4MUGA

Crystal structure of pantothenate synthetase in complex with 2-(5-methoxy-2-(morpholinosulfonylcarbamoyl)-1h-indol-1-yl)acetic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
287
structure length
287
Chain Sequence
b'IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 97
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4mugA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mugA01
3AIIA 1NYLA 1TFUA 1O95C 2GOYA 1M8FA 5FO0A 3Q10A 4ARIA 3CLUD 4MUGA 1ZH6A 3IH5A 4KR9A 1WXGA 1JGTA 4JXZA 5HG0A 2D13A 1H1TA 2QTRA 4G6ZA 1JEEA 2DUMA 4AS1A 5FNZA 1MBZA 2J09A 4ZT2A 1YI8A 1QRTA 4CDMA 2D54A 2J4DA 3FH0A 3KT0A 1T9GR 1NUTA 1F4LA 3H9BA 4MW0A 5AHWA 1WKBA 4H3SA 1ZUNA 1XNGA 4MW7A 2YY5A 3HV0A 4DDHA 4PBRA 3RK0A 3ELBA 1PFWA 4EG7A 1U0BB 1QTQA 1WQ3A 1IQUA 3PXUA 2DLCX 3P0IA 1EFPA 5J5AA 2PFSA 4EG8A 1GLNA 4K03A 3QE4A 1MC1A 3ZXSA 4EF6A 3HZRA 1OBCA 1H3NA 4I6GA 2AG6A 1NUUA 1OWLA 1M8PA 1KP3A 4ND7A 3HL4A 1PFUA 4MUIA 1F7VA 4XSVA 4HK4A 4UZFA 5DEOA 2DETA 1PFVA 1ULHA 5TS2A 1IQ0A 3N05A 4CQNA 5DASA 4YP6A 4EG3A 1I6KA 1YUMA 1T6YA 2X1LA 3CVXA 1KAQA 3IOCA 3TS1A 4G5FA 2VTBB 1COZA 2ZP1A 5IHXA 1JEDA 4RUKA 3N8HA 3ZXIA 5K0TA 4MUHA 4OUDA 4S1OA 5IJXA 2CV2A 5DK4A 2QUIA 4GU5A 1JMVA 1O94C 3ZJVA 1IQRA 1O5TA 1G8HA 1IH8A 3FWKA 3RJZA 1KH1A 1Q19A 3RBAA 3DO8A 4XFJA 1NP7A 3ZJUA 1X8XA 4JZYA 2H29A 2A84A 3IVCA 1KQPA 1FYDA 1TYCA 3CLUC 1M83A 1JIIA 1G8FA 4PY2A 1NUSA 1N77A 4DE5A 1TYDE 2AZXA 4KPUA 1WQ4A 4E1AA 2IJGX 2DXIA 1NUQA 4U63A 3IUEA 2Z3VA 4PBTA 3P0HA 2X1MA 5K0SA 1EUYA 3G5AA 1I6LA 2CYAA 1U3DA 4YBRA 4ZCQA 4MW9A 4R2LA 3GMIA 1JZQA 1MB9A 2QUHA 2CSXA 3AKZA 2EJCA 1J20A 4EG1A 3UC5A 3GUZA 3CVWA 4NAUA 4WSOA 3KT3A 1BS2A 3MUEA 4DDMA 1ZJWA 1R6XA 2ZUEA 4YMIA 3ZUGA 3IVXA 1WXHA 4MUEA 4DDKA 1NURA 2B7LA 1FFYA 3SZGA 1JIKA 2CYBA 2A7XA 2J07A 5H7XA 1Q77A 4MQ6A 2CYCA 3OTWA 1D2RA 2QJOA 4ZT7A 2QJFA 1J1ZA 4P2BA 4F3RA 1GTSA 3COWA 1YIDA 3JXEA 3KT8A 4NDAA 4MVYA 1EFVA 4HPWA 3G6KA 4DLPA 3DLAA 3X1MA 1WXIA 4QBTA 4PBSA 5BNZA 1O96A 1IHOA 2PG3A 3TQOA 1F7UA 4EG4A 1XJQA 1OBHA 2Z08A 3L92A 1OWNA 2J5BA 4MWEA 3FIUA 2WQ6A 4XFDA 2QTMA 3N9IA 1O6BA 1U7DA 4ND6A 3SEZA 4GRIA 2RD2A 1KQOA 1G59A 3ZIUA 1IRXA 3P0JA 3F3MA 3M5WA 1MJHA 3PNYA 5KWVA 1GZUA 1M8KA 1TYBE 3FDXA 2HMAA 1K4KA 4AQ7A 4MW6A 3HFJA 1MAUA 2E89A 1WOYA 1EUQA 4G5YA 3MLAA 2D5BA 3IOEA 3X1KA 3CVVA 1N1DA 3IMGA 1O96B 3D6UA 4JFAA 2A88A 4RPIA 1QJCA 3NBAA 3RHSA 5J59A 3FHJA 1QU3A 2V0CA 1KH3A 1WZ2A 3S3TA 1NI5A 1G8GA 3DV2A 1I6MA 3H99A 3ND6A 4MLPA 2CV0A 4Q16A 1LI7A 4MW1A 1K97A 1P7PA 1J70A 4ZT4A 1PG0A 3A04A 2E21A 2NSYA 1IVSA 1M8JA 1Q11A 2R5WA 3FOCA 3MMXA 1EFPB 1GTRA 3HMQA 2CFOA 1I2DA 3VRHA 3A4IA 5LM3A 4EG5A 4KR7A 2VXOA 4MWBA 2H2AA 2E18A 2Z09A 3CVUA 3G59A 5FO1A 5LLTA 4CT0A 3TNJA 4KR6A 1N2EA 4R0NA 4L2IA 2I1LA 2V0GA 2QTNA 4HJXA 5F23A 4OJMX 2IP1A 1U3CA 2OV4A 4Q93A 4MVCA 1M1ZA 1LW7A 1EE1A 2DERA 5LFAA 4MVXA 3H97A 4U8HA 1ILEA 3MLBA 2X3FA 1MAWA 4JXXA 3D6VA 2JANA 4MW2A 1OD6A 3SEQA 1H3FA 4ZCSA 3K9WA 1KR2A 5DB4A 1MRZA 3CA8A 4BWVA 2PIDA 4OUDB 2AKEA 3UK2A 3FI0A 3ND5A 1WJGA 3FY4A 3C8ZA 3TQIA 1VBNA 4HJRA 3SP1A 4J76A 3QTBA 3E27A 1KAMA 4NAHA 3HGMA 4JYZA 4MW4A 1X6VA 3RFFA 1JHDA 4KPUB 1T6XA 1OWMA 1GAXA 1N2HA 1PFYA 2EL7A 2CUZA 2PZBA 3INNA 4DNXA 1QRSA 2WQ7A 4ZT6A 4ZCRA 4MUJA 1RQGA 2PXHA 5HUJA 1R6UA 4MWDA 3AL0C 2BYTA 3ZJTA 1OWOA 1QRUA 3UY4A 4NZPA 4WNYA 4NX2A 1TEZA 1ZH0A 2BTEA 5KCMA 4DJAA 3OP1A 5EKDA 4EFKA 2CT8A 3COVA 2OQ2A 1EJ2A 1O97D 2G36A 3RK1A 3SDBA 3U1VA 3CLSC 2CV1A 5J58A 3CLTC 1N2JA 4EGAA 4I6JA 4ZCTA 1GN8A 4I6EA 1N2IA 3IDFA 1WXEA 1A8HA 3CLRD 1J09A 1N78A 4CDNA 1MB2A 3K32A 3A05A 1CT9A 1QNFA 3KT6A 1JILA 2X0KA 1S4MA 3TZEA 4ZT5A 3LCJA 2TS1A 2GM3A 1EFVB 5TEWA 1N2GA 1T9GS 4TS1A 1N2BA 1F9AA 1YULA 3QTTA 1N3LA 1KQNA 4K0RA 3UMVA 1N75A 1GPMA 1UFVA 3CVYA 3FG9A 2E0IA 3H9CA 2HZ7A 2XRYA 1WXFA 5TEVA 3VU8A 4MVWA 1MOPA 1K92A 1QU2A 2VTBA 3IODA 5H16A 3ILVA 1O95D 2PZ8A 1Q15A 3CLSD 3ISJA 2RE8A 3CLTD 2A1UA 1VBKA 2WB2A 3PRHA 1B6TA 3VGJA 1H3EA 3P52A 4U7JA 2QUJA 4YP7A 3IMCA 1O0CA 1DNPA 2QUKA 2A86A 4QREA 1XNHA 3TZLA 3FETA 1NSYA 4ZT3A 3AG5A 2O5RA 3CR8A 1KKUA 4FZJA 3GLVA 1KORA 4ZCPA 4MW5A 2C5SA 2NZ2A 3NV7A 4YP5A 3X1JA 1TQ8A 3IOBA 1VBMA 3ND7A 3PNBA 1JECA 3SZ3A 3NBKA 2A1TR 4MUFA 1NZJA 3COYA 1Y42X 2DEUA 2IELA 1K4MA 3LE8A 4NATA 4ARCA 3DPIA 1R6TA 1J21A 1SURA 3I05A 4UZEA 2JA2A 4F4HA 1V8FA 2A1TS 2A1UB 1OWPA 2YWCA 2DPLA 2JAXA 3FNRA 4MUKA 1T6ZA 1N2OA 1U7XA 1V47A 3N2YA 1YIAA 5TGTA 3IMEA 2DR2A 3SYTA 2ZUFA 3COZA 1NUPA 1XNJA 3PNVA 2PZAA 4EG6A 4MAFA 1LI5A 1O97C 2GKSA 4L2IB 1VL2A 3Q4GA 1PG2A 3Q12A 1M8GA 2YWBA 5HUHA 4J75A 1TYAE 4KKVA 5JBNA 4A91A 3A2KA 3ZGZA 2A4MA 1IFXA 3CLRC 3KFLA 1KP2A 2HGZA 4MUNA 4MWCA 1EXDA 2QJTA 1WY5A 1O0BA 3L93A 4R2MA 2YXNA 4QRDA 2XRZA 4MULA 1HYBA 3BL5A 4X0EA 2WSIA 1KH2A 3LOQA 5KHAA 3IVGA 1QQTA 3H05A 3AG6A 1JZSA 3IUBA 1O94D 2O8VA 3MXTA 1J1UA 1JIJA 1VLHA 3UOWA 3AFHA 2J08A 1YUNA
chains in the Genus database with same CATH superfamily
4E5MA 4PLPA 5AJZA 4GYYA 4ZO8A 5KVCA 2FN4A 3QMVA 2IXTA 4G8BA 2EYQA 4E32A 3WMWA 4L6AA 4KR9A 4GI2A 1E7YA 5D7BA 5LQCA 1SXQA 1M2VB 3EXHB 3I5UA 2QQ5A 4HRAA 2DBRA 4XVCA 2VHQA 4TUYA 4AUEA 1C9KA 1JEEA 1EUDB 1SD1A 1VOTA 1XA0A 2DUMA 3ILYA 2Y2VA 4UQOA 3JQAD 3M82A 2OV2A 3P0RA 4RPKA 4UBLA 2ISCA 3H87A 3P9RA 2CNLA 3V2UA 2FWBA 4H4CA 3EVTA 3TTXA 1ZMXA 3ABQB 4CKYA 3RW9A 1XQVA 2G4LA 4MHSA 3RC8A 3G17A 1ETHA 2J3LA 1AS3A 3GZNB 4KXWA 5EWJA 4WXPA 4HNTA 5EZQA 8ADHA 3T1HB 2PM8A 4JWTA 1L7EA 3ELBA 1K86A 2AUNA 3OTHA 4WD3A 2OSBA 4JB2A 1NKTA 2FG6C 1Z36A 4B3CA 4ZZ0A 2JHGA 4BFCA 2PUWA 3D3JA 3VBCA 3E48A 1NRXA 3LPNA 3AEKA 1S1CA 3L9WA 3AEUA 4OQDA 2V4MA 3R5XA 1E3JA 4NZYA 1U11A 4YRFA 5J5AA 2JFGA 5DNCA 1C1XB 4LJ4A 2G5GX 5K3SA 1AHHA 1BXGA 1PJTA 1R2QA 3K4QA 4TMYA 1I24A 3O8OA 3ZK8A 3EXAA 5JNVA 1P5ZB 1AN0A 2YQ4A 3NTLA 3MJ4A 5F77A 3KAPA 3MTDA 3UAXA 3N0VA 4L1KA 3FKJA 1WPQA 3FWYA 4OM8A 2WUVA 4ZCLA 2OPHA 4LXTA 1INLA 5KMGA 1G6KA 2HV9A 5ITVA 4JP1A 5KNBH 3FVRA 1QNLA 3G2HA 2KJQA 3FMGA 4Q9IA 2CL5A 4DCTA 5CFZA 1R0BA 3RR2A 3EBOA 1T3HA 4I5IA 1E3QA 3FCCA 4IH4A 4D9BA 2VF5X 1PFUA 2WJ6A 3TD6A 3PV0A 1O2DA 5BQOA 4V0RA 4DR7B 3VO2A 4U9HS 2PSEA 1EUCA 2DBYA 3AETB 4RELA 2F9MA 4HZGA 3FCEA 4JT9A 4EO4A 3FBGA 1SH7A 3E03A 4G2NA 2QV0A 3WXMA 1HM5A 3KQWA 1KQ3A 1T1IA 1GKYA 4FE3A 1KSHA 2QX8A 5DT9A 2VRWA 5JYCA 3T3EA 4A8HA 4C20A 1F4VA 1TB4A 5EESA 4TWIA 4J0KA 2A5DA 3TTVA 4BU1A 3H84A 3CVOA 3L1IA 1QIHA 1GFIA 1PJAA 1VA5A 4U00A 1EEHA 3RRMA 4YI5A 4OHXA 4ZAYA 3MIIA 1NSTA 2DT5A 1G7CA 3OFVA 1RHUA 2X8LA 4NL4H 1O5TA 5EE5B 3SMQA 4QFDA 2YUTA 3QEKA 2P3OA 4NNPA 4XFJA 3HDJA 4EEKA 2YICA 5AVZA 5BWOA 3OOWA 1N57A 5I47A 4YUXA 4RA6A 5F1OA 2B3DA 2XMSA 3EAQA 4BLUA 1XCGB 4EKDA 4PY2A 2VG8A 4DE5A 2WTMA 3PKJA 4ASUA 3OIUA 1S2IA 5DM1A 1XD8A 1PU2A 3Q3JB 3I9V6 4CBVA 8AT1A 2RETA 4ADSG 5H80A 3UF0A 2XHEA 4A3SA 1A7KA 1N4DA 2IYTA 3NJRA 1E0KA 4ALJA 5CDGA 5FNVB 2H3EA 1NM5C 1RQXA 3ELUA 1EZZA 4BLSA 4ZTBA 3B1FA 1E2FA 2DBQA 2XUQA 3KU4A 2IWRA 3RH0A 1G8YA 2QW0X 3PSHA 3BHJA 1USVA 4H27A 4JKYA 3D3NA 3EZXA 4QD3A 3S4YA 1OH5A 2CSXA 4O4IA 4QAQA 3IOYA 4I8DA 2X0EA 4DCJA 4ZI2A 3JV7A 1W96A 3NZEA 4OBXA 3F6CA 4Z3OA 5BT9A 1HDOA 4FFPA 4XB2A 1R8JA 1UZMA 2BMAA 4ARAA 2ENUA 2WTBA 3I9V1 4MRRA 1VJGA 3QTLA 1U2GA 1Q20A 1GGJA 2OBYA 1X7ZA 2GJAA 1XEWX 4XJTA 4ZMRA 3UPTA 3R6DA 3I8SA 3ROZA 4BBAA 4CLEA 4JGIA 5AFSA 5A62A 3SZGA 5I7FA 2YXBA 1TMKA 1FDOA 2NZVG 2A7XA 3NB0A 1B3RA 2FK7A 4RA9A 4AULA 2XZLA 2HFKA 5K3FA 1TO1E 4CEIA 2VTEA 5TJ9A 1DMSA 6YASA 1X38A 1V37A 3CZPA 4EJ0A 4F3RA 1DO2A 2DSTA 3KSAC 1V2GA 5K8CA 2ZUVA 1PZGA 1YMQA 3WKEA 1J4AA 1YIDA 3KAKA 4N40A 4NDAA 4OI1A 4TRMA 4HPWA 4ZEVA 5K0LA 1G291 2WUGA 4ROTA 1I13A 5EJ6A 2P3LA 4HNHA 3K1TA 3IAUA 4LQDA 2OP1A 3C6ZA 4XRGA 3QBJA 3GJZA 4RZHA 4HQKA 4YRBA 4E22A 1ZJJA 3CCBA 1P5HA 3QVKA 1ODTC 1GSOA 2K6GA 2JIQA 1L3CA 2RG7A 3FF4A 4JP8A 4C4YA 4HS4A 1M3SA 2O07A 4HNAA 4TV8F 2UAGA 2C5AA 1G4AE 3ETLA 1XRQA 3K2BA 2MMCA 5EXTA 4GRIA 3BQ9A 2AEJA 3OSZA 3AVVA 4BQEA 2JJQA 5EFOA 4DNOA 4DV1B 4NH0A 1G64A 3BXPA 3FMOB 4B48A 1HV8A 1SKQA 3RDPA 3EDQA 4S1TA 2IV3A 2ZAIA 3GFSA 3ZVKA 5HQJA 1TW3A 3PJGA 5E9WA 4IQ4A 2CDAA 1FK8A 5EIXA 2D00A 2FQWA 3CU5A 5AWFC 2NQ2C 3MLAA 2MSCB 2Q1UA 3I8XA 5ARDA 2GEDA 1DOZA 4C05A 5FWXA 1EWQA 1JKIA 3RS9A 5KEIA 3LKZA 1SB8A 1BO6A 4UNIA 4DV6B 1WDLA 1WQ1R 1JFFB 2GFHA 4F97A 1CUIA 3VSAA 3G85A 3HUEA 5DIZA 5AKIA 4N0MA 3NOVA 3S3TA 3W5UA 1C9EA 4DWWA 1BE0A 1USGA 3O83A 4RV9A 3KQOA 2X9VA 1KKMA 2IEYA 3BBLA 3WYBA 2W37A 3JASB 1JHZA 3BE5A 3T7EA 1G3UA 3GZTB 4TLAA 2I3ZA 2DTDA 3T5GA 1ZQ9A 1RPJA 3RAPR 1VHQA 3V1LA 4DKXA 4WK4B 1XMVA 4G89A 2WJHA 3QYJA 3SXUA 3HXMA 2JIDA 4N5NA 4GLFA 1Q0LA 3ZCPA 5L7YA 2PH7A 4RLSA 5IN4A 1I5OA 1R3UA 2MYTA 5AICA 3TZKA 1HNNA 2BCJQ 5CH8A 1ODSA 1Q84A 3DS8A 4CMEC 4BVJA 4ZHQB 3EIXA 4XWYA 3U4AA 4D41A 3W2IA 2B7CA 4KR6A 1Q92A 4IOKA 3L7CA 4MQMA 4KQWA 5HQ3B 1YRAA 1GLVA 2XVMA 3B3QA 1U3CA 2XDYA 4QYIB 1KVTA 3QVSA 2PEZA 4CG3A 3T52A 2JFFA 4YQYA 4M38A 3WWPA 2CXPA 3PQ5A 5BXYA 2ZSEA 2GN9A 4ZVKA 1M6WA 1ZM2A 1XYYA 2ZT6A 1LW7A 2RJ3A 4IOMA 5C7LO 2BMWA 2Q6LA 2REQB 1I7QB 4L4SA 2ZYIA 3NNDA 3QE2A 2WHYA 4HY3A 1H05A 3HUUA 5EZYA 3OQNA 1HYEA 2X0DA 4LJ5A 2FZVA 4U5QA 4TV9F 2HW8A 3HVKA 1N5RA 2JATA 2JIRA 2YJNA 3PJFA 4R6WA 1JT9A 2J87A 3TZCA 1GT6A 4HDRA 1E3WA 3L7JA 1FPQA 3QUQA 3OZDA 2GNPA 1VMEA 4LDNA 4LI0A 4Y1GA 3L06A 1MU0A 1BDMA 3PF8A 1GPLA 1UH5A 4LVNA 1SUEA 3FI0A 3F6BX 4OH7A 4OB6A 4Z99A 4DQLA 2WP0A 2XUHA 4EF5A 2H0RA 5BURA 5LYJB 3BRQA 2VHVA 3U4MA 3TQIA 4XCXA 2OKCA 3RUEA 3NEAA 4HJRA 4L16A 2IS1A 3MWGA 1Q0QA 1GM5A 1RAFA 1W6UA 4HQ0A 4X44A 1SBYA 4E2WA 3AM3A 1JUDA 1OAAA 4NAHA 2ZRJA 5BYAA 4RX1A 5IHPA 2XPCA 1V5WA 3NASA 3JQFC 3MD0A 4ITUA 4O8CA 2XCLA 5FBWB 3W8FA 4UFPA 4XD7A 5JSUA 2OV6A 1M2VA 3EXHA 4HADA 5T4HA 3SHVA 3RYCA 1BMDA 1D1TA 2FOXA 3A1SA 1IOVA 3UH0A 4X91A 1EUDA 4F46A 1S2GA 1ETUA 1HT3A 1Z0UA 4HMPA 3QHQA 5KQMA 3V8BA 1T5SA 2W2VA 1IZZA 1LBIA 2I2XB 1BGVA 2UZ0A 4CCYB 1JHOA 1HYGA 2OZPA 4W9MC 2OYCA 3LUFA 3Q3GE 4M9XA 2UKDA 1UDBA 4NU0A 1UDWA 2J6IA 3ZWVA 1OFVA 1DAPA 3ESAA 3V4FA 1OH7A 4RGYA 1KERA 3GZNA 3UY4A 4Q01A 2P1DA 1G6OA 3L8DA 4NZPA 3T7DA 3VQTA 4B73A 2XMRA 4M9CA 4KXFB 4BVLA 1Z7EA 1W2GA 4LGVA 4RZXA 4DSTA 1E7SA 5BN4B 3PD0A 5ER9A 3OP1A 4FWBA 1BYUA 1U8TA 2R6R1 4G9GA 4V3BA 4Y67A 4ZPXA 5IBRA 5JFTA 3U1VA 5K0BA 2YWXA 3A36A 2H92A 3O26A 1HQKA 3EQ8A 4EGAA 1TNDA 5GGYA 3ZU4A 1C1XA 2GARA 3VJMA 1OLXA 1UEJA 3IDFA 3VR5H 4CF3A 5IZ4A 1LGYA 4OQFA 5LB2A 5A04A 1TM2A 2IP4A 2C1EA 2ETXA 3D6MA 4QDZA 4C7VA 4ZU3A 1N78A 3B1JA 2OAQ1 3WLNA 2TMDA 1PK9A 2HDWA 2IU4A 1VYVA 5CB0A 3D0QA 1Y6GA 5AR1A 1W4AA 5FPPA 2MOKA 3A3OA 3BERA 3TZEA 4KDRA 2C29D 2Z3ZA 3H4MA 3IIEA 1AK2A 2PA3A 2VNIA 3OOJA 3RVRA 2IY9A 5DM60 5HUQA 1ZXBA 2X4DA 1UKEA 1Z56C 1JXOA 4LZWA 4BFXA 4RIGA 1CDZA 2GTPA 3IILA 4A8TA 1ZCFA 3AP2A 1Q2UA 1M7BA 4DA4A 1KI1A 2ZI9A 2PX4A 4MGEA 3GJ8A 2I1QA 3V55A 1N3LA 1UFQA 3AETA 4BQFA 3M5CA 1XFDA 4M22A 4JBWA 4K6FA 2PT9A 1WY7A 3SC6A 1EJ0A 1DCKA 3PENA 4ODIA 3HP1A 1NKVA 4WLOA 4RPLA 2ONZA 3E1SA 4S04A 2XA1A 2ZJBA 1MOPA 1E1QD 2B5OA 1JLMA 4G0PA 3K8OE 3IODA 2QF7A 2V4UA 4RGBA 2PZ8A 2QSUA 3IE2A 1XQXA 2J41A 1C7FA 1N0UA 1SG9A 3VTFA 1VBKA 4O2AF 3LYUA 3MWDB 5IJ0B 5L7TA 2WWWA 1EK2A 1OLUB 1KIFA 3FDZB 1W52X 4P0QB 3WGLA 3LRTA 4X8OA 4DYVA 1UJ5A 4L07A 1MN6A 4NCNA 2CCJA 4IDBA 1XK7A 4NDNE 1CIVA 1U7PA 5E8RA 5CXUA 1SVWA 4YRGA 1T8WA 2B1QA 4B75A 4MW5A 3HWWA 1MHPA 3KU1A 1CW2B 1RYEA 3A14A 4JDPA 4MPJA 5FLKA 3HI4A 8LDHA 5GZ1A 1J8FA 1C1HA 1XLTC 3T1TA 3BULA 4PRYA 6NULA 1G8KA 1K06A 4TT8A 3PNBA 2HSDA 3ZCTA 1N36B 4ZEXA 3I6QA 1ORHA 1T9ZA 2PZFA 4QASA 5JS8A 5KQRA 2GHTA 1T43A 2IZZA 3MS2A 1X7DA 2WZDA 5FNVA 3C6BA 1SURA 3H19A 3KOWA 4JT8A 5DBEX 4A73A 6AT1A 5AVTA 2CF5A 1NZDA 1CY1A 2X0NA 2EFYA 3ICOA 4M9QA 1X2BA 3BB3A 4ML3A 4A1OA 4F9TA 3DP7A 4NYIR 2B9EA 1Z68A 3E81A 2G0NA 4YB8A 2OGWA 2Q3JA 5K1ZA 1CUVA 1GPBA 3TNLA 2ZJ6A 3FCYA 5LBTA 3OPYI 1DVRA 5I9TA 4OKSA 1HK7A 2X5KO 2K7FA 4F9GA 4LRXA 1DG1G 2Y05A 3EBLA 4RHEA 3SVTA 2OAEA 1M76A 4V02A 3L0ZA 2I4TA 3LKDA 4BEJA 4ISCA 4R31A 3HU2A 1P60A 4L9WA 5DHAA 3LUKA 4KKVA 4ZV9A 5G1NA 4Q7QA 4RLQA 3H4TA 1A2OA 1UPUA 3Q98A 1YAJA 3FOAA 2V74B 4QRIA 1XC7A 4A0QA 2VQ3A 4UATA 3FMVA 1J2TA 4TM8A 3UHOA 5FX2A 5HKKD 2O0HA 1FSSA 2YHIB 4G5RA 4OQNA 4PNZA 1FX0B 4R2MA 2FN8A 3CLKA 5CA0F 2Y1FA 5CM8B 1B15A 2CL7X 1G20E 3QU9A 1H2RS 1WIWA 1ZVJA 4PF1A 4MHTA 3QNMA 3LFTA 3DEAA 1O94A 4X0EA 1XT6A 3IVGA 4MGKR 1I2CA 1OQAA 3F7NA 4RFSB 1U0OC 4Y0VA 5KKNB 2B8TA 4IKOA 3TNDA 4E5NA 2NN3C 2K5UA 4FJ2A 4CKBB 4NBNA 2V6GA 2VTVA 3GIWA 5GV7A 1PFGA 1LZLA 3WB9A 4JUAA 5AKZA 4B5KA 3FSGD 1BOOA 1KMHB 1O95C 1TFUA 4G3XA 3Q10A 3NVMB 4RSHA 1MHTA 2ZT8A 3WHIA 1XJWA 5FF9A 3RABA 1H5QA 3UOAB 4KAXA 4HGYA 2FWMX 1VJTA 2CE2X 4G4JA 4L3VA 2ODQA 3NORA 3S2SA 4JQYA 4CU2A 1KOGA 2ATEA 1XUOA 4CQJA 1BE8A 1ISSA 4MO2A 3UMGA 2B1JA 3B6MA 3OPVA 4LOLA 1PTJA 1QDLB 3G8AA 2QYTA 4OVKA 1XPUA 1C7ZA 3TLKA 5AKJA 1E3DA 1ZL2A 4HWSA 5F7OA 4KX5A 1JFFA 2OG1A 1WB4A 3NX4A 1Z5VA 2F43B 3HSKA 4GP7A 4RENA 4XDZA 4BNFA 3AJ9A 4UTZA 3P9QA 5SV2A 2Q46A 3WJ2A 3DFMA 4M1YA 4BNIA 4MW7A 2IOYA 5E7IA 3PEFA 4DAOA 5JXGA 1HQDA 1YQGA 2CXQA 2A0UA 4NC9A 4X7RA 1K6IA 3OPXA 4ICIA 1P2TA 1P77A 2P2DA 3UXMA 4DQKA 1AA6A 3TOZA 1II0A 2QE7D 1Q1QA 4UHBA 4B6FA 4C0LA 1WBBA 2GPWA 1PO7A 3VV2A 1LTKA 1PFQA 3VUFA 2PNJA 1Z37A 3LPCA 2X4LA 2O2EA 2J3HA 2N75A 2QUZA 4Z3KA 6REQB 3QHPA 1TYEB 1KMCA 1QOPB 1QX4A 3IP9A 2K7ZA 3WWEA 4MYDA 1NJFA 1GPNA 2F7SA 1UFRA 4H60A 3UYKA 2PGIA 4Y1EA 2J9XB 4EPTA 3EGOA 4JI1B 5I9IA 4HNGA 1C30B 3L8HA 5HQ3A 1OGJA 1DAHA 3QVUA 4LNAA 2HO5A 3MS4A 5KYUA 6ADHA 1E5XA 1JG2A 1SOUA 3V42A 4HH1A 4QYIA 2TYSB 2H1HA 4WZ6A 2HV8A 4H7PA 4RNDB 2QMOA 3ADKA 5JI2E 1PR2A 2O1SA 4MUIA 1JXAA 1ZC4A 1QOQB 1QG6A 1MMFB 3RVDA 3I5MA 1N2ZA 4PLWA 4N54A 5BV2P 5JPCA 2QT1A 2CKDA 2REQA 3AY6A 1V8ZA 4HMQA 1T6YA 1IIRA 3LVFO 1FMFA 2R62A 4PAGA 4Y30A 2AL7A 3RD5A 2WSSD 4X95A 1MVLA 3CGGA 1XP8A 2YH2A 1A0OA 1H0RA 3UG6A 2VUHB 5DMHA 4M89A 4D1YA 1V3QE 3C5VA 5EE1A 3H5TA 2P9TA 3N2LA 1WKCA 3WLMA 1YQWA 3NIBA 4UEJA 2FR8C 2XIJA 3CISA 4PZEA 3KLMX 3WK4A 2R8EA 4BE9A 3HM9A 3GNTA 5LYJA 1APBA 3FNIA 2RHJA 5HRCA 1D6JA 2SCUB 4K81B 1FC0A 3TVTA 3ZDFA 6ABPA 5FUYA 2ZU6A 1P72A 1JDUA 4JJIA 1HG1A 4IDHA 3WYCA 5CXQA 3V4LA 1R0CA 3Q3VA 1QKIA 4S1PA 4TKMA 3V1TC 2DR3A 4OREX 2EGGA 4TXNA 1N77A 1GZ3A 1U9IC 3N5CA 1BD4A 1UBEA 4YN3A 2DXIA 1TOAA 3AI3A 3LY8A 1PT8A 1ZVKA 2A5FA 2ZREA 4FYXA 4KU4A 2P4UA 4PZAA 2RGDA 1JQEA 4B74A 3P0HA 4CCYA 1EA7A 2JGAA 3OZUA 1LK7A 4BUCA 1A4IA 4A6XA 2XQGA 4WZAB 1LRLA 1XQ6A 2EWMA 3DEJA 3GGJA 1JNXX 1QRAA 3GW8A 3HU5A 3OZXA 4H77A 1EMDA 5FHQA 1UJ6A 4UEOA 2AFRA 3N86A 2E6UX 3BM5A 4C0AC 1XHEA 121PA 2PMBA 1JW9B 1TCCA 3DDSA 1EX7A 3QIVA 4IINA 3CFAL 3NDJA 5CW1A 1KEEB 3CBGA 5AUQA 5BN4A 1F0PA 3DE1X 2O19A 1H85A 3CUWA 4RTKA 1L4MA 1L5LA 1R15A 1SELA 1S2MA 3KJIA 3TXYA 1BHQ1 2GMWA 4ZI3A 1M6YA 3EMVA 2ZQYA 3IQHX 4GZ3A 2XB2A 5FWDA 2G67A 5TGDA 1QBGA 5J40A 4AJHA 4C78A 3K9FC 1NVKA 5JY1A 4JCCA 1EPUA 4K8RB 5C1PA 5I9BA 4EJ2A 1NNI1 2VNAA 3WKBA 4U9UA 5KJFA 3LJKA 3DMHA 3H9UA 1RMQA 2V54A 3B5JA 3KXDA 3G7UA 2XUZA 2JASA 1TUBA 4RVOA 5SY9A 3T99A 3WP0A 4JX8A 2C0CA 4NYMR 1NQAO 1DKLA 5G41A 2ZXUA 3UQYS 4PNPA 1FNSA 2ZVQX 2GKGA 4OL9A 4OHVA 3DQQA 3FI9A 4NQRA 2LD4A 2FUG6 3DOIA 4PBSA 3N8KA 1QFMA 2GJKA 1PWHA 1KHHA 3WA6A 1GVHA 4XIIA 4DJFC 4Q4AB 1YHYA 1DC8A 1OWNA 1Z4MA 1DTEA 1PGQA 3TUJC 2ET6A 1MB0A 4RK1A 5BRJA 1KYQA 5A6VA 2AA3A 3FIUA 4TMWA 2P11A 4WINA 1IMJA 4XFDA 1H9CA 4NCAA 1Y98A 4BAUA 4DV0B 5C8DA 4U1RA 3GBVA 1SWVA 1D8AA 1GTZA 4M53A 1AB6A 3AUYA 4PS1A 5F73A 4A0FA 3WK7A 2QVBA 4C22A 4UULA 4PFJA 3ZGVA 3FFXA 4BO9A 3LC7O 3MWDA 1IHUA 2AXQA 1OLUA 2GCIA 2Q4OA 3OZWA 2HMAA 4BMVA 1KF0A 3R9WA 2PX3A 1NF3A 2I7XA 4GI7A 5E4FA 1A5SB 4NBSA 1F2VA 1R4NA 5CW2A 4N7MA 4RIIA 2B8NA 1YK0A 1IOLA 1LPSA 5CX1B 4IL5A 3OCCA 2B4RO 4OYLA 4JI5B 2FK8A 3V2HA 2GK3A 4RL6A 3K6SB 2IA5A 3O0DA 1M2FA 1WRBA 1Y9EA 5IPFA 4KPFC 1Q0TA 4E7PA 1T1EA 2ZOSA 1X7GA 3DXXA 3EY9A 2J0VA 2PMEA 2P4EA 1NNSA 4UFOA 4LMBA 3BDVA 2JLAA 5F78A 2B37A 3EK2A 4LK2A 4EHHA 1A9XA 3OQ6A 3SE7A 4XVQA 4ZRDA 1TLTA 2PSHA 1PZHA 2CXNA 4WADA 1SM4A 1Z26A 3GI1A 3Q72A 4OXKA 4BS9A 1E4EB 3KEQA 3O2QB 3OQIB 3RFCA 4BFSA 3NS7A 5JNWA 1EGVB 3CNEA 5IM4F 3I4CA 3PUKA 1A5BB 3REQB 1M8JA 3ETDA 1Q0RA 3ZE6A 1P31A 2XE6A 4G5XA 3AJDA 3IPCA 2BGUA 4JVLA 4WFJA 4H7DA 1QZXA 3MLEA 3PPIA 2PKQP 4ZMBA 1EE2A 5JDIA 5DBOA 4HATA 1REQB 3NTVA 4DEXA 1XZCA 2FP4B 821PA 4EUHA 4B3XA 2Q9CA 5FOQA 4KR2A 4V1CI 4RZSA 1RYZA 2CLDX 3BICA 3LLUA 4JLJA 4Q3AA 2PJUA 3UV3A 2BI4A 1PHRA 3QX9A 3A6ZA 2R0QC 4HNRA 3PQCA 1MTOA 4P98A 2WF5A 5EPEA 1Z8DA 2EFDB 3S1LA 5T4BA 2QP4A 1HY3A 5FTKA 4FDTA 4J0QA 3WDLA 2BPOA 2FXVA 4R5MA 4MVCA 5EZYF 5G2OA 4X62B 2Z8ZA 2WVHA 1JTFA 4IGEA 4C87A 3JQCA 4UVIA 3ZWPA 1YE3A 2HEIA 5E9JA 5JMWA 1NVUQ 1XF1A 4OQYA 4EDFA 1XZGA 3U4CA 1NWCA 2YHIA 3QOWA 5HKAA 1CQPA 4JBGA 4O59O 1V43A 1D0IA 4AJEA 5L40A 3R9XA 2B4YA 3KOOA 5TQJA 2H2HA 3PFKA 1KFEB 4HXFB 4L7QA 5A4MS 5FA6A 1F60A 3DA8A 3K92A 2WNIA 4IF4A 3GCXA 1IAVA 4HUQB 1YVPA 1LKZA 3KWJA 1ESNA 4G67A 4RESA 1CUYA 1VHTA 2NVBA 2QTCA 4YACA 3WMXA 3TEFA 4RFSA 4B3GA 2KX7A 1OXTA 1GD1O 3PUIA 3ZXYA 4CKBA 4BCBA 1DT3A 1ZI6A 3C8ZA 3DE6X 4Y6SA 1ZXXA 3SFTA 1LBTA 3Q7RA 1PAUA 3BSYA 4PCLA 1JTEA 5BW0B 1KMHA 3DLBA 1CNEA 1UZUA 3GEMA 3OFJA 3LX8A 2P2NA 5FUMA 3GRAA 3IUPA 3FN4A 1LPPA 1MCZA 2C61A 1CQWA 3RFFA 1VYTA 1X9HA 1JHDA 3MMSA 2FPWA 1F3LA 4Z4IA 3THSA 3N6VA 1EVIA 3OEYA 4WGFA 4KOAA 3S81A 4BQSA 3PP8A 4G4GA 4WBNB 2AZXA 3AUAA 2NUBA 3B1YA 3PHLA 4MPDA 4QECA 4Y6GB 4AG3A 5JCXA 3QU7A 1XTJA 4WOBA 1QO0D 2C2ZA 1EFTA 2OOKA 1DIOB 2WR8A 1SBQA 4PICA 1FRFS 4QUDA 3EUWA 1R5NA 5A02A 2R7AA 4IRXA 3VR4A 2C8VA 2CVHA 2F43A 1NVDA 3A0RB 4QDTA 3CEHA 2R65A 3MNFA 1KE2A 2BGWA 2WMNB 5FA5A 3CXRA 3PWKA 3HQ4O 4BB0A 2QI9F 1W94A 2KM1A 4BN0A 1JA9A 3C7AA 1E6LA 3UT6A 1RQRA 5A5VA 4Z1MA 2XMPA 2XZOA 4S12A 4KFCA 3I0MA 5AJVB 4C2AA 3L4SO 4Z3DA 2XGJA 4WA7A 4FNOA 5DLDA 4AP9A 4DSAA 2CSUA 2OQ2A 1O97D 3MILA 4PSUA 4EARA 2B2XA 2VK1A 1VMIA 1J22A 4Q1EA 2EW1A 4C0HA 3TG2A 1ABEA 1QZUA 3QHAA 2ZAMA 4OLAA 2EAUA 4WXHA 3OZ7A 1FL9A 1AF7A 3ZD7A 1BU5A 3BGSA 2GYVA 4QNNA 2C9YA 3TWOA 3IL2A 4NECA 4EF4A 4Z4GA 1Z73A 2HPVA 2QZJA 4PR0A 3AEYA 3LY7A 4NU6A 5JCOC 2YZNA 5HBGA 2NQTA 2P2LA 3N39C 3OCJA 4RF4A 2ORVA 2Y76A 2XCRB 1WW3A 5DM4A 1SFRA 1NX9A 3JQ8B 3KM0A 3R5SA 3LCUA 4M0DA 1MOSA 3THOA 4CMCA 1S4MA 1ZLXA 2C4UA 2D1QA 3BCSA 3KVYA 3UGQA 4ARBA 4C14A 4F84A 2BFPA 2BEUB 2OYSA 2NX2A 3O3NB 3OFKA 3RSFA 4BE4A 2Q45A 4JQCA 4BC1A 2ANCA 2VYQA 3E9NA 4P3PA 1SUPA 4ZP1A 1HNZB 2GPNA 4OGFA 4B81A 1N75A 1GPMA 1XVVA 1K88A 1PR4A 1X0VA 2AJCA 2FWIA 1OZFA 2AT1A 3H9CA 3M3HA 2FZGA 4AW9A 3WZLA 3AHHA 4ND8A 2G04A 3EIEA 1OZ0A 2YVLA 4KR0A 4MVWA 2EP5A 4HP8A 4YQZA 1R0KA 2ZRFA 3AHCA 5AUPB 4LY3A 4ALKA 2R00C 4PZ0A 5H16A 1C14A 3MPUA 3PXCX 2B9VA 1GCOA 2GPTA 1SD2A 2DPXA 5C4GB 4DLYA 1KAOA 2CXOA 1T0JB 3CF6R 1NN5A 4LWZA 2QUJA 1R4ZA 2BEKA 4YP7A 5JAQA 3RASA 3S8YA 4R2WA 3A10A 2PS0A 3Q8LA 4BKRA 2IYPA 3TNYA 4QREA 1UDXA 2SCUA 2M6LA 4QKQA 4NHEA 2VPZA 3KXKA 2A59A 3R7DA 1V5FA 3BC1A 1FMCA 5EEHA 1KAGA 3BJMA 4U0KA 3KZ1E 3K2IA 1WULS 4Z53A 5DH9A 1JMKC 1EBFA 5F76A 1TM5E 3SOPA 1XMPA 2IHNA 2EBWA 2F1HA 4KLZA 2OORA 5IJZA 5DHUA 4L8YA 2W58A 2XY4A 3LBIA 1UMDB 2OHOA 3LDFA 3OG9A 4PCVA 4RVFA 5FNVF 1YZHA 2OVFA 3VJKA 4QTYA 4ZDIA 3H65A 4G81A 1RJDA 5KX5B 2GCPA 2ZIFA 2I4RA 2ZROA 4TGLA 3OJCA 1FIUA 1Y42X 2FH5B 2N1MA 2YUIA 1C3XA 5GVSA 1K4MA 2QY6A 3UO8B 2JDIA 3KZVA 5GOZA 2C0QA 1VKRA 4M0KA 3U17A 1RPTA 1ZNWA 3JD2A 2O2XA 3X43A 1RTKA 1MPTA 1P2VA 3TJMA 4WZAA 2CLEB 1AKRA 3HUDA 3FRIA 4AAYA 2VP2A 3GOHA 1WBJB 5F9FA 1NMYA 2QPAA 1LB1B 2XWSA 3IVMA 3P94A 3Q7TA 4D9KA 1RLMA 4ZI7B 2IZOA 3UMCA 2V7QD 1KEEA 2Q41A 1P9LA 1Y3IA 2IYLD 3GRFA 3QJGA 3PEUA 2HLHA 2W11A 4H1WA 1NQ5A 5C2JB 3WB2A 3R4VA 4FYYA 2HRQA 2AI1A 3NM4A 1OBFO 4R98A 1P7WA 4RLFA 3PC8A 3S2UA 1A8QA 1L5HB 1M8GA 4P38A 3DSRA 1VGQA 5A4IS 4YO8A 1II9A 1PQYA 2OZLB 3U16A 1QYXA 5EIOA 1ZITA 3KALA 2IH5A 1KI7A 1U1CA 1WCXA 1O6CA 2IEZA 4E3WA 1WCIB 4Q9DA 5G2FA 3F98A 2ATXA 5TMBA 2QHXA 4DZZA 3VO9A 1GFSA 4AXXA 5IUJC 1SOVA 3NDIA 4WH0A 3TDMA 1MIHA 2XF8A 3BRWA 3PUHA 1YGYA 2GM5A 3K2EA 3EF3A 4YEDA 5AK6A 4INPA 2OFXA 3SHWA 3CH6A 2BC9A 3H5VA 1UDCA 3Q5GA 5J63A 1Q1BA 3BCHA 2ODAA 3AU8A 1G3IA 1NHWA 5ALNA 1OYWA 3MQ4A 2KHZA 5KAPA 2WFLB 1ZM3A 4C7OB 1KYTA 3GT7A 3BL5A 4D9MA 3AESB 2GPAA 3NOQA 2FRVA 5TC4A 2H48A 3GD5A 2HXSA 4Q4AA 1PUJA 1KPGA 1U8XX 2ZE8A 2QT0A 4FDAA 4N1AA 1R9GA 3VR2A 2HL6A 2EFJA 4ZTUB 2ZCUA 2PBRA 5E6UA 2QAJA 2P5TB 2X15A 3FLMA 2A78A 4DQUA 1M2WA 4DDUA 4HFMA 1JAIA 2OBFA 1U28C 1HDGO 4HX5A 1XD9A 4JU9A 4PYLA 3UAOA 3QYFA 3G6WA 2JARA 1P33A 1BGXT 1FNNA 1NQVA 1TM1E 1R8YA 2VHTA 4Y6PA 4LWQA 4GL2A 2O59A 3QSYA 1SB9A 1YCGA 3IE1A 1J0EA 1WMDA 3A4MA 1ZWKA 1I1QB 2J48A 5GY7A 4OSOA 1JR3A 1L5GB 3W34A 3ZY2A 5JC1A 2G77B 1OI7A 3SWWA 1K3TA 1QMPA 5B1EA 1L8LA 4IYRA 5AM5A 1QRTA 5CX1A 3BRSA 4BFYA 3ED1A 3TXXA 5D8DA 1NUTA 2PR2A 5DHTA 3MK31 4B9AA 3K6SA 4OHUA 3P9CA 1FP6A 1E5TA 4FGKA 3WLQA 5B7GA 4JKOA 3W5BA 3JZMA 2A53A 1WMFA 4AT1A 5E3IA 4U4AA 4DANA 3WLIA 5AXBA 3HPQA 4D9EA 1O9GA 4P3KA 5AM0A 2XNDA 3MGBA 2DUUA 2LDXA 4YVFA 1GCUA 3OQIA 4KRXA 4YHHB 5K6RA 3AKYA 3GXBA 4H18A 3D81A 5EIHA 5GONB 3C6QA 1MFPA 5ALIA 3R23A 2Q49A 2XH8A 3REQA 4QVGA 5BWBA 4ZHQF 2V7UA 2Y1LA 5KC9A 5AKYA 2BKEA 4PO1A 2GS9A 3K71B 2OD7A 4Y0AA 2XADA 1I36A 2QR2A 1T5IA 3CFFL 1PDWA 5CFOA 1FP4B 1DG9A 3OF2A 4U5XA 1REQA 3Q1KA 2FP4A 2ZE6A 1UQTA 4S0ZA 4DCCA 2WKSA 1DOAA 4P5EA 2DQZA 3D64A 3AHIA 3BXEA 3EVFA 1E3MA 2IV7A 3U3KA 4C04A 5KOIA 4RV5A 4P4TA 2JF0A 2B82A 3CFHL 1NC1A 1SZDA 1AGNA 3LWNA 4A8JB 4YGYA 2VJDA 5FYQA 1NBWB 1XTRA 2JLCA 2HMWA 3I5YA 5JSFA 2A1IA 3G5TA 4KDCA 1QH0A 2FPPB 3DMYA 4BNUA 3FPHA 1J00A 2PNFA 4GQIA 4GMGA 1J9GA 2RGNA 5T8KA 4BO1A 3EPPA 2CUNA 3R1IA 3PDWA 1GFWA 1DTSA 3IA7A 2H3HA 3QFTA 4LSMA 2YZGA 4NKRA 3RC7A 4RANA 3SF0A 1Z33A 3UWOA 1M2EA 3T1QA 4QXOA 3WO0A 3ZQ4A 1JVBA 3AIKA 2PX6A 3B2EA 3L7BA 4IIXA 4G5FA 2JB9A 2CHVA 1XL0A 3JQ9C 3Q6NA 1A72A 1WW2A 1M54A 2P75A 2BFFB 2PRIA 1EHYA 4GXRA 4KVGA 3VXKA 2ZI6A 4HUQA 3M6FA 5BW5A 1UBRS 1OB5A 4ZDJA 3GX1A 1J0CA 2QUIA 3M9WA 5FOTA 1GUAA 1JHPA 3OF5A 4GU5A 4C0XA 5K4HA 1FZTA 1SC6A 3BFXA 1CUEA 3ED5A 3W7AA 4X93A 3ENVA 4KUHA 1E2PA 1G8HA 3TDNA 1U1GA 4HOYA 3NTRA 4GZ6A 1Y3AA 2PYIA 1Z2CA 2IYOA 2QUBA 3N5KA 3EODA 3WZMA 2FJPA 2G8NA 4WESB 2A84A 1UJCA 1TXGA 3AF4A 4FU0A 4WXEA 3BK2A 2VK4A 3HYRA 2XEDA 3EGWA 1IEXA 1BTOA 1JB9A 3W5JA 1P1RA 2BBSA 4M1WA 5C81A 3FE2A 1VE7A 4WBNA 2EP7A 3KSZO 3OQVA 1V0JA 3FFTA 3WO1A 3VYVA 2C9BA 2XOKA 3LDUA 1N8KA 4G0VA 2EC5A 2I65A 1XWWA 2R97A 4TXHA 5D6NA 5GIOE 1FNCA 1V3VA 4V39A 1D1QA 4QBFA 1AZSC 2IPNA 1SC1A 2VDVE 4JH0A 3UH1A 2LR0A 3NHJA 3AKDA 3GMIA 3KR0A 1T34A 3FM9A 1EINA 3QKSB 3DHNA 2ZJOA 3ROEA 3U0VA 4JHLA 5JI3E 1XQWA 3CRRA 2PBFA 3PXEA 4ZOAA 5JS6A 2B4KA 3P20A 2I66A 3GFGA 1Q50A 5K45A 3O3MB 4MARA 3FUCA 1UXJA 3OA0A 1YE5A 3LTEA 4DDMA 3QVGB 1TUIA 1Q1ZA 3W4KA 3EXFA 4D9IA 2BKUA 4IQGA 1O9BA 4I3GA 13PKA 2HCJB 2P0YA 1OGYA 4UXHA 2GDJA 3AVWA 1F20A 5H7XA 1Q77A 1HBJA 1FUEA 2JJ2A 2O0JA 3EZNA 3AF5A 3H11A 1BXRB 4FR5A 2GSDA 3E61A 4L8WB 2Y67A 3KX2A 5JD5A 1RACA 2H1LA 2GXSA 2NSJA 3U09A 3JQ8A 1DJOA 2C4WA 1DHRA 5HM6A 2ZJZA 2AOTB 3LPDA 4B2IA 2E1RA 1BDBA 1PS9A 5JCJA 3RVSA 2QVLA 3JXEA 1P9NA 3MB8A 2BEUA 4GPIB 5C1OA 5F9HA 2IS4A 1W76A 3WNVA 1A97A 1UBLS 1SCAA 2XNCA 4P7FA 4QBTA 4QUAA 5ICEA 1NF9A 2WIKA 1ZOIA 1B8NA 2G9ZA 2XVZA 3K0AB 3QE3A 3H9JA 4OAQA 1AX9A 4GZ5A 3S1SA 1KEPA 5JQGB 3R6LA 5KYGA 3FKSD 3G0OA 5BW6B 4EVQA 4M1TA 3TL2A 2ZRDA 4GSKA 1K08A 1PGJA 1PJBA 2WYUA 3UJ7A 1KMIY 1NVEA 4DC0A 1ADBA 1U5BB 4HAIA 1M6VB 1M1XB 3GT0A 5L8VA 4R5HA 5HP4A 1K2WA 1KOLA 2QBYB 3RKRA 3VOAA 4U2CA 3PUWA 2X4GA 4CMGA 3AVYA 1E0SA 3M5WA 1JKFA 2QRKA 5K8LA 4M3NA 3T9EA 4ZDWA 5EC8A 3P1JA 4GRDA 4LOKA 4DA0A 4MCHA 2XE7A 4MW6A 1LCIA 3N28A 1FX1A 4X85A 1MV5A 3FSRA 4LJSA 3IVAA 5AYVA 2WDPA 1PQPA 1P3Y1 3C41J 4KX3A 2ZJ3A 3BQNB 2WKRA 2W2QA 1QCYA 2BFCA 3IO3A 1UMDA 3GDWA 4K9OA 2H0AA 4O8ZA 5KX5A 2FZ5A 2XKBA 4KYVA 4DQXA 2WWRA 4A15A 4N48A 1F0KA 2RGUA 3L7YA 5K7SA 4CFYA 3SLGA 3ND6A 3LA6A 1JPJA 1NOIA 4MLPA 2PLFA 1U81A 1YBHA 4RH0A 3CJRA 4QGBA 3A1VA 3LL4A 1WS6A 4GOXA 4JOBA 2I80A 2NXEA 1KMNA 2W6OA 3I01A 4MVJH 4KP7A 5EERA 1IVSA 4MUBA 2R5WA 1JHVA 4HWTA 1TE2A 4RJJA 3IPYA 4PC2A 2VSQA 3M3PA 1RXSA 5FOVA 2EGHA 4AFNA 1KVSA 4N7RA 1RCFA 3PEWA 4HXYA 3BN3A 3L6UA 3GGCA 4RK6A 4MWBA 5F1KA 4ZI7A 2Q0QA 5FTWA 1UDAA 5BOVA 4MDFA 3A7EA 4L4RA 3HWSA 1L5YA 3T7CA 6PFKA 1SCIA 3KJXA 1E89A 3BD6A 5JXIA 1ND6A 3UT5B 4B8ZA 4HEA1 3U56A 1L5HA 3C15C 2CLHB 4LX8A 1Z5UA 1LRKA 2OZLA 2JGJA 2W90A 2ZKIA 1E2DA 2ARKA 2EGUA 1AKTA 1AHIA 1YBFA 2NUTB 5IJWA 1KWGA 1WCIA 4HDNA 2YJGA 1KYVA 4C07A 3T1VA 3FSJX 4YCSA 1D2NA 5DGXA 1HFWA 3CM0A 1LH0A 5EIBC 3QLJA 1EHCA 3IP7A 4OGWA 1Z29A 3K0HA 4G9EA 2E55A 4KO3S 4BBPA 4ASUD 1XA3A 3ET4A 2DCMA 4KYIB 5FTNA 2HYIC 2DUWA 2E4VA 2WFLA 1I9CA 4C7OA 5AKEA 2HF7A 3CX7A 3K9WA 3R5KA 4PZ9A 5BYJA 4DAEA 3T3HA 1KR2A 1NBME 1MRZA 3AESA 1P0IA 4H7HA 4HDOB 3KJNA 4EVRA 1LY1A 3L7MA 3WIDA 4MS4A 1FBNA 1VLZA 4N8DA 3OTIA 3ENNA 4FILA 2WF6A 3BIJA 3NNSA 1JQBA 1ONSA 1SWWA 1AQNA 2Q50A 4HRYA 1TF7A 2R6AA 9ABPA 2P4QA 2R85A 3IAM6 4IDQA 4INAA 1UWKA 2PKCA 1NMXA 1PYOA 3V1YA 2Q0HA 2HWXA 3ILSA 1P4GA 4KFTA 3QBVA 2GZHA 1L7RA 4YAOA 4JBLA 4M0MA 4YR7A 1SXHA 3MSXA 3T95A 1U8CB 1AS0A 2BMEA 1PEYA 2PJZA 4S35A 3RUIA 2OPBA 1OX5A 3BWCA 1OWMA 2MCFA 5JDCA 3D6JA 4WFIA 5CPFA 3MGCA 5GP1A 1ID8A 1W87A 3OY7A 2A50A 1CEXA 3O92A 4R1PA 2IIBA 1C9MA 2WOJA 2FG7C 2CUKA 3NC4A 3X44A 2NZUG 1T3SA 2AX3A 4KB5A 2G70A 1RD4A 3DCYA 4KDFA 3M6IA 1VIYA 3WNZA 1I7SB 4E08A 4Q3LA 1HWYA 1VDMA 1JHXA 2O2ZA 3QG5A 3QKRB 2V7WA 5DNEA 1U3WA 2CNWA 4LWPA 1DDOA 4RBNA 5GONA 3PFHA 4R1LA 1EJ2A 3IX7A 3SDBA 4DCUA 4R2IA 2A35A 3GRVA 4I5GA 5T3UA 3SBXA 3SYMA 2OWDA 4B33A 3KQUA 5E4JA 1XK6A 3TSWA 1G18A 2C9DA 2A9VA 2YV4A 1FP4A 2ZAOA 2YIDA 1Q22A 3DHEA 1CS0B 2ZYUX 4I19A 2AS0A 1FE8A 1JP7A 1USKA 2XYVA 5CYOA 3DVLA 4YDHB 2WB4A 1EM8A 5KQPA 4NP6A 1GDDA 2BVNA 1MIOA 2ZRCA 3N59A 3MTQA 4G4SO 5BUZA 1E9SA 3OHSX 1D4FA 5K01A 3KB6A 4QYTA 3PQ7A 1CY4A 3ZHYA 5IDXA 1BJKA 3ZU5A 2AMJA 2ZWOA 3EEQA 4OJNA 4JJFA 1QYIA 4WFKA 4KFUA 3S5UA 4KAAA 1IXZA 4A8JA 4AY5A 4YV7A 1N5DA 4US2R 4FBGA 3OEED 2GJSA 1RZUA 4BO8A 4KRFA 2DULA 2FWAA 4MXDA 2FSVA 2OXIA 2FPPA 3ACDA 2AYZA 1THMA 1LTQA 1RYHA 3NWBA 3E53A 2XRYA 4KPYA 1QIEA 1P2BA 4HB4A 4HWKA 2FFQA 4HSGA 1KK1A 3C8MA 2ZJ5A 3HHPA 1QU2A 2O0KA 3E9MA 5AI6A 5GV8A 1E69A 1M34B 2BFFA 2KMLA 2MIIA 2O2IA 3H6HA 1ARZA 3L4BA 3ISJA 1ACLA 3QW4B 4FYKA 1EYZA 4CU5A 2ZJ0A 2TRSB 1B6TA 1E64A 3NI2A 3GLGB 3WGMA 3U6KA 1QYCA 4H15A 3KZNA 1SZCA 3QUSA 3ZTTA 4DQVA 4GPZA 3IP1A 5AP9A 4B8WA 2E85A 1WU7A 2IX9A 2OA0A 1KORA 3W5IA 1RZ3A 4W8OA 4WESA 2VXBA 2DFKB 3F74A 3GT3A 1JQ5A 5B5SA 3M5PA 3HDVA 5TPWB 3KL2A 4GX1A 3T3DA 1VBMA 1TKAA 1E8MA 3NBKA 3O94A 1SO8A 2LUOA 3K7EA 3OM8A 2BE9A 3M1YA 4PXSA 4UCFA 2F6RA 3I83A 4MWOA 5KVVA 2F1JA 3LHSA 3ONVA 1R6TA 2HBRA 4LAFA 1L4BA 1IG0A 1LS6A 4I2VA 4G41A 1L4LA 1ZD1A 2C2MA 1U2DA 3VSCA 4UZEA 2JLUA 3SS7X 2WICA 2A1TS 1ZH4A 1K8RA 2A1UB 3QLUC 4FHZA 4HDSB 5ETJA 1G5IA 1IEQA 4YT4A 1ST3A 2I9PA 2A5LA 3LF1A 3QKSA 4B82A 2GZDA 3IR7A 2FEKA 2LCIA 5J4YA 1OF1A 3WSVA 5KS2A 1N2XA 4XWKA 3ROKA 3S5JA 3INRA 2ZUFA 2JFBA 1NUPA 2XIQA 3IPXA 1RYDA 3QVGA 4L95C 5CDHA 4OGKA 2H4ZA 2O54A 1AKNA 5A3SA 2O9JA 3PTLA 4W5WA 4A82A 2F55A 1PG2A 3ZNOA 5HUHA 2JD1A 4YC7A 1IULA 2D62A 2HA7A 3STXA 4G07A 3TD2A 3OMXA 1I32A 1FP2A 1OE0A 4ZVPA 3STTA 4DIUA 3R3ZA 3RTGA 3OY2A 4XD2A 1V35A 2L17A 3DR5A 3AHFA 3H2IA 2QTZA 9ATCA 2ZRQA 4TLDA 1U99A 3WRYC 1NR7A 4HXGA 4M37A 3ZWAA 3AR4A 4ZYWA 5KNCD 3ETNA 2VF4X 1UBMS 1KA9H 3ON5A 1JAHA 3PNPA 2FX2A 2AOTA 1GG5A 3DBLB 2C4HA 3KR1A 4QHYA 4XR4A 4GXQA 2EBHX 4ERNA 4D4IA 1XELA 1EK6A 5TB5A 3S2YA 1KDOA 4FFMA 2DT8A 3U3XA 3AFIA 2REXB 4ILKA 2BHTA 4P4NA 5CYFA 2P9FA 3EQ6A 2XI4A 3HLTA 4WOPA 3K0AA 4UE2A 4F7WA 5JQGA 1Y5MA 3N2NA 3H05A 2C07A 3GEEA 1OXMA 1H42A 2FMUA 2O8VA 3C1TA 3SCZA 2OVBA 1FDIA 1JIJA 3FD8A 2XV1A 1ZJYA 1QPGA 3LLCA 5EKSA 1U5BA 3OZCA 3TLGB 5IU6A 4UPVA 3ZBQA 3SY8A 4DNPA 3C7DB 4C43A 4BUJA 5KWEA 1FRNA 4NBKA 5AVYA 3QVLA 2PUCA 1VIDA 3FAKA 2FEMA 4JQOA 2OCAA 4EY8A 5DE3A 4QGAA 2M6RA 2WU8A 3HU3A 4G65A 2PTHA 4XZ3A 2WY2D 2WLTA 4G6ZA 2IOFA 5JE8A 2EWWA 4AWXA 3PICA 2CZGA 1GR1A 2YXEA 2PGAA 4IXNA 3Q9UA 2PK3A 4YRQA 1VA4A 2CLKB 5ELMA 1GTMA 1MKYA 4L5IA 4BN5A 3EYWA 4IHQA 2EF1A 2W6IA 3UB3A 1N34B 2OQIA 4MW0A 5FOUA 3VV3A 4BB5A 4LE0A 4QC2A 5B58T 1KDRA 2BT4A 4IX1A 4PXYA 4WK0B 4E6PA 3HACA 4RL4A 2PL3A 2UZAA 1O87A 5HIAA 1BA2A 3WYDA 2QSYA 5A4AA 1D7OA 1K8XB 2WK1A 4OJTA 3KKZA 3VC1A 1QHNA 1A5TA 3D3EA 4WCVA 4MAMA 5G4KB 1V3TA 2BMFA 4TTIA 3GA5A 4N7BA 1OC4A 3ZHSA 4HQOA 5KNDH 2IZ6A 1NNLA 1VXRA 3H1TA 1CR6A 2VPPA 4N65A 3P2OA 3RGWS 3D1VA 2OUKA 5LLSA 3KHSA 3LYHA 1W6RA 2RIPA 2KSQA 3NDRA 4JN6B 4PLCA 5IF3A 2HQRA 1LWNA 4D4GA 2B99A 1XROA 4FR0A 2I6XA 2YJ3A 4O25A 3Q8KA 5D5QA 1CEYA 4NARA 3MTGA 2Y4OA 3F1LA 3DR3A 1AZTA 2C83A 4X1IB 3SZLA 3HYTA 3ML1A 4K2AA 5AW6A 4PG5A 1KKLA 4QEZA 2AOVA 2OZVA 2WVGA 2NUTA 4CM1A 5I7VA 1OH8A 4UZFA 2G6TA 1F7VA 5T3YA 4MRMA 4RO0A 1GGFA 4RXUA 4QJ4A 3RKUA 2ZRKA 4A36A 4DLKA 3N05A 4CCAA 4YMLA 3U19A 3UBTA 1ES9A 5A4JA 3GH3A 1XVUA 4EB8A 4G84A 2QTHA 1SCUB 4LZAA 2CEKA 2F3RA 3SOZA 2HUPA 5DX1A 1DAGA 3IERA 3ZE2B 2BGJA 2BUBA 2OR3A 1F6WA 1K1EA 1Q7EA 1Y1RA 2W6QA 3AR8A 1IDOA 3C87A 3DZCA 4IWYA 4PLTA 1XEWY 1KYWA 4JLNA 4BNMA 3OIWA 3N2KB 1NAIA 4M36A 2FI1A 4AMVA 5GJVC 5HDQA 3ILHA 3OTGA 3U7QB 1VXOA 3CQ9A 1O6ZA 3R41A 3GCGA 2HHJA 2P65A 3VR1A 4P0PB 3G9ZA 1M75A 4YHBA 5A6SB 4D43A 1D3AA 3PQ8A 5FORA 3TFQA 4FCCA 1U3VA 5A05A 4EAQA 1XP5A 2VP0A 4YIHA 3FWKA 3FWHA 5AI5A 1GQRA 1Q19A 4PLVA 5EQJB 6GPBA 2IU3A 3MVEA 2W6JA 4JZYA 1W1WA 1XB2A 2H08A 4PLFA 4WBNF 4KE6A 2H29A 4KQCA 4Q6BA 4UM8B 3CRQA 2AJ8A 2JHAA 1YJ8A 5ESRA 4EH1A 1RNLA 4R16A 5BUCA 3I92A 2CLLB 1MQAA 4Q7MB 2D5CA 1E3TA 4NI5A 4Q3OA 4F72A 5C52B 1IN5A 1TQHA 2P91A 2RHLA 3SLKA 2WVJA 1RSZA 1TIPA 2BMJA 2FCAA 3NM5A 3QMPA 4CODB 3EDCA 3P27A 3OQHA 1L7VC 2QNRA 4JI6B 2GERA 3VYUB 1K8QA 2VF7A 3OJFA 3G2JA 4ND1A 1S89A 5G0WA 5B1DA 5L95A 4JC8A 4JI4B 3OEHD 2VHWA 4FWIB 1JWBB 3BL6A 2W6PA 3S2FA 5LPNA 1P19A 1XCPA 2Y1GA 3U4QB 1NMSA 4K9KA 1Z2OX 3P2IA 1KEVA 5DK6A 1Z06A 5TMEA 2O05A 2P3SA 3G68A 3QKRA 3ZDBA 3EEYA 1U2TA 3EZFA 3DUWA 5K0NA 4DS3A 5KYTA 4EOGA 1JWAB 1QYVA 2NV2B 4WK6A 4I1SA 4MDEA 4QWMA 4ZAFA 4F71A 2ZEJA 2A52A 1SJ9A 1IDN1 3TLBA 1BHO1 1CS0A 2AN4A 5L9AA 3Q3EA 3KD2A 1XVAA 4K3UA 2WEKA 3D4OA 3P4YA 5CVUA 4B45A 5JLAA 4RVCA 4RHYA 1MX9A 3KKOA 1VL1A 5MHTA 4QT4A 5DTRA 4ZVNA 3NBQA 1HRDA 2FUCA 2OHFA 3DL7A 2Y1CA 4E11A 1OLSB 1QJ4A 4FDVA 1XBTA 2C99A 1QCCA 3IHWA 4H6VA 1QRDA 3UXHA 1LPMA 1ENZA 1X39A 3Q11A 3OX4A 3RS5A 2IDZA 1JYEA 3AEQB 1H4VB 1GSAA 2J9RA 3CW8X 3QFSA 2VXCA 1MDBA 2CW5A 2WABA 5E6SA 3VTAA 4DEYA 1SC9A 2JGRA 3FWPA 3QI2A 3ZGLA 2BM0A 4TPKA 2BHNA 2NV0A 2Y1WA 3TW4A 3L92A 3C70A 2PRJA 1FFAA 3KQYA 1U8EA 4YJKA 4KIGA 3R9KA 2KWIA 3MJFA 3N6RA 4E2YA 4K9NA 5BSEA 1OIVA 5HZMA 4IVQA 3OC0A 3GK3A 1M34A 4E12A 3EQ9A 1FYWA 2IPMA 2ZANA 3IAXA 1U8ZA 2FFJA 5BRAA 1P0QA 2W71A 4NY1A 1XLWA 2B34A 3WDMA 3TLYA 1IBCA 3KAJA 4MWGA 5FFFA 4F4JA 2BCGY 3UGJA 4IS2A 3ZGXA 5AXDA 3NEPX 2QW8A 4NOKA 2AQKA 5TX7A 3EB9A 3N2EA 3SFVA 1T5HX 3HFJA 5AIBA 5KX5F 1H2AS 3Q6IA 4HGRA 4W7SA 4JEHA 5CLLA 3U37A 5JFGA 3C43A 3GZ4A 1B16A 3IMGA 4UM9B 5TPZA 1B0ZA 1E7QA 5ENVA 4ER5A 4DRZA 3I8OA 4FN5A 5TPWA 1UK8A 1GZDA 1NLZA 5THQA 2IU0A 4C6TB 3FNFA 4KAFA 4BKMA 1YL5A 1M5RA 3HTXA 3A6GA 5I4BA 1WXDA 1OI2A 4IG4A 2CHEA 5TMPA 2FFAA 2OLKA 4KEAA 2LBPA 5L3RA 1ZR2A 4AM8A 2AMLA 4YONB 4ZI7F 1U3GA 2F8MA 3AVQA 4YMSA 5BV7A 3NKVA 2GRUA 3EPRA 3HL0A 4HDSA 3T5PA 2FUEA 1H66A 1XU4A 4TM7A 2Q8NA 3B6JA 4MGZR 3U81A 3VRHA 1K7YA 2J5RA 3E35A 3OZTA 3STHA 4BO4A 3HN2A 1UM9B 2O2SA 2IYWA 3IHTA 3JQ6A 4BV8A 4BFLA 4EHBA 5JJLA 3OC6A 1MA3A 1A3CA 4WBSA 5CHEA 5GJCA 1BNCA 1YQ9A 2JEOA 3SN6A 2X8WA 4ID9A 3A9CA 1I33A 1DQSA 1R0ZA 1ZMOA 2V97A 3L41A 4N3CA 1N2EA 2B7BA 8GPBA 4W5RA 3ZHRA 2C0PA 3G9QA 3N7AA 1Z0ZA 3B2NA 2AYXA 2ZB4A 2VZ8A 3F6SA 3I62A 2Z6QA 4JBHA 4MIKA 5JWOA 1WXQA 4MRVA 3BWBA 1MC4A 2P9GA 3A4LA 3WLJA 1U2GC 4AXBA 5DI3B 2LIVA 4HRXA 5GM1A 2CL6X 4TLEA 1SY7A 1G3QA 3BD7A 2BM8A 4XX0B 3WQQA 3FTFA 4DGSA 1F6BA 3CPEA 4H6PA 4HDCA 1EVQA 3OT5A 1U3UA 3DBLA 4XGRA 7ABPA 3AZOA 5JZVA 1I6WA 2D5LA 1YF3A 2ZIWB 1XDGA 1G63A 2HJ9A 1C9YA 3RCBA 3D6VA 4B84A 3S28A 1J8QA 3BF8A 4TSFA 3G2PA 3JWIA 1SN7A 4LOHA 4LPKA 3RGGA 5J47A 4RVHA 4N7JA 4QFBA 5DWDA 3RLFA 3WY9A 4PVCA 4ETMA 3SQNA 4BMPB 3U49A 3D8TA 1A71A 2GWRA 3I30X 3OFNA 1KI2A 4KLRA 4RC9A 2IQ5A 4G85A 3TLGA 1VL6A 3VO8A 2ES4A 4ACAA 3E58A 5AMXA 3ETEA 3MJHA 3NRCA 1ZI9A 5KSOA 3UJPA 4Z86A 1AV6A 5CTAA 4YRTA 1KC1A 2HTFA 3LP6A 1BWRA 4J2TA 4NE7A 1W0CA 4F1WA 2W2XA 2J9GA 3LCCA 2QRHA 5KNCH 1RXIA 1E92A 2XRFA 1JPVA 5C5EA 5KNLA 1NFFA 1T6XA 4NFYA 2WU3A 3T1NA 4PONA 4MYCA 5FWYA 2IXEA 5CLFA 4A92A 1PFYA 1CP3A 1F2TB 4HI0E 5GZ6A 2A9RA 3U26A 2VAVA 2UXBB 6Q21A 2PZBA 1EP1B 3GQBB 2H7XA 3QRWA 3QYPA 2MTBA 4HB2A 2ZXEA 4GMKA 1D6SA 1G2PA 4JLOA 1S2LA 3CZMA 3DAYA 5DLPA 3SS9X 1ZNQO 2VNHA 1K7CA 2AFIE 3TL6A 3ZWKA 2HK7A 2VS1A 2ATIA 4GMXA 2AQ8A 4MJLA 2CDRA 3DDZX 1BMQA 5HKBA 4CW7A 5A3RA 4KQGA 4OV6B 3JY6A 3JPWA 3ZZ0A 3B1WA 1QQ6A 2FN7A 3E22A 5FAKA 5I7EA 1TVMA 4UTNA 1TKCA 1SKMA 4A23A 2PCJA 1A98A 1V8PA 4HXEB 5EKDA 1TQ2A 5G4KA 3PITA 4BGVA 4CN9A 3IIKA 4DF3A 4M1MA 4TZTA 1URPA 1WMAA 2XUFA 1NYQA 4GW3A 2AH5A 1T4CB 1N2JA 2QEQA 3QITA 4KQFA 4QGFA 2QMYA 1TAHA 3ORFA 3M6MD 4M76B 3BWYA 4NCJA 3S40A 4EUSA 4H17A 4GUDA 1CRZA 4RU1A 1OFTA 4JJGA 3SSNA 2W6ZA 2ZTVA 2J30A 4HWGA 1FPMA 1QNFA 3TLJA 2X0IA 1O03A 4LJLA 5IUNC 5GADl 1JILA 3W0LB 1UCFA 3K96A 5IVHA 1PR0A 2X0KA 4L3OA 5KOJB 2BF7A 2GBFA 1ZISA 4GECA 5DGCA 1MGOA 3E3NA 4YRIA 2NYVA 4X1IA 5TEWA 1ECFA 3NBFA 3OUUA 3LA8A 3TTUA 3V9PA 3ESYA 1TTPB 5H8WA 2HJVA 4YALA 2PZKA 4LYEA 4FCTA 3CVYA 1U94A 4B17A 1GGEA 1RFLA 2E0IA 2OV1A 1SA0B 3NHWA 4EY6A 1KTVA 1SCUA 2VTKA 2OFWA 3ZVNA 1D1SA 1WXFA 3DHVA 3QXCA 2G6BA 4OK6A 5AW3A 2LZ0A 2OAP1 4Q18A 2AQHA 1KXZA 3PGVA 4Y9DA 2HK9A 2QLFA 3L5OA 4Q7JB 3U39A 5ALWA 2YNMA 4MRSA 1FS6A 1Z8FA 2OXCA 1D07A 5B3JA 4URUR 1IZ7A 1EH5A 2V9ZA 2ZCVA 3C4QA 3N2KA 5ALGA 5EP3A 3U7QA 2VC2B 3I04M 1MB3A 4HNQA 1H22A 4P4UA 1P73A 4RH1A 4UAGA 4GR5A 4PZUA 3EXIB 1EHIA 3VDMA 4N6NA 1X3LA 3GJYA 5A6SA 5MF6A 3OJWA 3FETA 4CHTA 4QXPA 1EGAA 3OX1A 4P7JA 1SHUX 2DAPA 3JX9A 4TTTS 4LKRA 3G8CA 1PSDA 1E2IA 4IYJA 3C0KA 4QU0A 3BGDA 1G19A 2AG1A 2NZ2A 4NICA 4C4TA 2IIVA 4F04A 1NOJA 3DL0A 4LHYA 1A77A 4HMOA 4DA9A 5I7WA 3IOBA 1XZKA 3B3GA 3VNQA 3PZBA 3QH4A 4JX9A 4Q5IA 4PV7A 1DIRA 3HVRA 2WF9A 1NW5A 3OCXA 4TKVB 2DEUA 2VDMB 2ZYDA 3EXHC 5A3VA 2ZBQA 4C89A 2HGSA 4DSUA 2YS7A 1NR1A 4O5OA 5I9MA 3UA4A 3S99A 1QDUA 4J16A 4BO0A 4ZU6X 2D59A 4HVCA 1I3LA 5G0VA 2OKGA 5A1TA 3BOSA 3CEPB 3LUDA 3VU1A 3U4QA 3VH4A 4I9GA 5JMOA 4G5HA 3TPZA 3N2YA 4HTAA 5AUNB 1CUDA 2AI2A 3BDIA 1NY6A 3COJA 1P62B 2OBNA 4BQRA 1P5JA 4CI0B 4QUKA 3RC2A 1R12A 1DDIA 4ZRMA 5HPYB 1N9ZA 1KSGA 1Z4QA 2DUJA 2YY6A 3KCQA 4YJFB 1BKYA 1F8UA 4DSNA 1WSBA 4AKSA 3BT7A 1TYAE 2M98A 2QI9C 4S1VA 2EYUA 4FK8A 1NBHA 3BA1A 4QLBA 2QIPA 3GUCA 4MUNA 3ZE1B 4JYMA 4Q6WA 2OZKA 1EXDA 3TAUA 3DGFC 5CB6A 1N0IA 2BZ0A 3L93A 3X2FA 1QHSA 1IN4A 1OLSA 1VECA 3GEHA 3W2HA 4G5SA 4Z6KA 5JQGF 4NHOA 3W1EA 2XCTB 1SC4A 4L74A 5KSPA 3LRPA 1Q16A 2EZ8A 3O9VA 4Q1FA 4BJ6A 4OHYA 5KYXB 2RHDA 3AEQA 3U6BA 4YY3B 1V41E 3FPAA 3HJGA 2X2PA 3CPHA 4LGYA 3EOBI 5KUTA 3P45A 1R0YA 3VGPA 4B7CA 1N6NA 1KZ7B 1MH1A 4BIMA 4QJBA 3V3KA 4D3DA 4F96A 1XVTA 4YRNA 1ZK1A 5AI8A 4B3HA 1PJ8A 5EJFA 4LYFA 5K0FA 4JNCA 1ZK0A 1UBNA 2PSSA 5L6MB 3T7IA 1HDIA 3H5IA 1EFRA 2IDKA 2KE5A 2YDYA 4G8CA 2DRIA 2C77A 4MYTA 4TKLA 1TJNA 2QMEA 4Z1MD 3RSSA 2JL1A 2BV3A 2M1XA 1MR3F 3L8YA 3O73A 5FBHA 5KREA 2BFDB 3SYRA 3TTWA 1C0IA 5FBVB 1H4SA 1GVNB 1XZAA 4UHJA 2D13A 2QTRA 4LECA 2C54A 4AZWA 1W8IA 4FUQA 4YT5A 1LJ8A 4U2FA 3O6VA 3V8EA 1PJ3A 2GO7A 5D00A 3KLOA 1I8TA 5AI4A 3T5BA 1GPUA 1UJ4A 4CDMA 4EHJA 3MTEA 1FA9A 2ID7A 1JTVA 1YU6A 1XJ5A 2WZQA 8OHMA 2I54A 3N87A 1E8DA 2X41A 1C8LA 3DMDA 1CUAA 4J9UE 4C6TA 1RJEA 4C5BA 3D7KA 3N7TA 4FINA 1A9RA 1R1DA 5G1OA 4HV4A 2NAPA 3OKFA 1FDRA 4J6FA 3MZ0A 4PTLA 4DMMA 2CVFA 5MFZA 1U0BB 3ABSB 1P6XA 2BH9A 2Q4DA 2V1XA 2ZSHA 4L22A 3IULA 1G20B 2NQ8A 3M6LA 3P71T 1UZNA 5M3BA 5KYNA 3FSEA 2YWEA 1L4EA 4LYJA 4N5HX 3PDIB 2FKAA 2CFSA 2FU5C 5C8VA 1I3MA 1KDTA 1DO0A 1MC1A 1H5UA 4NMMA 2WJVA 4W5JA 4Y6QA 1IXRC 3LI2A 1UM9A 1Y7TA 3KPWA 2JFYA 4KQJA 3R7AA 4CZ2A 1KOFA 2HRZA 1MP0A 1GCGA 1T0PA 3JR7A 2Q6TA 1KY5A 3M1AA 3GIDA 3UHJA 1KWKA 3RS8A 1ZMBA 3BMNB 4EY3A 3KC2A 3NC0C 5TT1A 4FNGA 1MZVA 3GMSA 4URZR 2F1OA 3UAWA 4EA7A 1VCNA 1PQWA 1RLOA 3M4YA 1ZP6A 3PR2B 3QVJA 2I76A 1UWVA 4UUNA 1KTIA 2IXFA 3AUKA 5FLYA 2PT7A 4KIJA 2C4VA 5DI3A 4H35A 2DETA 4KUGA 2Z5VA 3Q41A 2C5FA 4C4OA 4KXUA 2NO0A 1W44A 5CM2Z 3RAFC 3NYRA 4O5AA 1XDWA 4OP2A 1ORRA 3WDSA 1B0PA 1NTOA 1G3RA 1XDUA 2GF0A 2YVQA 1FFBA 2AKYA 3O8QB 4QTTB 5HF6A 2PS3A 2YVUA 3DE5X 1LDEA 2O7QA 2ZP1A 3DLTA 1RCUA 1R4MA 3E7FA 4ME6A 3BIOA 2NTEA 4ESEA 5IEJA 2OHHA 2QM8A 2IBTA 1JB1A 3CH4B 3ZPXA 4EX6A 3EOZA 4TKUB 2Q4RA 4OD0A 4UOZA 4XEHA 3DMTA 1VKNA 4LDQA 1IJFA 1ITZA 1O94C 2Z30A 2A0WA 3AQIA 3BMCB 4FXOA 4EZBA 1Z35A 4MX8A 1RS0A 1VMKA 2AOWA 4E94A 1IH8A 2C2XA 2H1IA 2EJWA 4NU5A 1J0XO 3LF2A 2HPZA 2G16A 3L8MA 4Z0PA 4KJXA 4B80A 2XB8A 3E0XA 4HAVA 2QMUA 5DP1A 2QTLA 3W3AH 4GSLA 1Q0PA 3M4NA 3N58A 4FSDA 5C8YB 2Q27A 1TK9A 4B1FA 2XUAA 1FVHA 1Z74A 2YX1A 4DMFA 4RJKA 4NCBA 4B4KA 4B6QA 1GNRA 1BG6A 1IZYA 2Y0DA 2VPIA 1F2TA 1OTHA 2MSWA 2R4UA 4DCMA 4XVRA 3GQBA 4FI3F 1GXSB 2OLEA 3ZW8A 3CE9A 1T1SA 1MLDA 4C88A 2C84A 1DCMA 1LF5A 4OJYA 1KAHA 3VVMA 4Y6LA 1PTJC 3F6EX 2D7CA 4UTVA 5IMBA 3IESA 4N3GA 5DGIA 4E88A 5IEBA 2NVUB 4R1TA 4RJLA 3CVWA 3AYXB 2B20A 3GBSA 1L9KA 3N1UA 2DFNA 2BKVA 4YMUA 1IVYA 1LBEA 1Z6GA 5EP1A 5BR4A 2R6JA 2VSXA 3HI6A 2NWQA 1BMFA 3BTSA 2AN3A 3BTVA 4ZQCB 4G5GA 3V7UA 2HMSA 1WW8A 1ZJWA 1TQ6A 1T4CA 2A0YA 1A9TA 3VR2D 3KKQA 3IVXA 4DDKA 3GLRA 4FW9A 4QLOA 4JU8A 1RHRA 3AF1A 1XRPA 2CYBA 1KZHA 2C78A 4WKPA 3KQLA 1QWOA 2WF7A 3P97A 4JIGA 2CYCA 4C06A 4RETA 1PKXA 2G8LA 1TJ3A 2BFNA 3UEOA 2A30A 2DPMA 1AUOA 4IUBS 4KZKA 3NAQA 4QX6A 3S2IA 4ZYTA 2EZ9A 4RHXA 4TYMA 3I23A 5ECGC 3HXOA 3QNWA 3E3AA 5F2NA 3I9MA 4JJ7A 3TEJA 1FQKA 1FMJA 4GI3A 4IIDA 4OI4A 4CUJA 1VP3A 3KUKA 3AR3A 1DEKA 4MKHA 2FR1A 2VDUE 2FSUA 3HN6A 3FCXA 1EG7A 1XDDA 2DJ5A 3EPHA 3GAFA 1SU6A 2WSLA 3RTEA 3SR3A 1SA0A 4IOJA 4UOEA 1AQLA 1YNSA 3IJPA 3CFYA 1MAVA 3WYNA 1WL8A 1YMVA 2DH6A 2V03A 4OLJA 4OXIA 3T35A 2VSFA 3H3XA 2JIOA 1LBQA 4IIBA 5IN5A 1X7WB 3T4XA 4EA6A 1XHLA 1ZIDA 8ABPA 1IY1A 4RXMA 3GFTA 1WLYA 3FZEA 5J4LA 5JT1A 2GKOA 5TE9A 3ZIUA 4DARA 5H3CA 3LIPA 3DQZA 4A27A 1UJNA 2IQIA 2EQAA 1XTQA 4JA2A 2IOHA 2HLDD 3E3LA 3KB1A 4AMGA 2C8LA 3EXIA 4DSOA 1PR5A 3FDXA 2BEVB 1U0EA 4LN1A 3H1EA 1X1AA 4AQYB 3PK0A 4L27A 4R2XA 4GXTA 1WCWA 2D5BA 2JEYA 4WV3A 4TRRA 1R74A 2H5LA 2OK8A 2PMWB 3ICVA 5HGXA 5A2QA 4FX2A 3LMKA 3G8YA 1FRVA 5FR1A 4I4IA 2Y0EA 3ZW9A 4DILA 1UC4B 2QV7A 3WRXA 5I8PA 1GL7A 4F06A 1NPTO 4IFTA 2WAYA 3CR3C 3QVTA 3ABZA 2ZB2A 3RYTC 2GF9A 2Q8PA 2H06A 2WIGA 4Y98A 3KLPX 1R9MA 3F5SA 1QPBA 4OSPA 1NXPA 1RWNA 1UT5A 1FLVA 1ZMTA 1BH2A 1XRSB 2Q2WA 3DB1A 2VK8A 4L02A 4GI1A 4N9QA 5CDFE 1VKZA 4D0GA 2HKIA 4AS3A 3R0ZA 3OI7A 3K53A 1O8BA 2OY0A 2P2ZA 3PFIA 1OZAA 3K15A 4DKJA 2C9CA 3L0SA 1X86B 4MINA 3DE0X 1PJLA 1I7NA 2I7VA 2PSFA 1M1NB 1F0YA 3A9VA 1I14A 2QU7A 2QNBA 3SZUA 4BLOA 5C51B 4QBGB 3WGVA 4K05A 3EWIA 4AG5A 4E6EA 4EKGA 4YWJA 3TXAA 3AHJA 1JG7A 1CUUA 4DLNA 3HY6A 2IIQA 2MJLA 5EJIA 4BMZA 2QMZA 2Y4NA 4YJFA 4EKEA 1JE1A 2XNSA 4LG1A 4X6LA 5IUKC 1BCRB 1KJIA 2IYVA 5JMTA 3A3PA 4KZPA 5REQB 5G1PA 2W8BB 4Z49A 3OQMA 4YO7A 1DAEA 1Q2XA 2C5HA 2GR9A 2NT3A 2V7EA 2PZEA 4KFSA 3ZLUA 1M1ZA 2Q7XA 4HBGA 4FT2A 3SIWA 3ICEA 3W79A 2H1SA 1LPNA 4OHRA 5D5PA 1FSPA 2IW3A 1ZMRA 3L7OA 1P0FA 1XRNA 4OQLA 3G02A 1LZKA 2PUFA 4JLVA 4DJJA 4UDXX 1PSWA 3OE4A 1Q1EA 1P7VA 4E3ZA 4X6YA 1S3FA 4RKEA 5KYXA 5DYNA 3MT9A 1JJIA 3WK9A 2MHCA 3LPLA 1UBSB 1BOFA 1UMBA 2XOKD 3GOQA 1PX2A 1ZX1A 3GN2A 2IOFK 3T7AA 4BFZA 4D8WA 2AKEA 4UJ3A 4KWEA 5HIIA 2Q5LA 3GJSA 3MFQA 4KJZA 5F52A 3WLRA 4LBZA 4IO0A 5EQTA 4L4ZA 4OX9Y 1LV8A 3GHYA 3MWKA 3O4IA 3IBGA 4LS3A 1GRVA 5J4KA 3VA7A 2WAOA 4BGUA 1DGQA 4TLCA 2GEJA 4MIOA 2ZJ8A 1VSUA 1UK7A 4IVNA 3AM1A 1HEYA 2BFDA 4I50A 4X6XA 3RVJA 1VIAA 1EX6A 5G0UA 3ICCA 1C7RA 2FPIB 1GSIA 1GUDA 3KIPA 1ATZA 2CFTA 2WJ4A 2WSMA 3OBIA 4K87A 1BVYF 1J25A 4FYIA 4DBLC 5BQXA 1SQ6A 1YA6A 1F5SA 3I6ZA 3UA0A 1E18A 3CUSA 3NC1C 2II6A 3BEDA 4OB8A 4WHMA 4YRDA 5FUVA 1WB5A 2PAFA 3N2IA 4FC6A 4HLDA 4H2DA 3HKEB 5COBA 5HUJA 1I0ZA 2FYTA 2PYDA 4OYRA 4DPMA 4DV3B 4JUBA 4PYQA 4QOGA 1DAKA 3GRKA 1EIWA 3I45A 1DUSA 1X70A 3FZQA 4MTCA 5EJ4A 4MTLA 2GEVA 4UE3S 2O14A 3T9DA 1OLOA 2DYKA 1G8MA 1RT9A 4TL8A 2AMYA 5LXTB 1CZLA 1G20A 1VPLA 3KQTA 4EFKA 3HXTA 5M34A 2IH2A 4TYWA 2XYHA 1Y34E 2A8YA 2AN1A 4BZZA 1NVVQ 5E9QA 3PDIA 5J2TB 2E4AA 1NQXA 4O4HA 3UK7A 2C7BA 5ESWA 2V6MA 4URHA 2C3UA 5HF9A 1UBOS 2AHOA 3ITEA 3MOIA 4WNIA 3UENA 2C8JA 1X42A 3K32A 4LDRA 3BMNA 2HZBA 1TQDA 2BW0A 5JDIC 4RTSA 4JI2B 2OO5A 4BMOB 2WQZA 5B12A 1EJBA 3K5WA 1IG3A 2JI7A 1B43A 1UKVY 1RJWA 2I1VB 3SQDA 1EFVB 2HFJA 5HJ7A 1P9WA 5IX8A 3OIDA 4WXMA 2B78A 4F4FA 2ZFUA 1Z08A 1F9AA 3FIJA 4UTOA 1AUPA 3OWXA 2AVDA 5LQKA 4PWYA 1Z4OA 3R3XA 4K0RA