3CFIA

Nanobody-aided structure determination of the epsi:epsj pseudopilin heterdimer from vibrio vulnificus
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
76
Chain Sequence
YLEQKMFAAMVADNQMAMVMLNKNLKASNGEEELAGQTWYWKVAPVATTQPLKAFDVSVAAEKQASPIITVRSYVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type II secretory pathway, pseudopilin EpsI
publication title Nanobody-aided structure determination of the EpsI:EpsJ pseudopilin heterodimer from Vibrio vulnificus.
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Protein transport/immune system
total genus 15
structure length 76
sequence length 78
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2008-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02501 T2SSI Type II secretion system (T2SS), protein I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.30 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 GSPII I/J protein-like 3cfiA00
5BW0B 3CI0K 2RETA 2LMEA 3CFIA 2GR8A 3EMOA 2GR7A 3CI0I
chains in the Genus database with same CATH superfamily
4G5YA 3Q12A 3UY4A 3ISJA 3INNA 3IVXA 4MQ6A 2I52A 3UA0A 4MUKA 2A54A 2A50A 2LMEA 1V8FA 3LF4A 3MUEA 3QTTA 3EMOA 5G2FA 3MXTA 4IXJA 4DE5A 2RETA 5HG0A 3Q10A 3IMGA 2A56A 1IHOA 4MUGA 1N2IA 4MUNA 5KWVA 1UFVA 3IODA 4FZJA 2A88A 2A86A 3IMEA 2X3FA 4MUJA 4EF6A 4EFKA 3COZA 3HL6A 4MUEA 3IVCA 2A7XA 3IOEA 4MULA 3IUBA 3IMCA 3N8HA 4DDHA 2G5ZA 2A53A 3CFIA 2G16A 2OGFA 1N2EA 5EXCA 1MOPA 1N2JA 3IVGA 4MUHA 3LE8A 4DDMA 1N2GA 2GR7A 3CI0K 3CFAL 2GR8A 3COYA 3IUEA 3CI0I 3IOBA 3COWA 4G5FA 2G2SA 4MUFA 2A52A 2EJCA 4MUIA 4BHRA 2G3DA 3AG5A 3CFFL 4DDKA 5BW0B 1N2HA 3UK2A 3CFHL 2GW4A 3COVA 2A84A 2IECA 3AG6A 1N2BA 3IOCA 1N2OA
chains in the Genus database with same CATH topology
5BW0B 3CI0K 2RETA 2LMEA 3CFIA 2GR8A 3EMOA 2GR7A 3CI0J 3CI0I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BW0 B;  3CI0 K;  2RET A;  2LME A;  3CFI A;  2GR8 A;  3EMO A;  2GR7 A;  3CI0 I; 
#chains in the Genus database with same CATH topology
 4G5Y A;  3Q12 A;  3UY4 A;  3ISJ A;  3INN A;  3IVX A;  4MQ6 A;  2I52 A;  3UA0 A;  4MUK A;  2A54 A;  2A50 A;  2LME A;  1V8F A;  3LF4 A;  3MUE A;  3QTT A;  3EMO A;  5G2F A;  3MXT A;  4IXJ A;  4DE5 A;  2RET A;  5HG0 A;  3Q10 A;  3IMG A;  2A56 A;  1IHO A;  4MUG A;  1N2I A;  4MUN A;  5KWV A;  1UFV A;  3IOD A;  4FZJ A;  2A88 A;  2A86 A;  3IME A;  2X3F A;  4MUJ A;  4EF6 A;  4EFK A;  3COZ A;  3HL6 A;  4MUE A;  3IVC A;  2A7X A;  3IOE A;  4MUL A;  3IUB A;  3IMC A;  3N8H A;  4DDH A;  2G5Z A;  2A53 A;  3CFI A;  2G16 A;  2OGF A;  1N2E A;  5EXC A;  1MOP A;  1N2J A;  3IVG A;  4MUH A;  3LE8 A;  4DDM A;  1N2G A;  2GR7 A;  3CI0 K;  3CFA L;  2GR8 A;  3COY A;  3IUE A;  3CI0 I;  3IOB A;  3COW A;  4G5F A;  2G2S A;  4MUF A;  2A52 A;  2EJC A;  4MUI A;  4BHR A;  2G3D A;  3AG5 A;  3CFF L;  4DDK A;  5BW0 B;  1N2H A;  3UK2 A;  3CFH L;  2GW4 A;  3COV A;  2A84 A;  2IEC A;  3AG6 A;  1N2B A;  3IOC A;  1N2O A; 
#chains in the Genus database with same CATH homology
 5BW0 B;  3CI0 K;  2RET A;  2LME A;  3CFI A;  2GR8 A;  3EMO A;  2GR7 A;  3CI0 J;  3CI0 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...