4MUGA

Crystal structure of pantothenate synthetase in complex with 2-(5-methoxy-2-(morpholinosulfonylcarbamoyl)-1h-indol-1-yl)acetic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
287
structure length
287
Chain Sequence
b'IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
molecule tags Ligase/ligase inhibitor
source organism Mycobacterium tuberculosis
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
total genus 97
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4mugA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mugA01
2X0KA 3AFHA 3A4IA 3CLUC 1IH8A 1R6TA 4MLPA 5K0TA 3IMEA 3NV7A 2QUKA 3ZXSA 1JIKA 1TYBE 1Q77A 3P0IA 4EG1A 1M8JA 2X1LA 5FNZA 1H3EA 3CLRC 1KAQA 3HL4A 2BTEA 4MW6A 3TQOA 1FYDA 4MWDA 3L92A 3S3TA 1TYCA 3IVGA 2A1UA 1MC1A 1V47A 1VBMA 3FI0A 1MAWA 3BL5A 4ZT7A 1PG0A 2NZ2A 1YULA 1XNGA 4HJXA 2Z3VA 1GTRA 1NUQA 1QRTA 4K0RA 3IDFA 3ELBA 2J08A 3A04A 3H9CA 3COZA 2ZUEA 4QBTA 1KQNA 2OV4A 3ZJVA 1N2HA 3ZIUA 5DASA 2JA2A 1WQ3A 1QRSA 5LFAA 1EFVA 1I6LA 4X0EA 3RFFA 1CT9A 1X6VA 2Z09A 1OWOA 1HYBA 2QJTA 1RQGA 1VL2A 1ZUNA 3Q10A 1J1UA 1X8XA 5DK4A 1OBCA 3MXTA 2YY5A 1U7DA 4QRDA 1JZQA 1YIAA 3AL0C 3LE8A 3CVYA 1KQPA 3IVXA 4G5FA 3IH5A 3AKZA 2AKEA 1ZH6A 3FY4A 2VXOA 2QTNA 3AG5A 1O96A 4ZCPA 1TEZA 4F3RA 1KP3A 4NZPA 3D6UA 5KHAA 3A05A 3LCJA 3ND7A 2CT8A 1U0BB 1KAMA 2DPLA 1D2RA 1O6BA 3ZUGA 1P7PA 3ZJTA 4NX2A 4H3SA 1M8KA 3IOBA 4MUNA 1WQ4A 2G36A 1KKUA 4UZEA 3X1JA 1ZJWA 1QTQA 5LLTA 1N2JA 2X3FA 5J58A 3FDXA 4K03A 2A1TS 3HMQA 1XNJA 2GOYA 2OQ2A 3SZGA 2JAXA 1WJGA 1K4MA 4EG8A 2C5SA 3DPIA 4HPWA 3KT6A 5LM3A 4JXXA 1N78A 1F9AA 1MAUA 2PZ8A 1TYAE 5JBNA 1EXDA 4EGAA 1EJ2A 3K32A 4JXZA 1H1TA 1T6ZA 3HGMA 4DDMA 2CUZA 2JANA 1IQUA 2PZAA 1GTSA 1DNPA 1PFWA 1M8PA 1NUPA 1MB9A 5H16A 2VTBB 4MUGA 1IVSA 3SZ3A 2YWCA 3H05A 5F23A 1H3FA 1N75A 4L2IB 1VBNA 1MRZA 1N3LA 2J07A 3IOEA 3QTTA 4EG7A 2XRYA 1ZH0A 3N9IA 4KR7A 3RBAA 3KFLA 3ISJA 1IFXA 3A2KA 2DLCX 3IMGA 5TGTA 1KH3A 1G8GA 3N8HA 4MW4A 4MW1A 4JYZA 5HG0A 1N2GA 1H3NA 1PFYA 3N2YA 3FG9A 1O0BA 3MUEA 4G6ZA 3X1KA 3P52A 1JILA 2QUHA 4MWBA 1J09A 3SDBA 4DLPA 4I6GA 3QE4A 1MJHA 4ZCTA 4CQNA 1JZSA 3G59A 2V0CA 4KPUA 3TS1A 5J5AA 3VRHA 2DERA 4KKVA 5HUJA 4CDMA 2D13A 5HUHA 3KT8A 4MUEA 2E89A 1K97A 3G6KA 4KR9A 1O0CA 1OWPA 2AZXA 1ULHA 4EG4A 3HFJA 4MQ6A 2A1UB 2YWBA 1QNFA 4Q93A 4MUIA 4MAFA 2D54A 4ND7A 1LI5A 3VGJA 3CVUA 2GKSA 5IHXA 4CDNA 4MWEA 3P0HA 3AIIA 1FFYA 4PBRA 5FO1A 4J76A 4ZCRA 4MW9A 4JZYA 3CLTD 1OWMA 4ZT6A 1WOYA 3ZGZA 1IQ0A 2PFSA 2O8VA 4KPUB 1JEDA 4OUDB 1XJQA 3ND5A 2E0IA 3FH0A 4U63A 1I6MA 2DUMA 1M8GA 1QRUA 4J75A 4R2LA 1OD6A 1XNHA 2R5WA 4YMIA 1U3CA 2A4MA 3UK2A 4JFAA 4HJRA 3QTBA 4MW7A 3INNA 4KR6A 1K4KA 4XFJA 1BS2A 1COZA 3RJZA 4MULA 2DEUA 1N2OA 5DEOA 2CV0A 4NATA 1J20A 1VLHA 2A1TR 4S1OA 1TYDE 2WSIA 3COVA 1EUQA 1WXHA 1TQ8A 4MVYA 1T9GS 3U1VA 1QU2A 3FIUA 2HGZA 3CA8A 3OP1A 1IQRA 3TZEA 4AS1A 1N2IA 1JECA 2NSYA 1JHDA 2D5BA 1NUUA 1N2EA 3CLTC 3IUBA 2X1MA 3RK0A 4MW2A 3FNRA 2O5RA 4ND6A 2CV2A 2GM3A 1UFVA 4XFDA 3D6VA 3FHJA 1KH1A 1EFPA 3M5WA 3L93A 2A7XA 3PRHA 1N2BA 2QTRA 4R0NA 2CV1A 1IRXA 2WQ7A 2A86A 4DDHA 5TEVA 4TS1A 2CYCA 1U3DA 5TEWA 3G5AA 5K0SA 1QU3A 1O5TA 2ZP1A 3DO8A 2ZUFA 1KR2A 4GU5A 4U7JA 1QQTA 1YI8A 2CSXA 1K92A 3UOWA 2XRZA 1OWNA 1YUNA 2CFOA 4YP5A 4ZT4A 3TZLA 2E21A 4AQ7A 1O94D 4G5YA 3COYA 1OWLA 1B6TA 1O94C 1WY5A 2WB2A 3GLVA 1EUYA 3MMXA 1KH2A 4QREA 1JGTA 3C8ZA 1M83A 1T6YA 3LOQA 4MVCA 4DNXA 3PNVA 1NI5A 1A8HA 3RHSA 3ND6A 3HV0A 1KQOA 4YBRA 4ZT5A 3PNYA 1WXGA 1MOPA 3IUEA 4P2BA 4YP6A 1F7UA 2QJOA 5AHWA 1GZUA 2QUJA 1J1ZA 1EE1A 1QJCA 3AG6A 3CVVA 1F4LA 2B7LA 3CLRD 4L2IA 1TFUA 3E27A 2DR2A 2IJGX 4WNYA 5KCMA 4ZT3A 1S4MA 2DXIA 5BNZA 4OUDA 4BWVA 3SYTA 3IMCA 3NBKA 3IVCA 3H99A 1O95D 2Z08A 1VBKA 4NAUA 3H97A 4EF6A 1JIJA 4ZCQA 4A91A 1GLNA 5DB4A 2EL7A 1PG2A 3Q12A 5TS2A 1NUTA 2E18A 2J4DA 5H7XA 3F3MA 1G8HA 1SURA 1EFPB 3SEZA 1I6KA 2PIDA 1WKBA 4MW5A 5KWVA 3H9BA 2QTMA 3HZRA 3TQIA 4ARIA 4PY2A 2BYTA 4Q16A 1GN8A 4MUFA 2HZ7A 3KT3A 1MBZA 4MUKA 3MLAA 3RK1A 2IELA 3GMIA 3FWKA 1KORA 1YUMA 2HMAA 4RPIA 4WSOA 3COWA 1J21A 2WQ6A 1O97C 2RE8A 4U8HA 1JEEA 1GPMA 1NP7A 4E1AA 3CLSD 2H2AA 4MVXA 4XSVA 4FZJA 3N05A 3CR8A 4YP7A 1PFUA 1YIDA 1O95C 1NZJA 4NAHA 1EFVB 1G59A 1WXFA 3KT0A 4DJAA 4F4HA 2J09A 1MB2A 1N1DA 4MVWA 1J70A 1Q19A 3PXUA 4I6JA 3FOCA 1T6XA 1LI7A 4PBTA 1R6UA 3CVWA 5EKDA 1F7VA 4UZFA 3UY4A 1NUSA 1T9GR 1M1ZA 3DV2A 1ILEA 2PZBA 2A84A 1I2DA 1LW7A 4MUHA 4CT0A 2AG6A 1O97D 3IODA 2PXHA 3NBAA 4ZT2A 4MWCA 1GAXA 2J5BA 2QUIA 3ILVA 3TNJA 4ZCSA 1KP2A 3VU8A 4OJMX 1WXEA 3CLUD 4PBSA 3OTWA 4MUJA 2A88A 1NYLA 4DE5A 5FO0A 3UMVA 2CYAA 4RUKA 4NDAA 1NSYA 4I6EA 2QJFA 1WXIA 3DLAA 1NURA 3I05A 3IOCA 3K9WA 3SP1A 2V0GA 1OBHA 3X1MA 4EG5A 2PG3A 1M8FA 2I1LA 1N77A 3CVXA 4GRIA 1JIIA 2H29A 1O96B 1Y42X 3ZJUA 3UC5A 3FETA 5J59A 3P0JA 1G8FA 3GUZA 1JMVA 3JXEA 1WZ2A 3SEQA 5IJXA 2DETA 4ARCA 4DDKA 1Q11A 3MLBA 1U7XA 2VTBA 2EJCA 3PNBA 4EFKA 1Q15A 3Q4GA 2RD2A 2YXNA 1IHOA 1R6XA 3CLSC 4HK4A 1PFVA 4MW0A 2IP1A 2TS1A 4R2MA 2CYBA 4EG6A 1V8FA 3ZXIA 4EG3A
chains in the Genus database with same CATH superfamily
2O6HA 3CLUC 2GCPA 3CURA 3HQ4O 4HB0A 3WLMA 1JEJA 5L7TA 1QLHA 4MLPA 1B2RA 1GGKA 1VE6A 4KPGA 5G0TA 2I80A 1KEPA 3BDIA 1G8PA 4OMFG 3TECE 1FRZA 1AGNA 1TYBE 1UBEA 1USGA 1E3JA 1LKZA 3E3NA 1YZHA 2B35A 2Z5VA 4PXAA 4DWJA 1FMFA 2PZFA 2E5WA 3ED1A 3T5GA 5E8JA 4ZKDA 4HLDA 3CZ5A 2Q2VA 1BVHA 1RWBA 4GBJA 1VL5A 4BEJA 3GMTA 2IUSA 4NFYA 2RHRA 1IPHA 2QN9A 2VJNA 4J0CA 4C6HA 3CSSA 3FPSA 5F2OA 5JSKA 2J0UA 2BJHA 3SYLA 4A0QA 2RGDA 1YZFA 1UKEA 4HBGA 4S24A 1SC9A 1T5DX 5DSTA 1TYEB 3WBKA 4D3YA 2GVDC 3Q9SA 5JEEA 4LS3A 2PQ2A 5TMDA 1GGVA 3MJSA 3UB3A 1NUQA 1NFFA 1XRMA 2VJLA 2CVHA 2Q62A 2Y71A 4ZICA 3ZD7A 1NM5C 3G5LA 1GRQA 2ZUBA 4ITRC 4D41A 4IJVA 2Q3FA 3Q3HA 3OOJA 5FWYB 5H70A 3X3HA 5JU6A 3C7KA 4PAOA 1KEEB 1R0RE 3PUZA 2W22A 1IAVA 4WJLA 2Y1KA 4N7BA 5J47A 3CEHA 3N0WA 4KNWA 2WBLC 5D6OA 2Q7DA 4U2GA 4GGPA 4JYAB 1ZCJA 1U94A 1R0SA 2P2DA 2P11A 2Y1CA 3FMVA 3B6EA 5MHTA 2XRMA 1J1UA 1ZUNB 2YY5A 4Z5XA 2VI5A 4RJTA 1XD2A 3CJQA 3K0HA 2P41A 5JIBA 1JU4A 1CRPA 3TKYA 5E7QA 1QHYA 1RIFA 4NBWA 4CUJA 4BXOA 2Z4RA 3KTOA 4AF8A 1AKNA 4EJ6A 3CZ9A 2W9XA 3AHEA 4NZPA 3QLUC 1AUQA 1JDUA 4DV3B 2IUUA 2XH8A 4OM8A 1ADJA 1HX7A 2FN3A 2ZQ5A 3O82A 4H7IA 4Z3OA 2JLXA 1I32A 5CLGA 4Z1MD 3K5PA 2FJPA 3JVDA 5DN6D 2QX6A 4OQNA 4QTYA 1PR9A 1BW9A 5E7JA 2FW8A 4X95A 4E5KA 1JH8A 3AQIA 4II3A 2BE9A 4MINA 5SZIA 1K27A 1XDSA 3X1JA 5BSMA 2IV7A 3VH3A 5J4KA 5JTTA 1RQLA 5EP3A 2NUAA 4NS1A 4I2NA 2GOYA 3HMKA 4R41A 3LGAA 4WKOA 3OE4A 4XQCA 3RH0A 4KXLA 2CNLA 4IS2A 3ZGNA 4CKZA 1W5EA 2DECA 2VDLB 1CYDA 1RLIA 2Z8ZA 1VHJA 2XRFA 3MT9A 4IUBS 4M2LA 4MVJD 4JXXA 3N86A 2HYIC 4LPKA 1LCIA 1M2OB 1VTKA 3KPUA 5HOQA 2I29A 1EXDA 4EGAA 2C9DA 3BA6A 3NXSA 3D7RA 2WKSA 4XRRA 4F2HA 3EASA 3TJMA 3GA0A 3K0CA 5FT9A 1IUOA 1JJ7A 2E1RA 2GPWA 5EEHA 1DU4A 2O5CA 3ZW8A 2RGYA 3GRRA 4NIMA 3LT4A 5KKCA 3TZQA 1GAQA 2AFHE 2BGKA 3L5OA 3AMVA 3HSYA 4DCPA 2JZNA 4K87A 3QKSA 4Y1FA 1UKCA 1F2VA 3OZRA 2GEBA 3K7EA 3K8YA 5HDQA 4JKIA 1W85A 4G2NA 4U0JA 4OUKX 4DEXA 5IEJA 4G1EB 1J42A 4PSDA 4UNRA 4RDXA 4DCOA 1RACA 3W5UA 1P1KA 3CZAA 4K26A 3ZWKA 1JTEA 3A6ZA 2IU4A 2NO4A 5JAHA 3VMFA 1KZYC 3PWKA 4RY9A 2YMMA 3RFTA 2QDXA 3AHHA 3D8TA 2E5LB 3I30X 1PTKA 3KD2A 1ISRA 4TTTS 4N3BA 5CT9A 5DX1A 1B23P 5TGTA 3WHPA 4MYRA 3ZCVA 1PJLA 2HN9A 4IJ6A 4MW1A 4GOXA 1NJGA 2QX9A 3FI9A 1O6GA 4FR0A 5EGSA 1GA1A 1U8CB 4NOMA 4RZQA 3FN4A 1PFYA 4DQXA 5AW6A 5DYNA 2RHHA 1Q7RA 4G4IA 5AJZA 1E20A 2UVQA 3SDBA 1QFZA 4ZRDA 2JEYA 4IZIA 4D57A 1KJIA 1LLUA 2GM9A 3WAJA 2QL9A 3GDGA 4F8JA 5HUHA 1SVUA 1E0AA 2FVXA 3AGQA 5FRDA 3OOEA 3FOBA 4KDRA 4YRMA 1GV1A 4ARZA 4B33A 3GUUA 3LKDA 1QYXA 2WC1A 4QUHA 5C53B 4NBSA 4NAVA 4QO7A 6NULA 1UJ2A 1Y6RA 2D2IA 2OV6A 2Z8YM 4WWHA 3GMDA 4HGNA 1ECCA 4NEHB 4BHRA 1QKKA 2EJBA 4GLLA 5AQEA 5BPHA 5EE1A 2O8CB 4LWPA 3IT2A 5CJJA 3LPDA 3ZU2A 4RSMA 2V8OA 5JNUA 5C1BA 2R9VA 1UMDA 3MQ2A 3LZDA 3FDZA 4WZZA 3ZWQA 3GIWA 3D6AA 3LPMA 2BBOA 4M38A 1HLGA 1SXGA 2IZ7A 3AVUA 3A9TA 4LRXA 4BMVA 1UJBA 3K6RA 1TM4E 1XDDA 2BR5A 2HBYA 4HAXA 1KIFA 2MWMA 1WCYA 2BP7A 1NMQA 1JQJC 3Q8MA 4JLNA 3MWLA 4U0KA 2C29D 5M34A 2LRHA 4K40A 1E0DA 1XZIA 2H9AA 4MUXA 4BLUA 4J9VA 1Y1PA 3DWIA 1BOOA 1FFSA 2AMFA 3CRMA 3MILA 5AI6A 4ABYA 4DS3A 1CNEA 3K16A 2JZOA 3FCSB 4L28A 3KXLA 4GXNA 4KYIB 3U3OA 1DV1A 4F97A 5BNWA 2ZZNA 2VCYA 3P4XA 2VAMA 2VXCA 1RAHA 4HO1X 4Q24A 4HX2A 3UCFA 4HDAA 4MV5A 1QDEA 1CWUA 1TF2A 3NTLA 1L1RA 1LWOA 1WDMA 3U13A 5CVDA 5AI9A 1PWXA 3IB3A 2EQBA 3VU0A 4MH0R 2WPDA 5BUZA 2A1TR 3ACCA 1W59A 4NYJQ 4XIIA 3F67A 2TRSB 4UQOA 2OYCA 4KBFA 3TBFA 3A1EA 3UFBA 4EX6A 5BP7A 1ZL2A 2ZGVA 4TL6A 1Q7BA 4IUYA 3EISA 5CTJA 1NN1A 4CKWA 1U7ZA 5AH0A 3RRXA 3OEYA 3OG9A 1QP4A 3C3DA 3ZE9A 2I54A 3P9NA 3KPJA 3S2IA 4BMNA 3OP1A 3NHSA 1XMJA 4IY1A 1O87A 5DBFA 4AJ9A 4BJ3A 3OIWA 3EDQA 3T1HB 3AF4A 4D0NA 4AP5A 1BXRA 4KQJA 4K7JA 1V8OA 3D9QX 2GXSA 2WINI 3NAGA 4IEIA 2H1CA 2X1MA 2Q1TA 4YDHB 3DBIA 1GRRA 3VR1A 4B3GA 3SAJA 5DJ5A 5JW6A 3AHIA 5T5QA 1TAGA 2EX0A 3FHJA 5EA2A 3MK31 1W46A 3MMZA 1EFPA 5ALHA 4O4JF 2X58A 4LIPD 2JAQA 2XWBF 4OL0A 1F2UB 1J0EA 3EB9A 4R0NA 1FP7A 1UPBA 5HDBB 1SKBA 1YZ3A 1E2GA 2XR1A 2GHTA 3CX3A 1UDAA 4ZJPA 8GPBA 4A0SA 3T9CA 3H1TA 2YOFA 2D7DA 2HLDD 2ZDGA 3UHPA 4S05A 3DLPX 2WUFA 3EGIA 4KLNA 1G4HA 3OH8A 3O3MB 3EDYA 1XLUA 2W6OA 4FKBA 4LHVA 4B71A 4GNKA 4B44A 4G65A 3NVMB 3BXPA 1JA1A 3L8FA 4ZT4A 2QI9C 1L4HA 4BFSA 1NBMD 3DDOA 2XMGA 4UPEA 2IV2X 3FGNA 1E9VA 2CFTA 3O8OA 1E0KA 3BIFA 4BIMA 4IGFA 1U4SA 4JLVA 4RBNA 1SCBA 1G2IA 1ZEJA 2IYLD 2YUIA 3ABZA 1NYTA 3B6KA 2WG0A 1WNTA 1AKWA 1MIOA 4TMWA 5EY5B 4BLWA 5FA5A 3Q6MA 4GMKA 3JWPA 4OB7A 2GEKA 3RHSA 5G2FA 1TYZA 1Q2XA 4DIBA 1JYEA 2DQYA 4P4LA 1I01A 3MCZA 3WMRA 4C4RA 1A9RA 2ODPA 4TXNA 3GFRA 1RCUA 1SG0A 1SUPA 4FLMA 4JY7A 3ZDZB 5IC4A 2JFNA 1E3DA 5JFOA 1E92A 1Q0RA 3ZV3A 2EJVA 3LHIA 1QO7A 1EM6A 5SYMA 4C3OB 4PYKA 1JHXA 1C0IA 1QPBA 3CVOA 4MLZA 4P98A 4WNYA 4BDTA 4XD7A 4FGLA 2VH5R 2GB4A 4MK4A 4EAQA 2AEFA 1IJBA 3FMIA 3NQ41 3IP9A 3ZQJA 1XQ9A 2IW1A 2I7CA 1QQBA 2Q4TA 4D43A 2FSIA 2OL4A 2RGCA 1N1MA 2R0QC 1NNUA 1RRMA 1O95D 3E70C 2LIPA 4ER7A 4LMBA 3H1EA 4HNSA 2E9SA 4TTVA 2BHRA 4F92B 1C41A 2UUPA 4PX5A 1W4RA 3EFEA 1H0SA 3TIFA 1EUCA 3MQFA 4B34A 4KUGA 2XTZA 1E4EB 5T57A 5JCOC 1QIEA 4KVZA 4C0KA 3PXEA 3RS7A 4GKVA 2Q3EA 5FI3A 1ECFA 1Z5VA 2AXEA 2BJWA 1JEYA 3OJCA 4LWOA 1UMDB 5C8YB 4DLKA 2F1IA 3TRKA 5AW3A 1SXPA 4QQRA 4NRDA 4CV1A 1RE1A 2OFOA 3FNEA 2D00A 1FSPA 5L3SA 2PL5A 4TXLA 1EINA 3M9XA 3E1GA 3LL4A 4KR3A 1QE0A 2IEAA 2P2CA 2GEUA 4G09A 5CT6A 4JBIA 2BFBA 4RULA 4I9GA 3VNQA 4YFVA 4FOTA 1R3DA 1FLVA 3WBJA 3RYCA 1R2QA 2BUCA 2R4UA 1ATZA 1ELOA 1R10A 2Z1NA 3F49S 3Q2IA 4UBLA 4IHJF 1WV1A 5LKRA 2FN9A 1K6MA 2BW0A 3IQEA 3OZEA 4ETWA 3K9BA 3MTEA 1SU4A 5ADVA 2H4FA 5ALEA 2ERXA 5BYAA 1RYMA 1JAYA 1DZ3A 3IP3A 3K0CC 5FFMA 3R9KA 4BP1A 4HQRA 4EL0A 1WHSB 5SZJA 4A8JB 2IOQA 4R51A 2PFKA 2GSDA 3TCNA 2XWSA 2QE7A 3QEJA 2TYSB 2GA9A 4BFWA 4IDCA 4H4CA 2PRZA 3OPQA 4L57A 2Z6VA 3TW4A 3DH0A 4X6UA 1T8YA 4XGKA 1AKVA 1YS4A 1EH5A 1KU6A 2D8AA 4DBLE 4Y2RA 1TFRA 1G59A 5AJUA 2OKCA 2A57A 3SOPA 3JPWA 1LDYA 3PFWO 3EHDA 1UDBA 2CEAA 4AX8A 1XRSB 4KG7A 1NPYA 3M1YA 2YY6A 4P22A 2ONJA 4BO6A 4E07A 3EPRA 4IJMA 4DOMA 2P9JA 3LDUA 3WICA 5BPFA 1SXJE 5I4IA 3U5ZB 1WDKA 3A6KA 4R01A 4GC9A 2EFEB 5CJ2A 4ZYXA 4F1KA 2I52A 1RBYA 1V6CA 4BGVA 1EIZA 3UG6A 3FSEA 5BOSA 1FDTA 2CHUA 3NDIA 1Z62A 4HI0E 4WKGA 4XWAA 4A82A 4D9FA 2ZG6A 3A1FA 5KTMA 2LMEA 1T4MA 3CRVA 1ZRSA 3EFBA 3N2LA 4G25A 2C98A 4P4UA 5DZSA 4ILEA 2PL3A 1Z4LA 5E3IA 4AW9A 3ETGA 4ZZIA 3WB0A 2C83A 3KOXA 3PQ3A 3KKLA 5KWSA 1P1RA 5IHPA 4FYKA 2PMBA 3SX0A 4MRAA 5F7OA 1WPGA 2WOOA 4ZALA 1IPFA 1B0ZA 2C9YA 1KP2A 4WECA 3MAGA 1F0YA 4KNVA 5AIAA 1U0SY 4KYTA 3N6RA 5JE8A 3NP9A 4PYOA 2VL7A 4OJMX 1U8TA 2V7UA 3VU8A 1GZ4A 1TQ6A 2RKOA 1CUUA 1FTQA 5HS6A 2A5GA 3EJ6A 3JVVA 3JQDA 3VO2A 1MO5A 1IBSA 2I2DA 3NRCA 2ZU6A 4NJMA 4QDUA 4QRHA 3ZX5A 4HMQA 4WIAA 4HZUB 4IINA 4JKOA 1O9BA 4JDPA 2AXQA 3B51X 1Z7YA 1BWSA 1MV8A 3UHAA 3AUKA 3W5IA 4KX5A 2XVYA 3QVKA 4ZXFA 3R7SA 1A27A 2HJVA 1GA4A 4B3IA 1YS2X 1L7DA 3GDHA 2BZ0A 3PX3A 1BKYA 1TF5A 2I3BA 4R1OA 1S3IA 4PNPA 4OXRA 4PSVA 1QORA 2HCBA 2WF6A 4FC7A 4RQBA 4ATNA 1N77A 2XBMA 3U7EB 3E22B 5IBPA 5JSQA 4PQRA 4F6CA 3PB3A 1JPUA 3UOGA 3ES9A 2DFLA 4UEWA 5CIWA 4PQEA 2PTHA 4LFBB 1GGJA 1UBMS 3QVVA 5JJKA 3TQQA 5CLJA 1IN6A 3EDMA 4CTNA 4JLMA 3GHYA 1Z0IA 3P20A 4AJ4A 4ZEMA 3H5NA 4OFBA 4URVR 3ZE8A 3E9DA 3JQ8B 5FAXA 4KE7A 3WI7A 5I45A 1X7YA 4PGAA 1PWZA 1Q11A 2JDIA 4XJTA 5AJTA 1YCDA 4YLEA 2VK2A 2FR0A 3JQBC 4P3OA 3LYHA 2R1VA 3T7JA 5L4NA 2IDKA 3N59A 3RIGA 4HAUA 2O0MA 5ALOA 5JYBA 2HCFA 4N0QA 4MR9A 1DBIA 3DWEX 4GP7A 3URMA 2Z5GA 2NSHA 4OJTA 1JI3A 1GZ5A 2PV0A 4ZANA 2YC4C 3EIWA 2JHFA 1BA2A 2NGRA 3R0QA 4NBVA 3U3RA 2XE4A 3WIBA 2G88A 3DE7X 3ICQB 1TX4B 5HGJA 1OXBB 2J7KA 4UHFA 3ZXSA 2ZETA 3W0LB 4F1JA 3LLMA 4TV9B 2WU8A 2B4KA 5DCYA 2O2HA 3Q3JB 5CX1B 5LLDA 5AKGA 3PUYA 3D4NA 1KYXA 3OOSA 3DZFA 5FTNA 1L5NA 2WV7A 3I01M 4QOSA 4A9AA 3IHTA 1JHUA 4MXDA 4RVFA 4Z9YA 4RVCA 4PLGA 4NL4H 4TRMA 2H0AA 2REBA 1KC3A 4OL9A 4MMZB 3S3TA 1SBNE 3R3XA 7REQA 4ZQFA 4LJAA 5IG2A 1QWSA 1E9FA 1QVRA 4G1UC 4J0FA 1S8NA 2B0CA 2HNBA 2ZKLA 2QM7A 4WEQA 1TT7A 4I0WB 4O2AA 2LCFA 1EK6A 5LQUA 1K6JA 1MAWA 1Y8CA 3CRZA 3PK0A 2X0DA 3LW7A 2FZCA 5H1YA 3T0FA 2B37A 3OBIA 1GTRA 3ZCRA 1N36B 3RSZA 1J90A 3I37X 1R9MA 2O1EA 2WSBA 5AHXA 4PEVA 3VPCA 4FBLA 4PF1A 1YR8A 4LVNA 1PZGA 3AZPA 2ZULA 5BXYA 2X3YA 1HEYA 3ZI7A 3FWZA 1J00A 2AYXA 4K9QA 2QL6A 1KKLA 1X1BA 1W75A 1C1DB 2QL7A 5DHFA 3UFXB 2I91A 2UZAA 1UZMA 3X1WA 1GKYA 1EFVA 4KWEA 1MR3F 3VNBA 2R00A 4C0WA 4EF5A 1XJCA 4EY7A 1NWHA 1X6VA 2A1IA 2ANBA 5CB0A 2DCMA 2EERA 1I8TA 2BEJA 5EJEA 2Z6QA 1LS6A 1LC3A 1OLSB 1XUOA 1Q17A 3LY8A 2VK8A 3HFRA 5DK4A 4BO5A 1EU1A 2OZLB 2ZSDA 2HJRA 2Y67A 4KRGA 5AI8A 1X7WA 2Q3MA 1T9KA 3I8SA 5BNTA 2I4LA 3ENVA 4YRNA 4YV0A 5JY6A 4EW6A 1TVCA 3FY4A 3M34A 2C9CA 4AS2A 3OFKA 2ORVA 3SIPA 3TW8A 3TGPA 4NCAA 1HQDA 5B1HA 4K5QA 4S04A 4RTPA 4RJKA 1UOOA 1YH3A 1M75A 1C0EA 3GXOA 4K46A 1VE1A 2FFHA 2PM8A 3N75A 1P2FA 3CISA 4IIUA 2B3TA 1XFAA 3AXSA 1RM3A 3FPCA 4KAAA 1VCMA 2PYZA 1GNLA 3E48A 2X4LA 3H5TA 1X7GA 1JYSA 4S2EA 4RL6A 3WWDA 4B81A 2G36A 2PPVA 1L5OA 5DMHA 1E2LA 4TKUA 1XU7A 1VLMA 1N2JA 2EHDA 4YRKA 3I5YA 4I5DA 4QBKA 4ZYVA 1WMDA 2OO7A 5D3ZA 2BI7A 1GXSB 4GKBA 3ZCXA 4FINA 5IKOA 3KD3A 3IAEA 1KJ8A 3T3NA 1GQFA 1FRNA 2GI4A 2LR0A 3EGOA 3HR8A 3QELA 3D6HA 5DGTA 1IL0A 2R7AA 2RIRA 2NPFA 1VYTA 2WHPA 3VHXA 4CEJB 2FZWA 4Q6WA 1QHXA 4LI3X 4IDFA 3JQEA 1VFPA 1YZQA 3HYTA 4ONEA 4OHXA 3U7IA 1SGWA 4TZ6A 3FMPB 1U11A 1SUBA 1DTWA 3CG4A 1KE2A 3QNMA 1H65A 5A9RA 3KDPA 2XYPA 4M0MA 1SU7A 3ZBPA 5JSZB 1IQUA 4TQAA 3GJQA 1ZJZA 2GPNA 5B1YA 3UJPA 1L3CA 4A1FA 3DBLA 2ID4A 3L4BA 5JI3E 4UVEA 2H5JA 4HNGA 1V16B 4MPDA 4BL5A 3DE0X 1DEKA 3ULKA 4F9EA 3QKTA 4MQ4A 1RJFA 3BQ9A 5ALZA 1HO3A 2R8EA 1H3FA 1K6IA 2PZKA 3LXRA 4G84A 1EHCA 1VBNA 2PSFA 4L2IB 4TTQA 3V2HA 4BZZA 4DC0A 1HK7A 1KWKA 2G5GX 2JFWA 3VU9B 2PSDA 2W7TA 5FBZA 4KR7A 3RBAA 2PBFA 4OQLA 4Q3AA 5LP6B 1IFXA 1SC1A 2C0CA 3CX6A 3L2OB 4IYJA 1E7RA 1S3FA 1Q16A 4HD8A 4IOLA 3CW9A 1B73A 1PHPA 2IK8A 2QN6A 2TECE 1TVEA 4L3VA 3GH3A 3W3AD 5LQDA 3S40A 2O8CA 3YASA 2C07A 1DBWA 5IVDA 3A31A 4G6ZA 4G23A 1D6MA 3DBLB 2E6KA 2M6SA 2QUHA 3O91A 4L8GA 4CMBA 1MJGA 4QTZA 5IAEA 3OZSA 4TMVA 1R0ZA 1JZSA 1YR9A 5CVEA 2WMNB 1OLXB 4IMJB 4B84A 4DIMA 2V0CA 4ZZ0A 2L2QA 4JHXA 4QOFA 5GONF 2PCJA 2OBXA 2HY7A 4TQUS 2XHEA 4L5IA 5IBRA 1BWQA 3HVRA 3FXAA 5FTMA 3USZA 3WGMA 3LQ4A 3DFKA 1HE1C 1SNYA 1QCCA 4M1KA 4XGIA 4D2IA 4CEJA 2WIKA 4Y9SA 5H02A 2EW2A 3ORFA 2H1SA 3KQNA 4IOMA 1GQ2A 3UWKA 2VP6A 4LX8A 1U4OA 4I1YA 4L8WB 3RREA 1GXSA 4MAFA 3TAXA 3F90A 4IQFA 3JYHA 4YALA 4BUZA 3O0DA 1LI5A 2VUHB 3PWSA 4CL2A 1XNQB 4O2BF 4FEEA 1U7OA 2ONZA 4BP9A 1QR2A 5BVGA 1X0VA 5BYJA 4EW3A 3A70A 5ALFA 3W7BA 4F45A 2C7BA 3UWMA 2FB9A 2MIIA 4L08A 3UC9A 1WOYA 3UKOA 2E4AA 3CX8A 2JEZA 4Y1GA 1LLFA 3VR6D 1WUIS 1E5XA 2B1IA 3E9MA 5ENDA 3CNNA 1JEDA 3WQBA 3AETA 2OCIA 3OMWA 1RXWA 1Q83A 2OFPA 5AOAA 3WFJA 2HHAA 2B9VA 1YV9A 3TCKA 2J9FA 2FFAA 1AQNA 1UXHA 3EEQA 4JN6B 1N9GA 4IVRA 1QZTA 3ZD9A 3GD7A 5K20A 1NQAO 2F3PA 2LKCA 2O2SA 2OB1A 4GC5A 5EJFA 3AI2A 4PC1A 3TSOA 3ZV7A 4JCCA 3U17A 4PCUA 4EECA 3C5VA 3CEJA 1A9XA 2HPHA 4EPVA 2B94A 5L3QB 1ZN2A 1X15A 1SO8A 4G4SO 1A4XA 2QB5A 4CW7A 5ITZB 6REQB 2OCAA 4D3SA 1CJBA 4FS8A 4OXQA 5EYPA 4TT8A 5FOWA 3HO6A 1KAHA 3NC4A 1E96A 2AA3A 4Z9BA 3EPPA 5FBWB 2QLFA 1I7SB 5LJLA 3CA8A 4AJNA 1YZNA 2ASEA 4S0XA 4NE9A 2AB0A 5CHYA 1CD5A 1NU8A 1OVGA 4BY9E 3FPBA 3DZCA 4MB2A 3P9KA 4IS3A 1J0AA 2X0EA 4D25A 3T7RA 1MO3A 1M74A 1Z7EA 4EYOA 1Y4DE 5KSOA 4QYIB 2AFIE 3T34A 4F38A 1JR2A 1P0FA 3RK0A 2CHVA 4B82A 2I4IA 2O3UA 2ZTHA 3ZI4A 2EP5A 4MQFA 1N6OA 3A0RB 1EJ0A 2XMPA 4LRUA 4LVCA 3ZE7A 4BNWA 3NFRA 4AKEA 3PDHA 1AZLA 1IRXA 1J7JA 2YVAA 1UC4B 4L7QA 4QPZA 5EJMA 3PEWA 4BBPA 2EZTA 2GBFA 4BO2A 3T99A 2W8BB 1L7QA 4DT1B 1QG4A 1Z4IA 4X63A 4G0WA 2P9YA 5CA1F 1CHDA 5JANA 1QIHA 4D99A 4R0VA 1YVEI 2DUUA 2QXYA 1EFHA 3GPIA 3THOA 5C5DA 5IMSA 1VYUA 2CJPA 5JH7A 2ZRQA 4RHCA 5D86A 1I5EA 1YI1A 1DIAA 1YVUA 2N46A 1ZRHA 3LH5A 4IZHA 4EGJA 2OAP1 4K28A 1KI8A 2ZDHA 3EMOA 2C8JA 4HFMA 4ZRNA 2YNMD 4B0PA 1VLLA 1PLLA 2PHZA 3OQMA 4LJ8A 2DY1A 1JG1A 3FRJA 1J1IA 3IURA 4CVNA 5KNCA 3H18A 1X1QA 1WA5A 2GDZA 2PS0A 2YZNA 4GQBA 4WLOA 1RAGA 5AM5A 3ZW7A 1BMFA 4XEUA 4H1WA 3LOUA 1N57A 1XJWA 4XAQA 4Z1MA 1EESA 4JLBA 3N2GA 5DULA 4HN9A 5AHOA 3R9XA 1A8HA 1KSHA 1VRWA 2DFKB 1TQ4A 2L0XA 3KDSE 4AUNA 4E09A 4YP6A 2BUAA 1F7UA 1Y5LA 3E3OA 3FCAA 3EWAA 2I4OA 3DPSA 4IWNA 5EUCA 2P5SA 2YHSA 4KZKA 4GS5A 2OOKA 3B9QA 3EFHA 5ELMA 1X38A 3FYHA 2ZQYA 1VRCA 4RIFA 2CL6X 2JJ2D 3NHAA 1PGPA 1X1RA 3LRXA 4RXUA 1HUQA 1Z2DA 1X0XA 2Q5OA 1VB5A 4MQBA 1G5IA 1IBRA 2OGFA 2JLCA 4PR0A 1Z2CA 5L7YA 3BKWA 5THQA 4BMCA 4ZYLA 3L05A 5I9MA 3NEPX 4EY3A 2J1LA 1C5KA 4RPLA 5I8WA 2CB0A 3UK1A 2E4ZA 2Z08A 2XIJA 2QN3A 2YV5A 1C30B 2R8OA 4FYMA 1II8B 4MIEA 4LF9B 4WVFA 1XZKA 3JQGB 4NEGA 3PDCA 1DIBA 3VR2A 3LCVB 3RUDA 1Q14A 2XEXA 5K8UA 4GX1A 3AVYA 5LIRA 4JP1A 4X24A 3T94A 4IOJA 1MQSA 1U80A 2WAYA 1A7AA 1OXXK 1E1YA 3IELA 3RRNA 3H83A 2Y68A 1XO1A 3T3OA 3Q3VA 2CWWA 3NV9A 2HZ7A 1ABBA 2A9FA 2ZSUA 4LHZA 2IY9A 3CE9A 1EBUA 4ICIA 1YZUA 3TIIA 3U0BA 5HQTA 4E32A 1Y3FE 4GH5A 3SSMA 3CE6A 2WJIA 3V6MA 3COWA 4PZEA 3S2FA 3T3DA 3UW3A 3QUBA 4PLHA 3THXA 4DLAA 2BMVA 4D6PA 5DIFA 2GMWA 4US1R 3TTYA 4BV8A 2CDAA 1UL1X 3ABOB 4KX3A 1TCAA 4ID9A 2FHSA 1NP7A 2FZ5A 3C3JA 5DHSA 2YIVX 5BY2A 3LBIA 4UE3S 1T25A 4FE4A 3WSVA 2ECPA 2RDMA 3Q7IA 2BGGA 3ELWA 1KQGA 1P0CA 3GBVA 4Q21A 5G3ZA 3VR5H 3DS8A 1YDMA 2B8NA 4PGHA 5A71A 1XMIA 2W2KA 4M8KA 1IXKA 4CL8A 4MMXB 5AKYA 3VISA 1VSTA 5I7UA 4MHTA 2WD8A 1WULS 4P9NA 3HA2A 4GOMD 4Q15A 4C2TA 4NNPA 5H9VA 2X0NA 1H85A 1A5AB 3CFHL 1XWWA 1UXOA 2GASA 2J5KA 1EWVA 3F73A 4AO8A 1IPEA 2PGIA 1JQ3A 4UEKA 2VSOA 2Q2OA 3GI1A 4KJZA 1E6KA 4V38A 4DG5A 5F4BA 2NO0A 3BRCA 4H7HA 3HJGA 3LG2A 5FBVB 3EE6A 2AOUA 1SUCA 1XKXA 1CUFA 1W4LA 3ROQA 4AJ1A 3AEUB 4MI1A 3ZHQA 4JMPA 4BKQA 1UBRS 1ZI8A 3DCNA 1VPLA 1WE2A 4QUGA 3FOZA 3SZUA 3DL4A 1TJNA 5FTJA 2NG1A 5HBRA 1V8PA 3FTPA 4HC4A 4DEVA 4QULA 4X8MA 5K0GA 5J4LA 1OMOA 2WLTA 3A1VA 2AG6A 4RSGA 5EZYF 4D1YA 2QTTA 2QOEA 3NBAA 3BCSA 1Y4AE 2H07A 2REQB 3G0CA 1GEGA 2QUIA 4FXPA 1OAAA 2YXDA 4MQFB 3N6XA 4V0OA 3TL2A 2D7JA 4N0PA 2UZ1A 1DTSA 1A9OA 2CDCA 1YR3A 3SS9X 3EZLA 4F71A 4W7SA 3AR4A 3B7WA 3ZWBA 4Z7QB 1EFAA 4ED9A 1OOEA 4RGYA 1NV9A 1FDVA 3AGPA 2C0QA 4ARZB 3R6WA 1JA0A 2AK3A 1LK7A 1H5NA 3T3GA 4EJ0A 2WJVA 4FDVA 1KTVA 1CIJA 1PQ4A 2HREA 3BBPA 4DMMA 1KEKA 3B85A 1NURA 1BGWA 1XDZA 2AXNA 4JJEA 4U7FA 4ABTA 4LDJA 1FSGA 2BUBA 2I4TA 1EA5A 3A6EA 1QTIA 3B2EA 5EYPB 1Y7HA 5F35A 3PE3A 3QHAA 2M6RA 4L02A 2UV8A 5EP4A 4DMKA 1NVXQ 1YFKA 4CKCB 2AZMA 3QOFA 4KCGA 1MO6A 1H6AA 1TZCA 5TXGA 2CXNA 5L3QA 3FTQA 5I7EA 1D6JA 4G86A 2WE8A 3WRWA 1PX0A 4AMZA 4J0KA 5FBLB 3UC5A 3CXRA 4FR2A 1ZU5A 4NCHA 2CLDX 2H9IA 2VHVA 2ZBGA 3ASYA 3C6QA 1ESZA 1KNXA 2IYVA 1PNTA 2OY0A 2IHJA 1QPGA 2KW5A 4DCUA 1RHKA 4XUDA 2DETA 2NP6A 1DC3A 2O7VA 2CUKA 1PJCA 4DDKA 2P1RA 4B3CA 2QPLA 5LC1A 3MLBA 1L5MA 2LNDA 2ZIVB 3QKSB 3CW2A 1KSJA 1Q44A 1X9HA 4YUWA 2M6KA 5L6MB 4RV4A 3QGMA 3EPJA 1NGSA 5DBIA 2K6GA 4DHWA 2OSBA 1CF9A 2CMKA 4NV3A 4CIDA 4CM3A 2IKQA 1RLOA 1WUTA 3Q2OA 1ULZA 2CLLB 2IUYA 3PR2B 4N6OA 3LZCA 3NYRA 5LOVA 4KO4S 3EQ7A 3W5AA 1JJFA 4P0PB 2IYOA 4QNRA 5DH9A 4NARA 6Q21A 1EAMA 5K0TA 3GVCA 4C01A 1TZBA 1V8DA 2IS4A 1NBIA 2AEMA 2PKEA 4EYSA 5CBKA 5HIAA 1IZ0A 3GAZA 4Z99A 3UUFA 1IHPA 1YSCA 3EGDA 5KINB 2LDXA 2H16A 4U7TB 3TLBA 4DQDA 4MR8B 1T9BA 2WI8A 5ALMA 4FWBA 1E9RA 1D2NA 1NM5A 3JZFA 1CSEE 5CLIA 4EATA 1L7EA 4MWDA 3EVCA 4P32A 3QFRA 4XD2A 1ID8A 3G7NA 1WVIA 2BHSA 4MDYA 4RSRA 1VCNA 2JCBA 4RZ3A 3RVLA 4E13A 2YIJA 1CZKA 1PGJA 4HB2A 4LEIA 5LA6F 1MAHA 1N5MA 4YJ2B 1T1GA 2OTCA 3KSMA 4MIKA 4OFZA 4CMJA 2VQFB 3K2EA 1JPNA 3K8OE 1JVNA 1M6YA 1SHZA 1E2MA 2HLNA 3FI0A 2W2MA 2WFZA 1E1MA 1J9ZA 1NU6A 1XNGA 2P4HX 4D45A 5AKKA 2P7HA 2G1AA 3LHDA 4MRMB 4Q37A 3GGGA 3PFCA 2C03A 3GJ3A 3CCCA 4FQ7A 3UBMA 1G18A 3A4LA 3DOIA 3F6EX 5DM70 2ZUEA 1V43A 1C0LA 1P2UA 4BTLA 5LZ4A 2KLBA 3NGLA 2OV4A 4TOIA 3WO0A 1NVFA 2Z2ZA 4ZQBA 3GT4A 1B1CA 4RTLA 1SKQA 3AU9A 2W98A 5IDWA 3AUYA 4IJUA 2VJYA 5JTUA 4L5YA 4LF4B 4U2DA 1OROA 1VL2A 4RF5A 4GMGA 4EA8A 1QOQB 2Z56A 1OBCA 1MX3A 3CIOA 4H31A 4KAXA 3LO5A 1RQNA 2QX4A 1JEQB 3ZGLA 5CAEB 1V7QA 2CLKB 4C4YA 4Y9UA 2ZSHA 2AKEA 4K05A 1CDEA 4OAQA 1T5OA 2R2GA 2VXOA 3PGKA 4UNIA 1TEZA 4EGCB 5C7YA 2X9VA 4QA9A 3U7RA 1IZZA 3A05A 5A06A 3W34A 2E85A 2VJMA 3QQPA 4HH4A 4RK0A 5B2EA 2PWPA 2ZI6A 4DBVO 3HDQA 1JWLA 2VHCA 2HWKA 4JYCA 4NEQA 3O47A 4P4GA 3IR6A 4Z8XA 1NDQA 2H06A 3RYHB 2WWXA 2XUZA 2DUWA 3KAKA 2OFXA 3KYBA 1FDRA 1YFZA 2M1ZA 1SUDA 4HB3A 3FCEA 3EZYA 5JMOA 5K8LA 3ZCQA 5HS4A 1LRKA 1AHPA 2IPXA 2IBMA 2OBLA 3RJ9A 3VO8A 4RHEA 5HJ7A 2A5LA 5HCUA 2P4QA 3LHSA 4PLTA 1W1IA 2PJDA 2HPAA 3FDZB 1EE9A 3EZFA 3K6KA 2Q6LA 4P86A 5ADUS 1YDHA 1WPXA 2O3SA 4KRYA 4MS1A 5LQKA 3BMNB 1KPHA 2PMKA 1XMSA 4XQ9A 5K6TA 4YRRA 4QXPA 1L7NA 2IEBA 1USVA 1I94B 3N70A 1C14A 2LCIA 4G67A 1AZSC 1T15A 4OFWA 5AOCA 4CM8B 1KQFA 3M81A 3UK7A 3ZXYA 1H1TA 4G0VA 4XW2A 3LYUA 3QLEA 2BGUA 3EVFA 5ALNA 1T8SA 2V54A 5EXTA 2X5JO 1Q5PA 2EL9A 4WXHA 3WLLA 3F8SA 3UXHA 1KHTA 1V9SA 2C2WA 1V3TA 3G5UA 1SCIA 2Y1EA 3VPHA 2PZAA 3HJRA 2X0IA 5KDLA 2CLIB 1YR1A 5C5IA 2RG7A 4JUCA 1PWYE 3BTUA 4B6RA 3QNWA 1TU4A 2X2EA 5F3RA 5LXTA 1V8ZA 1R5NA 2BEUB 4RF2A 3FIJA 1NVGA 1GNRA 2XB6A 5F23A 1JAXA 4YCNA 1M2HA 4TV8A 1RT9A 3WLQA 4EB6B 4YJGB 3PCRB 3QTTA 3FR8A 5DEIA 3T3HA 4XVQA 3FTFA 3UK6A 3AUUA 4D6YA 4HYQA 4UDXX 1EGAA 4M3NA 3A7DA 4PXSA 2G04A 3RUAA 5EI5A 4C4SA 1IN7A 1DAFA 1JR4A 1DEOA 2WWFA 1RCFA 4J7UA 1VFNA 5CDYA 5TMPA 4YCJA 4ND3A 2XXBA 2RHDA 1YVDA 3R9IA 1AGRA 2QP9X 4CM8A 5C18A 1ZG3A 2H00A 4U7DA 1FX0B 4KN8A 3HY6A 4JYZA 1ZJ4A 2IZ5A 4Y2QA 1XHEA 3N2YA 2ZIUB 3NM6B 1IJEA 3DVAA 1H1DA 3P52A 1N6KA 3FBGA 1E2PA 2ZOSA 3DDHA 2WSMA 3N39C 3QE4A 3UCXA 2I7VA 3GU3A 3G8DA 4KQHA 4O2LA 1IY1A 1F3LA 4WEOA 3Q6NA 3R3UA 4NK5A 4UEOA 3ZXUB 4OO3A 5AVRA 5BMVF 2AMYA 3HXMA 2HEGA 3M5PA 3UV7A 7REQB 3QU9A 1CUEA 1IUNA 1FBNA 2RGNC 3G3EA 3Q41A 4ZO9A 1XJ5A 3R5SA 3P71T 3HU5A 2PX8A 4G1FA 4QHYA 1F0KA 3QVGA 5G53C 3QKRB 4W5NA 3S81A 1K97A 2Z4TA 4LTDA 1TMYA 1O0CA 3D4BA 3PFBA 4D46A 3RUIA 3OQOA 4MKGA 1K7EB 1CB7A 1U0NA 2QQGA 3DQQA 3RLFA 2CXPA 4GUDA 1QQ5A 1AKQA 2OBYA 2P68A 4ND7A 2I55A 2VTVA 3DDSA 1OREA 2JAUA 2DBRA 5IW8A 4QYTA 3VPFA 4EUKA 2W11A 3CINA 2H5IA 2I2XB 3QHPA 1YA8A 4P38A 2EQ5A 2ZJ0A 5AVZA 5K51A 4DLWA 2Q0SA 1Q84A 4LJ6A 2Q28A 3MWDB 5LQJA 1JI0A 1P80A 1WUHS 5DGCA 3BQNB 4FGZA 5A1JA 3LUGA 5AD1A 1FVHA 2PFSA 3K31A 2P9CA 4DR7B 4TMTA 2MR5A 2IHVA 5DTQA 2O8VA 3K1TA 1Y0BA 4WLNA 3RYIB 4UZSA 4C0LA 4YRPA 4ALMA 5IT5A 3OEHD 1U3VA 3O5AA 4LV6A 4ASUD 5THKA 3FWPA 4YAKA 3P7MA 4U2FA 3M82A 5F2KA 3WNDA 3TX2A 5DKFA 3BFVA 4YAOA 1Y6QA 3TRJA 3ETNA 3T61A 1Q0HA 3LF4A 4RY8A 4G26A 3UB4A 1EX7A 1BFKA 3EXEB 3OKFA 4OXIA 1QC5A 3EVZA 2CDBA 4XB2A 3U4IA 1YRHA 3FPFA 4AY5A 5HRCA 3IULA 3WDLA 1PZXA 1T5HX 5SY9A 4D9KA 3BBLA 3HABA 3COVA 4DJEC 3D3WA 4YJ2F 1Z07A 1CVRA 3EIQA 4HGZA 5HPYB 2VJBA 1Y37A 4YR7A 3G8BA 1PR5A 3ZG6A 1LW6E 3L79A 1J5PA 4W1SA 1MD9A 2ZWVA 2P69A 1KO8A 3STWA 5JSZA 1JXQA 1AO0A 1YO6A 2C2GA 1O5IA 3FMOB 4JASB 3UA3A 3OFSA 3PKIA 2A58A 3DNFA 4H3HB 1TCBA 1JHDA 3U4QA 2YH2A 1GUFA 2ZK7A 1XWFA 4NJMB 2HA3A 4JOBA 4U7PB 3HK2A 2X77A 2Z2KA 1Y33E 2N3ZA 5AM4A 2WZCA 3VNUA 5REQA 2VC2B 5I5EA 5K03A 4MRSA 2WHPB 3KQLA 1Q1BA 1ZHFA 3FNRA 4EKGA 2IXEA 4XFDA 3ZY5A 2JFFA 4OLAA 1YB7A 2XCUA 4ZMBA 3U60B 1LLQA 4TUYA 1N2BA 2C5LA 1KMHA 1SUSA 2ZRKA 3RSHA 5IFKA 1M2NA 1PR4A 1QG0A 3QI2A 5ALGA 1FS6A 3FOAA 3GJ0A 3OX3A 3WGVA 3U6KA 4FUTA 3MJTA 4HATA 3U3KA 1ZBDA 2HXSA 2FNAA 3L46A 3WLPA 4OHBA 2VG8A 1PCXA 2K4MA 3KK0A 4RLQA 4GU5A 1LTHR 1ODJA 2GVZC 2R11A 3DEZA 3EVAA 4AZSA 2EVWX 4WGGA 3V1NA 1ICEA 1QJ4A 4BV2A 5KQMA 4P3YA 1CC1S 1IEQA 1NTOA 3BH6A 3EIOA 4PAGA 3ZHSA 1RYBA 3I0NA 4L51A 4EOGA 2WUGA 1JDPA 1XEFA 3WA6A 1JTFA 3ADDA 4J7AA 2QTCA 3D3NA 2FR8A 3GLVA 1P19A 4ZI7F 1KBQA 1QGOA 2POCA 2QD3A 4MROA 1LVHA 3SXJA 1ONOA 3C5WP 2AJDA 2YFHA 3DE2X 1M5TA 4YAEA 4CMEA 2O9JA 2OZVA 1T6YA 4MVCA 1APBA 4YONB 3SQLA 2R6R1 2GBCA 1FL9A 3KBBA 1KTIA 1KQOA 1R6DA 2V58A 3PFIA 1XCGB 4IIGA 4M6WA 4CNQA 1F48A 3KZKA 1OAOC 5IT4A 5LU9A 1UKYA 1MGOA 3GOHA 3HCWA 1RZRA 4MQLA 2PKWA 3NIBA 3VZCA 1Y8RB 2YFYA 1Z0SA 3EF3A 3UAXA 1ZK3A 2OILA 1INLA 3OM8A 2B1JA 4Z0PA 3E27A 3C3MA 3R3VA 3I6BA 1NX9A 2IJGX 5KOHA 3JD0A 1E62A 1J24A 3THYB 3WLOA 5EMKA 4O63O 2BFBB 2PJRA 3SBEA 3IUMA 1G41A 4HDCA 1MC8A 3R0XA 5EHGA 3VPDA 1QH1B 3TLGA 1WS6A 3CPEA 1DAOA 1ZIYA 3O2JA 2EL7A 4RABA 2CNWD 1CY0A 1BMDA 2IXBA 5C8YA 2UU9B 4QAQA 3CC8A 4F3YA 4G9EA 1NRJB 3AHCA 2Q5HA 3A9RA 2D5IA 2O20A 2X7HA 2O52A 3REFA 1F8GA 2A7QA 5KTNA 4E15A 5BN5A 1RPAA 2HHLA 2QTMA 4Y6SA 5G0WA 1UANA 1TOAA 4Z0HO 2FV8A 1NF3A 3FFTA 3H0KA 2BYTA 5TNXA 4QBHA 6YASA 5JXGA 2Q50A 1FUKA 4NFSA 5U9CA 5JHGB 3KXPA 4MB0A 4RL4A 2A50A 3G2KA 4KXXA 4E3ZA 4QVIA 2QN7A 3SHFA 5CRIA 2Y2VA 4IFIA 1Z22A 2BI8A 2JLVA 5J2UB 4R3NA 4Q9LA 1H93A 3H0CA 2DQZA 3CN7A 1T26A 2BFEB 1EPUA 1J21A 3FCOA 3OD5A 5GZ6A 3U7QB 2BHTA 4KAFA 1ZC4A 4LOLA 3MJCA 3R09A 3F6BX 3B48A 5FYQA 1LS1A 3HFGA 2YOHA 1ID1A 1YWGO 4N0EA 5JCXA 4QJ5A 3RS8A 3AJDA 3K5IA 4Z7JA 5HK8A 3NDBB 2WYVA 3AR8A 5IUJC 5JV5A 1MJGM 1PFUA 2H2FA 4I4IA 3TKAA 2JGMA 3PEFA 2HD4A 1GRVA 4QBGB 3CUUA 2J9XB 1YL6A 1CPYA 2IY8A 2JASA 2VF7A 2YXEA 2P6MA 1WXFA 3PRJA 1J8DA 3PVSA 4JGBA 1HF3A 4BLTA 1MT0A 3PUIA 1MH9A 4AY2A 3ROMA 5DOZA 1TECE 1SQGA 3CO5A 3GEMA 3FPAA 2C9MA 3NU1A 1ADCA 4QTXA 1T6XA 4L73A 5AVWA 2QRHA 3F6PA 3JQ6A 1CF4A 2XF2A 3L0OA 2P2NA 2ZYUX 4C03A 1HZZC 2OR3A 2I6FA 4M1OA 3QBVA 5KHLB 3D7SA 4TLBA 2H0QA 1QIKA 1DL5A 1WZNA 3I4CA 3AY6A 3FHOA 3N6VA 3RABA 3IX7A 1X7ZB 5E0KB 3V46A 3VYVA 4QM7A 3C6BA 3MN1A 2Q2NA 3ACDA 1LW7A 2FG5A 4XPIA 3T1VA 1V39A 3NWOA 3F7NA 2QS9A 3HN7A 1O97D 4KAJA 5FQOA 3VVMA 5DISB 1II8A 3O1JC 1GAXA 2WWWA 2D8MA 4DLUA 5AQ1A 1O95A 3BGIA 4Y0AA 1RXVA 1AJEA 1ZCBA 3P9SA 4L15A 1WEKA 3OCCA 2C9OA 2BEVB 5TR9A 2WSSD 2FPGB 2OCXA 2HMWA 1QS0A 2ZKIA 3EDOA 4K8OA 4PLZA 3MJ4A 2C5FA 3Q5DA 3ONFA 4O4IA 2KLHA 4UBKA 5LB4A 3TZHA 4D97A 1RW4A 1T9CA 5CVCA 4MMYB 5EKTA 4DQUA 2ENUA 2H7VA 3KPVA 3PFKA 1ZCAA 4DE5A 1A3CA 2AXPA 3UJ6A 3Q98A 1MW9X 1SZJG 1KYZA 4XR9A 2ZRPA 5LP6C 3DJFA 4C43A 4Z6KA 5JQGB 4MDEA 3KLBA 1NSYA 4QTUB 3B1VA 4R3UC 3O75A 1MU0A 2OWEA 3GL9A 1JU3A 4TTAA 5JISA 3RADC 2H1RA 5DHUA 1YCGA 1Y7IA 3JR7A 3LJKA 1IK6A 3ZVLA 4E2YA 4JLPA 4S1TA 1F4PA 3RC3A 2A9OA 4GKKB 4R8RA 2I1LA 2FEMA 2WWHA 4B80A 3KLOA 4F0JA 4AG3A 2AZDA 4IL5A 5DP1A 5C0OE 3WSTA 1F9EA 2QQFA 1OSNA 3K1AB 3D0RA 4WDQA 2ZS9A 4O8ZA 1ZOSA 2N42A 4DPLA 3LX8A 4LF8B 1K75A 1ZKMA 3D7KA 2W93A 3OJWA 1Y5NA 4CF3A 2QTGA 4PZLA 5IAOA 3DTVB 1SWVA 4WY5A 2QZ4A 2J6CA 3DDNA 2F8TA 3ZHXA 2G4CA 1J5EB 2FSUA 3A9VA 3MF4A 5DU2A 4B9AA 3OOHA 2JATA 1A5TA 4DGQA 3HEBA 3CJRA 3UMSA 4ARCA 1DFGA 1IQPA 1L4LA 1L4GA 1NSTA 1KRXA 1Y98A 4BU0A 3GLSA 4HRXA 1DB3A 4OQMA 1TM7E 1MO4A 4CM1A 4CF5A 5CB6A 3RSQA 3BSFA 5ENZA 3LGSA 4EFNA 2G5CA 3FYCA 1F20A 4KQXA 2FPSA 2XUDA 1FU4A 5ELXA 3PG5A 1EG7A 3SMVA 4G1BA 1B6GA 4EPTA 3U9SA 1F1JA 4DJJA 1VJ5A 4PFQA 4KLRA 2GZMA 1BQ3A 1IB6A 2A5DA 4Y7DA 3THWA 1XMPA 1DAEA 3PC4A 2ZI3A 4JU9A 1EVKA 5AVJA 4DQVA 3IMEA 2B4QA 2XGOA 2Y2UA 2ZUSA 3NC1C 4K8RB 4LE2A 4QYMA 1WHTA 1Z6QA 3PPWA 3P0IA 2GKOA 2C4HA 2Z30A 3PNSA 4AG6A 4IUDS 3WS7A 3VPBA 4EG1A 3JAKA 1ODCA 5CT5A 2DJ5A 1REQA 2WJ3A 2R7LA 4H0NA 3WWCA 2X1VA 3CPSA 3JALB 1H6CA 2OCDA 4Q1DA 4C20A 1WHTB 1IZ8A 4GYWA 3C45A 4NMHA 3V1YA 3WGKA 1AKTA 3DBOB 3DFZA 4F9TA 3CZCA 2XXAB 1FUUA 2EW1A 4DMLA 3ZGOA 2JH8A 4JI0B 5J43A 3SZMA 2GYUA 1P4AA 3IVGA 1WD5A 2DYKA 1EDZA 4MKHA 1M0TA 3KQWA 3OKPA 2PX4A 2RHWA 4PIVA 3U4CA 4PYIA 3L4EA 2HRCA 1H0HA 1KJWA 1VMEA 1V1MA 5AVKA 1EDOA 1NW6A 3G49A 1J8YF 3PQ2A 3Q7QA 4R5HA 3WLHA 5CIQA 1J2JA 5IAKA 3GLHA 3KOMA 4JYMA 4EGQA 5EJ9A 5EHZA 3UJHA 1O08A 1N6NA 2WUVA 3RC8A 4B31A 1Z37A 4TRJA 4G8CA 2XE8A 1SFRA 3HCBA 3O4GA 3MWYW 1B8VA 3T52A 4YA6A 3OU2A 1JKJA 1JQEA 4AG5A 1HNXB 1N25A 4HPJB 1LF0A 2EARA 5BR4A 3OSZA 1MQ9A 1ICIA 2GD6A 4OB8A 1ORHA 4YAWA 1NN5A 2W2KB 1NBOA 4F3CA 3KL2A 1CUHA 1DDIA 1EFCA 1X8XA 2JRCA 1HE2A 1OTYA 2FZVA 1FTNA 1UBSB 3AI1A 1TO1E 1JG3A 2D0IA 2FEPA 3SR0A 4IF6A 1EBFA 2PKXA 3NH6A 3KZ1E 3E5MA 4RZSA 1T0PA 5DGHA 3CNLA 5CNJA 1IY0A 3TMYA 4PPYA 2HX1A 3M4XA 4LG1A 3V2UA 1T8RA 2GZDA 5FBHA 3L0SA 3IUYA 2UZ4A 1UXJA 2XYRA 1JSLA 4XCVA 1NKSA 3N0VA 2PMWB 3OX2A 1PUXA 2ZBRA 1GO2A 3B5IA 4RMJA 3T7IA 3O9VA 4TRNA 3RGWS 3L4JA 4KXUA 1L8QA 3WK7A 3DHNA 3ER8A 1V48A 2ZJ3A 3NWJA 3S55A 4A2PA 1MJ5A 1OZFA 1R0CA 4UREA 5G1NA 2APJA 1C7IA 2NPIA 1WETA 1KKUA 3K9GA 2ZUUA 1G6HA 1HSOA 1T3LA 2IITA 3I4LA 4OQZA 2RAFA 3NHRA 2JIQA 2W37A 1A4RA 1L4EA 2OQ2A 3A14A 1OLXA 3VZRA 1FNBA 4JENA 4UHJA 3TWOA 2B5WA 3QEMB 1AKYA 5AM2A 1CR2A 1ULSA 3GVIA 1Y8ZA 1T4CB 2OAGA 1GSAA 1VKZA 3PLRA 1PJ4A 2A3RA 4LYDA 1N78A 2EZ9A 2DF8A 5FQNA 2H3HA 1A77A 1TYAE 2FPMA 4B43A 5JBNA 4DLTA 1H9CA 1IDN1 5CLFA 1LV7A 1SZPA 1Y7LA 4KKXB 1BH2A 2RK3A 2WR8A 2AD5A 5GAJA 2ZJAA 1M2WA 4Y0VA 3EIXA 3DFUA 1NFRA 5UKDA 1CS0B 1NZDA 2D5CA 2AG8A 1I5RA 4OSOA 3W90A 1X42A 4B6OA 3RVSA 1M6NA 2PU5A 4JEMA 4UTNA 3QKWA 4F5WA 4X9XA 3D4OA 1GPNA 2J59A 1DXOA 2AEJA 1FZQA 1RVDA 5JD5A 2WJGA 1O8CA 1G291 5JLJA 3SZ3A 2NO7A 2P4SA 1BQ4A 3DF9A 5JDIC 3ODGA 3OEWA 4D4KA 3QMVA 1JB1A 1N3LA 2Q8QA 3BD9A 4HPXB 3VPSA 4EDFA 4EG7A 4CLHA 3HUUA 4M21A 5IULC 3BGOS 2G06A 3BN3A 1SUIA 2XEDA 3EYWA 2F43B 3TLCA 2Z2YA 3E2IA 3UMGA 4ZDWA 5C1OA 4FNGA 3KFLA 4MA0A 4PYQA 3K9LA 1EK2A 4DR4B 1K4YA 1E3MA 1H2ZA 3LYAA 4S1WA 5ADWA 5CCDA 1ZEMA 4C2UA 4EKIA 5FBRB 1VKNA 5AT1A 1XRPA 2XMBA 4D4GA 3MOSA 1AKEA 2DTEA 1SJ9A 1YNOA 3AFIA 3BVPA 4PLFA 1GNSA 4JQSA 2O8FA 4JT9A 2I2WA 1L5ZA 3GFGA 4TS3A 3VX3A 5IZ4A 3KZXA 5BN5B 4BQPA 4Z4EA 1NR7A 5ESXA 2QE6A 3Q15C 5JJLA 1Y1TA 1G21E 3I3OA 3UWOA 1IOVA 5K05A 3FYSA 2P2YA 3KUXA 2D5LA 3H5AA 5A4IS 4QSHA 4R16A 3RUCA 2R6GA 4EUHA 5HUJA 1CK4A 1RQ2A 3RTDA 1UP4A 4CDMA 3T7SA 3U19A 4W8HA 1HKUA 1QH1A 3VDQA 4KR9A 4K2AA 4BVEA 1G2PA 3D4IA 1XZGA 1IM8A 3GVHA 2V45A 2HIAA 4EG4A 1QVAA 3QF4A 4IVQA 1ZD5A 2UYYA 3P5BA 4UBNA 4UVGA 2GN1A 3T38A 3WYCA 4YMWA 2WWVD 1U2TA 5B3KA 1E4OA 3K0FB 1ZSNA 3FUCA 4FOOA 3ONEA 4D8WA 3VGJA 3KQVA 1Y80A 3EVNA 3NNNA 1ND6A 4EYGA 2ZVDA 5AW8A 4CFYA 2VRWA 1RAAA 3PKZA 4JUBA 3IP8A 5A3QA 1PT9A 1A0OA 1YC2A 1E94E 4J0GA 3NLLA 1NQXA 3P19A 4KIUA 1OXTA 5HRUA 4BTEA 3UJDA 5HKKA 4PHCA 5IZCA 1JG6A 3B7PA 3QUSA 4M86A 4PC2A 3OE1A 3LF2A 4F4UA 5TF4A 1KVTA 4Q3OA 4AWAA 1TMGE 4TYQA 3NP7A 5DDIP 2NTJA 3OI7A 3TF5A 3BE8A 3E0XA 4NCBA 2JGNA 4GAEA 1L5YA 4TGLA 2J33A 4UAVA 1YRAA 3ZWDA 1Y3IA 3EQ9A 3IOYA 3KHKA 2E82A 2HT1A 4XWTA 1HT1E 1U3CA 4JFAA 3FPLA 3R0VA 5JS7A 2C4TA 2G0NA 1L5QA 5DT9A 1H2BA 4OYLA 5IH7A 4KOAA 1K4KA 1QP8A 2TSYB 2OAEA 2FDRA 1BS2A 3KYJB 3PLNA 1DLJA 3Q87B 5EUMA 3CMMA 3SE7A 3UN1A 4U5XA 4Q3DA 3QLVA 3BGDA 1ECGA 4WK4B 2XCRB 1GZDA 4D9BA 4EUNA 3O8LA 1SY7A 1SXQA 2IHNA 1UT8A 4DNPA 3O93A 1S96A 1RC0A 4NBLA 1D9ZA 2QSJA 1XVAA 3W2GA 4YCAA 1SVNA 3NR2A 4Y2HA 1ZD3A 1TW3A 1GYQA 5TF0A 5I8PA 1NMYA 1EX9A 1VE3A 4GPZA 3C98A 4IILA 4KR0A 4FSXA 1G4AE 4XOUA 3NRJA 1RR6A 4RZUA 8ABPA 4WLVA 5IBQA 3LZ6A 2HSWA 4DRXB 5JROA 3MCAA 3PHHA 5LZ5A 4WAUA 1QE5A 4AB1A 4U8GA 5BW0B 1UBFA 1PEDA 1SA0B 2LUOA 3WSWA 5GM2A 1OAOA 1FFBA 2OB2A 3KKQA 2Q3DA 2XQIA 4H3VA 5G1PA 1QM5A 3QLJA 1YCFA 4Z8YA 3O74A 3M5WA 1DELA 5EIFA 4JBGA 4AVYA 1KU0A 1HSZA 1U3FA 2IY7A 2YKGA 2ZR9A 4WQMA 1ZK4A 5I3CA 2MSCB 1NY5A 4UUMA 3WBFA 3VVLA 3MD0A 5KYWB 3HZOA 1CIVA 4C7BA 3WNBA 4ZV4A 4X94A 3D6NB 4KTTE 2HU2A 4CQMD 2GT1A 1MZPA 4M88A 3RK4A 2ZW9A 1K92A 3RIMA 1PS8A 4PPFA 1T5BA 4WX2B 3AR9A 3LVBA 4YROA 2E21A 4IJQA 3OLXA 4QUDA 2YW9A 3COYA 3EY9A 2XDAA 4PNZA 421PA 1IN5A 3DB2A 4CHGA 4ZGGA 2JFUA 4JBYA 2AUTA 2H2GA 2Y1GA 1F8UA 4PGMA 2RC5A 2ADMA 3KQOA 4QREA 3FNHA 1KFCB 4DNXA 1PZFA 3EIFA 1BAPA 1I4EB 3VDMA 1QKIA 2OENG 2QAJA 4F11A 3PNYA 4HQ6A 2ZRMA 2MSNA 2VNHA 4LN1A 2PDAA 1V4VA 1E1NA 1PT5A 4M9ZA 2Y3IA 3SFVA 3HDYA 4ARVA 2QUJA 1YZTA 3QX3A 1Q3KA 3CLRD 1QFSA 2B7LA 1QHHA 1GL3A 2YJ6A 1EK0A 3QW2A 5DX8A 4MRPA 1ORIA 2NOAA 3JS5A 4BVGA 1A5BB 5JT1A 1JHOA 2P27A 5IN4A 1P5ZB 1UMBA 2OBMA 4OUDA 5FPYA 3T3PB 1U8ZA 4NV1A 3GLTA 3SYTA 1OX4A 3EK2A 3MWGA 2UYCA 3I5XA 2VNKA 4MA5A 5U1PA 4R69A 3NEAA 3M6LA 2OUIA 3HFSA 4PYJA 1VCIA 5H3HA 3H97A 2FOXA 1B00A 3QFSA 1TUEA 4DPKA 2PUWA 1C81A 3TOXA 2Q6OA 5TS2A 1C9YA 5DI3A 1CE8A 3JQCA 1TXGA 2R751 3JVIA 5LZ2A 3LBNA 5IBCA 1AO3A 1YS9A 1XYYA 3H9BA 3KM0A 3MJFA 2ZAGA 4XLLA 4YAFA 1W9HA 5GGXA 2OYRA 2X23A 2UDPA 3BK1A 4XM2A 3ZDFA 1RRKA 2QVCA 4YUZA 3F2VA 3UOAB 1I2MA 3DVAB 4FJ2A 3UYLA 1KJYA 5ITSA 2G9UA 5C1IA 3RK1A 3IHKA 3H9UA 4IHQA 3B3FA 2JKZA 3G9ZA 3SLKA 1B74A 3UH1A 5HIKA 4RPIA 3R74A 4AJPA 3T7DA 3KB2A 1CUCA 2JBAA 1O97C 4NTZA 3AUSA 3VVCA 2DBYA 5MDHA 3ZNPA 2WFLA 1MZVA 2IH2A 2OEPA 4G81A 2HMYB 4K88A 5JSYA 1PVVA 2FFJA 1L7PA 1XTKA 5FDFA 3KKKA 3CLSD 2ZROA 2AOTB 3TDNA 4WCFB 1X13A 1AS0A 3ER6A 3IYLW 2OCBA 3LU1A 1QB7A 3KWJA 4JLSA 4QFCA 4V03A 1ESDA 2BFOA 2GBPA 1VJRA 3DWGA 3K94A 1NZJA 2EKZA 2P35A 4P82A 2OP0A 3L8HA 1BIFA 1EFVB 3GOQA 4IXJA 2WKPA 4B3FX 2XJ9A 3KTDA 3ELDA 4GD3Q 1C1DA 2WUWE 3UMJA 1MB2A 1RWNA 3ZW9A 3M33A 4OHFA 3UMCA 1B43A 3CVWA 3JQ9C 1CETA 1F7VA 1P6UA 4FFVA 3RC7A 4B1FA 4I1RA 2O8EB 2BIFA 2GARA 2P5UA 1LZLA 3H87A 1D0IA 3FMFA 2DC1A 1E3SA 1XLTC 1M6EX 2QTAA 3LP8A 4ALKA 1B16A 2XITA 3IIKA 4JQOA 4L1KA 2WZBA 3KAQA 4GR5A 3F47A 4KE6A 3BMNA 4U9HS 4DMUB 4RF4A 2Q5EA 2V6BA 4ER5A 1UWCA 3PXAA 4I4CA 4JP3A 3RRJA 2PAAA 1E7MA 4S3MA 1O9GA 1I3MA 3TIXB 3TQRA 5CD9A 3PZRA 4B85A 3A2NA 1P1CA 4CR7A 4UFPA 3FNFA 3H9GA 1SOVA 2GJ9A 2PGNA 4KPYA 3PYXA 3KKPA 5T7BA 4M1TA 1I4LD 4WUTA 1CR6A 1KPIA 3CF4A 3WIDA 1IIRA 1WVMA 1Z0UA 3CLVA 5AW4A 4HGQA 4NH0A 5AI0A 3RYHA 4GM4A 1I3KA 1KNQA 3RYFA 4AROA 3F98A 3MGAA 5JZBA 5EIEA 2QIPA 1G5TA 1VMIA 2DHCA 1USWA 4YI3A 4RJIA 5FO0A 5TC4A 1MTOA 1ATIA 1M6HA 4N5LA 4R1SA 1IBKB 1T0UA 3HBNA 4U6QA 3WOVA 2XF8A 1GDDA 4NDAA 3TFWA 1ZUD1 2QTWB 3U49A 3NUQA 3HO8A 3L4KA 5IF9A 2Q4RA 4D9HA 3V7UA 4XUGB 2RIPA 3FDFA 1NW8A 3H2YA 5CVTA 1C3OA 2C5HA 1O6FA 1OBHA 4FR5A 4A0GA 5CFOA 4EG5A 1Z47A 3CWCA 4GBGA 4A36A 3AVXA 1O03A 4G5XA 1W5AA 3AKYA 4UTZA 4GPAA 1XRLA 4DCSA 4DZRA 2P5YA 5EMHA 5I9IA 3CVXA 4UUBA 5EPUA 1SC3A 3WISA 4C5AA 2Q8PA 2KYRA 3R6GA 4RANA 5EJIA 1Y42X 3P0JA 3PFGA 4HTFB 1IY2A 1YJXA 3SSAA 3WLEA 1JMVA 2WF9A 5BN3B 1XMOB 3NHKA 4NCNA 1Y4UA 3HB0A 4CR8A 1OPRA 4K6OA 4C78A 4C2BA 2BDTA 2VA9A 2XD4A 3N2IA 4HNAA 4AN4A 4BEVA 1X74A 3CNBA 2XT9A 4RPHA 3LUBA 2F00A 3M5CA 3UAOA 4DB4A 1VKHA 1NQWA 1GYRA 3VZPA 4D8UA 2F8SA 2EZUA 2IOHA 4EFKA 2OORC 3ZBQA 5BUCA 1U1IA 2MINB 2BMEA 3O8NA 3OLCX 3KS9A 4JDUA 3Q6IA 1LSUA 5JNLA 5IMBA 2QU7A 4QG3A 1WCV1 4AC9A 5EL0A 4YJ2A 1Q95A 5ALSA 3D7LA 1FBTA 1R3UA 4UNPA 1G21A 1YOVA 3BM5A 1Z5UA 4LJ9A 2HWWA 4LJ4A 4MB6A 2IECA 3TQCA 5GTDA 1OV6A 1UT5A 5GY7A 1Y3AA 3H11B 2VKQA 2WD7A 3ABQB 1RLJA 4PWYA 4QEZA 3S8MA 2ZVQX 1AMUA 3SQWA 2HLPA 4EJ2A 2WU0A 4IGAA 3P9YA 3MA0A 5AOBA 1UQTA 5JVDA 4UC0A 2FWJA 3LSYA 4M9SA 3C41J 1HPLA 2P6UA 3R76A 1ZHOA 2G70A 1UADA 3IBSA 3KUUA 3L6CA 3P97A 2ZJ6A 2XT6A 2EKLA 1E7YA 1XCJA 4ESOA 3AYXB 2D1SA 1RYZA 3TRIA 2PLWA 1Y6ZA 3QY0A 3U9TA 1JBQA 1KI1A 1G1MA 1N0WA 2WIAA 4XASA 5K0LA 2PUAA 1KO1A 3F4KA 2BBSA 4HDQB 5JALA 3OAAA 1O89A 4R7ZA 3MUFA 5ALUA 5BT9A 4RKQA 4YCDA 1R4MA 5FOXA 1JHAA 3EGCA 4PO8A 1EXWA 3FFXA 3H5VA 2VXYA 1XVTA 1YDFA 5BOSB 1EQAA 2ZSAA 3ZDYB 3EPHA 4C89A 1M54A 5J23A 4BNNA 5A4MS 1YBMA 3A04A 4Q9IA 2BD0A 3H86A 4FN4A 1YHZA 1S3GA 2GD0A 3B7GA 5TARA 4QSMA 1CNMA 3A1UA 3SJZA 3TINA 2YIDA 1O5OA 1XCPA 3PX7A 1S89A 2AFRA 2JA2A 1WP4A 2WPNA 3DMRA 3TSWA 3X2EA 5K0BA 3K1ZA 3PYLA 3OECA 4Q4CA 5KO2A 4JQCA 4JB3A 1A5SB 1SQ6A 3HVHA 3SNHA 3T1QA 4OQDA 5LOVF 4EDHA 2HSJA 2QSZA 4F7WA 1HYBA 2W2QA 3EH1A 3H17A 1R4ZA 4XQ0A 3A9UA 1H4TA 1PFKA 2CW5A 3LBYA 1NJFA 4XD7D 1XD8A 4OI0A 5KNDA 1U8AA 3EIHA 2NT4A 3WMXA 3QYJA 1M5RA 2GZ2A 2VWPA 2C2YA 3D3KA 3CVYA 2YWHA 3GH1A 4GMHA 4KFUA 1KQPA 4NMMA 2H2IA 4G5FA 1A7JA 1F4VA 2H1IA 4NVRA 5FUWA 4EF4A 4E6PA 3AKZA 5JXHA 4W63A 4K81B 5F9MA 1AIPA 2W70A 3M89A 4ZCPA 1BA3A 2RH9B 2I6TA 2PRSA 2I1WA 2CXUA 1K2VN 2UZ3A 3S1LA 1NDHA 3AXTA 3I34X 3K4HA 4ZREA 5EWJB 5I4CA 1KAMA 1USIA 2IXTA 2JFZA 3CKKA 4W7IA 5ECDA 2H1OA 1D2RA 4R2KA 2WK1A 4H6PA 4KO2S 5F1OA 4A4DA 1LLCA 1WX1A 1VSUA 1AE1A 3LT2A 4KC0A 4AMGA 721PA 3U7FB 1DRVA 5L3SB 1R0BA 2VT2A 3K3PA 1AKRA 2AK2A 1TDJA 3OPYB 3VHRA 2XZLA 1JB9A 1PSDA 2IOFK 4LGMA 2YS6A 4A8PA 1U0LA 3AM5A 2HH9A 2AE1A 2OG1A 3WHIA 2I76A 2PLAA 1G5QA 3E9CA 3QXJA 1TM5E 3BERA 3EWSA 1FMJA 3VFDA 3TD9A 1WUJS 3SQDA 1V25A 1P2VA 1YT5A 3PT5A 2KBEA 5EXSA 4FN5A 3JQFC 4RV5A 1TNDA 3K6SA 5DM4A 1F5SA 1GZVA 2RJ3A 3D1VA 5FJJA 5LQMA 4RTQA 2HU8A 2AOUB 2VYND 4UM7A 4N8DA 2FSGA 3T7EA 2VEOA 1N5OX 2I33A 5MN5A 4N76A 4FUQA 3WKEA 4OHMA 4E7PA 4DXHA 4Q4DA 3OPYA 3KHSA 2OAQ1 3A9WA 2NZWA 1B8PA 2XMZA 3A27A 3TNYA 2VLBA 4MKIA 3JAKB 5DBGA 2QENA 4U5QA 3R5JA 3RGGA 1V9LA 3RFUA 2QV0A 4EVSA 1K0FA 3S7ZA 2R5FA 2XA9A 1Z5GA 3CX7A 4N12A 1Q7GA 1WMFA 5F52A 1VJCA 1P9WA 3BMXA 3BIWA 2WIGA 3O83A 4Z49A 1GYPA 2TMDA 3BJZA 2ODTX 4H59A 4KWIA 3AUAA 3N1UA 2JS7A 1HDRA 1A2QA 3A6GA 1BCSA 2FWPA 2XNDA 4P3NA 1OC2A 1VXOA 1YR7A 3HXTA 2X5OA 3Q2KA 3PGVA 4HAOA 2NSDA 1GGNA 3DKIA 2FUG1 3V55A 3ZYZA 5U4QA 5IZCC 2QRPA 3PWZA 4LRYA 3LDAA 4WNAB 1UPCA 2ORED 3GFFA 1Y6FA 2D2XA 3K0EA 5DM0A 1Z82A 1IAQA 3ZH2A 4HRYA 5K8JB 4OH1A 4EVRA 2C59A 2EJWA 3G2JA 3WLIA 2Z4SA 1I7LA 2FWAA 1GT6A 2ERCA 5CYOA 4ZD6A 1QLJA 1Y4SA 4U39A 4X97A 4LRWA 1P4HA 1DE0A 1IHYA 2Z58A 5BUQA 1ZW6A 4MWBA 1J09A 1PO7A 2H2DA 2NW6A 3AHGA 4YRCA 4CM4B 2XYGA 4ZYZA 1IWPB 3OP4A 1IHXA 1YUBA 1CR1A 1RADA 3PTLA 2NM0A 3JQAB 2G67A 3U3MA 4BAUA 3IPYA 3WTCA 3C1AA 5ALJA 2FFRA 2V5VA 4MGYR 4NPCA 2NUAB 4B3HA 1TZMA 3TS1A 2DERA 1L4FA 1XR3A 1GNQA 3AUXA 4MHSA 4RS4A 3C24A 3DTNA 4FFSA 3BHMA 1PNOA 1SD1A 1UJ5A 4CRWB 1C1XA 5E6SB 4DLXA 1H2AS 1GUYA 2BWJA 1GRNA 4O4IF 3WBBA 2DE0X 4AYTA 1DBVO 5ER6A 1F14A 3JARA 3KELA 1GILA 2YDXA 4TX1A 3Q7SA 5BSEA 2BZGA 4J76A 4ZCRA 1EI9A 4MW9A 1WXXA 3JX9A 4JZYA 2XX3A 4DLSA 3ASUA 1PJTA 1WMEA 4CM7A 4FDMA 1YJAA 2RAPA 4W5RA 4LRQA 4WESB 3K05A 4RXMA 3RAPR 4X6LA 2PLFA 3RC2A 1NQTA 3KHUA 4RK4A 1XD2B 1QH0A 4B6EA 5HQJA 3L8ZA 4K9NA 1JMKC 4KMRA 5EZYB 1JQ5A 2E0IA 2HBQA 3CM0A 3IV7A 4ZDKA 1VJTA 2W2LA 1W52X 4L74A 1KAEA 3WNCA 3EVBA 1DT3A 4BCDA 5KPDA 1FP4B 1KK0A 1B8NA 2IEDA 3E0QA 5FWDA 5EMLA 1Y7PA 2W4MA 1KMIY 2XNSA 3HBMA 1E98A 4YMIA 3RSSA 4QM6A 5J58A 1UWKA 4GE0A 1IRIA 1XZJA 5GOTA 4GMXA 5I9SA 3DDZX 2NV0A 3NATA 5ECYA 1XROA 2XY4A 3HWX1 4XFJA 3K0KA 4LYYA 4QLOA 5B64A 2OWDA 2VPZA 3RTBA 3BD6A 1BXGB 3MTJA 3P2OA 1LDBA 3D64A 5H0IA 2HF2A 2O48X 3WIUA 1UKZA 5IAJA 3OAAD 2B2XA 3CWQA 2BP7B 2HGZA 1G64A 4MQ5A 1LSJA 4Q03A 1LY1A 3ONNA 1E8DA 2GM4A 1AKUA 4MKXA 1U90A 2XUFA 2Y0EA 2C94A 2J0UB 1FXSA 4JJ4A 1GU0A 3ZLJA 3ON5A 4CV3A 4FYWA 4L07A 4YIHA 4QQNA 4RLFA 2DH6A 5HM6A 5LDGA 3WGYA 5LD2B 3DLIA 4ZK6A 4WD3A 1FUIA 2CV2A 1VSQA 2GM3A 4X20B 4P35A 1FJXA 1WZUA 1T4BA 5ED4A 3ZD6A 4JHLA 4M0KA 3TZ6A 4EHBA 2N9UA 4XGRA 2A7XA 8LDHA 2D74A 3H3XA 4D0GA 1DJOA 2EBFX 3C4VA 3QX8A 3ZHBA 4BCBA 1EVZA 1MX5A 3E8MA 1M34E 1OJ7A 1O1YA 1UPUA 4TWBA 4Y7CA 1T34A 3RYFB 4BMXA 1QU3A 4WK0B 1AQLA 1L7BA 3IQHX 3JZMA 4WACA 4G0PA 4X92A 1OHHA 4QVGA 3AH8A 4CM9A 1UDCA 4BNZA 2ZANA 4JLOA 4U7JA 5MF6A 1Z2EA 1CUWA 1UBLS 4J3JA 3F7MA 3PYMA 1TQ2A 4R71A 4P3PA 3CVJA 1ZN7A 4C14A 1D7OA 1TD1A 2BR3A 1KFJB 2H1LA 1TJ3A 2QVYX 2CHQA 3FYUB 3GG9A 3KYDB 4HWPA 2ZJ4A 4N3AA 4QNNA 3ZR4B 2SKDA 4AJJA 4ZQCB 3RC9A 3MTAA 4RHUA 3AY7A 4RFSB 3M4YA 1U28C 5DRTA 1Z8NA 2C4VA 4KQ9A 2Q21A 2XAAA 1E60A 2YZMA 4U1RA 3SYKA 3VI3B 1PZHA 1WQ1R 3R8CA 3C3YA 2PEYA 1GCOA 2WT4A 4I81A 3LF1A 4YN3A 2IYNA 1Y48E 3OPVA 5COAA 5E4YA 2ZLBA 4ZOBA 3K72B 2OXTA 1FNSA 5DBOA 1PV1A 4G0UA 3Q40A 4EH1A 3KQHA 1I2AA 5FWAA 2Z8YA 2VAXA 2WT9A 5KX5B 2AQIA 2X40A 2ZT5A 5CA0B 5AHWA 3EWNA 1G5PA 3JATA 4ZC8A 5FPKA 4B2IA 4N65A 1W93A 1ZGHA 2BISA 3MUOA 3L7LA 3PHLA 5CLLA 3Q9NA 1YBHA 5K0EA 4FJ1A 3MTDA 4TMYA 5LWHA 1SVSA 2VLIA 3QVWA 1C4WA 2HSEA 2FH5B 1X8LA 1T10A 2WFLB 5AK4A 5LMZA 3BCUA 1RI3A 3MZ0A 4XGQA 4EA6A 5FL7D 2M2IA 2SCUB 3O3NB 3NPMA 4EF6A 4BVFA 2FU5C 2BKLA 2P6NA 2G08A 3CRQA 3FSJX 3CRNA 4WERA 2CZQA 1IOWA 4YXWA 1JG2A 5BQFA 1E7WA 3LXUX 1IULA 3N7TA 5L51A 4M8NE 5LBUA 1X1SA 3TMAA 4YJKA 4BMYA 2PIDA 3B70A 3B5JA 3VC2A 4NWIA 4YT8A 5KWVA 3S8EA 2B36A 2ZXFA 2NAPA 1V6AA 3BXHA