5G2FA

Type iv-like competence pilin ttha1222 from thermus thermophilus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
86
structure length
86
Chain Sequence
ANLAAGQSYVRNVALALEAQRDPSTGALPTHLTDCLSGFGQRPKTVTACTITYLNALDYVIEASLDGAALKKVVYKSSDGTLTSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE-IV LIKE PILIN TTHA1222
publication title Structures of Type Iv Pilins from Thermus Thermophilus Demonstrate Similarities with Type II Secretion System Pseudopilins
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Unknown function
total genus 22
structure length 86
sequence length 86
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18682 PilA4 Pilin A4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.70 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 5g2fA00
4BHRA 5G2FA
chains in the Genus database with same CATH superfamily
1UFVA 3UA0A 5EXCA 2GW4A 3CI0K 3CFAL 4DDKA 1N2EA 2A7XA 4MUNA 4FZJA 3MXTA 2A54A 4MUFA 1N2IA 3Q12A 3IVGA 3IODA 3IMCA 1V8FA 4MUJA 1N2HA 3IVXA 3AG5A 1N2OA 3UY4A 2A50A 3CFHL 4MUHA 2GR7A 4G5FA 2G5ZA 3IMGA 4MUKA 4EF6A 3INNA 3MUEA 2OGFA 3COYA 3ISJA 2RETA 4G5YA 4MUIA 1MOPA 3COVA 5BW0B 2A88A 3UK2A 3IOBA 4BHRA 3COWA 3Q10A 2GR8A 2A52A 3N8HA 3IUEA 5HG0A 1N2JA 2EJCA 1N2GA 4IXJA 3LE8A 2A86A 2X3FA 3IOCA 3EMOA 3QTTA 4MUGA 4DDHA 1N2BA 1IHOA 2A53A 3CI0I 2I52A 4DE5A 3IUBA 2LMEA 3IOEA 2IECA 4EFKA 2A84A 3AG6A 4MUEA 4MULA 3HL6A 3IVCA 2A56A 2G2SA 3COZA 2G3DA 3CFIA 5KWVA 5G2FA 2G16A 3LF4A 3IMEA 4DDMA 3CFFL 4MQ6A
chains in the Genus database with same CATH topology
1UFVA 3UA0A 5EXCA 2GW4A 3CFAL 4DDKA 1N2EA 2A7XA 4MUNA 4FZJA 3MXTA 2A54A 4MUFA 1N2IA 3Q12A 3IVGA 3IODA 3IMCA 1V8FA 4MUJA 1N2HA 3IVXA 3AG5A 1N2OA 3UY4A 2A50A 3CFHL 4MUHA 4G5FA 2G5ZA 3IMGA 4MUKA 4EF6A 3INNA 3MUEA 3COYA 3ISJA 4G5YA 4MUIA 1MOPA 3COVA 2A88A 3UK2A 3IOBA 4BHRA 3COWA 3Q10A 2A52A 3N8HA 3IUEA 5HG0A 1N2JA 2EJCA 1N2GA 4IXJA 3LE8A 2A86A 2X3FA 3IOCA 3QTTA 4MUGA 4DDHA 1N2BA 1IHOA 2A53A 4DE5A 3IUBA 3IOEA 4EFKA 2A84A 3AG6A 4MUEA 4MULA 3HL6A 3IVCA 2A56A 2G2SA 3COZA 2G3DA 5KWVA 5G2FA 2G16A 3LF4A 3IMEA 4DDMA 3CFFL 4MQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BHR A;  5G2F A; 
#chains in the Genus database with same CATH topology
 1UFV A;  3UA0 A;  5EXC A;  2GW4 A;  3CI0 K;  3CFA L;  4DDK A;  1N2E A;  2A7X A;  4MUN A;  4FZJ A;  3MXT A;  2A54 A;  4MUF A;  1N2I A;  3Q12 A;  3IVG A;  3IOD A;  3IMC A;  1V8F A;  4MUJ A;  1N2H A;  3IVX A;  3AG5 A;  1N2O A;  3UY4 A;  2A50 A;  3CFH L;  4MUH A;  2GR7 A;  4G5F A;  2G5Z A;  3IMG A;  4MUK A;  4EF6 A;  3INN A;  3MUE A;  2OGF A;  3COY A;  3ISJ A;  2RET A;  4G5Y A;  4MUI A;  1MOP A;  3COV A;  5BW0 B;  2A88 A;  3UK2 A;  3IOB A;  4BHR A;  3COW A;  3Q10 A;  2GR8 A;  2A52 A;  3N8H A;  3IUE A;  5HG0 A;  1N2J A;  2EJC A;  1N2G A;  4IXJ A;  3LE8 A;  2A86 A;  2X3F A;  3IOC A;  3EMO A;  3QTT A;  4MUG A;  4DDH A;  1N2B A;  1IHO A;  2A53 A;  3CI0 I;  2I52 A;  4DE5 A;  3IUB A;  2LME A;  3IOE A;  2IEC A;  4EFK A;  2A84 A;  3AG6 A;  4MUE A;  4MUL A;  3HL6 A;  3IVC A;  2A56 A;  2G2S A;  3COZ A;  2G3D A;  3CFI A;  5KWV A;  5G2F A;  2G16 A;  3LF4 A;  3IME A;  4DDM A;  3CFF L;  4MQ6 A; 
#chains in the Genus database with same CATH homology
 1UFV A;  3UA0 A;  5EXC A;  2GW4 A;  3CFA L;  4DDK A;  1N2E A;  2A7X A;  4MUN A;  4FZJ A;  3MXT A;  2A54 A;  4MUF A;  1N2I A;  3Q12 A;  3IVG A;  3IOD A;  3IMC A;  1V8F A;  4MUJ A;  1N2H A;  3IVX A;  3AG5 A;  1N2O A;  3UY4 A;  2A50 A;  3CFH L;  4MUH A;  4G5F A;  2G5Z A;  3IMG A;  4MUK A;  4EF6 A;  3INN A;  3MUE A;  3COY A;  3ISJ A;  4G5Y A;  4MUI A;  1MOP A;  3COV A;  2A88 A;  3UK2 A;  3IOB A;  4BHR A;  3COW A;  3Q10 A;  2A52 A;  3N8H A;  3IUE A;  5HG0 A;  1N2J A;  2EJC A;  1N2G A;  4IXJ A;  3LE8 A;  2A86 A;  2X3F A;  3IOC A;  3QTT A;  4MUG A;  4DDH A;  1N2B A;  1IHO A;  2A53 A;  4DE5 A;  3IUB A;  3IOE A;  4EFK A;  2A84 A;  3AG6 A;  4MUE A;  4MUL A;  3HL6 A;  3IVC A;  2A56 A;  2G2S A;  3COZ A;  2G3D A;  5KWV A;  5G2F A;  2G16 A;  3LF4 A;  3IME A;  4DDM A;  3CFF L;  4MQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...