3Q12A

Pantoate-beta-alanine ligase from yersinia pestis in complex with pantoate.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
285
structure length
285
Chain Sequence
AMLIIETLPLLRQQIRRWRQEGKRIALVPTMGNLHEGHMTLVDEAKTRADVVVVTIFVNPLQFERPDDLAHYPRTLQEDCEKLTRHGADLVFAPAAADIYPAGLEKQTYVDVPALSTILEGASRPGHFRGVSTIVSKLFNLIQPDVACFGEKDYQQLALIRKMVADMGYDINIVGVPTVRAKDGLALSSRNGYLTEEERQIAPQLSKIMWALAEKMALGERQIDALLEEAAAQLLRVGFTPDELFIRDAETLQPLTVDSQQAVILMAAWLGKARLIDNQLVDLRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pantoate-beta-alanine ligase from Yersinia pestis.
rcsb
source organism Yersinia pestis
molecule tags Ligase
molecule keywords Pantoate--beta-alanine ligase
total genus 96
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3q12A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3q12A01
1JHDA 2AZXA 4MUNA 1EFPA 4MLPA 3PNYA 4EF6A 2A7XA 4YBRA 2RD2A 4MW5A 1O0CA 3OP1A 4DE5A 3DV2A 4F4HA 4MUGA 1HYBA 1N2EA 4R2LA 3KT0A 1J21A 1N77A 2G36A 2DEUA 2DPLA 1JILA 5J5AA 1OBCA 2CYAA 5KHAA 5TGTA 1OD6A 3P52A 3IVGA 5H16A 1Q15A 2V0GA 3H9BA 2QTRA 1P7PA 3X1JA 2A1UA 2YY5A 4EG8A 3OTWA 5FO1A 1WXIA 2O5RA 1N2GA 3SEZA 4EG5A 1M8FA 2OV4A 1JIJA 5K0TA 3ELBA 3CVYA 3A2KA 4MW2A 3I05A 3UOWA 2EJCA 1KAMA 2H2AA 2YWBA 1PFWA 3IOBA 1M8PA 3X1MA 1KH2A 2NSYA 1YI8A 4H3SA 2RE8A 3TZEA 1KORA 1O6BA 3CLUD 1COZA 4U63A 2DR2A 1IQUA 2X0KA 3HMQA 3LOQA 5AHWA 3NBAA 3N9IA 2CYBA 1O94D 4CDNA 2JANA 4OUDA 2NZ2A 1PFYA 4XFJA 1FFYA 3CLRC 1H3NA 2ZUFA 2XRYA 1WZ2A 3TQIA 4QBTA 1IH8A 4ZT7A 3COVA 3COZA 1YUMA 1GN8A 3CR8A 1JIKA 4I6EA 3UMVA 4EFKA 3P0HA 1KQNA 3INNA 2PZAA 1H1TA 4MWBA 3SZGA 4AQ7A 4RPIA 4G6ZA 4HPWA 2YWCA 1KAQA 1JZSA 4JYZA 3FHJA 2CV2A 3Q10A 5FO0A 4KR9A 2WQ6A 1XNJA 1LI7A 5F23A 1EXDA 2R5WA 1G59A 1IFXA 1NUSA 1QNFA 3KT8A 4KKVA 1MAUA 1RQGA 2D13A 3E27A 4AS1A 5K0SA 4MVXA 2GOYA 1X6VA 3FG9A 1GLNA 1GPMA 1U7XA 2OQ2A 4QREA 1VBMA 3D6VA 3IDFA 2WQ7A 1K97A 1X8XA 1NSYA 4YP6A 1JEEA 1N2JA 1ZH6A 1O95D 3RHSA 1WJGA 4NAUA 5HUJA 1TEZA 1QRUA 4ARCA 3TQOA 3AG5A 1WXGA 3CLRD 1PG0A 2A1TR 2E0IA 2BTEA 3PRHA 1I6LA 1MB9A 1QQTA 3ZJUA 4K0RA 1NZJA 2CV1A 3ZGZA 4NZPA 3VGJA 4DJAA 1NUTA 2E89A 2J4DA 2IP1A 3COWA 1PG2A 2E21A 3CLTC 1NUUA 1TYBE 1KP2A 4X0EA 1XNGA 3L92A 4MAFA 5FNZA 4KPUA 1KH1A 4JXXA 1N78A 3QTTA 3K32A 4J75A 4EG1A 2DERA 3RK1A 3VRHA 4L2IA 3L93A 1VL2A 3AFHA 1K4KA 1EFVA 4Q93A 3KFLA 1H3EA 3S3TA 2E18A 2AKEA 3H9CA 1NI5A 4EG4A 3A05A 3K9WA 1I6MA 1M1ZA 4GU5A 2BYTA 4TS1A 1J1ZA 3NV7A 4PBTA 4G5FA 1JEDA 4ZCSA 1N3LA 1O5TA 1EFPB 4HJXA 3LE8A 4NX2A 1WQ3A 4MUIA 4KR7A 5JBNA 4EGAA 2GKSA 1OWLA 3QE4A 3ND5A 1CT9A 3ZIUA 2TS1A 4G5YA 1ILEA 2X1MA 1PFUA 3CVUA 3ZJVA 4P2BA 1S4MA 4YP7A 1T6YA 1NP7A 2D5BA 1JMVA 3F3MA 1FYDA 3GLVA 1ZUNA 1G8HA 1YIAA 1O97D 4KR6A 4MUFA 4MW6A 3CLSC 2J09A 3G59A 1IHOA 2A84A 3JXEA 2PZ8A 3N2YA 2QJTA 1UFVA 3ZXSA 1T6ZA 5DASA 1GAXA 4NATA 2VTBA 1ZJWA 2A88A 1F4LA 4MUEA 3TNJA 2CV0A 2J07A 3CLUC 5TEWA 3N8HA 2QUIA 4DLPA 1XNHA 3IUBA 2HGZA 1QU3A 2O8VA 2PZBA 3Q4GA 2PXHA 2QJOA 2Z08A 3IMEA 1T6XA 1QRSA 4ZT3A 3RK0A 2WB2A 2A1TS 5IHXA 1EUYA 5HUHA 4K03A 4RUKA 3AG6A 3IH5A 1QRTA 1EJ2A 3ILVA 4ZCQA 5DB4A 4E1AA 1O96B 1O95C 5H7XA 3CVXA 4ZT5A 3DPIA 2AG6A 3RBAA 4MVCA 5KCMA 2CYCA 1O97C 3MXTA 5LFAA 1R6TA 1JECA 2VTBB 1KH3A 3CLSD 3DLAA 3HL4A 1N2BA 3SEQA 4JZYA 1XJQA 3IVCA 1J20A 2A86A 2QUHA 4MUKA 1V8FA 1G8GA 2QUKA 1F9AA 3FI0A 3IOCA 3MLBA 2V0CA 4ZT4A 3SYTA 3IODA 4XFDA 1MOPA 5IJXA 4MWCA 3SP1A 5KWVA 4MULA 3FY4A 4DDHA 3FNRA 2ZUEA 4PBSA 1VBNA 4BWVA 1J1UA 1DNPA 4UZEA 1MBZA 3HV0A 3UC5A 1F7VA 3C8ZA 3DO8A 1I2DA 4QRDA 1Q77A 1WXEA 1WOYA 2H29A 3HGMA 2PIDA 4MWEA 3FH0A 5J58A 4FZJA 1O94C 1Y42X 2GM3A 4MQ6A 4ARIA 3KT6A 1J70A 1MAWA 1IQ0A 4ND6A 1MJHA 4CQNA 4DNXA 3CA8A 2EL7A 3BL5A 1KQOA 2QTNA 4YMIA 4MW4A 1QJCA 3D6UA 4MW9A 3ZXIA 1JIIA 4KPUB 3UK2A 2Z09A 2PFSA 3IVXA 3UY4A 4DDKA 2J5BA 1WXFA 4EG3A 1R6UA 4EG6A 2IELA 2D54A 1QTQA 2HMAA 3X1KA 5BNZA 3COYA 4CDMA 2J08A 3PNBA 2HZ7A 2YXNA 4HK4A 3H05A 1U0BB 3RFFA 1JZQA 4MW1A 4YP5A 3CVVA 3GMIA 1N2IA 1JGTA 1EUQA 1MRZA 4JXZA 2X1LA 3MLAA 1K92A 3PNVA 1ULHA 2A4MA 4MWDA 4I6GA 4R0NA 4WSOA 2CFOA 4MUHA 4A91A 1GTRA 2DXIA 4CT0A 3RJZA 1KKUA 1N1DA 2QTMA 1VLHA 1V47A 1R6XA 4MW7A 3IMGA 2X3FA 1IRXA 1T9GS 3FETA 4UZFA 4XSVA 3FIUA 3CLTD 4EG7A 4ZCRA 1TQ8A 3A04A 4J76A 1WKBA 4WNYA 1T9GR 5EKDA 1Q11A 3NBKA 1N75A 5LM3A 3IMCA 3FOCA 3HFJA 3SDBA 1KR2A 1F7UA 1TYDE 4S1OA 3IOEA 2DETA 1WQ4A 1D2RA 4MVYA 2QJFA 3N05A 1M8GA 1GTSA 3G6KA 2CUZA 2DUMA 3HZRA 4PBRA 1LW7A 3P0IA 4U7JA 3ZUGA 3SZ3A 3KT3A 1YULA 4NDAA 1BS2A 1TFUA 4ND7A 3AIIA 1O96A 1EFVB 4U8HA 2Z3VA 3ND7A 3H97A 3PXUA 5J59A 3IUEA 1A8HA 1J09A 1K4MA 1NYLA 1IVSA 3H99A 4HJRA 4L2IB 5HG0A 5DK4A 1GZUA 1ZH0A 4MUJA 1NUQA 1U7DA 2PG3A 1N2HA 1B6TA 2C5SA 4ZT2A 1OWMA 5DEOA 3M5WA 1NURA 1WY5A 1LI5A 3AKZA 5TS2A 3P0JA 3TS1A 3VU8A 4NAHA 1OBHA 1OWPA 3MMXA 3MUEA 3ISJA 1NUPA 3AL0C 1KP3A 1PFVA 3U1VA 5TEVA 1M8JA 3ZJTA 1OWOA 4PY2A 2DLCX 1I6KA 2VXOA 4Q16A 1VBKA 2QUJA 1H3FA 2B7LA 1KQPA 2JA2A 4I6JA 1U3CA 3LCJA 1QU2A 4OJMX 3A4IA 3QTBA 1TYCA 3FWKA 2A1UB 1G8FA 1M8KA 2XRZA 3G5AA 1Q19A 4OUDB 1M83A 4ZT6A 1MB2A 1TYAE 1N2OA 4F3RA 3Q12A 1SURA 1WXHA 4R2MA 2CSXA 4MW0A 3CVWA 2ZP1A 2JAXA 1MC1A 2IJGX 3GUZA 3ND6A 1O0BA 2CT8A 5LLTA 1YIDA 4ZCPA 2I1LA 3FDXA 4GRIA 4ZCTA 1EE1A 1YUNA 4MVWA 3TZLA 4JFAA 2WSIA 1OWNA 1U3DA 1IQRA 4DDMA
chains in the Genus database with same CATH superfamily
1T2AA 3ZIAD 2HLNA 4QXOA 1ZOOA 2WHPB 3FD8A 4DNOA 8OHMA 2RD2A 4F06A 4DWJA 4NYJQ 1M6HA 1Y1PA 2BUAA 4PGFA 3WDSA 3E9EA 2G72A 3PQCA 4HRXA 2IDZA 3D4PA 5GOZA 3VPDA 1ADJA 1JAIA 1U7HA 1CJSA 2TMYA 4YCAA 4E5SA 1R66A 3BD9A 1Y63A 3CI0I 1M1UA 3OQ1A 4Y9DA 3GPLA 3C0KA 3OY7A 3V8VA 5JYBA 4YRKA 5HCNA 3A1TA 5SY6A 1MH1A 1ZJZA 1UBLS 2OAP1 5ENDA 1DRWA 2X4LA 4XVQA 1EAMA 3AJ9A 4GT1A 1T8TA 2ZZNA 3CRRA 3V7YA 5J2UB 2N0SA 2O20A 1U7UA 4AM8A 5ITZA 4D0GA 5KWSA 4O0MA 4UBJA 3QXGA 2OV4A 2IFTA 2ZYUX 1Z0SA 2X3YA 4QU5A 3P9QA 1NSFA 2YZ2A 3WQHA 1GEGA 2JZNA 2VZ0A 5H4GA 5LXTA 2DWUA 4IZ6A 4O4LB 4GZ3A 4ZVQA 4C4XA 4M8IA 5ALRA 1B0ZA 3NWOA 4D41A 3QLEA 3R7DA 1D2GA 4TS3A 2C0PA 1KEVA 2ZIZA 4RD0A 5ANRB 3DE7X 1Y5IA 4Q6WA 1TK9A 1DBPA 2W11A 4CR7A 4OQYA 2FZWA 4EHLA 2A5YB 2OGUA 3PL1A 4JBWA 3UT0A 1UDAA 1Z4IA 2QBYB 2NTVA 3E3LA 3JD0A 4QATA 2V4UA 3S1AB 3WZMA 1W6UA 1ZL0A 3ESQA 4RADA 3NFYA 3NBYC 3G8YA 4FYJA 5G0WA 1L5WA 1NRWA 1C1DB 4V0LA 4HNUA 5ALGA 5AM4A 3R77A 3VNAA 1PGPA 1UDRA 2ZDHA 5CB4B 5I7SA 3MJVA 5FHQA 2GBLA 2P40A 1RPNA 2Q99A 4FW9A 5DMXA 1Z18A 1QLJA 4B7UA 4FMCF 6Q21A 5LIRA 2RAFA 2FKNA 4B32A 1ZCBA 5HUQA 1NOIA 1PRYA 3EUAA 1JDNA 4B3IA 4UHKA 3G8DA 3LBYA 4TZ0A 1X8LA 1QMGA 2B4AA 2NO1A 3NHFA 4PHGA 4PYLA 2XTJA 4BCCA 3A3NA 3CPEA 3CCBA 4DREA 4C4AA 3LM8A 1AIPA 2IPMA 3NDRA 1KQNA 3TAUA 1XL0A 3V48A 5CFLA 2QP4A 3D1VA 4WRRA 3SZGA 3ER9A 1ZYUA 5MF6A 3R3JA 1FRNA 1BO6A 1K0FA 4DPMA 3AP2A 1JG2A 2WE7A 2WF9A 4HF7A 5HYVA 1V4BA 4KN9S 5H9VA 2V7PA 1OFHA 2Z5GA 4UM9D 4ZOLB 1UXJA 5AJHA 1BCRA 4ZDIA 2ODQA 5D6NA 1ZJ4A 3P2EA 1SKUA 1WLSA 1XNJA 4ZJPA 1BNCA 4UCWA 4FPXA 4UMVA 1JA1A 2HRDA 1SKMA 2YWFA 1M10A 2GNPA 3F9RA 3L1VA 1E5QA 1JDVA 1L7XA 1Z2OX 2C9CA 4H1TA 4MYCA 4ND8B 1JE1A 2RGNA 4YO7A 3RVDA 1QNFA 4M98A 3R3XA 2OXRA 5HTKA 1GDDA 1RQGA 1NJFA 3O73A 2IZ5A 1JU3A 2FLVA 4JUFA 4AJOA 1TA9A 1T34A 3L6CA 2D3WA 3SR3A 1HO3A 3DHWC 2ZRKA 3FG9A 1UEJA 2VHUA 1ID8A 3E8MA 4G41A 4PEVA 3ZW8A 2PGJA 3CGWA 1P2VA 2OE2A 1GNLA 5KWJA 1XA4A 4RE6A 3HY6A 4X8LA 1NSYA 1N4AA 3KLMX 3FCSB 4YV0A 2X8BA 5HUJA 1EUZA 4MDHA 4PQFA 4QDUA 1R0YA 1TF2A 1VPTA 1BN7A 1Y8QB 4XQEA 3EVNA 2ZS9A 3KSMA 4YONB 1EVZA 3FMIA 1G3UA 4TV9A 4WY5A 1IUOA 1DWQA 1QVVA 5JW6A 5LOVA 1UWVA 1C3VA 1D1SA 4LZOA 5CAEA 4ESEA 2QZPA 1R9NA 2ECFA 4P3OA 3UO8B 1TCVA 2XB4A 3S8EA 2B8NA 4P53A 4FHFA 3PUXA 3MT7A 5EE5B 5EYPB 4YJKA 4B3HA 5CA1B 1GPAA 2GHQA 3PQ3A 1H85A 3V8MA 5C4MA 5IF9A 1CUVA 3DEAA 2YIMA 3NIDB 1DAFA 5FBLB 1K63A 1MKYA 2X0JA 3BCUA 4IDAA 1FPMA 5DM1A 5E3IA 4CIXA 3LUHA 4G5GA 4OQXA 4IXMA 4J75A 1E6LA 4EG1A 2O4UX 4CM9D 2RKWA 3EHDA 1JPNA 4RNCA 3VC3A 5G3ZA 4DJJA 3QVVA 1DQSA 3UMMA 1GFIA 1VL2A 1SELA 4GVPA 2PR2A 2ZW9A 5BPHA 5BY2A 1FFXA 2YXLA 3T9CA 2OD2A 1K4KA 1AGPA 1WMEA 4DUGA 2VAWA 1SD5A 3WK8A 4OB8A 3H42B 2W2QA 3H9CA 3WLOA 1LF0A 1N9GA 3OEEA 1K3TA 2P1DA 3E3NA 4F3TA 4B8YA 4IH4A 4D96A 3L40A 1CNEA 4YRSA 3BD7A 3DFKA 1TJ5A 4FNGA 3GLHE 3EXAA 4I08A 4P2GA 3TIFA 5IMBA 3KV1A 1PZXA 4QEDA 2CW5A 4QELA 1W4ZA 1GPNA 3CH7A 4DV6B 1W1IA 1VJ1A 2PMBA 1RJGA 2JLSA 3E9ZA 1A9XB 1BA2A 3EVZA 1J9EA 4CLRB 4DNQA 4ESHA 2E49A 3KXKA 4KN6A 5TQ2B 1KZYC 2B92A 2BBOA 2XQFA 3IMKA 3JATA 1TVEA 3DUFB 4QQFA 5LYJA 2POCA 3ZHSA 5KSWB 4W99A 3AR9A 1Q1EA 3W6PA 2ZYIA 4AMUA 2JK1A 4XIYA 2Q3HA 3K09C 3MBKA 3BRWA 4NNOA 1U1EA 1AMUA 4BTEA 2L0XA 1NVAA 4U7PB 2BY4A 4IYRA 2HF9A 1ZUNA 2VJMA 4IDGA 1KI2A 4N7RA 1TECE 2P9GA 4QDZA 4QTZA 3DMDA 1G5PA 1ZN8A 5FOQA 4RAOA 5K2OA 1LSJA 3LCUA 1CZNA 3ETGA 1KEEA 3G88A 3GH1A 2V7UA 2A84A 5EJGA 5F3WB 1HDRA 3N2YA 4KJXA 3ZXSA 4IG4A 3Q9UA 3DMGA 4RPJA 5B58C 1VL1A 2AQHA 2H5EA 1P39A 1RWNA 3GJYA 4C3UA 2XWQA 1IBMB 2PUCA 4KFCA 4CI9A 1PT5A 1EP3B 2EF1A 4LC1A 4M1QA 3S40A 3BAFA 1TZJA 1LWOA 1SU6A 2X2EA 3CONA 1ZJ5A 4V0OA 2OKGA 5GV8A 1CY0A 2C59A 2VA8A 3G0OA 5FA6A 3W2EA 4D8YA 8ABPA 4TZ6A 1LPPA 3PF8A 1AKTA 4PS0A 3JTMA 5DCYA 5EJEA 1N8SA 5KYYA 1VL6A 2FMFA 2HQSA 4N39A 2ZJ7A 3TMAA 1FOEB 5DWQA 5MHTA 3NETA 3KVOA 2VS1A 3QX3A 1Q91A 4IDOA 5ENZA 3VV3A 2UVDA 4E32A 3BPSA 3FZQA 4R1TA 3IURA 4QUHA 3UJ7A 3ZQUA 2MYTA 4KNYA 3CWZA 1O7JA 4WXPA 3UXEA 3I1IA 3E0XA 2X58A 1GNPA 4NNPA 3QJ5A 4TLDA 4E5NA 1YFLA 5THKA 1JHRA 2YUTA 2PYZA 2XD4A 2F2TA 3WK5A 1CZOA 3RLFA 4M8SA 4YRBA 4HGPA 2YMQA 3DPIA 4YP9A 4W7IA 3NHKA 4L0CA 3BIWA 3ZWXA 1GIAA 2VYCA 2JFGA 3KQTA 3OU7A 1R5JA 2CNWA 4CBVA 4RVCA 5J63A 3O8RA 1IJEA 2VPPA 3RH0A 3U4MA 4OO3A 4A8JC 1JNXX 1UKZA 3O26A 5IAJA 1DARA 2Q6TA 3T1QA 1XVLA 4C0KA 4ENRA 1FLAA 4BE9A 1N2BA 1C9MA 4PRKA 3IVCA 3F6EX 5M3BA 3OTQA 2QUHA 4PF1A 1UKCA 5KTTA 1V8FA 2VDQB 3P4XA 2Z8YA 4Q3CA 3DAYA 3AYZB 3KB2A 4FN4A 3TE6A 1WV0A 1AA6A 5JSKA 1I2BA 4NH4A 4KPGA 4JNCA 3A31A 2R48A 2OORC 3GCDA 4HLUC 2XDYA 3TMYA 3DULA 3VJMA 3G6WA 4HQFA 5DVZA 5J1SB 3JY6A 1BFKA 5PGMA 1KMCA 1EXWA 2REBA 3ROPA 1VRVA 4XTRA 3ZCXA 3EFBA 2ZG6A 4MKGA 4BASA 2HXGA 1NNSA 2IZ6A 3OFJA 4JB0A 1VCHA 1I2DA 2BSAA 2WIGA 4OREX 1HDOA 4DY6A 1RZRD 2RHRA 5DN6D 1PJSA 2IS2A 2NIPA 3GT4A 4KQEA 3DF9A 3IQDB 3GG9A 6CHYA 3PFGA 4B5KA 2PBZA 3MCTA 2HQOA 3PT5A 2POQX 4ARVA 4B8WA 3NNNA 1DV2A 3R7BA 4NICA 4UEQA 5KOHA 1AXGA 3M1AA 3NMUF 5FCDA 3GA0A 1OC2A 3B2NA 4RHEA 5IDVA 2VUTA 2PX3A 1XXHE 4JI1B 4B46A 1LBEA 3VO8A 4UHJA 2W8BA 3GXOA 3T5BA 1L4YA 2ATVA 1UDCA 3DL4A 2IV2X 4CKYA 5JBQA 4KO2S 3ANLA 4YMIA 4JLDA 3VZSA 1V25A 1KYXA 4PCAA 1QJCA 4RFSB 4ZOEA 2GB4A 5CLGA 2A14A 2GVNA 1JRLA 2DWOA 1Z0JA 1OXUA 3VR5A 1VMKA 1Z2PX 4JLPA 3X0DA 2ONCA 4GI5A 1RRKA 1Q7CA 1IEXA 2Q5OA 3ZG6A 4M9XA 2PXXA 5ICSA 4I3HA 1LD3A 4MH0R 5FWYB 5KTPA 3ET4A 5FHRA 1UJ5A 1Z9BA 2YRXA 2Q49A 2A92A 2BHLA 2QL6A 3CG0A 4GH5A 1WWKA 5CVEA 5DDIP 3TLMA 3V2UA 2ESRA 1CVLA 4JY7A 4Q9AA 4YLGA 2ETXA 3K3PA 1C3OA 1XD2B 2NGRA 1JFFA 2PA3A 3LHIA 4Y3UA 3TQFA 1O9BA 4Q03A 3ZBPA 4YY3B 1P33A 2FUKA 2EF0A 3JQDA 2PRIA 4V02A 4K7JA 1X2BA 1F12A 4S12A 4Z9XA 3OT5A 5JIBA 2WKQA 3BMCB 2NM0A 3ROEA 5IH3A 2YXNA 2XUJA 2A8YA 3PPXA 1LDEA 1PR4A 2PD6A 1QO0D 4INAA 4CKWA 1J8VA 3RRNA 3M6XA 3QLVC 3ZU2A 2PA0A 3MRVA 5I01A 2D2VA 2EDCA 2EATA 1ISFA 3OI7A 5COQA 5B1DA 3L7LA 3EZLA 3GFTA 2GFIA 3URMA 1G5RA 4RULA 5C31A 1PTJA 2Y77A 3ZV4A 1Q20A 2ZEJA 1PD1A 4NSNA 4DWVA 3W5VA 3P5BA 2EAUA 5K6AC 1F17A 1LWNA 3KVVA 1XA0A 2UZ1A 4ZEOA 1TDJA 1LBIA 1XCLA 1Z83A 2W2VA 5H81A 3TW0A 3V6LA 3WJ2A 4R81A 4BLUA 3NORA 1QH8A 3UJ8A 1XG5A 3QF4B 5DXAA 2C5BA 3E3MA 1FQKA 1IHXA 1O4WA 2FP3A 2P68A 2Q5HA 1T9GS 3RBZA 1WVGA 4QVKA 4DANA 4BMZA 4UZFA 3U7IA 5F2OA 1HX7A 4MARA 3MJ4A 1P61B 3ZXUB 4J76A 3RCBA 3GAZA 2I78A 4ND8A 2X4DA 4BNHA 5HM6A 3LL4A 4DR4B 3GGGA 4YHBA 4YT5A 1DRKA 3GBPA 5LM3A 4H6XA 3HFJA 3AR3A 3KDSE 2PSDA 4F84A 3ENQA 3UPTA 1G3IA 1NFFA 3SMQA 5CW2A 5FTWA 3WI7A 4PTYA 1TU4A 4P31A 5ELXA 4IRXA 1PJ2A 5LBUA 1K8QA 3VU1A 2VRBA 3CLKA 2JATA 2YHUA 2GBGA 3ZLVA 1S7GA 2FZVA 1HDXA 2PX8A 1CRZA 4KW7A 4Y2GA 2VNAA 1TOAA 3P0IA 2GJ9A 5C4GB 3QSGA 4JKOA 2F8LA 1QV6A 2OB2A 2YQ4A 5HMLA 4Z9YA 1U5BA 1ZSNA 2OTCA 1KK2A 2PEZA 2VJPA 1X86B 2VK2A 2R1VB 1XZDA 3BJRA 3Q5GA 4HN9A 3UG7A 1WPXA 4B2PA 3UGJA 2VG8A 2BI4A 3EULA 3F7TA 5TNXA 2PVSA 4L4UA 3UTDA 2JKVA 3CXUA 3RTEA 4WNAA 5E1MA 3RVKA 4E51A 1LS1A 1R50A 4RFSA 1EM6A 5AJUA 1A8UA 2RFLA 1AUQA 3ZXXA 3DDSA 5DK4A 1GZUA 5IFLA 2FV8A 4FSHA 3ZDCA 2AC7A 4Z4IA 1VLJA 3KQQA 2P4HX 3M9XA 3RU7A 1OWMA 3THWB 4EA6A 1ULBA 1MEOA 5FUQA 2FW1A 2ID9A 3MT0A 1M1NB 1PZMA 4C2BA 2C03A 1PE0A 4BO5A 3CRW1 3NALA 5E8JA 4GGMX 4V0NA 3R9XA 3ISJA 4C5CA 1L7PA 3IT0A 3MTEA 3VPFA 3ZJTA 2QM3A 1NZDA 3CWCA 3FN4A 3JWGA 4OFZA 4YQYA 3RU2A 3ZN2A 1W0CA 3AVWA 1Q84A 3TBFA 2JFPA 3AUUA 5FL7A 4G0WA 1Z7WA 4V1CI 3FUTA 2JA2A 5G4KB 5EHZA 4GKJB 1QU2A 4LOAA 2ARKA 1KI3A 3NYIA 2LMEA 3RHFA 2EGHA 3OZEA 3UJPA 2C9DA 1QQ6A 1AB5A 3PUKA 1M8KA 2XRZA 5ICEA 5EHGA 4MWSA 4NE2A 4OUDB 5ALWA 3TQRA 4RHUA 4RZ2A 3V55A 1I2ZA 3WMRA 4ER3A 5EZYB 4K0KB 2WTUA 2XGMA 1UXHA 1VG1A 2O2SA 3QBTA 2VR1A 5JCZA 1JXAA 1XCPA 4JP3A 2OMEA 1BU8A 2W2NA 3ESRA 3GNLA 4UAGA 5HF6A 4AN1A 2JGAA 3L1KA 2UVPA 4NOKA 4Y6RA 1X92A 3EGEA 1FFHA 4EHKA 4GSYA 3V4VB 3QUAA 3JRNA 5K3EA 1R37A 1OWNA 3F0TA 1A9PA 3DZFA 2HAEA 1N77A 4P4LA 5B3LA 3HCCA 5BOSB 4EL5A 4EF6A 1RKUA 4DUPA 5EG5A 1IZZA 2B1QA 4OM7A 4DRYA 4PX9A 5IFKA 4Z7QB 1ODFA 1O0CA 4RV9A 1G8MA 1OAKA 3H2ZA 4HQNA 4E4TA 1VKHA 3ZHUA 4ZQBA 2IS6A 4N7MA 3CBGA 3ONEA 1KDRA 2H11A 3DDNA 5I7EA 4DRZA 4OGLA 2P8JA 2AWOA 3LT0A 4HS9A 1OBCA 1HH4A 1OILA 2CYAA 3O47A 4KL8S 4R98A 4RJKA 5FOXA 2EWMA 3P7MA 4G4IA 1GL6A 2J32A 1E3IA 1FUEA 2LDBA 1P60A 4CGYA 4HEA6 3COJA 4EGCB 4O2BF 3FCYA 4YP1A 3V8PA 2QAJA 2WF8A 3GW8A 1HC7A 2YV3A 4KMSA 3LBHA 4IKEA 4TM8A 3EW9A 4C4SA 5DN9A 5KTSA 2GRJA 3ZX4A 1AK2A 3CY6A 2OXCA 3OE4A 1WB9A 1YQTA 3OZVA 3ELBA 2C2ZA 3F8TA 2QUBA 3GUYA 1XZAA 4Q1AA 2R6GA 1N2CE 1PFWA 1QFJA 2VP6A 4BX8A 4WJZA 3GGJA 2R8RA 3LX8A 4XD7D 4NCAA 5C0OE 2GMWA 2NSYA 1KBQA 3I0MA 5TMEA 4ECEA 4R2IA 5IUKC 5KX5A 1II8B 1U98A 3CNNA 3GRZA 2ZJAA 3ISTA 3NHRA 4RVNA 1T3HA 2I33A 4JU9A 4EQ6B 2QTFA 4G2NA 1MRNA 2NU8B 1RRGA 1YI0A 2PBFA 2WSYB 4X91A 1LNSA 2F67A 1V8BA 2FSFA 4U5XA 5F77A 3EIEA 4BATA 1CEEA 3LXMA 4BGUA 4LZZA 1E2HA 2P27A 1YD7A 1NMYA 4R4JA 3SEAA 1KAHA 2REOA 4FQ5A 4D81A 1O94D 2DJIA 2EKBA 1Y1TA 2QD2A 5CXUA 5AOCA 2KM1A 4OMUA 4NABA 4HC4A 3R5HA 3Q8XB 5ALUA 1E6MA 3AEUA 1X94A 2C2MA 1U0GA 2V1XA 3CR8A 3L5OA 3PC4A 4PO9A 4I6EA 4QO7A 1X1QA 1K3FA 1GYRA 1V35A 1U1GA 2W9XA 4HN2A 3QLTA 4J49A 3TE7A 4KB5A 3W5SA 3HDQA 3P9IA 5A3RA 2QI9C 5AUOB 4V2UA 3A9UA 1GRQA 1MO3A 3IJPA 2YJ4A 1TZBA 4FGWA 1D04A 2Y9PB 4IR7A 2LGJA 2VT7A 5CB6A 1OF1A 1CEXA 1I3LA 3HS3A 3I8OA 3I9V6 3I3OA 4CFSA 5EWJA 2RGRA 2XT0A 2J9FB 4IDQA 3SHWA 3TXYA 1V41E 4JJKA 3OPQA 5LU8A 4IXJA 1FTSA 5HWSA 3KT8A 3FKSD 1CY6A 3ZE0B 1W36B 2B25A 2VWHA 2IX3A 4N5IX 3CISA 5DX8A 5CHYA 4KH0A 1DTEA 1SGWA 1OZHA 1QHIA 1HFJA 3H5OA 1QG4A 4QC2A 4RNDB 1JKXA 4RPKA 4TGLA 5DGHA 1VBMA 2J87A 1D4FA 2MSDB 5HKOA 1OZFA 2XMDA 2DCUA 4M0EA 4QFBA 3ITDA 3NHYA 1P2DA 4D0NA 1FJXA 3DMYA 4RO0A 4F91B 4KN8A 3PLRA 1V3UA 1WJGA 2UAGA 2QT0A 3HYNA 4XVCA 1Y6FA 4RXUA 4P32A 4URXR 3GJTA 3E61A 3N58A 3QBJA 5LQRA 1EUDA 2Y8EA 1S2NA 3QJGA 1GCOA 1JIUA 2VNIA 3VPCA 1L8LA 4ZEMA 4HTAA 4QGAA 1F4PA 1I6LA 4G8BA 4WXYB 1P2BA 5FPQA 5LP6B 5AKGA 4DB4A 4ASUD 2CDBA 4H60A 1H4SA 1F8UA 1O9GA 3QH4A 5CNMA 5LQUA 1YNOA 4NESA 1IN6A 5LQDA 4HAWA 5FTKA 2IS4A 2QN9A 1RR6A 2G17A 4NU0A 1NG9A 1EVYA 1M72A 3W90A 5HIJA 4N3CA 4RLSA 3I1JA 3L92A 3OKCA 1YQ9A 2OP1A 3CCCA 4GL2A 3CTPA 4C76A 3NYRA 3RVQA 1VQ1A 1FSGA 3SU8A 1CR2A 3DCNA 2QVZX 3AF0A 1RZUA 2BEUA 3W7BA 4A9AA 4CFZA 3DVLA 4R9NA 1T9AA 4E1VA 3HB5X 4LI3X 3G0GA 4EHJA 3GLGB 1UOPA 1I3KA 1XEFA 2AJBA 3A1CA 3E8SA 4N0EA 3AHGA 3VI4B 4Z8YA 4RESA 3W8EA 1NL3A 1X1CA 3E6AA 1Y8CA 1OLSA 4BFLA 2EFCB 2BEWB 1D2NA 2V5VA 3GZNA 4RA6B 3SG0A 1DKMA 3QKRB 2VDWA 1ULZA 2Z2YA 2VHCA 2ZT6A 3T15A 3WRXA 4ZJZA 1VBFA 2H5IA 4L15A 1I6MA 3A1SA 5BP7A 3JS5A 1RHKA 3C6MA 3QPCA 4GU5A 5LQSA 3KQKA 3SXJA 3LLMA 3SF8B 3ZH9B 2QRKA 2QG4A 4L4XA 2C0QA 2B69A 2CBXA 4GX1A 3NTRA 4URUR 3VV2A 2H9AA 1ORVA 1CZHA 2NVUA 3DE5X 3IQHX 5AKXA 2VHYA 1J6UA 3GLQA 3PC2A 1IXSB 2FMIA 5DI3B 1T2CA 4J0DA 2AXEA 2WNIA 5ILGA 4JI4B 4K81B 1D4OA 3E7PA 1YXMA 3LGAA 1EIZA 4K1XA 1MQAA 3EAGA 4Y1FA 4QGFA 3ND5A 1HNWB 3UYKA 2TS1A 3E3AA 4B6PA 1UKVY 1JPUA 3HEAA 4AJNA 2W6JD 4TT3A 5JI2E 2P35A 2HXYA 2OYRA 2UYQA 1FMCA 1XMXA 3GLRA 5SICE 2I5PO 3HA2A 1PWEA 5KOJA 4V39A 2QE6A 3DHEA 3NCHA 3DPUA 4V3CA 3M34A 4BLRA 2F3QA 1KIMA 2H63A 2NQ2C 3BZUA 4L5IA 1L5LA 1GQOA 4ZHQB 2YNMC 2H4XA 1J2JA 3FM9A 2FEPA 3ZJ4A 3WGMA 4WLUA 4B6EA 1PX2A 2OOSA 4F1WA 3W3AA 4BAZA 3G3EA 3OQVA 4YRTA 4V0ME 1LPAB 3A9SA 5E4FA 4A36A 4FFMA 1R6VA 1KI6A 1MVOA 2GYVA 4LXQA 5EJ8A 5JZMA 5LSAA 3AJ8A 2BMAA 2OVFA 2OZPA 2JI8A 4DLYA 4BNTA 3C1OA 2QUIA 4O4IF 1X7GA 4PPFA 1IWBB 2ZBDA 3U3ZA 2CCKA 2ILTA 4A10A 2E5FA 3REQA 4F6LA 1LX6A 1NY6A 4HVCA 4EW3A 1Z0UA 2IYPA 2WYHA 4XQ0A 3IDOA 2VATA 5DLYA 1G6HA 4BQSA 2Q1YA 2X4GA 2K7FA 3THWA 3RK0A 1R5BA 1US8B 1KC3A 1YR2A 4YBZA 2VTDA 3CS3A 4J0CA 3HKEB 1B2LA 3GT3A 1A3CA 3AERA 2EL9A 3HJTA 1B3BA 4RUKA 3LT2A 4IV0A 2G9RA 3USCS 5TMDA 5FBWB 1SK8A 4CEIA 5CPFA 2RBGA 1L7OA 2CNOA 3KCQA 1YQUA 4NYIR 2QZJA 1GSAA 1HZZA 1M1XB 1ODCA 2DFNA 2X8AA 1LLDA 4R7TA 3WWCA 5AVZA 2J3DA 5B64A 4YV7A 4ZV4A 4KGXA 5HXAA 1PNRA 1W59A 4RJ2A 1YRHA 1IZ0A 2B6HA 1XOIA 4Z99A 1RQ7A 2FR8A 4U2KA 4YPVA 1CULC 3WA7A 5DHUA 2HHAA 1SIOA 4PSDA 3T3PB 2IUFA 3J80A 2GRUA 4BMSA 4X6XA 1H5NA 2ZUUA 2ZR7A 3PQ6A 1G6Q1 2XTAA 1PYGA 4KYIB 3QG5A 5KSPA 2I1VB 3O3MB 3PXGA 1CIJA 1GGFA 3DQZA 2OK8A 4C30A 3OHSX 1D5WA 1J20A 3LLUA 5KQRA 4HYQA 3WVNA 3B3JA 4R1PA 3ZNQA 4YXFA 5IM4F 4S0ZA 2A5FA 3B1FA 3RT1A 5EINA 5TIIA 5HFAA 4TTRA 1BX3A 1VHDA 1W9HA 3ZS8A 1GQRA 4FYVA 2EWVA 1Q16A 4DLVA 1MABA 4DSNA 1CK4A 5AIAA 3KQUA 3VSDA 2PWAA 4PAOA 2YFYA 2V9CA 5DSXA 4L28A 2ZUEA 3C1TA 4MCHA 3Q7TA 3GMDA 1U0TA 2JCXA 1DUVG 1JB9A 3PC3A 1DNPA 1O54A 3F8WA 4HDSA 4Q4JB 3J81A 1LFAA 1NVDA 3DO8A 2WY2D 3O0DA 1IB0A 4DXAA 3Q8LA 3D3QA 1UK8A 3USZA 3UWKA 3JQFC 4BDTA 1DDGA 3IBTA 1NTRA 2AFIA 2QYSA 3HGMA 4IRMA 4OKNA 4QIHA 4ZVNA 3BERA 2OXIA 1S6YA 3G2KA 2QR3A 4PV7A 4A4DA 2YOFA 4I36A 3FH0A 1NZFA 1G42A 2JFUA 5AUQA 5IC6A 4R2JA 2H57A 1O0SA 3NTXA 3VX3A 2QR2A 4AJ4A 2WA2A 3WLLA 2HR1A 4DR1B 3L8EA 3T1YB 4ZIRB 1K7SN 3CF4A 4AMBA 3FYHA 1LCIA 1DJLA 1KZ1A 3WAKA 3GLFB 1E6EA 3IQZA 4HH0A 3R0VA 3TINA 4UU8A 1E98A 2WPDD 1EVLA 3F47A 2Z09A 1DMSA 1Y37A 2BZGA 3ONWA 4HXFB 2MYNA 2F64A 3K71B 4GR5A 1L4EA 4EG3A 1QX4A 1JFVA 4AZVA 3GIDA 4OHZA 5DP2A 1RD4A 3PDWA 2HLDA 4HL6A 3G5LA 3TNDA 3U09A 4HLQB 5AJWA 1ZO8A 4RKRA 2C8KA 3L6RA 4MO9A 5IBQA 4B3MB 4TS9A 4GXRA 3M6LA 4ED9A 3D8HA 2WICA 1SQ5A 2XMBA 3GRRA 5BNZA 2IODA 1GHTA 4K6FA 3LPLA 4H08A 1R27A 4PLGA 3DYVA 3PNBA 3ZI4A 3S44A 2OC9A 1A95A 1XT6A 4EZEA 2GJAA 4ZYLA 2MINB 1U28A 1VMIA 5AM5A 2OBFA 1JDSA 4B2YA 3ASVA 4BNNA 2C5AA 3HKDB 4RKEA 5F51A 1JZQA 4F11A 3BXFA 2RHTA 4LGCA 4Q9IA 5BPFA 4IS3A 2CMGA 4XX0A 9ABPA 1R0RE 4LJSA 4DTCA 3HKCA 5ELLA 3HUEA 5T6MA 4DLTA 2YDYA 4B45A 1CU1A 4AYTA 3VFDA 1E2FA 3I1FA 4OHYA 3O8QB 4WSOA 4Y6PA 3N2LA 3DUFA 1NGSA 4LWOA 4DIFA 4QNNA 4UEKA 3QZUA 5DNAA 4S24A 3A7DA 1V47A 4UZSA 3I72A 2W0MA 5ALQA 3KAQA 4B40A 2H2IA 1U2GA 5B1SA 1NW6A 3I01M 5C81A 2CD9A 2IC5A 5IUNC 2HLDD 3C3BA 1YCDA 3TG8A 1TUGA 2GK3A 2WDPA 3LF2A 4CODB 3G0BA 3P9NA 4QU0A 4YA6A 3NX4A 5CIYA 4FIZA 2AOTB 2E5LB 4RGQA 1AMNA 2ZYSA 2WTXA 3WYGA 4PR0A 2R6AA 1INLA 3DHVA 3N0RA 4LNUA 4R5MA 3QWAA 2I9PA 4LMRA 1I30A 3HI6A 4LBWA 5CRIA 1TYDE 4HTFB 3V6MA 3RAJA 3L8FA 4CV2A 3K2IA 1HBJA 1P4GA 2PVCA 3AFNA 4ZYWA 2IXEA 2VPYA 4WKCA 1UBOS 3OUTA 4EY5A 1M8GA 4JT8A 3G6KA 2CLSA 4J3JA 3BSFA 3HWRA 4XDZA 4M3NA 3QE3A 1E3JA 1LU9A 5D51S 3IB3A 5JV5A 2HK7A 1W4BA 2IY7A 2H85A 4MRVA 1K27A 1JEQA 4MGYR 4PNPA 3OM9A 5G40A 1HDYA 3TSCA 5I9SA 2YS6A 3VTKA 4D82A 2ZAMA 3DTNA 3I73A 3PHJA 2I4MA 5JJLA 2I4IA 3O95A 3SHTA 2W5UA 4LY3A 1NIJA 3E18A 3N2GA 4OHXA 5ELMA 1FF9A 1GL7A 2NYAA 3VUFA 5LIPA 2ZS7A 2FFRA 2YICA 4Q12A 4BVJA 5C5IA 2F8MA 2OGZA 5LWHA 1SG6A 1R7RA 2QZ4A 4YO8A 2PL9A 3H2SA 3TNFA 2H1FA 1C9YA 2JGMA 2VDJA 1TFRA 2BHTA 3QY9A 2GZDA 3DL0A 1RYHA 1SKYE 4BQIA 1YE5A 2VAVA 4NQZA 2DFTA 2FWAA 1EGMB 3B9QA 4JOCA 4IXDA 2Z6AA 2H7VA 2VYQA 1TUEA 4G85A 1FJGB 3HO6A 1CKEA 4GHWA 1XTSA 4J3NA 3B6EA 3BBPA 5DYTA 5IVHA 4UHFA 1M2HA 3K8YA 4MMZB 1XTVA 4GLJA 5G0TA 1OWOA 1T4GA 4FM9A 2CFIA 2VXOA 3O4FA 3QBVA 2DLCX 5FYDA 4M54A 3FPJA 3IHTA 3JQPA 4FYYA 4TKLA 4TMZA 2CLDX 3DZBA 4HDKB 2IV7A 1Y7HA 3U7RA 4S3MA 4BVHA 5I3ZA 3WOHA 1KQPA 3NLLA 4Q9KA 2O7RA 1P73A 1NQ5A 1OH5A 1JEYA 5D3MA 3DMNA 4EABA 1PQWA 3G2PA 1V2HE 1E7RA 2WTBA 2QPAA 3NKFA 1EFUA 4GPTA 4R83A 1KF0A 2FZEA 4DV4B 1XN1A 1XTUA 3GCXA 4U7HA 4BMVA 4A6EA 1NY5A 2IXFA 4KBYA 2J7PA 3BHJA 4ZOLF 3CW8X 5AXBA 3TN7A 5CB4F 2BGJA 4Q4AB 1XDBA 4K46A 1JTFA 2F43A 4LS3A 1E2KA 3LDGA 3DMFA 2XZLA 7MDHA 2YJ5A 3MGCA 2UYHA 2ZJZA 1U7TA 3BFJA 3C6KA 3AF5A 2OCXA 4QXPA 1SCKA 4B31A 3GYBA 3BC1A 4QKQA 3TQTA 4ASUA 2COEA 2HSWA 5U1PA 4FFBB 5CPBA 3WC4A 1SUBA 3PX2A 3ZV5A 4DJTA 1H1LA 1MR3F 2C96A 4MLPA 5AK3A 1GG2A 1IOLA 2G04A 2XYQA 3OWOA 5BW5A 2W4IA 1NI4A 2VSXA 5TPWB 4ZI5A 2VJMB 1UUFA 3DONA 4M87A 5DULA 1W29A 3WO1A 2Y76A 3RIGA 3V1KA 5JY6A 1E4EA 2BFNA 3LYAA 2C7PA 1ZZGA 1LC3A 2QNBA 2VIIA 3AL3A 3IVGA 1F14A 1UK7A 3MC1A 4B74A 1VHQA 1G21A 2BKUA 4KDFA 4J8PA 4EEXA 4E1BA 4JJZA 3B89A 5TJHA 4DMUB 1I7SB 1EJ6A 2FPMA 3KHTA 5BXYA 4CKCB 4JUDX 1ZD5A 5ECDA 1WUJS 1RHQA 1UWCA 4R2WA 4CTJA 3UBTA 1T36A 1KO8A 4FJ0A 1A9OA 4OLFA 2OYCA 2W48A 2P2YA 3U48A 2Z0MA 2AZMA 2XMCA 3KL4A 3L77A 3QRWA 4C08A 4E46A 1KOGA 4YH1A 5D7NA 2WUEA 2Y71A 4Q82A 2CXQA 3BS4A 4H7HA 5IEBA 1KAMA 1HORA 2C61A 1HSOA 3RSQA 5KU7A 1SHUX 3NGMA 2YN4A 4O02B 4S05A 3DHNA 4PYIA 1RRCA 3AP1A 1N9GB 2G7MC 3CC8A 4OJNA 1B8VA 1XP5A 5EJ2A 4F4FA 3RQIA 1YASA 4K86A 2OQIA 4ZOAA 5ALLA 2XKJE 2E85A 5IJ9A 3DDZX 4HB0A 1RXIA 3O6VA 1A72A 4AMYA 4NIMA 2O57A 5JJKA 5I7RA 4FGKA 1QZUA 1N6HA 3GVHA 3CLUD 1J0XO 2QP3A 1COZA 1DAKA 2QY9A 3L07A 3JD2A 4II3A 4N0DA 1KMIY 1B0PA 1BN6A 4Q9NA 4HPJB 4Y2RA 2ZSUA 4N8DA 2Q4BA 4MV3A 4ER7A 2NXWA 3QEKA 4BTVA 1C3EA 1G17A 2HRQA 1PFYA 2GK6A 4ARBA 4O4HF 5TRTA 2IEYA 2W6PA 4PZYA 1WNFA 5KNDD 4B6OA 2IS1A 2ZUFA 1GGVA 1QG6A 4LJ8A 4U39A 1NA5A 1RRVA 2G6TA 3COZA 5B37A 5A05A 3WK4A 3UAYA 1JIKA 1C4XA 1UM9B 5AW4A 1JEYB 4IQ4A 4MQFA 3EMOA 2AD1A 5JC1A 4RE5A 2V74B 2QA5A 1DG9A 2ZAIA 1MAVA 4LNUB 2CLOB 3F90A 2YHBA 1SXIA 7AT1A 3UFXA 4NY1A 5MN4A 4G6ZA 3DGEC 1V1RA 4C6TA 1W2WB 2PEYA 3DC7A 1DLIA 2OFOA 4RH0A 1Y5NA 3FAZA 3IDSA 4GXTA 3GGDA 2ICAA 4PO1A 2ODBA 1Z6PA 2QZ9A 2X6QA 1PQUA 2LXNA 3E7WA 3QI2A 3V4FA 1AO0A 4O3MA 3HCOA 4L3WA 1RM5A 2PGIA 3KK0A 4MIKA 3RVJA 3ZWAA 4EECA 3FOFC 1BXRA 2HSDA 1IFXA 4J0EA 1MEJA 3GHHA 4OSPA 4URFA 1DZIA 4CKEA 4IVPA 4LYAA 3JQ9C 4RQUA 1QH9A 4LAFA 1W5TA 2ZSFA 4BV3A 1JE0A 2JLBA 1YS9A 3TKLA 2GBCA 4JJGA 3IIKA 3I4CA 5DNWA 4RF5A 2F90A 1IY2A 2F3PA 3EZ6A 4WXMA 1B1AA 2P0EA 1R10A 3GAMA 3A6JA 4ZARA 1K2WA 2AC2A 4RVSA 1MC4A 4MKZA 4HNVA 3D7RA 4E30A 1JEEA 3OZGA 3Q0TA 1EK1A 4ETWA 2FWBA 2FPUA 5DT9A 1YB7A 3GVPA 4ZV9A 4EP1A 2IPLA 3GI1A 1WCXA 1YC2A 3T7SA 4X8HA 5EWLA 3LV8A 3KJEA 4OXYA 3EWAA 5BQPA 2XCQA 4S1PA 1MB9A 1USUA 2PO5A 3E1KA 3TFQA 1EKXA 2GF0A 2H06A 2Q0XA 3AR2A 3CNEA 4FS3A 1JMKC 4K0RA 4LW8A 4QDOA 1VSTA 1HI9A 4ILEA 4EX7A 3GWGA 5TE9A 1XI2A 4GPAA 4G63A 1QIIA 3C2QA 2ZRGA 2JGDB 1M2EA 3NO4A 1HKHA 1Z37A 3LBIA 3RANA 1AQIA 1X7ZB 3R0IA 1F6DA 2F59A 2RI1A 2E82A 1P7YA 4KGDA 4F04A 3K6KA 4JLMA 5KQLA 4CEIB 3F7NA 4JIMA 1UODA 4EA9A 2B9VA 2DT5A 4G07A 1A76A 1SQ6A 1X8JA 3ETLA 1ZI9A 3TVTA 1RPZA 2AE2A 2IK8A 1FIUA 1WMDA 3JR3A 3BIOA 3HBAA 4QJ5A 1PLJA 5I7WA 4CYMA 1ZGAA 3TZKA 2DECA 2QRUA 3QLVA 4N3GA 1SXJA 1GD1O 4IKPA 5JVDF 3N76A 3S81A 5IJWA 2AT1A 3C24A 4RKQA 4LX0A 1H3EA 4CLDA 1RYDA 2GBLC 4IUYA 3U7QB 1D2AA 1YMUA 2Z04A 4AAYA 4JR0A 1PEAA 2VBGA 4EG4A 3HKCB 3BJEA 2WIBA 3HDYA 1TM5E 4LSZA 1ONBA 1S2LA 2XYPA 2QROA 3HJFA 3F4BA 1NAIA 3A25A 5AKHA 3OIVA 5HRUA 4TS1A 2QRVB 2I71A 3MMNA 1OH8A 2HPVA 5A02A 3KYJB 2B83A 1FL9A 1SC4A 5FJJA 3U26A 4L50A 5EZYF 1RT9A 2GSDA 2ANCA 2GK4A 2MTBA 2CNKA 4JB8A 2EU8A 3NHZA 2HHCA 3SIXA 4EGAA 3P2IA 2JEZA 2NTYC 1N9KA 2R65A 4BVKA 3C4QA 3K5IA 5INTA 2FEAA 1DX4A 1A5TA 2P9ZA 1UXKA 4OG2A 3TDMA 1VB5A 3BMQA 2DZDA 4KO3S 4YRGA 3CVUA 3U5ZB 1QRDA 3B9PA 3NOOA 5BR7A 1EGAA 3HXLA 2KBEA 5KC9A 1M33A 5DEIA 5KTMA 4CMJA 8LDHA 2IY8A 2PQMA 5BR1A 1CB0A 1YIAA 2V3WA 3CW9A 2VF8A 4UCXA 1J2EA 4K6OA 4K9PA 2G5ZA 3WP0A 3HSSA 4YCJA 4C7OA 4FLMA 4X60A 4QYIA 4HAOA 3PEVA 3OE1A 2YXBA 1QDEA 3K6SB 1BU5A 3KB8A 4GPZA 5JAHA 1XTJA 2GCOA 3G1TA 1CJTC 2RHOA 1FTQA 3WLJA 1QG2A 5LD2C 1DKNA 1JNYA 3D6MA 1KE2A 1FBNA 2H1SA 4EJSC 2EC5A 4DCUA 5ECWA 4PG4A 1ZX1A 4O4LA 4QSHA 3F5MA 4RIIA 2VJQA 3ABOB 4I55F 2JFYA 3AUAA 4MX8A 2FSUA 4WK6A 5D3KA 2C8LA 4BU0A 4DV7B 1NMQA 1T0JB 2ZSKA 2OSBA 3GMSA 4JLUA 1GYPA 5FP0A 5K45A 3IQGX 1YS1X 4LYDA 3TSOA 1IBRA 5JAUA 5WRFA 5JNUA 2Y0CA 2XAUA 1IB6A 1YFJA 1JXQA 4Y2XA 4E5DA 1W5EA 5JAOA 3HY3A 2PT9A 3DC2A 3RSHA 2ZB4A 3SMVA 3WKEA 1T6XA 4JEUA 1FUIA 1NN3A 1Z73A 2DUNA 3FE2A 4JBGA 4RD3A 5IYZB 5MFPA 3JQAB 1RXVA 5EZ6B 1QFXA 3EMBA 5GONA 3D4OA 4M49A 2I91A 1EQUA 4PO8A 4OBEA 1IN1A 1MJNA 2PSFA 4NDNE 2WFMA 4JI5B 3UMFA 1LQ2A 1RYZA 2HO4A 3IKLA 5KDOA 3IQEA 1CETA 1P5JA 4E5VA 5A5EA 2NUBA 3ZCQA 2ZRMA 3OQPA 1SCNE 1N5RA 1OKKA 2CYCA 2AFHB 1PHPA 5EPOA 1K66A 4NDZA 1EJ0A 5JWRA 4QDKA 4NULA 4YJHA 4G0NA 4PQRA 5JEDA 4H4EA 4AI6A 2HCJB 4FR2A 3QBDA 3HL4A 1WCV1 4FMBB 1AJEA 4BJ3A 2AVNA 3T3OA 2ADMA 1T8YA 2GN2A 3EXIB 3IERA 3JALB 4ENQA 1N9ZA 3O4VA 1G8GA 3GWZA 3B7GA 3MNFA 3W9YA 1E7QA 4JLVA 4EFDA 5EC8A 4LQLA 1PEKE 1Z17A 3BULA 2A0KA 2IPAB 1XCOA 1MH9A 1XLUA 1BQEA 1LQTA 1Y4DE 2B3TA 1FVFA 2BGTA 2H2WA 5L7WA 1DIBA 1E2MA 4WLVA 4P82A 1X7WB 5AOVA 4CMIB 3ER8A 5TJ9A 3OIGA 3PL5A 4RIGA 3TQCA 3HRHA 3R7NA 3D4LA 2M6KA 2HA7A 1NVWQ 3B3QA 2C3PA 2YBEA 3DEZA 5IK2A 1H6BA 5GV7A 3NWEA 1NM5A 2FSVA 3EVCA 2BKEA 2RETA 4U7GA 4BFVA 2YCLA 4EUKA 5FOTA 5E6RB 1MAHA 3OIUA 4M53A 3PF9A 3A1VA 4BAUA 5JALA 1ZG3A 1DHRA 4AO7A 1IQ0A 2G6BA 1UKEA 3IP9A 1MJHA 1DO8A 1HYGA 2MU1A 1S02A 3B1WA 4RMJA 4RKWA 4O2LA 1MP0A 2VYVA 2ZIVB 1P72A 4EGFA 4FYXA 3L0CA 3WA6A 2CL5A 1Z5UA 4G97A 2E4UA 3Q87B 1MC5A 2VP2A 3CX4A 2AEEA 3MZ0A 4M83A 4WACA 2QM0A 4NFYA 3VSBA 2II6A 4E2XA 3VR4H 1E92A 5A03A 2PH7A 5EXCA 1IG3A 3LGXA 3SBEA 5GJBA 4X65B 1ZNQO 1J5PA 2E4ZA 3KQPA 2WWYA 4ZP1A 1OI3A 1YCFA 2Q3BA 3HU5A 5HQTA 4OHKA 2HMVA 3QVLA 2OUKA 2GXQA 2XH8A 3BXPA 4ITUA 2O54A 4PM4A 1SVNA 1TYEB 1XDSA 1W4LA 5G2OA 3C4VA 4K6HA 1NF3A 2OLEA 5SYNA 3RUHA 1U8XX 3IUQA 2PZEA 2BEVA 3PVZA 1GG9A 4B3SB 1W19A 5HSGA 3WLMA 3VNQA 1PAUA 4J4BA 4CG3A 1Q1GA 4MW1A 4RS4A 5LXTB 3KOMA 1DELA 1UXOA 2Q3JA 3W4IA 4Z6KA 5J2TB 3JQEA 1EUQA 5I7AA 3VR5D 1UZMA 4M4SA 3RU9A 1IM2A 5L3RA 3GYGA 4WBSA 2O05A 4LDQA 4MICA 2IXAA 3IP7A 3N75A 2PRYA 4H3VA 4F3KA 1GTRA 4OD0A 2IKSA 3K9CA 5JSHA 1NR5A 2MIIA 1T9HA 3Q5EA 4LJYA 3I61A 1QHGA 3T7DA 2YV4A 1Y9JA 1NONA 2OV2A 1YZKA 4WKOA 4FDTA 4N9WA 4Y30A 4CLHA 3S4YA 5TQJA 4IWXA 3LPNA 4MJ7A 4UXJA 2IYSA 3B1KA 3ZGOA 2R79A 3BTOA 2JVIA 4UUMA 2VH5R 4QXAA 3IAFA 4F46A 1BXRB 2F62A 6REQB 1R4ZA 2BFAA 1K2VN 2XMGA 1JQKA 2Z1DA 3GNQA 4KODA 1ORDA 4YMGA 1GPJA 4JVNA 4C4TA 4BNDA 4DJFC 5GIOE 4OK3A 4MA0A 3EDCA 1IWOA 4NE7A 3QEOA 3K0SA 3NB0A 4H6PA 2EX1A 4Q18A 1SC3A 3NH9A 1I6WA 2P6PA 4PYMA 4ZODA 2CHUA 4L02A 4X8OA 1RLIA 4POAA 3SHVA 2OCIA 2FZLA 1SG9A 1YULA 2P69A 2VLBA 4RA6A 2H59A 5DJ5A 2V7GA 4Y0VA 4DM7A 4WK4B 2D8AA 2OO5A 2ZQ5A 2Q5CA 4TTQA 5A7GA 4OGWA 3S0JA 2CVFA 4K6GA 1R5NA 2Y3IA 5D01A 3FWPA 3MWJA 1A8HA 4ZU3A 3CH5A 2ZPUA 4MV1A 2WUVA 4KMOA 3WE7A 2OO5C 4HJRA 1YDGA 2WBLC 4K9LA 4ACBA 4KV7A 3FGPA 3L3BA 1CQPA 3WNZA 4JP1A 3LUDA 4KC0A 3I5YA 3HJUA 4Y2PA 1E32A 1PYDA 1XDGA 3BSYA 1QPBA 2X5JO 4CNBA 3AHHA 5M04A 2X8JA 2XXAB 4WXEA 2XW6A 2XOKD 4EA8A 3EB9A 3EARA 4F9FA 4X1IB 2HL6A 4ENVA 5LOVF 1YBFA 4Z4QA 3L6EA 1WTCA 2HJVA 4GMDA 4NAHA 1A9XA 5J2UF 2ILVA 1DQPA 2WPDA 5FFMA 3U4IA 3ZS9A 4EELA 2Y1DA 3KEMA 1SVOA 3N0VA 4NONA 3RUAA 2I4RA 3FGNA 1WL8A 3HLKA 4RTJA 3AL0C 3ZZ1A 4L95C 9GPBA 2OG2A 2VZLA 1X77A 2PL1A 3VPXA 3PKJA 1C4OA 1SY7A 3GIWA 3ZBTA 1GPH1 4IUCS 2OCAA 3EH2A 3RS7A 5BSFA 5JTUA 1QWOA 2FUG6 2ID7A 5E4TA 1G2OA 2FNAA 1PDOA 1N3YA 2IHYA 4HQOA 5ILOA 2I4OA 4HWOA 1Q19A 3TLZA 3VHQA 1I5OA 4RV5A 2G1KA 4F8YA 2F3RA 3C3JA 3CQ9A 5IJ0A 1HG1A 4AIRA 4DV0B 4Q66C 2ZBPA 4JSTA 1YJ5A 4R2MA 1ABEA 4LZPA 2D7DA 1QK5A 2HU5A 1BMDA 4RDIA 4YRZA 3ND6A 3Q6MA 4XOUA 2PX6A 1REQB 2C57A 3E70C 2CDRA 5C1IA 2IXBA 4HNTA 4WADA 2VUHB 4KZPA 1YB2A 4LG1A 5E6RA 4WUVA 1P8AA 5LA6F 2RHHA 4HMOA 3FFWA 4XLZA 3BMXA 3ADDA 2CVQA 4JHLA 4EKGA 1BXGA 2N9UA 3NONA 4Q4LA 4R9UC 1RLUA 5JBIA 5DHFA 2ZWPA 2JFVA 4DL9A 2Q6OA 4A1FA 2I4TA 5KNBA 4XIJA 4QSMA 4PC2A 3OEHA 4MS3A 3EISA 3C16C 5EQTA 4D57A 2BMDA 2ZS8A 3GEHA 3L7NA 3IUJA 2DPLA 2KS6A 1Z4NA 2BEUB 1JH9A 5ALJA 1L5HA 1I2AA 2C58A 1UEXC 2YVQA 3VH2A 4KO8A 4MGHA 1LSOA 1NPDA 1YQWA 2IVFA 4BZWA 3I04M 4RETA 3WWOA 5GIPE 2HMWA 3KPWA 5E1OA 1L7QA 5F1YA 4B83A 5A2QA 4JWKA 1PQYA 1Y4SA 3TOSA 4IEIA 1VYVA 4TLLB 3HRKA 1Q2XA 5COAA 1WD7A 1VPLA 3HCRA 5AQEA 5TQ2A 1W75A 3ICCA 2GZRA 5ALYA 4ME6A 2ZM5A 1E9EA 1R5OA 1XZMA 1YMVA 2I6SA 3QU7A 4P8RA 3H1FA 3EFOA 1QVAA 3O7MA 3AFMA 3DPSA 2XUZA 2WW8A 1FVOA 1N5KA 4WCFB 1C1XA 3S27A 2YWBA 2OMKA 4ALNA 4ZI7A 4HEQA 3SZRA 3GCGA 2YKGA 3HVIA 1KH2A 4XM2A 4BP3A 4GD3Q 1UM9A 4QFDA 3TZBA 5ALVA 1MDFA 2O8DB 4XYEA 4Y18A 1D09A 3ICQB 5DO9A 3R9IA 2RE8A 3T1TA 2B20A 2A59A 1WDLA 4RSRA 4DAEA 1DX6A 2PTGA 1DC7A 2W2MA 2PM8A 2X42A 3HYCA 5EA2A 1QCDA 3AI2A 1E1RA 2X77A 1EXVA 3OVMA 2PR7A 4YDHB 1XVUA 4PXAA 3GEIA 3OF5A 1FDWA 4DF3A 2HV9A 4GW3A 4LHZA 1Q83A 4LPKA 4B6GA 3IPLA 4Y6LA 2NZ2A 1R3UA 4E11A 3D3WA 2Q4EA 3L8MA 3WSTA 3H2IA 3KS9A 3TPZA 4UBLA 4E94A 3LHDA 3VH4A 3EWNA 4Z7JA 3I8XA 3DWEX 2PD3A 3TQIA 5BN5A 2FMXA 3P32A 1UFOA 4BO7A 1AV6A 4LDNA 5IUJC 2YZGA 1U9ZA 4BUCA 4W5QA 2G0AA 3L0OA 5CLLA 5EPEA 1E9RA 1B6SA 1KFKB 2XQIA 3AY0A 1YV9A 5DTRA 4BCDA 3N0WA 2B4RO 3OCVA 1NASA 4AQ7A 4KAAA 1SA0B 2VCHA 4KQJA 1ZFNA 4PNZA 1J2YA 3BQ9A 4RDXA 1SCDA 3LY9A 3T99A 4BE7B 4MB2A 5FTLA 1T3ZA 2NN3C 1KJ8A 3FFBA 4HTFA 4CN8A 3TGPA 1PR1A 2J9ZB 2A0UA 4KR9A 2UYGA 4JOBA 3ZOKA 1D2EA 1QHHB 2ZIFA 1UZLA 4TTVA 2H6EA 1XAIA 4QYTA 4G0MA 4YEDA 5KJCA 2V9PA 3LPDA 5EHXA 3HEBA 5CTJA 1KZ7B 4NFSA 3EGOA 4BFTA 5A7HA 3FRJA 1QX3A 3DR5A 3RUCA 3IEPA 4CEJA 2HRRA 1SEVA 2GOYA 2OO7A 1GPMA 4HFMA 4L1KA 4RABA 4N18A 3D2CA 2VHVA 3S2YA 3H5TA 4JH0A 4OQPA 3M6MD 1IXKA 4IH1A 2WAOA 2UXCB 1KNXA 2YV5A 2JF0A 2HJRA 3MW8A 4RCZA 1PN3A 3K9LA 4R51A 1MFZA 1KXJA 5KNBH 4HS4A 4NAUA 4XWKA 2FN3A 3DE1X 5LWQA 2A0FA 2JFXA 3FPAA 4UAJA 1DC5A 1PS8A 2QWXA 3PYLA 1W94A 4X24A 4C4YA 4LOJA 4OKSA 2C2OA 2P3LA 3IKVA 2XUQA 4DLBA 2R8XA 4OXXA 1T3LA 3NT2A 3O3NB 4W6QA 2O4CA 2PZJA 1MO5A 1W2HA 2RHJA 4XPIB 2CV1A 3HUFA 3KEFA 2KLHA 2IP1A 1ZI6A 1KTIA 3EY9A 4DDVA 1AZSC 1EVIA 1V11B 2NUPA 1U2DC 3GZNB 1YVDA 1NVEA 3Q85A 1F0PA 4PQEA 2PTHA 2KYRA 1RBQA 1C1XB 2AXPA 2N46A 4ZVOA 2RBEA 1RKBA 5HE9A 3C3DA 4RM2A 2G28A 3KWMA 5FNZA 2QI9F 3CEAA 1U9YA 4INJA 2AH5A 5KNBD 2ZSDA 4Q6BA 1A5SB 3OA0A 3GRUA 1RZ3A 4IYJA 1U2RA 2WJWA 3IQFA 5D3MB 4HX2A 3WXMA 5G4KA 1RLTA 3NDIA 5JADA 4AKGA 5KYVA 3UMJA 5KYUA 1PTKA 2R1TA 2XZOA 4M21A 4LQ4A 3TLGB 5BV1A 3JZMA 1ZN7A 3OJLA 2P3QA 4GX5A 5CVDA 1OIWA 2G4CA 4BYMA 4E13A 1FYXA 3V32A 4QA9A 4O1MA 1W88B 3B9BA 3ADPA 4NPAA 4DWOA 4PGMA 4PNHA 4WGGA 1GZ5A 2WMDA 4MMYB 2JI9A 2PIAA 4WDQA 4XX0B 3WGJA 5M34A 1LDGA 3MERA 1R0WA 4Z4FA 4NEQA 3UZUA 5G1PA 3O2JA 1RRFA 4DJEC 1XQ1A 5FWXB 1CLUA 5C8YB 2UVPB 3F98A 3GFFA 4LFBB 4HFRA 5G41A 1AUXA 5DBEX 1N3LA 1BXGB 4JENA 2P79A 4NX2A 2DTDA 2HNKA 2VBFA 3QPWA 3CF4G 4BX9A 1FW8A 2BGGA 4BNMA 3DO5A 2OFWA 3PJEA 1UBUS 3U3DA 2HPHA 2I2BA 2V6MA 3C5WP 2CUKA 3G82C 1RHUA 4GI7A 2VVTA 4HUQA 4TVOA 1BRTA 1JQJC 4MUXA 2WIKA 4Y1RA 4DQXA 5JQWA 1MHTA 1RRMA 1PFUA 4L8VA 2Y2VA 5JT1A 1VG0B 4LRSB 5BRNA 1V4NA 4OXQA 4RZHA 1LPNA 5AJZA 2D5BA 2EJBA 4P34A 4QOSA 3N7AA 7ADHA 5I7HA 5KEIA 5MN5A 4NCNA 3WGTA 1J49A 5JMPA 3FZNA 4AQYB 4X61A 4JI3B 1R0SA 1GU7A 4J6FA 3GEGA 3JARA 4Q7EA 3SSAA 2BEVB 1C9NA 3V4ZA 3KZVA 5ITWA 4RBNA 3H1EA 3PGA1 5JASA 2HYIC 4CF3A 1KPGA 1Q0SA 1QJ4A 2GA8A 2BGUA 4MKIA 4OIFA 5ALNA 4JQCA 1M0WA 2AA3A 4RD2A 5A1JA 4G86A 4CXMA 5L6LB 2VTBA 2BELA 1HYEA 1FQJA 1XWWA 1X14A 8GPBA 4ZWNA 3BDIA 4P6VF 3ZDDA 1WCWA 4DLPA 2ZCJA 1XNHA 4LHVA 3V4SA 4ZFNA 5E6UB 5JAMA 4WL0A 1B8UA 4QGBA 2JHCA 3E05A 1AB6A 4AJEA 1OJLA 5SZJA 1DUSA 1KA9H 5EXPA 5FEMA 3PXBA 3LX6A 2J46A 2X8JB 3KQYA 3R8CA 4QD3A 4DLAA 2C84A 1FFAA 4JT9A 1PJRA 1VCNA 1JPVA 5FUWA 1QE5A 2A1TS 5IHXA 3GNSA 3PQ7A 1A2QA 1KZHA 3CM0A 3JQ8A 1ZD9A 1IK4A 2XF8A 1PR5A 3FOAA 1EJ2A 4DTIA 3V34A 5EE9A 4KX5A 1JDBB 5J5CA 1QOQB 1L5VA 5FT9A 3QFTA 3WNBA 4Q3BA 4OMDA 5DB4A 5H7XA 1RVDA 1U65A 2A78A 4XCQA 1G4AE 1V6CA 2NT4A 2A5LA 3RBAA 1QE3A 3SXPA 3KUCA 1LQUA 4RL6A 4DRXA 3O1HB 3F4KA 3NUZA 4V0KA 2CWDA 1MPXA 3LP6A 3PFHA 5BSMA 1EFTA 3MXTA 1IEVA 1TQHA 1GNRA 3OZCA 2X0DA 3TIGA 1A4XA 1EB8A 3NYQA 2YYZA 1U1IA 3M5PA 5JD3A 3L2OB 4BKRA 4D0RA 5FLXA 1KFJB 5IM4A 3FLMA 4FFWA 4OYRA 4G5OA 3MGBA 3K2EA 2NZUG 2AI1A 2HD4A 2P7HA 4AUMA 2QUKA 3G9ZA 1V0JA 2HK8A 3IP8A 4LYFA 2NU6A 2NPOA 3MD9A 2YWDA 5DCWA 1XRMA 3WY9A 1C9JA 2WIFA 1VIYA 4I9FA 4MVJE 2PNJA 5AW8A 5KPDA 3UJNA 3KETA 2WYVA 4EY3A 3CFFL 1DU4A 1JA9A 1SC9A 3K0KA 2D0OB 2GN9A 1GUZA 3O8BA 4M8KA 1TO6A 3SC6A 3OEYA 5GVSA 1XPRA 1CQJB 4HD8A 4O33A 5CUQA 5KYKA 4IIDA 3B6JA 3OZTA 1DXHA 1PFQA 5FF9A 5BNIA 1Q77A 3GRPA 1CEYA 2H8KA 4I4CA 3HPRA 4OY3A 3ENWA 3GUCA 2PUAA 4ANFA 1BC5A 2Q9AA 4S1NA 1R8YA 5EIBC 1Z8FA 3FHLA 1EQ2A 4AYWA 1YK1A 1O94C 2WABA 1VB3A 3K96A 3N8IA 4M60A 5H1YA 4DCNA 1KAEA 5A0TA 2ODEA 4ZREA 4CMAA 4HQRA 5TSDA 3GDHA 2Z98A 3KZCA 3M82A 3KKEA 8AT1A 5A04A 3K1AB 1NHWA 1EG2A 2FDXA 2JH3A 2NYRA 1DFGA 3CA8A 3GQBB 4JLWA 1IXYA 4YJDA 4MW4A 1OHHA 4GQAA 1H2WA 2XHZA 4XI9A 3GPIA 3DBOB 3IBGA 3KKNA 5H0IA 2GN0A 3V3TA 4HUTA 4IV5A 4YAWA 4BNUA 3G0HA 4Y98A 3ENVA 3A9TA 4N0QA 1FLVA 3KD3A 2QLMA 1TGYA 2DFLA 4B4OA 1SWVA 5IDYA 1URPA 1OI7A 4E4YA 1HETA 1MJ5A 1DJPA 3PEUA 3IAM6 2X2FA 2P90A 4KDEA 4QHSA 5TQ0A 1W1WA 4MI9A 2GR8A 2GPJA 3PFIA 4WN9B 5LCXA 1YZHA 2ZT7A 1C3XA 1YRAA 1I0LA 2DPXA 3RKSA 2QSJA 4PYJA 3R7AA 2R0QC 2D3TA 4G3XA 4MLZA 4EYQA 4NCJA 3QX9A 3OQIB 3V7WA 1P1KA 3DAPA 2HLPA 1EWTA 2QQEA 4LJKA 4CDRA 1SA0A 3SQMA 4JJFA 1IZ7A 2L17A 2BRUC 2R7KA 3KO8A 4MINA 4MPDA 7ABPA 1UADA 4UNPA 4QUGA 3ROFA 3RUPA 3RWOA 3T3HA 2G25A 4ADSG 4MV8A 2CXXA 3WLIA 3H65A 4FC7A 4FS8A 4TWAA 5FEUA 2VQSA 1E9VA 2OBBA 3GFVA 3F8SA 1QTNA 2Q6VA 4OXKA 5J5VA 4WFKA 2CFOA 4DLKA 5IU6A 4P0QB 4RHFA 2DBYA 3NP9A 5G0UA 3MQFA 4ZVRA 3GFSA 3VZCA 3ZHCA 2GYWA 3DDCA 1DKOA 1EDOA 5ALPA 1X87A 1OKKD 1I4DD 4NARA 3TW8B 1Z63A 2WWFA 4XSVA 1Y6ZA 2ZSEA 2AN5A 1JKJB 1RLJA 5AVYA 1A96A 1ZEJA 1CIVA 1IE3A 2HA2A 3RVBA 3W4JA 4UPDA 3K70C 3EXFA 2GUGA 2XAAA 3O4JA 4F96A 4XLLA 1Z62A 5FPSA 2J6BA 2V6JA 5EMLA 2ZTLA 1ZH4A 4YGXB 2WJAA 5K8IA 4YVFA 2AMFA 3EGXA 1Y1KE 1X3LA 3A6LA 3FOCA 4IDFA 4P4UA 4WKBA 4DCJA 1KMMA 3MTDA 5KHLB 2NZVG 2Z9BA 4DQLA 3G8CA 1D2RA 1QP4A 3LZCA 2JVJA 1Q0ZA 1UBGA 2QRMA 1D6JA 3CZ9A 3UHAA 3VJKA 4WOBA 1O94A 4I1IA 1SXJB 3CUVA 3QP9A 1TQ4A 1L4UA 2HCRA 3FNQA 1IHYA 1WA5A 1Z4PX 2G70A 3AI1A 4KQ1A 4NYMR 3T3IA 2UZIR 1TFUA 2E1RA 3PCRB 3QKSB 4JMPA 1UEIA 4NMWA 1L5NA 4ZJYA 3UK6A 1EE2A 1M2VB 5B7PA 1E3MA 5EIAA 1ZESA 3QVMA 5IJAA 2PUEA 2Z3VA 3AONB 4LTDA 4MA5A 3H97A 4D43A 1KMQA 3IUEA 2VPQA 3WMEA 4GVXA 2WKSA 1YB6A 4LK2A 3FOZA 5IYZA 3C87A 2OC4A 1W46A 4JP2A 4HFJA 3ELYA 5EXXA 1PUIA 2QTAA 2PGNA 1D5CA 1B2RA 2NVUB 4F9TA 4CQLB 4GEKA 3EEIA 5C1OA 1W9MA 4JVMA 2AMYA 2J3JA 3EQ9A 1DPGA 5DISB 2X6TA 3T1VA 1RPTA 4DRXB 1XCBA 1AK9A 2P9QA 3AVQA 1TX4B 1ENZA 1G8AA 1X80A 2VWQA 2ZR8A 3BFVA 1VG8A 3P2OA 1XZBA 5LUAA 3TKYA 3LD9A 5LZ7A 5BVGB 4YR7A 1VGRA 5CD1A 4RH3A 1EJBA 2W4QA 3I6IA 2NPFA 4JNKA 4LVCA 3TPFA 5C8ZA 1P1IA 2Y1OA 1I6KA 3FTNA 2RDMA 4WFJA 4IDPA 1HQYE 4J90A 3PRKE 1Y8QA 3ZWCA 1P7CA 1FX0A 4EW6A 3QK7A 4MGEA 3LQYA 5AKKA 1HWYA 2IGBA 3OJXA 1RACA 1NT2A 4E7PA 2PT7A 3GFGA 4EAQA 5HZMA 2CVOA 2J7KA 4ZO8A 4Y1EA 3ADOA 2J9FA 3F6SA 4G36A 4JUBA 2FA9A 2L42A 3UWOA 4O0LA 4XJTA 3A6GA 3WTBA 1M34A 2J41A 3IA2A 3I2IA 4B43A 3L1IA 4C05A 4F3RA 1W30A 2XPCA 2EIXA 4M0UA 3N86A 5GQSA 3TOZA 2IHJA 3QFSA 1SURA 3T7AA 5KKCA 2R84A 2I99A 2OBMA 2QY6A 4ID9A 4PLFA 3WJAA 4OOFA 2QENA 4BQEA 1KQGA 2FR1A 1V2GA 2YDXA 3BRCA 4HP8A 4D9FA 3FHCB 1WHSB 2X6RA 4CF4A 5JH7A 1HPLA 4P0TA 1DIOB 4ECAA 3QLJA 5DM2A 5LC1A 1YSCA 4YQEA 3OT4A 4XQCA 4G65A 2Q28A 1TM4E 2Y1LA 4U0JA 4NYMQ 1HGXA 3AZOA 3OSZA 3SX4A 3WQBA 3EE6A 3SF8A 3VNBA 2VYFA 2G36A 2HY7A 3JQGA 5KX5F 3B7PA 4YAGA 1L3IA 3LL7A 4BGDA 5AM3A 1VM6A 3CMCO 1EIWA 2EQ5A 2WU0A 3D02A 1D2CA 4GVLA 3HBLA 2WP8J 1X1SA 1FXWF 1LY1A 3MGKA 4LJ5A 5B4UA 3VYRB 1QF9A 1Z06A 3NWPA 4YAOA 1G5FA 5BV7A 2J5RA 2PL3A 4WFIA 4KWHA 4MNTA 2AZTA 2FEOA 1HT2E 2ZPAA 3G17A 3ND8A 5AW1A 2RMKA 4EW2A 1K6JA 1W7AA 5CLJA 3RI3A 3QWIA 4BFUA 2VT3A 1QONA 1ARZA 3O84A 3L9XA 1J9GA 5TF4A 1M9NA 2QRLA 3EY4A 2YY7A 2IKQA 2WHYA 4MITA 2W2PA 3HU1A 3ROZA 4EL0A 3TCNA 1U3UA 3OCUA 1GGNA 1WEHA 3K0CC 5JD6A 5B3KA 4F5DA 4ALIA 4DUGD 4MP8A 3T3MB 4AS2A 1QS0A 3O1LA 5BO5A 1ISJA 3A2NA 4CQJA 4EEZA 3OOJA 3SQDA 3B8EA 1IM5A 5AK4A 4LF9B 5C4IA 5H80A 3CUUA 2P8SA 3PNMA 4UU7A 3JV7A 2M1XA 3PKIA 3B2QA 3TLCA 3IPXA 3Q3IA 4ZQFA 1IQUA 5C8VA 2X0KA 1AV7A 1E4EB 4QVGA 1JYFA 2OESA 5FOWA 3RS0A 3N9IA 4BPRA 4TYNA 1JAYA 1TT5B 2HEIA 2RGXA 3NC1C 2FCRA 4KR2A 3RYFB 2GEVA 4YPOA 1GUBA 4LHXA 3T9EA 3DFFA 3T35A 1UBHS 4ZT7A 1EX6A 2ZI6A 3KTOA 1Z4MA 1OC4A 3PGVA 4CTKA 5AFSA 4YI3A 5KVVA 5CDSA 5BMOA 1E2IA 3UMVA 1V48A 2PKQP 3ABQB 3HYSA 3GFOA 2C9MA 3P0HA 3BCHA 3FB4A 2BW0A 4P0PB 2JCBA 4KKXB 4Y2YA 3T06B 3V5NA 4C0JA 5I7OA 1OX4B 2QVBA 4B3DA 2FMUA 3M6VA 1DOAA 1RAGA 3EXG1 4M7PA 3UMBA 2GO1A 2YHAA 3CFIA 4KUEA 3KE9A 3KOXA 3O4RA 2HA5A 4L51A 4EH1A 1PJ4A 4JZKA 1RAIA 3A4NA 2IF0A 2GD1O 3ZDAA 3ZGNA 1EFDN 2Q4RA 1EM8A 1NTOA 3DT9A 3MT9A 3ROXA 2Q4DA 1MDBA 2OLJA 1EESA 2DCMA 4W1QA 1M0SA 4FD3A 4P3PA 1YS7A 1HLGA 1VYTA 2O6HA 3PPVA 2EJWA 3PDIA 2R3SA 3K0AB 4IF6A 4JLSA 4L74A 3M6WA 3QXXA 3AUJB 1EX1A 1VYHA 1NPYA 3ZLJA 5KTKA 4FBGA 4FINA 2M2IA 1RBMA 2V58A 1X8XA 2Y99A 1BH2A 1PL8A 1IYZA 3K2BA 4KAXA 4RELA 4YP6A 5BSHA 2CNDA 3FPCA 3RHSA 2ATCA 3WSVA 2HMSA 2I2WA 2PAFA 4DLSA 1H2XA 2AJ8A 2ZJBA 2JLXA 1C7ZA 5EJAA 5CA1F 1HRKA 3E1SA 5DYGA 2OXEA 3WL8A 5EIXA 1WXGA 1N2XA 1E2PA 1M7GA 4E15A 5JD5A 5EVCA 4Y2VA 3K15A 1ZGBA 3B85A 4UMEA 4DMCA 2BZ1A 2Z2ZA 4C5BA 4Y2SA 3N0XA 2IV3A 3TLJA 2DH5A 3WDLA 2O3JA 3CLTC 5AW6A 3R3ZA 2BFPA 8MHTA 5I9TA 1Z22A 3ETHA 4IICA 4OXNA 3VC7A 2WT9A 3RSOA 2O3QA 5JZBA 3T94A 3DM9B 3LWBA 4P33A 4Q0MA 1N78A 4OA5A 1NJGA 5JJCA 3K32A 1JR4A 2CHFA 3VZRA 3WL3A 3HCNA 2CXTA 3S7ZA 3HVRA 1DKPA 4Y2QA 5TC4A 3ZD9A 2PFGA 3BXEA 4ODIA 4E3WA 1G8SA 1SFRA 4CM1A 1N32B 4B6FA 1VI2A 3CZCA 3TR0A 1O5OA 1PZHA 3IRUA 3UFBA 3OHMA 4CMBA 3NU1A 3IP5A 2ZTSA 1X38A 4GI1A 2JA1A 2B8WA 5BVHA 2QE7A 3LQ2A 5FBQB 4MCIA 3GVIA 2QJRA 2CZQA 2D74A 5I8PA 3IT3A 5IYZF 4BO1A 2XT6A 4QUBA 2G9UA 5EJIA 1E9CA 2WG0A 5H83A 3RS8A 5DGTA 4CRWB 4D98A 3KPJA 1W47A 2ZBFA 4RORA 2B4QA 1P4JA 2XVMA 1SC6A 3FDIA 3Q3JB 1VJRA 3T3DA 3AEKB 3OEWA 3FTQA 2I4NA 1KBOA 4PICA 4Q3AA 1WQ3A 2G1UA 5FOVA 4KR7A 5ERGB 4WZAE 2DM6A 4TMXA 4MB0A 2V7EA 2V7WA 1AN9A 3SIRA 2VJDA 3C7DB 3QE4A 4QPCA 2O2ZA 4LBVA 4WDRA 1VLMA 1NBMA 1EK0A 1QCZA 1RTKA 1C3LA 1ZCJA 2DKOA 3EXFB 4G4GA 4LXIA 4ZZ1A 4FCCA 3THRA 1GAEO 3IAXA 4N54A 4OOEA 3KAKA 4HN4B 3UKOA 4W5OA 1FEZA 2RBKA 3HKEA 4P2BA 3V1UA 3VZQA 3H8WA 3W2IA 2H0RA 3LQRA 1TF7A 1USIA 1DZ3A 4U2EA 4Z8XA 3D2LA 3TNLA 4A5SA 6AT1A 3I0NA 2CCJA 3FVTA 5CH8A 4JGBA 4K88A 1IN5A 4V3BA 3REFA 5IZCA 4IOMA 2BPOA 1U2PA 4F6CA 1GZHB 3WZLA 3NAGA 4XUGB 5A4AA 1IHOA 2CHGA 3IALA 2QRZA 3AUTA 3K5WA 4Q4DA 2PZ8A 2QJTA 5EFOA 4ITVA 3SYRA 2GT1A 4TUYA 5DASA 1YA6A 1CHNA 3D6JA 1KY2A 1MZPA 1XMIA 1FYFA 5CXQA 2ZE5A 5F52A 4PSUA 3ADKA 1ZGGA 1GNVA 3I9OA 3MFYA 3NXKA 4D99A 3M9LA 3DXYA 4CM9A 4LV5B 1GLGA 2J07A 4F7WA 3R3SA 3IHKA 4MP6A 1KZ6A 2NNLD 2UVQA 2YYAA 2ZWMA 3DBHB 3K9GA 3KEGA 4HXEB 4BP1A 1X7XB 3L1HA 2J9XB 1E18A 4H7DA 1CY4A 3IBSA 1WW8A 4Z49A 2O8VA 3FBTA 3JD3A 1QU3A 1DDOA 4HYYA 1HE8B 1MABB 4BHRA 1VL8A 2IIQA 1O03A 2QTTA 1E60A 5DTMA 5GINE 1KO5A 4G0VA 3DL7A 2QJOA 5JAIA 2Z08A 5LPNA 1LBQA 1TT5A 3BB4A 1ZVQA 3UXHA 1XJ5A 2G3YA 2YXDA 4C89A 2Q3LA 3EIQA 2Q5FA 1MO6A 4D6YA 5P21A 4O25A 3U4QB 2YJTD 4CT5A 5JSZA 3DE4X 2UZ0A 3CX7A 4LF6B 3H4VA 3T95A 4E1AA 3OIFA 3O9VA 1R88A 1YU6A 1YJAA 4F4CA 3NWJA 4MEJA 3SM9A 3HZHA 2FRXA 1ZEMA 2FZCA 1ENPA 4TS4A 4EI7A 3O93A 3C8DA 1EP2B 5BWNA 1O89A 4M9RA 1T5SA 2VQ6A 4LHSA 1HF3A 3CZMA 3WHKA 6REQA 5LFAA 3JAKB 4ABTA 1XDZA 2Q27A 3KZOA 3EWSA 1AKUA 3VHXB 1BKDR 2VQFB 1ZA1A 3FGOA 3O7WA 4AN4A 3BRWD 2ERCA 1QOPB 3MB5A 5K8CA 3P19A 4M7RA 2VRNA 2A30A 1O6FA 1U28C 2P2GA 2ZVQX 3LXXA 3NIGB 1Z5OA 4KWEA 5IAKA 5BWLA 1JI0A 2JGKA 1G5QA 4RMIA 2EJTA 4ZT4A 3U0VA 3HVKA 1PW5A 3IODA 2OORA 1IMJA 2ZUWA 2A67A 5CDFE 2OWEA 4IJWA 3RYFA 4TT8A 2QDKA 2OHXA 5DNEA 5GM1A 2FEMA 2C2BA 3FNRA 4HZUB 1SUFA 2BF7A 3RNOA 4OYYA 5KQPA 2Y6VA 3BHNA 3GQBA 3GJRA 4UTXA 2AN3A 3RVOA 4L7QA 1P91A 4ZMBA 1T4CB 4P81A 5EI5A 4ZDKA 4JBXA 3U0BA 2Q2WA 1F7VA 2DBRA 2JBAA 4PWYA 2VYVD 3NDBB 4GOOD 1GSOA 3LT5A 5CR9A 2W6OA 2H29A 2Z2XA 3HL0A 2Q0SA 3V4PB 1ZSYA 1E6WA 4V0RA 5CVVA 2J67A 3W9SA 4NHEA 1XEXB 1Y3HA 3AR5A 5J58A 3SN6A 1FXSA 4CTMA 2HYDA 3IPAA 3ONNA 3DP7A 1ZONA 2AI2A 4UHHA 1B00A 2J3LA 5GZ1A 4PNEA 5EGNA 4F85A 4FKZA 1NDQA 3ZV3A 4ZTUB 5AOBA 1GSIA 1GDTA 2N47A 3HLYA 1Q3TA 4XWTA 1ISRA 2ID8A 3QVXA 3FUXA 4MHSA 4CIDA 1BW9A 4RCVA 3LXRA 1Y5RA 3G5MA 1HURA 3H0CA 1XLVA 2J5BA 4IW3B 3D3EA 1QPGA 4PLVA 5D3ZA 1NXXA 1MIOB 3BB1A 3PNQA 1KRHA 1P1CA 4A8HA 2H54A