3Q12A

Pantoate-beta-alanine ligase from yersinia pestis in complex with pantoate.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
285
structure length
285
Chain Sequence
AMLIIETLPLLRQQIRRWRQEGKRIALVPTMGNLHEGHMTLVDEAKTRADVVVVTIFVNPLQFERPDDLAHYPRTLQEDCEKLTRHGADLVFAPAAADIYPAGLEKQTYVDVPALSTILEGASRPGHFRGVSTIVSKLFNLIQPDVACFGEKDYQQLALIRKMVADMGYDINIVGVPTVRAKDGLALSSRNGYLTEEERQIAPQLSKIMWALAEKMALGERQIDALLEEAAAQLLRVGFTPDELFIRDAETLQPLTVDSQQAVILMAAWLGKARLIDNQLVDLRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantoate--beta-alanine ligase
publication title Pantoate-beta-alanine ligase from Yersinia pestis.
rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 96
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3q12A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3q12A01
2A84A 1NYLA 1N2IA 1NI5A 3FNRA 4RUKA 2EJCA 4MQ6A 1J09A 1EFPA 1OWOA 1NURA 2G36A 3SZ3A 3AL0C 1TYAE 1MOPA 1M83A 3D6VA 3KT3A 3X1KA 2DEUA 1U3CA 3ZXIA 4RPIA 5F23A 1VBKA 3FG9A 3FWKA 1A8HA 1HYBA 1V8FA 1PFYA 4EG3A 1WJGA 3HFJA 1KR2A 3N2YA 1GPMA 2A1TR 1N2BA 1EFVB 1NUQA 5AHWA 2A88A 2R5WA 1J21A 1OWNA 3TZEA 2RE8A 1N1DA 3IMCA 4DDKA 2EL7A 4YP5A 2PFSA 2QUIA 1EE1A 1NUPA 1PFUA 4MW1A 3IOCA 4MW0A 3RJZA 3P0HA 1UFVA 1U3DA 1JEEA 4ND7A 3S3TA 1O94D 4HJRA 3P0JA 1DNPA 4XSVA 2QJTA 5DEOA 4OUDA 3AFHA 5FO1A 1I6MA 3CLUD 4MUHA 4F4HA 3H9CA 2NZ2A 3PXUA 3F3MA 3N9IA 1COZA 3KT6A 4PBSA 4EG6A 1IFXA 2E89A 1YUNA 3N05A 3ZIUA 2ZUFA 3ELBA 1QU2A 3HMQA 4R0NA 2YWCA 3PNBA 3UC5A 2O8VA 3CLRC 3MUEA 1M8FA 4JFAA 1V47A 2OQ2A 1Q11A 1WZ2A 3COWA 4KKVA 3SEZA 2IJGX 3JXEA 4MW4A 1IVSA 1F7VA 3H99A 4DLPA 1N78A 1KAMA 2RD2A 1PG0A 1SURA 3FDXA 2V0GA 2A1UB 1R6TA 1VBNA 1O0BA 3HGMA 1MBZA 1KP3A 1XNGA 1OWLA 3NBAA 4ZT4A 1GAXA 1XNJA 3VRHA 3ND6A 3H97A 4BWVA 1B6TA 1KQOA 1TYCA 3IVCA 2TS1A 1VL2A 1JIKA 1G8GA 3MXTA 1D2RA 1QTQA 2OV4A 3KFLA 3RBAA 4ZCTA 4WNYA 1K97A 1Y42X 4NX2A 2GKSA 3IVGA 3CLTC 1KH3A 1WKBA 4PBTA 1YIAA 3U1VA 1YIDA 5J59A 5TEVA 1M1ZA 3P0IA 3KT0A 3H05A 3CLSC 4DDMA 1LW7A 4WSOA 5TEWA 1R6XA 3QTBA 3FOCA 3CLRD 2CYAA 2WQ7A 2J5BA 1QNFA 2QUKA 1GTSA 2D54A 3GMIA 4JXXA 1WOYA 1OWMA 5IHXA 2HGZA 3UY4A 5H7XA 2PG3A 4Q16A 4H3SA 4MUIA 5DB4A 1OD6A 3KT8A 3TNJA 3QTTA 4NDAA 1WXHA 4U8HA 1U0BB 2CV2A 3C8ZA 4DNXA 5K0TA 1QRTA 5TGTA 1NP7A 1O5TA 4NATA 3TQIA 2PZBA 1OBHA 3ZJVA 3AIIA 4EFKA 4MVXA 2J09A 1MAUA 5LFAA 2ZUEA 1EXDA 4U63A 2VTBB 2YWBA 4MVCA 5K0SA 3TZLA 1WQ4A 2Z08A 5LM3A 3A4IA 3OTWA 1J1ZA 3K9WA 4MVYA 1NUSA 3TQOA 4MWDA 1G59A 4U7JA 1M8GA 1KP2A 4EG4A 4J75A 3CLSD 3RHSA 2X0KA 3D6UA 3DPIA 3SYTA 2X1LA 1J70A 1NUUA 1JZSA 2ZP1A 4EGAA 2VTBA 1MB9A 4CDNA 2HMAA 2IELA 3Q10A 1IHOA 2CYCA 2QJFA 1WXFA 2QTMA 4GRIA 4HJXA 3FY4A 3L92A 4G5YA 4R2MA 3VGJA 2D13A 2AKEA 1S4MA 4MW5A 4MUJA 1M8KA 3GUZA 3PRHA 1EFVA 4MULA 1MC1A 1MB2A 2A4MA 1O95C 2QTRA 5TS2A 2H2AA 3ILVA 2DUMA 4ZT2A 4GU5A 4JZYA 4ZCPA 2GM3A 1NSYA 2PIDA 3FH0A 2YXNA 3CR8A 4KR6A 4P2BA 2PZAA 4YMIA 3PNYA 1ZUNA 3G6KA 1T6XA 3AKZA 1OBCA 1P7PA 3ISJA 1CT9A 3ZXSA 1EJ2A 1J1UA 3AG6A 5H16A 1RQGA 1EUYA 2PXHA 4EG7A 5KHAA 1TFUA 3LCJA 1IQRA 3G59A 1NUTA 4HPWA 2H29A 5J58A 3ZUGA 4MW6A 3ND7A 1IQ0A 1PFVA 2JANA 5HUJA 4UZFA 1K92A 1O0CA 4MW9A 1T6ZA 3ZJUA 2CV0A 4R2LA 2C5SA 4OJMX 1O96B 2A1UA 2QUHA 1WXIA 1O97C 4ARIA 4MWCA 3RK1A 3LE8A 4L2IB 2AG6A 1N2GA 3CVVA 1KH2A 1MAWA 1N75A 4JYZA 1IRXA 3DLAA 4EG8A 4XFDA 3IVXA 3A04A 4EF6A 1YULA 4KPUB 3ND5A 1EUQA 1O95D 1KAQA 2D5BA 4ARCA 1WY5A 1U7DA 1KH1A 3CVUA 2CFOA 2A7XA 3FHJA 4KR9A 3FIUA 2AZXA 3INNA 2DXIA 4MAFA 1QRSA 4MUGA 4DJAA 2J08A 3UMVA 3X1JA 3A2KA 4K0RA 1QJCA 3CVYA 3CVWA 1I6LA 2XRYA 1EFPB 1O94C 3SP1A 1JIJA 3UOWA 1JZQA 5KCMA 1ZJWA 3SDBA 1K4MA 3IDFA 1M8PA 4KPUA 4Q93A 1JGTA 4PBRA 1GN8A 2Z09A 3OP1A 4DE5A 1WXEA 3TS1A 3CLTD 3I05A 3IMEA 3IUBA 1KQNA 1R6UA 1OWPA 4YP7A 1ULHA 3GLVA 1JHDA 1WXGA 1T9GS 2XRZA 1QRUA 1H3NA 4ZCQA 3A05A 4MW2A 3ZGZA 4KR7A 5KWVA 3H9BA 4MUNA 3UK2A 2V0CA 3BL5A 4OUDB 1FYDA 3VU8A 1QQTA 1LI5A 4E1AA 3DO8A 1GLNA 1LI7A 1YI8A 4AQ7A 3CVXA 1I2DA 1TQ8A 4NZPA 2JAXA 3IMGA 4I6GA 1N2EA 3NBKA 1G8HA 5BNZA 1X8XA 3NV7A 3IUEA 1JECA 4G5FA 4HK4A 3L93A 1N2JA 1I6KA 4EG1A 2I1LA 2DPLA 3COVA 1IH8A 4ZCRA 3MLAA 2NSYA 4ZT7A 4AS1A 4K03A 1T6YA 3FETA 3FI0A 4CDMA 1X6VA 2WSIA 1Q77A 3Q4GA 3QE4A 4CQNA 1GTRA 2QJOA 1H3EA 1Q15A 4QREA 2O5RA 3DV2A 3M5WA 1KQPA 1J20A 3E27A 1F7UA 2JA2A 1JEDA 1GZUA 1JILA 1ZH0A 2CUZA 2DR2A 5FO0A 3SEQA 1XJQA 4X0EA 1VLHA 4JXZA 4XFJA 2X3FA 2E0IA 2QTNA 1MRZA 2CYBA 2B7LA 2WB2A 1KORA 3HV0A 1MJHA 3ZJTA 4PY2A 2E18A 2QUJA 2A1TS 2X1MA 1Q19A 3X1MA 3N8HA 2BTEA 3PNVA 1VBMA 4MUKA 1H1TA 1ZH6A 1QU3A 2DERA 3MMXA 4F3RA 2DETA 3HZRA 3RK0A 1PG2A 4QBTA 2J07A 5LLTA 5HG0A 5EKDA 2PZ8A 1F9AA 1H3FA 1N3LA 3MLBA 2DLCX 1TEZA 4MW7A 2YY5A 4YBRA 1FFYA 4I6EA 4ZCSA 4MVWA 4TS1A 1KKUA 1M8JA 3Q12A 4ND6A 4YP6A 1T9GR 4I6JA 4MWBA 5HUHA 1U7XA 1XNHA 2J4DA 3IOEA 1YUMA 2CSXA 3COZA 2BYTA 2CV1A 1TYBE 3IODA 1JIIA 1G8FA 5JBNA 3LOQA 1TYDE 4S1OA 4MUEA 3RFFA 1JMVA 1ILEA 1O96A 2GOYA 4ZT5A 5FNZA 2HZ7A 3IH5A 4L2IA 3SZGA 2E21A 1O6BA 2VXOA 2IP1A 4ZT3A 3IOBA 4CT0A 1BS2A 5IJXA 5DK4A 2Z3VA 3CLUC 4MUFA 1K4KA 3HL4A 4QRDA 3P52A 3K32A 4UZEA 4MWEA 4NAHA 2A86A 3G5AA 1N77A 4J76A 2CT8A 3COYA 3AG5A 4FZJA 4ZT6A 4G6ZA 5J5AA 1NZJA 1WQ3A 4EG5A 1N2OA 1IQUA 5DASA 1N2HA 3CA8A 4NAUA 1PFWA 4MLPA 4DDHA 1O97D 2WQ6A 1F4LA 4A91A
chains in the Genus database with same CATH superfamily
1EVYA 3B5IA 1OHHA 3IBTA 5DNAA 1N2IA 5LA6F 3ZW8A 1C1DA 1NA5A 4RUKA 1R12A 2Q7DA 4M1YA 1LCIA 2QROA 4JN6B 1V2GA 4BY9E 1G5TA 4FYPA 5YASA 3ESYA 4DUPA 3W78A 3ZXIA 3CUUA 4GIBA 4C7JA 1SQGA 2Q5CA 2ZANA 1O4VA 3BH7A 4ZEOA 3ZNNA 2PGJA 1HDXA 1OTXA 3BXPA 3IQXA 3O1JC 4XYBA 4MKHA 3WGZA 4F12A 3R9XB 2O2DA 4WAUA 3P2IA 2GFHA 2I4TA 2VBIA 4OYRA 4EDHA 1IG0A 1LPNA 4DBVO 1FMLA 4EYGA 3RWOA 5DO9A 3O83A 1VHWA 1RZUA 1DEOA 2WTMA 2UYYA 2V6GA 2HD4A 2BEJA 3DOCA 1AZSC 3NKLA 5KJ1A 2WJVA 2IOFK 1UAYA 1R5BA 4NPHA 3HKBA 3VXKA 2PK3A 4GR4A 2XUHA 1RWPA 1EFRA 1JKIA 2X3UA 4IQ8A 4OUDA 3GLSA 4CQMD 1AA9A 3AWDA 5CFNA 5JT1A 1I51A 5FKJA 3BQNB 1ZNZA 3KVRA 1G5HA 3ZCPA 3GRVA 1XJ0A 4BX9A 3A9TA 3E7FA 4AIRA 4TTPA 4RLQA 3N9IA 3K72B 2I67A 4GC5A 6PFKA 4NOLA 2R86A 1T5SA 3E9ZA 2WNSA 4GVPA 4IZHA 4KACA 4P34A 3BSSA 4PXYA 4UU7A 4IX9A 3W8DA 5BUQA 3FA2A 4Z4IA 5J9FA 1C50A 3AIOA 2W6CX 1BAPA 3KHKA 1ZITA 4FFRA 4HNHA 4LZNA 5EMNA 3RVMA 2ZULA 1L7VC 1T5IA 4LY3A 1AE1A 1UJ4A 4KXNA 4K7JA 2AT1A 4ZOBA 5AJXA 3BWCA 3PR2B 4BVAA 5JJCA 1SXJA 3ZD7A 3OF5A 3RS7A 2P4EA 2XNHA 2JBAA 4CEJA 4MARA 3AJEA 2EW2A 4PS1A 4UTPA 5KTTA 3JARB 2C97A 5L6MB 4OJYA 4RHEA 3RM3A 3PX7A 1YKGA 2V0GA 1WLSA 1A7KA 1BFDA 3MK31 2VZ0A 2Q1TA 3RADC 1YFLA 1ZQ9A 2I8AA 3NBAA 2H6EA 1C30A 3W4JA 2LCQA 2P6RA 4J91A 1AB6A 1D0IA 3PXAA 4BFZA 1N4DA 4UM7A 1KQOA 4K5QA 2WEKA 2E1RA 4OEHA 1H6AA 3BMOB 4N0QA 1OKKD 4B9AA 3EWNA 3TZHA 3R5KA 1EX6A 5PNTA 3H6GA 3C45A 1SHKA 1YCFA 1SOUA 1V7CA 3HRIA 4ZO7A 1SUFA 4Q4AA 1UZAA 4CLOB 3DMTC 2ACWA 5BYAA 1IEVA 5FLXA 3GP5A 3IAXA 4RF3A 5AVUA 1QSGA 3KAKA 1U0LA 2Z8XA 1LUAA 1DL5A 4I55A 3I9NA 1TJPB 3B5EA 4BB6A 5B2FA 1RXVA 1VI2A 2DWQA 5HIIA 4AO7A 1TAHA 1C9KA 4WK2B 2FUKA 1PGPA 1Z3CA 2KS6A 3DHNA 1K7FB 4FWTA 2ODQA 2WJZB 4AZ3A 2Q1UA 2F6RA 3MC1A 3GU3A 5HMLA 1A88A 2WIKA 3KEQA 4BOYA 2NADA 1RRMA 1IB6A 5D1HA 3QU4A 3KPVA 4A0SA 4KQ1A 3DAFA 2CYAA 1SKYB 4LV5B 1KJWA 1N5IA 2XV1A 3IT3A 4UUMA 3TG8A 5AXAA 5KBYA 3LD9A 4IHQA 3AF5A 4OAPA 4W6ZA 2YH2A 4PLCA 3F67A 3EZXA 3SVTA 3DWFA 1P74A 2PHZA 3FYUA 4PNPA 5KCZA 3F4LA 4W5RA 2OVFA 1TAGA 1CUWA 1PEAA 2HCJB 3N86A 4U8HA 5CNJA 4D3FA 4HV4A 5JBQA 1P0MA 3CB2A 4N39A 1W76A 3O1HB 5KKNB 4JC8A 2EDAA 2B94A 4HWRA 2C54A 4BJ5A 4W5OA 1B6RA 1ONBA 2B34A 3FWHA 5DHAA 1KO5A 1ML4A 1Q6YA 2QRVA 3IAUA 1Q1GA 3V55A 5F51A 3I5YA 3ICVA 2HL6A 5GM1A 5IH3A 1GKKA 1VFPA 1VRVA 3AF1A 2JA1A 4HDNA 1OXSC 4LHXA 1XTJA 3HCNA 3KLBA 3TECE 1MH9A 2P2SA 2FTKE 2F2TA 3OUZA 4Z3KA 4C2AA 5CAEA 4B7XA 4KN6A 2FFHA 1JA9A 1E6KA 1QHNA 3T7AA 3HKDA 5E4FA 1Z5UA 1XTUA 1C0KA 1UBCA 1B6GA 4HX9A 3ZXUB 3I1IA 1PSWA 1NUSA 1E0DA 1P2SA 3R3UA 3TQOA 4WJKB 1Q7BA 5BNWA 1BN7A 1CB7A 4HZUA 5JXJA 2Q6OA 3A3YA 1L1QA 1CEYA 5FTJA 1K3UB 1KP2A 5DNDA 2Y92A 4CQLB 2K7FA 2Q8PA 5HSGA 5LWHA 1NJFA 3D4PA 4L85A 1ZWKA 1Q1QA 5L7WA 3PS9A 3B48A 3LX4A 4MO9A 4BX3A 1LPSA 3DLCA 1CUGA 3MS4A 3VGPA 1DWUA 2Z8YM 4GQIA 2I8LA 5AHOA 2A5YB 3GUHA 1KIFA 3BIFA 4CCWA 2WV7A 4X6UA 3KQKA 1XZCA 3HM2A 4CF3A 3VZRA 3A31A 1NQWA 2WD8A 2BKXA 3PNKA 4M89A 4TV8F 2XGSA 4P8RA 3ME5A 2HHCA 1Y4SA 2BL4A 2JLAA 3DSRA 3IUNA 3UQYS 4YMTA 3ON5A 4RVCA 3WRYC 1YJ8A 4YV7A 5J47A 1MC4A 3L7JA 5MN5A 1MR3F 1UBEA 1O4WA 1XZEA 3ABSB 3L43A 1TA9A 2FRVA 4KI7A 4OK6A 4BVHA 2DLNA 4Z1OA 3GLIB 2QBYB 4RGVA 2WG2A 3NRJA 4MDEA 3RIXA 2JZOA 4BQOA 4R83A 2FX3A 3B13B 1CFJA 2W4QA 2CDBA 4WK4B 421PA 2IS1A 2UZ0A 5LDGA 1U90A 3PWSA 4WOKA 2WABA 3U7QA 1TM4E 2DHRA 5CFMA 4GRDA 3RSCA 3UJ7A 4UUQA 1VI6A 1JEQA 1NLZA 2MSCB 5BV0A 1BIFA 5BRJA 5ITZA 4KR6A 1R0YA 2PZAA 3P9YA 1E3WA 1QHHA 1MLDA 1DCMA 4IOLA 4V38A 5JS7A 2OB2A 5FI3A 4B7UA 1S3IA 2P90A 3HYTA 4X1OA 3IQDB 4DSNA 4MIOA 1CULC 1ZI8A 1C4KA 4QRIA 3KQPA 2X86A 4IFEA 4LJRA 1GVNB 2AEFA 3EGIA 3O8DA 3RRJA 1JFFB 4DIOA 5JCOA 4BHRA 3OIUA 1L6IA 2ANCA 3LCJA 5DI3A 3DBIA 3NTLA 4U00A 1ZW6A 2XDQA 3C0KA 4G5GA 4JJ6A 4X1IA 1GGVA 3H2GA 3QJ5A 5BWOA 2AQKA 2NTJA 2ETVA 3OZFA 1LPAB 3AKEA 3GJ4A 1E5XA 2TMGA 3HYCA 1HEYA 4M55A 1DC8A 5H3HA 4C1BA 7AT1A 1KIAA 3PUJA 1U9JA 3V1KA 2IV7A 1MHPA 3JCZA 1DQRA 1TFRA 3ZJUA 1OXXK 4R84A 3SYKA 1RE1A 1BD4A 1RKXA 3G9QA 4GYJA 4RQAA 4TVBA 5AW7A 5ALRA 5KMGA 5ELLA 2AFHE 4IDPA 3NBXX 4E3WA 5FBVB 3SJCA 4MWCA 4QZVA 4CGYA 1GPKA 4FYIA 1AQYA 2O4UX 1HDEA 5GONF 5C8YF 4GG1A 5A62A 1N75A 1I80A 3K31A 3OJCA 4TM8A 3IVXA 2L17A 4FOSA 2CBZA 4QC2A 3JYOA 3K94A 4Y6OA 4OHVA 3L6CA 3QEKA 2GNPA 2PBRA 2QN2A 1JSRA 3VU9A 4RABA 2PQMA 3KXKA 3FPGA 4I4TA 4KOEC 1AMNA 3K0CC 1JKMA 3KKOA 3LHSA 1JPNA 2AE2A 1Q2XA 2D1RA 4KR9A 1IXRC 5LMCA 5U1PA 1C3OA 4M49A 4OJNA 1N1EA 3GOHA 4NU5A 1TCUA 4FYHA 5B57C 1KI7A 5JCJD 3INNA 3FVWA 2OHOA 1U63A 1DUSA 1Z88A 1AKWA 2F9FA 2H65A 4MRMA 1Z2NX 1HT1E 2GZAA 2AOXA 1UM9A 3EW9A 4JI6B 4DRZA 3C3MA 4M8NE 1JHAA 3DMTA 4P53A 2EJVA 1GL6A 3NJRA 4R05A 3DXFA 3BGVA 2R62A 4KQJA 4HDMA 3UT6A 3GBSA 1Q0TA 2FU5C 1BMQA 2XMBA 2WILA 4QELA 2AYZA 3E7PA 1L7QA 1E4VA 1D04A 3I6YA 3QE0A 4KPUA 4UNSA 5CCEA 1WIWA 3ILYA 5K05A 1SC3A 3RVJA 5JRJA 3NTXA 2Z09A 1FP1D 2IYTA 2I78A 3N3AC 1KMQA 4JI4B 1XHEA 5HW0A 2O2HA 2QVBA 3PGMA 1SZDA 2CZCA 3HS3A 1NMEA 4IDGA 4PEVA 4HDKA 1TYZA 3O4IA 4M2LA 2F8TA 5C31A 3RSZA 3ANMA 4HXYA 1OH8A 4GE3A 2W00A 4BL5A 4WBNB 4OP3A 1Y8CA 4YAOA 3V2UA 4FB4A 2CXOA 3K92A 3TDMA 3L6UA 3U60B 3ZQJA 3M82A 3SIRA 4BO6A 5DV9A 1H2BA 4OPMA 3ZGNA 5A2QA 5C1PA 4ZI2A 5HIJA 4QDZA 3ZQ4A 4YCJA 4J7XA 3SFZA 5C5CA 5BR7A 1YR3A 4FFDA 1XCGB 2J9GA 3O1LA 1EGHA 2Y66A 1UFKA 3H5IA 2IS6A 3D4LA 3KBBA 4OQ4A 1Q0RA 4IMJB 1VIMA 2HJVA 4AK9A 1SOMA 2G4LA 1GZHB 3C16C 2D0IA 1H2FA 4G3XA 4KGXA 4KAJA 3LRPA 4Q03A 2ODBA 4K28A 2CLDX 1Y5LA 1P61B 2G6BA 2IL1A 2UXBB 4EL5A 1L4BA 2XIQA 4FBGA 1C4WA 4HUQA 1XPUA 1VKRA 1LBQA 2YV5A 4GP7A 2ZRGA 3NC4A 2C92A 3C43A 5L95A 2ZFUA 3QTLA 4R1QA 4RCZA 1EEHA 1Y4UA 1HQDA 2HLDA 3BH0A 3GT3A 1G6Q1 3QPBA 5TQ0B 1GGEA 4MA5A 3C98A 4X91A 4ZVKA 4B85A 1EZ4A 3AO0B 4YXWA 3TSCA 3DEAA 3VPDA 1MGOA 1O03A 1QLJA 2HPVA 2L18A 2WSIA 2PCJA 3M3HA 2JJ2D 4ZXPA 3V1LA 3ASYA 2R3SA 5GPBA 1VL1A 4DY4A 3F6YA 2H4WA 5J1TB 3EXAA 1E61A 2FEMA 3C3CA 2NUAB 3S4YA 4A23A 4HLQB 2JEZA 2O5RA 3OQHA 4LYJA 1KPIA 1E9VA 1U3TA 3D8HA 1J20A 1Y3HA 1JR3D 4LHYA 2R1TB 4M9SA 1T1SA 1WUIS 1PJ3A 1VLMA 2NTVA 3AFOA 1L4KA 3CB4A 2JA2A 1GZUA 3TYXA 4A8JB 2W2KB 5HRAA 5LL6P 4N6OA 3NCHA 3U4GA 1NP6A 2ZJ7A 2GN8A 4PHFA 4PX9A 1P62B 3FJ1A 4GKVA 1BW9A 3I76A 4BQQA 1KKLA 3VMMA 4QYMA 4FD3A 3LXMA 1LS6A 4CLHA 5EIXA 5KSOA 1RI5A 4HQOA 1PDWA 4HDQB 4HRAA 5A4DA 5HK9A 4PY2A 1TADA 5A4JA 1TB4A 4LOKA 1GNSA 2A52A 1BFUA 2F3RA 2RIRA 3FUXA 4ZODA 3ZXYA 5AW1A 2GAJA 5M2QA 2XTJA 3Q5DA 3BXOA 1G41A 3RUFA 2PZKA 3N58A 1XK6A 2VP6A 4X3PA 4LW8A 4BE9A 4LMPA 1Z0IA 3RT9A 4HF7A 3TUZC 3F4KA 1XZLA 1ZMTA 4KWCA 4QOEA 1H3FA 4GOKA 1N3LA 5C51B 1Z0SA 4OMUA 2X5NA 2YVQA 4M6WB 2Z2JA 4RS3A 1UBMS 3LZCA 5IM5A 3TFOA 1XVTA 2OK8A 3AJDA 4IDDA 4B34A 5KWIA 3LLCA 1KI6B 4JJ7A 1U7HA 2YY5A 2H3EA 1EVLA 3B12A 4UMEA 1LDEA 4A2CA 2FP4A 1RQ2A 1YMQA 1W4AA 1XNHA 1ZH2A 1LPBB 4DDUA 1K0UA 3FNFA 5CXXA 3DFIA 2XQFA 1X7ZA 2VR1A 4A1OA 5G4LA 1OB2A 3I30X 1CUAA 4DG5A 2Q5FA 2XWQA 3EXHA 5CG1A 4UQLA 5KX5A 1IMJA 3RGGA 4A6PA 4ZOCA 3CW8X 4AUNA 1SCJA 1NF8A 2J4CA 3AR6A 1THMA 1C9MA 2FUG1 2OCBA 2XOEA 3EDRA 1GAQA 2BN4A 3UAXA 2UYGA 2FN8A 3F9IA 2XCLA 1U28A 1RJEA 3QVUA 4OAOA 1A5BB 5LB2A 4XASA 3PPYA 3S55A 1R5JA 3P9RA 1AKYA 4NRDA 3W5CA 4CMIB 2VL7A 3HTXA 1G2QA 1XRQA 3A9CA 1RRFA 1OCEA 2QV0A 3QQPA 4G81A 2DM6A 2Q45A 3HB7A 5C81A 3GT4A 3UM9A 2RGBA 1R4AA 2ANBA 3FBGA 1LRJA 4Q7KA 1W44A 3PQ2A 4TVKA 3C41J 3COYA 5FA8A 3DDZX 4BVGA 2YFHA 3GCGA 2PE5A 5A9SA 1AXRA 1DINA 1VLJA 3D3KA 3PXEA 3F5DA 5FEUA 3LSTA 2WWFA 4Z9XA 2J41A 4AY5A 4BTVA 3OZCA 1G60A 1J2JA 2RAFA 2ZYIA 4B4DA 3DHEA 2HHHB 4JGGA 5B3AA 3D59A 1N5LA 2A84A 1ELOA 1K63A 3Q1LA 4AZ0A 1PO7A 2A8YA 1NN1A 2VAXA 4UM9D 4D0GA 1NG9A 1G8PA 2IWRA 3IDZA 3E8XA 4RMIA 4MS3B 5LOVA 2H5IA 1FDVA 1PYOA 1UJ6A 3SZ3A 1P2FA 3GNLA 2ZIWB 4RX1A 2J5KA 3PA6A 1WZCA 2OCGA 1FX0B 1M83A 1WCIA 3JQCA 1G3IA 3GGCA 1SA0B 3HDGA 1LX7A 3BQ9A 1IPFA 2GBCA 2OZPA 3I1YA 2BZGA 1DJOA 1P4HA 1C8VB 2CD7A 2X5XA 3VBEA 5EKXA 4A3SA 1F1JA 1ODCA 3N2YA 4GPAA 2UUAB 4TSRA 1EFVB 2DC1A 1H4SA 4PZYA 2GA9A 4Q82A 3IMCA 4HKTA 1FDOA 3SSOA 3IV6A 5E7MA 4TT3A 1TT5B 1L5WA 1FYWA 2PKEA 4CM9D 1CQWA 3LVRE 4ND7A 3C7KA 4HJRA 4E08A 3D4BA 4L0MA 4NCKA 3UB4A 1PJ2A 3AFHA 1I6MA 1WY7A 3VNBA 1WMFA 4Y2UA 1KSJA 2AJTA 2JGEA 2VT6A 4RIGA 4TYYA 1O6CA 1OASA 2C1EA 4JIGA 4UVEA 3LCCA 2CJPA 1LKZA 3O4FA 1A1SA 2BP7B 4W1PA 2AK3A 1SQSA 4ZEXA 5LBUA 1HYQA 4Q02A 3C87A 4HVLA 3ELDA 3EXEB 3ELBA 2B61A 3KJQA 4OMCA 2YHSA 3D4IA 4K86A 1ISFA 1A8UA 3UB2A 1SVSA 3X2SA 3REOA 1QC5A 5CBKA 3E1SA 5ERXA 2ES4A 4LRYA 2P35A 2AR7A 2NM0A 2O3TA 3B8EA 1GQSA 3DJFA 1B74A 1MV8A 2P9YA 2WD7A 1RYBA 1C8BA 3SQDA 4NG5A 4M83A 5DKFA 4ZQFA 1QG4A 4EX7A 3EWSA 1RQRA 2A9FA 5KKAA 3D7NA 4KFUA 4FJ1A 4ZKDA 3GCZA 1DG1G 1PJLA 3EB9A 1F2UA 2NLOA 3TQSA 4MCIA 3U7EB 1CR1A 4PHGA 1KP3A 3JAMA 2DFPA 4R9NA 1X2BA 3L7BA 3R4CA 5CH8A 5BN3B 3ZZ0A 1GAXA 1GFWA 1ZJJA 1Q0LA 3VRHA 1S2GA 2XHZA 2ZIEA 1CYDA 1TVCA 5FUQA 4NECA 3JRNA 4IXWA 1YFZA 1D2EA 2FVXA 5HKOA 2OXFA 2VNKA 4G67A 1OBFO 4C30A 1RJDA 1G8KA 1C81A 1KDPA 1E32A 1ORWA 2XVAA 3AJAA 3NC0C 4YT5A 5IW8A 2IHZA 4BC1A 2XH8A 2I6GA 5LNK1 4NS4A 3ONNA 1O0SA 4FE4A 2VQDA 1GUAA 3GHHA 1PTJA 1N5KA 1W4LA 2AJDA 2E4VA 2VDWA 2Q62A 3FRHA 3ZLBA 4PQEA 1PYGA 3UENA 3SAJA 2HJHA 3O21A 3IQEA 4PGMA 1U2QA 2A0KA 2QRLA 4KQIA 4ENTA 2VHWA 5BSEA 1SG0A 3ZZUA 2AUMA 2F1IA 3JQDA 4NYIQ 1CLEA 5SYNA 1R37A 1UQRA 1N7HA 1EP2B 1QTRA 3TE7A 5DISB 4CV2A 1SQ0A 3AY6A 1BEZA 2A30A 4KEAA 5TEWA 3CUEF 4EMBA 3Q8LA 2BFMA 2XWBF 3EWAA 3F74A 3ND8A 5GJBA 4YAGA 2ACKA 3I12A 1T3GA 2VP2A 4BMZA 3EMBA 4CKWB 3DL7A 4IXNA 4MKXA 5BN1A 2GZDA 5DLYA 3O4GA 4H7KA 3P0EA 5CB4B 3CG0A 3UAGA 3RTEA 3UWDA 4BO7A 3NIDB 2JFXA 4MPRA 4E1VA 4LE1A 4E6EA 4TKMA 3A4TA 2NYUA 3G68A 4XGKA 5SZHB 3B85A 3BMCB 2JL1A 2X4DA 1ZIDA 4IDQA 4LF5B 4A7PA 2CEAA 2J9ZB 3UMSA 4YC7A 1YB4A 2R6ZA 4DA6A 4BQSA 2CVPA 3B1VA 5DYTA 3SXJA 3QI2A 4E2XA 1ZR2A 2J3LA 4I1IA 1C9JA 1JAYA 3ETHA 4PLGA 2B1GA 2EGUA 3U1BA 1L4UA 1LNSA 4TXMA 1L8LA 4KH0A 4B3BA 3FSGA 1MQ8B 3ITKA 3DPSA 1BHJA 2IDZA 2BDUA 3FNHA 2VC2B 5KOYA 2FZLA 4ZPJA 1KC3A 2JGMA 2YASA 2OTCA 3B7PA 4Z5XA 5HQ3B 2HHJA 4C4AA 1HR0B 1WTCA 3I2JA 4BNNA 3IJRA 5H3CA 3GVXA 4JXXA 1QQ5A 5AW8A 4UARA 1WF3A 3U61B 3EGXA 3ZHXA 4IWYA 4AL4A 1E79A 1WQ4A 4R8LA 3WK4A 3DA8A 1ZD5A 3EVNA 3G1WA 3DEYX 3U26A 3W6UA 1RKVA 1GZ7A 3IMKA 2G5CA 3H9UA 3RFXA 2FDCA 5A9RA 4J16C 4UREA 3EZYA 2FUEA 1M1YA 2VSXA 5A3SA 2FVYA 2ZYUX 3QLVA 4FDLA 4WESB 5E4YA 3QJGA 3RHSA 3QOFA 2A35A 3IT1A 2LP4Y 4Q3OA 3FMOB 5DOVA 1VKNA 4AUEA 4BNDB 1J70A 1R9MA 2I55A 4HFMA 1GFZA 1I3MA 2Q2OA 1OV6A 3C3JA 3QVJA 4UW9A 3C39A 1RSZA 3ANTA 2GAIA 4QAQA 3DC2A 4JLOA 4RYLA 2B99A 4BBZA 3OQVA 1W88B 4ZDIA 2ZIAA 5TMBA 1N34B 1P0QA 1P1KA 5JNRA 1ZZEA 2C0CA 2ZJ6A 4GI2A 1W1IA 5E95A 4F3NA 2QJFA 5AW4A 3L1KA 3VR6A 5K0CA 2QTMA 3VYRB 2FUG6 3CBQA 3BGWA 4IV8A 1RM0A 2IUYA 5SICE 2P3QA 3M6XA 3I2FA 1K9SA 5B30A 1YHZA 4IEEA 4OCZA 1PZNA 3R9XA 4M7WA 4KBYA 5FBZA 1ODTC 1EYZA 1S2OA 1RI3A 2R8RA 1ZONA 4O1HA 2EJTA 2X41A 1F6WA 3IP7A 3OX3A 1FCJA 2OCAA 1NAIA 3T5CA 3IILA 5A1JA 4KDCA 1YJXA 2PXXA 5ULLA 3TQTA 2HBRA 2PXCA 5AOCA 1NSYA 2A0YA 2PIDA 1XWIA 3IPXA 1QGDA 3CR8A 3PDJA 4RFVA 4R2XA 3UCEA 3NUZA 2H9YA 3ZYZA 5A71A 4FFMA 3KM0A 4X85A 5ER6A 4BFXA 5FH9A 3KKKA 3EPPA 4R81A 1SBZA 3W7AA 3BZWA 3G6KA 3AKZA 5AICA 3SK0A 1ZEJA 3ISJA 1M0WA 1EGQA 4J0IA 1ZK2A 3PHBE 4V03A 1FLAA 5ALKA 2LR0A 5D5PA 4DCVA 3MBOA 3G2PA 3H87A 4HAXA 5EL0A 3EEIA 3ESCA 4MYCA 4A4DA 4A82A 2BE7A 1IQRA 1TEHA 1HTTA 2HWXA 3JYLA 3UV7A 2O3QA 1H22A 1LRLA 2ZRIA 3EFHA 3N5KA 4WXHA 1SUBA 1Z6PA 4A2WA 5HJ7A 3DKRA 1ZFNA 4XVHA 2D1SA 1ESCA 3L8YA 1W75A 3OJOA 2BFDB 2UZIR 4FIZA 4G5SA 1KNXA 4IIYA 3OFKA 3VJMA 5BV7A 5CGZA 5HUJA 3TEMA 2GTHA 1EDEA 2AG0A 2PKQP 3K9CA 4BFTA 3P9IA 1IZ0A 3H3XA 4TOIA 1I1OA 2P79A 3JARA 4FFBB 3AYZB 4G2NA 4PG6A 3QVWA 4KWIA 4QU8A 5CLIA 2CV0A 3MFQA 4MV9A 1C1YA 4PZUA 3TDNA 4A10A 4YRPA 4JXKA 4P0TA 3ULKA 5BRAA 1B8OA 4YECA 4EO4A 1P1FA 1GRCA 4HB4A 3V8NA 3I5MA 3MW8A 3R0QA 4G84A 2VJDA 4P5PA 5ALFA 1WMEA 1QHYA 3ESBA 3SMVA 1HT0A 1YULA 2PWPA 2RHOA 2YN4A 4PONA 2H4YA 4JHXA 1O95D 1PVVA 2GX6A 3Q3EA 1K68A 4WK6A 2YW9A 1VLLA 2AR0A 1KH1A 2Y05A 4CLOA 4BECA 1HI9A 2CFOA 4RAQA 1RVDA 2OL4A 1BQ3A 5DM60 1ORIA 1E4EB 2J3MA 2DKOA 3B3GA 3GDOA 1RPNA 3MTBA 4C6SA 1X9HA 2GWHA 4Q3AA 2F8MA 4B3FX 2WKPA 2JJ8A 3RIGA 4G9GA 4GOXA 5DGCA 4ACAA 4DLSA 1AKNA 1O8CA 1U8AA 1TKRA 1XEWX 2I3AA 3KSUA 3OIDA 4PO3X 4XUGB 5FLYA 5GP1A 4ATNA 4EMUA 3ACCA 1ISSA 1B14A 1WV0A 3NKFA 3I01A 2V5VA 4FHDA 3PQ4A 4G0MA 4Y2HA 1VHTA 2RGWA 3G02A 3RSOA 4BB0A 5D6NA 1Z5OA 4BAUA 1USWA 1JDJA 2Q4TA 4D81A 5M29A 1EXVA 1WCXA 5BSUA 1G19A 3E5RA 4FGSA 4CMGA 3NT5A 1YC2A 4JVNA 3U09A 3ADOA 4ME6A 2FF7A 2N42A 3WIDA 1ZJWA 4XQ9A 4I0WB 3WIUA 3ZE7A 4RKRA 4M0DA 2FR8C 3ZE9A 5IBRA 2W4MA 3BSFA 2OENG 2PX5A 1VZ3A 5JWOA 1HQCA 4TTRA 3WLJA 3GGOA 3K0KA 4UCQA 2IF0A 5FNVA 1T4GA 2O8EB 4TWAA 1K6JA 2W6JD 4RESA 3C6MA 1KC1A 3IMEA 1S8AA 5BSMA 2MINB 4FYWA 5D01A 4ZVTA 3V46A 1ONPA 4ZAYA 3ZHVA 4O4JF 3EX7C 4EF5A 5TRTA 1CK4A 3IQHX 1GT6A 1WUTA 2QRUA 4KYVA 4L8WB 1ZGAA 2ZE5A 5T3YA 4CM5A 5C8DA 2VJBA 3HY3A 3KWLA 3A05A 3TR6A 1AXEA 4K6OA 3A1CA 4ZZ0A 1NVUQ 3THOA 2IBTA 1Z33A 1ZN2A 2JI4A 2V0CA 1UPBA 1B73A 4ZAVA 1SH7A 5D51S 3K6JA 3TGWA 2PUHA 1M72A 4KPGA 3U3ZA 3AHIA 1Z22A 3IAS1 1P44A 4C6TB 8MHTA 4EM6A 3H3FA 4DZZA 1EQAA 1RYDA 3O8LA 3VHLB 3T99A 3I5UA 2IQ5A 1S3SA 2I87A 1IK4A 1ZN9A 2WUGA 1T8RA 3ZGYA 4MJXA 3IESA 3AGPA 4G5FA 4HK4A 3RVDA 3OCYA 5EHQA 1A8QA 3E9YA 5I9SA 5HUQA 3FVRA 4UAVA 1F8GA 1Y6ZA 2P8JA 5DN6D 1NNI1 3COVA 1NNSA 5EZSA 4CQLA 2JFNA 4F11A 5G0UA 5IAGA 3KTFA 4PZLA 1XUOA 4KBFA 2KPOA 4FTWA 4JI0B 2EEPA 1J8FA 1GAEO 1B2LA 2KW5A 3FETA 3TD2A 1QBKC 3UA3A 4CDMA 3TGLA 1A0OA 8GPBA 1RQPA 1FYVA 3WADA 4EJ2A 3DEJA 2D5IA 4M0KA 3WXMA 1N6OA 1T8PA 1MEEA 4C3ZA 1UCFA 4Q9LA 4P80A 2PRZA 5F98A 1JQKA 2DQKA 2N1BA 1YBMA 1K5DA 2GUGA 3PNOA 5BXYA 1UK7A 3QVLA 2DHQA 1FFHA 4R7GA 3WWDA 4EBBA 1B93A 3ITEA 1AQJA 2RHWA 2CCKA 8ABPA 4XR4A 1ARZA 1ACMA 1I4TD 2E2WA 2AMVA 2OO3A 4LF7B 1A4IA 1UK8A 3MB8A 1FBTA 2QBYA 3GLIA 2OZEA 4OL0A 4BNUA 5P21A 3OF2A 3DVSX 4R98A 3TVTA 2E0IA 5I7UA 4N5IX 1Z36A 3KTOA 3QFTA 4IHKA 2IEZA 3BULA 4JQYA 3AP2A 2MSWA 4OYYA 3K0SA 2ZAOA 1CF4A 3TSAA 3CEJA 4UU0A 4HPJB 4ZV9A 2IGBA 4P93A 4U0JA 4DL9A 2YWHA 3ETCA 3KQOA 4MV6A 5BYKA 1NQVA 2H9IA 5J4KA 4CTNA 1X8LA 3VU1A 2OVBA 2RFLA 3GAAA 3MCAA 3MERA 3A6HA 2BMWA 1J06A 2C1ZA 3OWOA 4Y30A 4IDAA 5EKDA 3SZOA 3VAAA 1K3TA 4ETNA 1KI1A 4YRBA 3MLBA 4LQCA 3CRNA 5HF6A 4AKGA 4NMXB 1JFFA 3ZLVA 3E7WA 4RK0A 5BW8A 2EJBA 4ZAZA 4INJA 5F9HA 1JU3A 3DHVA 3PUYA 4ZANA 1LJ8A 2FXVA 3L6EA 3JD4A 5KVSA 3AWIA 1DBRA 1X42A 2EOAA 3RDPA 4IVPA 2HA4A 2XVXA 3TJMA 3HB5X 4NNPA 2FFRA 2MR6A 4PV7A 4W8GA 4RETA 2R79A 2Y0EA 4G8DA 3EGCA 2ZTHA 4XYGA 4EITA 1H6BA 4LF9B 4QGAA 3H11B 3P2MA 5JCPA 3OWHA 5HF5A 1TJ3A 2ZQ5A 4MUMA 4KNVA 3R5JA 4NHEA 4NU8X 3U4AA 1AD2A 2J30A 2ZBRA 4QOFA 5LP6C 2Y0PA 4V0NA 2B3TA 4B4KA 2CMDA 3ITDA 4OHWA 4GM0A 1QANA 3CLUC 2L2QA 2QMHA 3EMDA 4OOEA 4FYMA 2PKYX 2WYVA 1DKUA 1NULA 2JDID 4P3OA 1RXSA 1WNFA 5LQNA 3W2GA 3G5AA 3H19A 1ZR4A 3BRQA 1ECPA 1NW8A 1XAIA 1RAAA 1WULS 4TROA 4D80A 5KX5B 5DASA 4TL8A 1BHQ1 2GETA 1OFTA 1MNAA 1TT7A 3CA8A 3KOWA 4NAUA 3RVSA 1YU9A 4LWQA 1TTPB 2PLNA 1LC0A 4BHTA 1QYCA 4DCJA 4EG3A 4IGFA 4RGYA 3M3DA 1OI7A 3T1TA 5LXTF 3EHDA 2UV8A 3ZD8A 1Y37A 3QWHA 1TYEB 1U8XX 1TI7A 1L1FA 2HCRA 2QVGA 1DWPA 1M6HA 2CFIA 1TXGA 3CX7A 5TC4A 6REQA 3MJ4A 1MOPA 4R1TA 4BDSA 1NP3A 2ZVJA 2FXIA 4RPIA 5K3DA 3WK7A 2A4KA 4PTZA 1KJYA 2WZCA 1NRIA 4C2BA 2EKLA 1KZGB 5KINB 2YWJA 1S2DA 3AU8A 4GAEA 1N2BA 2A5FA 1D09A 1IDOA 2IPAB 5KSYA 4JL8A 2G88A 1X1QA 4WBNA 1VPEA 5IFLA 5B36A 2FR8A 3MWLA 1OIWA 4M88A 3R7BA 4MW0A 3PHHA 5EXSA 2H0AA 4QYTA 3RVBA 5BP7A 4OM8A 3OX2A 3L0ZA 2XUQA 4NYMR 1CNFA 4DV0B 2NACA 5ALTA 4XSVA 4OHCA 3IS3A 4ERNA 1OI2A 3QBJA 1SU7A 3EE6A 3PX2A 1D6SA 3EVGA 1ZCAA 1TUEA 3BEDA 2VH2A 1TQ2A 4XVUA 4L0CA 4QXRA 1CF2O 1Z74A 2HIHA 1U7UA 1P2TA 3F3YA 4G63A 1SN7A 4Y6LA 4ZEWA 1XPOA 3PJEA 3NYRA 4PBSA 1EHCA 2WIDA 4L78A 4ID3A 4ZMBA 4EG6A 2V6FA 1W73A 3PQDA 2GN0A 2HI0A 3WBKA 3ZXXA 3ZWNA 2W2LD 2X9VA 1S2LA 4JT9A 1NLYA 4F3TA 2JD0A 4H27A 2XQKA 3ZHBA 4EI8A 1ZD3A 2CKDA 1T5LA 5E9WA 5IT5A 1ZCJA 4QUGA 2ZYSA 1JT2A 2XMZA 1OH5A 4MTCA 3MGCA 4FGWA 2D4HA 2HT6A 5FWAA 3UGQA 2PX4A 4MVJG 3RNLA 5KNCH 1CHNA 2IJGX 1DTWB 1NMXA 1L4GA 1E1MA 1Q3KA 1UC8A 2PL5A 4IIHA 4RK6A 2Q9BA 3C8DA 1IVSA 4CEHA 1QFZA 3HBLA 1KAMA 2V4MA 1Y9ZA 4CM4A 3D0RA 1AN0A 4L0DA 4TWBA 3I62A 2YIMA 3NMUF 1L8XA 1V1JA 1XJ5A 3P26A 1KEZA 1P6QA 3JASB 5AW5A 3TFWA 4CW7A 1T29A 5IX8A 1XNGA 4MYHA 3HWSA 3JYQA 2NTNA 3G88A 2PYIA 3CYFA 3K53A 1E1KA 1WBJB 4G0NA 3G89A 4EQ6B 3ETGA 1OBOA 1VG0B 4KSCA 1L5OA 1NG1A 3E2MA 5L3ZA 5FPQA 1FW6A 3IXQA 3PWKA 4RQUA 4ASUD 2R1TA 4OHBA 5CD9A 4HR7A 2IXGA 2JLQA 1ZIYA 3KKQA 3F49S 2VK8A 5F1OA 1HE3A 1JJ7A 2W2KA 4A8JA 1C3EA 4YCLA 2GBLA 2RH8A 5DYWA 1ZVVA 2C9CA 4YONB 5DBHX 1J56A 4BVEA 3WO1A 3N0XA 3PGXA 4ARZB 2DRIA 1Y42X 4JI7B 2CJXA 1VHJA 1RWXA 4EHNA 2GKSA 4KSBA 2QD3A 2ZATA 4EW1A 5K0JA 2PZFA 1OJ7A 2EF0A 1GNQA 4JXJA 3NALA 2NNLD 4O2BB 2Y6UA 1NVTA 1FTQA 2GPTA 4M53A 3BK7A 3VNVA 3HA3A 4IJ6A 4WKBA 5GMOA 4DCOA 4UZSA 2E5WA 2OBNA 4BNKA 3LP8A 2ZSKA 2A50A 3JQAB 2SNIE 5C32A 4RA9B 2BMDA 3V9AA 1KJ9A 4JB0A 3GEEA 3ZKAA 4QUKA 1HH4A 4IV0A 1NU6A 2ZGVA 2D3TA 4M6WA 4C0JA 4ZJZA 3WKEA 1FFGA 2D0OB 3URKA 3WLEA 4UFNA 1RHJA 1KI6A 2ZQYA 1KFCB 1XDBA 1COWA 2NXWA 3PKZA 3WQHA 4B3MB 4GX1A 4GXRA 5T3UA 2ODPA 3ADKA 5BUSA 2B8WA 4ITVA 3NHJA 5LD2B 2WG1A 2PGXA 2FSHA 4DIUA 1BKSB 1OWMA 3GAMA 3OEYA 1PL7A 4JZKA 2EP5A 1Q22A 1YRBA 2F1OA 2JJ1D 4KBGA 2IW3A 3M6MD 4Q3DA 4BPBA 1D1QA 1Q20A 2BR3A 4BLRA 2HF2A 4LWZA 2GHTA 1MG5A 1NVWQ 4DXHA 2CUKA 1K08A 3L1HA 4X64B 1UADA 2FQ1A 4P3NA 4NTZA 1KJJA 3PHGA 2RB5A 2BM9A 2VRCA 4JBIA 1NQAO 4CT4B 5CT6A 1TCVA 3LK6A 4RGQA 4F85A 3V7YA 2HNBA 4FBMA 4YR7A 1X38A 4E4RA 1TTQB 2VPPA 1XZPA 5CNKA 4MVXA 3SCZA 2I71A 5AJWA 4N4AA 4CMIA 4U63A 4QWMA 3LY8A 5T6MA 1L7BA 5IJWA 4LE0A 1T9DA 1ZXLA 2A0UA 3R2JA 4LI3X 2AFVA 5JS1A 2G76A 2VQ6A 1XF9A 2F3UA 3Q3GE 1QCYA 1XDUA 1BWPA 2KWIA 2XE8A 1ZD9A 4PGFA 2I2BA 3R6TA 3T7SA 5K0FA 4AY6A 3MS7A 2HV8A 3P9PA 1M8GA 4FFNA 1G18A 3T7JA 5JH7B 2KBEA 4B3DA 1RMQA 3FVVA 4OHXA 4KUEA 2DLDA 3BL8A 3OQPA 1FUKA 5M3BA 3MILA 1U9ZA 2JI7A 4QGFA 3EOBI 5IARA 2ZIVB 3T0GA 4B7AA 2GPJA 2ZW9A 3O31A 1XDZA 1UBTS 1CR6A 4G0ZA 2J8ZA 3IBCA 4DR3B 3ONFA 2IELA 4Q7LA 4MS3A 4PPFA 3UO8B 2BY4A 1UEXC 2IPNA 2P9QA 2P6UA 1LK5A 2W0MA 5BT8A 3C6XA 3KXDA 3LPNA 5EQDA 1JLRA 1FX0A 1WVIA 2BMAA 1X70A 1T0IA 2IXBA 4OSEA 3W8NA 5KHLB 3K1JA 2O0LA 1RLIA 3BWXA 1JS1X 1E3TA 1SA0A 2RGCA 4MDYA 3V4VB 1Y3AA 5LZ9A 1N5RA 3SSAA 3V4OA 1N5JA 2SHKA 3LI2A 2NP6A 3JZFA 5THQA 1L3IA 2Q9UA 1EFVA 1IIBA 3M1AA 4DGQA 1HZZC 4RY8A 3QZUA 3ONVA 4JK3A 4QBHA 2HA3A 2PUWA 1RHUA 5FWYB 2JIOA 4OHYA 1H9BA 3OBIA 3PTLA 1WETA 4IH1A 5EUMA 1TT5A 3TXYA 3FPSA 5FTNA 4GLFA 4EGCB 1PJ4A 4IR7A 2Q1YA 3TQCA 2AK2A 1H2HA 3OKFA 3AVWA 4GW3A 2X0NA 1RPJA 3IKLA 2NP7A 2CN1A 2VS1A 3P2JA 4R2IA 1JJVA 2OD9A 3OPYB 1GPUA 4J7UA 4KR0A 3E9CA 2H9AA 1MO4A 3QU5A 3RS8A 4YAJA 3SWWA 1HEIA 4DJDC 3OHPA 2HA6A 1DS6A 2BP7A 1K2VN 4N9WA 3V2HA 4BNGA 3SZUA 3S81A 1DFHA 3DD1A 4GX5A 5KHAA 1XTBA 1GSHA 1YACA 3N39C 4H1TA 2G17A 4YT8A 3EXEA 3K5IA 3O95A 5HJ5A 2P9FA 2ZUSA 4CLRA 3ZUGA 1NNEA 3GJQA 2ZYGA 4K9MA 3VI4B 2O2XA 4ZREA 1R5OA 4HEA6 4C0WA 3ROEA 3D4OA 4FKZA 4UZFA 2V7EA 2B69A 4BNXA 4DG8A 4DRXB 2OHHA 1JYEA 1FXWA 3PCRB 4PHTA 3MT7A 5GOZA 1YR2A 3QLTA 4MJ3A 1O97C 3PDHA 4HWTA 4BKUA 1ESDA 4CFZA 4DLBA 1SB8A 4NL4H 2NPIA 1F3OA 3FUVA 2VCHA 5BN3A 2VNJA 3GK3A 3LIIA 4K6MA 3R7WA 4B3HA 3L7YA 5IZCA 4NXMB 4BQNA 4CYMA 4E2ZA 4ENPA 1HC7A 1U7PA 4ZI3A 1P72A 2G1KA 3MJSA 4W82A 4KWTA 1GGHA 2AN5A 1QS0B 2CLIB 2YXEA 1LTQA 1NRXA 3KOZA 2DWUA 2PRSA 2VXCA 1UBHS 2P6NA 4Z99A 3DMRA 3BRWA 3EH2A 4XDYA 4DYHA 1GCIA 2ZBVA 3FTQA 1MNQA 1VFNA 2OGZA 1RP1A 4EABA 4EPVA 1CY0A 4EHFA 4NZYA 3RSLA 1OIXA 1SG6A 1VSQA 3P9NA 3HR7A 1NV8A 1T1RA 3VHQA 4C4ZA 4D9NA 4ZK6A 5ALYA 4I4CA 3VVLA 3OCVA 3WGVA 3FMVA 1AM4D 3DMYA 4FB5A 4U7PB 2DULA 3DD5A 2JK0A 4FEAA 4YDHB 1A9YA 1J90A 5TX7A 1GP2A 1KY5A 2HMVA 1WZEA 1T43A 3N87A 2HMUA 3KALA 3ZWBA 4D9EA 1ZISA 3OH8A 1AZWA 1XDDA 3L4SO 1J07A 1L5NA 4QLBA 4CKWA 1HDCA 3WXBA 5KS2A 4GP9A 5CB4A 1JX6A 2G04A 4JX9A 2JHGA 2VUIB 2GMWA 4FFVA 1IN7A 3QVOA 3MRTA 4I9FA 4NMWA 4CCSA 3M5PA 2QLNA 4JP8A 1YQTA 2B2CA 2GBPA 1YDMA 3I05A 3DF9A 5BYJA 8ATCA 1TZKA 1J0CA 2AVDA 2HK6A 2P2LA 2GD2A 3BMCA 3KOYA 3TQFA 2X7XA 1A9PA 3DT8A 1Q7RA 2G7ZA 1PCXA 1ZJYA 2OLJA 3JWPA 1T8WA 2PH7A 3HCOA 3UK0A 4DYDA 3E4CA 1LV7A 3OBBA 4G9BA 2CFCA 4H4EA 2GJKA 1MO2A 3JQBC 4B4VA 1FTSA 3MVEA 4HWKA 4AROA 1XLTA 3RAJA 4JUIA 3U0BA 4CN8A 4ALMA 1QLWA 2NSDA 5HQ3A 5KNLA 1GPDG 1YI8A 2CJYA 2QPAA 2WWGA 2XUIA 3LHFA 3NDPA 4R3UC 2PSEA 5B1IA 1NUAA 5A6SB 3SS7X 4EI2A 5J4HA 2IYFA 4Y67A 1VOTA 2IQIA 2QAIA 4PVDA 3LYAA 1UK9A 3GLHB 4G65A 4H6WA 3DEFA 1LGYA 1BS9A 3NBKA 4HMQA 1X8XA 2GEKA 2SCUB 2IUUA 4AQDA 1KAOA 2Z56A 3AUJB 4C7MA 3IVRA 2I2AA 3ZPXA 5BW0B 4BFUA 3RKSA 1W4RA 1XZAA 3OAAD 3CSDA 5KWSA 4RMGA 1VIDA 2V1UA 5DF1A 2I3ZA 3RVNA 1U1FA 2GASA 2QG6A 2NSYA 1SBNE 4TLBA 5A3VA 1N9ZA 1WMAA 2XKJE 1RJ9B 3UPDA 2GF2A 1DDIA 1VRCA 3GNSA 3T1OA 1H42A 1UBSB 3ILHA 4WACA 1QM5A 1XTVA 3HWWA 1FFDA 4KQFA 4XCXA 4Y6RA 4EFLA 3M4ZA 2ERCA 4AC9A 1A9SA 3KPWA 4LHSA 5KC9A 5KNBH 4JU8A 1Q2UA 1Z37A 3WGNA 4RE5A 1K66A 3BE8A 3QM1A 4IVRA 2NUPB 3WK5A 3HBMA 1W88A 3WGTA 1KEWA 3TX6A 1CRQA 2ZDQA 3QXGA 1VPTA 3DV2A 4RJLA 3ABRB 1X0VA 1QGYA 2EXXA 5AFSA 4QPCA 3SBXA 1I94B 1QB7A 2QRZA 4OBEA 4W5NA 3BILA 5LWQA 2VPWA 2H1OA 9LDTA 5MN4A 5B7NA 1A76A 2HU7A 1M2EA 2AS0A 4RD4A 2OQVA 3DE5X 3NWJA 5CA0F 2D7CA 5LA6B 2QTNA 5C3MA 1DHRA 521PA 4OYHA 1IY9A 1J8QA 2QRMA 3K2EA 1B1AA 4RTMA 4UU8A 3G0GA 1UZNA 2QUJA 1KDOA 1R9JA 3KL2A 3GFPA 1PR3A 3WNBA 5DCYA 5IHPA 3QSYA 1BGVA 4QPDA 2I3GA 4WNCA 1JLHA 3HEAA 4JUBA 3BE5A 4I50F 2BONA 1UC4B 2DETA 2I0FA 1H1DA 3ZLJA 5HG0A 4MLZA 4C7OB 3HACA 3FRJA 2ZRMA 3BERA 4LPSA 1NKSA 4YRJA 5KVQA 1Q0PA 3OSUA 2GYWA 2O7NA 3R0JA 5IJZA 3AFGA 1GRQA 3U17A 2C7VA 3KLPX 1FRFS 1Q95A 4WVLA 3WA6A 5IG2A 1K3FA 4HGRA 3WNZA 4K9SA 5AQ1A 3N07A 1BO6A 3M6UA 1YHNA 1FQJA 5LZ5A 4LRUA 3PXDA 1GITA 3Q12A 3JPYA 2G83A 2SBTA 2JS7A 3OZDA 3IDQA 2BFDA 5EPOA 2XSZA 4DIFA 1G8YA 1YUMA 4KXVA 2OP0A 3JVUA 2JFPA 3DBRB 4M0EA 4FW8A 1OX4B 4JSYA 2O8BB 1R50A 3SQNA 3T5AA 1GKLA 5EFOA 1LD3A 2PIAA 3DR3A 2OBXA 3I5XA 2VDMB 4FFBA 4NJMB 4R1NA 2QPLA 2FAXA 1PNVA 4ZT5A 1E2EA 1TRHA 4X6XA 3NHRA 4HB3A 1PT7A 2CHGA 5JAPA 1ZM3A 1BE8A 4ED9A 1CUCA 4JP5A 4J9VA 4Y2VA 4TX1A 3IRUA 2MR5A 3K30A 4LTNA 4TYNA 4AF8A 1SXQA 3T9CA 1U6KA 2DQYA 4D44A 4ESEA 4DYVA 2PLRA 2F1RA 2GPAA 4MITA 4DJEC 4AFNA 3OIWA 4QX6A 4HWOA 5ALQA 1KSFX 2ATIA 2ZJ5A 4TUYB 3TKAA 3HJCA 1THTA 3ASUA 3LRTA 3R4VA 4R8KA 3GN2A 4KFSA 5K03A 2C2MA 1E4EA 3UJPA 3ABOB 1SU8A 1N2OA 2FJUA 2JI8A 5AVKA 2ZRQA 1GRVA 2JVIA 1VJRA 2GYUA 1V45E 1V5FA 3C1OA 4XRRA 3UHJA 2E85A 2JLWA 4TL6A 3V00A 1ODJA 5JTUA 1KMMA 1XTKA 4DW8A 1NI5A 5UKDA 1BG6A 3OLWA 2QYHA 4Z86A 3DBVO 3FFWA 3ABZA 3SJZA 1VKHA 4ZK2A 2G36A 3CFHL 1DJPA 3DFFA 2Q4DA 4WDRA 4OP1A 1RLMA 2J7PD 2DJIA 1YZ3A 2JFYA 1U3CA 2INGX 4MJLA 5LB4A 1VBKA 1F2DA 4WLUA 1V8FA 3BK1A 3DVAB 3PGKA 1TF7A 2O8EA 3HFJA 2QQ0A 4LEIA 1GL3A 1WVMA 5TGZA 5I01A 3F6CA 3ICPA 3O5AA 1JYFA 4M0PA 2MINA 3OD5A 2W43A 1PGJA 3UHOA 4OB8A 2HO5A 1EA5A 1IWBB 1PFUA 4MW1A 2JW5A 3KYDB 4JJFA 4QJ4A 2QA5A 4MUXA 4CCYB 1MB0A 4HXFB 4WGGA 3TLXA 1SCKA 5BSRA 3FLMA 4ZVSA 2ZZKA 3GPCA 2QTTA 3C4JA 5BNFA 1IN1A 3UV6A 1D5WA 3I34X 4C6TA 1HUQA 2XCIA 5DTEA 3DM5A 4N3CA 5I9NA 5HGXA 2WE8A 4Q21A 5CXQA 4LF6B 4YIHA 1LS1A 1E2GA 3BK2A 1TO2E 1YI0A 3BVPA 2J0EA 5MGNA 3NTRA 1S2MA 1KI9A 1RHRA 1Z0FA 1TIBA 4XD7D 3UANA 1MAHA 2J31A 3ORHA 1J49A 1QYWA 1RJWA 1SKMA 2CUTA 4RIIA 5J2UF 3DDOA 5GZ6A 3PSAA 4NR0A 3NG1A 2AC7A 1YJAA 3MSCA 3QXSA 3JXEA 5WRFA 1NTOA 4MW4A 4EW3A 1JFRA 5FX2A 2ZSIA 2ZB4A 4C7KA 4IJQA 1USGA 1J97A 3KKEA 2NU9A 1PEDA 1NBIA 4LBYA 5C8XA 3FDXA 1JB1A 3W6ZA 3KV3O 1RKBA 3WJAA 3X3HA 3GDGA 3KUKA 4PLYA 4IILA 5M5BA 1CLUA 2DFLA 4NMMA 2FK8A 4BZQA 1XU7A 1CP3A 3D0QA 2J3IA 1ECCA 1CERA 1RE0A 3FNGA 3QFCA 4H3HB 1S6YA 4UM8B 3W6PA 1EWTA 5DWDA 5HFJA 3P2YA 3IIIA 4UQPA 1O87A 3RQIA 4ZQCB 1SXGA 2ESRA 4PLFA 3R6DA 2XB9A 4JLWA 4JNKA 4GI5A 2YKGA 3KWMA 3LT1A 3TOSA 2C9BA 2IPLA 4IFIA 2QX7A 4N5HX 4JC4A 2Q2WA 2TYSB 2WINI 1Y81A 3MQ4A 3WDSA 4ZCMA 5LU8A 1NXTA 3ETJA 3QEJA 4GX2A 4TV8B 1DQSA 1KETA 4G1VA 1GUZA 2XKBA 3PGVA 1Z26A 4D56A 1ORDA 4J9UE 5E2BA 3D8SA 1D4ZA 3WLNA 3GUUA 2I2DA 3KT0A 1G21B 4ZQHA 3FDZB 3TRIA 2F3PA 5B3KA 1EVQA 3LZDA 5ALOA 2XT0A 4IDNA 4JLVA 5ADUS 1DMSA 4QULA 4TS4A 3NCTA 4OXKA 2WKQA 2IS2A 4X90A 3K0FB 1Z4MA 3B6KA 4E30A 5JJBA 4A0FA 1FRVA 2XVZA 1C5KA 5EPUA 4DVGA 4HAYA 7MDHA 2WQ7A 3R09A 5E3HA 1YJBA 1NV9A 2FLWA 2QUKA 3UCFA 2WF7A 4NEGA 3VNQA 2C95A 5G1PA 1QYRA 3DB1A 2O8NA 3KUUA 3A6PC 1SPBS 4XIFA 1MEOA 1XI2A 3ZQKA 4Q16A 1J25A 4Y9RA 5KVCA 4WMLA 1XZDA 3GLKA 3V34A 3R3SA 2XTMA 3BE6A 1BA3A 1ZA2A 3HRKA 4M1MA 1EJBA 3FF1A 2GHRA 4DRYA 1HOTA 4R8SA 3TDKA 5MDHA 2EFHB 1I2CA 1PAUA 3IMFA 3AK4A 1QLHA 4JVSB 1MDFA 5K0TA 3GROA 3H11A 3STWA 1SBTA 1QRTA 1OREA 2R85A 1NP7A 2XKKA 4JT2A 1KYQA 3CNLA 4U39A 3D6HA 4GT1A 4BVKA 5C8VA 2EX4A 3GWGA 4TS3A 1MAUA 4WKPA 1Z4IA 3UQZA 4IX1A 1OXVA 2IPMA 4BEJA 4CMEA 5A5DA 2ZUEA 1GY8A 2FUNB 1DG3A 3HI6A 4R1MA 2O9JA 1AS3A 5K0SA 1V6CA 3N8IA 4NBLA 3FGPA 2O2CA 4RTSA 5IULC 5B4UA 5G3ZA 3C7AA 2O54A 1PBTA 4H16A 2IX3A 1WF6A 3O03A 1QIEA 1USVA 2GGSA 3K70C 4L4ZA 4Q1BA 1G4HA 4HSEA 5BY2A 3PB3A 2P11A 3HXTA 4BAGA 4CG2A 5K45A 1JWBB 2JH8A 4PFKA 4ISCA 3FIJA 4M0LA 1CEXA 4J94A 4F6CA 5C8YB 5K01A 4F9TA 2C84A 3QY9A 2PVCA 5FTKA 2B9EA 2FEPA 3AV3A 4F4JA 5CHYA 1DPGA 4KWEA 4MINA 3W8EA 5K99A 2PS9A 2BIFA 3T38A 5LLDA 4DPLA 5C1OA 5CJPA 1U6JA 2C9YA 2B0CA 4RMJA 2A5DA 2HU2A 1NBAA 3D5QA 3L6RA 1G8SA 4TYMA 1A8PA 1UMKA 2ZBDA 3OE7D 1GL9B 4MCJA 5HNKA 3TJRA 3FY4A 1IUNA 2BCJQ 4QDUA 3G9XA 5DWVA 3RS2A 1RZ3A 4C3VA 4FOLA 2SECE 3DF7A 3VOAA 1E2UA 1L0BA 4JVLA 4R6XA 1F0YA 1XZNA 3TW6A 3VSCA 2PMBA 1GQRA 2CE7A 4YJ3B 4K9QA 3I9V6 5AOAA 5CPBA 1AS2A 4B3JA 2B83A 4Z0TA 4F4DA 4M1WA 1DB3A 4IEFB 4WCFB 4C3UA 4DM7A 2ZT6A 2EFEB 2FNAA 5LP1A 5HP4A 2OR3A 3O2JA 5JWRA 1JN0A 3PXBA 5FLEX 5B3LA 2G2SA 1KVQA 1G1MA 1V8BA 1ZQ1A 4P2BA 4OGKA 2GLTA 1CR0A 3P71T 1T2VA 4LOIA 4UPDA 5DHFA 3PBKA 4ZARA 1AUXA 3DB2A 3KHTA 4QFBA 1KFEB 1S1CA 2VG8A 2CMFA 4OHUA 1CX9B 1IHPA 1CT9A 3AHGA 4MSUA 2ZXFA 2WHPB 2OYCA 3URMA 1N8NA 2R4QA 3VSAA 3KQUA 1EP1B 1C3JA 4L4YA 1SC9A 4TLDA 5EGNA 1S3GA 5BW4A 4IFBA 3MTQA 3RG8A 1GKYA 4J0FA 4FFSA 5FA5A 4C0QC 1I7NA 3ZZ1A 2LRHA 3F5MA 2AFHB 2ZBFA 3ND7A 5FQOA 3TTUA 3B1FA 4HQLA 4RA6B 4RHFA 4JL5A 5P8WA 4J0QA 3TEJA 3VJRA 4ZRDA 3KYJB 4CZ2A 2IOFA 3JRXA 3SQOA 2HFKA 4R54A 3IERA 9GPBA 5JYCA 2A3RA 3AUXA 3PFHA 4CT5A 2Q1WA 4B31A 4UMFA 3KKMA 3ZS9A 4H35A 5JS8A 3HP4A 3JASA 3KVVA 1WP4A 4MHTA 4GLBA 2D00A 1M6WA 3G17A 4JSTA 3U62A 3OQMA 4EQ6A 4ZI5A 3H8JA 3CVVA 1W4BA 3LBAA 3FFBA 3WP0A 2H4JA 4L07A 4MQLA 3P4XA 3WGIA 2VOEA 2COUA 2PJDA 4OQEA 3CXRA 5FB3A 3USES 2Y1EA 1KY2A 1PL0A 2AWNA 5IT0A 2J5XA 1T3ZA 3AKDA 4A16A 4XTRA 4CBVA 1H1LB 4N49A 1CB0A 3WRXA 3FYSA 4ARZA 2Z8ZA 3R74A 2DT8A 1UXOA 3EIOA 1EG7A 1Z0AA 4CI0B 2X0EA 2V9PA 4IYJA 5K8VA 4O2BA 3WO0A 3QPCA 1YQDA 4I66A 2YVUA 3T4XA 3TNFA 3W5UA 1A98A 3A2KA 2LCIA 2PJRA 4RA9A 4FXOA 4RD6A 2D7DA 2PCLA 3KFXA 1H5QA 4TYWA 1EA7A 2GLUA 2CVOA 4HFRA 4HQKA 1GV0A 2RI1A 2YNMC 1QP4A 3MUOA 3AEQB 3NBFA 3RC9A 1L5HB 4IIXA 5A4FS 1FUIA 4ND1A 3U4HA 1MO5A 4URVR 4YT4A 3G0DA 2I5PO 4ZV7A 4QJ5A 4DV2B 4DUGD 1E2JA 1F0NA 1L6RA 3CLTD 3O92A 4R8MA 2IYXA 3WY9A 1VA5A 2W58A 3DCIA 3OTQA 4QG3A 1GIAA 2F48A 4EAQA 4NESA 1MF7A 4ZQEA 3QVTA 3SGLA 3HL6A 5BV1A 4ZTZB 1C1HA 3TLMA 4BMYA 5ILOA 5HFAA 4MW2A 3W3AA 4JYPA 1M1YE 3KAJA 3M83A 1XZHA 1JFTA 4OGLA 1GU1A 2NXNA 2IUFA 4PQYA 1NAHA 2D8AA 1G16A 3DO8A 1RWWA 5JAQA 4A9AA 3K2IA 1U1EA 4DFDA 3TN7A 1PZGA 3M1IA 3KU4A 4KQGA 4DILA 1DEKA 3A1VA 4MI6A 1XMSA 2GI4A 5ELXA 4K2HA 2E5LB 2CLHB 2WPDD 5JMPA 2E49A 2CNLA 2N46A 2ADMA 3M4NA 3NDRA 4KVFA 3ACDA 2Y27A 3HJBA 3RF6A 1HM5A 5L7YA 5ABPA 4IS3A 4UUOA 1NJ8A 4CR6A 4R8VA 1Z63A 5JH7A 4X7RA 1IM2A 4CKCB 2GDJA 4LK3A 4URYR 2JAWA 3MJRA 3PFKA 4LJ4A 4ABYA 4D6XA 5DN6A 3WYEA 4PYJA 2Z2IA 2C3UA 1VMKA 5DTMA 5ECWA 4BNIA 4R1UA 1FTYA 2QU7A 2RHGB 1XLUA 3VZCA 1DRWA 2C2BA 3NIWA 3NAGA 2AI3A 2IIBA 3SHWA 1YE3A 2R7MA 3W04A 4D9JA 4EQZA 4DJFC 2E4AA 5DGIA 1T2EA 2W6IA 3UXYA 1KQPA 5IT9A 3EOZA 1QYVA 2FEWB 3ZY5A 4HX5A 3Q1KA 3BMNB 2XMQA 1ESEA 2GO7A 3KC2A 1J0AA 1EIZA 2QLFA 2WRZA 2D2EA 4QUEA 4JXZA 3AKCA 2BC9A 5BR1A 3IEPA 1H9AA 1JJIA 5AW0A 3JQPA 2PS3A 3BL6A 1YZHA 1IG3A 1P1HA 3AW9A 1J9GA 1QHGA 2GZMA 1FP6A 3KR1A 5FWYA 4OHMA 2VEDA 4U7TB 1AG9A 2R1VB 4LHWA 4PQFA 4QLAA 4QTXA 4C06A 5JZOA 3N8HA 1MD9A 3KQNA 3KR0A 1SBQA 3F46A 1KJZA 4NE9A 2AX4A 4YRCA 4FXPA 1ENZA 2PH1A 1B16A 2QI9F 4Y2SA 3S8MA 3DAYA 1G2IA 4YR9A 1JHUA 1SXJD 2VQEB 1Y9DA 1ETHA 2IXFA 2IYLD 3FTDA 4L74A 1NVVQ 3KIPA 3D1JA 3FKJA 2B20A 3WLMA 3OPYA 1K98A 4CPDA 1SEVA 4UTZA 3FLAA 5ILQA 3SPXA 1I0LA 4BV8A 3RUHA 2OOSA 3W1EA 3W3ZB 3DFZA 4IIBA 4I5GA 2HNKA 5B12A 1F6BA 5AW2A 1OPXA 1Z6YA 2OGWA 2RK6A 1YC5A 1SHTX 4KO8A 1E9FA 1KE1A 3KD3A 3ZK8A 3LUPA 2HK8A 4GZ5A 1HK7A 1QIMA 3T9FA 5EVJA 5TS3A 3AF4A 2FKAA 4QM6A 3FOBA 2GJ8A 2Q99A 4AB1A 4RF2A 1W5SA 3QUQA 4HWPA 9ABPA 4DRXA 4W5TA 3B1ZA 4DQKA 5FBRB 4LRTB 3LOQA 4QUIA 4S1OA 1EVJA 3BIWA 4JVOA 1U80A 1SUDA 3EAQA 2BF4A 2OZKA 4GLJA 4I8XA 1EWRA 2UAGA 4HGPA 3SY8A 4CTOA 3QE9Y 1W96A 3L7AA 4NAVA 1DCTA 2PUFA 4ZHSA 3TJZA 1AT1A 5AJYA 1ZBDA 1GXSA 3L7DA 5DK4A 2ZS9A 4MUFA 1VCMA 4ID9A 2JIQA 4JBYA 1QS0A 2QN8A 4FT4A 1IBKB 2NZVG 3G1UA 4FLEA 1SHJA 2R4TA 4ROTA 1R2QA 4L8VA 3V4FA 2XNKA 1KXZA 1M2VB 1MB3A 4ZU3A 5GM2A 4X62B 1V1MA 1JHYA 3AG5A 3N76A 3OO1A 5BWMA 4ZC1A 2CT8A 4PWYA 3DG9A 2PLFA 2AW5A 1EWKA 1SKYE 3ANYB 4P3YA 4XUEA 5KEIA 3K9GA 4BN4A 1UDRA 1HE2A 2C3PA 3AUTA 3O93A 1DAMA 4BLWA 4EUHA 4H60A 2I9PA 3VVMA 1LDGA 3N7AA 4WNAB 4NI5A 4Y1EA 2FE4A 5HF9A 3F6BX 4FMBB 4QUBA 3EZ2A 2ID4A 1K2WA 2IZZA 3FBTA 1P3DA 2P9GA 2WUWE 4RXTA 1GTZA 1NVXQ 4C01A 2HTFA 1G42A 1SZPA 2P4UA 3DKVA 4B0PA 2PD6A 1IZ8A 4UXJA 4Z4QA 1FXSA 2H08A 4B3IA 2V6BA 3HB0A 1ZNXA 4RLFA 1Q0SA 3AOEA 4QO8A 2W8BB 4MV1A 5HGJA 4Y0VA 2IWHA 4D1YA 1MX1A 4D7AA 4HAIA 2AOVA 4OX9B 4LXGA 3MLEA 2VHTA 2HQBA 4I9HA 4QFDA 3S2FA 3SZRA 4ZHQB 4BZXA 4UBJA 3LNTA 4NEQA 1CC1S 1T24A 3P45A 4YP5A 2DBZA 2ZJ0A 2PO7A 1XLWA 2WU4A 2YNMA 1EE1A 1QIHA 3SC2B 1INLA 3L7KA 3BXHA 4D92A 1J4AA 2JHPA 4B40A 1Z3IX 2DBYA 2JFGA 3GR6A 2EP7A 4N0PA 2QYTA 3HSKA 3Q2OA 2NV6A 2XUPA 1ZXXA 3NBQA 4PAWA 4HBGA 5CB6A 2XYGA 3PENA 4FZVA 4IYRA 1UXKA 2GAOA 3M6FA 4Z9FA 3L4BA 1V4BA 1YDEA 2XZLA 1RXIA 1ZJZA 3R3HA 4LHVA 1LXCA 3F3MA 1P9OA 2LW7A 3MJDA 5F1PA 5A6SA 3E3LA 3JQ8B 2C20A 2WY2D 1NVDA 3KXIA 1Y1PA 2ZYAA 4L76A 3NM5A 4RVSA 3PLAE 4RK5A 2E89A 3GLHA 4YXFA 3CPJB 121PA 2ZUFA 2Q8QA 2SCUA 3HR8A 5HE9A 4R9VA 3ZEAA 4C0LA 5L51A 3ZDBA 3ZY6A 3RVRA 1T0HB 1U8EA 3KKZA 1ZLYA 5DT9A 4CQMB 4JOSA 2R6CA 3Q5EA 5FULA 5IAEA 2QNBA 2PEYA 1UBOS 3WJ1A 1C29B 1RJ9A 4V2IA 3GLIE 1JF8A 1VE1A 3LM8A 1DAIA 3I92A 4BWYA 2RD2A 3VISA 2WFZA 3ICEA 2AFRA 5FWXB 2A1UB 1R6TA 3RIYA 5KOJB 3BJRA 4BP1A 1CS0B 2ENWA 1P80A 2NUPA 2FV8A 1CKEA 4O4HB 4PO8A 1RCUA 4D26A 3NXKA 3HM9A 3INGA 5AHRA 2FJPA 3SHQA 2DBVO 2E4XA 1HEUA 3D0KA 4C4SA 3OC6A 5JJ5A 3FUCA 1EHIA 1UKAA 3N7UA 3NEAA 4QHYA 4GOND 3T1HB 1QKIA 1KEPA 2WWVD 1HT3A 1PQUA 5HJ2A 1GM5A 3MXTA 4D02A 3BMQB 1KR5A 2CL6X 3MELA 2B5WA 3G7SA 4IAOA 2ASVA 3A6FA 1A95A 4ZCTA 1DADA 1DX4A 2VF7A 4Y6SA 2VN8A 3EZ9A 1FP2A 2JKVA 3VDRA 3GZJA 4DANA 4HYEA 5FF9A 1YZVA 3ZC3A 3UKOA 4JQOA 1SOWA 2ZRNA 3AETA 4JKIA 3U19A 1G5FA 3A2NA 2QN9A 1V6AA 1RQLA 4TS9A 3BRCA 2WIJA 1M1ZA 4RVOA 3GFSA 1TO6A 2XUJA 2RCNA 3AW8A 4L6AA 4MV3A 4UD6A 4I1SA 2G09A 3MJHA 2R48A 1KF0A 1EAMA 5DGXA 1J7KA 2VHXA 2VPQA 2HA5A 3KRTA 5ICFA 3FDFA 2ZZMA 4C7OA 5TQ2B 5JYBA 3OM1A 5DMXA 2O2ZA 3LFUA 2JIMA 3FOCA 4MRSA 5T8KA 1F4PA 5DU2A 5JQGB 3LHKA 1QCDA 3SU8A 3ZWCA 1FDRA 1G17A 1KS9A 2X8BA 3H18A 2JFQA 5E7IA 1N1MA 4EVSA 2FPXA 4DCUA 2J5BA 1QNFA 1F06A 4QG7A 1FNNA 1L9XA 1NRJB 1VJGA 1YOBA 2OHFA 2VEOA 3PI7A 4OHRA 1XL0A 4U6NA 4EGJA 3PFFA 1T25A 5JXHA 1RLTA 2D3WA 4NV3A 3RYCB 5H7XA 3MT0A 2OAGA 1BJRE 1QUFA 2PG3A 3DVQX 3BB3A 3L1UA 1NR1A 2GN2A 4PPQA 3QTTA 4U9UA 3UCXA 3AH8A 3DBRA 2PD4A 4Y2GA 1OX4A 2OCLA 1ADBA 4JT4A 4Z9AA 4ECEA 2O8BA 3TPZA 4R5MA 2Y1OA 1GSOA 3HA2A 4NJMA 4D9IA 4ZCLA 1CP2A 4YMUA 5C80A 3TQHA 2WOJA 3A0UA 2CV2A 3QWAA 5JALA 3G79A 5DGTA 2J32A 2YV4A 5ICEA 4W7SA 3T8YA 3LQYA 4BMVA 2H5EA 2V8OA 4GL4A 2EKZA 3OSZA 3DUFB 3MWGA 3WL4A 5KU1A 2V7WA 3ISTA 1WDMA 3KO8A 3KSZO 3ZWAA 4G36A 2AHRA 5EIOA 1OH6A 3KHSA 4YBZA 2D2FA 1CW2B 2R8ZA 1CUZA 1UFOA 5CYGA 2Y9MB 3VM6A 1SHUX 2W90A 2YWBA 3G1TA 4KO1S 1QQ7A 5A4KA 2WAXA 1BKDR 1XAJA 3MRSA 3IOMA 2BM8A 5I48A 5TSDA 4CKBB 4TUYA 2W42A 4CL0A 1OF1A 3RLIA 3ZTYA 3LC2O 5EESA 3VKUA 1P7VA 4Q1DA 4QA9A 1XN1A 3GYBA 4MEAA 1NLUA 2QP4A 2YY6A 3WAGA 1UDWA 2W83A 2Q41A 3HXLA 3P2EA 3VKGA 4Q12A 3TD6A 4Y2XA 1QQ6A 3ODGA 4ZYTA 3KEFA 1GAJA 4P5DA 3CZ9A 1DKQA 2X1LA 1NUUA 2R11A 3I2HA 2GN6A 4RH3A 3D8TA 3HFGA 2NQ2C 1Y34E 1OU0A 2WDPA 1KQFA 5EVCA 4F5DA 4UMVA 2EBFX 1MAAA 4YAIA 1UKCA 3DMGA 3VR4D 5DLQC 1M2JA 4ERXA 4XB2A 3PDUA 1XTSA 4OQLA 2QMQA 4R2MA 3TW8B 2XF2A 3L1VA 1Z08A 1U8CB 4FKMA 3DVAA 4D9MA 2AA3A 2VVTA 3HB1A 4MUJA 5LQMA 1PW5A 1TVEA 3E84A 3PRHA 4KO4S 5L53A 3IKVA 4H7HA 4LTDA 1K6EA 3OU7A 3A70A 1SXIA 3GCWA 2Z6VA 3EASA 1D6JA 1SO8A 3HDTA 4PXSA 2OGUA 5CITA 3LJKA 2XJ4A 3Q15C 4LXXA 4B9EA 1PWZA 2B1IA 4H7DA 2V54A 3LPMA 4GU5A 4PC2A 4QNNA 4YP1A 3RU2A 4HY3A 3I9MA 5AI4A 4CCYA 1L4MA 2NNWB 3FH0A 3H1EA 3JQFA 3IIJA 3LG2A 4H17A 1QIDA 4PQRA 1XU9A 2XYVA 4MGYR 2HLDD 3GARA 4CWAA 3HDYA 2Q3BA 3BFXA 3H5NA 5FHQA 5JMTA 5L45A 4YXWD 1LF0A 4GPIB 4FCWA 5AKGA 3WMFA 1WW3A 3OLZA 3AVYA 2FP3A 5EWLB 2R6HA 5G53C 2GFIA 3T9EA 1POXA 4BUCA 5J40A 3E8MA 5JHGB 4RHUA 3JD0A 3G59A 5AKHA 2I03A 2H29A 3B3AA 3KPJA 4EVRA 2IIPA 2XCQA 1L5RA 2B4TO 1E20A 2GPNA 5MHTA 1KU6A 1CY6A 1P1RA 2IUSA 3R0VA 5IS2A 4GFDA 1NW7A 4QDTA 4F6RB 2P9EA 4O08A 4P08A 1WBDA 3F90A 5LIRA 3COJA 4FJ0A 2VSOA 2GKOA 2AZ4A 4W9NA 1VSUA 1GLGA 3MJFA 1NT2A 1PUIA 1IEWA 2F17A 3HBAA 4Q48A 3VPFA 2AMJA 3Q98A 2FW6A 1FS4A 4ZZIA 2VHZA 5IKOA 1JTVA 2FFQA 2LE0A 1ZM7A 1N2GA 3O90A 3D2AA 1BXZA 1KH2A 5I4BA 5AI0A 3NUQA 6NULA 2NU6B 1SRQA 5BNTA 1P1CA 2GA8A 3CXUA 3GH1A 4A8HA 4EX6A 2QR2A 1N25A 4LQDA 4UNQA 3GV0A 4QYIB 4FHCA 5D5QA 4JIMA 3B9RA 2JCBA 3PIIA 3FLEA 3IP9A 4CMAA 7REQB 5HK8A 3VYSB 3VDMA 2CXXA 1VE9A 1GRRA 2EFYA 3AZPA 1CUXA 3SX4A 2R6R1 2HYDA 2QTAA 3E3NA 1DWQA 4RIEA 2N1MA 5IANA 2CVQA 4GOMD 2WSLA 1X77A 4TV8A 4HUJA 1PX0A 2RG1A 5AJUA 3L6DA 5EZQA 4B3CA 821PA 4LJ5A 1Y3CE 1P5RA 2K2QB 3HHPA 5AOVA 4NVRA 4UVGA 2Q29A 1FDTA 1G21A 2AV6A 3A8TA 3BE4A 3FDZA 1PQPA 4EP1A 5JFGA 2VSFA 2BSQA 3GZTB 4JI8B 2E9SA 2REOA 1JJAA 1VE5A 4OIFA 1W48A 4OQPA 3U3XA 4RWEA 3K0FA 5GTDA 3HJAA 3CF0A 5COQA 4EIWA 1YZTA 1I4EB 2XD4A 4UAGA 3U6KA 3RF7A 4ZQGA 3WP1B 4CM7A 2BMEA 3ST7A 3A4VA 1E0KA 3OHMA 4C89A 5JEDA 2P7HA 2OWEA 4DMKA 1HSOA 1UBKS 1UWCA 3CZRA 2ROQA 4RIFA 4FSHA 3QEBZ 3TS1A 2C58A 1RAIA 1LK0A 2XMRA 3STYA 4AYTA 3STUA 2WTEA 2BFCB 2X40A 3U4QB 4RPHA 2P7IA 2OP1A 1L4EA 3N3BC 2FKNA 4L95C 2BVNA 2R8EA 4OHFA 1ISGA 2ZT8A 1M3SA 1ZVQA 3L1JA 1TEXA 1UDCA 3O7WA 1XTQA 1P3Y1 1PSDA 3EYAA 2GXSA 3OICA 4IWXA 4P0PB 5TMEA 4B33A 4QECA 4EVIA 2POQX 2V6JA 5JRDS 2HDWA 3O8RA 4JITA 2QT0A 5AJTA 1H66A 1PR6A 2BGNA 2B82A 2G6TA 2V7BA 4I9NA 4LV8B 1KMCA 3M5CA 4PLVA 4MS4B 4RD2A 5FXMA 4FHGA 3TK1A 3ZLTA 5JRZA 1HPLA 2IHVA 5KDLA 3CZQA 3PXXA 5ECGC 5B5SA 3HJUA 4GGPA 2Y1DA 4RJKA 3P2KA 5L3QB 5JJIA 3KDSE 3HU1A 1Z62A 2RMKA 4BVLA 2ZAYA 1OGYA 3NV7A 4OKIA 3MCZA 3IUEA 1JECA 1TTHA 3CKYA 3TB6A 4B6QA 5KWJA 4TMWA 4D43A 2O0KA 4J07A 1N3IA 4QUHA 4IRUB 4G4SO 4DSUA 1YH3A 1JUDA 4YV1A 4QHTA 5KQPA 2I9KA 1Y7PA 1ZUHA 2QAGB 3EVAA 4MQUA 3IIEA 4IF6A 4U2FA 3MLAA 4CLXA 2V97A 3BPSA 2BHTA 4IFTA 5IFKA 1ZESA 1KRWA 2WIAA 3AB7A 4GL2A 2ZUUA 2EJUA 3PEWA 2MHCA 5K3EA 3O8QB 5TPWB 1XVLA 1VLVA 3BXXA 4H4CA 5DT2A 4HLUA 2IYAA 3QU2A 1H3EA 3TL6A 3MHTA 4Y2RA 1V11B 4J03A 3AM3A 1MCZA 1T1EA 2C9ZA 4N5DA 4R0MA 4AJJA 1NBMA 4AWBA 2OHJA 3M70A 3TQQA 1I1NA 3SF0A 3LY7A 2UZ4A 5IF3A 2BGMA 2CUZA 3ZDDA 4ESVA 3EPRA 3KU1A 3IUMA 4M7RA 2HPHA 3DDCA 3QHAA 2IE8A 4YA6A 5GV8A 4YJ3A 4P6VF 3ZE2B 3OLYA 3IA2A 1MRZA 4LYAA 4N03A 1I0ZA 1I3NA 2C2OA 2YHIB 1B0AA 4MYSA 2GKGA 3CI0I 2XXBA 3HV0A