3RDPA 4YO7A 5DTRA 1ZA1A 3H2YA 3I45A 5CX1A 4QPZA 3LE8A 2IEGA 2CVZA 3LG2A 3GJXC 4CFZA 3I5XA 1GPDG 2R25B 3D8BA 1MA3A 3FAZA 3MBOA 3C6KA 3O3MB 2RHDA 4GGMX 5AKZA 1N57A 3FOEC 3AVXA 2V7EA 4N49A 2C98A 1SUDA 2BMEA 1COWD 1B8OA 2DFPA 5KVSA 4MV0A 4L3WA 2P7HA 2ZS9A 3QYAA 2CFCA 2F8LA 4DF3A 2B3DA 5TNXA 1QGUA 4H15A 4NCXA 4BX0A 3CVXA 5FUYA 4ZIRB 4FQ5A 2KS6A 5A4JA 3VNRA 3INYA 5IYZF 1G98A 2C4UA 3GD7A 1GCOA 1ZCFA 4R1TA 3R23A 5AUOB 4QC2A 3TCXB 2PUEA 1A8PA 1Z5GA 5B3JC 1NQWA 3H18A 3D3KA 4Y98A 1FXUA 4YWJA 1MABB 1JHUA 3LA8A 4MK4A 4H59A 4Q3EA 3LDGA 5FPSA 4C0XA 5CA0F 3L8ZA 5KDDA 3ZCQA 3O8QB 5BQXA 1PYDA 4RF2A 1W0KD 4RE6A 5U1PA 4EMTA 1HZZC 2ZUWA 2VPPA 2ZB7A 2QIPA 1MN6A 3FZQA 4OAQA 1EBUA 5C53B 3HSKA 4JT9A 2RGNA 1CR2A 5L3RA 4NFHA 3UWOA 4Z53A 3W77A 4YP0A 2WU8A 4YAFA 2C4HA 1V8FA 1NQUA 2VPWA 2ZR8A 5EUBA 1APBA 2BPOA 1KMIY 2ZRPA 4CV1A 2MSKA 1W5BA 1PSDA 2VA9A 2X13A 3R5JA 1YZKA 3UWSA 5CFPA 2IHUA 4ZC8A 1E1RA 1YFZA 1RWXA 2PUCA 2IOFA 4RUKA 3ZWWA 2XDAA 4MQ5A 3RFUA 1H5UA 2PT5A 3PFHA 1XZFA 2YXNA 2V45A 5BRNA 2JLAA 1WPQA 1KO5A 3AMVA 4IIUA 1YASA 4KQWA 1XKQA 3OLQA 4M87A 3BB4A 4UPDA 2XWPA 3PX7A 3EVDA 4EJFA 1A50B 4ENPA 1CZUA 1U1CA 4P22A 4D97A 3U7FB 3CN7A 3F6CA 1KU6A 3KWFA 3IAFA 1M2FA 4IUYA 5U4QA 4BMOB 1NN0A 2W0MA 3C6MA 3LYAA 4RXUA 2XB6A 1PFQA 1KAQA 4RSGA 4PXYA 1G1AA 2QPLA 3OFNA 5TPWA 3SFTA 3PI7A 1QKJA 4RHCA 3CFAL 5D85A 1KJJA 5GVRA 2QD4A 5EYPB 1FIUA 4HAXA 4QNNA 4MYSA 3I9LA 3FUTA 2H4WA 2HFKA 1JIJA 2XOKD 4KAAA 4OHRA 2FWIA 3G2MA 3FMFA 2QVYX 4BYMA 4MW5A 2OBBA 3KT0A 1OROA 1Y33E 2CMGA 3LQKA 4C4SA 3C6QA 3GB9A 3WYFA 1IH8A 1OLUA 3EZGA 5I5EA 5K5EA 5CW1A 2CV1A 3LF1A 5BYAA 1ZI9A 2WJJA 4N5MA 5EIXA 4H4EA 3LXXA 3P2JA 3AB7A 3AXTA 4C6TA 1QRUA 2VDOB 1IZ9A 3L4SO 1VLLA 4XIYA 1W581 3LDHA 4RZUA 1QP8A 3QUQA 4EHJA 2ZIWB 2XNHA 3T0IA 3QSYA 2O0JA 3TSAA 1ZSYA 4D9NA 3ANLA 3OF5A 4D0NA 4YPOA 5CXUA 2E1RA 3MTGA 4MP3A 4PHCA 4RVGA 1RNLA 4ZP1A 1QF6A 1HLDA 2VDWB 3OCUA 3N8DA 5WRFA 2W70A 3AOGA 1WF3A 4XAQA 3DT9A 1AKWA 3OZXA 5HGXA 1T6YA 3HBFA 1JNXX 4HHEA 2C3PA 2F1OA 3L6DA 4P5PA 4PG6A 4Q3CA 5IK2A 4DCPA 5K6TA 2WLTA 4DDUA 1QP7A 5HGJA 3KU4A 4BFSA 2JRCA 4MQBA 3D8SA 2VTBB 2OZKA 4LVOA 3RTDA 4WZBB 4E03A 2YJZA 4HFJA 1YDMA 1S01A 2D2EA 3IXQA 4HWKA 4NLLA 4KDCA 4X60A 1OLSB 4G0PA 3T41A 1IXYA 1H2BA 3CNQS 1Y3HA 5C32A 5JDIC 5HKKD 3ZBTA 4EG5A 5M3BA 5EZYF 3DL4A 4CR8A 4P54A 3BTUA 1WTAA 3V00A 3TDMA 4J43A 5KYNA 1ZKMA 4EKNB 2MDTA 5DM0A 1E3TA 5DCWA 1JSLA 5KC9A 1L5HB 4GC9A 4WNAA 1U0GA 1ZRMA 1FTGA 2QP3A 4JXJA 5HHTA 3C8MA 3ACCA 4ZV7A 3FPLA 4QYSA 4ZEOA 2PUFA 1X77A 3HNOA 4LMBA 2ZI6A 1HE2A 2NSLA 2TRSB 3BA6A 3IH5A 3K05A 4JIMA 1C9EA 1E1MA 2WD7B 2UZAA 4UDYX 4CF6A 4N0PA 5G0VA 2QP4A 2KE5A 3V42A 2PEZA 3A36A 3L46A 4URZR 1J8QA 4OXXA 1WCWA 1R6UA 4DC1A 4ETWA 3U44B 5AICA 3VKHA 4L8VA 2WSSD 1NW8A 3FSGA 3PFKA 5FA6A 5G4KA 5AHWA 2PN1A 4DQXA 5K8IA 4QEDA 1F2TB 3DMYA 2FQ1A 1IOLA 3ZHSA 1TMOA 4N01A 3H9JA 3V4SA 1TC1A 3K6JA 3QEKA 1ZUNB 4J0QA 4MR8B 1YDHA 2AJDA 4NJMA 3IMFA 5L6MB 1ZEMA 1BX0A 2HWWA 3OPQA 1ZD4A 4RL6A 1MH1A 4MB0A 2CFSA 2PWBA 3TM4A 2EW8A 2RKOA 1YQGA 1E18A 2G9QA 3CW9A 1Z5ZA 1SZJG 3IHTA 3NNSA 2HFJA 4H31A 3CUVA 4JT8A 2FWMX 2FRVA 1RFGE 1NA5A 1SY7A 3WGHA 5LDDC 1L5QA 2IGBA 3PFNA 2DX7A 4S1WA 4MS1B 2Y0EA 1J8YF 2QUAA 5BN5A 3ONNA 3FI0A 2Q27A 4BP1A 4DV4B 3ZQJA 5CLLA 2D13A 1WU7A 2R8XA 3WRVA 4XCQA 4HFRA 3R6LA 4N47A 3IRUA 3J7TA 1ECCA 3U13A 3U4AA 4R68A 3D8NA 1DCTA 1PNRA 2IHBA 2PKEA 3I1YA 3MJTA 4RF5A 5C4IA 1NNEA 2Q21A 3E9YA 2XTZA 1LLCA 4FHGA 4ZI7F 2I7TA 1XA3A 3U9LA 5I9NA 1CB0A 3VPHA 3ZLBA 4ZJYA 4QBFA 2I1VB 4UU1A 2Z58A 1DU4A 1NQVA 1WBJB 4HEHA 4NMWA 3JQBC 4QBKA 2JZOA 3WK4A 3KKLA 3V9AA 2EFCB 4YP5A 4DE5A 3KSUA 1Q0UA 3EPHA 2OZLA 1QAMA 4ZYYA 1R8YA 2AOUB 5DYNA 3KJFA 1F0PA 4O4JB 4AZWA 4Q4AB 1FEZA 1GUFA 1UMDA 2X7XA 2ZUBA 3GUYA 4PCAA 2C2XA 3Q3HA 2ZSAA 4WN9A 3BAZA 4LBZA 3K2BA 3LBIA 3TOSA 2I7DA 4DDTA 4HXFB 5EQFA 1P5HA 5IM4A 3QSGA 1G9SA 5LZ2A 3UH1A 4Y1EA 1WLYA 5MGNA 3U4DA 1V39A 3HJBA 4RIHA 4B84A 5C51B 1Y7PA 3AR8A 1BQ4A 1NW9B 3NATA 4R5HA 3OZTA 1PEKE 2REOA 3LGXA 5FUWA 4JVMA 2GK6A 1JFRA 3EZXA 1VL0A 1S96A 3BMNA 5IJXA 4Q18A 2FN3A 4XUCA 2X3YA 1D9ZA 1JG6A 3WJ7A 1A5TA 1PFWA 1AHHA 1M2VA 2QDKA 3P9NA 2I3BA 1JXAA 4K9LA 3GLFA 4ZOLF 4P5EA 4JP2A 1I30A 2NT3A 3KSRA 2IUSA 3M6VA 3N7UA 4M4SA 2DR0A 4MKRA 2A52A 3BGDA 4OKSA 5TJ9A 2UYHA 1O03A 1WMEA 2DSTA 2WAYA 4MIEA 1B0ZA 3EOZA 5KHAA 5T7BA 4DJ5X 5A9SA 1P2SA 3BFJA 3M33A 1YBHA 5AI5A 2O2DA 3CZRA 4HADA 4YPFA 3TQOA 4BFYA 1GL7A 1MW8X 1U3VA 3WYBA 3LVFO 4IJUA 2UV8A 4O33A 5FPKA 3I62A 2XA9A 3I9FA 5G3ZA 4AJPA 9MHTA 1SVLA 1PT9A 4GPZA 7YASA 4F97A 2NUBA 1LTHR 1I14A 3DBVO 4G0QA 4LDPA 5IXSA 4M89A 4WOJA 4QD3A 2V5VA 1DKOA 2QTMA 3QG5A 4YCNA 2GAAA 1XZPA 2IZ5A 4PG5A 4LNAA 4M49A 4ZVMA 1QLHA 3ZGYA 1N2EA 2VDUE 3LC0A 4V38A 1FJ2A 1Z5VA 2LCFA 3JZIA 4EG4A 2WHRA 1W96A 3VR3A 4AWBA 4FFMA 1UBTS 3FYCA 2D7JA 2IHKA 3JAWA 2VDRB 4K9OA 1ZDMA 1U31A 1Q17A 2V7BA 2OHFA 1BC5A 2D1YA 1QV9A 2VBIA 2AK3A 3F6BX 3GVCA 5AOAA 2H3HA 1QR2A 2VT7A 4RPHA 4DXAA 3VM6A 4BMZA 4MWGA 1AZTA 4UTVA 3R3WA 5ALYA 4Y6OA 2A8YA 1T9AA 1QG0A 1CVLA 3R9KA 3OQVA 3BXFA 3TIXB 4YGXB 2C3YA 1AKMA 4CNQA 2OD2A 1AZSC 3PPXA 1MC1A 5MN4A 2VOJA 4UJ3A 5TARA 3LPLA 2HH9A 3N2YA 4RBNA 2XJ4A 1OZAA 2J5RA 5L95A 4XJXA 1QK3A 2D59A 1FDWA 3DOOA 1N6PA 5JJLA 5C0OE 2ZWAA 1C1DA 4GLLA 4RKFA 4AUNA 2WSYB 1Q77A 5F7ZA 3THXA 2GD2A 3WC4A 1GKKA 1JQDA 2RAPA 3DCYA 4ZU3A 2IEAA 2UYGA 4FEAA 1HYBA 4UXIA 4JLWA 4R69A 4PLCA 2N0SA 1XYGA 4FFLA 4YACA 2O59A 3DP9A 3RVOA 5JD6A 4KPUB 1THGA 4HWRA 4RJ2A 2B9VA 4QTZA 3WHPA 2O8BA 3R8CA 1E3WA 2K6GA 2R6R1 2WTNA 2Z2JA 3MT8A 3ST7A 2P79A 2XUJA 3T5TA 2IE8A 2NXCA 3WB9A 4II7A 4CE6A 4CXMA 1C3EA 2FDXA 1W9HA 1Q91A 4O5AA 3OZVA 4RAOA 1LFAA 1VIDA 3AT1A 3G6KA 3IQDB 4JI2B 3JZMA 4Y3UA 2ACEA 1KK0A 2BZ1A 3PDJA 1EAMA 5CRIA 4LF4B 2V8BA 2L17A 4EMSA 2BISA 1KYQA 4D9KA 5CFOA 5LVAA 1QTNA 3ABIA 1RRVA 3K0KA 3OQ6A 1P60A 2CVOA 4KWHA 3ZLUA 4AY5A 2OAP1 4E7PA 3ZLTA 2Z1DA 1FP4B 2V65A 3CLTC 4EMUA 1EM8A 3C41J 2PVPA 3KWLA 2PRKA 4MQEB 1T34A 5F12A 1K4MA 1OX5A 2K7ZA 3DMTA 3DQPA 1SCIA 3GZ4A 3NRJA 4MRVA 4BVBA 2VT2A 2JLRA 5DGTA 1OU4A 1Q20A 2LCIA 3V2IA 5HUJA 2FSIA 2UZ4A 3AJDA 1NTOA 3BPSA 3D5EA 3SC3A 3SYTA 4W1QA 3H13A 4I50B 5C3MA 2PH5A 3R0QA 2CZQA 4IVQA 1ZESA 5JI2E 1MV8A 1T9BA 4UOQA 1S1MA 1SBCA 1UOOA 2JH3A 3MBIA 3PFFA 3EY4A 4OI0A 3LLUA 3PNLA 3TZKA 3G7SA 1NJ8A 5DXJA 4BMXA 1L4KA 3D9QX 2Q0HA 1GPUA 1KIMA 2ROQA 2WC1A 1Q1NA 1ZHHA 4ND6A 1Z5UA 4PC2A 1NOKA 3PNSA 4RM2A 3NDIA 5LOVF 1U5AA 4E30A 3RFFA 5FBWB 4DS3A 1VZ3A 1M1YB 4Z8YA 2ZIZA 1MB2A 4FYVA 1II0A 4QLBA 3A1TA 1V8OA 2R8EA 1O58A 4MUMA 4CV3A 3RFCA 1JH9A 3K31A 1Z28A 3PJEA 1Y1RA 2RAUA 3RC9A 2P62A 3C1AA 4D43A 3IBGA 1RXUA 2VJNA 3UT5B 3HR8A 1KZYC 4WLVA 1U4SA 5TLSA 2QOEA 4Q1FA 4PQEA 3UICA 2PBLA 4WA7A 3V8NA 3QXSA 1BIFA 3KPWA 5DYYA 1G5FA 3WGYA 1KDOA 4XARA 5LCXA 3U1VA 2KHZA 4UEWA 1SCQA 1B43A 5G0UA 1R6BX 3R76A 1IIRA 2AT1A 3P4YA 3EW7A 4IG9A 3A2NA 3VZRA 3JYLA 4BPBA 4S35A 4YS6A 3B1JA 1D6SA 3HFGA 4UVGA 1R7RA 2BGLA 4LDRA 4OKIA 2A30A 1SQFA 2OCDA 3ONDA 2H00A 2Q99A 3W8NA 3UB4A 5EJ8A 5HS6A 5HK8A 3I34X 1EDOA 1QGAA 4NCAA 2NZVG 2C5SA 2BEVB 4KZPA 4XCXA 5H59A 2OEPA 1F48A 3DG9A 1QHEA 2O2HA 3F4LA 3PGLA 5F52A 2AN5A 1RXYA 1Q0QA 1UBLS 2AW3A 1RPJA 3EAFA 3EGDA 3ESRA 3QG1A 4WCFB 5FOSA 1SA0B 3UJDA 4ED9A 4RTNA 3GLGE 2AVNA 4YUAA 1QGDA 1PTJA 2BZGA 1XTSA 2ZYSA 3H8VA 2O8CB 1ZH6A 3LRXA 4JJ7A 5JAMA 4X66B 4L4YA 2RHMA 1T43A 1ZD5A 1CY2A 2L69A 4ZARA 5JRZA 1CJSA 1CQZA 1NOJA 1R50A 3PR1A 2OBFA 1E64A 3NBZC 1RPTA 1DTWB 3BWMA 3Q2IA 5TE9A 4AKTA 5HJ5A 4OQXA 2Q7OE 1I80A 4L7QA 4CMJA 5BN4B 2J33A 3D1JA 1HFEL 1B8PA 3II6X 3V1TC 3ZNPA 4ZEMA 1WD5A 1BEEA 1L8QA 3ZQKA 1V7QA 2DY0A 1LU9A 1QFMA 2IF0A 3KIPA 1W34A 4N3CA 4Y30A 3O7MA 1I3MA 3CB2A 4L6AA 1JIUA 1LB1B 4DR4B 1U8AA 5JZOA 3EARA 4WIAA 3OX1A 4IDAA 1NI4B 1LD3A 2ZWIA 4HI0E 3IE1A 1DJLA 3LL7A 2E4ZA 5I7UA 3ZXXA 1YJQA 2WSIA 2FH5B 3UHAA 1H2EA 5KJEA 3V8BA 2ZDHA 1ZVVA 3FNBA 1CFJA 2SCUB 3U5TA 4S24A 5FYDA 2NYUA 3B85A 1W8DA 3FJOA 4N3BA 3MUFA 5D3MA 3ABOB 3IUJA 3MRVA 1H4VB 1XRPA 3P96A 3QPWA 1GU1A 3QLJA 4P83A 2ZXFA 5FPHA 3N6RA 3PWTA 5AVYA 3RLFA 2PKXA 2RI6A 3CLUC 3OIDA 2PCJA 5C52B 4D9JA 1CEXA 5CX1B 3KYBA 2FP3A 3TFOA 1W2WB 2BFDB 5AI8A 2D8AA 2I6GA 3HJCA 4MA5A 1PWZA 3DHNA 3I8SA 2SECE 1BDJA 5H16A 4M1ZA 5GJVC 5CDFA 1K88A 1PLJA 2JFQA 4DMUB 4F3CA 2XH8A 1WBBA 4PBSA 1YTLA 4PTYA 1JU9A 4ZCQA 4GGOA 2HA5A 1M0TA 2P2YA 3D7RA 3C3PA 1UKCA 1E6MA 3ZWDA 2GHIA 3C2QA 2BE7A 1MTZA 2Q0QA 4G24A 5EUQB 1HE1C 1LBSA 4CM8A 4IS3A 4Q7MB 2RETA 4J1NA 5KNLA 1K5HA 1LDGA 4XOIA 4EJ0A 2G77B 4B2YA 2I8AA 3KSDO 3QELA 3ADKA 3KSAC 4DEVA 1FSGA 1Z7BA 3JWEA 1POXA 1YR6A 3TR0A 4BKUA 4BE4A 3AVVA 2IXDA 3G2OA 3IKMB 4B40A 1FJGB 1MT0A 1U0FA 4KLRA 4XOUA 5E9JA 3L82B 4BB6A 4W5OA 4RMJA 1V16B 1P4RA 3CWQA 2EF0A 1KOGA 4BKOA 1EVJA 1AY0A 2JGDA 3CT4A 1YQWA 4ZYLA 4QRHA 3ZY4A 1DAMA 5FF9A 3PF8A 3ITKA 4GUDA 4JD5A 4WZ6A 4KE6A 1UPUA 3LCRA 4MQ6A 4UE2A 5FUXA 1V6CA 1XZBA 3NHFA 3TLYA 1IEVA 1MGOA 3RIGA 4I55A 1UJ4A 2VPIA 1JWBB 1SU8A 2A3NA 1KNQA 4JJEA 4RPGA 5C9ZA 2VLIA 4KAFA 3ZXUB 1JBEA 5B57C 4G6ZA 4EFDA 1SUSA 4GZ6A 2G1UA 4DA4A 4DUPA 3QHQA 3GPDG 3UZUA 2DCUA 5HM8A 2J6IA 3GT7A 2C58A 2WYHA 2GPSA 5E9WA 4ZZ1A 1E6LA 3O94A 5CFQA 4IV8A 4UJ5A 3QXCA 2OP1A 1KF0A 4CFSA 2Q1XA 4WOCA 1I0IA 2QUKA 3AIOA 3EIEA 4ADSG 2HUPA 1DKRA 1WUKS 2J67A 3R2JA 4FNGA 4MVJI 4MI1A 4DKJA 1ISHA 1KYVA 4EKEA 1WXDA 2MU1A 1R0BA 4DMFA 2BFCB 2OOKA 3KXDA 3QWHA 3A04A 4TYMA 5FJJA 1K5PA 4YJDA 1EQAA 1MGPA 4TL8A 3CNLA 1M8JA 4M21A 3IJEB 5TF4A 4P4SA 3U62A 1MPXA 1LW7A 2A58A 3IUBA 1Z8HA 3F7OA 5DASA 4DJTA 4Z9FA 2XX3A 4CL3A 4XWTA 1JEOA 4U2KA 1U3CA 1X7WA 1JSXA 2C7VA 4IRMA 4DCTA 2AHOA 5LWHA 1QRTA 4N0MA 1SC4A 2YUTA 3N7TA 3C3JA 4CMAA 5HKOA 3OVMA 3RIHA 5DIFA 1WDLA 2W6PA 4HXYA 7REQA 4L5AA 3C3AA 4JI6B 3AEUB 5J2TB 2PX2A 1XROA 2NXEA 4A2PA 1NG9A 4A91A 3KXKA 4ZAZA 4U39A 2NUAA 1N0WA 3U3MA 1FSFA 1SAYA 2OGFA 4PU0A 3KYDA 4FLEA 4C30A 1Z25A 1K6EA 3HB0A 3GN1A 3AF0A 3KLBA 4W1RA 4HJXA 4YREA 3T0GA 3K70C 4FS8A 4CLRB 4C9BA 5KTOA 1VG9B 2H1FA 3BEOA 5BN4A 2NYRA 3DLCA 3RG2A 5M34A 5CDGA 1MKYA 4DN6A 1YI0A 2O3RA 2R8YA 3EK2A 3MJDA 4M1WA 1BKSB 5C8YF 3VDRA 3DBLA 1AD2A 1N8NA 3H5AA 3JARB 5JNVA 2IZOA 3HXKA 4JSYA 4M1KA 3Q9SA 4WKGA 3T06B 3D4IA 5LLDA 1MO3A 3ODGA 5CA0B 1OJ7A 4HZIA 3LRPA 4BNDA 4X65B 1UZLA 2R86A 1XMXA 3DLTA 3QFSA 4MLCA 3TNDA 2BKLA 2PEYA 3PDIA 2PM8A 5CFMA 1R6VA 2NXJA 4KXFB 1FXWF 4PZZA 2H52A 2PY6A 2FVXA 3AR4A 1CJTC 4BJHB 4OXIA 4D80A 3SZRA 4BNHA 3MJSA 5IVIA 4DPKA 5CPFA 4WLUA 5AKIA 2EKPA 3Q3VA 5ENDA 2EQBA 1Q14A 1XDZA 3D5QA 2HYDA 3KPUA 2BUCA 3O82A 1PD0A 1JPJA 4TWRA 3DR5A 3GLHA 4J9UE 3EQ6A 4HPJB 3ZWBA 5AVTA 1XZIA 4QU8A 1WUTA 5FO0A 1SHJA 2DFLA 4CLHA 3FJ1A 2NUTA 3REQA 1TFRA 4FQ7A 4MVCA 1EVLA 3D6MA 3AGQA 3QVXA 4H16A 3RWMB 2VQFB 3U4GA 3W5VA 1S02A 4X1IA 4MIOA 4US0R 2DULA 2FG6C 5CEJA 4DILA 5M29A 3GPIA 1DKUA 3BK1A 2UUOA 3AQ4A 3D2CA 3AI1A 4FBMA 4H0FA 5F9MA 2D7DA 1Q11A 3A6DA 3TB4A 1XKXA 3BJIC 4BGVA 4Q1VA 2ENUA 3ZEAA 1TA9A 1UBKS 1DZ3A 2G8LA 2PT9A 3A6JA 4U5QA 4ZGBA 1G2PA 2ZRMA 3ZK9A 2ZJ5A 4FFOA 1FFDA 1NMYA 4FGLA 1JFVA 2P1DA 2W22A 3PD1A 3UJ3X 3OP1A 4L6CA 2JDIA 4ZVVA 3EA4A 2J5BA 1JIKA 3U9SA 1JXOA 1M2JA 4JNCA 5KI6A 1G7SA 4F5YA 4A5SA 1CC1S 3MD0A 4AMZA 4CGZA 2CT8A 3W5JA 1F8UA 3T9FA 3ENZA 3VDXA 3THWB 4QGSA 2XW6A 2W6MA 4IDOA 2WTBA 4KQ6A 4G1FA 4CF5A 2GPBA 3L7YA 3SSMA 2O8DA 5IVKA 2IHYA 3KBBA 4DCVA 2GASA 4OP3A 4BO6A 4FN4A 1JAIA 4LXYA 1EH5A 3IHLA 3ENWA 1DWQA 1PV1A 3KVVA 5CXXA 5L7TA 1Z38A 3W2EA 3DYIA 4KI0A 4XVUA 1W8IA 2YNMD 3HFSA 5ADWA 1JR2A 4PC7A 2OBMA 1E79A 3ZGVA 1H4SA 4CEHB 1BVHA 2X86A 3Q0TA 5D3KA 2CKMA 4KK3A 5JEDA 1R18A 4ZREA 3K1AB 4L8GA 3V8QA 3WYCA 3F7NA 1XTPA 2MSEB 4U7TB 4TTRA 1Y5LA 3E0QA 1JGTA 4QJ4A 2B34A 1YJCA 2WWTA 2O3TA 1SB9A 4NZPA 3GDGA 3PLNA 5EXTA 4YAOA 1Z82A 5TT0A 2QN7A 2W6ZA 3TR5A 4K9KA 1UFVA 3TOVA 4JUCA 1TUGA 3N2NA 4AJ4A 3MW8A 2GUWA 5E2BA 1A1VA 2YVKA 2WU3A 1I8TA 3G2LA 4EB6A 4DR7B 4AG6A 3AHEA 1E9CA 4FYXA 1U02A 4U6QA 5FV7A 3N2GA 4A16A 4QT4A 2JKZA 2O52A 3OIWA 5EKSA 4ILEA 3SP1A 3SPXA 2NU7A 4AZVA 4AKGA 1DRUA 1E9SA 3I9OA 1EKXA 2BGMA 4KYUA 4F72A 4IMJB 2FN7A 2B4YA 1NMEA 2K2WA 5J2UF 3VKGA 5HUQA 4MW7A 1KK2A 1ZK1A 2Y1WA 4ZVQA 5CW2A 4BNYA 5LQKA 2PIAA 4RJIA 3RF7A 5EHZA 1YVUA 3MRXA 1G5TA 2O0MA 5GM1A 4BBJA 5BSEA 1H69A 5JMOA 2BF4A 1FNMA 3DWGA 3IVGA 2JFWA 3T3IA 2H8GA 4OAPA 3O7WA 2GX6A 1OGIA 2AMFA 1R12A 3B53X 1U7PA 2FPRA 2HBZA 1Q74A 3H8WA 4KRGA 3THSA 3W2IA 3TGLA 3N2KA 4BU0A 2FW1A 3CLVA 1C8KA 2OAGA 1VECA 2P3OA 4YJ2F 3W3AH 4Q7LA 4CT0A 3MSCA 4LA4A 3U9TA 4REQA 3W5AA 5DB4A 3FLMA 4CCWA 3I72A 5JVDA 1QONA 2XMGA 3EIOA 3OI7A 2HRDA 5LNK6 1EUCA 2ZYGA 1CFZA 3CU5A 4M38A 4JL6A 1PUIA 4V0LA 4KBYA 2B83A 3BILA 4GOOD 1U2GA 4UUQA 3KR2A 1QTIA 4E1BA 1FTQA 3EC2A 3GEBA 3PA8A 3PGJA 2KYRA 2GNAA 4IEEA 5DLEA 3RWBA 4B3IA 1A77A 2YYAA 2BT4A 4DIKA 4KVZA 4NYMR 3CH6A 4Z1OA 5DEIA 4WXRA 4XM1A 4AJOA 2Y1DA 4BZWA 3BIXA 4EDFA 1V41E 4IINA 1NXPA 3AIMA 3USCS 2X9VA 4M0PA 4JGIA 5EMKA 4A9AA 4DIEA 5JY1A 1F7VA 3S7TA 4QPNA 1JI0A 3OOHA 3M82A 2YWGA 1I3NA 3D0RA 1U9YA 1UZAA 4Q4DA 2FMKA 3A6FA 3N75A 1EIWA 4B6SA 2YOHA 3WMXA 1ID8A 3WZLA 3U40A 4BLSA 5EZSA 2R2AA 2ZROA 5K0SA 2DBQA 2QE6A 4R98A 3E3LA 1E0DA 4Z1MA 4E5MA 2H92A 4GI1A 4NICA 3A7DA 5HNKA 4PR3A 1AB6A 1IMJA 4GNKA 4WDRA 2XXBA 3BTVA 1U3UA 1Y1KE 2QRGA 2JFNA 3JQGB 3ZE2B 3K32A 2PZBA 3S2UA 1FFSA 1RIIA 3JQAB 1DRVA 1EFDN 2M32A 4CM4B 3OT4A 1D03A 1NJGA 2LBPA 3AUTA 3VR1A 1HOXA 1IVYA 2EJWA 2CNWA 4HFMA 4LRTB 4RFSA 3PLRA 2HSDA 1D9XA 4W9NC 5EA2A 5HE8A 3TTTA 1C14A 2P9QA 4S1PA 1MZPA 3KKMA 5CNMA 2C4MA 3DB1A 2VP5A 3E4CA 1M2HA 3KM0A 3K4PA 3UWPA 4ENRA 1MG5A 1ORVA 1EX9A 3OT1A 1CUHA 2VJQA 4DLTA 1Y3AA 5KNBH 2ARKA 1FUIA 3OPNA 5AJTA 3E3AA 4B6RA 5AKKA 2F90A 1UKYA 3AHGA 4NOJA 5T41A 3D8RA 1TW3A 3TR6A 5A03A 2E55A 2R00C 3NBXX 2PE5A 1NVXQ 1SFRA 2WHYA 4KITB 3OFJA 3R3VA 2BE9A 4NPHA 4B44A 2L82A 3FHTA 1BW9A 4A03A 2Y2UA 3LK7A 4E5PA 1D2RA 1VXRA 3H75A 4Q05A 3SFVA 2RH8A 3WLAA 5AUNB 3KFXA 4LXIA 1E63A 2O2SA 4Z1MD 3E4DA 2HNBA 1Z3CA 1IVSA 1XNJA 4F6RB 3KQOA 2PUWA 1EINA 2HWKA 2Q0SA 3DW1X 5DRYA 4R05A 1JHQA 1QYVA 3DM5A 4D9HA 2DUJA 4GXQA 3WNDA 1SCBA 1KSFX 2YWDA 1W7AA 3GNQA 1OH8A 3OOJA 1GSIA 4FKMA 4R1LA 3ZU3A 3K8YA 5DYGA 3CXRA 3D4NA 2PUTA 3OWOA 1G1MA 4WSOA 3T3OA 3JATB 1VHQA 2Z2ZA 1B6SA 5J5VA 2ECQA 3ULKA 1U9CA 4CG1A 5D8DA 1GPBA 4MWEA 2ZYDA 3UBMA 4Q3DA 4RSHA 1JMKC 4YNBA 4BRWA 5HTOA 1HSZA 1B6GA 4WMLA 4YLYA 1I5EA 4XE5A 1N5RA 2CLKB 1IL0A 4RHUA 5DNDA 1KZ9A 3G88A 3KKZA 1WPRA 2EQ5A 1BWRA 4V02A 2ZT5A 1BWQA 4LY9A 4AJ9A 4DADA 2O8FA 1H9CA 4UUMA 1TVMA 4NCNA 5DLDA 1HDOA 1Y4UA 1K75A 5LNK1 1T26A 1YFJA 2EAUA 4FFNA 5D86A 4UM9B 2GZHA 4HNRA 4IIJA 4R1NA 3AYXB 4XDHA 1JXQA 2GUGA 1B15A 3PC3A 4K9PA 5CCDA 4OO3A 5B1IA 4A2CA 1JJFA 1T10A 2EHDA 1U28A 2QMUA 2KBFA 3FDJA 5BNTA 1J23A 1FMTA 3LFUA 3ESCA 2FFRA 2RGAA 1LI7A 3NALA 5AM4A 1HRKA 3KLNA 3SFZA 4C3UA 5D87A 3LA6A 4QREA 3VR4H 2NQ8A 2J3EA 4M53A 4KR9A 1II9A 2QRMA 2O1SA 4YP9A 2GJ4A 4UQPA 2F1HA 1G3RA 3SBEA 3O90A 4E32A 1QMPA 3SS9X 1JHVA 3I64A 2H5LA 4UHJA 1DFIA 4D0LB 2VAWA 4W1PA 2HMSA 3CGGA 1RWKA 4GQAA 4BNWA 1P45A 3B1VA 1SU6A 1L4LA 3B9BA 3KUKA 1QDLB 1RWWA 3AOEA 2ZCUA 2IRWA 2O8VA 2DWOA 2ZIGA 4NCJA 5JNLA 4CIYA 5K3OA 1BNCA 1RJWA 2QBYA 3R5SA 5BOSB 3G82C 4WK2B 2J3LA 1XVVA 4AWXA 3T99A 4F71A 4HDSB 4XUDA 1MJGA 2WG2A 2REQA 1FRNA 3OWXA 1G7TA 1V6AA 2QP9X 3COSA 1Q1BA 2CLOB 4PZAA 3U3JA 5EERA 4WK6A 1W4AA 1UKEA 2ZAYA 5LUAA 2G71A 4KO8A 1F4LA 2WNSA 3E15A 3JXEA 4IOJA 4MGKR 4PNZA 1I5RA 3ZHCA 5E3JA 2GXUA 4JFRA 3AK4A 3LT2A 3CXUA 2DY1A 3MA0A 3I8XA 3C15C 1VTKA 3G5MA 3PTZA 4JQZA 5DI3A 4A8TA 5JYEA 1NVBA 3L43A 2H1RA 4U6NA 5KHLB 2PKYX 3OPYA 3KLOA 4RD4A 5CR9A 5DU2A 3ZDAA 4FEEA 1BXRA 3ZX4A 4C43A 3L8GA 4BKQA 3JQ8A 2FZLA 1G8YA 1QPGA 3ZDDA 2ZVPX 3E81A 1B0UA 5I7EA 1ZUD1 1VKHA 2PBRA 2V7XA 3QMMA 2VCHA 1ZJ6A 2OFPA 5DSXA 4G4JA 1C3OA 3AFGA 4LGCA 4V0QA 5DXAA 3N2LA 5IF9A 3NAGA 1WSWA 5K3FB 1EZZA 3HDQA 4IPTA 4N8EA 2Y9PB 4QUKA 2WSBA 1IJFA 3WSTA 2XOXA 3HCDA 3KYJB 1G5QA 4IGIA 3S2ZA 5JC8A 2ZBEA 4IV0A 3DQZA 5JO9A 2PAAA 1GTMA 2GFIA 3HO8A 5F1KA 4BO8A 2QL9A 3S5JA 4HB3A 4YH1A 3GEMA 5FULA 3VX3A 3JQ6A 5IUNC 3W1WA 1QTQA 3KOZA 5JMTA 3PXXA 3D59A 4X7BA 3JALB 1H42A 2BOVA 3I28A 4FMCF 2WWYA 2PUHA 2ETVA 3OSZA 4FHCA 1SIBE 3NFRA 5D3QA 2OXTA 5H8WA 5ES4B 4DLVA 3OQHA 3HB1A 3OQOA 2RAFA 3DZIA 3I23A 1I3OA 2K2QB 1XTIA 3C0KA 3HEMA 3LX5A 3QITA 4UBJA 5D51S 4NZOA 1H9BA 1NBMD 3Q15C 5LL6P 4DJEC 1TXGA 2QUIA 2WIGA 4JI0B 3CEMA 3PC4A 4FBGA 4YRTA 3SZLA 1TIPA 1UFRA 2I2CA 4YV2A 5TQ0A 2PZFA 3NZEA 3LY5A 4IFIA 4BHRA 3GZNB 2M2IA 2LD4A 3MTDA 5EIAA 4MP8A 5T4BA 1S0UA 1W6RA 3V8PA 1BDIA 1P1JA 4PZEA 4OXYA 4EHFA 5A04A 4G5XA 4J49A 2O7SA 4IFBA 1J8FA 4ZAYA 1T8PA 4G8DA 4IQFA 4LHVA 3IP9A 4BO3A 4B9EA 5FPYA 4XRGA 5JNSA 5JS1A 4D8VA 1CY8A 1P4JA 2QD5A 3V7UA 5BW6B 5L9AA 4MDHA 4MKGA 5E3IA 4C06A 4K0RA 1E3QA 5JFTA 3K8OE 2AG1A 3FWYA 2XDYA 3B78A 3IJ5A 1V7ZA 2DT5A 2PH7A 2QR5A 4I55B 5FHRA 3KSMA 2JARA 4JODA 3WWPA 4HDRB 5B4TA 3ZQUA 1U8TA 4F5DA 3FY4A 3ZV5A 2GCOB 3DFIA 2VHTA 3NEJA 5EUMA 1K6MA 2NZUG 2A5DA 1YGPA 2QMOA 2VYFA 4C2UA 1WKVA 4F5EA 1OZ0A 4CMKA 3V33A 1NF9A 4BFVA 5KS2A 3U4IA 1ZOLA 5K3DA 1QHFA 2HIGA 1AXEA 5K0LA 5A3QA 3P32A 4ARIA 4H7IA 4HKTA 1EBBA 4H4CA 1CF9A 3PCXA 3GRFA 3ED1A 3NH9A 5DT2A 3H1EA 2ZE8A 3MTAA 1K98A 1FQJA 1C1YA 1HPLA 4A0HA 1BWPA 5DLYA 3OPXA 1D6MA 2CW5A 2PRZA 3L0BA 5CYFA 3WRYC 3JYNA 1B0AA 3ELWA 4FWBA 1HDCA 1KOLA 4RH0A 2WT9A 4Z8XA 4HZUB 5ARBA 1EQ2A 2IU3A 4QOGA 3ZHUA 1VYUA 5ICCA 1I4OA 3FIJA 1A4UA 4PXSA 5ESRA 4BLVA 4OJMX 3DEIA 2ZJ7A 1RXCA 2ZWVA 4NZ9A 3VPAA 1VJCA 3VI4B 1OWMA 4MR7B 5JJBA 3HFJA 3PCTA 3EFBA 4CNBA 3NC1C 7REQB 2IZ6A 1NYTA 1LX7A 3OIVA 4UMEA 5TX7A 1NM5C 3RUCA 2HDNB 1KI4A 4URYR 5EXCA 1ZQ1A 2FR8C 2VXOA 2YOFA 5AUPB 1YMQA 1GVNB 2FMFA 2AFHE 4MQFA 1YQTA 2Z8XA 3IYLW 4N12A 4TKMA 1R15A 3LQRA 4HLQB 5DCUA 3RBXA 1L8LA 4EX7A 1P19A 1Z5NA 4FOOA 4RMIA 5H3CA 3QU9A 4W5WA 4BWVA 3ZDQA 2RHRA 4O0MA 1MQAA 3QBJA 4W5JA 3FDFA 1J56A 4RL4A 1Z4QA 2F3PA 1RI5A 2I3GA