1N2IA

Crystal structure of pantothenate synthetase from m. tuberculosis in complex with a reaction intermediate, pantoyl adenylate, different occupancies of pantoyl adenylate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
286
structure length
286
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a pantothenate synthetase from M. tuberculosis and its complexes with substrates and a reaction intermediate
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords pantothenate synthetase
total genus 95
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2002-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 1n2iA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1n2iA01
1X8XA 2J09A 2NZ2A 4MVWA 1MB2A 5J5AA 3AG5A 3ZJUA 1T6XA 2GOYA 2ZP1A 3SEZA 3LE8A 2X1MA 1QRTA 2O8VA 2CYCA 4GU5A 2WB2A 3H97A 4EG1A 1M1ZA 3HV0A 4U7JA 4EG5A 5LM3A 2IELA 4MUFA 4R2LA 2QJOA 3FG9A 3ZGZA 3MUEA 1J1UA 4MUHA 2H29A 4CT0A 1N2JA 4MULA 1O97D 3PNYA 1QRUA 3BL5A 1YUNA 3RBAA 5JBNA 3FHJA 1PFYA 3UC5A 1JGTA 2XRZA 1F7VA 4EG7A 2B7LA 3AFHA 1QTQA 1ZH0A 4EGAA 1OBCA 2EL7A 3FH0A 2JA2A 1MBZA 4RUKA 3CVVA 3ZJTA 4MVCA 4G5FA 3ILVA 4BWVA 3GLVA 1QU2A 2A1UB 1H3EA 1WXHA 2CYBA 3FETA 4HPWA 2DR2A 2X1LA 4JFAA 1KQOA 1VBKA 3TZEA 2VTBB 4AS1A 3AG6A 1PFVA 2J08A 1G8GA 3HL4A 1N2HA 1YUMA 3N9IA 3JXEA 3QE4A 2CSXA 1IQUA 4MW9A 2PZBA 3INNA 3CVWA 3COZA 3TS1A 4PBTA 3IOEA 3HFJA 4JYZA 5KCMA 1F4LA 2QTRA 5IJXA 1I6KA 1N2OA 4QRDA 3RHSA 3IMGA 1N2BA 2WQ7A 3D6UA 4L2IA 4OUDA 4DDHA 4X0EA 2E21A 1WQ3A 1M8PA 2JAXA 3NBAA 1IH8A 1O94C 2I1LA 3AKZA 2Z08A 3H9BA 1KAMA 4MVYA 4MW5A 3FOCA 4MUEA 1MRZA 2A88A 4GRIA 1BS2A 2QTMA 2A86A 1IVSA 1EFPB 1B6TA 3CLSC 1O0CA 1XNGA 1GN8A 4ZT2A 2A1UA 4TS1A 2H2AA 2E18A 1H3FA 4QREA 2PG3A 2O5RA 2QTNA 2EJCA 1JZSA 1TYBE 1TQ8A 5LFAA 3IMCA 2YY5A 3SDBA 3PXUA 4AQ7A 3CR8A 4MLPA 3P52A 2RE8A 3X1KA 2IP1A 2GM3A 1OWPA 2CT8A 3FI0A 1Y42X 4PY2A 4ZT6A 4MWDA 3RK0A 1NUUA 1COZA 1IHOA 2E89A 4ZT3A 3CA8A 1MJHA 2AZXA 4DDKA 4KPUB 1M8JA 1MB9A 5FO0A 1ILEA 2QUKA 1J21A 1PG0A 4U63A 1M8KA 4I6GA 1KH1A 1X6VA 3S3TA 4ZCRA 1ZH6A 1EJ2A 1RQGA 1O96A 3CLUC 1K4MA 4HK4A 1D2RA 3U1VA 3VRHA 2D5BA 5DASA 2WQ6A 1FYDA 4MW1A 2DEUA 5KHAA 1N3LA 3GUZA 3DO8A 4HJXA 1JMVA 1NUSA 3KT0A 1IQRA 4YMIA 1JILA 1KQNA 5HUJA 5J58A 2CYAA 1NURA 1NYLA 1U3CA 1LI5A 1YIDA 2J5BA 4ZCSA 4MUKA 1N2EA 1YIAA 4KR9A 4ND6A 1U0BB 1I6MA 1OWNA 3CLRD 1WQ4A 4KR6A 2QJTA 2CUZA 4MUGA 1JHDA 1OBHA 3K32A 2Z3VA 3COVA 1IQ0A 1N75A 5IHXA 1OWOA 2A4MA 5HG0A 3P0IA 1G8FA 2DETA 5DEOA 3DV2A 1EFPA 1GPMA 3A4IA 2TS1A 4HJRA 3H9CA 4DLPA 1YI8A 3D6VA 1NUPA 1O97C 1JIJA 4K03A 2BTEA 1SURA 1IFXA 4JXXA 3DPIA 5KWVA 3TNJA 5K0TA 1TYAE 1ULHA 1HYBA 3IUEA 4DDMA 2GKSA 1H1TA 1O96B 4J75A 3IOBA 2J4DA 3ND6A 3H99A 3A2KA 1MOPA 1U7DA 2VTBA 4YBRA 1J1ZA 4A91A 3HMQA 4NX2A 3IH5A 4F4HA 5BNZA 4MWCA 4NAHA 5TEWA 1F9AA 4MW4A 3SYTA 3P0JA 5K0SA 2PXHA 3K9WA 1WJGA 4FZJA 4ZCTA 2YWBA 3ZIUA 1K4KA 4YP5A 1TFUA 3ZXSA 4ND7A 4RPIA 2C5SA 3L92A 1QQTA 1EXDA 3IDFA 4EFKA 3CLTC 1QNFA 4CQNA 3N8HA 1VL2A 1O5TA 1Q15A 5HUHA 4DNXA 2Z09A 1GLNA 1J20A 5H7XA 3UOWA 1M8GA 3IVGA 2J07A 5DK4A 3TQIA 4KKVA 2VXOA 4I6EA 3UK2A 1WXEA 4XFJA 4MW7A 3COWA 4R2MA 4E1AA 1JECA 1I2DA 4H3SA 1WXFA 1Q19A 2JANA 1I6LA 5FNZA 4ZT4A 1KAQA 3A04A 4ZCQA 1O95C 2QJFA 4WNYA 4OJMX 1PG2A 4ARCA 1U3DA 1Q77A 4YP6A 4NDAA 1H3NA 2G36A 5J59A 2V0GA 1R6UA 2XRYA 2DXIA 3OTWA 3DLAA 1WXIA 4MW6A 3CVYA 2AKEA 1PFWA 2QUJA 1VLHA 4K0RA 3ELBA 1T6ZA 2IJGX 3IUBA 1JIIA 4R0NA 1GTRA 1WY5A 5AHWA 5FO1A 4YP7A 4ZCPA 4P2BA 3AIIA 3RFFA 3CLUD 1KQPA 1JEEA 3ZXIA 4MUNA 1EFVA 4WSOA 2PZAA 1NUTA 1VBNA 3MMXA 1EUQA 3FY4A 1OWLA 1O6BA 1GZUA 1U7XA 2NSYA 4EG3A 3X1MA 3IODA 1KORA 4NATA 1G59A 2A84A 2CV0A 4NAUA 3G5AA 3QTTA 1OD6A 2ZUEA 1KKUA 1JZQA 2D13A 4G5YA 4MWEA 1N2IA 2V0CA 4MW0A 5F23A 2ZUFA 3FDXA 3F3MA 1KP3A 5H16A 3PNBA 4QBTA 1NZJA 3C8ZA 3COYA 3LCJA 4NZPA 1JEDA 1XJQA 1KP2A 1NI5A 1M8FA 3FNRA 3FWKA 5DB4A 1EE1A 3A05A 1KH2A 1WZ2A 2R5WA 1F7UA 5TGTA 2CFOA 1O94D 1R6TA 3SZ3A 1QU3A 4U8HA 4DE5A 1MAWA 2YWCA 1EUYA 1YULA 4DJAA 2E0IA 1KR2A 1Q11A 3KT6A 1JIKA 2PFSA 1A8HA 2CV2A 4MWBA 3CLSD 4G6ZA 4OUDB 4PBSA 1NP7A 1QJCA 1WOYA 4JXZA 1V47A 1DNPA 1IRXA 1J09A 2D54A 3NV7A 2PZ8A 3IOCA 5EKDA 1XNJA 1EFVB 3H05A 3MLAA 3L93A 1WKBA 3KT3A 3KT8A 1P7PA 5LLTA 1ZJWA 1UFVA 4UZEA 2X3FA 2X0KA 1T9GR 1XNHA 2HZ7A 3TZLA 2BYTA 4MQ6A 1KH3A 3I05A 4EG6A 3Q10A 3CLTD 3FIUA 1PFUA 4KPUA 2RD2A 3AL0C 2HGZA 2OV4A 2PIDA 1O0BA 4EG4A 4MAFA 3RJZA 1FFYA 2QUIA 4ARIA 3IVXA 1NUQA 3UMVA 2DPLA 3G6KA 1WXGA 3Q4GA 4CDNA 1QRSA 2A1TR 5TS2A 3ND7A 1GTSA 1VBMA 3UY4A 3X1JA 4Q93A 4MW2A 3KFLA 4EG8A 1N78A 1N2GA 4I6JA 1K97A 3MXTA 4CDMA 3PNVA 4EF6A 4MVXA 5TEVA 1N77A 4ZT5A 1TEZA 3VGJA 3G59A 3PRHA 4J76A 4XFDA 2AG6A 2A7XA 3HGMA 3IVCA 3N05A 3ND5A 3QTBA 1T9GS 2DUMA 4ZT7A 3SEQA 2DLCX 3CLRC 2YXNA 4S1OA 3MLBA 4PBRA 3CVXA 1N1DA 4Q16A 4L2IB 2QUHA 3SP1A 3VU8A 1ZUNA 2HMAA 1R6XA 1MC1A 3P0HA 1S4MA 4MUIA 4JZYA 3Q12A 3E27A 1OWMA 1M83A 1CT9A 1NSYA 2CV1A 3ZUGA 1T6YA 3OP1A 3LOQA 1LI7A 1TYCA 4UZFA 1GAXA 1TYDE 4XSVA 4KR7A 2DERA 3ISJA 3N2YA 3TQOA 1G8HA 1J70A 2WSIA 3GMIA 3NBKA 4F3RA 3RK1A 4MUJA 1K92A 2OQ2A 1MAUA 1V8FA 3ZJVA 1O95D 3HZRA 3SZGA 3CVUA 2A1TS 3IMEA 1LW7A 3M5WA
chains in the Genus database with same CATH superfamily
3HO1A 2APJA 1CUAA 1KY2A 1E9VA 1UZMA 2D0PB 1ZHFA 2LDBA 3WQSB 4XVUA 5JAHA 2D3WA 4LRWA 1KMHA 4AO7A 2N1MA 1DHRA 1G18A 4LNAA 1B1CA 1VPVA 2CZQA 2QE6A 4FMCB 3JD4A 4IIDA 1EESA 3L8HA 2WB2A 1MABB 4ZI7B 5FWDA 2IECA 1F1JA 2XVAA 2HN9A 3T9AA 1TGVA 3ETEA 2GYVA 1L5ZA 2IXTA 3TIXB 1S02A 3A9RA 3UNXA 1TIBA 5U4QA 1O57A 1RIIA 3G02A 4OU5A 5B30A 1H66A 3E58A 4RDIA 3BF8A 4KR2A 1J1UA 4HQ0A 1O97D 2VJNA 3PNYA 5HP4A 1C0PA 1P4AA 1RJGA 1NATA 5B3KA 2YWJA 3OKPA 2PX3A 1DPGA 5AJTA 3JAMA 2EXXA 1WVMA 3HUTA 2X9LA 3SM3A 3UYKA 1SCQA 2Q1UA 2XF8A 1O9BA 2YJ4A 5KBYA 5IBPA 1J42A 4KO8A 2SICE 3KJQA 2FY8A 5HPYB 3QF7A 4YYZA 2RGXA 3DQZA 3H3XA 4BWVA 3VU0A 4WI1A 1H0RA 1KQOA 2VH5R 2ECOA 1KVSA 2YNMA 1X7XA 1B6SA 3Q3CA 1TK9A 2YJNA 3CT6A 2PZFA 4DUPA 5BW6B 1CZNA 4NK4A 2ZPAA 3EA0A 3S2GA 3AFOA 4R1MA 3GAMA 5JAMA 4IVRA 3QI7A 5A9TA 3O2SB 4NYMQ 2R6DA 2B6NA 3G8YA 1HQKA 2ZJAA 2AFIB 2ZW9A 4QFDA 3AP3A 2OYRA 1EK0A 3GMDA 1WPGA 3M9LA 5C4GB 2QTRA 2WA1A 5JCZA 1J99A 1V8BA 2AVNA 2XMZA 4LGMA 3HO6A 3OTQA 4UXIA 2JVJA 1N2BA 2I6FA 3OLXA 3PVZA 1XPJA 4G56A 4MARA 4NONA 1NG1A 1FFCA 2NW6A 3B1VA 3DTYA 4X0EA 1JYSA 4DQDA 3AR6A 4JLDA 3E2PA 3F5MA 4WKBA 1F3OA 4F5DA 4CFZA 1KZ9A 4UPVA 1ID8A 1LVGA 3TNDA 4DA9A 1YS4A 3D6MA 2VJBA 4MS1B 4OKSA 4P7BA 3RKUA 1R6DA 3CRW1 1M6VA 1BH6A 2VS1A 3PDIA 3PGA1 3LPMA 3QBTA 2OXIA 5KDLA 3RVLA 3ZQJA 4EKYA 2Q46A 2A9FA 2JGIA 4ETWA 1PWEA 1VZ3A 2QTBA 4QD3A 3LS2A 1ELOA 3BEOA 4UOEA 3RAGA 5FNVB 1EFCA 2QN6A 2RHLA 3ZWDA 2B0JA 4YB8A 4JNKA 4PX2A 3OZEA 5BVHA 2A1UA 4N0EA 4EO9A 3K4HA 2OV1A 2QN3A 3FVRA 1C3OB 2YHUA 3R74A 3OQHA 4HTFA 3NTXA 3VX3A 3OQNA 3E84A 3K1AA 3MINA 4O2LA 5LFAA 3LNCA 5LUBA 3SIPA 5I5GA 3L1UA 1NSFA 1DO0A 2WD7B 3S7ZA 3UWOA 3KZCA 5BSTA 1ZI9A 1ZKDA 3Q2OA 1DEAA 3LK7A 3I83A 1Y42X 5DM1A 1S0UA 7REQA 1I3CA 5CW1A 3IELA 5EXEA 2X15A 3G1WA 4G85A 3IALA 3CA8A 3TFQA 3WRWA 1MJHA 2CNWD 5ENZA 3TRDA 3WOVA 3EGVA 1T8TA 2B94A 2HD4A 3AWIA 3PHCA 4H1HA 4QPPA 4D56A 5JATA 4AZTA 3IJ5A 3GA0A 1AHNA 2WIGA 4C6HA 4PCUA 3AR3A 2AA3A 4N7RA 4NYJR 1EK6A 4B80A 1CEEA 4OVKA 1RZ3A 5A71A 2GJAA 1C9EA 3G2NA 3ACDA 5EE3A 5SICE 4AXXA 2D5BA 3L1HA 5ALFA 4HQRA 1IM2A 3LUBA 5E1MA 3B5EA 3FMVA 1ZXXA 4ZCIA 2XJ9A 1RZRD 2UDPA 4ZAGA 3VKGA 1ZWLA 2I71A 4TVBA 2WYOA 3B82A 5BN4B 3L4EA 3ABZA 2QTVA 4EECA 2CD9A 2WD8A 4OYHA 1EAYA 2YHBA 3C97A 5C9ZA 1NURA 3D1JA 2M1ZA 4GQAA 4UZSA 3EHDA 1NVWQ 3FOWA 3MB5A 1U8AA 2DQYA 3Q8WA 3SKYA 4BS9A 2C0CA 1SRRA 3HXLA 1V5GA 2BEKA 3LXRA 4HDRB 1KTIA 1EEXB 3GEMA 1T5SA 2BGLA 2IYLD 3BXOA 4U6QA 4URVR 1NLMA 3S29A 1O8BA 3LHIA 2E4WA 2ZBDA 3LZDA 3M6VA 2M9MA 2QP3A 4WZBA 1NJSA 1QH1A 1UAGA 2JLRA 3KJNA 3NXSA 4PSCA 1P3JA 4B5KA 4OLHA 3TOXA 1CDOA 1ES9A 2G04A 2AJBA 1OFTA 2GAAA 2J3EA 2YJ5A 3IV6A 2VR1A 3OCJA 3UAZA 1NG9A 2QTLA 2YV4A 5IK2A 3P0IA 4FIZA 5C2JB 3PGXA 5HKOA 1X1BA 3EMBA 5FYQA 1GPMA 2XVMA 4NP6A 5KZMB 1X7DA 4CU2A 1UP7A 3OHMA 3L49A 4FYPA 3FVVA 3LO8A 4KSCA 1PR0A 2OKGA 3H9JA 5FI0B 4AYTA 2GCGA 4P92A 5IUNC 2H7XA 2WMNB 5CB4B 4KYTA 1TL7C 2PLFA 3AM5A 4JXXA 2ZPTX 1PQYA 3OOSA 2EEPA 4L5CA 4N40A 2PU7A 4RZ2A 5CTJA 2QPLA 5LNK6 1WSDA 2BEWA 3H2IA 1NM5A 4B5LA 4PYMA 1Z88A 2B4RO 2ZCVA 1XDDA 4TVOA 1ZL2A 3R5XA 4MKIA 3QXSA 1MRSA 4OB6A 4Z7JA 2I8AA 4YBRA 4U6NA 3UMSA 3ONDA 3ZBPA 4X60A 3KPUA 1KFJB 1U8TA 1Y6ZA 2VYVD 3VHXA 3WGYA 1N6PA 3FGNA 1JH9A 1BFKA 1RS0A 1WY7A 1JWAB 1W34A 3B5IA 4NZMA 4QM7A 5HA5A 4ALKA 1LX7A 3K09C 4OX9B 4CQMD 4MPPA 1AS2A 1GGJA 4KC0A 1M1YE 2YQZA 3CKLA 3OU2A 3C3YA 5EP1A 1XU9A 4ZEWA 3V2HA 1EBFA 1XK6A 3ELUA 2XZLA 3SWWA 5BQOA 1D6SA 5I8ZA 5KOYA 4DLRA 1KY5A 1ID1A 4ZGBA 3GARA 5BWOA 3B52X 4YT5A 4WY8A 2VHZA 2JLQA 3QFHA 3R0VA 1RAFA 3WNQA 3PDWA 5JDIC 1VRCA 1AGXA 5DLPA 1ONOA 1BD4A 3CNOA 1EMDA 1PNOA 4X61A 3I04M 4L8FA 5I9SA 5TGZA 2J5KA 3GNQA 2FEXA 1R9NA 2C4KA 2VXOA 2ZTMA 1Y9EA 1Y6QA 1BVYF 2XMGA 2AE1A 3RH0A 2VWHA 4PG6A 5DV9A 5TQ2A 5A1TA 1IOZA 2W7TA 1JECA 1PT6A 1PZMA 3G9UA 4U2KA 1ZD5A 4HGQA 4EITA 1YGPA 2GHIA 5IAEA 4YIHA 1YZHA 1OYYA 4ZT4A 1NQTA 5FT9A 1PJSA 1FE8A 1HG0A 1WNFA 3NP9A 2O7VA 4JVOA 1K3FA 5A5GA 4B3TB 1AHHA 2C3YA 3CR3C 2BCJQ 3EOZA 3FZYA 3QFSA 4EYSA 1HFWA 2B61A 5B57C 3BWCA 2W6MA 3QUSA 1XXHB 4CKWA 4L4YA 1BNCA 3DOCA 2AXPA 2NSJA 1QGOA 4C1BA 3IVMA 3WGUA 4CEHB 1JR3E 2IYYA 4HZGA 2X6RA 3KZVA 1JAZA 1SJ9A 3ON5A 4MW6A 2RGDA 5D1HA 1IN7A 2JI6A 4FN4A 1QCDA 3AHFA 3ILYA 4M36A 4OQLA 3TRIA 3GBPA 3U4DA 1CY7A 1T6ZA 1WV0A 1V26A 4JSTA 4CLXA 4FILA 5FO1A 2IDJA 4BZZA 1KMIY 2WVHA 2ZJ0A 5AH0A 4PWYA 2G09A 1F3LA 5IYZF 1Y7IA 2ZRDA 1PNQA 4IV5A 2AMFA 4ENVA 9ABPA 1AQJA 2H17A 1UIMA 3EGXB 1JMYA 3G9XA 4BFLA 3OZVA 4FFWA 5HE9A 3WJ2A 1QHIA 5HILA 1T8UA 4OHFA 4UM8B 3IGFA 2PZAA 5NLLA 1S2NA 1NUTA 4PLPA 1JALA 3KQQA 3K30A 8AT1A 1OWLA 2HYDA 1B8VA 1XDWA 3RC1A 2NU9A 4D4JA 1U7XA 3RYCA 3OPXA 1ACLA 1I4TD 2CVPA 2HMSA 4UNNA 5CW2A 2XT9A 2YWGA 3UXHA 3PIDA 2F55A 5DKFA 5A5EA 1VRWA 3GJ4A 2WAYA 5AHRA 2Z8YM 2GK6A 1R0LA 1WO8A 3GD7A 1US8A 2AYYA 3BA6A 3OAAA 1ZI6A 2YWFA 4NFSA 2BGJA 4ZRMA 5E8JA 3QTTA 1UPXA 4HWOA 4M60A 4WFJA 3TNFA 3WLFA 3SDZA 2WI8A 4FE4A 5HQ3B 2MSNA 4ND5A 3I9JA 1UQTA 2FE1A 1YL6A 1TM3E 2FHSA 1RLTA 5IANA 4ZVTA 2JIPA 3BUSA 3JR3A 2DH6A 2OBBA 1XTQA 3H75A 2SKDA 4EBBA 5DBOA 3OQ6A 4NOMA 1TTTA 4LJ9A 3R0ZA 4J2TA 1XT6A 1K0FA 5JAUA 4DR6B 2CJPA 3LBYA 1ZGAA 4RELA 3OC0A 3FWKA 1CVRA 2HQ1A 4BVFA 2XV1A 1XNRB 3WQHA 1TKRA 3VO9A 3VSAA 4A73A 3L07A 5BPFA 2BELA 3B20A 3SE0A 2FFHA 3AEUA 4N8EA 4PEVA 4WJLA 3UB2A 4Y2VA 1LPBB 1W2HA 1T9ZA 4FGWA 3T7EA 3SZLA 2ORIA 1JHRA 2PUFA 4M8LA 4O2BB 1X8JA 3I1FA 1X7ZB 4MWBA 5FUYA 1F1BA 4M1KA 1B93A 1V5FA 2KSQA 2WLTA 3PP8A 4BUCA 5TMPA 2OLJA 4Q9DA 3W5HA 1D09A 1MGPA 1R0RE 4MLCA 3R6LA 5EZ6B 3W7VA 1Z5OA 3PWSA 4TTTS 3WDKA 1QGUA 1CDZA 2VP0A 5I7FA 4J1QA 3K7EA 1CQXA 2A58A 2GHQA 1CUHA 5LZ7A 3FFXA 3OHPA 3WLKX 5AIBA 5JJCA 2J3MA 4LPKA 1NRXA 1CUVA 1WD7A 4I9FA 4L5AA 3QLJA 4LRYA 2Q4OA 2JEOA 2C2XA 3STWA 2RH4A 4UBKA 5LLTA 1E6MA 3PNSA 4CQLA 1DLJA 4BL5A 4FI3C 2AE2A 3UEOA 3MSXA 3GYBA 1H6AA 1XVUA 1EK2A 3OEED 4QUEA 2LWIA 5F2KA 1KYWA 4J03A 5FULA 4RXTA 4CFYA 2C5BA 2I4OA 3Q10A 2OC9A 4LNUA 4E88A 3F9CA 2ZRCA 2FZEA 2PIDA 4K9PA 2HK6A 4QFBA 4RNCA 5F1KA 5JV5A 5E0OA 1X1RA 3BFXA 1K5GA 5HKKA 1QV7A 1RJ9A 5ALNA 2FPGA 3MW8A 3QFTA 1OAOA 5EYPA 5BV7A 3G6KA 3ESQA 2ENWA 5EERA 4UOZA 1X8KA 2Q3BA 1SXJB 1E89A 2CHFA 1J00A 2IHJA 2IY8A 1QB8A 2QXTA 4G23A 4CTMA 3PX7A 1A76A 1Y5NA 4HAWA 3E1KA 3FWNA 4FYIA 3N8KA 2OG1A 3ESDA 1VBMA 3X1JA 2CXTA 1PQ4A 2E48A 3PC4A 4H1WA 3ZVMA 3A10A 4OX9Y 4FSDA 2COEA 4HGOA 5J2UB 1YCFA 3AUFA 3B13B 2EGHA 3GEHA 3R7SA 4C0BA 4CDMA 5K0FA 1ZW6A 2DUUA 1P31A 2JHCA 4JT8A 1XA3A 4TZTA 4DCUA 1S9DA 4KQ6A 1KEZA 1H6CA 1UPCA 1BJTA 1DXQA 4ZO7A 1UC5B 4JJEA 4QWWA 4ZQHA 5ECYA 3FUUA 1FVHA 1NDUA 3L7NA 3T34A 4UM5A 3SQMA 2IXDA 3KTAA 1M2OB 3IQDB 4ZO6A 4QUIA 1C7QA 4B0PA 3QTBA 3K0KA 3F7NA 4E3ZA 2R7NA 3HDGA 3AUSA 3VR6D 2OBFA 4AS3A 2REOA 5K03A 5CEJA 1K75A 2DFKB 4QE3A 4QFMA 221PA 2EG5A 4M0LA 2R00A 2GFIA 4K9MA 4U4AA 4YRQA 5SYMA 2Q5IA 3RFUA 3RJ5A 1LY1A 3U3XA 5B36A 1K68A 2PMCA 4BTLA 3WB1A 2W6JD 4WCFC 3Q7TA 4F7DA 4CLOA 1EIWA 4XB1A 1NR1A 3MRTA 4DWOA 3H9UA 3KM0A 1ECPA 4AW9A 4CDRA 2OD9A 1C1XA 4FR2A 2QV0A 4XUEA 2WM9B 2FSIA 4CF3A 4A8JC 3WLNA 5G0VA 4E1VA 3ESCA 1W4RA 2PTGA 4I4IA 4FFPA 4IAOA 1YBVA 2BKUA 5C8YB 1QYIA 5IYZB 3IQEA 5JS6A 5KNDH 1JI0A 1HH4A 1VIYA 5CNKA 1FP4B 3MPOA 1H22A 1DRVA 3UA3A 5KHOC 3IE0A 2Y9PB 2VRWA 1FJXA 3DBHA 1ND6A 3BFKA 1Z2PX 4HYQA 5E4FA 3ZTYA 1G8HA 4C0HA 5IJ9A 3VPFA 3T95A 3RK1A 1T0HB 2LKCA 3PFWO 2DWOA 4F9EA 7MDHA 3A9SA 4KG7A 1NV8A 1QZ3A 2KJQA 3GP3A 4RPHA 3LSTA 4CLOB 5JD5A 2CJFA 1JQBA 1T1IA 1U3GA 4OM7A 3DWFA 5F7ZA 3RVRA 4ER6A 3NWEA 1IZ8A 2R1UA 2D5AA 2Z83A 2Z8YA 4DGQA 3DOUA 3EXIB 4ZA2A 5JFGA 1X8XA 1X94A 1BOOA 4S05A 1HDRA 5JH7B 4F4DA 4PIPA 1T6XA 4UCFA 5AXDA 3WI7A 3ZJUA 4LFCB 3A4NA 3QX8A 2B92A 2PQ2A 5G53C 5HKLA 2IV3A 4HADA 4OP2A 3E1GA 3T5BA 1P5JA 1YWGO 4QHTA 1NXPA 1TADA 2JGKA 1TJ3A 2HU5A 2R60A 2ZJBA 4MV5A 3JQ9A 4BNDA 2Q2WA 1LFDB 5ESWA 3TVYA 1BCRA 3O94A 4NBRA 4MGHA 4QXAA 3VGPA 3KCNA 1Z6AA 4XVQA 2YFHA 3EB9A 2YHIB 3GRVA 4LTNA 4AIIA 4I81A 3X1XA 3RYHB 4MGYR 3MTGA 4MULA 4CPDA 3AF5A 4XX0A 1ZHOA 3DBRA 1NA5A 4JLVA 1GCAA 1HORA 1XALA 4FQ5A 4IH9A 3TQQA 4WUVA 3WBBA 1S3GA 1JR4A 4YMVA 2P78A 2QI9C 3EZ2A 5T64A 3UC5A 4AI6A 4PZZA 1XEAA 1LKZA 4YRLA 1WE2A 3CUKA 4KQXA 3LT2A 3AFHA 2GRUA 1SC6A 2JGLA 3FFBA 4V0QA 4Y9TA 4HNGA 2GUWA 2WSYB 2VJDA 3ZE2B 2OHOA 3TZQA 2CJWA 1D0IA 2C2OA 3BMCA 1KPGA 1WDKA 3N53A 3AF1A 3FYHA 1R4NB 4DLAA 1I80A 4CM6A 4F4UA 4TVSA 5IF3A 2BKEA 3DLCA 1OZAA 1P5RA 1Q2XA 3PD7A 4C76A 4IGAA 2AYZA 4X85A 3W2EA 2XYGA 2YFKA 1AB6A 3N0XA 4S04A 1NLFA 1QOPB 2DTXA 3LCUA 2C59A 1KJQA 4RY8A 3W1VA 1L5QA 4XIIA 4A8JB 4GOMD 2ZJ1A 5ALGA 3ZV3A 5HDBB 1LRKA 2ZQYA 4NRDA 4IIVA 5BUZA 4N3NA 3NJRA 1FSZA 4PBTA 4GMDA 3TS1A 3ZHVA 5CBPA 4N0DA 1IY1A 1IBCA 4GDFA 1JXOA 3BWXA 3SLRA 5JU6A 3ZHOA 3O82A 3P2MA 4I4LA 2C2KA 3NRCA 5G2OA 1YQXA 4RIGA 1FYVA 1KIFA 1JBQA 1GIAA 121PA 1WU8A 2AG1A 2JIMA 1G5HA 4LXTA 2CHVA 1G3QA 2Z08A 1E2BA 4JNCA 4IP0A 4O02B 3NPMA 3Q2KA 1CJTC 3QEOA 1DKQA 1IZ9A 1C1HA 1VL5A 1XHFA 4HWGA 4GRIA 3JD2A 3I32A 2IS1A 1O6ZA 3VU9B 4KLNA 4X1IB 3NJ4A 1PEYA 2YN2A 5HIJA 3VI4B 3LY5A 4G0OA 4X92A 4NOKA 4OJTA 4XGKA 5K3BA 3E3LA 3EJ6A 5EQDA 4ES6A 5KNDD 3U4MA 2C4TA 4FT2A 1GN8A 2WF6A 2C2HA 2IIBA 3DFIA 1P1HA 3FKSD 2GTIA 4LISA 2G9NA 4KREA 1REQB 2FA9A 1U5BB 3DWGA 3KXDA 3PJRA 2AFHA 3RVMA 4A5SA 3BZUA 1FFBA 1WW8A 3DKKA 1Q1QA 2DHCA 2RGYA 3K9BA 4Q01A 2ERXA 2ZAMA 3H8VA 3LQ1A 5DW0A 5IAJA 4TLEA 5EKTA 5BSVA 4FD2A 3WGIA 3WOHA 3R3UA 1BVRA 1II8B 4MIEA 5DM0A 3A1NA 3D3EA 3N5KA 4YFYA 5BOVA 4MVJA 2DF8A 4NZZA 3A3YA 4LTMA 1LA2A 2ODPA 2YQ5A 3WNZA 4PY2A 4E11A 2HWUA 5CDSA 3UO8B 4I1IA 1C7ZA 2QSUA 4ZT3A 2OECA 3GLUA 4PLVA 1H4QA 4S1PA 2AZXA 1B3RA 3UK7A 4KO3S 1N6LA 4Q7EA 3V4PB 1PT9A 3P2KA 2RI1A 4NNJA 2QUKA 2WTNA 3L7CA 4H6VA 5T4HA 4Q12A 4P08A 1ZU4A 3HB4X 1UBTS 2YDYA 5DLQC 3SHWA 5ICFA 4D6PA 5T5QA 4JASB 4TYMA 5AVOA 4K9DA 1GKIA 1PR2A 3DAYA 1RQGA 4ZOQI 1JDBC 3LC1O 5IVIA 4HZIA 3GHYA 3AZQA 4FOPA 5DGHA 3RASA 4YXFA 4C5AA 1IPHA 1RXUA 1WWKA 1GCUA 4IIUA 1U63A 3CJRA 3FNQA 3VH4A 1WBDA 2CK3D 4DUGD 2DEUA 2EFYA 3JVIA 5KU1A 5AKZA 4YPVA 1JEYA 3QX3A 3PC6A 1R37A 2XOXA 4GBJA 4QOSA 4WJKB 4TT8A 4WUTA 1YZYA 4E2YA 1YKGA 2X3YA 4EQ6B 3EAFA 1K6EA 4PR3A 1TM1E 1QE0A 3WIOA 4LK2A 2JASA 1FXWA 1L4GA 4KUHA 1LK5A 1RBZA 3OF2A 3PD0A 3QUAA 4MV8A 1FX0B 1UK8A 4M46A 2N75A 4XJVA 4XRGA 1SXJA 3ZHZA 2C4VA 2YH2A 3WG9A 1HTTA 2YRFA 3RUAA 5I9NA 5JXIA 2QIPA 3T6KA 1SCJA 2Y92A 3LG2A 4MR7A 5LQNA 1TVKB 1XRLA 3R5JA 4R8VA 3RTDA 3HG7A 4MUGA 4B4UA 4BQFA 3LF1A 2ADMA 4M4SA 2W5UA 4XCVA 3L7YA 5FUXA 1FFGA 1RABA 3B1JA 2O2JA 5KX5F 5EVJA 2F1JA 1YO6A 1JU3A 2V6MA 3CRRA 3I3OA 4GX2A 3E2MA 3K9GA 4HX9A 4PZEA 5KX5A 2LTAA 3HM2A 4N01A 3PJGA 1VHTA 4K9SA 3WQQA 5K05A 4PG4A 5I4CA 1PJ8A 1WB6A 1E2UA 2XGOA 4R41A 4U7PB 5HGXA 2I34A 3FWZA 2COKA 3PPWA 4RCYA 1YDGA 4QYTA 5HKKD 4I1PA 2XB8A 4XIGS 1Z4OA 1X3LA 3OT1B 2C04A 3IUEA 4M0DA 3UMRA 4LJLA 4DIUA 4EBFA 5HF5A 2QUAA 2QZ9A 3JY6A 5LA6A 4P58A 1U7ZA 9MHTA 1U1EA 4H77A 5CGZA 4BGIA 4JJ7A 1X86B 1MOPA 3JD1A 1X2EA 4ZDIA 1SKYB 4L28A 9ATCA 3NAMA 1P0CA 4HTFB 4LMAA 4H7PA 4A8HA 5I9LA 1U2ZA 5B3JC 4MW4A 2CJWB 1C7IA 3NM6B 3TOZA 1A5ZA 4KMOA 3MEQA 2UYHA 3COPA 3HY3A 3TNLA 1CEQA 2HH9A 4DIFA 1VCHA 2JATA 3C1OA 1H05A 2F8MA 2JFYA 4G1VA 3PZBA 1P60A 3V1NA 4QKQA 5ALPA 2J30A 4L0DA 3ZHXA 2G3DA 1SBHA 1YZFA 3DV9A 1AKTA 2D8AA 2VWPA 3C7DB 3HYRA 4X71A 3WNVA 4R81A 3ZQUA 1H1LB 5CXUA 1B8OA 3N76A 2XWPA 2P67A 3DD1A 5DP2A 1LTQA 1UADA 3ZY6A 1SWVA 3T99A 1YDFA 4WGGA 3L7LA 3LHKA 2PSHA 2PSDA 1N5LA 3QHPA 4HGPA 3ITDA 2J3DA 1XJ0A 1Z35A 2VNHA 1O5TA 4ZAFA 3PKZA 4H0CA 4TWBA 5C32A 2AEJA 1VDZA 4MQ5A 4O4JF 3RG8A 5HUHA 1Z18A 2Z09A 2R6R1 2OM2A 4C4OA 3K72B 5T41A 1XVIA 5JQWA 2RHHA 4GM0A 1V9SA 4EOGA 2DECA 5AVTA 1E2IA 1EWYA 2DC1A 2QMEA 3RF7A 4CODB 2JGJA 1SCUA 3PA8A 3LBNA 3AEUB 1EGQA 2OORA 3DBOB 5DTRA 3VOBA 5JHHB 1XVVA 3GAAA 4FFBA 3H42B 3PDJA 4GZ5A 1CZLA 1TX4B 5TSDA 2WWWA 2WE7A 2WFZA 5AVJA 1U2SA 2UXDB 2X4IA 1I6LA 3IUJA 3ZHYA 3IRVA 1N8SA 3OJ0A 4JI1B 1MABA 4WN3A 2GLXA 3RANA 1EFAA 1IBLB 1PUJA 3Q40A 4JYMA 1JBKA 2HU8A 2WMOB 4CV0A 1R8XA 3C4JA 4WLOA 2N1BA 1SH7A 2ZWOA 3SLKA 1DFHA 1ZVMA 1W30A 4UVIA 3SEFA 1W85A 1AXGA 2H52A 5AVUA 1U7HA 1I24A 1CJBA 4YLEA 5G0UA 3NHJA 1TMYA 4BX0A 3MYYA 2O52A 4WOKA 3T5AA 2B7CA 4PZ9A 5DVZA 3UJ7A 2HM7A 1T2EA 3FOAA 3LIIA 3V2UA 3K70C 2IVZA 3Q7EA 1ORVA 2C8JA 4FZ3A 4LV6A 4POAA 3NHRA 4D81A 3H1BA 3HBFA 4OK3A 5ALHA 4AROA 1WDLA 3BBPA 3OIYA 4EEKA 2G72A 1LLCA 3HU3A 1T2CA 4HATA 4DABA 3K2QA 2J3HA 3MMNA 1WY5A 1QP0A 4NCJA 4E1BA 1FRNA 5HF9A 5TC4A 2YXBA 1X1AA 4COOA 4Y2RA 4ETMA 2PRZA 1KNQA 3DR3A 3GRPA 3OM8A 2XB6A 3RT9A 3WGLA 1P1BA 2RARA 1C3EA 4G63A 4WWHA 4A8TA 1TAHA 3C39A 3LAWA 2HJWA 5EIBD 1U81A 1GLGA 4PZPA 4YRKA 4C4PA 4DC1A 3SHVA 1SQGA 2ZUWA 1AUXA 3CPEA 3B7PA 5EGSA 3KC2A 1QMGA 3HY4A 4C78A 3Q85A 2XPCA 1HI9A 1QWSA 4Q1BA 2AMJA 4CL2A 2XUIA 3QK7A 4XGQA 3IODA 2YMQA 3I8OA 3OPQA 3B3GA 2L0XA 4NATA 4RPKA 3MD9A 1GQOA 2VZ8A 1BROA 4KKXB 3FR7A 4FUQA 5EJEA 1QV6A 1AG9A 1C3XA 3KVVA 3PEEA 3EASA 4JJ4A 1OVMA 1THGA 3MQ2A 3RS4A 2L18A 1VPWA 1N2IA 4IUYA 3GF4A 1MCZA 1ORIA 3HHEA 4FGJA 2L69A 4ZQIA 1H4SA 1AS0A 1KP3A 3ORSA 3RABA 4TVKA 3OX1A 3QV1A 4CUZA 5B3JA 3BE6A 3COYA 2AB0A 1UJ5A 1U1GA 2VAXA 4LJ6A 4O2RA 4HZUA 1Z3IX 1LW6E 2C2GA 3EIEA 3I23A 2O8FB 1Z62A 1VL8A 3OU7A 1F17A 3CB2A 4P32A 1X14A 4PHGA 3GRZA 4R3WA 2H51A 3GP5A 1Q84A 3F6SA 3F4BA 4B75A 4N41A 2BEUB 2HSJA 2AWOA 5BVGB 1LI4A 1R10A 5BVHB 2XZPA 4KQGA 2PV7A 1T6BY 1RZVA 4ZTBA 1S6YA 2AG0A 3UA0A 3EXFB 4LVNA 2JKYA 2ORYA 1ISGA 3W8DA 1W5BA 4MGIR 5DOVA 4TTVA 3SG0A 3ZWNA 1XNQB 2EIHA 5TMBA 2QP9X 5IARA 4LYEA 4C4TA 2DKFA 4IIYA 4L8YA 3A1SA 3WISA 4F71A 4Y2SA 5CDTA 3JQ7A 1DDIA 2OXRA 4FWIB 4LJ5A 1C3LA 5K8JB 1KFCB 1CR2A 1YBHA 3M1LA 1E5LA 2H1FA 3B2QA 2WB4A 3R23A 5J2TF 1NP7A 3KEMA 3GGPA 3FLBA 4Z4EA 1PR1A 5A2GA 3PTAA 2FEAA 3ZHTA 1NRJB 2BH2A 5J5VA 4G4IA 2NSHA 3GT4A 3BC1A 4NFLA 1APBA 3KKMA 3IAXA 1KEPA 1T3TA 1QYWA 2YWRA 3ANMA 1Q7GA 2JAHA 1Z0IA 2HDWA 3DBIA 5DHSA 3IR6A 3TXAA 2TMYA 3PB3A 5H70A 4JBLA 4RV9A 1UFVA 1FDSA 5LBTA 3W8NA 5A6VA 2Z8XA 2CLOB 4P7JA 4UZEA 3HRKA 4MVJD 2IY7A 2VUHB 1T2VA 2J0EA 3ETCA 1XTPA 2PJZA 1A5SB 3TCNA 2M6KA 1UPUA 2ASVA 2IIQA 5G1PA 1U28C 5JWRA 1G38A 1BA3A 5H82A 3WK6A 4ZMRA 3L9XA 1DKPA 1K2WA 1G5RA 2E2WA 4QOEA 2DWUA 4QT0A 5F21A 3SMVA 4G4GA 1RXYA 2F3QA 3UV3A 1B3BA 2JJ1D 1ZJYA 4O4JB 4CLRB 2ZXUA 1PYOA 2X4DA 1WSWA 2AG5A 4BNHA 1PR5A 4QQKA 2BT4A 5DOZA 4RXMA 4A10A 4CDNA 3DNPA 1Q21A 1DKOA 3OCZA 4QBKA 3K0CC 3ZK8A 4R71A 1PZGA 3OE7D 2HNAA 3ONNA 3ZH2A 4IXDA 4WADA 4DUGA 4MW2A 5KYXA 2J4CA 1MR3F 3MBOA 3TRJA 2PSEA 4K9KA 3H2ZA 4ROSA 3ZE7A 3M9WA 4U02A 4URWR 2ZIAA 4JU9A 2Y0CA 4YUVA 2H5LA 3ND8A 3PNVA 4MVXA 5FF9A 5TEVA 1U7TA 3CN7A 4HG2A 4DOMA 4ZJZA 4WCVA 5CG2A 4CM3A 3OO0A 4L1KA 3TCXB 1M5UA 4FGUA 3KHTA 4BQNA 2XQGA 4MWTA 4YUYA 3IVCA 1WU7A 2ZYVX 3DFKA 1CW2B 1DAPA 3QUTA 3D3NA 3M4YA 4KX5A 4UPDA 5CVVA 2JGEA 4PBRA 1UXOA 3HCWA 1VLQA 3ORRA 5E7JA 4J90A 3ZIAA 4FU0A 2JIBA 1GG5A 4Y0VA 2FAXA 3PYXA 3W90A 4YJ2B 4YCCA 3RS9A 5J47A 3LPCA 1E1RA 5L95A 3N7AA 3ZK9A 1S4MA 3LGSA 4KIFA 3FD8A 3KTDA 4KQKA 4P4NA 4F85A 1D0VA 4EMBA 2I66A 4JJ6A 5B64A 1DBWA 2CHEA 1TRKA 5FI1B 3CZPA 2FFJA 1NSYA 2OZLA 3NDJA 2KWIA 2MSEB 3GP8A 4V2IA 1FLNA 1RXSA 2PMKA 2GR7A 3MCUA 1UBSB 3P2EA 1TYDE 2VVTA 2YV1A 5BQFA 2HMVA 4F5ZA 1WM1A 4CM4A 4BJ6A 1SCDA 4ZKDA 1SBTA 2YRXA 4BWGA 2QVYX 3K9QO 3LWBA 2ZT7A 3OCYA 4H59A 1DBQA 1VG8A 2GGSA 1Q91A 1LW7A 1L8QA 1NKTA 2WHPA 3DQPA 1RJWA 2PGNA 1UKYA 1WR8A 1LNSA 4GKBA 4KFUA 4P36A 5JQGF 2OGUA 1Z9BA 2G08A 1JJIA 3DF7A 3ECAA 3LUCA 3QWFA 1U2GC 3VAAA 1JDJA 4CVNA 5A3JA 3AHIA 4MVWA 2C9DA 3SHFA 2Q3LA 2R7LA 2WFLB 3EULA 3WFZA 3AWDA 2ANBA 1KJ9A 4Y6QA 1PKEA 1MAVA 2DOKA 1B6RA 5FBLB 2I4LA 1MOSA 1YS7A 2HRCA 2YHIA 3T5DA 1TMGE 4RVHA 1KKLA 2BFWA 2G07A 2PD3A 2EP5A 3G23A 3FPCA 4IEEA 2ABWA 3HR7A 4BAGA 3OTOB 3RVDA 4J9VA 2EERA 1II0A 5AKYA 1QFXA 1Q0ZA 3KSRA 4UFPA 2AT1A 1JIQA 4BNDB 5JNWA 2O1EA 2VOEA 3N5CA 1IXRC 1QO0D 2I4TA 3QVMA 2O2CA 4MQ4A 4MUHA 1PJLA 4F21A 3Q41A 1A5AB 3BT7A 1JFRA 2DBQA 3VR1A 2IS4A 3S44A 1PT7A 1ESDA 2Y76A 1R8QA 2XIQA 3OQJA 1K3TA 3B1FA 4NKRA 3TQRA 3S2ZA 1X15A 4IOMA 4JJAA 3VUFA 1GYPA 1DJQA 3W6UA 5JBNA 5KYYA 4J1NA 3WGKA 5KREA 3ZD7A 5T7BA 1Y5RA 3M5DA 1EVKA 4ID3A 4OQFA 2DSNA 4KJXA 4YRMA 2EL7A 3GUCA 3I8SA 3FB1A 1Z0ZA 2DPHA 3OZFA 3UENA 4C3VA 1EVYA 5LOVB 3IAUA 3ZJTA 3GLVA 3NKVA 3ZVRA 2V7WA 2FWMX 1EUCA 4KNWA 4YUZA 3ER6A 3OWHA 5KTMA 3IQWA 4NS1A 2VNKA 3J7TA 1U0RA 4QGGA 3VDRA 5FHRA 3CIOA 1TECE 4IHJF 3HUEA 3FBWA 2P9HA 3AX6A 5ICEA 5IC4A 4O29A 4JKIA 3VC2A 3NP7A 5AW2A 4KXUA 1V16A 2OXEA 2QXUA 4HEHA 4DBLE 2JFHA 4D7AA 1QX4A 3CF4A 2Q8QA 3BGDA 3LUKA 2PCJA 5EWMA 2SECE 1F4LA 4EDHA 4JYZA 2FU5C 3I2GA 2FPIA 1EE9A 2IZ5A 4YACA 4BNKA 3C3JA 2SKCA 2FVYA 1DE0A 2HOQA 2ZJFA 3R5SA 1TQ6A 4HLUC 2ST1A 3LLUA 3L0DA 3O9ZA 1QYXA 1UAAA 4LIPD 1BE6A 3TD9A 5B1DA 4GYWA 3BX1A 2GT1A 4GXNA 4XASA 1ZOPA 4EVQA 2E37A 5DLDA 1KTVA 1X1TA 4DSZA 1K5DA 2OP0A 1DJOA 3EXG1 1M5TA 3SBEA 1IVSA 3GA5A 1Q6YA 5C8YA 2C8LA 3QWBA 4NJEA 3C14C 4IGFA 3CLSC 4J3FA 3WAKA 1UMCB 1GFWA 1V37A 4GBGA 4Q05A 4DG8A 5GMOA 4IPTA 3C74A 3KQMA 1IRIA 2QYSA 4B3FX 1MV8A 3MWYW 1N9ZA 3GFVA 3VJKA 3NETA 4AWBA 4DA0A 3D3WB 3T0IA 3AFIA 3OQ1A 1SUSA 4M21A 2YY5A 3I0NA 4XDHA 2Y27A 3ZCUA 4MUAA 6REQB 3F98A 1OV4A 4OA8A 3KJXA 4D2IA 3AR7A 4K7JA 4QDKA 4WASA 3X1KA 3ZEIA 2GZMA 3PVSA 2DULA 2R4UA 1NIPA 1NIJA 4ECEA 3K16A 5KWSA 4J0KA 5CFOA 1ZNZA 3UMBA 4GM1A 4YNBA 5EZYA 3U5ZB 1FMJA 1VJGA 2PBFA 2H1IA 1OC2A 3L6EA 1J33A 5KWJA 3MB8A 1HDZA 3Q0EA 5JZOA 4WKPA 5A7HA 3CSSA 2BR3A 2ERYA 1KDOA 2M6RA 1Q0SA 3AKDA 4LN1A 1UC8A 1X6VA 1CB7A 2CMFA 1QFYA 3LL7A 2R6FA 4ZVKA 3TFWA 4F3CA 4DAEA 5JEEA 1RYDA 3EIUA 3BGVA 5ENVA 1QR2A 3WIEA 2CL0X 1IDN1 4PYRA 4FMDF 1KE1A 5IULC 5BSGA 1YHZA 4FFRA 5TQ0B 3KQPA 4D96A 5IKXA 4B46A 5U4XA 1EB8A 2B35A 3IMKA 2XTMA 5AVSA 4DV7B 3DO8A 1VMIA 3KQOA 3EIOA 3EQ9A 1G55A 3N0RA 3JWGA 2GJ8A 4IICA 1U2DA 1IXYA 2IYZA 2UZAA 4IO1A 3WP1B 1Z8DA 4GI2A 3S5UA 2WTUA 4RVSA 2VWGA 1N3IA 4IQ0A 3RUDA 1BGWA 2BN4A 4MGZR 2XUPA 4E4TA 3OZAA 421PA 1QYVA 3GEGA 3JW8A 3CJQA 4ZCSA 1IEWA 1U5AA 4QRHA 1ECJA 1E2EA 2R6ZA 2HHLA 3H0KA 3A0RB 4KDEA 3UWKA 1VE3A 2JAWA 1JG1A 2WTAA 1XTKA 3GX1A 4RVDA 4UAJA 2GF2A 2QAGA 3D7MA 3HB5X 4G81A 1XMVA 4FW9A 5FA6A 3W2GA 4DIOA 4WBSA 1PVOA 1FX0A 1DV2A 2WM3A 2ACWA 4L8WB 1K63A 1F0KA 5M3BA 2YWDA 3K3PA 4JL5A 4OI1A 4WV3A 2Q29A 4RFSA 4XM2A 1PD1A 5IW8A 5C18A 1BXRA 7AT1A 2NT3A 2C97A 2XECA 3CINA 3T35A 3R76A 3AVOA 4X94A 5EJ5A 3AF0A 2O1XA 3ZWCA 4XYMA 3NTVA 3GFFA 2ZSHA 4RK5A 5JBQA 2K87A 4JJFA 4WN9A 1QTIA 2VF2A 1ZH4A 5GGXA 3VVMA 3DVRX 3AUXA 4BUZA 1JEYB 5IVKA 2WLSA 3RBXA 4CKZA 1OV6A 2BMJA 2Y71A 1I3MA 1UDXA 2HWYA 1FUEA 3PLNA 1JIJA 2AFVA 1GUYA 2LVBA 1XP8A 4JZKA 2CMHA 4UHHA 1X9HA 1E2HA 2G82A 3I01M 1M67A 4KXVA 3VI3B 1C0IA 4R8LA 2R4TA 4HEJA 1L6IA 4J07A 4D3DA 4TMFA 3F5SA 3PNOA 1E99A 1YDWA 1NNUA 3ENKA 2CL5A 5AMXA 1XEFA 4KVZA 4D6XA 2J6HA 3ND6A 4GEGA 4J43A 2WNHA 5MGBA 1MA0A 1RLIA 5LN1A 1SOUA 2C0QA 1K6XA 1OBFO 2JBAB 2JIZD 4KQIA 3BORA 3BULA 4F4HA 4MB2A 2WPDA 3U4QB 3AI3A 2GBPA 5BP7A 4OH1A 1M73E 5H68A 1BZYA 4DREA 1EWQA 3U56A 5E6UB 1YF3A 1MOQA 3HA2A 4ON9A 1T26A 2B2CA 2Q5CA 3DEYX 3ESAA 4WEOA 3JVEA 5ALEA 2YX1A 4KHZA 5M7EA 3T5TA 3PFCA 3PKJA 5K0CA 4NHEA 1K4KA 1L5SA 3PL5A 2CF5A 4PCVA 4JP1A 5ADUS 2QNBA 4LY3A 1XTVA 1W4LA 4BV9A 1AF4A 2A5JA 3HCEA 1QQTA 2I80A 5FPTA 4WZAE 1G1AA 1IWOA 2OBXA 1OUMA 2JBAA 1U04A 3RJTA 1O7JA 5GONA 2ZS9A 3BZWA 1SBZA 4E30A 1IZYA 2GHRA 3WGZA 3ZCSA 2QEQA 2VDMB 1P7WA 2YOHA 1B6GA 3ROMA 3IDSA 2H9IA 3GJ5A 3B9PA 5ALDA 4Z99A 5DI9A 2XUHA 2ZUTA 3PF9A 3IXQA 3Q3EA 4JLPA 4C2BA 1I8TA 1E8NA 1T3HA 3TRFA 1Z08A 1XTRA 1LWOA 5CD9A 1TEXA 1N6HA 1NTRA 1YZUA 3NIFB 4ENSA 1AXRA 1NDHA 2O2SA 3FLAA 4ND4A 4Y1RA 3BSFA 5HIKA 1XTZA 4EG0A 1Q1ZA 5CK4A 5A3QA 4CF4A 1E2QA 4E1AA 4EYGA 1A9XA 1M0WA 3N2GB 4FNAA 1L5HA 5J2UF 1S9HA 2W6IA 2VPZA 3E7FA 3R5FA 4TOIA 1QLHA 5GJWC 2I76A 2XWSA 4Q9JA 3R4VA 2C3PA 1QZTA 3PWTA 1XC7A 1ILWA 4WCFA 1ZM3A 1M6HA 4TMVA 2XTZA 1OFGA 2JJ8A 4V03A 4LK3A 4A92A 3R40A 5A9RA 2HT1A 1DAKA 1JKIA 1R6UA 3MA0A 4A8JA 5LU9A 2YN0A 1YL5A 1QDUA 1Q92A 1EB9A 1KK3A 2BMAA 4AM8A 2IF2A 4YLYA 1JKJB 2WE8A 3O74A 3KPJA 4PRKA 4BAUA 1WXIA 3KFXA 5BW0B 4EVIA 4WDQA 3GCDA 2G7MC 4NLLA 4JODA 3K71B 1DB3A 3G8DA 2F4VB 2LW7A 2WD9A 1YJ5A 3K5WA 4PXSA 4H35A 4UBJA 5KSWB 2ADFA 3K0FA 1D2GA 4WZAA 5BPHA 1XXLA 2YICA 3QKTA 3TLKA 4EPVA 2O8FA 1DC3A 3FB4A 3MM4A 4UHBA 4XYLA 2O8BB 4KWIA 1CUUA 3OTIA 2PVSA 4E70A 4OEHA 1T9BA 2DHDA 2ZZMA 4TM8A 1JHPA 4Y1FA 2PQ0A 1N2CB 1YC5A 4MR8B 1ZNWA 4UHEA 4WK6A 3N0VA 2W2MA 1KQPA 2IVFA 4WW0A 3AEYA 3ZQ4A 1JQDA 1PL8A 1EFVA 1GADO 4MZDA 3GLGA 3COSA 1WCWA 3FX2A 3HKDB 2JFFA 3D4IA 4HQFA 3CLKA 3KQVA 4BKPA 5AJXA 1PX2A 4GXQA 5ALZA 5EXDA 5LUAA 1RFLA 4G0XA 1YR9A 4W1SA 2JI8A 5G0WA 1G3MA 4IJ6A 1DDOA 4W6ZA 1FLVA 4POOA 3TECE 1IXSB 2NVOA 3TD2A 1HX7A 2O23A 2P4HX 3UFXB 1XLVA 1QBGA 4RVUA 3R75A 4U3JB 3S8MA 4Q18A 3REGA 5A3RA 1XL1A 3GDFA 4X9XA 2O3JA 1A8IA 2HRDA 3FZEA 4G5YA 1NYRA 4Z5XA 3PQ4A 3W3AD 1VIDA 1IOLA 2G1JA 5ALOA 2IFTA 4KXLA 5TR9A 1WDWB 5LLSA 1LBTA 5DYTA 2FPRA 4BFYA 4EEZA 4BTEA 1H8EA 4F4FA 2Z5GA 1OT5A 3OHSX 4LI3X 1PGNA 2V7PA 2XOEA 1J8QA 2RB5A 4NWIA 3MWKA 1SOAA 4RVGA 1IXZA 2ZWAA 3SF8A 5A7GA 5FBWB 1K3UB 4ZZ2A 4C9BA 1L7MA 1XV5A 2X5OA 2PYDA 3AB3A 4IJMA 3C8DA 3QYJA 4YRCA 3HH8A 5DB4A 1U2QA 1YRHA 2UZ1B 4HSGA 4D46A 3BZBA 4J1TC 2QLBA 3Q8XB 2FSPA 1Q12A 5CLJA 3LLSA 1QU3A 1VJCA 4N47A 3G49A 1MPXA 4XEUA 3AVQA 3G0DA 3VSDA 4DXAA 3O3MB 4HNUA 2NO4A 1UL1X 5FA5A 1JZTA 3VYRB 4WACA 3T7SA 3LF4A 3DZKA 3C5VA 2OD7A 1ENZA 1XRQA 3CI0K 3TX6A 1BYUA 2AL7A 3A9CA 1FYXA 3AFNA 3JQGB 4BFWA 3VNRA 3UIEA 4G9EA 1KEUA 3EXG2 1QVWA 2P1ZA 4GS5A 5CT5A 3RU2A 1WXQA 3OM9A 5KNLA 1N0HA 5CVJA 3JATB 5C5CA 4PG7A 3AUKA 4II2A 2IYSA 2PMEA 2GNOA 3NV7A 1T29A 3IOCA 5EKDA 2IHBA 3H87A 3VV3A 4N76A 3MLAA 3TINA 5JJBA 2J9XB 4ZQBA 4AJHA 3GQBA 3KT8A 1UDWA 4ITVA 1MH1A 1RHRA 3HCNA 4KXQA 4NBVA 3TN7A 3ZWOA 2FZCA 4GD3Q 2XGJA 3MS4A 5KYWB 3I5XA 3OQBA 5AM2A 4J4HA 1SKQA 3CKYA 4LXIA 4YS6A 1MV5A 2VDWA 4C04A 2YZMA 1NQOA 3UGJA 1FYFA 5DI3B 3ZCTA 2Y9MB 3EZNA 1QVRA 2ATIA 3F6PA 3EVCA 1J0BA 3HKBA 3A06A 5BSEA 4FBMA 3C1UA 5EHZA 3REFA 2CCKA 3U80A 2XMCA 2BFCA 4IDDA 3M83A 4IJVA 4X3PA 4Z9AA 5EP3A 1QFZA 3REOA 1J8DA 1ESNA 2EC5A 1XI2A 2Q4RA 5KUTA 1C30A 1QO9A 4FPXA 4EKGA 1YGYA 2YUIA 4QGHA 5ESDA 7MHTA 4DNOA 5THXA 1RWXA 3ZG6A 2X9NA 3KTAB 2VA9A 1U0JA 4M38A 2HA2A 4D74A 4E6EA 1GTSA 2IH5A 2F1IA 5HBRA 3KFLA 4MUXA 1WZNA 5JXHA 6ADHA 2ESRA 4DDWA 4P4LA 3EWAA 1SXQA 4NULA 3C3EA 3GLQA 4HRYA 1QP4A 1ZL0A 3A2LA 1DCFA 1QPGA 2JBHA 2H5EA 4HXGA 4Y2QA 5JCOA 1TEZA 1BN6A 2QGFA 1MG5A 1NJ6A 3FFTA 5IHPA 3NHAA 1BHQ1 4XFDA 4W9MC 2NMVA 4MRNA 2F64A 4CMIA 4EHKA 1A4XA 1L4HA 2IP2A 4IJQA 5FOTA 4EIWA 3BQ9A 1T3ZA 3ROZA 4OQYA 3EDOA 4B6QA 3WAGA 2NT4A 3D4OA 3LUGA 2X0DA 3W3AH 1NVMB 3OIFA 4TQUS 4HH3C 3H84A 2WHPB 4A0RA 4PO3X 3WL4A 3CZRA 1C1YA 4FI3F 2JGDB 3GQVA 1FQJA 4INAA 4M37A 4RSRA 3RRBA 2QW0X 2NIPA 1UBCA 1AXEA 3T61A 2WTBA 5K6AC 1ZWKA 3DLTA 4LG1A 4IDCA 4M9RA 5ED4A 1YXMA 2W2PA 2ZR0A 4ZPJA 2R5NA 5BT8A 5DNUA 4OD0A 4BN0A 1T6YA 3IDOA 2NZUG 1B00A 1Q0HA 2PGIA 4Y2XA 3I4CA 4X1YB 3ZUPA 2XTAA 4C21A 2DH5A 2VYND 4ZN6A 5BMVB 3OQIB 1M74A 4JOBA 4Y2YA 3C3XA 3X44A 3CE6A 1SIOA 3OJEA 4YRZA 3I5UA 3O6VA 1J70A 1AHPA 3W9YA 2B9VA 2UZ3A 1SQFA 3KOXA 1X19A 2MHCA 1N5KA 3B78A 4YCBA 3IT3A 1U0OC 2VPWA 4MRSA 4R2KA 5KDDA 1I2CA 1QG4A 1SK8A 3ESZA 3JALB 4UEJA 3RVNA 1D7OA 5KTSA 3SDSA 4CM9A 5I7VA 3H2HA 1UUFA 3KP1A 5HF6A 4R6WA 4AJNA 5LL6P 1VHQA 2J5QA 5JNVA 1BIFA 4BO2A 3PDHA 4LCEA 3SEZA 1FLDA 2QYTA 2HIGA 2R00C 2YYAA 3WNDA 1GGNA 2WIAA 4FQ8A 3GLFE 2X1MA 4S1TA 1Q1AA 3UJPA 1LUAA 1YZGA 2HDHA 3A3PA 2W83A 3QEMB 4E5MA 3PUYA 1F20A 2PX0A 5EI5A 2NU7A 4TV9F 1OBOA 1V96A 4RLHA 4ZO9A 1QG2A 2O7NA 2BVNA 4BO7A 4EG1A 5IXYA 3FOZA 3I53A 1QWOA 3L7OA 4NYIR 2FUNB 3FCSB 4H7IA 5ALIA 2HSWA 3KQKA 3LRXA 4U7DA 1FOEB 4R2XA 4WY2A 2H29A 1TLLA 2QMOA 2AVDA 1G16A 1N2JA 2H4FA 3F0TA 3NIGB 1Q95A 4OHPA 2G5PA 4B3CA 4KPEC 4K87A 4ZPXA 4M9ZA 3NHMA 2R8PA 1JHAA 3CSUA 3F7MA 3ZBQA 3IMFA 4HH1A 1VJ0A 2VTKA 4II3A 2EDAA 4RF4A 3WK9A 3VU1A 4AP5A 4MAMA 3CEAA 3EAQA 3L5KA 5L4SA 3H2JA 1I7LA 4JFRA 1U0FA 3QKRA 2ZM6B 2BM9A 5KWIA 1SXHA 1AV7A 1NYQA 4MQUA 4BTVA 1KS2A 1OXUA 3LQYA 1MBZA 3ZWPA 3ACBA 3K5HA 2XGSA 1QZUA 2BMDA 4MKHA 1H3EA 4Q1FA 2X41A 4HS9A 2HPVA 4DWJA 1ACJA 4P80A 3GGCA 3NHUA 3VA7A 5I48A 3Q3JB 5DZSA 3QMWA 2ZJ7A 2ZSIA 1FTGA 3VKHA 4F06A 4EUNA 1NPDA 2C5AA 4QASA 3IXMA 1IQUA 3IHKA 4Q34A 4DUYB 4V3BA 5ILGA 4YMSA 2HK8A 3D1LA 4OMDA 5JG7A 1RRKA 3W77A 1KQ3A 1JDBB 2E55A 3EGOA 1E69A 2JJMA 2XCOA 3BMNB 3LT5A 3ZDRA 1P1KA 3OSZA 4EHFA 1KXZA 3GUYA 1CS0B 1H5QA 2RKOA 3ITNA 5DISB 3EA5A 2P6RA 4YT8A 3ER8A 3E53A 3OOJA 3F8TA 4YRDA 4LF8B 3T9FA 2W37A 4EHLA 3DMRA 1A98A 1H0HA 4ZD6A 1RYZA 1G1MA 1A4RA 2GO7A 4H6WA 1UDCA 3S7TA 5LMZA 2LXNA 4GE3A 3USCS 1AK1A 4NE2A 2FVXA 3I9V1 2HJ9A 3BK7A 2IHVA 4KVFA 5F33A 5F73A 1KZHA 3HI4A 1L7XA 1ND5A 2DPGA 2QTMA 3N58A 1BWPA 2BR5A 4S24A 4DLYA 5KJFA 3C85A 4DV2B 2R87A 2NP6A 1CP3A 1GWNA 3WYFA 4OSEA 3JAWA 3MJCA 4L6AA 4ZYZA 2EYUA 3GMTA 2VDQB 2FFQA 1ODCA 2HZBA 2PBRA 1ZD1A 2C4HA 2D5LA 3FHCB 1C29B 1XZMA 3QUCA 3R0QA 4K8RB 3RCBA 3UOGA 3FWHA 3WGGA 2QTNA 4AZWA 5EMNA 4JHXA 2J9GA 3UWSA 1GDDA 3BAZA 3IO3A 4GECA 3U4QA 4BQIA 3K9FC 3BWEA 4BATA 1L4FA 2HNKA 2W8ZA 4C6SA 4IDOA 4FYXA 1BCSB 3TTXA 4RGQA 1QUEA 4R6XA 1TD9A 1TQHA 1K6MA 1JFLA 2C94A 2R1VA 3DDWA 4OXRA 4BBPA 5LU8A 3MILA 3ADOA 5EJ6A 3IYLW 3OE4A 5CJ2A 1LVHA 4RCZA 3WX0A 2C20A 2E89A 4XQGA 4R0MA 5AOAA 1BFUA 2X1VA 2X2EA 2OESA 9LDTA 4UMFA 1M8KA 2A0KA 2V7UA 4XD7A 3OT5A 3ZDYB 1HNXB 2HMUA 5H1YA 1OW3B 3UMGA 3PHIA 4X20A 3C43A 2DMRA 3ANYB 3FCOA 4V0NA 4C4ZA 3DD5A 2CUTA 3IILA 1PEDA 2PJDA 2P2ZA 4GGPA 4B4WA 3CVOA 2KBFA 5CURA 2YJ3A 3JV7A 5I9BA 5CDYA 4CMIB 4EKDA 3VRHA 3W3ZB 1M2KA 4D9BA 1ZGZA 5GZ1A 1J2RA 1YOVB 4MMXB 1JA1A 4ND3A 5HYVA 5EXTA 3D4PA 1I94B 3EISA 3AR9A 5DYGA 1IQRA 1K6JA 2WNSA 2MYTA 3K0AA 2NYUA 5AVWA 3SVTA 2FFAA 3MTQA 1PJZA 3LTEA 3AU8A 3ASUA 4GLLA 3DE7X 3JVVA 3KEGA 4MX8A 3T1QA 3M1AA 2NNWB 3OKCA 3EXEB 3FJYA 4FHGA 4MUKA 2JHAA 1N2EA 2OG2A 4UUOA 3EQ6A 5H59A 5KKCA 2GXUA 2JHGA 5K0LA 4RW0A 3IS3A 1WX1A 3B9RA 3MAAC 3D0OA 4DR3B 3W2TA 3EEFA 1SZJG 4I1RA 5TQJA 3FPAA 1ZCZA 2G8LA 4UCWA 4E2XA 6REQA 3MWFA 2FB9A 4EW3A 3FYSA 1KFEB 4TS9A 2QTTA 2C9YA 4Y2PA 1YASA 2VPTA 3CW9A 3J81k 2FXVA 2GKOA 4MV7A 3N8DA 4FEGA 5CNMA 4DA7A 2XCSB 4LBZA 4JUFA 2Y4NA 3LUPA 4KO2S 4XPIA 5IBRA 2XJ4A 3H5WA 3NC0C 4KPFC 1BXZA 2JGMA 4BZXA 1SQ5A 5K20A 1X9GA 1W52X 1P4HA 4TRJA 1CEXA 1JEOA 3GELA 5DEOA 3U81A 4FCTA 1COWD 4UBOA 2M1XA 5IFKA 3DUFA 3ZN2A 2E82A 2XOKA 4DJ5X 2VNJA 3PIIA 3D6VA 4LQCA 3BK1A 3HU2A 4QBIA 1H93A 3Q88A 4HXEB 4K03A 5F9MA 3QWHA 4HKTA 3WICA 3ICQB 3LBAA 2AGVA 1VIAA 1KJJA 1ESCA 1JDTA 3KYCB 4FNOA 4UTNA 2R2GA 1HYBA 2KLBA 3A9WA 3HADA 3I9MA 3SVLA 4YHHB 1PGJA 2ROQA 1NM5C 1USIA 2PX4A 3CH7A 3E15A 3JQCA 4GOKA 4N3CA 1O95A 1IZ0A 3QELB 4TLCA 4Y6PA 3USES 1WTCA 1VE1A 2WJJA 5B6PA 3CO0S 3LNTA 3NHYA 5KYUB 4YJ3B 5AW8A 3ES9A 4GC9A 5D2CA 1KPIA 3QOYA 1G5TA 4A91A 4BB5A 4NX2A 3JQGA 2XADA 2WKPA 4B2LA 3E3AA 5U9CA 3HCFA 4DSAA 3UPUA 5GM1A 2I99A 3P0JA 1LSSA 4UQOA 1DBPA 1PZEA 4XOUA 4HDQB 1BE1A 1W9HA 4K6HA 1RRVA 4NMMA 4UMEA 1A9YA 3T3DA 3B5JA 4L16A 3VZSA 4ZMBA 3TGLA 3H1FA 5U1PA 3FUCA 4JLMA 5AVRA 1EXVA 1BWQA 2YFYA 1ZBDA 3PUKA 3SCZA 1SO8A 2FG7C 2JFUA 1JF8A 3D2CA 4ND7A 1PVVA 1Z47A 4RPIA 5EIFA 4HVLA 5JR3A 2R65A 1PFGA 1XRRA 1H9BA 5FYDA 2P9YA 1EXDA 1CF9A 1RYHA 2I03A 3ZXXA 3U7HB 1TZCA 1CUZA 1JDUA 2G1UA 3E4CA 4RO0A 3S40A 3UB3A 3T3NA 4EZIA 5CJJA 2XD4A 3D8HA 3FYUA 4DIKA 5K99A 4LUCA 3ZVKA 4WOPA 3V3TA 2A35A 1R9GA 4QYMA 4PQRA 2AJLI 1OYWA 4OGGA 4FHCA 3EIWA 4WOCA 2IOFA 4HGNA 1YTUA 1GV0A 3HUFA 4JITA 2A57A 5CX1B 5B1EA 5M5BA 2GPJA 3V4ZA 2SNIE 2Y1XA 3P71T 4EY3A 2AFHE 2WJGA 4RPCA 1IEVA 3PKIA 4G2TA 3EJWA 4MS1A 3NHKA 4BE4A 4Q7JB 1E7RA 3FYCA 3V48A 4ILEA 1RYFA 2IHYA 3KELA 4QT4A 3S2IA 1E9RA 1PQPA 2VBCA 4LZLA 5E1OA 4KZPA 3SJAA 4BYMA 2A52A 1ZD3A 1XDUA 2I4NA 2VDVE 5C1BA 3A04A 1G21B 2F48A 4D25A 1CUXA 1TT5A 2R8OA 3FKJA 3PPVA 3WS7A 4F7WA 3L6DA 5FWYB 4ARCA 2WWHA 5KEIA 2HRQA 1JXAA 2BGUA 3FYDA 3ABOB 4DT1B 2GZSA 5C1PA 1NKVA 2P2CA 4BP8A 2XCTB 4QPNA 2TMDA 3DLAA 1OXSC 2WUVA 3LKBA 3U3RA 1BCSA 2FFRA 3AEKB 2QPAA 2W98A 3LH5A 2WSBA 4B2PA 3W5AA 1SU7A 2ZATA 4HDSB 1H4TA 3W05A 1AA9A 1C14A 4ZRNA 5F2EA 4TN5A 2VT3A 5KU7A 5FAKA 3QX7A 1KU0A 3M82A 5CCDA 1XTIA 1BXGB 1Y4ZA 2RMKA 3B70A 4NQZA 2XMRA 3NB0A 3LGXA 4QDTA 4C5BA 3WLPA 2PZGA 1N6NA 3U7EB 3LKDA 4R1TA 1RPAA 4I4NA 5DTQA 4ARUA 1B23P 2QX8A 1J9EA 1XLTA 2ZJ8A 1JKJA 3MCVA 4X97A 1E1CA 2P0YA 4LV8B 1OLUA 4KIUA 4HX5A 4YMWA 4PN7A 4B8WA 1QR6A 1YFKA 2POCA 3JZMA 4UTVA 1E61A 1N1MA 4ZARA 3LY7A 3AJEA 4YV7A 3Q2IA 4P38A 4CT5A 1PK8A 2FN9A 1U2RA 3PEWA 1D2AA 3A4YA 2FUG6 2W4QA 2WU0A 3NEAA 3TDNA 3L8CA 3NBYC 2QBYA 4RETA 1XROA 2HRBA 4ZANA 4EYOA 3EH2A 2D06A 3IEIA 2VHEA 2P5SA 2QOEA 3C4QA 3QELA 4J7XA 1PIWA 2PWBA 5IXSA 2C58A 2Y93A 3OEHD 4NAUA 3JZIA 2P9EA 3OX4A 2D2FA 4FLMA 4LPSA 3RB8A 4DQXA 2WQZA 5LNK1 4HEA1 3GPBA 1SUIA 4Q4HA 4X7RA 3C3DA 1V3UA 3MWLA 1EGHA 3QVUA 3Q1LA 1UR5A 1WPQA 3JR7A 5H4HA 3EQ7A 2P6NA 3GFTA 5HJ5A 3I1JA 1U8CB 5D87A 3UMFA 2A0XA 1E4OA 1UKZA 3VTKA 3GFSA 1YFJA 3PZRA 1AKEA 2ZJZA 2GN4A 4RVFA 4ZALA 5KMGB 3OETA 2MT9A 1ZJZA 2IEGA 3AR8A 4UNRA 1E0JA 3OURA 4MWOA 4EKEA 1P1JA 3T1TA 5A4IS 2JLWA 2XB2A 3CU5A 3A05A 1DX6A 1Q1NA 5B1HA 5EXPA 5AM1A 3AOEC 5IVHA 2H2FA 1LEHA 5KYUA 3TLEA 4JXKA 3G5MA 4FZRA 1MOZA 4X65B 2XUJA 4IIJF 3ZZ0A 4EZBA 5J4HA 1UZAA 3KL2A 3ZDCA 1YQUA 2QPTA 1ONNA 4ZICA 4S2UA 3E05A 3Q3IA 3PRYA 4NPHA 1Q11A 2GN9A 4MB0A 4F91B 2IZ7A 4D5EA 1J0DA 2RBGA 2JFVA 3E81A 4JH0A 3WJ1A 3QE3A 2WAAA 4P7KA 5KKAA 2V03A 1RAEA 1V2HE 3IFSA 5GVSA 3V42A 3ZWBA 3WK5A 1ZD2P 3E5MA 3OFVA 3P32A 1DAFA 2WIJA 3QOFA 4KIJA 4L57A 1YDMA 3EF3A 3LHDA 3M5CA 3MMPA 2EG9A 3OE5A 2P8SA 3T0FA 1AKQA 3FPFA 4LJ8A 2G5CA 1RYEA 3IQZA 3WK4A 5F12A 3ZKAA 5LVAA 5E3HA 1RAIA 5A0VA 1RCTE 2AZDA 2IU3A 2XYPA 4HDNB 4C7XA 3SYMA 5IS2A 2UU9B 2JFGA 1JB1A 1RD4A 3ONVA 4RJTA 2VJKA 1NQAO 4KAAA 3TQHA 1VKOA 1ZXLA 3HDVA 2WC1A 3TSAA 3QE0A 4BQRA 5A1JA 2JAPA 2IZ0A 3DE4X 3DTVD 3EFEA 2OYCA 1XNHA 5CXQA 1U9JA 4G1MB 4JWKA 3TZLA 1H2YA 4Z0NA 1A82A 2BSQA 4ZHQF 3FIUA 2XMPA 3CM0A 1HEIA 2X3UA 1YHNA 4KQ1A 4TV8F 4L15A 5E38A 3RJZA 1BFDA 2RFLA 5CA0F 3IVXA 2R97A 4ARIA 4DDTA 1BG6A 2AOTB 2QT9A 2K2QB 2P91A 1FU4A 4R2IA 5LD2C 5KCZA 1GQQA 3EOAI 5IMSA 5KYYB 4H6PA 4QGSA 1QGED 2D59A 2C4WA 3OIVA 4FLEA 4JGGA 1GCOA 4QQRA 1HNNA 4RANA 4EO7A 3ZTTA 2OHJA 4UAGA 1DUIA 1GRQA 3LCRA 1BMTA 3JWHA 2F6RA 2H7CA 4JJZA 3WP0A 1AKMA 2CXQA 4QO8A 3TJMA 4ZAZA 4CMCA 2ZRKA 3M33A 3FZQA 4NAVA 4W5WA 4XUCA 2QLTA 1OYOA 3DVQX 3KV1A 4E5UA 4DY6A 1NAHA 2BIFA 3GVIA 3ZBUA 5LQUA 1V11B 4OATA 3GZNA 4WQMA 1E9DA 5BWCA 2JAOA 1Q7TA 2FN4A 2Z4SA 4ZGWA 4D02A 3IQXA 1L7EA 3IX7A 1R5NA 2WJ6A 1LWNA 2GEFA 4V2UA 4HNRA 4BRSA 1K8ZB 4E31A 5F4ZA 4CEIA 1EYZA 1QH9A 2D5CA 4AKEA 1M2VA 2GCOA 1RYMA 3UJHA 1QLJA 1TUIA 2G76A 2RGRA 3EGEA 4TT3D 1GQFA 1Z5GA 2H0RA 4LOHA 4KEAA 3BB4A 1CYDA 3EFBA 2HMWA 3QSYA 4P5EA 1LSJA 5TXGA 3UUEA 5KNCA 5DULA 2MCFA 3RUPA 4DR5B 3IP1A 4GPZA 2JH9A 2WEKA 2VSYA 5BSMA 1P0MA 4GPBA 4QUDA 5ER6A 4W4TA 4BIMA 4XM0A 2EYQA 1Y89A 4KIGA 3EC1A 3PHLA 4FHFA 1NWCA 4N03A 2P9JA 5IAAA 3E4DA 3ZWWA 2PUBA 2JEZA 2O7SA 3N6XA 1ESZA 1COWA 2QG6A 1B42A 1ADBA 2ZE5A 1F2UB 3C3MA 3PWKA 3DDUA 2IYEA 1NXQA 4OHUA 4EHBA 2PGXA 1K5HA 2ZBFA 3IC5A 3FOFC 4F3RA 5JSYA 5AUPB 5DXAA 1XMQB 1MAUA 4LWOA 2ODQA 1UMBB 4I2NA 2HSDA 1O95D 2AI3A 2ZWIA 4PW0A 4AAYA 1Y63A 3CVUA 4J9UE 4P3NA 2IRWA 4FONA 4DJJA 4L5IA 2XRMA 1SNYA 4PF1A 1W5EA 3SX2A 1GZ4A 1GQSA 4CCYA 2VUUA 2VYVA 1OLSB 3D81A 3ADBA 4M6WA 1GSHA 3STTA 1A8UA 1JPNA 1N7IA 1OLOA 1RNLA 1UBEA 1WS6A 4B4DA 1E7QA 3P5BA 5ER9A 3TLAA 3ZIDA 3MCTA 4IW3B 3W78A 4E2WA 2NZXA 1ZQ9A 6NULA 5A4FS 4FOSA 4QUBA 5HR5A 2Q4DA 2AN5A 3C3CA 2IELA 4MUFA 4QO7A 4JUDX 1AUVA 1Z34A 5HK8A 2G5ZA 1VE7A 3PDUA 5KYKA 4OMUA 3RNLA 2IK8A 1BX1A 4GUDA 4OQEA 3U0BA 4LGCA 1QC5B 2QSJA 3HZOA 5IN4A 4L0MA 4AMBA 1RHUA 1ZK3A 4RWZA 4Y0AA 5ISMA 2PAFA 1C9YA 3AF6A 3EDRA 3N8GA 2IE0A 1T5HX 2XQIA 3BK2A 3Q0TA 4P3XA 4QGFA 4RGYA 4V39A 5DNAA 3T7CA 5A02A 3RSQA 4HFJA 2NV2B 1DHTA 4OAOA 3JALA 3B8EA 3GBVA 5PNTA 3F5DA 3RJ9A 3HWX1 5CFZA 2GAIA 4HUQA 3L43A 1O58A 3AY7A 5EY5B 2PX2A 5EP4A 3W6ZA 5LBIA 2A1UB 4QEDA 2HIAA 2AOVA 1WXHA 4UUQA 5JI2E 5LIRA 3MNFA 4JSYA 2HFJA 4JFAA 2FWJA 3B51X 3HYLA 1KSJA 2Z6VA 4DZRA 2BCGY 1DAMA 1NBWB 1TAGA 2AX4A 3PHJA 4IIGA 3BH0A 4NE9A 5AOBA 1JLMA 3DFMA 5L8VA 1ICEA 1YRWA 2IYVA 2VO1A 2XXAB 3HCCA 5F3DA 1BJRE 2QLMA 2RIRA 1XGKA 1Z5PA 3AIKA 4XIJA 3RRMA 3T12A 4YPOA 2OXCA 4UDNA 5AKJA 5IM4A 3B3JA 4J7CA 5DCWA 5IJXA 5IZ4A 2EFDB 4R1UA 3V4VB 3JQ6A 1XLUA 4I3GA 4G4JA 2YHAA 2N42A 3IMGA 1KFKB 2X2OA 4MLZA 4QRDA 2W6CX 3WYBA 4BU0A 1M2FA 3E3MA 2J0QA 2N3ZA 1QCZA 1TQ4A 3WWYA 3UF0A 5JNTA 4QYSA 2HDNB 4MITA 4DA6A 3TJZA 3ICEA 4EABA 1CZRA 1UFOA 2C98A 3K73O 4ZCLA 1BYIA 1GU7A 1KDVA 3RV3A 4ZYYA 1NR5A 2CD7A 4BP3A 2C88A 3L18A 4IJWA 3ICOA 4P5DA 3WWZA 2XYVA 4LDZA 1A9TA 2FZGA 3IIMA 3K94A 5D5QA 1TKCA 1YE3A 2B5OA 2EFHB 4I4CA 4M3NA 3I2HA 4U2GA 4L5YA 1M34E 2HF7A 1NJGA 3HP7A 5KQLA 4MV6A 4G97A 4G1UC 2V4UA 4EP1A 2H1RA 4GZMA 4QREA 3N75A 1IY2A 2H85A 3P0EA 4XE5A 4MEAA 4QOJA 3TTYA 3RAFC 2GZAA 1MTOA 3AGQA 3EX7C 3PFKA 5ALYA 2H1OA 1GRCA 4D9FA 2Z6UA 4FGZA 1IWBB 3FUWA 4ETIA 4LRXA 2P2SA 4DLTA 2ACEA 1VPTA 2G0NA 4TMYA 4XDGA 2PJUA 4CN9A 2IP1A 3M3HA 5G4KA 1M0TA 1VSBA 2ZIFA 4RM3A 3GDGA 5E95A 4BC0A 2DPYA 4R4JA 3O8QA 3STYA 5EMHA 3CSDA 1UIRA 2Q5OA 2ZB7A 1E6KA 3JQAD 4ARZB 1VECA 3NI2A 4ZV7A 3C5HA 3FZNA 3CFAL 3FRHA 2W93A 1J24A 1U98A 3UHOA 3VJRA 3LBHA 4KCGA 1F6WA 1HEUA 3L8EA 1EJ2A 1FC0A 4GYYA 1YA8A 3ZV4A 5KOHB 1RQRA 1ETUA 3QW4B 4JLOA 5B4VA 4E3WA 2H2DA 3JD0A 4G89A 2HQBA 1PSDA 4NU0A 5CVDA 1FTNA 1QFSA 1WP4A 2NTYC 4TMXA 3ZXUB 2C03A 4EB8A 3CTPA 3U4IA 5EA2A 4CM5A 1XELA 4URHA 5KNBD 4HJXA 1AURA 3PC7A 2AOUB 1ZOIA 1XIVA 2BL4A 2IBMA 2VFAA 2JCSA 2JFXA 4YBZA 4MI3A 2BW0A 2BE9A 4EW1A 4XGNA 4BEVA 2JFWA 5LCXA 4TV9A 3UOAB 1YB7A 3KKLA 2HYIC 1LI5A 2D7JA 3AFMA 3N7TA 1YIDA 3D6AA 3HEBA 1LV7A 3FPLA 4E5PA 2VDWB 4P83A 5HHTA 2EGUA 3NFYA 1LPMA 2DBVO 1R6VA 3D1VA 3I5YA 4NXMB 1PS8A 2VHTA 2TSYB 3E18A 1HZJA 4WY5A 3RQIA 2GR8A 1SG9A 4RHEA 3SIXA 1QIKA 1SBQA 1A4IA 2ZANA 2H9YA 3EUEA 1INLA 2XTNA 1E5TA 4RJKA 1WMBA 1W2WB 2MINB 2W2LD 4KV9A 4ZC8A 2Q1TA 3PPIA 4FLFA 1YI0A 2O7RA 1ORWA 1L8OA 2C7GA 5FTWA 4ZVVA 4WPGA 4KYIB 4NE7A 2GHTA 1YR1A 2X5XA 3ZDEA 3KJGA 4E15A 5LD2B 3IDAA 4BNIA 4NESA 4XXHA 4IL5A 3MT0A 5CB8A 5EZ5A 4F4CA 1YI8A 1X92A 4NZYA 3U3JA 3TW6A 2PRSA 1U2DC 4BPRA 1CJKC 3JWEA 2FF5A 4CG0A 4CR6A 2P5TB 3GGGA 3O38A 4OGWA 3L4SO 1T2UA 2VJYA 5FPSA 2W2QA 3MIIA 5IH3A 4BCDA 3GB9A 1GFIA 2MSCB 4BN5A 4ER7A 3GOQA 4CCAA 621PA 2GVZC 3GFQA 3LUDA 3MAJA 1DEOA 1K7CA 3H6GA 4GF5A 4H60A 1J5XA 4G09A 5BR8B 2Q3EA 5GIOE 2Q41A 3AFGA 3D2BA 3EQZA 3GAFA 4F8YA 4CIVA 2XZDA 3S1LA 2RONA 3IURA 3ULKA 5JCXA 3WJ7A 1R27A 5A9SB 5GZ3A 1F2TB 2V59A 1DDGA 1VP9A 3MGAA 3FA2A 1SUBA 3AVVA 3E3OA 2GWHA 1D3AA 1ZEJA 2I6UA 1DIRA 1DZ3A 4G26A 3AL3A 3E61A 1GG2A 1MGOA 3FNGA 5DYIA 5KOIA 3VR6A 3G2IA 5KVCA 3BMCB 5DW3A 5AXBA 1SR8A 2Q99A 2O48X 4JX9A 1I4DD 5BQ5A 2J8ZA 3GY0A 5AM0A 5ARCA 2UUBB 3ZCQA 2X0RA 3L79A 1SUFA 3JRXA 4CM7A 1DTEA 2BUCA 4I50F 3PQFA 1S8NA 1XX6A 2VJMB 1Z74A 2NAPA 5CJPA 3I8XA 3L0YA 5EHGA 3RIGA 2JG3A 1L5OA 1P6UA 4AN0A 2K7ZA 2YVAA 3RAPR 3QOWA 3V9PA 5HZKA 1JVNA 1XFAA 3F97A 3KETA 5LP1A 1HTBA 3R4CA 3CF0A 4GXTA 4CR8A 5FL3A 4DSNA 1K89A 1GRRA 1J25A 3EXFA 4WLUA 5KC8A 1K9VF 2BGTA 4OHOA 4C4AA 1ZH2A 1Q19A 3BE8A 1NBME 5IJAA 3V8BA 3ZHRA 5KNBH 3JARA 4N7MA 3DT9A 4FBGA 3VKUA 5HKBA 1KZYC 1NT4A 1LTHR 1GRNA 2AD1A 2TECE 1FMLA 2Q3CA 3K2EA 3NIBA 2HJRA 3BMNA 2V1XA 2Q4EA 1X1QA 2B8JA 2EF1A 2QJFA 2VRBA 3FDIA 3H5VA 3K0FB 3P7MA 4OJMX 2MINA 4WNYA 1CE8A 3A6LA 2FX2A 1M6EX 2P6MA 4HFNA 2R8XA 3RIHA 2EJBA 2AR7A 1I32A 3GLHB 4PGAA 2DXIA 3CISA 2Z0MA 4OM8A 4AC9A 5EE1A 2H4YA 3EEIA 4PYNA 3KR0A 3VZPA 1YVRA 1E5DA 1HRKA 4C0LA 1QXSA 4K40A 1NVAA 4HFRA 4JP8A 2PL3A 1DVRA 2XBLA 4IV0A 5DHTA 1PW7A 1F8FA 3A31A 4YPFA 4HUJA 4BKUA 1SBCA 4C7BA 3I04A 4D9NA 5BWLA 4MJ7A 4N39A 2FWRA 4XWOA 1LCIA 2BP7B 5EAIA 4A3SA 3H8WA 2VP3A 2VQ3A 4NFYA 3WRVA 1AKVA 1PKXA 1KJ8A 2PHZA 3BH7A 5IVDA 2NU8A 3RS7A 3O4HA 2EJVA 2MIIA 2R1TA 1XCGB 4CE6A 2NUPA