1N2IA

Crystal structure of pantothenate synthetase from m. tuberculosis in complex with a reaction intermediate, pantoyl adenylate, different occupancies of pantoyl adenylate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
286
structure length
286
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pantothenate synthetase
publication title Crystal structures of a pantothenate synthetase from M. tuberculosis and its complexes with substrates and a reaction intermediate
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 95
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2002-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 1n2iA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1n2iA01
4XSVA 1XNJA 5EKDA 4EG4A 2C5SA 2QJTA 4S1OA 4K0RA 4MW6A 4MQ6A 1EUYA 3H05A 3CLTD 3COZA 4RUKA 2V0GA 2A88A 1OWOA 1NUSA 5TEWA 1V47A 2D5BA 5FNZA 1U0BB 1WQ4A 3FDXA 3ZUGA 4G5YA 2BTEA 1PFWA 1QU2A 2HZ7A 1KR2A 1NURA 1Q77A 3IH5A 3HMQA 1P7PA 1H3FA 1KQPA 2J09A 1K4MA 1TYAE 5HG0A 2V0CA 1QRTA 2DPLA 1QTQA 3ELBA 3VRHA 4GU5A 3PXUA 2QTNA 3UK2A 5JBNA 3IOBA 4H3SA 4I6GA 2VTBA 1B6TA 1QNFA 1N2JA 4MAFA 3N2YA 5H16A 2DR2A 2PFSA 3HFJA 3F3MA 1U3CA 1X8XA 1NYLA 3FOCA 1MJHA 2DUMA 3N9IA 3N05A 3ZJVA 3SYTA 2WQ7A 1O6BA 1T6ZA 2GM3A 1VBKA 3L92A 1M8GA 3MUEA 4NDAA 3IOEA 2D13A 1YUNA 1KKUA 3CLUC 5FO1A 2J07A 3CVWA 2O8VA 2AZXA 2X0KA 1J1ZA 3SDBA 4MUKA 2QJFA 3KT3A 2HGZA 4G5FA 5IHXA 1KP3A 1PFYA 1EXDA 2CV1A 3ND5A 3P0HA 3UOWA 4EG7A 2IP1A 1MOPA 3DLAA 2WB2A 3UC5A 1VBMA 4L2IA 1N77A 4R0NA 1QU3A 1EJ2A 1F7UA 3QE4A 1LW7A 4KR6A 4JYZA 2Z08A 2Z3VA 1O97C 3FH0A 1J1UA 3LOQA 3IODA 1JGTA 4XFJA 3CA8A 3HZRA 4I6EA 4MLPA 4MUIA 4NAUA 4DE5A 4DDKA 2TS1A 4KPUA 1R6XA 1NZJA 1WXIA 2QUJA 3FIUA 4MWEA 4ZT6A 3PNBA 4HK4A 3IUBA 3CLTC 1WXFA 3G59A 4ZCPA 3SP1A 2A1UB 2CYBA 4DDHA 1T6YA 2X3FA 4MWCA 4PBRA 5KHAA 1M83A 2OV4A 3AL0C 2RD2A 3CLUD 3AFHA 4QREA 5TEVA 2ZUEA 3KT0A 4EG5A 1T9GS 4QBTA 3QTTA 2NSYA 4YMIA 4ZCSA 4KR9A 4DNXA 1FYDA 3MLBA 3Q10A 1M1ZA 3OTWA 4NZPA 1JIIA 4AS1A 1TYBE 2H2AA 2E18A 2X1LA 3GLVA 5AHWA 5LM3A 1KH3A 5FO0A 4ZCRA 3CLRD 4R2LA 2Z09A 2OQ2A 3IOCA 2JANA 5HUHA 1IFXA 3AKZA 1IQUA 1YI8A 5DK4A 2ZUFA 3D6UA 1G59A 2EJCA 1GPMA 4RPIA 3U1VA 1I6MA 3TS1A 3ZIUA 5BNZA 1O94C 4HJRA 2XRZA 2PIDA 3H97A 1DNPA 4AQ7A 1R6UA 1NP7A 1Q11A 3TZEA 4YP7A 3FHJA 4JZYA 4Q93A 3IMEA 3DPIA 3RBAA 5K0TA 1KAQA 4HJXA 1JHDA 1KP2A 1OWNA 2PZBA 5DB4A 1G8FA 2AKEA 3TQOA 1N1DA 4MUEA 2A86A 4MVYA 3IDFA 1WXHA 1M8FA 1WQ3A 5HUJA 1EFVB 4U63A 5TGTA 3TQIA 3X1JA 3ISJA 3HL4A 3VGJA 1QRUA 3IMGA 4ZCQA 4ND6A 1Q15A 1JZSA 4CDNA 1OWLA 3A05A 5J58A 2DEUA 1MBZA 4JXXA 3Q4GA 2CV2A 1O94D 2CYAA 1KQOA 2CYCA 2DERA 1YUMA 2PG3A 1IQRA 3KFLA 1O0CA 4MVWA 1VL2A 3A4IA 4F3RA 1N2OA 3TNJA 3FETA 1WXEA 1UFVA 3UY4A 4MVCA 4Q16A 1J70A 3KT6A 1WXGA 1PG0A 2EL7A 5F23A 3IVXA 4XFDA 4GRIA 3IVGA 4MUGA 2H29A 4NATA 3CVUA 3OP1A 4DLPA 4ND7A 3FNRA 1EFPB 3ND7A 1IQ0A 1JZQA 3CVYA 1LI7A 3CLRC 5LLTA 1KQNA 2GKSA 4OUDB 3G5AA 1F7VA 1J09A 3DO8A 2A1TS 1EUQA 1SURA 4KPUB 4PBSA 4MW4A 2JA2A 4MW0A 4MW1A 3CVVA 2BYTA 1WY5A 3S3TA 1F9AA 4MUFA 4MUNA 3LCJA 3NBAA 2QTRA 3HV0A 4MWBA 3IUEA 2CV0A 3DV2A 3Q12A 2QUHA 4CDMA 3SZ3A 5KWVA 5IJXA 3ZGZA 1TQ8A 2IJGX 4A91A 2G36A 1WZ2A 1V8FA 4WNYA 2WQ6A 1M8PA 3NV7A 4YP6A 4J75A 3TZLA 4F4HA 3CR8A 1IHOA 4MW9A 4UZEA 1N78A 2O5RA 5J5AA 2B7LA 4U7JA 1EE1A 1K4KA 1XNHA 1IRXA 2E0IA 3X1MA 2QTMA 1ILEA 1CT9A 2QUKA 1ZUNA 1MB9A 4MUHA 2PXHA 1N2EA 5DEOA 3LE8A 3RJZA 4HPWA 2A84A 3COWA 1S4MA 4MULA 1M8KA 2E21A 3C8ZA 3H99A 2CT8A 4BWVA 1OD6A 3CVXA 3I05A 4P2BA 1TFUA 1YULA 3FG9A 4YP5A 4YBRA 2JAXA 3INNA 1NUQA 3RK1A 1U7DA 3IMCA 1RQGA 4EFKA 2QUIA 3SZGA 1T6XA 3MMXA 3PNVA 4DJAA 1JEEA 2WSIA 1T9GR 1U3DA 1O96A 4J76A 1H1TA 3ND6A 3L93A 1MRZA 2YXNA 3ZJUA 3N8HA 1N2HA 1O95C 1Q19A 4NAHA 1YIDA 3H9CA 3E27A 4CQNA 1YIAA 2X1MA 2R5WA 2HMAA 4MW5A 2VTBB 2NZ2A 4X0EA 4NX2A 4EG3A 4ARIA 3HGMA 4I6JA 1IVSA 4CT0A 1GTSA 2CFOA 1JIJA 1GTRA 4PY2A 4U8HA 3D6VA 1GZUA 1N2BA 3CLSD 3ZXIA 1N3LA 3P0IA 3MLAA 2YWBA 3RK0A 1F4LA 4ZT4A 1MC1A 1TYDE 2YY5A 1ULHA 4MW2A 3VU8A 2I1LA 3AG5A 1MAUA 4EG1A 1H3EA 4ZT7A 1GLNA 4EG8A 1ZH6A 2QJOA 3P0JA 4TS1A 3AIIA 1NUTA 3K9WA 4JFAA 3M5WA 2J4DA 4E1AA 1U7XA 3P52A 4EGAA 1EFVA 1JIKA 1G8GA 1WOYA 4G6ZA 3A2KA 1X6VA 2E89A 4ZT5A 1JMVA 1OBHA 4EG6A 1OWPA 1XJQA 2VXOA 3FWKA 3COVA 1MAWA 1O95D 1I6KA 2J08A 4L2IB 1ZJWA 3AG6A 4MUJA 5KCMA 2IELA 4FZJA 1N2GA 1J21A 1VLHA 2CUZA 1G8HA 4OJMX 4QRDA 4PBTA 1K92A 3BL5A 3GMIA 3RFFA 4DDMA 1KAMA 5H7XA 1HYBA 3PNYA 2PZ8A 4KR7A 1M8JA 1LI5A 3KT8A 1OBCA 1TYCA 3QTBA 4MW7A 2RE8A 1PG2A 3K32A 3MXTA 1KORA 4WSOA 4ARCA 1JECA 1O0BA 2PZAA 3UMVA 3PRHA 5TS2A 1EFPA 1R6TA 1I6LA 3ILVA 2A4MA 3H9BA 4K03A 3IVCA 2CSXA 4OUDA 2DETA 2XRYA 1QRSA 3ZXSA 3FY4A 2DXIA 4MVXA 3SEZA 3X1KA 2D54A 5J59A 1ZH0A 1IH8A 3G6KA 1COZA 4JXZA 2J5BA 4MWDA 3A04A 2AG6A 1NSYA 1N75A 3ZJTA 3SEQA 3GUZA 4ZT2A 1QJCA 2A1UA 4ZT3A 2GOYA 1KH1A 4EF6A 1FFYA 1JILA 2A1TR 4UZFA 1XNGA 1NUPA 1WKBA 3FI0A 1I2DA 3CLSC 5LFAA 1GAXA 2A7XA 1H3NA 1N2IA 1O5TA 5DASA 1KH2A 3COYA 4KKVA 1D2RA 1NUUA 5K0SA 2DLCX 3JXEA 1OWMA 3RHSA 4ZCTA 2YWCA 1NI5A 1A8HA 1BS2A 1TEZA 1WJGA 3NBKA 1VBNA 1J20A 1PFVA 1QQTA 1O97D 2ZP1A 1GN8A 1PFUA 1O96B 1K97A 1Y42X 1MB2A 1JEDA 4R2MA
chains in the Genus database with same CATH superfamily
3WGVA 5J2TB 2R9VA 5FQNA 5ICCA 2HF8A 4RZ2A 4I1PA 2H31A 1NXXA 4M8IA 1ACLA 2VP2A 2BE7A 3Q7TA 4REQA 4IINA 3L4EA 3OFNA 3PS9A 1J2UA 1IEQA 1R4AA 4REMA 5AICA 1XCPA 3HI4A 3O5AA 3SKVA 1DAGA 3P9KA 3GJ4A 4MR8B 3H5LA 1WNTA 2A4KA 3UXYA 4ZEVA 3V4RA 2KLHA 3LP5A 3PE3A 1TF2A 1EA5A 2G88A 4I5FA 3EGXA 1KERA 3VOAA 1HXHA 4RTPA 2R6DA 1NXVA 1QH1A 1KJYA 1UWKA 3NONA 4Y6OA 3K0FB 2XVMA 1UC5B 4LHSA 4KUGA 4QIHA 4Y3UA 4GMHA 1MH9A 3ZI4A 4GPTA 3G5MA 4XLLA 3V4FA 3G9QA 2RGBA 1WF3A 5IUKC 1RI1A 5EFOA 4IZIA 1OMOA 1N8TA 3NOXA 4D79A 4FS3A 3EZ6A 4ZYZA 1Y6ZA 1NW4A 5M04A 3KUDA 3I2HA 4I7EA 3VR3D 1EU1A 1ENOA 2A54A 1HDZA 1UOOA 2QTGA 2YQ4A 3D2BA 3D0KA 4KYTA 4H3SA 4TOIA 2X40A 2X2OA 4I6GA 2XMPA 4C2AA 4NCAA 1E7MA 4Q34A 2ZDHA 4CGZA 4X90A 4X7PA 4JI0B 1EWKA 1SULA 1ID8A 3EZLA 4FCTA 4ZN6A 1L4LA 1X1SA 1GR1A 1VRVA 4IVQA 4TVKA 3OQBA 3B2NA 1SXJB 4KWCA 4XSHA 2EBUA 1Q14A 4A1OA 1QVWA 1AZWA 1SU8A 3EEQA 4BFZA 2ZUDA 1SA0B 3HCOA 3EPRA 4XASA 1C1DB 2XE8A 3IA2A 3IOEA 1ZY2A 2J9GA 1HZZA 2FRVA 2AX3A 4XX0B 2BTQA 4M0MA 2ZXFA 1P2TA 1YUNA 1LK5A 4PLTA 5C2JB 1CIPA 3QKSA 2ZYUX 4BUJA 3WMGA 1EWVA 3G0OA 1JI0A 4G85A 5MN4A 3TB4A 1VCNA 3K70D 2O59A 4Y9RA 4WK0B 3NI2A 4W5RA 3KPJA 5BWCA 2HF2A 4JP5A 1VBMA 3KAPA 1K86A 1XYVA 2O8FA 1CD5A 3N3AC 1DHRA 5AJUA 1F7UA 3OE7A 1QYDA 5FWNA 1E3WB 3E5NA 4LQCA 2QHXA 4QFCA 4U2GA 5BUZA 4TKLA 2ZIUB 4X8MA 5ECGC 2WV7A 5GINE 4BO7A 3SYLA 1W5EA 4DUYB 4G23A 1J1UA 2ZTLA 3H87A 4GVPA 4WN9B 4KH1A 1A04A 5ITSA 3G8CA 1SPBS 3QVWA 1UZUA 1RABA 2JBWA 2XF2A 3KZXA 5T7BA 2G5TA 4F97A 4RD3A 3A9RA 3DLCA 4GMFA 3AILA 2B7BA 5G53C 1UQRA 3D7RA 2ST1A 3NWOA 2CHEA 1OLXA 4CUZA 5LZ9A 2NG1A 1GVNB 2G28A 2QD1A 1FTQA 5KOYA 2CYBA 3A31A 1PV1A 3VR6D 1FRVA 4BFSA 2WNSA 1PRYA 5LP6A 4BMNA 2MYUA 3MIZA 1JBEA 2EKLA 2YXPX 3NDPA 3OT1A 1HK7A 4RVOA 4U9UA 1AURA 3A36A 3WHPA 2HM7A 4PS0A 5FCDA 1K63A 3LCRA 1PJTA 3PGKA 4J94A 3X1ZA 5CHYA 3WK7A 2V7UA 3WLNA 2JH8A 3KTAB 3RYFA 2JS7A 1E2MA 2ZAMA 1EAYA 2J5QA 4EUEA 2ODPA 2FFJA 4BRUA 2JDID 2R4TA 3BC1A 4O08A 5JMOA 1AA6A 4H31A 4CR8A 3D2AA 3EPPA 4NSNA 3AV3A 2YVAA 3S2EA 1J9EA 1REQA 2H2AA 2ZYVX 1T2CA 2JBHA 2JBAA 1ZSVA 1NXSA 3FNBA 4Q4CA 4AB1A 4MR7A 2ZJ1A 4G1MB 4ZCRA 5FBHA 1MJGM 2AHOA 1MHPA 2QF7A 3EWNA 5SY4A 4FMCB 4TRJA 2X8JA 4GXNA 4TQGA 2DH6A 3UK6A 2ZSBA 4FZRA 4QNMA 4NJMB 2P5UA 1S02A 1P6XA 2E1PA 2CFRA 2V3VA 3NBQA 2FPOA 4MPTA 4Y2QA 1OC4A 1QX4A 2QSYA 3OIGA 2WJ4A 3FBGA 1U8TA 4MSUA 1K9SA 2PWBA 3TL6A 4OHOA 3R3YA 3RGGA 3TSYA 5T5QA 3DCIA 4M46A 4AKHA 2W4IA 1SKYE 1FE8A 2W7TA 3DOJA 4QM7A 2Q7XA 4AQ7A 2I4LA 4F85A 1OKKD 4L4UA 5IVKA 3G9TA 1DIGA 3CGWA 3TLAA 4HMOA 1IL0A 1LNQA 3FVWA 1KEZA 1IVNA 3JWGA 4BFLA 2FFAA 5ESWA 4EPVA 2R87A 3I53A 3I9V1 4I5IA 4JZYA 4XVQA 5B58C 5BN3B 4A0FA 1AO0A 3NIGB 4GGOA 4CE6A 5K0TA 1NRJB 4KXYA 1LDNA 2WD7A 2ZUSA 4M49A 5G1OA 5J4YA 5JZBA 1RRPA 2NO6A 2P4HX 3KXPA 1Z4QA 3DEHA 3AI3A 2W0SA 3H3JA 2M1ZA 4B3BA 1E6CA 3ZVMA 3LOPA 1S2MA 1BEZA 4TV9A 4JP2A 3I2IA 4JENA 3KEGA 5LZ8A 2W2MA 4D9KA 5CB6A 1ZVVA 1QR6A 5CBPB 1X87A 4LF9B 3LA8A 1SCIA 1FFSA 2Y4OA 4NENB 1BIFA 1U02A 4KZPA 4YT2A 4GMKA 3PFWO 3PHJA 2AJDA 1R50A 5JD4A 2PNFA 1ISJA 4ROSA 3SJUA 3ELDA 1BN6A 3HL4A 2AOUB 1U3VA 1KMHB 1QKJA 1U1DA 2JFHA 5FPPA 3RSSA 4DC1A 4KMRA 2IY9A 1H4QA 3GB9A 4JX8A 1TD9A 3A05A 5BQPA 2R86A 3EYAA 1NW9B 1KO1A 1MAAA 2WMYA 1NNLA 2ZJ4A 4MI1A 1ZSYA 4UE6A 1SCAA 2FEKA 3HJUA 1P5RA 3WLOA 4KXNA 4F2DA 5JQGA 4EW2A 1RCTE 3RI3A 4GEKA 5KTNA 4CKYA 4E5MA 1PKEA 2ZJFA 1M2FA 2H1IA 4EHFA 3RUPA 2WINI 3LRTA 5D3QA 2PK3A 2QY9A 3A4IA 2ZUWA 5SZHB 3AGQA 4F3RA 1DBQA 2DJ5A 1OAOA 2Q1TA 1KGDA 1RXYA 1CUHA 2QL6A 1T15A 3TKAA 5EAIA 4BFUA 2J46A 2ZITA 3UY4A 3GROA 3TX2A 1QCCA 3P32A 3WMFA 4AJNA 1C14A 1WM1A 3AKEA 2OBBA 2LP4Y 4FKZA 3J81k 3AXSA 4DN6A 5D5PA 4PAOA 5CFPA 5HXAA 1YRHA 4DUZB 2QRKA 5IN5A 2PGAA 2VKQA 1XZNA 3GFVA 4MJLA 4PAQA 3SS9X 3VISA 4AULA 4HVCA 2P6PA 4R1QA 4PFSA 1HM5A 2EZ9A 1OI4A 1VJCA 3BHIA 3B1FA 1NOIA 4ND4A 3R2JA 5K6TA 2OD7A 1GGHA 1U9ZA 1UP7A 4C7MA 1Y1SA 1M2OA 3VOBA 1RMQA 4LOIA 2ZR8A 4K0KB 3RVOA 3OZEA 2RHBA 3LVQE 3HLKA 5AK4A 1JLKA 4S0ZA 4O2LA 3WFZA 3T52A 2WZCA 1AKVA 1GNQA 3D0RA 2HA5A 1C9DB 1VJ0A 5JEEA 1S2LA 4P3NA 1YOBA 2I03A 4MW0A 1LPAB 1NU6A 4ND5A 5LQJA 1F9EA 2FPGB 3MAGA 3CURA 1P4HA 2J0UB 3KYDB 3E23A 3R4VA 1QQ7A 2OHJA 1HL3A 1CB0A 2CJWA 2WG2A 3RS5A 1L5GB 2FK8A 3ZS8A 3M6MD 3V00A 3ZKWB 5KC9A 1E69A 4HAVA 1LRLA 3HV0A 4B80A 1BAPA 1P2SA 5H02A 5J47A 3KO8A 1TM4E 4RY0A 3DV2A 1U6IA 3M4JA 1VE9A 5E1BA 2OKCA 3WSWA 1V11B 4B46A 2WJIA 4MWGA 4URZR 1YBHA 2VK4A 2WYUA 2FMFA 3K6JA 5T57A 4UNQA 4QL3A 1JHAA 1S2NA 3O38A 2BP7B 2WKQA 4IDNA 4ZRDA 3C3WA 3TZLA 3QA9A 4F4HA 4MV1A 5EJ5A 2B7CA 4O0LA 4RADA 1PJAA 5J5AA 4MB0A 2FW9A 2YINC 1YDMA 4LJSA 4N49A 1XNHA 1IRXA 4UC0A 4WCFB 5C0OE 5JWRA 3L4KA 1R6DA 1UF9A 4B3IA 4LDAA 2F8TA 1ILEA 5KQRA 1Z17A 4FFMA 3N6XA 4URHA 1BJTA 5DYGA 1TQ6A 3WDLA 4BCDA 5BV2P 2MR6A 5EE5B 4F4CA 3QPAA 4YJDA 4M6WA 1VJ1A 1YQWA 2QMEA 4G4JA 4YHHB 4GOJA 5D00A 5LQDA 2ZIAA 4B09A 5JJKA 4TPKA 1JJVA 1QCDA 4NJEA 3H65A 5DO9A 2RH9B 3L7BA 1DAOA 1M8KA 4UVDA 3O4VA 1QQ6A 3TM5A 1KY4A 4PO9A 1XZEA 3NEPX 3SC3A 7GPBA 1PJZA 3Q8MA 4JC8A 3VKVA 3W04A 1XEFA 1BVHA 2ZUCA 3L49A 4Q1VA 1H1LA 1DKMA 1O9GA 5ILGA 3F7MA 3OJEA 2M6KA 4Q1CA 3UJ9A 3RK1A 1YCHA 2IOFK 1RQGA 1VJRA 3PFFA 4AJ4A 4BDTA 1WSDA 4CMAA 1F8YA 1E2EA 2AR7A 4HDRB 4XUDA 3VNAA 3LECA 5A7GA 5LQMA 1JJBA 1ZL2A 5K45A 4B3SB 3R40A 4AX4A 4D9CA 4E70A 1CNFA 1RBMA 4DCUA 3ZU3A 4LVOA 4C29A 4ABYA 4JL8A 3FA2A 1MRZA 4NY1A 5D3MB 2RHDA 3PZRA 5CFOA 1BRTA 2C5BA 3KKNA 4TLDA 8ABPA 4DMHA 4FBGA 5CM2Z 4CTNA 4CQNA 2OV1A 3WLQA 4FGLA 2X1MA 4FFRA 1OTYA 2HIGA 2RKBA 3O8NA 4LZJA 4Q3AA 3L77A 2JFGA 3OU6A 4TTQA 5D3ZA 1XWFA 4X8HA 3NEYA 1D2EA 1PGOA 4FFVA 3X1KA 5BPFA 3QX7A 1GTSA 1QGAA 1JIJA 2AVDA 2ZSFA 3IP3A 4HGOA 4PY2A 3TGLA 5A3RA 4RL4A 1E63A 5H68A 5JPDA 1GZUA 1JG7A 5AVXA 3EUAA 1Z7GA 2BCGY 4PX9A 5I9SA 5L40A 3OBIA 2PBFA 1PN3A 3OKFA 4B8YA 3EVCA 1KKMA 1G55A 5HF6A 1DMSA 3DZCA 3GDHA 2YY5A 3V7YA 4J8PA 4B6EA 1VXOA 1MAUA 3FVVA 3FLMA 1FFCA 3B6MA 1GSHA 3Q72A 4PLZA 1CR2A 1GLNA 1KBOA 2D2IA 3ISTA 3PQDA 3R0JA 1SUSA 3VNRA 1I8TA 1OT5A 1Z63A 1KYYA 3BK7A 4GRAA 1TRKA 1SUBA 2DUJA 4K7JA 4OHPA 4S2EA 3UOGA 5MHTA 1I2MA 2J9YB 4BGDA 1CRPA 2ZB7A 3BGSA 1CJUC 1PT8A 2V7BA 3AR5A 4ARUA 3A2KA 3GZTB 3RROA 2IE8A 4AECA 3S7ZA 2P78A 4HDCA 4UULA 2BHNA 1VJTA 2AA3A 4JQZA 1UAAA 3Q2IA 3UJ8A 3EWAA 2BM0A 3SK0A 4JVSB 1NPYA 4OL0A 2BOVA 3TE7A 3N0XA 2QAGC 1JVSA 2P6OA 4IJUA 2FQXA 2PA3A 3OFKA 5FAXA 1R9GA 1XQWA 5HYVA 4RIFA 1CZRA 4D4IA 4B0OA 3T94A 4LOKA 3M49A 4YCSA 4OHFA 2OVFA 1YFJA 4AL4A 1WZIA 4U9IS 3BWYA 3CRNA 5KHOC 4W5OA 1SR8A 1L5LA 1XTRA 2J3EA 1T13A 5H7XA 3O0TA 4QQRA 3ICQB 3RRZA 4YAJA 1ISRA 4IOKA 3V1TC 4KR7A 1WBBA 2OCIA 3ZXYA 2OV8A 5K3AA 4AG3A 4RDXA 4DWWA 2JLBA 2ZTSA 4DMMA 4KJZA 3MXTA 1YS6A 2QNRA 4HRAA 4IFBA 4IRUB 4WBNB 2GAJA 2IEZA 1O0BA 3DEIA 2HZBA 2MYTA 3DAHA 2VZ8A 3IIJA 5KMGB 3O1HB 5D1HA 2YZMA 4A2PA 3ES9A 3CMMA 2FETA 2V96A 5JTUA 2DHDA 2Z95A 5FLXA 5I7RA 3M4ZA 2AX4A 2I62A 4ACAA 1I6LA 2ZR0A 1R8XA 4ADSG 3LUFA 3IVCA 1O6GA 4XWAA 2DETA 1QRSA 2CNLA 3Q3EA 4MMYB 1QFJA 3HU5A 2F64A 3BCSA 5TT0A 2QEQA 3PYXA 3UQYS 1QIIA 5AW0A 1XZPA 4JBWA 5AI8A 1GG5A 2JIZA 1ULBA 2CKDA 3X43A 5JNWA 2BKVA 2V4ZA 3BWBA 1O94A 4EQ6A 4LJLA 1MG0A 3UQZA 1V9SA 1UDRA 2CSUA 4OGLA 1S1MA 2AG6A 2SBTA 2QD4A 3PDIB 1Y3CE 2P9HA 3DWEX 3IAHA 2VAWA 3PDCA 3UT6A 1VDZA 3VR2A 1WCYA 2GOYA 4UCWA 5EXSA 2YY6A 1CJMA 2C7QA 1E9DA 1T3ZA 4TLLB 5IDYA 3R3JA 1ESEA 3T0GA 1I2DA 1QGDA 1T29A 2HSGA 2RCYA 3PQ8A 4JLVA 4WK2B 3KSZO 3UNXA 4ZGWA 2UZ4A 5CLJA 5F4ZA 3WGMA 4DG5A 5F52A 5K0GA 1TL7C 2GN6A 4N03A 3FD8A 1J23A 5D7BA 3ZBQA 4KKVA 3S68A 1GPAA 2ZBDA 2CF6A 5K0SA 3FUWA 1D0SA 3C5VA 1YU6A 1EGVB 1V5FA 4BE9A 1FFXB 1Q7CA 1L8XA 4JQOA 2ZGVA 1P4RA 4LDPA 5DGDA 3O0DA 4W9NC 2MSDB 1RSZA 1UBOS 4LG1A 3DL4A 1O97D 3A4MA 3FPBA 2AMJA 3HU3A 3CEHA 2OGSA 2VZEA 3D8RA 4R8LA 3RYIB 1O96B 2CCKA 4YH1A 4KV7A 2D3TA 2BM1A 4OP2A 3M3DA 1XNJA 1RMTA 4OA5A 3SQOA 5B1EA 1NDUA 2YMQA 1D5WA 4UTZA 1JIXA 4KN8A 5E2IA 3FOEC 4KQ9A 3UF0A 1DRVA 4W1RA 3GLGA 2FR0A 2G0NA 4B45A 1D04A 5A4FS 1P1FA 3H05A 3DCNA 5J2TF 4JEIA 4RD0A 4DJJA 3B70A 1DUIA 1FOEB 2FXVA 3E58A 4I5EA 4PYLA 1I3KA 1ODLA 1GPBA 1V16B 2D1TA 4YJHB 4HAXA 821PA 1XCMA 4GGPA 4WXYB 4PZUA 5IF9A 4EB6A 1WCIA 1YZLA 2GHTA 3N0TA 3ESCA 2P2ZA 3E53A 4XTCS 4EELA 4ES6A 3ANLA 4KACA 4B35A 4EHLA 2A7QA 2VK8A 5AH0A 3S6JA 1VP9A 3DMNA 1CY4A 3MWJA 4DLLA 1FMFA 4FMPA 5MF6A 4GC9A 1H3FA 3N2ZB 1RXEA 1YR7A 2WYVA 4YAEA 5BR7A 4AKSA 3K0CA 5TQ0A 1K7XB 4MHSA 3OM1A 1QTQA 2C0CA 2CKMA 3VRHA 3LNCA 4GU5A 1QZUA 2CXPA 2Y1OA 4IZOA 2WG1A 4QSHA 5K6AC 3HBMA 3UBMA 3B38A 1CZUA 2PVSA 4OOFA 4WOPA 3M82A 5D5QA 2BCEA 4PZAA 3RVJA 1CR1A 2GN0A 3KOWA 2MINB 2QVCA 3I76A 4E3ZA 4PNHA 5AI4A 4EMSA 3NAGA 3ANNA 3I8XA 1Z73A 2Y9PB 3FSGA 1R0LA 3H1BA 1YR8A 5BSVA 4BKQA 3DMTC 3Q2OA 1X94A 1CEYA 3BMQB 1AX9A 5EIHA 2ADMA 3F71A 1JSLA 4GSLA 1IN4A 1NFQA 1S3GA 1Z36A 2PX0A 3P20A 2O06A 3VZBA 1T9AA 2ZW9A 1U8YA 1M8GA 1SVLA 2BKXA 3KQYA 4EKNB 1ZYUA 4EW3A 2H8KA 2JJ1A 4IIXA 2JHFA 4Q9DA 1GT91 1OBOA 1CZKA 1OLSA 2BM9A 2ODWA 4MROA 2HMYB 5C8YA 4ZJPA 3NBFA 1C1HA 2DP4E 3HYRA 4LYDA 5JG7A 2UYYA 3QP9A 3GLFE 2LGJA 1UEXC 1F2UB 4RPCA 4C6TB 4FS8A 3CF4A 3AHIA 1GKUB 3FBWA 1QFXA 3KPUA 3Q87B 2CNDA 3DL7A 4KW7A 5FYDA 4CMEC 3KQHA 4MTLA 1RBQA 3JYHA 1ZUD1 3DLAA 4NF2A 4B3CA 3A10A 4I1YA 1PD1A 2ZRHA 3WRVA 5IM4F 4ILKA 1HPLA 2PX6A 2VG8A 1VHQA 2WWXA 4DV3B 1IZ9A 2PSFA 3B5IA 1GGMA 2KSQA 3HB1A 3LQYA 3UOAB 3IO5A 5ALYA 4E5PA 3CLHA 2FJUA 3HKEB 3OLCX 1QQAA 2JGIA 2IYSA 3DVSX 5CIQA 1T4CB 5LP6F 4KFCA 3GPCA 4JC4A 2TS1A 1MT3A 2AI1A 3LD9A 5DBOA 1UPTA 4DQXA 1KY2A 3FKSA 4MWEA 1JEQB 4RH1A 2Q3EA 3P2IA 2A9QA 3NXKA 1J2RA 2WLSA 4MVJE 5CH3A 3VH4A 3IT2A 2FF7A 4DLSA 4F5EA 2PKEA 4Q48A 2HNKA 3CVJA 1PR3A 2A9RA 2PXCA 5HE9A 5CCEA 4RY9A 2FVYA 3SR3A 2Q3CA 4DDHA 4Y9UA 3R76A 4EEZA 3RBZA 5E9QA 2Q6KA 1VPLA 1J33A 4QHSA 2JFQA 1JHXA 4CMGA 3WOHA 2WBLC 4EVQA 1F2TA 2HSEA 1K89A 1Z5VA 3EC1A 5DNVA 3U6BA 1T36A 3OP4A 4HWPA 1GXSA 4XWKA 3L8DA 3DOIA 3NBMA 4YMIA 3RO7A 1CUXA 3L6BA 2CXHA 2XUFA 3R3WA 3ANXA 1RAEA 3EGOA 2WQZA 2V6IA 1Z5PA 4X1KA 4ZOQI 3PNKA 2IHUA 4GKAA 1G16A 3U3KA 2DWPA 2LTAA 2IVFA 5ITZB 3R09A 5BQ5A 1ZNWA 2X2PA 2ORIA 1U3FA 3SI7A 3V1UA 2I4IA 2ZE5A 3AR6A 1I2ZA 2YOGA 5E95A 2BJWA 2NV2B 2JANA 1MRSA 2FSVC 5DEIA 5DN9A 3KU4A 1PR4A 1KWKA 5BVGB 1YDHA 5ALSA 5AHXA 4BZQA 4A27A 2DB3A 3T54A 1C4OA 2BFCB 3L6OO 4LX8A 3KBBA 1I3OA 2R85A 3TPFA 3TOZA 3E4DA 4LI3X 2AMFA 4RPIA 3BK2A 3S28A 3U1VA 5C5CA 1G8KA 4PSDA 3N7AA 3PWTA 5FA5A 1JBQA 2INGX 4FSHA 1NY6A 5B1YA 4YRJA 4G0OA 1OYYA 2FFQA 5GWXA 3W5BA 5DM2A 1AS2A 1P2FA 4Y1GA 3STXA 2JGNA 1TLFA 2CW5A 2MSEB 3CR7A 3KOOA 4QJ5A 1E1DA 3JQ9A 3M4YA 5K0LA 2C2GA 2R44A 3ONDA 4TT8A 4ASUD 2W6CX 3T4XA 4G5OA 3TLEA 1E9EA 4HEA6 1GL3A 3FTCA 1P1RA 1W4AA 4Q93A 4KDEA 3ZVKA 1BVUA 2CXSA 3UTCA 5WRFA 3KB2A 2CMHA 4G1VA 5IANA 1KAQA 4KP7A 4OM7A 4DMFA 5HW0A 4WL0A 1DBPA 2NUPB 5F1OA 5INTA 1V3TA 2ACVA 2VJOA 4PVCA 4OH1A 3ZU4A 3TRIA 1G7CA 3I4FA 4F0JA 2O6LA 1II8A 2IT1A 3QFTA 4HUJA 2VHVA 5TVKA 3FMGA 5BNIA 5JH7A 3IE0A 4NLLA 4CEHB 4KR3A 4ZA2A 3VPSA 3WK6A 1ODKA 3E7XA 1XTIA 2JCSA 2XQVA 3TW0A 5JQGF 2HTFA 3NKFA 2NNWB 1C9JA 1ZO8A 4O3FA 4JCCA 2BJHA 1JFLA 1OXKB 2O2GA 4TS9A 5EKTA 1OFUA 3QF7A 4QYMA 5FI5A 1HZJA 3CUUA 3HUDA 4HZGA 4GKKB 3N2LA 1P91A 3AUFA 2VQDA 3DTVB 1FBTA 3DVLA 3JS5A 3NGXA 1C3VA 2CXXA 2QRMA 4L3OA 4M9RA 4NP6A 1R9JA 2PUWA 3WO0A 3ZPXA 4EHJA 4KE7A 1SC4A 1T26A 3NHWA 4BMXA 2XB2A 1E9SA 2QDXA 1SMKA 1G21A 1MO6A 3B82A 4FINA 1DUSA 4HDKB 1Y7LA 1BVRA 4LXHA 4GYWA 1LF0A 2XRFA 3TLCA 3I01M 1BO6A 4AKTA 1EX7A 3OAAA 3BFVA 4NQZA 3HCDA 4BMYA 4D41A 5HM6A 1DQYA 1U2GC 3CZPA 2ZPUA 1VCMA 3OCVA 3ROKA 3UV7A 1ZHFA 2WM3A 3OZBA 1PYGA 3DF7A 4UDYX 4XD2A 3IUMA 4MVCA 1F0NA 1EG7A 1N6PA 1NLYA 1JDJA 1ZLYA 1WKVA 1PG0A 1WXGA 2YHAA 2Z0MA 3QKUA 4I14A 1PJSA 5TXGA 5EIEA 1U1IA 4M53A 4PQRA 4V0RA 1QUFA 1UK8A 4GP7A 4HTAA 1T4DA 2PCJA 3R6TA 1BKDR 1RVDA 2ZCVA 3F5FA 2DU8A 1Q74A 4GDMA 4DLPA 4JK3A 5EGNA 1OBVA 2R8ZA 3FGZA 3QM1A 3U0BA 5BUSA 3KIPA 2QM3A 2QQ0A 3ZWMA 1U0OC 4E46A 1NPDA 4BJHB 1X80B 4WESA 3A4VA 2V0GA 2V1UA 2IL1A 3Q7PA 2VSOA 1ZU4A 3DJYA 1B1AA 2ZIGA 4I8XA 3KKLA 1AXRA 1E0JA 4KLAA 1IPHA 5IBPA 3ROFA 3HPQA 3K8QA 4JGIA 4F4JA 1KOGA 1DKQA 3PEWA 1N6IA 2H48A 1N8KA 4FD3A 1A4UA 2JA2A 4HGYA 5B4TA 3MXOA 3HYCA 3WWDA 2OYSA 5JCJD 2MMCA 3P45A 1WVGA 2ES4A 2W9XA 1T0IA 2I22A 3DDCA 3TIVA 1XG5A 1NT2A 2EG5A 4WWHA 2FHSA 3T5CA 4AZ0A 5GJBA 5LA6A 3R7WA 3GGJA 3T1NA 2O1EA 1W1UA 4K9MA 3P0EA 2ZRQA 4I50B 4DV7B 3HSSA 3LWBA 3VNSA 4C7XA 1KDTA 4IEEA 4IVRA 3EDYA 1XAHA 4IIYA 5GONB 5KWVA 3V4ZA 5D8DA 1R0ZA 3DMFA 4JV5B 4CL2A 5JSZA 1ZUIA 2IP4A 3ASUA 4X95A 5I9NA 4QYSA 3I73A 3ELYA 3EBOA 3NTOA 4H4EA 1PGJA 4TWIA 1SB8A 4POOA 5JPCA 4R1LA 2GCGA 4FIDA 2HWWA 2Q21A 5BYBA 1Q84A 5IJWA 1N78A 3URMA 1MR3F 1Z75A 2DC1A 2G3YA 4HNHA 4BL5A 4KTTE 2HA0A 4R7ZA 5AVVA 3TGPA 1WS6A 4QA9A 3RH0A 1J4AA 3H17A 3WHLA 3KQUA 3TEMA 1NHGA 3AK4A 2FV8A 2GCIA 2OE2A 4MQUA 4UD2A 4ZRNA 3EMKA 4TWBA 1L9KA 3ZS9A 4JLNA 2E85A 4RWEA 3A0RB 1XNRB 1G60A 1QWSA 4AK9A 4KFSA 4NEHB 2AFIE 2HJRA 2PD4A 2VH5R 4DILA 1D2GA 2G5PA 1GUZA 4HR7A 3FLBA 3AFOA 2P9CA 4EKDA 1GG2A 2P6NA 2H4WA 2FJ0A 3MILA 1XALA 4WN3A 3HDVA 4PZDA 1WG8A 3WL7A 4B5KA 4DIDA 3NH6A 5ICMA 1IK4A 1WHTA 3FCSB 4YCAA 3U3JA 1W581 2DT5A 2G4LA 2KI5A 4XD7D 4F2PA 1X0VA 5GVSA 3WRXC 2HQBA 4PE5B 4QG3A 1ODJA 1H9AA 4PSAA 3INTA 4EFKA 4OQNA 1HFWA 2QUIA 2I3GA 5LQKA 3KVNA 1T1RA 4C88A 1RYDA 4BVEA 1ZN9A 4HYYA 1EIWA 2D2EA 2TMDA 4FHDA 3U7EB 3I9MA 4XJTA 4D56A 3NNNA 5HFJA 1MC5A 2WJAA 2W70A 5KQMA 3AEUA 3O94A 4QPPA 4OGWA 4UAVA 4EGQA 3U4QB 4QTXA 3DB1A 2XMGA 1N2HA 2G09A 2FR1A 2GH1A 2XI4A 3NOOA 1P9WA 1XFDA 3I2YX 3LQQA 4I55A 3DR5A 2GX6A 4RK4A 1Z13A 3JQ8B 1QO7A 3N8KA 4TX1A 4NX2A 2RGNC 3T4PA 4J29A 4JT8A 5CM9C 2P41A 3FSJX 2FPMA 3BXXA 4TN5A 2O19A 3VPBA 4P0PB 1TMGE 1BCRA 4ZVPA 3ESRA 5K3SA 5TS3A 1UIRA 2UVPB 3AEZA 1QKKA 4BRWA 1MNAA 2EEZA 1SIWA 3FPHA 2VJBA 1T34A 3IPYA 4X3CA 1Z0JA 1A8IA 2WMNB 1G7RA 3NHRA 2NVBA 3L1IA 5AI0A 4DR1B 5IAKA 1TYDE 2HA6A 3SXPA 1OIWA 4GLJA 4LSZA 3HBAA 3UFXA 2RAFA 2WJYA 4JZKA 3RK4A 1SBIA 1T8PA 2N0SA 4HKTA 5E0OA 2QJOA 5EZYB 2HRQA 2YYAA 3EGEA 2XHEA 2B2XA 2QRZA 5AM1A 2IZOA 1TAGA 3TE6A 4G65A 4TZKA 1G8GA 2C7PA 3SDSA 1HL7A 3T61A 3GNSA 2O0MA 2R62A 3IV7A 4ZT5A 2VF7A 1Q2UA 1Z4IA 3ZG6A 2BDEA 3BRWD 3NBXX 2Q0SA 4Q1BA 3COVA 4DUGA 5KWJA 3TDNA 4D9NA 2DY0A 4QGFA 1CJKC 3OPMA 4YLEA 5LBUA 4A2QA 4XQ0A 4WAUA 4IXDA 4LCEA 4UNSA 5AXBA 4EPTA 4Z5XA 3C3DA 3TUZC 3QU5A 3O82A 5KCMA 2W22A 3CG4A 3CWCA 2GK6A 3EXIB 4QNNA 2G9NA 2WTUA 1VKHA 1ZGCA 4HQ6A 4IOMA 1CUEA 3SF8B 3MCUA 2ZRCA 1XRJA 2ZXEA 1XDDA 1P2GA 4B6QA 3P8ZA 1XRQA 5JRZA 1U28A 4KGXA 3A11A 1V1MA 2G63A 4GOOD 1R3DA 4QBFA 3F46A 2GDJA 2WV9A 2NADA 3SIRA 1N5JA 2DWCA 2PZ8A 2H9YA 3VO2A 1W6RA 4D4JA 2JJMA 4RTMA 3QSYA 2GEJA 2FWIA 1GKYA 3SC2B 3BMCA 3ZZ0A 3U44B 3BQ9A 3A3KA 1V41E 2JIRA 4FFPA 4KVZA 2Z1NA 2JLSA 1CF2O 4L8YA 1U7HA 3QUSA 3TVDA 1OILA 2DRIA 1W1IA 2GYUA 2W6ZA 3DFFA 3N5KA 4MQBA 5DTQA 3RUHA 5L8VA 3AR3A 2A5LA 4ZARA 3CV3A 1ZN7A 1NR1A 1P3JA 4JYCA 3BE5A 1I4DD 2F2TA 2V7XA 4MKRA 3EYWA 3RVSA 4ZKEA 4EJSC 4PIPA 1M6EX 2GN9A 2F3TA 1FS5A 4WBNF 1JEAA 3IOYA 5LN1A 2CSXA 1NASA 5I9LA 3TG8A 1KU6A 4INJA 3B6IA 1PSWA 4NFHA 5E1OA 2UUOA 1U9IC 1C3EA 2HU2A 3PL1A 4PYMA 1XP8A 5FLEX 3ZLTA 3ITNA 4MVXA 1P3Y1 5K1ZA 4B74A 1NUHA 2NQ8A 3QYFA 2DBRA 3IV6A 2D4HA 2D54A 3HN2A 4U7WA 2H4ZA 2E4ZA 4EKYA 4EYGA 1JKXA 1RWKA 5BXYA 4DA9A 3I2KA 4L4SA 1KVTA 3TRDA 3DL2A 1V35A 3D5TA 4YGXB 2NIPA 1Z3CA 1JWBB 3AHEA 3FLAA 3V1YA 2JFUA 4ZVKA 3A6EA 4MQFA 5SV2A 2HO5A 1U9YA 1J5PA 3K0AA 5E1DA 4Q4JA 3U7IA 1RFLA 1GZ5A 3U5TA 5IZ4A 4WVFA 1GZ7A 2Q28A 3CLSC 1U11A 3GBPA 4XR9A 4DA0A 4OIFA 2YN4A 3NT2A 4RENA 1K27A 1LDEA 1V9LA 3C15C 3RHFA 1ZMBA 1N2IA 3ORFA 4FB5A 5JSUA 4IF4A 3D5EA 4C0WA 1AUOA 4DRYA 1XQVA 1S8NA 4I1OA 5CURA 4YPOA 3FF4A 3K9HA 3ADCA 1YR6A 5FOSA 2IEIA 3EQ8A 4EATA 3LY9A 1T5SA 3WVNA 3NIWA 1OH8A 3BRQA 1YB1A 1X92A 4FR5A 1Y3FE 2OG1A 3TFWA 1GITA 3K9FC 1QAOA 2QRVA 4N6GA 3FOFC 2RONA 2VRWA 2YFYA 4K8RB 4OXIA 5ALRA 2Q5CA 1YGPA 1M2VA 1UK7A 1IXKA 4H27A 4XGKA 3WIVA 3TL2A 4R2MA 3FAKA 3ETGA 5CVJA 2UUBB 1VMAA 3JU3A 4G1FA 4UBNA 2OQVA 1SHZA 4DAOA 4C3OB 3WLMA 3PGA1 1L5HA 1I7DA 4UBJA 2J3QA 3GZJA 3DFMA 1DCFA 1IJBA 1L7XA 5HKKA 3AERA 1E79D 2B8TA 2AZMA 4HEA1 1KYXA 2LKDA 1T1GA 4M55A 4KXVA 5K3DA 3COZA 3DC2A 5BN1A 2E4WA 1NDHA 4EHIA 3EXAA 4AO6A 4F2WA 1A4RA 2PZGA 3LF4A 5D6OA 5AD1A 2FUNB 4CDRA 1Q5PA 2FZCA 1WQ4A 1J8YF 1DKPA 1WXQA 2PVCA 3CUSA 3ELUA 5KDLA 3RLIA 3PJEA 2NX2A 4Q24A 3T3IA 4A8JC 2VJPA 3DM9B 4HQKA 4RFVA 5HA5A 4GW3A 2DF8A 2G71A 1E4YA 2Z6AA 2FQ1A 3H1GA 4O8CA 1P6UA 4GP9A 3ELBA 4NPHA 4PWZA 5CEJA 4JOBA 3GEPA 3OHPA 4POAA 4RU1A 3EGCA 4G4SO 3FZNA 2VTBA 1A5AB 3FNHA 1IJEA 3EQZA 3IDQA 4JR1A 3KL4A 2HK8A 1QBGA 1U3CA 1ONPA 2C2HA 1XELA 4OREX 4KDRA 4UTRA 5A62A 3NUQA 1E1RA 4DEYA 4TWRA 4RJJA 3T9CA 4E5VA 5JZOA 2GPSA 1Q0QA 3PUHA 4WMLA 3SNHA 4BO3A 2IZZA 3LHSA 5HE8A 2PRKA 3A8TA 5G40A 1OLUA 2CLKB 4J4HA 4RKQA 3UGTA 1KI6A 3CTPA 2OVBA 4AMZA 4QELA 3VVCA 3R9XB 3AVXA 2J3DA 3GN1A 1NVVR 3WLHA 2J3HA 3EPLA 4LC0A 1LA2A 4HUTA 4MVJP 3JQ7B 1X77A 1WPGA 4C4ZA 1QG2A 2QAJA 4RETA 5A71A 2G7ZA 1TZ2A 1V4BA 2GYYA 3Q1KA 4N0EA 4CQLA 1LGYA 4UEOA 4GBMA 2X0KA 3P9XA 3STYA 5DCUA 2C03A 4JEHA 2C57A 1KETA 3ZTTA 3WQQA 3PXXA 1PFYA 3MTBA 2WSSD 3IUSA 5JNTA 1MENA 2PO7A 3KWLA 5H4GA 2PL5A 3QPVA 1PHPA 4UOQA 3RRYA 1UMCA 5F2NA 5KYYB 2O8DA 2Q1YA 3S8EA 4DZRA 1DUVG 3HE3A 5IC6A 3T7IA 3VJLA 4AYWA 2CY0A 1LC0A 3FFXA 2XKAA 1UDBA 3PUKA 3QE4A 1W5SA 1V26A 3B5JA 3QF4A 4NBRA 4F5ZA 2Z3VA 1EVZA 4JT4A 5FOQA 1GTG1 3IODA 1TCUA 1R37A 2QG6A 1CLUA 1T6NA 3HGQA 3M34A 4MEBA 1W48A 4GC5A 4OQ4A 4YT8A 1QIDA 1NKSA 1YBAA 2HFKA 4TTVA 5H59A 3TKLA 4B40A 3D59A 4F1JA 1NZJA 3OBBA 5FPTA 3BH7A 2I54A 1Q57A 3LBNA 4C4TA 1E1KA 3MCWA 3WV5A 5K8VA 1TIBA 2IYEA 1WB4A 4JI1B 1DFIA 1NTOA 1CJSA 2BZGA 3A9WA 2CCJA 4M37A 5TPZA 3PQCA 1Y8ZA 2W0MA 3VSDA 3C3BA 1EVLA 1NVVQ 2R1TB 4YWJA 5DNYB 2QVXX 3AEKB 1XZKA 4MKGA 4YPVA 2H92A 2BM8A 2IBMA 4YRBA 3TBKA 2AI3A 1IHYA 6GPBA 1LV7A 4YCMA 1ZN2A 1KOFA 2O14A 1QK5A 1JHRA 1XNQB 4KR9A 1TYZA 4X6YA 5CA0B 3RKUA 3UXMA 3G1TA 3HCCA 3PUIA 2VDWA 3IL2A 5ERXA 3VPDA 4X24A 2C5AA 4E0BA 2BKEA 4DC9A 3UHPA 4NFLA 1HFKA 5CYFA 3WXMA 3RJMA 3AM4A 3U31A 2VDQB 3H83A 1V43A 3IOCA 2CL0X 2PJDA 1E5QA 2WI8A 2ZBGA 4M1TA 1Q83A 2RARA 1RYYA 4EI9A 2O8CA 3I92A 3CX8A 4XQGA 4MOWA 2POQX 1W5AA 5DBHX 4CIXA 4OL9A 4IMRA 3CZQA 3GUVA 4JI4B 3C6ZA 2XAAA 1UADA 3TS1A 3WK9A 4Z0HO 1Y6GA 1JB9A 2VPTA 1G5TA 2H1HA 3MTEA 8AT1A 1QTNA 1TECE 4UHHA 3L0PA 1Y4AE 4OI0A 2OAEA 4M8NE 4PYIA 2HW8A 4C0KA 1PFQA 1U5CA 4DCSA 1Z6XA 5BW4A 5J4VA 1KAHA 1MF7A 4B3TB 2ANBA 2HQSA 1ARZA 1YBFA 5BSHA 1R12A 1ZOSA 1RAHA 1NP7A 2XNDA 1KFEB 3MCAA 2FZWA 3NHJA 3OICA 1Q11A 5LMZA 5KJ6A 1CRQA 1NQWA 4PAMA 3E9DA 4AWXA 2C94A 5KJCA 4UEQA 3B60A 3HXOA 3T3OA 4WERA 2ZVDA 3E1GA 2IS2A 1C80A 3HL0A 3U9SA 1KS2A 2JD2A 4RK0A 1J2YA 1PJ3A 3PFBA 4GVXA 2OXIA 5BT8A 2B2NA 2QVYX 4Q7MB 3ZLBA 5AVRA 3DR3A 1HQYE 5AXAA 3QOXA 3AWIA 2AKEA 2QN1A 1VJGA 3I0MA 2WNHA 1H5NA 1L4KA 4ZEMA 4F4UA 3ABRB 4F12A 1NIPA 2CLMB 4B6OA 4DQKA 3IQEA 5DGIA 4NMXB 1VRWA 5G4KA 1JHOA 1DP4A 1KVSA 2Y1XA 3Q0TA 1E0DA 1BWRA 1PUXA 5I45A 4ILEA 2GVDC 3Q15C 1NBWB 2OENG 1ONSA 2F1HA 2QE6A 1E94E 1JJFA 2WT9A 4E2YA 4GYJA 5LD2C 1AK9A 1Q15A 2ONKA 5FBWB 3AHHA 4CDNA 4CKWA 3NRJA 2IRWA 1XK6A 1UKVY 2PIAA 2BKUA 3ZQJA 1MBZA 5IC5A 4PTLA 5DYWA 1G3QA 3CF6R 3FOWA 3SQNA 2ENUA 5JYBA 4OYYA 1ENPA 2CYAA 4Y2GA 3THYA 3U9TA 1KI1A 2XCSB 2OECA 4ZHQB 4UHEA 4KMSA 3WYCA 3NDJA 3WGKA 1Z4JA 2Q2OA 2FP3A 2PJRA 5JARA 2GGSA 3EIQA 3KEMA 4LIPD 4XAQA 3A1DA 3TUJC 4KFRA 5CYGA 2VDNB 1MVNA 4A1FA 3N70A 4O1HA 1JLRA 2DQ4A 3BHNA 4K2HA 5FWXB 1SCNE 2BL4A 1W25A 2NTVA 2DFKB 4I9NA 1NG1A 4CM3A 4INPA 3WYNA 4JFRA 1NOJA 5KS2A 4OX9Y 1Z5NA 4WZAB 2G6BA 3LWNA 2XE7A 4FXPA 4MHTA 4O33A 5ABPA 1EXNA 3EGDA 4B71A 1XMOB 3NOQA 1QQ5A 3U44A 4RD1A 1DAIA 3P1JA 4QT0A 2I1VB 5SYAA 5EHIA 1ISGA 2UYGA 3LS2A 5DWQA 1SVWA 4NNJA 1ZD8A 3TIIA 4Z1MD 4JVOA 2VHUA 1LPMA 2GKSA 3H6KA 4GQBA 2X4LA 2FG7C 2QU8A 3G2HA 3QFFA 4NFYA 2J6CA 1TUGA 3MINA 3KZOA 2I2CA 3PUVA 2V7EA 3CUEF 4MW1A 4V0ME 3KLNA 4U02A 4IBOA 4BQQA 2YFHA 2YS6A 1IN5A 1N9GA 1UM9A 3AY7A 3E22A 2ZWPA 3OTIA 3S44A 4MUNA 2VYVA 3M4NA 4GOKA 2VSQA 4OG2A 4CW7A 2PKQO 2RIPA 3G17A 1WF6A 1Y9DA 3MGKA 1O9BA 3R20A 2OCLA 4FYVA 1WU8A 2CV0A 2EYUA 4RM3A 1U31A 3T3GA 1ORWA 2QD2A 2YN2A 2H59A 2X6QA 4Q3NA 2XTJA 4TTIA 4CDMA 3QWIA 2VR1A 1TU0A 1IJKA 3ED1A 3FMOB 1K88A 5G1PA 2VHJA 4N01A 3TXAA 1Z74A 3CH7A 2ZZNA 4I50F 5DLDA 3ACBA 4DYVA 1YA4A 4O4LB 1Q21A 1Z37A 3IE2A 5GONF 1T8TA 1A9RA 1EIZA 5BUCA 4BN0A 4R1TA 5G0UA 4J1NA 2WUVA 4PYNA 1OYVA 4RA6A 3RVRA 5FULA 1XF9A 2XUKA 4MV8A 1PD0A 1SCUB 3JZFA 4CIVA 5DI3B 1QAMA 2PH3A 3TRHA 1RYBA 2C2KA 3R74A 4AJ9A 2PPLA 1RRKA 3RD5A 3OEHA 4YUWA 1MMFB 3IEKA 1ZA2A 2RGWA 3K73O 3TIFA 2B3DA 3OX2A 4V0KA 1HTTA 3MAJA 4WQMA 3UB3A 3EBLA 2CWDA 1V7CA 2CUNA 1KJQA 2HRDA 3C8ZA 3OTQA 4WZBE 3NJRA 5DMHA 1JEYA 4NC9A 1HE5A 5JVDF 4PG4A 1L4MA 1QGOA 1TT5A 2E5FA 3BN3A 1TLLA 4PC6A 5TF0A 3U48A 2NUBA 2V5UA 3OZXA 3HXMA 5JMWA 2W6PA 5BR8B 3VXKA 4MJXA 3T7AA 4CM7A 3W8DA 2BDTA 3IEXA 1R4MB 3LVRE 4GMDA 2P0YA 2Q5QA 1TVEA 4YDSA 4QDUA 4AJLA 4B48A 5FAKA 4ZO7A 1XTQA 5G02A 2ZKIA 1JTFA 3ZK9A 2KWIA 4UU7A 4DJAA 3K96A 4TWZA 2ACWA 2P2LA 2O0LA 2NW6A 3ZOKA 2DGDA 3U4IA 4BN4A 5GAJA 4C0QC 3I6MA 1LTQA 2A52A 4P3XA 5C9ZA 2UZ1B 3BS4A 1PUIA 3HDGA 4BASA 1ECGA 2H1VA 2IYPA 3OMXA 4Q5IA 4C14A 1GFZA 3NO4A 3O93A 1DIBA 1PUJA 1YONA 2FX3A 2AKAB 2R5WA 3OLZA 3G0BA 3L07A 2OOSA 4C4RA 4PXAA 1EFRA 4JJIA 4ARIA 5IRCD 4NCIA 1D07A 3AF0A 3A6PC 1IVSA 3MLEA 2QM8A 1PNOA 5D87A 3DPUA 4AZ3B 5I4KA 1DPGA 5FHRA 2VAVA 1TJ5A 2BGTA 3PFNA 3VDNB 3NVAA 3OC6A 3VUEA 3K0FA 2Q3HA 2H5LA 3AKYA 2WVGA 1YQQA 3DLIA 4W5HA 4WXHA 2C97A 4F5YA 3THOA 4MQ4A 4G0QA 3O74A 1C9KA 4E13A 3ICEA 5EJ6A 5ALGA 3TNLA 5IC4A 3RVLA 4E5NA 4JB2A 1ZH6A 4R01A 2O3TA 4L8WB 1EM8B 2MSLA 1AKYA 4MEJA 3MPOA 4ZI7F 1NHWA 2VNAA 3CTMA 3RTBA 1JIKA 2TECE 1I9GA 1WOYA 4FYIA 3SHWA 5D3KA 3O8OA 2BSXA 1U5BB 3F8SA 2FPRA 1HG1A 3CJRA 1G20E 3RTDA 2G77B 5F51A 4QVIA 4CHTA 4AY3A 2LRHA 3V9AA 1NFFA 5KX5A 3HVRA 2J08A 2CD9A 3TAXA 1KDRA 3U3OA 3ZHYA 3VNVA 5JZMA 2Y77A 3IQWA 3R6LA 5DTMA 1K8YB 4YV2A 1SM4A 3NHYA 4V24A 1CFZA 3H4VA 4L4XA 3WNVA 1QCYA 4BPRA 1VHWA 1TCAA 2PNJA 1RC1A 1ILWA 2IU6A 3UJBA 1LVGA 4N47A 5CXUA 2BFBB 1NM5C 4PYJA 5C1PA 1WLSA 4TROA 3VBCA 2VSXA 4RA9B 1KZ6A 2YJTD 4FDMA 6AT1A 3BB1A 2GILA 1E1CB 3FYHA 4JLSA 4UE3S 2P7HA 1MQAA 4YC7A 5KJEA 3A06A 4WGFA 1BGXT 1TYCA 2VDKB 2C1EA 2OYRA 5B53A 4RXTA 1GN9A 4PYQA 3H6GA 1G4UR 4QRHA 1GRCA 4DEVA 4DNQA 3BMNA 4Z3OA 1EDBA 2JAPA 3RRJA 1JFSA 6ABPA 3KBOA 2ZETA 3AEQB 5TS2A 2ZLBA 4EHAA 1E2LA 4PPNA 4IIHA 4GPBA 2HLDD 2RGAA 3BSSA 1PNTA 4PIVA 5L4SA 5IWAB 1QK3A 3UJ7A 4MR9B 1CKEA 5SZJA 3QYPA 5CFZA 5JS1A 3JCZA 3VUFA 5GV7A 2ZBEA 2XRYA 1XU7A 4JJ4A 1F1BA 1ZWLA 3F1KA 5FUBA 4D0SA 2Q5EA 2Y93A 2PX3A 2GJ8A 1E6UA 1G9XA 2R79A 4FPXA 4PZEA 2NPFA 1ZH0A 3NC4A 4C87A 1COZA 4I99A 1YQTA 4WKOA 3S70A 3VZDA 5FBRB 3WWOA 3NX4A 3TCNA 3DBHB 4CLRA 3WOVA 1C7RA 4B82A 2XECA 2I76A 2GAAA 2ZRMA 3UJPA 5KYNA 5K4AA 1O2DA 3RREA 4HNAA 1OAKA 1KFKB 2ODAA 4IJVA 2CD7A 4PHFA 1G18A 3RU3A 3GUYA 4RTKA 2MDTA 1O5TA 2R6ZA 3PIIA 2Y1EA 4UM9B 1YRQA 1I2BA 1Z4KA 1F4PA 2VZ0A 4HC4A 4J91A 3V8PA 1EESA 2Q3BA 2HC9A 1D6SA 1EX9A 1CUZA 2GAFA 2NAFA 2ZUUA 5AQ1A 2V6BA 1QZXA 4Q3OA 3VU3A 1L4UA 2YNMC 2ZQYA 3U13A 3VKUA 3SMQA 2OC9A 1DAEA 1J20A 2RGUA 2Q27A 2VUSA 3DAGA 3UMJA 1G5IA 1K8QA 5DPMA 3KQPA 5B1DA 3F6YA 2OT3B 2CL6X 2GLUA 2YRWA 3IHWA 1H0HA 5JR3A 5LMNB 5BMVA 1N34B 1LCIA 1AUXA 3ME5A 3LT2A 2W4MA 1P5HA 1WBJB 4YQFA 2XTAA 1BJRE 4CV0A 4JUFA 5BQ3A 1KXJA 4RPHA 4X7BA 5ELXA 3SX0A 1BH6A 3KVVA 4QPDA 3CNHA 4EEXA 4DEXA 1NW5A 3NYRA 3NWPA 1Y7HA 1D3AA 1RRGA 2PYIA 4Q37A 3H11A 2A88A 4KV9A 5KOHB 3K9GA 1X0XA 4J6FA 2BRUA 3DEZA 4L9SA 2XB6A 2HWUA 5FNZA 1R0SA 3BWEA 3PXAA 5AJZA 5DYTA 3NUZA 2FZ4A 2IEYA 3JTMA 2FWBA 3MBIA 3ZUGA 5JHHB 3VNUA 2HZ7A 5EIFA 2JHAA 1NURA 5EVCA 2H17A 1GG9A 4MS1B 4DQDA 2V7TA 5BWOA 4RHTA 4HZIA 3PWKA 4QQFA 3FCOA 4A4DA 2FFRA 5JT1A 1OXSC 3FCEA 3E3MA 3GF4A 3CZ9A 4EDHA 3D4LA 3D31A 4M86A 3FNGA 2A0KA 2I29A 4MI6A 5H81A 1UQUA 1FZTA 4DIEA 4FFBA 1RIIA 4YI5A 2CNWA 2NO9A 1II9A 1HSOA 1NI3A 1RR6A 1IM5A 2WWIA 4JHXA 3ZDXB 5JAZA 1ZD3A 5AKZA 3M83A 2QVLA 3QKRA 1X8XA 3G89A 3TCXB 5KNLA 2O7SA 2J0EA 3ABQB 3DNMA 4IEFB 1LUAA 1Z39A 3E05A 5GJCA 3U17A 4AIIA 3ZJVA 2C2XA 3B20A 4OHUA 3SNKA 5JNLA 2O52A 621PA 5JUWA 4AAYA 5FUWA 1P1KA 5HJ7A 3DOOA 2DYKA 5JYEA 4RE5A 2F17A 1P8JA 5FEUA 4FN5A 1YB6A 5I3ZA 4EB3A 1AKEA 1BMDA 1DV2A 1WXXA 1RYMA 2WK1A 5FF9A 3V8VA 2IDJA 2Y1CA 4DM4A 3MJHA 1WWKA 1Z29A 4Q3BA 2D13A 4L8VA 2BR3A 3UT5A 1JKJB 2C61A 2YIDA 5J2UB 1G5RA 2PUDA 5DI9A 1JXOA 1E7SA 1R74A 5LQAA 3U3RA 1N2CE 3U7FB 5CITA 2W43A 4MUKA 4EB8A 1QVRA 4U7DA 3UHOA 2W2LD 4TKVB 3L8ZA 3QBTA 5IHXA 4XPIB 4F9GA 1U4SA 1FP7A 4D9JA 5AVYA 1X15A 2D59A 1ZRNA 1SK8A 1SBZA 2VHXA 4JJZA 3UC5A 3N7UA 3G7NA 4L2IA 4ZZ3A 4XJVA 4EGFA 4EPWA 3H8WA 4EVIA 3FFBA 2IUSA 3IQGX 2JLXA 1MXFA 4TSFA 5ES3A 4C0AC 1CZLA 1V3QE 2IK8A 1L1FA 1WD5A 4GSYA 2NU9B 2VWPA 2AMLA 4H60A 4FK8A 5D7NA 3TXYA 2DAPA 3B6ZA 3WQRA 3O3CA 4ZVMA 4R40A 4MLPA 5HFNA 4NAUA 2XIQA 4DE5A 3HQ4O 3TLMA 1MO2A 5MFZA 3EF1A 2VRCA 4H7FA 4YRTA 2D1SA 1EJBA 3QXJA 4Q3DA 4X66B 3B7PA 3PPYA 4RVGA 2QSJA 4KG7A 3O73A 3OQNA 1WXFA 3SP1A 4IFTA 3QUAA 5EPUA 3ZCSA 3BXFA 4BNLA 3DV0A 4LGMA 3L7MA 4Q1AA 5EHNA 3KAQA 1SBYA 4DDVA 2ZRFA 2OV4A 3D81A 3I5UA 4B9EA 2A9KA 3I04A 5DCYA 5DGXA 2PT6A 5AKYA 4PNPA 5TEVA 4JOQA 5IF3A 3AF5A 5T64A 2NU7A 2ZJ3A 1JLLB 2J45A 1D6NA 3TQCA 2G1KA 4L4ZA 1VPVA 2Q62A 4JOCA 1V1JA 1A7UA 2NUAA 3H4MA 4FKBA 1JS1X 3SM9A 3C6YA 2HDNB 3CZMA 2A5FA 2WHYA 3NDRA 3ZD8A 1ZCZA 1E8NA 1TYBE 2YIJA 3PEFA 4QJ4A 1LLDA 1XV5A 1JYFA 3MCTA 1CJTC 1PR5A 2B69A 5CA0F 1TZMA 2B25A 2GVZC 4HS4A 2J5RA 2R6FA 3RWMB 4GNRA 5JD6A 1A3CA 3DEFA 4BVBA 1KK2A 1WD7A 3AZQA 2VH2A 5HUHA 3BTOA 3D4BA 1OXMA 2I2XB 5HZGA 5DK4A 3L8CA 5SYMA 5LD2B 2AK3A 1PZMA 1U2QA 4BVFA 3ZCXA 2DZDA 4L28A 4BQPA 4EGCB 4GI3A 1G41A 1V37A 4TZ0A 2A9VA 5DNDA 1USGA 4RULA 1WEHA 1XB2A 1PK7A 5BNZA 4UFNA 1NI4A 3F73A 2CUKA 3GFFA 1BX3A 2XRZA 3C6KA 3K7EA 3RR2A 4AFNA 4BQEA 1H8HA 4RF3A 1R6UA 2DECA 2SECE 2FWNA 4TMZA 1Q92A 3UH1A 5LQUA 4B4UA 5FBVB 4TMXA 4NG5A 3KSDO 1XRLA 1DKLA 4UXJA 1J9GA 1CIVA 3K20A 2J41A 2WPNA 3IEIA 3LY5A 3MPUA 4N3NA 5L3QB 2VLBA 4GG1A 3RBAA 4Q7QA 4FI3C 5BN5A 4KQCA 5FOVA 4HNUA 2H54A 2AG0A 2YBDA 3CKLA 3QVKA 3QWBA 1IAVA 5E6UA 4G01B 4IV8A 3ZW8A 3Q8KA 1YJAA 4WLEA 2WAOA 4BC1A 3GG9A 5D3MA 3KDSE 3A1SA 1N1DA 4E94A 3CFIA 2QGFA 4P80A 1XD8A 1SIBE 3FXAA 1HY3A 1ODIA 2G82A 4ZOLB 4WA7A 3O75A 2XYPA 5EJIA 5GM2A 1U9JA 3NEJA 3O90A 5AVTA 2I6FA 5HKAA 4QTUB 3JASA 4PNEA 2CEAA 2XNHA 3KJQA 4OB6A 1DXHA 3HBFA 3REQA 1F38A 1LK7A 2GEUA 1P7CA 1O6CA 3H42B 3LBFA 5I7HA 2QV7A 4MYUA 1G38A 3IESA 2IXTA 3AX6A 2RHCA 4ZPJA 3WGQA 2H4JA 4B3DA 1SKAA 1LBQA 2B1JA 1O94D 2E4VA 2B9EA 1FNCA 2CYCA 1CQWA 4LE0A 2JIBA 5AW4A 2GYVA 3TYXA 3FOBA 3F47A 3NASA 3OWHA 4XOUA 3W4KA 2IUUA 4UKDA 4PSCA 4BX8A 4Q9IA 2YWRA 2V58A 3PXGA 1BOOA 3KFXA 5E6SA 4O6VA 2G04A 3RW9A 4URUR 1ESDA 1FUYB 3A27A 3HEAA 3IPRA 2FPLA 4ZHQF 2PD3A 1YRAA 5AOAA 5EQDA 2PSJA 1Z8HA 2NYAA 4PR0A 3TWOA 4TKMA 3IQIX 1HC7A 4UJ5A 2QT9A 2DKNA 4IGFA 1QHNA 5IM5A 2VRBA 1AQYA 1K5DA 4IWYA 2Y1LA 3OP1A 4JR0A 2OHVA 2IHNA 4TL8A 2VQ3A 3FYUA 4GI1A 4ESVA 2AN3A 3CPJB 3M1IA 3C48A 3ND7A 5B1SA 5LQNA 3T5AA 1JHPA 2AFHA 3HB7A 2P6MA 3M4XA 4IHJA 2MCFA 4UVEA 1Q7BA 4GHWA 1LI7A 1DELA 2REOA 1QFMA 2V4UA 3C24A 3EIXA 3HNOA 4M9XA 4OF4A 2JGAA 4XCXA 1CY6A 2EKPA 3IHKA 5ICFA 2ZS7A 1WA5A 3QHPA 1GQOA 3VR1A 3NJ8A 1N6NA 1TF5A 1Z2NX 2GBIA 3MGGA 3N53A 4RGBA 1Z34A 1BX1A 1PJBA 4OO3A 5AOVA 1KHTA 4CKXA 2IOHA 1RWBA 1R3UA 1TVMA 2XUGA 2VJAA 4BP3A 2BVNA 5IT5A 3P9CA 5J63A 2JGKA 3WRYA 3O8RA 1UODA 1BW9B 1XMXA 1YDGA 1TXGA 1NVKA 3WKDA 3Q41A 3DZJA 4G5SA 3BE6A 4LF7B 2C95A 1YMQA 2BEVA 4HCJA 4TVOA 2GTPA 3LXXA 3VTFA 5J1SB 4RSMA 3NTVA 5FUQA 3EX7C 1YL7A 2A78A 3KC2A 4CR7A 1NX6A 4HN4B 3SZ3A 2MJLA 3GJTA 3N2NA 3OA0A 2XYGA 1WZUA 4A91A 2J3IA 3UIEA 4QJ3A 4GAEA 3HWWA 4WNYA 4EUKA 3KZNA 3LUAA 3ZD9A 4JJ6A 5BMOA 2ZAYA 2WHEA 1NA5A 3ZTWA 1D6MA 3QU9A 1VC2A 4HBZA 1UT5A 4PSKA 1VGRA 4G2NA 3RU2A 2X76A 5DW0A 2X58A 1BXRA 5KKAA 5AK5A 3U7QB 1I0LA 1KFCB 4RHXA 3RSOA 3CEJA 4EHDA 3GT3A 3HHEA 5DEOA 1N2EA 1WDLA 3JSAA 4GOMD 3LE8A 4KHZA 1X2BA 3Q88A 4KMMA 4E88A 1Q2XA 1E0SA 1XKLA 1IB0A 3V8MA 1B8NA 1ZX1A 2VP9A 1EZ4A 1SC1A 3D4OA 2QTVB 3M3PA 1QS0A 2W8BA 4G2TA 4RXMA 4PX3A 2BGKA 2CT8A 1PEKE 3HY4A 2D6FA 2ETVA 5IZCC 1CQIA 3EC7A 3TZHA 4AWAA 1ODSA 4ZODA 1X9GA 2O7QA 1B0ZA 4D4HA 3P0RA 3PWZA 5HEKA 1YCFA 3A4NA 3PD1A 4YBRA 5CCXA 3P0FA 1N3YA 3IMCA 1YS7A 5HTKA 1ECBA 3A14A 3UV6A 1PNQA 3GVXA 3PRKE 1ODFA 4KDFA 2QBYA 3AZPA 3GBVA 5FB3A 4ED9A 2H52A 3HXKA 3T41A 3WLTA 1C1XB 4N5LA 2GJ9A 2PV7A 5DTJA 5AI6A 1XJWA 1O96A 2NO4A 3EE6A 3OWXA 4EF4A 5KNCD 2HMVA 4Y6QA 5EVJA 2A9PA 1DGQA 3PC8C 1B76A 3PR2B 4PZCA 2VSYA 1C0KA 2P90A 3H13A 3IVMA 1EEHA 1GARA 1SBTA 2Q1UA 2WFAA 4URYR 2Z83A 5JMTA 3MRVA 3M2TA 5EJEA 3RPEA 3JQFC 5GPBA 3RVMA 1RAFA 1EVQA 2EFCB 3WGJA 4I6JA 4BE7B 1UAYA 4ERNA 1IXRC 1NRWA 1TMYA 4U8HA 3X44A 5I7FA 5E0KB 4D3XA 1AN9A 3BXPA 1NQVA 2N3ZA 2WOOA 3T1VA 3BJRA 4P3PA 1UIMA 3ZXIA 1C41A 4PFQA 4TLAA 4FC6A 2QLMA 4CIYA 2ZR7A 3FKSD 3EEOA 5K6RA 3MT9A 2ZK7A 4OEHA 5K3EA 1MVOA 3L0OA 5JU6A 5DM1A 3WL5A 2YC4C 1W52X 2G1AA 4OI4A 4F11A 4ZO9A 3MEQA 5A05A 2RSLA 1FLAA 4YMTA 3M6VA 2JA1A 1BQ4A 5D2CA 4BVHA 3SC6A 2GRAA 3QE3A 4PQEA 3G49A 2V8BA 3SLKA 3G82C 2R6CA 1W34A 3H2KA 4Q1FA 1FSGA 4ARAA 3CR3C 1X6VA 5T41A 2HCRA 3HHPA 2GT1A 2P3LA 4QSMA 1V1RA 4LRYA 5T4EA 3W1EA 5TQ2A 2HWXA 4DV0B 1UOEA 3TFQA 4BMSA 1SUFA 1XZCA 2AL7A 2F7SA 2MSWA 3K1ZA 4RL6A 3RSLA 4OGKA 3KUKA 1FYEA 3I42A 4LWQA 4BO9A 4CBVA 1CQZA 5C35A 1SXGA 3NKVA 2AQ8A 2WJZB 2BUBA 3CWQA 5JI3E 1A9YA 2C3UA 3F3KA 2A0WA 2Z5FA 3V3TA 1XK7A 4C04A 5KKCA 1MNQA 1Q50A 1DBSA 2B82A 2O0JA 1M1XB 5TY0A 1AIPA 4IIGA 4JQCA 4QHTA 3RM3A 5I3CA 3DT8A 1AUPA 4WINA 2PZLA 4MICA 1IU9A 3HJGA 2GPYA 4NU8X 4AJJA 5IJ0A 5BR4A 4AROA 2BMFA 1QQBA 1TRHA 3DGEC 5C32A 1M8JA 4HWGA 3GWZA 3C5WP 2JCXA 3CY6A 2QJWA 1TVKB 3QEMB 1NVGA 4LYJA 4PRKA 4V39A 5DNWA 5CA1B 5KSOA 3W79A 5LZ5A 5CLLA 2ISQA 3G0IA 1WU7A 1O4WA 2OCYC 4JASB 4RKFA 1F12A 4MZDA 4RHEA 2WWGA 5KVVA 4PNZA 4QUKA 1NLFA 1RLOA 1XKQA 1ACMA 1V4VA 1XXHE 2UUPA 1L8LA 2ZIWB 2YJ6A 3DD1A 3HN6A 4G5HA 2V4MA 1XFAA 2BFMA 5A4DA 3PFKA 3WR5A 1YOVB 5EP2A 3B13B 5HZMA 4QJBA 5HWSA 2C8LA 4U6SA 5E6RB 3C5HA 3IVAA 1VZ2A 3DE1X 1XQYA 1TK3A 1JDVA 4WLFA 1CUBA 4HD8A 1PQYA 1IH8A 1ZRSA 2DPXA 2QKYA 3TNYA 1FDWA 2FPKA 1UKBA 4DQVA 2E9SA 1D4AA 2PSSA 2EIHA 2IQ5A 3GVPA 2RK3A 3NG1A 3QMPA 4IDDA 2GBPA 1JLMA 4DXAA 5FRDA 3W5VA 4ZVQA 3ONEA 4DMUB 1P1CA 1KH1A 2JLUA 4BNWA 1EK1A 1PE0A 3T7SA 1NP6A 1LK0A 2QL7A 3FI0A 4KQIA 1U3GA 4WPGA 1R8YA 4OQEA 3BERA 4N7RA 1TZKA 1F2DA 3EXG2 3U19A 1N9KA 1VHJA 3EPKA 4MKIA 3JWIA 1X1BA 1K0FA 3R8CA 4F91B 1M75A 2XSZD 4TV8A 5HIIA 3DKRA 2QM7A 3OAAD 5FOUA 4U0JA 4MIOA 4P5DA 4UMFA 1SUAA 4NARA 1RKBA 2ZB4A 1GP2A 3W4JA 4HQRA 1SCJA 2BISA 2JNWA 3QV1A 2WWVD 4TTJA 1EP3B 2OAGA 3S1AA 3KHUA 2QTTA 4KQJA 4R2KA 1JH9A 4I1SA 4YQEA 2EXXA 3DMPA 1P1HA 2BFWA 3DUFB 4S1OA 3SBOA 3GAFA 1MB4A 4PCVA 5LMCA 4HV4A 4DLTA 2XF8A 2FPIA 4S05A 5AJTA 2WU4A 5JDCC 4CMIB 4MJ3A 4ZKDA 5DIZA 2GZHA 2EF1A 3KZCA 1OWOA 3AFNA 3I1JA 1U04A 1V47A 2IS6A 5JCOC 5KYGA 2I67A 2EATA 1K6IA 3G0DA 4DBLE 5EWJB 3QU4A 3H1PA 3MMSA 5CJ2A 3JVDA 1RXCA 3HZZA 4M4SA 2JFFA 4Z9YA 2P9GA 1KR2A 2PZJA 1RQ2A 2GWHA 4IGAA 3SJCA 3U9LA 3WK4A 4ENWA 4DR3B 3BFPA 3VNBA 2QVGA 3ETNA 1WMFA 3AP3A 4NESA 4WXMA 3U4CA 3W0LB 2DSNA 4ZCMA 5JXIA 4RPLA 5IBCA 3VO8A 3F8TA 1D4ZA 3PE4A 1UINA 2UYHA 5KTMA 4C7KA 2CDNA 1TQDA 4CEHA 1MN6A 1I24A 1WABA 4B6PA 3TPZA 2XYHA 3NDIA 5LCXA 5BSGA 4N7JA 3KSAC 3COJA 1ZD2P 5KJFA 1S2IA 2ZFUA 4MS3B 2GPAA 4YRLA 3W77A 2NAPA 1L4FA 2BZ1A 4FZ3A 3DBRA 2ONZA 4FNMA 3RV4A 4OK6A 3CT4A 1II0A 2HJ9A 3GNLA 3SYTA 1NW7A 5K09A 3TF5A 3HU1A 3GJQA 4MA5A 4I9HA 1XTTA 2FQQA 4CRWB 3BMOB 5LQCA 3IAAA 2WIAA 4C7VA 4MDEA 2YOHA 1SBCA 3GLHE 1GFSA 1FLVA 4F84A 3PD0A 1DDOA 1HE3A 1AB6A 4PAWA 3SZUA 4C4SA 3RYCB 3SC4A 2Q0QA 2R7MA 4ND8B 1H2WA 3CLUC 5E9AA 1BXKA 1S3FA 2GRJA 4PANA 1WSAA 1H2EA 3DCYA 4AN1A 5KSPA 1WPXA 2MMGA 1BDMA 3ITKA 1J1ZA 2VT2A 1GZ4A 3ADPA 2D5LA 3GJZA 1B3RA 3JQQA 4G56A 4N9QA 4OAOA 3K6SA 1YT5A 3KQOA 2HGZA 5CR9A 3S2UA 1KP3A 4N5DA 4NE2A 3ZLJA 4QGBA 1Z7EA 5J2UF 5LYJF 5CX4A 1P8AA 2LPMA 2HREA 3R9IA 1RJEA 1AD2A 3PDJA 3N86A 5G4LA 3IALA 3LO5A 4Q00A 4ZYVA 1S8FA 2BEKA 3C3AA 1JR3E 4EPYA 2ZPTX 1QU3A 4I3GA 5GGXA 2R00C 4EI2A 4LPKA 3IHLA 5ALMA 4C89A 4TWJA 4JYZA 2G80A 1O97C 4WEOA 3BG5A 4JR2A 4JBGA 3JYPA 3DULA 4WCDA 3E7DA 2D0DA 4L5BA 5ARBA 4ZYWA 2J8ZA 4GZMA 3Q9NA 3WIBA 3T7TA 3KSMA 4C2BA 3VJRA 2GETA 2H51A 2E2WA 4JT9A 4MUMA 1QYRA 3LTEA 3S7TA 3SJBA 3UZUA 3SHQA 3V5NA 2QUJA 3FIUA 5TVGA 4CR6A 1Z6YA 4R8MA 4BO4A 3ZHUA 2O2JA 4GKVA 3IUBA 2OCPA 4EI8A 4ZU6X 4Y6SA 3UUWA 3R7SA 2F1RA 5DNUA 3CSDA 3V1KA 3SYMA 4I4IA 4KWTA 4OB8A 1R2QA 4QECA 1H93A 4ZOAA 5JEDA 3L8EA 1V8BA 3TDMA 3ULKA 1VPEA 1XJ0A 4PG7A 3RS3A 2IU4A 1ZA1A 5CDFE 3HXQA 3EPJA 3P9NA 4HGZA 1FNNA 4UNNA 3K70B 4V03A 1WCXA 4R6WA 3EBPA 5IX8A 4B3HA 3HFSA 4XUGB 5LDHA 1K3TA 2UXCB 5AW6A 1UJ6A 2J67A 3ZBUA 1ENYA 2J7PA 2O3SA 3U0VA 3TOXA 3KR2A 4KAAA 1SBHA 1ZI9A 3GNTA 2CNBA 2XUIA 4KNVA 1U90A 3SG0A 5JI2E 2BMDA 3PEUA 5BYKA 3W9BA 3LFHA 1LBIA 3VHXB 3I23A 1XZIA 1U63A 3JR3A 1YZYA 2G5CA 4IS2A 3HZOA 1G9SA 4P36A 2G2SA 3GCGA 2IYZA 4JP3A 3V7NA 4BX9A 4QD3A 3SQXA 1ZAKA 2X13A 1B26A 1F5NA 3T1OA 5EMJA 2VUIB 3TRFA 2D2VA 1CY0A 1OSNA 3T3HA 2VZ9A 4GWGA 3C1OA 4K6CA 4CFZA 3QMWA 1QZTA 4NCBA 3RAJA 4CL0A 1T2VA 3DNPA 3QLTA 4LZLA 3G7UA 1DFHA 4OKIA 1JR4A 5F64A 1CRZA 2FZLA 1Y34E 2EZ4A 3TIGA 1YZTA 3DJFA 4HG2A 2ECOA 1UXJA 1N6OA 1HOXA 4IYRA 3IMEA 4RW0A 3RUDA 4A2CA 3O8DA 3G8BA 3RARA 3IFSA 4HATA 2ZRGA 2OFXA 1V25A 4FOLA 1DJQA 4WNCA 3KHKA 3GMDA 2HCTA 4EMTA 4PZPA 1DCKA 3IHTA 3CLVA 3LKZA 4JXJA 4MVYA 4BEVA 1H6DA 3IDFA 4D82A 2QAGA 3D3EA 3H5IA 2F6RA 3LGXA 4LNUA 3E81A 4QPNA 2OB2A 3V9PA 3QXXA 1XSEA 5KB3A 1UPBA 1K7YA 1KY3A 2HA7A 3ZV4A 5BORA 1H23A 1Z25A 2G76A 3DT9A 5AVSA 1E4EA 3ROPA 1FYVA 1L4EA 1M5TA 3TQIA 2PX4A 4RF4A 4CM9D 4J90A 2FSUA 3Q0IA 4YMGA 4II2A 4LWOA 2A0YA 3GZNB 4RZSA 4Y8VA 5HIJA 1IOWA 1DFGA 3O31A 5EE3A 1ZZEA 1K68A 2C3OA 3L1HA 3GJ5A 2PMKA 3W1WA 2DEUA 1I30A 2ZR9A 2ZBFA 4GICA 2N1MA 2OPBA 2XGGA 2AD1A 4FGKA 4XTRA 5DBEX 4HDMA 2CXQA 3OD5A 3MS2A 1IQRA 4IG4A 2JC3A 1NQTA 2C07A 2NO5A 3KWFA 5KPDA 4EO4A 5J23A 4NV1A 2Q0HA 1IN6A 1ATIA 2HHCA 4I3FA 1RJDA 1VL2A 1GNLA 3E3OA 4FX2A 5EZYA 1W5FA 1SKMA 5KYXA 3TNJA 4U1RA 1B15A 1S2OA 3UWOA 1WBDA 1ZITA 4UMEA 2OESA 2EBHX 2QJRA 2B0JA 4GX0A 5J9FA 4DBLC 1O3YA 1BJKA 4F3NA 1FA9A 1D03A 2P11A 3KJGA 4G41A 3S55A 4EMBA 4FNOA 2IYRA 3HB4X 1X7XA 2PWAA 2J6IA 1ZN8A 2EFEB 3NTXA 3ECCA 3SHOA 3QEBZ 1F1JA 1Q44A 1BFKA 1EB8A 4R2HA 2O1XA 3IBSA 1U7OA 4HHEA 2NVOA 2WU1A 5JPIA 4DYDA 4GPD1 4LJ8A 5A5EA 3NBZC 4XJXA 2L17A 2Z5VA 4HXEB 1W85A 2QI9F 4HGPA 3SF8A 2QT0A 1IJFA 1RLMA 2ET6A 2BV3A 5CT4A 3RRNA 2I6XA 4HVLA 4L7QA 3M6XA 2FEAA 2A3NA 4MW4A 1VKZA 4NULA 3HNRA 3AQ4A 1JTVA 3TJZA 4MQLA 1INLA 1NV8A 2ID9A 3PC2A 3ZDBA 1ZRMA 3KB6A 5JIBA 4EY6A 1ZICA 3V97A 5EXXA 1XE3A 3TKYA 1NXOA 2EERA 1IUNA 4W9NA 5AKIA 3R7LA 2ZVJA 4YJKA 3RDPA 4DLWA 4HADA 3EXHC 4E08A 1N2ZA 1HGXA 3AB7A 3RKSA 5KTTA 2IJGX 1Z38A 1L7AA 2IUEA 3E3AA 1M6VB 2WFLB 1M74A 3OZRA 2JW5A 1VE1A 4IDPA 1S01A 1C4XA 2ILVA 3I4CA 2XB8A 3IJPA 5THXA 1XDBA 1YRYE 2CXRA 2EJTA 1Q1EA 1I10A 2H85A 2WVJA 2VHCA 1EDZA 4R16A 4U7JA 1CU1A 3HM2A 2AWOA 3OC0A 4YRZA 3RRFA 4AKEA 4QPJC 5EJ7A 4DCVA 1OIXA 1H2FA 4RTSA 1G2IA 4KBGA 1CT9A 3ROEA 3ESYA 1CY7A 1B00A 2BHTA 4DG8A 2O3RA 4EZIA 1P9RA 3MUOA 4CFSA 2W48A 4R2JA 3T3EA 1RPAA 4JODA 4M36A 1Z8FA 1AHIA 3COWA 4OHYA 3T95A 1Q0ZA 3V7UA 1Z45A 1E1RD 2OMEA 1I1QB 4YMWA 3SF0A 3ZHVA 4AN0A 1RWWA 1L7MA 4LZWA 5CBKA 1BE6A 4Y1FA 3VTZA 3UHAA 2NWQA 1M2EA 1QM5A 2OO5C 4NWIA 3IURA 3T34A 4CT5A 2Y1GA 2M2IA 1ZCJA 2MYPA 1KOJA 1XKXA 3EF0A 3HLYA 4YCJA 2YMPA 4U7FA 1LY1A 4LBYA 5CFLA 5K6AA 3LLSA 4MCHA 5HOEA 3T3MB 5CFMA 1XTSA 3MYYA 1KJZA 2Q3LA 2IW1A 3HJRA 4AJ2A 2IPLA 4FGWA 4XGNA 3KQTA 4EK9A 3OIYA 4BNTA 2XUOA 4LHVA 5F4BA 2GBCA 3THXA 4NS4A 3TLGB 3BM5A 2IVZA 2PT7A 4FEGA 3AVUA 3OZGA 2Y6VA 2YXNA 2PQ0A 4DANA 3DMTA 5KNCH 5BN4B 1OHHD 1QJ4A