4MUGA

Crystal structure of pantothenate synthetase in complex with 2-(5-methoxy-2-(morpholinosulfonylcarbamoyl)-1h-indol-1-yl)acetic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
287
structure length
287
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 97
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4mugA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mugA01
1CT9A 1M83A 4YMIA 2B7LA 1NI5A 1NUQA 1NUPA 4NZPA 4ZCQA 2NSYA 3H99A 5DB4A 1M8GA 3ND7A 1YULA 1SURA 4EG7A 1M1ZA 3GLVA 2CYBA 1EUQA 2PG3A 1A8HA 2YY5A 2E0IA 4ZCPA 1QU3A 3X1JA 4MWBA 1ZH6A 4ZCSA 1O6BA 3HZRA 4EG4A 1X8XA 1KP3A 1I6MA 3HGMA 3SZGA 1O97C 1TEZA 2JANA 3IOBA 4F3RA 4ZT3A 1TYDE 2CT8A 1JILA 1J1ZA 3P0IA 5DK4A 1NUUA 3U1VA 2CV2A 4XFJA 5F23A 4AQ7A 1JEDA 3VGJA 1NUTA 3RJZA 3LOQA 4MW7A 1WXFA 1YI8A 2J08A 4H3SA 4P2BA 3MLBA 3HL4A 1RQGA 4OUDB 3K9WA 1MBZA 3AL0C 3ZJUA 1KAQA 5TGTA 4MW4A 1K4MA 3N8HA 2TS1A 2DERA 2BTEA 1X6VA 2Z08A 1EFPB 4G5FA 3SEZA 3TQOA 3IUBA 1O0CA 4MW1A 4WNYA 1N2JA 3L92A 4JFAA 3RBAA 1GZUA 2DEUA 2CFOA 5HG0A 1D2RA 1H3NA 4JXZA 1G59A 3PXUA 4MVWA 4QRDA 1YIAA 2I1LA 3IUEA 4MQ6A 2QJOA 2YWCA 4EG8A 1GN8A 3ZJTA 1GAXA 4WSOA 2PZ8A 2DETA 2Z09A 4DDHA 3AIIA 5J58A 2XRZA 4CDNA 2AKEA 3D6UA 3DV2A 3ELBA 3ZGZA 1TFUA 3RHSA 4I6GA 1KQOA 5K0SA 4NDAA 2CSXA 3NBKA 1QJCA 2A1UA 2O8VA 1IQ0A 1LI5A 4ZT2A 5BNZA 4MVCA 2A88A 1QRUA 3A2KA 4MUFA 1JIIA 1KR2A 1FFYA 5IHXA 1WXGA 1JGTA 4EFKA 2WQ7A 1XNJA 3H97A 2A1TS 3OP1A 1WXEA 5JBNA 2AG6A 1P7PA 1Q77A 5IJXA 3ZIUA 3A4IA 1S4MA 1WY5A 4S1OA 3ND6A 1T6YA 1GPMA 4MUGA 3IDFA 3VU8A 1MOPA 1XNGA 3KT6A 2RE8A 2PXHA 4MWCA 3FDXA 4MUKA 4JXXA 1U7DA 5H7XA 4F4HA 3ILVA 2E21A 1T9GS 5FO0A 4MW0A 1EE1A 3QTTA 1IQUA 1Q11A 3IMGA 1PG0A 2V0GA 1NYLA 3IOCA 3MMXA 1N75A 2JA2A 1N2IA 1O97D 1IQRA 4KPUA 1COZA 1Q15A 2QJTA 4NAUA 1EUYA 3H9CA 3A04A 1JZSA 5EKDA 4KR9A 3KFLA 3TZEA 3ZXSA 1MAUA 1ZH0A 1IFXA 3G5AA 2D5BA 3FIUA 4I6EA 2CYCA 2QTNA 3COWA 3UOWA 1ULHA 2X0KA 1V8FA 1G8HA 1WQ4A 3I05A 2NZ2A 4L2IA 2GM3A 1IVSA 3KT3A 1H3EA 1VBNA 2G36A 1N1DA 3FETA 2IP1A 2A4MA 4PY2A 3CVWA 3CVUA 4HJXA 3N05A 1J09A 4K03A 2DUMA 1N2GA 1DNPA 4QBTA 3RFFA 3IVCA 2VTBB 1LI7A 4FZJA 2C5SA 3ZXIA 1O95C 1JIKA 1WKBA 3HV0A 4ND6A 1NSYA 2ZP1A 3N2YA 1TYAE 1QNFA 1EXDA 1N3LA 1GLNA 3CLSC 5FNZA 3UC5A 1ZJWA 1GTRA 3DO8A 4EF6A 1KH3A 3AFHA 1JECA 1VBMA 3FOCA 1PFYA 2QUJA 3Q12A 1GTSA 1H3FA 2ZUEA 5DASA 1VBKA 5FO1A 3SP1A 4ZT5A 1QRTA 3AG6A 1VLHA 3CLUC 1ILEA 3IVXA 3IOEA 1EFVA 2VXOA 4JZYA 3OTWA 1XNHA 4HJRA 2Z3VA 4CT0A 5LFAA 2DPLA 3FH0A 2J4DA 3SYTA 1F7VA 4K0RA 3GUZA 3N9IA 4QREA 1QRSA 1YIDA 1OBCA 2WSIA 4MWDA 1KORA 3CLRD 1MAWA 5KCMA 1BS2A 3H9BA 1N2OA 2QJFA 3X1MA 5DEOA 2A84A 3COVA 4DLPA 3P0JA 3ISJA 1PFUA 3KT0A 4ARIA 2QUKA 1N77A 1U3DA 1XJQA 2H2AA 1R6UA 2X3FA 1J21A 1MB9A 2J07A 3CVXA 3IODA 3Q4GA 2E89A 3G59A 3F3MA 4GU5A 3PNYA 2CV0A 4DE5A 1I2DA 3INNA 2DLCX 3IH5A 2A7XA 3CLRC 3FG9A 1M8JA 2OQ2A 4KR7A 1H1TA 5AHWA 4MW6A 3FHJA 4ND7A 4MW5A 3PNVA 1PG2A 3AG5A 3MLAA 2OV4A 3PNBA 4I6JA 5LM3A 2GKSA 2PIDA 3TS1A 4X0EA 2J5BA 1U0BB 1WJGA 4HPWA 1I6KA 4A91A 1N2EA 1Y42X 2A1TR 3JXEA 4XFDA 2DR2A 1KAMA 1K4KA 1NZJA 1IRXA 2XRYA 1M8KA 1NURA 4MW9A 2QUHA 2EJCA 4YP7A 2J09A 3CLTC 2DXIA 4EGAA 1KH2A 3SEQA 3MUEA 2WB2A 4DDKA 4TS1A 2VTBA 3UMVA 5KHAA 2HZ7A 4R0NA 4YP5A 1T9GR 4HK4A 5J5AA 2CV1A 1Q19A 1T6XA 1MRZA 4OUDA 1KH1A 2A1UB 1O95D 1LW7A 4RUKA 1G8FA 3SZ3A 4PBSA 1J70A 3FY4A 3CLSD 1U3CA 4EG1A 1EFPA 4UZFA 4MUIA 3G6KA 1O0BA 3E27A 1N2BA 5HUJA 3RK0A 1YUNA 2GOYA 1N2HA 4NAHA 1TQ8A 4JYZA 4Q93A 1WZ2A 1WQ3A 1M8FA 4EG5A 1JEEA 3X1KA 3CLUD 4KKVA 4MUEA 3KT8A 5LLTA 1K97A 4GRIA 3MXTA 3HMQA 4R2LA 2ZUFA 3CVVA 3QE4A 1IH8A 2PFSA 5K0TA 1O94C 3VRHA 2D54A 1WXHA 1NUSA 4MVYA 4NATA 1N78A 3CVYA 4MAFA 3COZA 4KPUB 1YUMA 2WQ6A 3P0HA 1UFVA 4MW2A 1O96B 1OWPA 3UY4A 5J59A 1OWLA 4DJAA 2R5WA 1KKUA 3HFJA 3LCJA 4Q16A 2PZBA 3M5WA 2V0CA 4PBRA 1VL2A 4MUJA 3ND5A 3NBAA 2BYTA 2QTRA 4PBTA 4ARCA 2IJGX 1O5TA 2O5RA 4L2IB 2X1MA 3C8ZA 4R2MA 3K32A 3PRHA 5H16A 4MWEA 4EG3A 4ZT6A 1JHDA 3RK1A 3SDBA 1J20A 4XSVA 2D13A 3COYA 1EJ2A 4EG6A 3UK2A 1KP2A 2HMAA 3LE8A 1QU2A 4G6ZA 4MULA 1I6LA 1OBHA 4YBRA 4RPIA 4AS1A 4CQNA 5TEVA 1IHOA 1QTQA 3FWKA 2PZAA 3ZJVA 4U8HA 1HYBA 3CR8A 4J76A 4ZT7A 1OWOA 2YXNA 3P52A 3Q10A 1JZQA 3TNJA 3S3TA 1JMVA 1R6XA 4MUHA 1MC1A 4CDMA 1MB2A 1QQTA 3CLTD 2X1LA 4NX2A 3D6VA 4BWVA 3A05A 3TZLA 2RD2A 1OWMA 1OWNA 1J1UA 5HUHA 4MUNA 2HGZA 3H05A 3IMEA 4ZCRA 4OJMX 3IVGA 1R6TA 1EFVB 2JAXA 4ZT4A 4DNXA 3CA8A 4E1AA 2QTMA 1F7UA 5TS2A 1WXIA 4DDMA 2IELA 2A86A 3DLAA 3GMIA 2QUIA 5KWVA 3NV7A 3AKZA 4ZCTA 4U63A 1F9AA 4G5YA 4J75A 3TQIA 1U7XA 3FI0A 1NP7A 1M8PA 3IMCA 4U7JA 4KR6A 3FNRA 1FYDA 2H29A 2AZXA 2CUZA 1JIJA 3ZUGA 1K92A 3L93A 1OD6A 1PFWA 1WOYA 1B6TA 1V47A 1ZUNA 5TEWA 1MJHA 1G8GA 1PFVA 2CYAA 1O94D 4YP6A 4MLPA 1F4LA 1KQPA 3BL5A 2E18A 1KQNA 3DPIA 3QTBA 1TYCA 1TYBE 4MVXA 2YWBA 2EL7A 1O96A 4UZEA 1T6ZA
chains in the Genus database with same CATH superfamily
1PR0A 4AURA 2C61A 4M38A 2GK4A 1LU9A 2QTWB 3H5AA 5FNVF 1M83A 2YZ7A 2ZRPA 3DGEC 2FEOA 3HKEB 3MSXA 4UASA 4KNYA 1N7IA 1T8RA 1XHEA 4H17A 5HF8A 1NVBA 4DJJA 4Q9JA 2JFBA 1NOIA 4QAQA 4C6TB 1KOGA 3T41A 4PLVA 4FSXA 5MFPA 2FUKA 1PT5A 4MQBA 1VJCA 1FTQA 2G5GX 2H1IA 1XOIA 2E0IA 1NJ1A 1OYVA 2YY5A 3EWIA 1R4MB 3QNUA 4UCWA 1FX1A 4DBLC 4NAVA 3PXCX 1R4ZA 4HG2A 4QU8A 3K0EA 2BGRA 4BJ1A 3QEBZ 3DOUA 1Z75A 2DYKA 5IC5A 4BFTA 1HBJA 1PYDA 3UG7A 3HO6A 4QODA 2P6NA 1GY8A 3BGOS 4LHYA 2CT8A 1T3GA 3QIAA 4OXXA 1JILA 3M8KA 4RTMA 3FVTA 4RVFA 4EA9A 3KSMA 4AQ7A 2XTJA 3OIFA 3PNMA 3EXHC 1ETUA 4MGZR 3DOIA 3H2IA 2ZR8A 2CCGA 3D2AA 4YJGB 1W94A 1QYXA 1ZM7A 7MHTA 1O8CA 1H6AA 3MT9A 4MLZA 4HWRA 1ZY2A 4DWJA 5JI2E 3RYIB 4DV6B 3MYYA 3LECA 2X6TA 3AUUA 4BCCA 3UJ3X 3QWBA 3U48A 3QLUC 3KYDA 4QKQA 3EEYA 1RBYA 1BCSA 1UOQA 4X3CA 4QELA 2RI6A 1XLTC 3F49S 1UBEA 3B2EA 3IQWA 2ZRDA 2B20A 4P98A 1EFPB 3SEZA 2WUVA 3T61A 4INJA 4B3RB 4MGIR 2PH1A 1BMFA 1S02A 1SHZA 1AGPA 2DLNA 2PKRA 3G0OA 3O83A 4DUYB 1TUIA 4PC7A 3PF8A 5U4QA 1CX9B 1DAPA 3N5KA 3SIPA 3VHQA 3LY8A 3L7BA 4R2WA 1JAYA 5H9VA 2DUJA 4BN5A 4IDEA 2ZAMA 4H15A 4WZAB 3VO9A 4GZMA 2CHEA 3TMAA 5CCEA 4FFBB 4HNSA 5D00A 2JJ2A 3LX8A 4R1NA 4CL2A 2C4TA 4KBYA 1D2AA 4L95C 3SJZA 3LDHA 1UAYA 1PNOA 2YWCA 4ZO4A 2UV8A 2QHXA 2AOXA 3PCXA 4MA4A 4QPNA 1RIFA 1VZ2A 1HTTA 2HV9A 2PXXA 3BXHA 3JVEA 2Q9CA 4D3XA 3LPNA 2JI6A 1LY1A 4YK7A 5HF9A 3TLGB 1RXYA 4FHFA 3UICA 5HIKA 4FLEA 4HGOA 3ELBA 4JJ7A 1D03A 1RM3A 1OZAA 5EWJA 3T12A 4I6GA 2O4UX 2WNSA 2EBWA 3KOMA 1RRVA 4NYJQ 5IJAA 3ZY6A 3DH0A 3LHDA 1LI5A 4EABA 1XZPA 3TQRA 1RJEA 1Z6YA 3LX4A 2A88A 2HU5A 1SIWA 1IC6A 3GX1A 3P5SA 3A2KA 1GFZA 4L6CA 3AYXB 3SOZA 2AN1A 1JGTA 1MJGA 3RUDA 1U7ZA 1HL7A 4RZ2A 2HUPA 3BGIA 3HWRA 1C9EA 4NQRA 1J97A 3DXFA 1OKKA 1Q83A 3WNQA 5C18A 2XWQA 1U5CA 3ZHSA 1XB2A 3AJ9A 4QWWA 1WNFA 2CHUA 1AKUA 1Z82A 3TW8B 3ECSA 1GP2A 16PKA 4L9AA 3T4XA 5HMLA 1Y7IA 5E7IA 1T2VA 2VRCA 1WD5A 3MWFA 4M53A 3U7QA 3TVTA 3B2QA 4RY9A 1CNEA 5B1DA 1OX6A 1HT2E 1U8XX 4GI7A 4O4JB 1MQSA 1V71A 2RGDA 1XZJA 3B1ZA 3N07A 3UMGA 3FVWA 4C88A 2GAJA 4A03A 2XIQA 4DY6A 1ZD5A 1PHRA 4MI1A 2DSTA 5JI3E 1EE1A 4Z86A 4A0RA 2C9YA 1X15A 2OQVA 3A9VA 2O2ZA 3EJ6A 3IBFA 1WU7A 3SOPA 3VH1A 3IOCA 3EXEA 5C81A 1BXGB 4QXOA 5IKEA 4PC1A 3B13B 4AUKA 5AOCA 2I3AA 1Z4MA 2MYPA 2V7GA 4QX6A 5LBIA 5TIIA 5U9CA 4L4UA 2AI2A 4UBLA 2P4HX 3V42A 3HB4X 1RYEA 1YC5A 3HB7A 3LUGA 1E2QA 1E1RA 1P3Y1 1Y34E 3O9VA 3R5FA 2ET6A 4MKFA 5FBLB 2IZZA 2I1QA 5ARBA 3JVDA 5JH7F 4J16C 4IQ4A 3WLNA 1E2PA 1AM4D 1IFXA 1NLFA 1RAAA 1BGWA 1IM8A 3MQ2A 2D5BA 3N2NA 4Z0NA 5IT5A 4Z51A 1RXVA 2QA5A 1K8XB 4Z2AA 2QN8A 3ZR4B 4IGFA 4YIHA 4C7KA 1NNI1 4IHQA 1B41A 1JVNA 4L2IA 1Q20A 5ITZA 3QVLA 4Q1EA 3VUFA 2WHEA 2G25A 3UB3A 1Z0AA 3UJ9A 5GM2A 4YO8A 4ER7A 3U4QA 1R9JA 3AEUA 2YWXA 4A1FA 4J91A 3FBGA 5I4KA 4K03A 1R2QA 3AP2A 4LFCB 3RUAA 4M21A 4W5RA 3EYAA 4KYVA 4M37A 2RAUA 4EITA 3EIUA 4R4JA 2QORA 4IHJB 4M86A 2KJQA 4FZJA 2BLLA 2RGXA 2YWGA 4RA9B 2FG6C 3G79A 3OF5A 2AR0A 4I1SA 5JPDA 2PGAA 3U61B 3LRTA 4HDMB 1ICIA 3DT6A 1N3IA 1UPBA 2B3TA 3AUYA 5HGXA 1VI5A 2R86A 3EIWA 3IVMA 3QUBA 3VI4B 4DQ0A 2PWZA 4C0KA 4LZWA 1CHNA 4G4SP 4F9TA 2GF0A 3GAFA 5DCWA 2ABWA 2X2OA 4TWRA 3V32A 5DTRA 5KJFA 3VPCA 2AXEA 4X63A 2J3KA 4RVNA 5JOQA 2VAPA 4BU0A 1NXQA 1SXJA 5HFAA 4C2BA 2E5FA 2ZOSA 1HORA 1US8B 4NYIQ 4BATA 4W9RA 2A0FA 4FFDA 3V1UA 4DUGA 3RLFA 4BMZA 2CDBA 2R97A 1AGXA 3ABRB 3KDSE 3GR6A 4LQLA 3N1UA 1EK5A 4QZVA 1T1RA 3D0OA 1H8ED 4M9ZA 4TLMB 3TI7A 3V4SA 3HCPA 5CB4B 5KJ1A 1NJ6A 2HA4A 1UKBA 2I6QA 4I9HA 1R6BX 5LFAA 4D9FA 1WE2A 3CGWA 3VDXA 4DWVA 1AO3A 1XZHA 4G8CA 2V98A 1NNEA 5DHSA 1XJ0A 3KYJB 1QVVA 1E1CB 3RSGA 1JAHA 2ZPUA 4YUWA 1YIDA 2Z58A 5CBPB 1OFHA 3CLRD 4HXFB 2PD6A 3DTVB 1PLKA 2JHAA 1LVHA 4ZZ2A 2WWRA 5KCMA 4C21A 2GPWA 2GZHA 1WTCA 3DTVD 4I5EA 5ECYA 1XYVA 4TTPA 5JS6A 3KKOA 2CWDA 4DR3B 2QUKA 2H2AA 1KFJB 1P7VA 5JH7A 1KIAA 2X3FA 1Z3CA 1EXMA 5FYQA 2ZREA 3I04M 1UDAA 4P38A 3Q4GA 3FFTA 3G59A 3IAM1 1WBJB 1KSGA 4UQPA 4YRGA 3QKUA 4TT3A 3ER9A 1GGHA 3MTEA 4HNGA 1SXJE 1ONNA 1V5IA 2WOOA 4CG1A 1Z88A 5B7QA 1C3VA 1CJSA 1ESMA 2A7XA 1SB8A 2VHJA 2WZCA 2BUCA 2ZFUA 3UJDA 1H1TA 2VCEA 1PS8A 1T4CA 2MSNA 1Z34A 3V33A 3DM5A 3RFTA 1W4LA 1CEYA 4BN4A 2K5UA 3O4JA 3JRWA 3L0DA 3O90A 3R3YA 3RRJA 2DHQA 5K4AA 1G60A 2V3VA 3TCNA 4E13A 3U3KA 5B57C 3IQHX 1HG1A 4B6GA 1O58A 2G9RA 5CA1B 4HPWA 2VAXA 3U37A 3ZK8A 3KZOA 1RHRA 1U1FA 3H0EA 3JRXA 4CI9A 5TMDA 1IU9A 4C03A 1SXPA 1V7ZA 3FOEC 1HX7A 4OMFG 2WFLA 3GNQA 3MTGA 4Y30A 3ZU4A 4PNEA 1GGFA 1EGAA 1GU0A 1F12A 2VDWA 1SOAA 3A1SA 3SPXA 3TEFA 4DABA 3LBIA 4F5ZA 2A58A 4LI3X 3IDAA 1YJQA 3BRSA 1ZNQO 2J3QA 5I9TA 4YJFB 5AJVB 3VMFA 1E3WB 3WXMA 4FFMA 4D4JA 2Z1DA 3KJXA 3U3RA 2QOEA 3LXMA 1B8NA 4WJKB 3NVKI 2HZ7A 3MJTA 2ZATA 1R10A 1KRHA 3CUEF 1DKRA 2DBZA 2ZI5A 1FQWA 5GP1A 1Y1TA 2NUAA 3O3NB 4Z3KA 4MRMA 4XDZA 2AOVA 3OKAA 4QC2A 1S5PA 2VBGA 4RSMA 1W44A 2EU8A 1P1FA 1MGOA 2NVBA 5DMHA 3I61A 3MFQA 4MS1A 4RNDB 2KBEA 1HH4A 4GHWA 4KRYA 3E27A 4XWGA 4A6XA 3RK0A 3WE7A 4D9JA 4ACAA 4FCTA 4HEJA 4QGGA 2C7QA 5DBHX 4TMKA 5DBOA 3DMDA 3ZLTA 5HQJA 1P0IA 1YB1A 1DC5A 2J5XA 4MROA 3QM1A 1R0KA 4RQTA 5EZYA 1HDRA 2UVQA 3NJRA 5JALA 2XZLA 3DMGA 3BA1A 3H1GA 3VSDA 3CVVA 1EDDA 2V6FA 1SBTA 1FW8A 2DTXA 2AGVA 1DU4A 1CUIA 1JU4A 2BWJA 2J9FB 2GA9A 2VAMA 2ZYRA 4RIFA 1VQ1A 2AHRA 2PT9A 2ZIFA 4U3JA 4YASA 4YI3A 4DMUB 5IM4A 2PE5A 3ESQA 2QE6A 2YMQA 4KGDA 2UUCB 4ABYA 3KJIA 3HBMA 2OSVA 3NUZA 4IFEA 4I36A 1OI3A 3T5PA 4DT1B 3KLBA 2O2GA 3JTEA 2GJ4A 5LXTB 5L3VA 4J4HA 3COZA 1G3QA 1L5OA 1YS1X 5KSOA 3B1VA 4CM7A 2OXTA 4Q4AB 1NI4A 1V3TA 2B4QA 2VJKA 4F6RB 1I80A 2FPIA 3X1DA 1EXVA 1QIFA 3OKCA 4GH5A 2AJ8A 1QLWA 2VYND 1UM9B 2ZXEA 3F7MA 3DE2X 2R5WA 2H51A 3P2MA 1FVFA 4C4OA 5B5SA 1A77A 5KJ6A 3WNBA 5JPCA 4MUJA 2EF1A 3DHVA 3ILHA 4IUYA 2YUTA 3LP5A 4X7RA 1AT1A 1U9JA 3QVWA 3T38A 4MYTA 5FDFA 1KQFA 2HJGA 4BFUA 4ZVKA 2JZCA 1FSSA 1S9HA 3BB3A 1Q95A 2E4UA 2GBLA 1PLLA 4F7WA 1MQ9A 2AV6A 3ZDFA 3M4YA 3MS4A 4BFXA 1SG0A 3JY6A 5IHPA 3DHYA 2GD6A 2YJTD 4UHFA 1PAUA 4X00A 3SDBA 4WUVA 4MGYR 5I9LA 1Y4UA 3W2IA 1YR2A 4QEZA 1OLXB 1B2RA 2WWGA 4MMZB 4Z2YA 3DCYA 4UNQA 4WH0A 4S3MA 5LYYA 1P4HA 2GPJA 1H4QA 1QV9A 2P9QA 3GGCA 2OCXA 5C3UA 2FEPA 8GPBA 2VXBA 1TMOA 3DMFA 5FV4A 3DXYA 2CLIB 1GT6A 1XTRA 3VGPA 3IQXA 1C9JA 5LYJB 1HOTA 2ZIXA 4J76A 1XWIA 1IY2A 3K92A 3I0NA 4EA7A 3IEIA 1GNSA 1ML3A 4E3ZA 2YXNA 2PBFA 3UH0A 4CE6A 4G0WA 3HKBB 1U8FO 5DGDA 4EOGA 4WV3A 2J3LA 2UVPA 1GEGA 1Q0LA 4NFLA 3PFBA 4MUHA 1LK7A 5BVGA 2QR2A 1X7GA 4Q3AA 3RWOA 3T9AA 1ZO8A 2J33A 1KYTA 3CKLA 3NXSA 2X0EA 2IVFA 4IGEA 3GJXC 3P9ZA 2C31A 3B1YA 4URHA 1QFMA 5HBGA 1H2XA 4PANA 3W8EA 1RVDA 3JR3A 1EAMA 3VUEA 4QAJA 3V8PA 4IXNA 1YR8A 1OZGA 2PVPA 1M2VA 2XMCA 1EFVB 1GTMA 3GVIA 1TCVA 3E3LA 3H84A 3NEAA 4M9XA 4FI3F 4ZDKA 5BV8A 1CF4A 1HRDA 5DHAA 5TS2A 1I24A 1BE8A 2G6TA 5JD3A 3FCXA 4Y8VA 4QG3A 1PJTA 1TB4A 1UADA 1G20B 2OV2A 4RM3A 5T5QA 1W6UA 4CF4A 1DC3A 3HJUA 5GJWC 3JATA 3LOPA 2OD2A 5B53A 3UUWA 2ZZNA 3B1FA 4TXJA 1UOEA 4IFTA 3RYTC 1AXRA 1F9AA 2H17A 5A4JA 4BO3A 4KXXA 1FRQA 3OM0A 4KXNA 3LDFA 3UAVA 4LDZA 3V1NA 3W9BA 5CCBA 1F14A 4YY3B 1L7PA 3EOAI 5LQMA 1P61B 4HLQB 4C3UA 3IMCA 3CONA 3FHLA 2F4NA 3G2HA 4MYRA 1SRRA 2PX0A 2VT7A 1SXJC 2CUZA 1AKVA 2R6GA 3D4OA 5DH9A 5A62A 4P6VF 1CUZA 2WJPA 1GZ3A 3DJYA 3N2IA 5DYNA 1UZLA 2AMFA 2VSYA 4DW8A 3TNYA 2OHVA 1G7RA 4OP1A 1LTKA 5CXXA 1DTWB 3WL3A 4AN4A 3I2YX 4BB6A 2BMJA 4D4GA 4C29A 1FCJA 1FP6A 1OYYA 1VLQA 2WT9A 3DBOB 4KSYA 2I22A 4RD1A 2WPNA 3O0TA 2W6JD 1Z4OA 1WETA 1HFJA 2K7FA 1R8SA 2Z57A 2ZBVA 1VL8A 3PYXA 3QTBA 1VP3A 4BPRA 1G4UR 3D2LA 3WIEA 3ZHQA 2YWBA 2Z56A 4YJ2F 3KB8A 3WWYA 1CT9A 3GYBA 3WLRA 3S55A 3GCXA 4YMIA 1KJJA 2F1KA 2P4SA 2PNFA 2BZGA 3BC1A 3DT9A 1FYVA 5MN5A 3W5UA 3AKEA 2AYYA 3U44B 1H2HA 2A5YB 3F4LA 2EP5A 4N8EA 5CVJA 3BA6A 5TSDA 4LISA 1RT9A 3TUJC 1E77A 4F72A 3UQZA 1YULA 1SURA 2GFHA 3GLVA 4IDAA 4LJAA 4B7CA 4WWHA 2BGMA 2XRMA 2BEJA 3F5MA 2ORWA 3LPMA 1AURA 5CW1A 3RWMB 1RFGE 1RLUA 3T1HB 1NVTA 3AERA 3LGXA 1EM8B 3E2PA 4BP3A 4IY1A 1L8OA 5FCDA 3GJ0A 2YCBA 3BXPA 5CVTA 2XY4A 2R6AA 2DWUA 2C20A 2OBFA 2PRSA 1KAEA 1G3RA 2WJ4A 3I58A 3PC8A 3IALA 1NVVR 2GTHA 4MAMA 2A8YA 3GJ6A 4MRVA 2B7CA 3AI2A 3OEHD 2FQWA 1FZTA 2PAFA 4YT2A 3TTUA 4CR7A 1L7AA 1W5TA 5L6LB 3GLFA 4LDRA 4ZJYA 1A0OA 4KHZA 3BFJA 3H2SA 1UL1X 4ZVMA 3E05A 1UWKA 1YI8A 3TLEA 1NBMD 2OUIA 1RXCA 2CLSA 1XSEA 2VEDA 1L5HB 3L8FA 5IBRA 3H75A 1IULA 1XI2A 2Y4OA 2ZVDA 1JP7A 2SKCA 1IY1A 1MBZA 2HF9A 2IP4A 1GQOA 4KZPA 3AL0C 1CZOA 1E2LA 2CMHA 3ZN2A 3ZJUA 4LJ9A 4LCEA 1YT5A 3O4RA 1ZC3A 2O8CA 1W96A 4AWXA 1UBMS 1FY2A 4KXQA 4U6QA 1XN1A 3A36A 4MIOA 1L3IA 1PZFA 2W4IA 5J47A 3R75A 1JYSA 3DFZA 2PZMA 5T57A 3P94A 4QSMA 3ZGNA 2XUGA 1P6QA 1N2SA 1NXTA 4KMRA 4Y9TA 3KOUA 5DLPA 4B80A 3L0SA 2NV2B 3OJWA 2ZS9A 2QL7A 3EF1A 2ONKA 5REQB 2WA1A 1E58A 1KE1A 1V26A 2CF5A 4BNYA 4JJIA 3FW1A 1X19A 1Z0FA 4GXQA 3NHAA 4J94A 4FPXA 4UUNA 4FONA 1U63A 5FUYA 2GR8A 4EHDA 1ODCA 3DD1A 4F92B 2P9CA 3WGIA 1G59A 3L4JA 5B4TA 4OAQA 3ZW9A 4D9NA 5KMGB 4TROA 3C7KA 2XMPA 2L82A 5AP9A 4KUGA 4I50A 5CFOA 4YXFA 1IHXA 1NNUA 4OSEA 3O92A 5ES3A 2WUFA 3R0QA 2E4ZA 1RR6A 3BGDA 3TM5A 4LYEA 5LL6P 1Z5OA 2BBSA 4O2AF 4II3A 3H5IA 2PBRA 5J58A 2CN1A 5CK5A 3V4ZA 3D6UA 2GWRA 2QLLA 2CXXA 2Q5IA 1YGPA 4IM7A 2DKOA 5IAEA 3VJKA 4LJ6A 3WQBA 3C7DB 5AXAA 3R5HA 4YP9A 1DHTA 5JYEA 3NBKA 3CX3A 2CF6A 2YJ6A 2A1UA 1DADA 4ENRA 3B7GA 5F4BA 2FF5A 4DC0A 1JEQB 3A9CA 1VCHA 3BEDA 3RRNA 3NCTA 1KR2A 3RTAA 2G8LA 1OGJA 3AC0A 3BH6A 3GROA 5AK0A 3PSAA 1SKYB 4XLZA 3TNDA 1E1QD 2CBZA 3IURA 4QPPA 3SBDA 3UGQA 1QUEA 1XKTA 1IRIA 1WABA 2OAGA 3HZOA 2PKXA 3M9WA 4PC2A 4WKGA 4H0CA 1O5IA 5KYKA 4OHWA 4DANA 2X5OA 2IHVA 3E8MA 3PPXA 1KZ1A 4RFSB 5KOJA 4BLVA 4TXNA 3T54A 5B1IA 2H2FA 2B5WA 3STXA 4P3NA 1WDMA 2OWEA 4IIVA 2IYLD 1BD4A 3S68A 1QIDA 2C4VA 4H7KA 4BNDA 1CC1S 2LR0A 4KQWA 1L5VA 1XZDA 1MT3A 2EQAA 4PCVA 1S01A 4PRYA 3SF0A 3VQTA 4PG7A 1TLFA 4ZO6A 3UZUA 3P4UA 1ZAYA 2XNDA 4H0NA 1NLUA 3D4NA 3FNHA 3N2EA 2CW5A 4OLFA 3VR6D 4BU1A 4M0CA 2V0GA 4CLRA 3F6SA 5FR1A 5BORA 3F6BX 1JEAA 5K4HA 5DGXA 3E9MA 3CF6R 3DFIA 1Q15A 3QUAA 3QHQA 4ILKA 2R8EA 3RE1A 1GGJA 3VC1A 5FEUA 2MR5A 2GBLC 4LHVA 3THOA 3OJCA 3PHBE 3KSUA 1CUYA 2BE7A 5HFJA 4A15A 3C6MA 4YCLA 5DIFA 3E6AA 3I9MA 5IUKC 5G2FA 5DNVA 4Q3OA 4WZ6A 3W90A 2ZI9A 5IN4A 2GXAA 2Y8EA 3OPMA 5FNVA 1NJSA 2Y93A 2OENG 4MARA 4KSCA 4FFRA 4ZTBA 2VK8A 1QE3A 5ILQA 2HYDA 2X19A 1YVEI 2FEXA 2PD3A 3LPAA 3ND8A 1VL1A 1PS9A 1A50B 2HU8A 1POWA 2IPXA 2ZIWB 3F2VA 5DW0A 3F5FA 2DQ4A 1OF1A 3AEXA 4Y0VA 3KSZO 2NVOA 1O54A 1PL6A 2C5GA 1W25A 4KQGA 1NBOA 5FTMA 3UO8B 5L40A 4WDRA 4AS2A 2FWAA 1H4TA 5AI8A 1MLDA 3HUDA 3F5SA 2JFFA 4MPJA 5EHQA 5A71A 3ULKA 4HMOA 1BH6A 4X6UA 1BX3A 4F2PA 3EDOA 3A32A 4GECA 4MEAA 3ZXIA 4WA8A 1M9NA 2IU6A 4N39A 4IX1A 1WZNA 3AUSA 3KXIA 2PSEA 4GGMX 4IX9A 1ZSYA 5ALYA 3MJ4A 3SE0A 4FGJA 4JI0B 3F7NA 4R5MA 3W2FA 2UZ4A 3NHUA 2H2DA 1JAXA 4M1TA 3DEAA 4MRNA 4L3OA 5JRJA 1I7QB 4JIMA 3EBPA 1DEXA 3ORFA 1UK9A 2RMKA 4ERNA 5FBVB 3FOCA 4QHSA 4PRKA 4P5PA 2FPMA 1CETA 4ZIRB 3PL1A 5FWYB 3WB1A 2IKQA 1Y7TA 1TRHA 1Y7HA 1XZNA 4CIXA 5LD2C 3MK31 1DDIA 2VXOA 1JLKA 3KTDA 4RK7A 3U7JA 4YT5A 3T3HA 1QTIA 3K0CA 3QBJA 1JMKC 3BWYA 5K3FA 3VKUA 5IWAB 4QU5A 2J4DA 2H8KA 1CQJA 4JB0A 2REQB 1L6IA 2YCLA 5LQDA 2QZSA 1G9TA 3ENQA 1MB3A 4Y2GA 1L5NA 3BXXA 2C58A 1HEYA 3QFFA 5DIZA 4L57A 4KAJA 4HNAA 1MB4A 1J8VA 2IOFA 2HBRA 3PFIA 2Q4DA 3D81A 3EK2A 4JAVC 4P58A 2QL5A 4QUIA 3DHNA 3K16A 4EAQA 4F1WA 1L4MA 3RQSA 4RYLA 3S4YA 3ZI0A 1JYFA 3GQVA 2PSSA 2YVUA 1EZZA 4IZOA 2W6ID 4JMPA 3RRYA 1N77A 3OU2A 2HCJB 2VJOA 1E3LA 4MJ3A 5FXMA 3UMSA 4N8SA 3RYCB 1VKJA 1QPZA 2Y0DA 4LGCA 1PR9A 3G02A 5PNTA 1M6HA 1XFAA 2J07A 1L7XA 3SX2A 3WWEA 3NOQA 4XASA 3HJNA 3RS8A 1Z62A 1ZSNA 3BJIC 1BRMA 3LPLA 4MKZA 3RAGA 3P20A 3N0WA 2HJSA 1AUPA 5TVKA 1OLUB 5GAJA 2FZCA 3UCEA 2ZYGA 2VRBA 3X2EA 1UBUS 3K30A 1G8PA 1HZJA 2P0EA 1P9RA 4K8RB 5T6BA 1HE8B 2ECPA 4GOOD 5JG7A 1QKIA 1KBOA 4S2EA 2P4EA 5KOYA 4TYNA 4MW5A 5A06A 1XMJA 3MRVA 1WSWA 1D0SA 4TLDA 4EG0A 1Z7GA 2OFOA 4MPPA 1UMCA 2WTMA 1GCUA 1CUHA 4B8YA 1NATA 3MWKA 2YL2A 3LY9A 4LGYA 3Q40A 3X1ZA 2G0AA 1XZKA 2O1EA 3JZAA 3QQ5A 4XAQA 2JGNA 2R1TA 3WJAA 5CA0F 5MF6A 1QB7A 5JQGF 5HKOA 2R6R1 3EG9A 3PGJA 5KYTA 2QKYA 3UCXA 4C04A 5BR4A 1RJDA 1FP7A 1JIUA 3G88A 5G1PA 5KYWA 2RHRA 2O7RA 5A0VA 3OQJA 2H2IA 1S8FA 2XRYA 1R6AA 2ZSUA 3KKQA 3RROA 2W11A 3THYA 2G9ZA 4MW9A 2HK6A 5CMLA 3MTIA 1ZJ4A 5DWVA 1GKLA 5B58T 3LC2O 1JPVA 1LF0A 4MWTA 4DRZA 2PX8A 1D2MA 1F2VA 2DVMA 4YDSA 3MB8A 1JU3A 4YNBA 1SH7A 4H60A 3ZY4A 2H11A 4YLEA 4EB6B 1YFJA 2QJRA 3W9UA 1I0IA 3TAHA 4Z49A 1N4AA 4F2GA 1FFEA 3ESYA 3OEED 1T6XA 3ZU5A 3OCYA 2VNJA 2DUUA 1KH1A 1PR3A 4XR9A 1F4PA 1DG1G 3RSHA 3FHCB 1IN5A 4U2CA 4RUKA 2NUBA 1E1LA 5LP6F 1RWOA 4RK0A 4EHJA 3RIMA 1U3TA 2VYFA 2PH7A 5JCJD 3R0XA 4M99A 4FMCF 1AO0A 2A59A 3AWIA 5EPOA 4G5RA 2FN9A 4MV5A 1GPH1 4KEAA 3WIDA 4EZEA 1MTOA 4CKBB 4ENVA 3Q8KA 4P9NA 1E9BA 3M0EA 5D86A 1B1CA 3BORA 4RVGA 4EG5A 2C98A 3BDVA 2ZKLA 2FE1A 4MUEA 3URMA 2BFOA 1U8CB 2ARKA 2BELA 2IXTA 2WF7A 3BK1A 4NEQA 4NY1A 4QJ5A 4PN7A 5A7FA 3UK0A 4BVBA 1ZVJA 2BEUA 5EP2A 1MTZA 1MXHA 1H9BA 3T7IA 3L0BA 4P33A 1OXBB 1SKMA 1RKQA 4Q7JB 2UYOA 2O2JA 1PGNA 3DDNA 5P8WA 5JD6A 4BNMA 4XWOA 5KUTA 2DC1A 2G3DA 2G76A 2JLAA 1CR1A 3QP9A 4FGKA 3DONA 1A2OA 4JBIA 4HN4B 4TZTA 3EXFA 3KLNA 4XRRA 5K20A 1JJIA 3PUXA 3N0RA 4JS0A 2NNWB 3Q3CA 1Z4LA 4YUAA 3HBJA 2JLBA 3LWZA 1EDEA 1Z7YA 1WPXA 4V0RA 4FQ5A 2VFAA 3WHPA 1QDLB 1JLRA 5IKOA 3ZWKA 4LKRA 4MW2A 2JCXA 4IIFA 4FFNA 1ADFA 3H42B 1YRWA 1P75A 3CW9A 3O74A 5EMNA 5J59A 2BR4A 2JFYA 5BUQA 3Q3JB 4LY0A 3KM0A 4XB1A 2ORVA 3SE7A 3DL7A 1RQLA 4QBFA 2C3PA 1CR0A 2FETA 3GN1A 3MAGA 2JIQA 4FKBA 3NBAA 2BM9A 2HIMA 5T4BA 4H6WA 1BHJA 5EQJB 4F04A 2Q3EA 1DMSA 1EHYA 1QO7A 3JRNA 1Y9EA 1EWRA 4X92A 3A4LA 4RD3A 4R2MA 1P3DA 1XJWA 4HDNA 1JWBB 1C9DB 3N8IA 3W8NA 5EE5B 3QZUA 3HKDB 1FC0A 2BONA 4AO7A 4ZVTA 4C4SA 1ZK4A 3O73A 1W49A 2SBTA 4GC5A 1EJ2A 1FX0A 4YC7A 3K2IA 2FR0A 5SY9A 4BMNA 4EG6A 1W2HA 3R40A 5A5EA 5EKTA 4KQIA 2A0XA 4XWYA 4MGHA 4HAWA 4NL4H 1QV6A 1BJRE 3I9LA 4L5CA 2EYUA 3PWKA 3KJEA 2F2TA 3M83A 3ZOKA 5B58C 2WJJA 3DFUA 4Y0AA 3G2LA 4KUHA 4LBVA 5C5CA 4QLBA 2OPBA 3MA0A 3MJVA 1NJ8A 2D1RA 3DMYA 2P75A 1THTA 3KEMA 3HTXA 4Q6WA 1G16A 1BCSB 2OP0A 1KY3A 3L8GA 4Y6SA 2X5KO 2Q9UA 4X8LA 3ETGA 3L7MA 5LZ8A 4UM9B 1N3YA 4QPCA 2O3UA 4UM9D 2BGWA 4B73A 3I2HA 3Q0EA 1Y89A 3PGMA 3U4AA 4DRXA 4D3DA 3AOGA 1J1UA 3UIEA 4Z4HA 2BSXA 3NWJA 5BOSB 5C46F 1ZVVA 1BMFD 5LMUB 1DO2A 3AW8A 3RIHA 1HNNA 4B2LA 2H1SA 1NKVA 4Q3DA 3OA0A 4BTVA 4DDMA 2A0UA 1RC8A 3B3AA 1T4MA 3K1JA 1MN6A 2ZQZA 5BSMA 3UJNA 1H8HD 1SM4A 2WAXA 2Z04A 1HE5A 3E48A 5BN4A 4A8PA 2M6RA 2W8ZA 1QYRA 2W42A 3IKMB 3A9UA 1V5EA 1Y4AE 4U7FA 3MWYW 4M6WB 4PM4A 2PUFA 1U7XA 4BKRA 1ZCFA 5FFMA 2QLJA 4JC4A 2FZKA 1UZAA 2IYSA 1V3QE 1ODSA 3W4KA 2CLHB 1KJ8A 5DGTA 5C34B 2NO7A 5BN5A 1FYDA 1SC9A 2W2LD 1ZLXA 5FJJA 3S81A 2CL5A 4BVLA 1AA9A 2PMWB 5LKRA 1PFWA 5G53C 1F48A 1REQB 3KS9A 4GE0A 1USWA 2Y4NA 2XODA 3IQEA 3Q11A 2NU7A 1JHQA 2XYPA 3B1WA 4ZYTA 1KL7A 4ZO7A 2ORIA 3P9PA 1Q1GA 4YP6A 1D6MA 2R6CA 4JR2A 3T7SA 4CCAA 1NAIA 4JUFA 4P54A 3CISA 3TL3A 2AMLA 4F11A 2ODWA 3G17A 4CMAA 4B3FX 4ZCSA 4EGCB 2IZ6A 1IIRA 4WOJA 4M1OA 2CFIA 1LBHA 2BL4A 5I4BA 3UJ8A 5FUMA 1HFEL 1C50A 3EEIA 3KYBA 1Z4IA 4Z4EA 2ZBPA 4BEVA 3V3TA 4Z7NB 2OV3A 1NP6A 2CHGA 4L7VA 3OSUA 2H59A 4BPBA 5KBYA 3ZV3A 4DLSA 4NZYA 3V4VB 2CYBA 4U7PB 1KMCA 1U9IA 2Q4BA 4PLHA 2PG3A 1VZ3A 2VRCD 1ZL2A 1C9KA 3AY6A 2IZOA 2SHKA 4XPZA 5BSHA 1PJCA 3S2IA 3HP4A 2QAGC 4BX9A 3QBTA 3L6DA 1SIUA 2PBZA 2ZUUA 1SVUA 1FLVA 3Q0TA 2W90A 3B3FA 1E96A 3QFTA 5DRYA 2AQIA 2HPAA 1YF3A 1ZJYA 1J1ZA 2AH5A 4S1WA 3UKOA 4DA6A 2NQTA 4ZQHA 1AK1A 1NFFA 1NC3A 1PUIA 4PZYA 3ZXYA 4E7PA 1OTXA 3AESA 1LFAA 1X86B 1GPAA 3AUAA 2C96A 1WEHA 1BVYF 3WWCA 1I32A 5KU7A 3TTYA 3U7HB 2NUPA 5IAGA 5TNXA 4BFLA 4KVZA 4Q12A 2QRLA 1U2PA 1QTNA 1W46A 2QVYX 3ZX5A 5JISA 1FP2A 2HWXA 1ZCZA 2WRZA 3ZHYA 1YJ5A 1KAGA 1G63A 1NASA 4E3WA 5B3KA 3K5IA 3OPQA 2YINC 2Z08A 2NPIA 4CM8B 1M72A 1VL5A 1ZEJA 3M5PA 5K0LA 5HXAA 4L0DA 1RKBA 3CINA 3H9JA 1O0CA 4Y7DA 5FA8A 4PNPA 4IGKA 1GR1A 1CD5A 1CQWA 3AEUB 4LWPA 2O20A 1VYHA 1MEJA 4BO5A 1YRQA 3RRFA 1TJ4A 2JCBA 1VLLA 4AL4A 2H9AA 2EKZA 3ICVA 4LQCA 2VPTA 3CFIA 3BSSA 4EMTA 2FSIA 1JHMA 3OHSX 1QHEA 3RC7A 4GZ5A 2D5AA 4IFIA 2IS4A 5IJ9A 3QX7A 4L1KA 3WMGA 3BD8A 1J2YA 1OLSA 3GFTA 3HJRA 4JZKA 1WUJS 1KVRA 2VSFA 4M1KA 4DSOA 2YIDA 2XUHA 1OFIA 2WB4A 4RJ2A 2CK3A 4A26A 3OZXA 3RVPA 3QX8A 3EZ9A 3JR7A 2ZANA 5BV1A 3L07A 2P40A 1S2GA 5EE3A 3PBKA 2ZGVA 4PICA 3DV2A 3LUKA 4Y7CA 3H11B 5KVQA 2BAGA 3UHJA 1PJAA 3B9QA 1C0PA 2JFWA 3BTUA 2VDNB 2HRQA 2WUEA 3HVKA 4PYOA 4I55B 5J2TF 4EENA 2FCRA 3A3OA 3EJWA 1ITZA 1AF4A 3M70A 2GZMA 1EJ0A 5M7EA 2VLIA 2ECKA 2DPHA 3BXZA 4ETIA 2G1KA 1C4OA 4IMIB 3ITNA 1UKVY 4L5BA 4YVFA 3H97A 3KTOA 5TV2A 3B8HA 4FDVA 1YCGA 2DTDA 3ZBUA 4BWGA 4RKYA 3PE3A 4OL0A 5F35A 3QWAA 1SG9A 2WU4A 1H2RS 1J8QA 1XEWY 3GLHB 3LQYA 2WD8A 2WD7B 2NZXA 2DLDA 2QJWA 2QTCA 5FOQA 1CP3A 2HK9A 2JZOA 1A9XB 1K7EB 2EJVA 4Y3UA 4WK0B 2AEEA 2PKCA 1ZR2A 1OH8A 1EVLA 1U7TA 5IK2D 1VIMA 3A4TA 4JD5A 4WKCA 2WMNB 4QNRA 1ZM2A 2V65A 3FTNA 3H1TA 5CLQA 2Y6VA 3EF0A 3IAUA 1UC9A 4Q9HA 3TZQA 1FDRA 1CVRA 1HK7A 2IYQA 4A8JC 4AMGA 4LV8B 4K9RA 3H8JA 2CXRA 3RRMA 1CS4C 2FPKA 1NONA 4TT3D 4MA5A 1MOSA 1KKLA 3ZWWA 1W6RA 1NPTO 1XZGA 1Z6ZA 1LPOA 2EC5A 2X5JO 2VI5A 2QRNA 1VHWA 2XCQA 3A04A 1T4CB 2OV6A 3NDJA 2FN4A 3F7OA 1RLJA 3V46A 3W79A 3UWMA 3QELB 4QDOA 5CUQA 1B2LA 4MUMA 1ISGA 4FGSA 4JIGA 5C53B 1VFPA 2IHNA 1AZLA 2GCOA 4HGYA 3TGPA 4YJ2A 2WU8A 4JA0A 5C52B 4MO9A 3ZQKA 4DR1B 5J1TB 3UOWA 1NBHA 4ZA2A 4DLRA 2QD2A 2WYIA 4UHDA 3MJSA 4I81A 4PONA 1XRLA 3NBYC 4JYCA 2DB3A 4D92A 5ARDA 3ILSA 3R3SA 3PQFA 1EVQA 2P69A 2WFLB 1XZFA 1SC6A 2ZJFA 2ZRKA 2OE2A 2QRMA 1JFSA 3C4VA 6REQB 3QXJA 5K1ZA 1CF2O 1K2VN 3A4NA 4W9NA 3CVWA 3CVUA 3ND9A 1X2EA 1PGQA 5SY6A 5AW1A 1AS2A 4QBTA 4JLSA 4HVCA 3CB2A 4KYUA 2DFDA 1TF7A 2EGGA 3CZCA 1RXEA 2P78A 4MS3A 2IYEA 2O3SA 2Y1KA 4QBGB 1CFJA 1OE0A 4MV6A 2O3QA 4ND6A 1P31A 3G9XA 5AKKA 4HNTA 4PAQA 3IELA 3G7NA 3AUFA 4CM3A 3DBHA 5FV7A 2CNNA 3U16A 1PTJC 4QA9A 1XVAA 4M8IA 1GTRA 2MHCA 5EGSA 4QT4A 2H16A 4GR5A 2OFWA 5EE1A 2P9BA 3U9LA 4MS1B 2BFAA 3CS3A 2BFCA 3WSWA 3S28A 4TYWA 4GNRA 1YR9A 2FXVA 2WM9B 3TRKA 1UT5A 2C77A 2G77B 4GSLA 3ETLA 1SC3A 3EMOA 1S4QA 2Q0XA 3PLAE 1SOMA 1QANA 3CRRA 5EJ9A 2JRLA 4O1IA 4KW7A 5AVJA 1SKQA 2V4ZA 1T25A 5CH5A 4G9BA 2C3MA 3UWPA 2BHTA 4RPGA 3RJ9A 5D85A 1K7CA 4YX9A 2VA9A 5L6MB 4E4YA 2FWIA 1ORVA 3F97A 4J9UE 3X0DA 1QXSA 3HN2A 3ISVA 5A2QA 2PSDA 3GJ7A 3N2KB 4S24A 1JV2B 2LVBA 1JA9A 5JNSA 1RRMA 1A8SA 2O5VA 3ZDQA 4RTJA 4QSHA 3AK4A 1A4XA 1ECGA 3LO8A 5IVHA 3IPRA 3R09A 3N6RA 3MT8A 1T5LA 4DIOA 2A84A 4RD0A 1NVFA 1CJBA 4EQ6A 2X8JB 1W19A 2X0FA 1Z5GA 1I7LA 1JT2A 2B5VA 1C5KA 3SF8A 5J5VA 1R6UA 3L1KA 2P6RA 3DYBA 2OAP1 3ET4A 3WQQA 2R2GA 1RLMA 4K9SA 4O2AA 2C9DA 5GONB 4UUOA 4R0MA 2YIMA 3F3MA 3UPUA 3IV9A 4EELA 2CNDA 2JKZA 3C6KA 3W77A 2CJWA 5D3MB 1N2CA 2BFEA 1EQUA 3HY4A 4F96A 1E20A 4XYLA 1B14A 3L6CA 3CUVA 3A6KA 4WKPA 2VPPA 3ZCTA 1QR6A 5SYNA 3FHJA 4HC4A 3R44A 2BKLA 3EVNA 4YR9A 3E3OA 1JHOA 2VP9A 5GJCA 4BNVA 2RI1A 5CT6A 3OZCA 1CV2A 1B00A 3SC4A 4HH0A 4N5MA 3HV2A 1NT4A 5CM8B 1T29A 3B20A 3WGUA 5LM3A 5IULC 1OT3A 1PQPA 4Q19A 1DKUA 4U9HS 4TKUB 3VR5H 4R1PA 1IZZA 3GPLA 2GUWA 1E5TA 1LUAA 2QBYA 5C7IO 1T43A 1CR2A 1WB6A 4U39A 2DR2A 1DV1A 4W1RA 3HDQA 3MTJA 5LMCA 1LJLA 1EIZA 3JQQA 3PDHA 4X85A 3KWJA 1JHPA 2AOTA 2FGKA 2JAOA 3GIWA 1RQNA 2YDYA 3G9UA 4YP7A 3CGGA 3I4FA 2JGAA 3T7KA 2UVPB 1TJ3A 3W8DA 4TS1A 4N8DA 5BVGB 1A95A 1HYQA 1IOWA 1P4AA 3HZHA 4RELA 3VKGA 4P93A 2G5ZA 1Z73A 1CNMA 2WM8A 2DHEA 2ZQ5A 3AV0B 3Q85A 5I48A 1CUSA 2HQRA 3T1NA 2GD0A 1N2CE 3AU9A 1ZRNA 4IQ8A 1IMJA 2QY9A 3QJ5A 3CFAL 4KN9S 5HHTA 4EW3A 4AY3A 5AJZA 1Z17A 3PFWO 1UEJA 3PYLA 4O2RA 4Q82A 3E5MA 1DKQA 1ZN2A 4PS1A 3ZKWA 2OLKA 2FQXA 5AJWA 5IZ4A 3AF0A 3K8YA 4EJFA 1JFFA 3V4PB 4UZFA 1D04A 2OM6A 4Q15A 1TF2A 3S7ZA 1PJ2A 2W2TA 4C2UA 4WBSA 5EE0A 3W6PA 3E70C 3OHMA 1DWQA 3P1JA 5LD2B 1H2WA 2EXXA 3DMPA 2ANBA 2QTLA 4X94A 3QBVA 1RYYA 2JK1A 1JEEA 1R00A 5C4IA 2DFTA 2YH2A 1DRWA 3D8TA 5LLTA 1OT5A 4MPTA 2WV9A 4MYSA 3MCWA 1V1MB 1E9RA 2FRDA 4EPTA 3E15A 3W04A 3TDKA 4DEVA 5CYFA 5F73A 4CRWB 4FMDF 3PUYA 2GBFA 3REFA 2QTBA 3W2HA 1QKJA 2LCIA 3DP7A 5FFNA 1KJZA 10MHA 1DJLA 3JQ9C 5D5HA 1L5FA 1ISSA 4WFIA 1IVNA 4NATA 4BV9A 3G0HA 2ZB4A 4YEDA 5JCPA 3T3IA 2EWMA 5K8UA 2NZYA 3H9UA 3K0FB 2C97A 1HLPA 3MF4A 4XQEA 1ZONA 2VH5R 4EY5A 3MGGA 1QIEA 2FSHA 2OGUA 1AB6A 3FYCA 4YFYA 3H0CA 3S99A 5K3AA 2ZTSA 3RVKA 3DZ8A 1F5SA 2V6MA 4IUDS 3N53A 4NJEB 5FPPA 4DF3A 4OFWA 1U90A 4LI0A 2ZB8A 3MCTA 1KVTA 4IG9A 4XQCA 2KM1A 1XL1A 4CIYA 2FSUA 1F9EA 2R8RA 2F6RA 7YASA 2PWPA 1M76A 2A92A 4CU2A 1M75A 1CE8A 3L40A 5GJVC 1B76A 3NTLA 2EKLA 3KV3O 3DE4X 5TR9A 3AERB 3RK1A 1TKBA 1UBCA 1QDEA 4Y2HA 3SXUA 1E9EA 4NYMQ 3C6BA 1DBPA 1TUBA 2EFGA 1V1RB 2G5TA 2HRDA 3DZJA 1XYYA 2D13A 1TK3A 3I0MA 3UMJA 1YJAA 3E0QA 3KZVA 3KYCB 3FCAA 4RDCA 3AVWA 1MFPA 1OBHA 4RPIA 5B12A 3D6FA 3KE9A 2WI8A 4QL3A 4ZQGA 4J03A 5KB3A 4QUGA 2BGTA 1Z2OX 2WHXA 1FUKA 3QF4A 4ZT7A 5F98A 3CEAA 4JEIA 4CEIA 4C0XA 3HC7A 4CEJB 3TX2A 2Y27A 2I8LA 4R1MA 2P4UA 2DQSA 4IDDA 2BEVA 4JLNA 4ALNA 3SDZA 1FBTA 1Z07A 3I9FA 1N36B 2A53A 4HYQA 5JJBA 4Z4CA 1OX4A 3CNBA 1KI8A 1QO0D 5FI5A 2Q0QA 3PDIB 4UNPA 2XJ4A 1NPDA 4NMMA 3SIRA 3NAZA 4W9NC 1F6DA 2PMDA 3RTEA 1S1MA 1EH5A 3TZKA 2OHIA 1E2UA 2JFXA 4OUKX 1TQ4A 2HV8A 5L45A 1H66A 3OT4A 2X3UA 2J3MA 4NEGA 4M1MA 5G2OA 5J9FA 1LDBA 2WM3A 2BM1A 2C5EA 4BLPA 4C4YA 3DWFA 4RO0A 4XWKA 3U26A 2FW7A 1YE8A 3NNSA 5H80A 1KS9A 5CA0A 3DR5A 4K40A 5FOTA 5JQGA 1ZWKA 1ZA1A 4WNIA 2EHJA 2GN9A 3D8RA 3FI0A 4DLLA 3UPDA 4BUJA 4MGEA 4XXHA 7ABPA 4J7XA 1W4ZA 1BA2A 1GUDA 3KZNA 4KQ2A 4LRSB 1OXSC 3R7LA 2IBTA 1EIWA 3D2BA 3SX0A 1H0HA 3TCKA 4ZGWA 1U3WA 2ATCA 1JIJA 1RKXA 3ZC3A 5FL3A 2HTFA 1DXQA 5CTAA 4L08A 1U2EA 4J0QA 2ZUSA 5KQPA 4CKCB 4MVJM 4UTPA 1CRWG 2FPLA 3U4DA 4Z1MD 1DIOB 2M6SA 3GT4A 3OZGA 1RI1A 3WRVA 5IFKA 5K8CA 3OE5A 4G9EA 1MO2A 5T7BA 1NOJA 2HSEA 2X8AA 3V55A 4LVOA 2A4KA 2I67A 2RC5A 2XH8A 4OQNA 1FXUA 1L7BA 1FUYB 3K1TA 1R6VA 4PAWA 2YMLA 2CXQA 2Z43A 3BE5A 4DCCA 4DGQA 3DBRB 1SOWA 1O96A 3NWBA 2WHYA 2XUQA 1GWNA 4EWLA 3BF8A 1XZBA 4OMCA 3RT1A 3Q88A 4YJHB 4BCDA 2AL7A 2DPXA 4JLKA 3B6KA 1BNCA 2BSQA 4XVCA 1NJGA 4G56A 4GP9A 4RLFA 3V6LA 4J0FA 1XKLA 3QV2A 4MRRA 2O7VA 2JJMA 3CKMA 2VP2A 4N0DA 3RW9A 5J2UF 5I7OA 5BR8B 1PJRA 3GDWA 2D4AA 4DIUA 2W6MA 2IZ5A 4Y2PA 4LRXA 2ZBEA 1W52X 3LUDA 3ONVA 2B9EA 2H0AA 2W9XA 3JSAA 5M2QA 1KS2A 3NORA 3Q2IA 4AU1A 3O8OB 2Y05A 1EBFA 3GRYA 4K2HA 4NIMA 1DKOA 1YACA 3IOBA 3MIZA 1XTQA 4UUBA 1ESEA 3HGQA 3R24A 2O0KA 2Z83A 4NSNA 1RM0A 1YS9A 3PDJA 2R4TA 1E6EA 3DOJA 4NZNA 3TBKA 6ABPA 1FRZA 4A4DA 1QZUA 5KPDA 3JZDA 3ORHA 3AHCA 3C3PA 2DPMA 3CRZA 3F6PA 1BG6A 4HH3C 4K6OA 2N0SA 3NB0A 5I5GA 4C1NA 4EJSC 3L43A 3LHSA 3E9DA 3MUNA 3ZG6A 1UZNA 1RQRA 5GWXA 3I9V6 5TGTA 1RZRA 1W88A 4ZQIA 3GG9A 3H87A 2I80A 3WLHA 5TXGA 4EVRA 2GVDC 2D3WA 1JDJA 1V39A 4I1VA 2P3SA 4G5FA 1Z68A 1JIQA 2YV5A 5L3SA 3N2GA 2I9KA 2B78A 3AEZA 3EWSA 1AHIA 2UZIR 3I12A 5HF5A 4HV4A 4WNYA 5CT8A 4JFAA 1Y33E 2ZYUX 3G89A 4P7GA 5E8JA 4FCCA 4GP7A 1RQPA 1FU7A 4LN1A 1VPWA 2FB9A 3C7TA 3D8HA 1DC8A 3RWBA 4JBGA 4QTTB 1KJIA 1I3CA 1H3NA 3M9XA 5A3JA 3DKPA 4HDSA 1WB4A 3QEOA 4DC1A 5BSEA 2HOQA 2OXEA 2WC1A 1WX1A 1TUGA 4ZAVA 3QFHA 1KHHA 1ZOPA 4ID3A 1XDSA 5T8KA 1PZEA 3BEOA 1ACMA 1V6AA 2IBMA 1A04A 3QKTA 4A3SA 2HU7A 1JLMA 3BL8A 5L3QB 3KOXA 4YECA 1DSSG 5CIYA 5AK3A 3WYFA 5DVZA 1W87A 1P4SA 5AQEA 1TE2A 5FKJA 2C2OA 4E11A 2WIDA 2G2SA 5DT2A 1GVHA 5JIBA 1L5YA 4KPYA 1SZJG 5JQWA 3K2BA 5CNMA 3SI7A 1RJWA 4LYAA 3GMDA 5HE8A 2PLRA 2VYQA 3DKRA 3IVRA 4G1MB 3RS5A 4CLEA 2GD2A 3ROXA 3Q98A 5BNZA 2Q5OA 1HUQA 1WDLA 2ZTHA 3BSFA 2F43B 2I03A 4FFVA 2FPGB 5AVXA 1FMCA 2FRDC 2I76A 1FDUA 2ODEA 2YHIA 1CQJB 2NIPA 3K5HA 3PE4A 1CY8A 4N1AA 1M0TA 4JITA 2EFDB 4RY0A 4CF5A 4E1VA 3E22A 3NT5A 4NPAA 2N46A 5TF0A 1XA3A 2HQBA 4C78A 4XRGA 3ABSB 5A2GA 1CS0B 1Z18A 1RJ9A 2HDOA 3LM8A 1SELA 1ESNA 4HNAB 1Z2EA 3DOHA 3E03A 3R0IA 4I14A 3UHOA 3WIOA 4AO8A 5CFQA 4EAAA 3F73A 1PJ8A 4KYTA 5JLAA 4DFDA 1GYPA 5KNBA 5F1PA 3OWXA 1APBA 2HQ1A 3K4PA 2ONCA 1XA0A 2JW5A 3IGFA 1XLVA 5F33A 3L9WA 3HXOA 1M7BA 1G2PA 1L8AA 3Q1LA 3C3BA 5E6SB 1E6CA 2CNOA 3INTA 3NX4A 4QRHA 1JQJC 2XYGA 2ZXFA 2UXCB 1OZFA 2HGSA 2QAGB 3GUCA 3KVNA 5LVAA 3VNRA 3AVPA 4N6GA 4QGHA 1FNBA 1YNOA 1COWA 2G1AA 1N2IA 3CPJB 3GAZA 4JXKA 4MVJE 1COZA 4N7RA 1VHTA 2C92A 3ZZUA 1K3TA 2P5TB 3MMSA 4G0YA 1MC5A 4R1LA 1JZSA 2ZE8A 3PICA 2Q5CA 3VV3A 2O8BA 1HDYA 2FPPB 2LW7A 4JY7A 2G1PA 2P65A 1GAWA 1TA0A 1ZH0A 3ZGYA 5IC4A 4A6EA 3I72A 2WBLC 2GXQA 2IE8A 3R8CA 5A7GA 5F3RA 3GJTA 3FIUA 1Z0DA 5PGMA 2NADA 1HC7A 4DS3A 2QTNA 3FCSB 4F86A 2O19A 2LDXA 1QHFA 4C3VA 2X0KA 1LZLA 2P9HA 1F38A 1XCBA 1CUAA 1CR6A 1EP2B 1DIAA 1Y3FE 2QQGA 2O0JA 3KBBA 3QSGA 2OESA 3PNOA 4MQEA 4V0OA 4IGAA 1GU7A 4BKPA 2E4YA 4YV7A 1NLYA 4RVHA 1UEIA 1OILA 4YPOA 1FRVA 2GEFA 1XTJA 1X8LA 3G0IA 3VXKA 1IN6A 1QZXA 2PKYX 2WHPA 3DEKA 2JCSA 4Q3LA 5AM5A 2OOSA 2DUMA 3WGMA 2AZDA 4LIPD 3IP5A 1TIKA 1Y5NA 4JI5B 3WGJA 5C2JB 4EDHA 4MWGA 5I6DA 3AKZA 1SQFA 3IPCA 1HDGO 3Q9NA 1JG1A 2G71A 3NWOA 1SKBA 3HYLA 3AO0B 4FS8A 4GMKA 4P3KA 2BMDA 1NMZA 3IUSA 4UEKA 2IL1A 2FEMA 4DMKA 5EEGA 1MCZA 3BJRA 2NAFA 1S8AA 3OPNA 4H1TA 5KNCH 1ZJWA 3UAGA 3JQDA 1VBMA 1TZBA 2I4TA 2I2CA 1IXZA 2X0JA 1XFDA 4LZNA 3EFBA 4YUVA 4G81A 1Q91A 4LOIA 2IYNA 1AQ6A 2MSEB 3VVLA 1QRTA 4EY4A 5HIIA 2I4OA 4EUNA 1OR8A 1Y6RA 1N0UA 1STOA 3IP1A 3IVXA 1QG6A 1SXQA 3LWDA 3A9SA 4MTCA 2FPWA 3NM5A 4QDJA 2YWEA 4I08A 3B85A 3CF0A 4UTXA 2C29D 5ADWA 1UKEA 2WJIA 1YK0A 1DAFA 3QITA 4PCUA 5A9TA 3SX4A 3V2HA 4D4IA 4EJ6A 1Z12A 2F17A 3LX6A 4Q05A 4K0RA 3RFCA 1JKJA 4MRAA 4PPNA 3I64A 1ID1A 4QIHA 2IY7A 4RXMA 2ST1A 4NI5A 5BVHA 2ZM6B 1C9MA 1OY1A 4Q9LA 1NR7A 3FYUC 4MINA 4ZHQF 1E1YA 3W1WA 2FKNA 4LY6A 2EOAA 3E4DA 3EZ6A 4Z5XA 4UQLA 1WV1A 3IV7A 4OIFA 5FAKA 2XW6A 2OAQ1 3EXFB 4C01A 5D6NA 4Z8YA 4D41A 2O7NA 4YMHA 3IDZA 3H5LA 4TUYF 2D2IA 2F55A 2OC9A 5AVUA 2OVFA 3CZ4A 2JVIA 2WKWA 1CF9A 2XCOA 3OT1A 4YROA 1W85A 1AV7A 2FTKE 4QECA 2CVFA 1VE5A 5AHXA 1CEXA 1A71A 1W4AA 2C95A 4A8JB 5TMPA 2NP6A 5TT1A 3OZUA 2AXPA 1LWNA 1B0ZA 3F6CA 4FK8A 2BFFB 4A2PA 2HEGA 2GPTA 4EGJA 1F2TA 1OC2A 2XDQB 2EBFX 1P7CA 1U2DA 4XQGA 4RJTA 1LBEA 2CJYA 4RS3A 5J2TA 5JJIA 3CF4G 1NWCA 1UBJS 4G9GA 2J41A 3IUYA 3WLEA 4JI2B 3LDAA 2MT9A 4YMSA 3NQ41 4DXHA 2J0UA 1GPWB 3IIJA 3T5CA 5JSUA 4KGZA 1NPYA 4ICIA 2VP3A 3ZD7A 3HCBA 3HJCA 2HTEA 2PH5A 1J8YF 3BMQA 4YRDA 5LCXA 5KHOC 2ZJYA 1FX0B 1VPDA 5JTUA 1ZJ5A 3A1WA 5ALVA 1GPNA 4ROSA 3VR2A 5EJ7A 2ID8A 5DI3B 4E5KA 1LRKA 5EYPA 1IUOA 4WN9B 8LDHA 4U2BA 2FCAA 4Q4HA 3GFOA 4QYIA 2QT1A 3R7BA 2CFRA 5IWCA 4PO9A 3G9TA 3WX0A 1VSTA 2FRXA 5CLIA 2DR0A 2D5CA 1ZNXA 5AUQA 3SEQA 4KNWA 5AO9A 3FDZA 6CHYA 3BZBA 3RVQA 4DV3B 1ZM9A 2RCNA 2ROQA 4Q1CA 5HJ5A 3CE9A 2YY7A 1FFHA 2WSYB 1LS6A 2ZSJA 1F3OA 1NG1A 1Z6GA 4P4LA 5E1DA 1XCJA 1O03A 4JK3A 1IEXA 4DHWA 4DM4A 4DRXB 4E1BA 4GYYA 2AMJA 3KK0A 1QRRA 4DNPA 2HT1A 1U99A 4V3CA 1LB1B 1U5BA 2VC2B 2G0NA 3RU7A 4B4UA 1A9SA 3VH2A 2XOKD 2TMDA 5NLLA 3K2EA 1W0KD 4JHXA 1ZYUA 1EP3B 5G0TA 4EJ0A 3FZYA 3RUPA 2HLDA 5AM1A 3STWA 3T7EA 5C8DA 2VG8A 4CKCA 1EVYA 2YZMA 4B5LA 3OLQA 1N2BA 3RRBA 4RF4A 5EP1A 3CMMA 1PSWA 1X9HA 3I5MA 3Q7TA 4BAZA 1KMQA 3RVRA 4R3UC 1UBNA 4JYZA 4OYLA 3DXZA 3OPYI 1NXVA 1WDWB 1S3FA 2PGJA 3AUKA 3GCWA 4PPGA 3WG9A 5JASA 1MUUA 2IH2A 1BZYA 1SA0A 1YGYA 2HC9A 1U7WA 2YV2A 3DE5X 1GM5A 2ZIUB 1T3LA 3T1VA 5F1YA 4J49A 3K71B 2QR5A 3HMQA 3KL4A 2FZEA 2HIGA 4OHVA 4NPHA 4BX3A 2A2ZA 2ACWA 4EB3A 3NTRA 3RV3A 4E08A 1ZIDA 3SC3A 1E3QA 2NU7B 5IARA 3ZTTA 1HT1E 3LLUA 1NU8A 1ZISA 1H2ZA 4U0KA 3VPBA 2GCNA 4W1PA 2BHSA 1ACLA 1CDDA 4MO2A 3EGXA 5IG2A 2INGX 2QLFA 3W4JA 1TO1E 3UB4A 4QBIA 3CUKA 4RMHA 2LD4A 3FMGA 3C5CA 5EEHA 2W98A 5FBHA 2ZBRA 1QC5B 5BWBA 4NCAA 2QM3A 1RWVA 3GJ8A 4Q4JA 4TV8F 2DY1A 1Q0HA 1A7AA 3H2GA 4FYMA 1RPNA 2I3DA 3OZEA 4E4RA 4K88A 4ODIA 1IXKA 4CVNA 1CIVA 1YDMA 2QLNA 4RPLA 5C8VA 4YUYA 3H13A 1QVWA 5L95A 3NM4A 1SCUB 1QYWA 4GM0A 2OECA 4BIMA 2RK6A 2Q5LA 2DX7A 3U9SA 3SR4A 2SCUB 1LTHR 3P27A 2YQ5A 5CM2Z 5F5XA 5IC6A 3RJTA 3W6UA 3CH6A 5KQMA 5BNFA 1P8AA 2IJGX 3IAAA 1IBRA 4JA2A 4Y9DA 2G08A 3IDSA 3LZDA 2X1MA 3HA2A 3KQHA 3OZAA 3RU3A 5JMPA 5CB6A 3OZFA 1LSOA 3LTEA 4P7JA 1FFXB 4IO0A 1BDJA 3SEAA 3QKWA 3LS2A 3KNZA 4RL4A 2ZJ1A 5DFAA 3TJRA 3UJAA 3S8EA 4J4TA 5C31A 1U28C 1DQZA 3JQ8B 1R8XA 3Q3IA 4N7JA 1PWHA 3GU3A 3SHWA 2ZZKA 1NSTA 1P0CA 2PYZA 4J29A 4R7GA 3EMKA 3NBFA 4U7TB 2OD7A 3AESB 5FWDA 3UXMA 3ZHVA 3IOYA 4BLQA 4AJNA 4J43A 4N76A 3Q5GA 4L8VA 4HO1X 1FS5A 1XDUA 3FUVA 4HQFA 1XPRA 2XMBA 1DBQA 4Z9XA 4O4LB 3O4IA 4FD2A 3M34A 2EF0A 5G0SA 2C54A 3NASA 3FCOA 2NXNA 3S3TA 4XFKA 3I9V1 3DQQA 2ZW9A 2E49A 4LAFA 3DL0A 3KSAC 2GZ3A 3LF1A 1MEEA 4HYTA 4Q01A 5C8YA 5AICA 1ZMRA 2JH9A 1PJLA 2HI0A 2X1LA 1M7HA 3JPYA 3D6VA 4OHMA 1YQEA 5IZCA 3I8SA 3PPYA 4KN6A 4XYBA 5EIWA 1OWMA 3NOXA 3BIFA 1Q5PA 3RB8A 4G07A 4ZMBA 4NMWA 3PUVA 5EMHA 1VJ1A 3U09A 2VZ0A 1EFCA 5EQFA 4OJMX 4QYTA 3SC2A 3M89A 2JAXA 4ZT4A 3LBYA 4V0NA 1D1QA 3RYFA 4ESOA 2CB0A 1NQUA 2GR9A 3KQUA 1EWQA 3ZE7A 1FFSA 4E2FA 1S2IA 2DBRA 1JG3A 2EFHB 2WWHA 3DZFA 2IX9A 2P9EA 4GEGA 3QNMA 4PZAA 4S2UA 4EBBA 3WQSB 1OASA 3F6EX 1JBKA 2YTZA 2VHUA 4HAIA 2VNIA 4C6SA 5K3EA 4ZV7A 3TQIA 4YRZA 4DMMA 4CDGA 1QF7A 2OXIA 3GUVA 4DV7B 1M8PA 2WIBA 2OHJA 2ORED 2WAOA 1ZUIA 4II2A 5DM1A 1RRGA 2OPHA 3ESDA 2I7XA 4BNFA 4DLVA 2CXPA 2XKAA 1IPFA 3CBGA 3GFPA 5IT4A 2JD1A 3O1JC 3N6VA 1B4DA 1OD6A 3B48A 4AXBA 4DWOA 5BUSA 1UINA 2IHYA 3X3HA 4BX0A 1MIHA 5A03A 1PVOA 2F00A 1V48A 1RM5A 5ELXA 3CUTA 3JS5A 2A7QA 2R8XA 5IDWA 3WADA 4D3ZA 1QIHA 4A82A 1VDMA 5I7EA 2PMFA 4DQXA 3C15C 4AT1A 1OBFO 1Z0JA 2V7VA 4OCZA 4Q39A 3OY7A 4CMBA 5AKGA 3OICA 3GRCA 2P2CA 1M5UA 3D7NA 2JF0A 5IJZA 2ZUTA 2AFVA 2PX3A 1V43A 1T6ZA 4BO6A 5U1PA 1EHIA 1C3OA 1GARA 1X7XA 2V7EA 3EZFA 3O8QA 4IJMA 3RF7A 2PEYA 1Z5PA 2VZ8A 4TPKA 3Q3VA 2OLJA 1FJ2A 3GDGA 1OAAA 5BW4A 2JLUA 1YZ3A 1M6WA 1BN7A 1GYQA 1K8QA 3L6OO 5JANA 1HURA 3CRMA 4B6EA 1GLGA 4EPVA 2XGOA 4MRSA 3JX9A 5FIUA 1FK8A 2WU1A 3ONEA 1PUXA 3Q9SA 2UYGA 4X64B 1T5TA 1CULC 2DQYA 3R3UA 3WA7A 3HZRA 1QX3A 4JJ6A 4BNZA 3LFHA 5BURA 3IS3A 2Q45A 2VF2A 2C78A 4C0JA 4J0KA 5ECGC 3IE2A 1NIJA 4Y1RA 3OLCX 1U2DC 4MJXA 4URFA 1ZL0A 3PT9A 3GJ5A 2VTKA 1OZHA 1WPQA 2PX2A 4N3GA 1ZXBA 1ZPDA 3ICWA 4HLNA 4K86A 1GKKA 3NP7A 4TMFA 5JS8A 2XR1A 5HCIA 4E33A 3NVMB 4C4ZA 4WFKA 4P2BA 3WHLA 4AO6A 4Z4QA 4WLNA 3STUA 4ZDIA 1FU8A 4KJZA 5HSGA 2V58A 1KAQA 2HDHA 4BMOB 2XKBA 5B2EA 3Q7EA 3AYZB 4P0PB 2DERA 1GKIA 1X6VA 2YZGA 2G1UA 5JZBA 5K2OA 5EXPA 1TGVA 4DCMA 3PWZA 2CGEA 2EZ8A 3OKFA 3BH0A 1EE2A 1W2WB 2VKTA 5EESA 1WAMA 4PTYA 3WDMA 1L5QA 4E70A 4GD3Q 4FBMA 4KACA 2WMYA 1G3MA 5JMWA 1I0LA 4FOPA 4HAUA 1GR0A 2V9CA 2HPHA 2W6QA 3CH5A 4N0PA 3VAZA 2W5UA 4E5NA 3DEIA 2YICA 4Q9IA 1AV6A 4YRPA 1NW5A 3AL2A 1ABEA 1KJYA 5L8VA 1SCKA 3H5TA 2FU5C 3CNNA 1RWNA 5FLKA 2IK8A 3G3EA 3T9BA 5DCYA 2L42A 4MDYA 2IRWA 1IWBB 5ITWA 1IXSB 5F7JA 4QATA 2QRKA 1YZGA 5K8IA 1QYCA 2J0SA 1GQ2A 1YJ8A 3AJ8A 2VHVA 2VSOA 2W6NA 4DDHA 1Y3HA 4IXDA 3S2FA 2WSLA 3SZLA 2C83A 3DOEA 4ZI7B 1SUPA 4A2WA 4I2NA 4UU1A 1U1EA 1BOFA 2PWYA 3UC9A 2VF4X 1B73A 3A25A 3FTFA 4TZ6A 2A0WA 1DBWA 2O8VA 3W8RA 2X8LA 2ZKIA 3TE7A 5HJEA 3K9CA 4AG5A 2BM0A 3SFZA 4BJ5A 2LIPA 5AI4A 1OW3B 2AG1A 2C2YA 5HTOA 5IT9A 1WXGA 4ND2A 2QF7A 1MO3A 1P2VA 1V16B 1W9HA 5EIFA 1YFLA 1VECA 2QNBA 1LV7A 4W99A 4Z9YA 2P68A 1WXEA 3P9NA 2BISA 3SY8A 3DBVO 2B4RO 4GBGA 4EVQA 3AZOA 4HYEA 3TR5A 3AZQA 4HTFB 4K8OA 3WTCA 5AW2A 1OPXA 3A4IA 3ZIUA 1B6RA 3QX3A 2CNBA 3ND6A 1T6YA 1GPMA 2Q6IA 2HXSA 4RK5A 4BV8A 1SULA 5I45A 4XI9A 3PWSA 5IU6A 5H3HA 1QQ5A 3ELWA 1RD4A 4DEYA 3L04A 4Q3NA 5JS7A 4I5DA 4X93A 2PXHA 4CZ2A 4PSDA 2Z1NA 1QH1A 1MJNA 3FJYA 3I2JA 3EWNA 2ZIAA 1FP1D 3UJHA 3V1KA 4JXXA 2W37A 2CZQA 4DDWA 2RSLA 4NKRA 4ZC8A 5H81A 3WR5A 3SVTA 2V9ZA 1L9KA 3OU7A 2V0NA 1HT3A 2RG1A 5C4MA 3BRCA 3IAS6 3ZHCA 4KDFA 1TCUA 4QQKA 2X2EA 3NDIA 3TRHA 2GAFA 5ES4B 3IMGA 1NVDA 5BRAA 1MH1A 4R51A 4QXQA 5D7BA 3FOZA 3OCJA 1EX1A 4PIMA 3BX1A 3F4BA 1LDMA 4CL0A 5LZ4A 4BXOA 3MW8A 1K86A 1XRSB 2WWVD 1MX1A 3UV6A 5TQ0A 4BMDA 4UNNA 3SR3A 1OGYA 3DNMA 4PF1A 4X62B 5H3LA 4YV1A 3ZVMA 1CUFA 1LQUA 3NT4A 4IXMA 5TMBA 2GILA 3NG1A 4EJSB 1DZIA 3IJPA 3VR5D 2CNWA 1ATZA 3C14C 3PE6A 4KREA 3GQBA 2R9VA 4AG3A 5EJ6A 3WFJA 3HDYA 1ULHA 5COBA 2I52A 4ZAGA 4GKVA 4D1YA 2ZE7A 2NZ2A 3I76A 4ARZA 4I4IA 3ZJ4A 1F2DA 4GPTA 3DQPA 1H3EA 2BRUC 4IINA 3T4PA 4BEWA 1J0XO 4CEHA 3QWIA 2VK2A 5DOZA 3CO0S 3SK0A 4EZBA 5KIAA 4D79A 2PO7A 2ZSIA 3JWEA 1NNSA 2A4MA 3RC9A 3O8CA 1QFZA 4BFYA 5AVWA 2R5FA 3MGBA 2PUWA 4JT9A 3AKYA 5COAA 1DNPA 3VBEA 5CAEB 4DM7A 2PPLA 1BXRB 2HUNA 4X6YA 3WAJA 4KE6A 2A30A 1E7YA 4B2IA 2GEKA 2X4GA 1U8UA 3BFPA 4EYKA 3FF4A 4EKYA 2Z6UA 1JDUA 2GVNA 4MITA 4V03A 1E2GA 1EG2A 5A6SB 4LECA 2ZP1A 2HMUA 1R8JA 3KC2A 4KVAA 5DGIA 1TYAE 3FGPA 4ED9A 2GB4A 2VT2A 4B8WA 1VJTA 5FBZA 2OAEA 1L9XA 1LK0A 2PRYA 1Q1EA 3E8SA 3SYKA 3UVEA 2WJ3A 4GI2A 4IDPA 3TF5A 1GSAA 2CKDA 4IJKA 1EFRA 1KY5A 3RIEA 3WISA 2G3YA 3BWEA 2BTQB 4EI9A 1QHHA 5JJKA 2IHKA 2X0NA 1YHNA 1KEEB 3DGFC 1NXWA 1WL8A 3YASA 3AF6A 3CW8X 3LLVA 4QDUA 1URPA 2NUTB 2IOYA 1BXZA 2FZ4A 1ZW6A 1GD1O 1KXJA 1WF3A 4NOKA 5EFOA 3OZIA 3ZGVA 5LQRA 1DRKA 3RVMA 2XXAB 4HNUA 2ZJ5A 2A52A 1AUXA 3H8SA 3TGWA 2JFNA 2MYTA 1FVXA 4N7MA 5CXQA 1VMEA 1YQWA 1W5SA 4DUZB 2DJ5A 5B37A 1SHJA 4OQMA 4EUHA 2O5CA 3CWZA 4WT7A 4G2NA 3N9IA 5HE9A 4E5DA 1XQYA 2C5FA 4V24A 2C3OA 1W581 1C8BA 4L16A 1KWGA 2R6HA 1X94A 5JVDB 1IPEA 1YZLA 2VYVA 4R2XA 3HRKA 4H1HA 2GJAA 1PS0A 3P0JA 2CHQA 1KNXA 4IVRA 4NDNE 2ZJZA 3I6ZA 2QLBA 3FFBA 3KFXA 4W1SA 4AP9A 6ADHA 3CV3A 1XJQA 1S2DA 4R2JA 3MEQA 2ID4A 6NULA 1SHKA 1TYZA 2YV3A 3ZQJA 5AVQA 1QIGA 1TJNA 2P2YA 1N7HA 3MZ0A 1JN0A 3M81A 5A04A 3AEQB 3IP9A 3K2QA 3SKXA 3UAWA 4D3YA 1XG5A 1GTL1 2E89A 4UOQA 2VQFB 4R01A 2WKRA 1Q7BA 3I1FA 1YRLA 3RARA 4DKJA 1JA1A 3OO1A 1YHYA 4UPVA 2HMYB 3MN1A 4WKNA 5ISMA 1SWWA 1BC5A 3V8NA 2OL4A 3CUSA 2IUYA 3ZGOA 2DLCX 2DOKA 1SEVA 3PT5A 3F67A 5IANA 5KX5A 5IJWA 4H77A 3THRA 5SZJA 1CE8B 5FFFA 3TIFA 2HHCA 2PUBA 2QVLA 3AG5A 2Z8ZA 2X9QA 3JQGB 4QGAA 4JYPA 1RE1A 3MHPA 3SXUB 4YRKA 1L7MA 3WNZA 1FUEA 3DG9A 2W43A 4X0EA 2PR2A 2QZJA 5E2IA 2FW8A 3FD8A 1E7SA 3DZBA 5IAJA 4PYIA 3L0ZA 4MIKA 1HRKA 1XMPA 1ZGCA 2PA3A 3IUJA 1QQAA 3OZDA 5FOXA 4BEBA 1EMDA 3NO4A 4P5DA 5ALUA 5DBFA 4DJDC 2QEQA 4HX9A 4H7FA 1JFTA 4M87A 2XCSB 2OYRA 4PG4A 4NBTA 4I5IA 1NW4A 1RVV1 2XZDA 3HNPA 4KSBA 4OGGA 3ICCA 4UVDA 3PKIA 1Q17A 2EJCA 5FWNA 2J09A 4Y98A 2IYXA 2PS3A 3V1LA 4P1ZA 2BW0A 1O4WA 2XT6A 1KSFX 4IDGA 2DPYA 1Z38A 2BEVB 1UKAA 3M1IA 3NRBA 1NN0A 3I6BA 4QYMA 4OK3A 5IYZF 1PT6A 5KC9A 2QV0A 2I55A 3L79A 2RHOA 5FWXB 3UJPA 5J5AA 4LC1A 4BFWA 3B1XA 1SHTX 1Q19A 2VNKA 4Y18A 3SZOA 3COJA 4OUDA 4KIJA 2XE7A 2NU9A 2ZRAA 3MINB 1DWUA 1C80A 3MMPA 2JL1A 1O89A 1CHDA 1F8GA 3VR4A 1J5PA 4OLHA 2NWQA 4H31A 1QO9A 4GM4A 2ZI6A 4FDAA 2JDIA 3FOFC 6YASA 1LBQA 2F8LA 1YVPA 4N7BA 2JFVA 3FZQA 3GFQA 4MP6A 4ZI5A 3VR4H 5J3JA 3NAGA 1F0YA 2Q9BA 4G8DA 5FAXA 1C1HA 3K0SA 1Z8NA 2QX7A 2X7XA 2YYAA 4ZRDA 3DAGA 4D0SA 1W7AA 2IYFA 2LV8A 3BWVA 4IXWA 1IBMB 2VJBA 2BFBB 2EFYA 4I8XA 4DA8A 3QGMA 2C2KA 2CUKA 2FLVA 1IIBA 1XPJA 1U8EA 2DQKA 2UVDA 4HN9A 1WXXA 1YTLA 2P1RA 2ZJ4A 4YDRA 1K97A 3T3PB 3NGLA 2AUMA 4TTSA 3M6UA 4N18A 4WZBA 4ZEMA 2MIIA 1I1OA 1A96A 4NVRA 1RC0A 5BV0A 2O06A 4BQSA 1BFKA 2IIQA 1NX9A 2PFSA 4TS3A 2HO5A 1EK6A 4F3TA 1NT2A 3FYUB 3KVOA 2ZYDA 5CT9A 5M3BA 1HMYA 1L5ZA 3OFJA 3FKJA 2OBBA 3OIGA 4QEDA 2VQ3A 3GLIA 3MQFA 3WK5A 1N3BA 5DZSA 4P0QB 5HKLA 4ZOLA 1Q0SA 2F3UA 1E98A 2QMYA 1S8OA 4CLOB 3E7PA 1YUMA 3HDGA 5C37A 5FULA 1RP7A 4NFHA 2VVTA 1GPJA 1O96B 3CCBA 4BRWA 2IS2A 1EK1A 3T6KA 2D1FA 1RYFA 1GFSA 3ROFA 3WGQA 3VR1A 3LQ2A 3K6JA 3TXXA 4DAOA 1TL7C 5BR7A 2UZ0A 3T5MA 2RAVA 2V55B 4W6QA 4P4SB 3ESRA 2R00C 1OPRA 1YBVA 3B3JA 1E3SA 3OMWA 4QQFA 4ZDJA 4XD7D 1JBQA 1X7DA 2OZEA 2XWPA 3B6ZA 5KTYA 4ZT6A 3CTPA 3GHYA 3HSSA 2X41A 4KX5A 3WKAA 2I2DA 4EZIA 4ZHQA 3CXRA 4KR0A 4Y2XA 4YAGA 2WW8A 3ECCA 4O2LA 3IT1A 1ORRA 4LSMA 4KQXA 1FQKA 1V41E 2ZAIA 1KU0A 4FE3A 2BN4A 1OAKA 2B5OA 5EWMA 3SG0A 1U7HA 1FMLA 1SRQA 4OOEA 4IUCS 4TUYA 3VNAA 1DCMA 3GLIE 2QXYA 1DZ3A 4RJIA 1IBLB