2A52A

Fluorescent protein asfp595, s158v, on-state
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
HGSASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GFP-like non-fluorescent chromoprotein FP595 chain 1
publication title Structure and mechanism of the reversible photoswitch of a fluorescent protein
pubmed doi rcsb
source organism Anemonia sulcata
molecule tags Luminescent protein
total genus 9
structure length 64
sequence length 64
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.40 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 2a52A00
2A53A 2G5ZA 3CFAL 2G2SA 2A56A 2A54A 2A52A 2GW4A 2G16A 2A50A 3LF4A 2G3DA 3CFHL 3CFFL 5EXCA
chains in the Genus database with same CATH superfamily
3IOBA 3UA0A 1IHOA 3IMCA 1N2EA 5BW0B 2G2SA 3CI0I 4DDHA 3COYA 3COWA 2A50A 3IOCA 2G3DA 3N8HA 2IECA 2G5ZA 3EMOA 4EF6A 3CFHL 3IMEA 3IMGA 2A56A 1UFVA 3HL6A 3AG6A 3CFFL 4G5FA 4DE5A 3LE8A 5G2FA 2LMEA 1N2JA 2A52A 1V8FA 2I52A 2A86A 3Q12A 4DDMA 2A7XA 3AG5A 4IXJA 4MUEA 5KWVA 3IUEA 3CI0K 1N2BA 2A88A 3CFIA 3IODA 4BHRA 3IVGA 3Q10A 1N2OA 2A53A 3UK2A 4MUGA 4MUIA 2GW4A 3ISJA 4MUNA 5EXCA 4MUJA 3COZA 2A54A 4MQ6A 2GR7A 4MUFA 2G16A 1N2GA 2GR8A 4DDKA 3LF4A 2EJCA 4EFKA 3INNA 1N2IA 2OGFA 2A84A 3COVA 3MXTA 3QTTA 1MOPA 3MUEA 3IUBA 3CFAL 4FZJA 3IVXA 3IVCA 5HG0A 1N2HA 3IOEA 2RETA 4MULA 4MUKA 4G5YA 3UY4A 2X3FA 4MUHA
chains in the Genus database with same CATH topology
3IOBA 3UA0A 1IHOA 3IMCA 1N2EA 2G2SA 4DDHA 3COYA 3COWA 2A50A 3IOCA 2G3DA 3N8HA 2G5ZA 4EF6A 3CFHL 3IMEA 3IMGA 2A56A 1UFVA 3HL6A 3AG6A 3CFFL 4G5FA 4DE5A 3LE8A 5G2FA 1N2JA 2A52A 1V8FA 2A86A 3Q12A 4DDMA 2A7XA 3AG5A 4IXJA 4MUEA 5KWVA 3IUEA 1N2BA 2A88A 3IODA 4BHRA 3IVGA 3Q10A 1N2OA 2A53A 3UK2A 4MUGA 4MUIA 2GW4A 3ISJA 4MUNA 5EXCA 4MUJA 3COZA 2A54A 4MQ6A 4MUFA 2G16A 1N2GA 4DDKA 3LF4A 2EJCA 4EFKA 3INNA 1N2IA 3QTTA 2A84A 3COVA 3MXTA 1MOPA 3MUEA 3IUBA 3CFAL 4FZJA 3IVXA 3IVCA 5HG0A 1N2HA 3IOEA 4MULA 4MUKA 4G5YA 3UY4A 2X3FA 4MUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A53 A;  2G5Z A;  3CFA L;  2G2S A;  2A56 A;  2A54 A;  2A52 A;  2GW4 A;  2G16 A;  2A50 A;  3LF4 A;  2G3D A;  3CFH L;  3CFF L;  5EXC A; 
#chains in the Genus database with same CATH topology
 3IOB A;  3UA0 A;  1IHO A;  3IMC A;  1N2E A;  5BW0 B;  2G2S A;  3CI0 I;  4DDH A;  3COY A;  3COW A;  2A50 A;  3IOC A;  2G3D A;  3N8H A;  2IEC A;  2G5Z A;  3EMO A;  4EF6 A;  3CFH L;  3IME A;  3IMG A;  2A56 A;  1UFV A;  3HL6 A;  3AG6 A;  3CFF L;  4G5F A;  4DE5 A;  3LE8 A;  5G2F A;  2LME A;  1N2J A;  2A52 A;  1V8F A;  2I52 A;  2A86 A;  3Q12 A;  4DDM A;  2A7X A;  3AG5 A;  4IXJ A;  4MUE A;  5KWV A;  3IUE A;  3CI0 K;  1N2B A;  2A88 A;  3CFI A;  3IOD A;  4BHR A;  3IVG A;  3Q10 A;  1N2O A;  2A53 A;  3UK2 A;  4MUG A;  4MUI A;  2GW4 A;  3ISJ A;  4MUN A;  5EXC A;  4MUJ A;  3COZ A;  2A54 A;  4MQ6 A;  2GR7 A;  4MUF A;  2G16 A;  1N2G A;  2GR8 A;  4DDK A;  3LF4 A;  2EJC A;  4EFK A;  3INN A;  1N2I A;  2OGF A;  2A84 A;  3COV A;  3MXT A;  3QTT A;  1MOP A;  3MUE A;  3IUB A;  3CFA L;  4FZJ A;  3IVX A;  3IVC A;  5HG0 A;  1N2H A;  3IOE A;  2RET A;  4MUL A;  4MUK A;  4G5Y A;  3UY4 A;  2X3F A;  4MUH A; 
#chains in the Genus database with same CATH homology
 3IOB A;  3UA0 A;  1IHO A;  3IMC A;  1N2E A;  2G2S A;  4DDH A;  3COY A;  3COW A;  2A50 A;  3IOC A;  2G3D A;  3N8H A;  2G5Z A;  4EF6 A;  3CFH L;  3IME A;  3IMG A;  2A56 A;  1UFV A;  3HL6 A;  3AG6 A;  3CFF L;  4G5F A;  4DE5 A;  3LE8 A;  5G2F A;  1N2J A;  2A52 A;  1V8F A;  2A86 A;  3Q12 A;  4DDM A;  2A7X A;  3AG5 A;  4IXJ A;  4MUE A;  5KWV A;  3IUE A;  1N2B A;  2A88 A;  3IOD A;  4BHR A;  3IVG A;  3Q10 A;  1N2O A;  2A53 A;  3UK2 A;  4MUG A;  4MUI A;  2GW4 A;  3ISJ A;  4MUN A;  5EXC A;  4MUJ A;  3COZ A;  2A54 A;  4MQ6 A;  4MUF A;  2G16 A;  1N2G A;  4DDK A;  3LF4 A;  2EJC A;  4EFK A;  3INN A;  1N2I A;  3QTT A;  2A84 A;  3COV A;  3MXT A;  1MOP A;  3MUE A;  3IUB A;  3CFA L;  4FZJ A;  3IVX A;  3IVC A;  5HG0 A;  1N2H A;  3IOE A;  4MUL A;  4MUK A;  4G5Y A;  3UY4 A;  2X3F A;  4MUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...