3Q12A

Pantoate-beta-alanine ligase from yersinia pestis in complex with pantoate.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
285
structure length
285
Chain Sequence
b'AMLIIETLPLLRQQIRRWRQEGKRIALVPTMGNLHEGHMTLVDEAKTRADVVVVTIFVNPLQFERPDDLAHYPRTLQEDCEKLTRHGADLVFAPAAADIYPAGLEKQTYVDVPALSTILEGASRPGHFRGVSTIVSKLFNLIQPDVACFGEKDYQQLALIRKMVADMGYDINIVGVPTVRAKDGLALSSRNGYLTEEERQIAPQLSKIMWALAEKMALGERQIDALLEEAAAQLLRVGFTPDELFIRDAETLQPLTVDSQQAVILMAAWLGKARLIDNQLVDLRH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantoate--beta-alanine ligase
publication title Pantoate-beta-alanine ligase from Yersinia pestis.
rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 96
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3q12A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3q12A01
2H29A 4F3RA 1MB9A 1G59A 2HGZA 1N2IA 3RK1A 3K32A 5DEOA 3H97A 2Z08A 4RUKA 4R2MA 3TQOA 1K92A 3D6UA 1N75A 3LOQA 1R6UA 3N2YA 3TS1A 4MUEA 1IFXA 4CQNA 3SZ3A 4RPIA 2DPLA 4ZT2A 1PG0A 2DERA 3FOCA 3HZRA 4A91A 3CVUA 1K4MA 2I1LA 1MC1A 4ZT7A 1Q15A 1Q19A 1U7DA 1TQ8A 3DPIA 3MLAA 4EG6A 4MWBA 1EFVA 1U3DA 2PZBA 4GRIA 5EKDA 3ILVA 3GMIA 3SDBA 3VU8A 3CR8A 2A1UB 1R6TA 2NSYA 4YMIA 5TEVA 1TYDE 1HYBA 4I6GA 3X1JA 1GAXA 1K97A 3RBAA 4MUKA 2V0CA 3PNYA 3UY4A 1BS2A 1GLNA 4DDHA 1JHDA 2R5WA 3RFFA 1GTSA 2H2AA 3IOEA 3L93A 2CSXA 3QTTA 4EG7A 1K4KA 3SP1A 1O94D 1N2HA 4K0RA 1J70A 2HMAA 2JA2A 1KH2A 3D6VA 1KQOA 4MW2A 1YUNA 4YP5A 4MVWA 1I6LA 2A4MA 3LCJA 5TGTA 3C8ZA 1MBZA 3A04A 1XNHA 1QNFA 3GLVA 1TFUA 2E89A 4KPUA 4HJRA 4KR9A 2X1MA 4ZCSA 5JBNA 1O95D 1U7XA 4MUFA 3IOBA 3ZJTA 1WXHA 1NUPA 4OUDB 3FWKA 4MVCA 1KR2A 4MAFA 3AFHA 2VXOA 3OTWA 3IOCA 3CLUC 4MW1A 1XJQA 3G5AA 2EL7A 1M8PA 2RE8A 1TYAE 4AS1A 1FFYA 3FH0A 1WQ3A 1A8HA 2QUHA 1IRXA 1WXIA 2QUKA 3HGMA 1KP3A 4MW5A 4DDMA 1KKUA 1WZ2A 2J07A 1EFPA 1NUTA 5DK4A 1D2RA 2A1TR 1Y42X 4QREA 3IVGA 2OV4A 5IHXA 2XRZA 1V47A 4ND7A 1F4LA 1WXFA 3A05A 3ZUGA 3UMVA 4MW6A 1IH8A 4MW4A 2J4DA 4P2BA 1NP7A 3CA8A 2AZXA 3INNA 1O97D 5BNZA 4ZT3A 2D54A 4ND6A 1MOPA 1TYBE 1O0BA 2QJTA 4EG5A 4PBTA 2QTNA 1QU3A 4U63A 2QTMA 2TS1A 1VLHA 3FIUA 4ZCTA 3AKZA 3P0JA 3N05A 1DNPA 1T9GS 2A86A 3MLBA 5DASA 4ZT5A 2HZ7A 3CLRD 4JXZA 4ARIA 1J20A 4MWDA 1NSYA 2EJCA 3GUZA 4G5FA 3HV0A 5HUHA 1KH3A 1Q77A 1YIAA 4EFKA 2Z3VA 3L92A 4MULA 1NUUA 3RK0A 3VGJA 4U7JA 2RD2A 2D5BA 3N9IA 4HJXA 1KQPA 2X3FA 4DLPA 1GZUA 1XNGA 1N78A 3Q10A 1CT9A 3SEZA 2WB2A 1PFUA 1T9GR 1OWNA 1WQ4A 1H1TA 1JZSA 4FZJA 4G6ZA 4NAUA 3IDFA 4UZFA 4J75A 4PBRA 2X0KA 4I6EA 4R2LA 1T6XA 1UFVA 4S1OA 4BWVA 1ZH6A 3P0HA 1H3NA 1R6XA 1GTRA 3FHJA 5FNZA 4ZCQA 1IHOA 1N2BA 2PIDA 1LI7A 4E1AA 1QU2A 2BYTA 4NX2A 3ND6A 1KAMA 1IQ0A 1PFVA 4DDKA 3COYA 3IMCA 3MUEA 2PG3A 3SZGA 2GM3A 2A1UA 2E0IA 1N2EA 4MWCA 1GN8A 1GPMA 1MAWA 2GOYA 4WSOA 4MUHA 4Q93A 4EG1A 2PZ8A 1M1ZA 2XRYA 3UK2A 2VTBB 3AL0C 3VRHA 1J1ZA 4MQ6A 3HL4A 1O94C 4MW7A 1JECA 1N77A 3JXEA 2IP1A 1JIJA 4ZT4A 4JZYA 2WQ7A 4MW9A 1JEDA 3ND5A 3IMGA 4ZT6A 1OWMA 5TS2A 5DB4A 2DR2A 1PG2A 3HFJA 1KAQA 3ZJUA 2NZ2A 3CLTD 4JYZA 5TEWA 2A1TS 1O96A 2PXHA 1O95C 4XFJA 4L2IA 1LW7A 1T6YA 2O5RA 5H7XA 3RJZA 2CT8A 4G5YA 4DJAA 2CYAA 3K9WA 1X8XA 2IJGX 2DLCX 3M5WA 3SYTA 4NZPA 4JFAA 3ZJVA 3I05A 2QJFA 3A4IA 4YP6A 4KPUB 3QTBA 2PFSA 1JZQA 4KKVA 1JGTA 3SEQA 3ISJA 1JIIA 1EUYA 3KFLA 1M8KA 1J09A 5J5AA 1VBKA 3AIIA 1JILA 4AQ7A 3CVXA 1T6ZA 4X0EA 1J21A 4R0NA 1QTQA 3MMXA 1TEZA 2DEUA 1F9AA 1QJCA 1P7PA 1WXEA 5K0TA 3S3TA 1LI5A 3PRHA 2JANA 4WNYA 3CVYA 1IVSA 4HK4A 1MJHA 1O5TA 2J09A 3FG9A 4CDNA 1YIDA 1IQUA 5LM3A 1O97C 1N2JA 4MUJA 1ZUNA 1Q11A 2V0GA 2JAXA 4OJMX 2WSIA 1EFPB 1NZJA 3TNJA 2Z09A 1JIKA 4PY2A 2YWCA 3DLAA 4YP7A 4DE5A 3BL5A 4XFDA 5J59A 4KR6A 1O6BA 2A84A 4NDAA 1N2OA 3IVCA 1KORA 3H05A 3COZA 2YWBA 3G6KA 4GU5A 2CYBA 1G8HA 3FI0A 3CLSC 2CV0A 4CT0A 1N1DA 2QUIA 1ULHA 3QE4A 4J76A 2PZAA 1MB2A 2OQ2A 1EXDA 1YUMA 1NUQA 2CFOA 4ZCRA 1FYDA 5HG0A 1ILEA 2YXNA 3COWA 2AKEA 2J5BA 1H3FA 1M8GA 3U1VA 3X1KA 1RQGA 2QUJA 1MAUA 1M8FA 1EE1A 4ZCPA 4XSVA 1EJ2A 3PNBA 4EG4A 4MUGA 1I2DA 4EG3A 3AG6A 4H3SA 4HPWA 2QTRA 1VL2A 1OWOA 2YY5A 3KT8A 3DO8A 3X1MA 1VBMA 1X6VA 3FY4A 3FDXA 1WXGA 3IMEA 1YULA 1H3EA 1OD6A 2AG6A 1G8GA 1XNJA 3RHSA 5F23A 2QJOA 4ARCA 2ZUFA 3CVVA 3IVXA 1EFVB 3DV2A 1F7VA 3A2KA 2E21A 4Q16A 5LLTA 3FETA 1QRSA 2VTBA 3LE8A 4EG8A 1NI5A 1PFWA 2ZUEA 1U3CA 5K0SA 2E18A 4EGAA 2CUZA 5IJXA 4YBRA 4EF6A 4DNXA 4MUIA 1U0BB 3AG5A 3CLTC 1VBNA 2B7LA 5FO1A 3FNRA 3H99A 2GKSA 4F4HA 3OP1A 4UZEA 3NV7A 3KT6A 3ELBA 1KQNA 3N8HA 2A88A 3HMQA 2IELA 3NBKA 5LFAA 3ZGZA 4NATA 3MXTA 1KP2A 4PBSA 5FO0A 4MVXA 5H16A 4OUDA 3ND7A 1NUSA 3F3MA 1O96B 3Q4GA 3NBAA 5KWVA 4L2IB 2CYCA 3UOWA 4JXXA 1TYCA 4I6JA 1WKBA 4MVYA 1J1UA 4K03A 3PNVA 1OBHA 1QRTA 2BTEA 4QRDA 3TQIA 3P52A 2DETA 3COVA 1QRUA 1M83A 3CLUD 1M8JA 5HUJA 2G36A 1PFYA 1V8FA 2D13A 2O8VA 4U8HA 1F7UA 4TS1A 4MUNA 3TZEA 5J58A 3KT0A 3UC5A 5AHWA 2A7XA 2CV2A 3IODA 1MRZA 1NURA 3CLRC 2J08A 1WJGA 4CDMA 1I6KA 1S4MA 3KT3A 1NYLA 3IUBA 3H9BA 4MWEA 1SURA 1OWLA 4MW0A 3H9CA 2CV1A 1N3LA 1OWPA 1O0CA 2DXIA 2C5SA 1YI8A 3ZXSA 3ZXIA 2X1LA 1ZJWA 4MLPA 1COZA 1I6MA 3Q12A 3IUEA 1WOYA 2DUMA 1ZH0A 2ZP1A 4NAHA 5KCMA 1G8FA 3E27A 3IH5A 3TZLA 3P0IA 3ZIUA 1B6TA 1JMVA 1OBCA 1JEEA 4KR7A 1EUQA 2WQ6A 1N2GA 4QBTA 1QQTA 1WY5A 1KH1A 3PXUA 3CVWA 1IQRA 3CLSD 5KHAA 3G59A
chains in the Genus database with same CATH superfamily
1Z6ZA 3A3PA 3SC4A 4F3RA 2FI1A 2YCBA 2ZDGA 2GCNA 3DXYA 4CQLA 1PV4A 1CUIA 1WCIB 4MA4A 3BIJA 2QG6A 3GLQA 1S8FA 3WDSA 1TLTA 1E2QA 1YE5A 5IBRA 1OH6A 1JG4A 1ONOA 1VFNA 1PQPA 2JAOA 3H19A 1SM4A 3N7TA 3HSKA 4R1OA 5FWDA 5KC8A 1T1IA 2GA8A 1U2RA 4BEJA 2R6AA 1RJDA 2WWGA 1IG0A 2ONZA 1E7SA 2WHEA 2WBLC 3D7LA 3WB9A 1X3SA 4HO1X 2BMAA 2JEZA 3FCEA 2H00A 3FOCA 3L8CA 5DW3A 1TTTA 2A1IA 3JARA 4A73A 4P34A 1MT0A 2EKLA 4RKRA 2ZIWB 3GP3A 4B3SB 4YXWD 1ZHFA 2ZJ0A 4PZLA 5CT8A 2PUEA 3SHVA 2NMVA 4XCQA 2BD0A 1AS0A 4JQSA 3L82B 4XAQA 2X86A 3TI7A 3H2BA 1NR5A 1UIMA 2WJYA 1U8XX 1I1QB 2GJ8A 3ZHCA 4MWBA 3KETA 3P7MA 3PR1A 2JKZA 3LQRA 5B3JA 2PQ6A 4ZVLA 1WVIA 3JVVA 4JLBA 4QQNA 2HHLA 1AXEA 1GGEA 5HJ2A 4R0VA 3HSSA 1K3UB 4B74A 4BMOB 4BNFA 1YVPA 3S7ZA 3DLHA 1NX9A 3JV7A 4FGKA 4OATA 1XQWA 4I55F 3K8YA 3PFGA 4QNRA 4QG3A 5K5EA 4PICA 3S27A 3R3XA 2PMFA 5LZ5A 2OL4A 2V0CA 1Q14A 2VOJA 3H11B 3PKZA 1UPUA 4B7XA 3RC7A 3DE6X 3TZQA 3EDMA 3VHLB 3UGJA 4WXYB 2GVDC 3NHZA 4PGHA 3QTTA 1TMOA 1VSTA 3O21A 4Q1DA 4EG7A 1GFZA 1NHWA 1QGYA 1TJYA 2JI8A 1CQXA 5DTIA 5H3HA 3RADC 2DQZA 1Z0KA 3GK3A 3C14C 3PHLA 1M75A 4R8KA 1NM5A 3KQMA 5BT8A 4MW2A 4ESOA 3EGDA 4F46A 4R7ZA 1YQXA 4DREA 1D2MA 2NACA 4QHSA 3CN7A 2EG5A 2IBMA 4I19A 3PPXA 1C8VB 2Q0QA 1COWA 4Z4GA 3IIIA 1SXIA 4AD8A 4B34A 3KTAB 2YN2A 4PYIA 3IAFA 3OESA 4TYPA 3ZV5A 5BWNA 1R00A 4OJYA 2BJWA 3ZJTA 4IX9A 3AUAA 4M21A 3N70A 4IEIA 1A7KA 3KD2A 4MAFA 4WZAB 3WWEA 4UUAA 3NGMA 1CNFA 3G9ZA 6REQB 5T7BA 4DXDA 4MRRA 1FDWA 3H6KA 2LIVA 4MCHA 1F0PA 2VPIA 4Q3NA 1OYVA 2G4CA 3CT4A 3Q2OA 3L8GA 4CU5A 1YZKA 1SOVA 3LY7A 1M0SA 1HFJA 4Y9TA 1TYAE 1B3RA 4CTNA 1LJLA 1J0XO 2A14A 1D09A 1U1DA 2B37A 5LZ8A 1FFYA 2CXOA 2F1RA 1H94A 1QYIA 1LBQA 1XTBA 3NPMA 1OKKD 3O1JC 1XDSA 3NLLA 3PHGA 4PHCA 5FLYA 5K4HA 3VX3A 2XB8A 1F4VA 3EPJA 2F48A 1NBAA 2WM9B 1NONA 3NDIA 4FDMA 5FTMA 2Q3FA 3FFWA 1QIMA 3VQTA 1RVV1 3B8HA 3CRW1 3SY8A 1T5IA 4ZO8A 2AQHA 2OQRA 3L79A 3ZBQA 2CK3A 3IAEA 4OTZA 5I48A 2XRZA 4NE2A 3JWEA 4EA9A 2O0LA 5FR2A 4G0OA 2RKWA 1WXFA 4GMGA 1C9DB 2IECA 1B6SA 1R18A 2XTAA 3JASB 1KMCA 1VIMA 4M9UA 2AMYA 2UZ0A 3LCMA 821PA 1XTQA 2KLHA 4B7UA 5D3MB 5IAAA 4CQMD 3W8FA 1S3GA 1ZCAA 4I5GA 1OVMA 1RC8A 3FRHA 5IXSA 3M9WA 4U63A 2NU9B 4IHJA 4D4GA 5DYGA 1UJ6A 3VH1A 3ZW7A 3N05A 3HY3A 2ZKIA 1N2SA 3Q0IA 5A5GA 1SKYB 3JQ7A 5JJ5A 5DNVA 2QVLA 3SICE 5FB3A 3PJFA 1QIFA 2JFNA 3FUVA 2OBNA 4DILA 5C1BA 3GLGE 3S2EA 1CY7A 1E9DA 5P21A 4F45A 1T5OA 4K6FA 4C4PA 3C48A 3A8TA 3IMKA 4PO3X 1Z45A 1DQPA 2IQIA 4XLLA 4EBBA 2RB5A 3HN2A 2D2XA 3OPMA 2BMJA 2XUOA 3QVSA 2F1JA 3IQWA 2E48A 4YUWA 2XNDA 3ROFA 1H9CA 1UPFA 1FK8A 1BGWA 1ZCJA 1JL3A 1GQYA 1OTXA 4M8IA 4YRFA 4CV1A 5BSHA 2PSHA 1H22A 4KXQA 3MJEA 4Q37A 4ENPA 3T9DA 3WYCA 2YVUA 3L8ZA 4V39A 4B9EA 2JGNA 2X58A 5DHUA 4BRUA 4DQDA 3TFOA 1NOJA 1K0FA 5A9RA 3E9RA 4TRJA 3WK9A 5KQMA 3K6SA 9ATCA 3QUTA 2YVLA 4PLVA 4Q9LA 3N59A 4YFYA 3UHOA 1ISPA 1JLSA 1N5RA 3AUXA 3FDJA 3PQ3A 3HJGA 3DTNA 1XCJA 3FWHA 3MTGA 4LIPD 1TXGA 4LTMA 3IE1A 4PN3A 1LVGA 2O7QA 3OUUA 1VJ1A 3WZLA 1W4RA 3N53A 4MKIA 3RIEA 2R6ZA 3AEKA 4RMJA 2P6PA 3D2BA 3U44A 4QOIA 2PA0A 2ZFUA 5FNZA 4QICA 3TR5A 3ZJ5A 3FHTA 1XTRA 2CDBA 5JDIA 2AJ8A 1LI7A 1Z0JA 2AC7A 2E2WA 3HJUA 3N5KA 4UAUA 5IC6A 4FS3A 4JWTA 3PC8A 4JXKA 4JP5A 3WSVA 2GTPA 2XNCA 1G6OA 1M54A 1LU9A 3K8ZA 2V03A 4KZKA 1MIOA 3CZQA 4M8NE 5ALOA 4BASA 1X7GA 1QUEA 5ECDA 3AVQA 1WVGA 2C7RA 2VH1A 5FNVF 1N2EA 4DQVA 1CQIA 3MQ4A 4MWCA 4ZQFA 1MAWA 2HNAA 1BS9A 1X74A 1WDLA 3B53X 2WY2D 4YYZA 5G2FA 1IL0A 1T9DA 1RJ9A 5J2TF 1ZW1A 5E2BA 3VRHA 3GLIB 2PQ0A 2RSLA 2ZIGA 3PZRA 1N2CB 1NA5A 4MW7A 1WDTA 4TUYA 2FGKA 5DWVA 3ZIDA 1Z6PA 3MCTA 5HQ3B 3ESBA 4JZYA 4GBMA 2J5XA 1KNQA 1CYDA 1W29A 3KYDA 4MJLA 5AM1A 2ZJYA 1N2XA 3F7TA 5A9SA 1UPXA 3W3AD 4DMKA 4KYTA 2B6HA 3ONEA 2G7ZA 1L5ZA 2ALJA 2R1ZA 5CLLA 4TROA 4A16A 2C0QA 2GS9A 4MQMA 4Q3LA 1QXSA 4ER5A 2GETA 3PSAA 2P9TA 3DGFC 4FOTA 3Q3HA 4RL6A 5L4NA 3P8ZA 2RBEA 3AUTA 2RFLA 2ATIA 2ZE8A 5H7XA 3DLIA 5HFNA 1RKQA 4FGLA 4K81B 1ADGA 4YMSA 1A4RA 1P33A 1QFMA 5DCUA 2GAJA 2H1LA 1M10A 2HFKA 4PXSA 4TT3D 4XIGS 1GHTA 5ALTA 5IU6A 2CLDX 2W98A 1P29A 4YGYA 3U39A 1PJRA 4B2PA 3NU1A 1AHHA 1IIBA 1YZFA 2XQJA 3AINA 3BMQB 2Y76A 5CX1B 3WQRA 1X1QA 1JE0A 1RPAA 2EFYA 2WF7A 4PZZA 3QEBZ 4WJKB 1Z4OA 3JVUA 1NT4A 2PSDA 2V3WA 4LF4B 4MYUA 1GVHA 3AB3A 4KJZA 3EVCA 2OA0A 4OYYA 4CMJA 5KYTA 2QTTA 3EXIB 4GOXA 1E1DA 1J09A 3UHFA 1BD4A 1O08A 3GO4A 2LBPA 4FI3C 4M0FA 4XLZA 3A2LA 3CWZA 3EXEB 1T6ZA 1XZNA 2W8BB 3H3XA 3H42B 4CL2A 1QTQA 4KQ1A 3QVXA 3K9NA 1XJWA 1G18A 3GDFA 4IIFA 3ASUA 3MQ2A 1MORA 4RH0A 2JANA 5DM70 4IO1A 1P0IA 4I46A 1G0OA 3DOEA 5BN4B 4A9AA 3PFFA 4AJJA 3MYRA 1AG9A 3HBJA 4M1WA 2GHTA 1IY8A 3U26A 1O97C 5D6OA 1KQFA 4I50F 5ALQA 3CYFA 4EUKA 1NVEA 1QV7A 4YJFA 4G1BA 2QRVB 4I1RA 5FOXA 4D9BA 2O8DA 1TI7A 2JAXA 4OHUA 4BV2A 2GBFA 3L0PA 4D9IA 1HMPA 3T38A 1A96A 1FL9A 2FX5A 1JDSA 1FS5A 5JATA 1PE0A 5MFPA 2YXPX 3KZ1E 3V6MA 2G7MC 2Q99A 4LWPA 4CV2A 3NHSA 2HWXA 3F5DA 3CPJB 2FEKA 2FPPA 2GCEA 3IVCA 4IHQA 2O48X 4PC1A 2HTFA 2ZYIA 3KEFA 4Y2RA 5D01A 4BC1A 2Q7XA 4DAEA 5HZGA 1YCGA 3I9OA 4ZRDA 2VPTA 3PD7A 1FVHA 2P90A 4EH1A 1G8HA 1XOIA 2EIHA 3A4TA 3DCYA 4XSGA 2ZT6A 3I9KA 1F2TA 5D00A 4IIYA 5E38A 4LY0A 4RY2A 1ZDMA 2B7CA 1ZLYA 2CLSA 4XH9B 1TK9A 3HDYA 3IPRA 3KXDA 3NWOA 5CLGA 5I3ZA 4EATA 1AF7A 5EFOA 1THZA 3AM5A 3UH0A 1YZGA 5KNCH 2XADA 3BCSA 1AGYA 1UK8A 5ALLA 5JZOA 5KTRA 4ZYXA 1V5IA 2B1IA 1W4AA 3GELA 3DM9B 3QWHA 1VB5A 3MJHA 4A5SA 1M8FA 2XMBA 2OHJA 2PZFA 3GCDA 2VHXA 3ZU5A 4COOA 4DQXA 1IN6A 1V39A 2BGRA 2X5OA 3A0RB 3HL0A 1WIWA 2XX3A 4EG3A 2RARA 16PKA 2IU6A 5H0IA 4WOKA 3RYHB 3ZD9A 2AXPA 2JGJA 4QXMA 2XUJA 3FLEA 2UXCB 2FSVC 3GJ6A 3EPPA 1XVLA 4LXQA 1L7EA 1HLPA 1SZCA 1WUJS 2PX2A 3O1HB 3UV3A 3VR1A 4G5HA 4NNOA 2NO4A 3FY4A 5EPEA 2J31A 1J22A 3L18A 3FDXA 5AUPB 2BP7B 4ZKDA 2EKBA 5J9FA 2AWOA 3E3MA 4I1VA 3DZGA 1ND6A 1PX2A 1M6VB 1RHRA 1B4DA 1XNJA 4NHOA 4YMHA 1B8PA 5FOUA 2HQ1A 1U9JA 2FEOA 4O4HB 1MGPA 1I3NA 1ZK0A 3NEPX 4CI9A 4FDTA 3L4KA 3AH8A 1KI6B 4RA9B 3W5DA 4MRAA 1CZUA 1FS4A 2NTNA 3F90A 5IVHA 3D6JA 3ICOA 3URMA 4JI3B 1XZBA 2EJVA 2JJ2D 3BQMB 3K31A 2LNDA 4JJFA 4NKRA 5FUXA 3RYCA 2HB6A 1QRSA 4ERXA 4DDTA 1QPGA 4X84A 5CVCA 4N3BA 4IJUA 4NNJA 3QENA 1B2RA 1PHRA 3CISA 3DYVA 2A9PA 4Y2JA 3S0JA 3U7QB 2UZIR 3KV3O 4E46A 2G71A 4E94A 4HVAA 4QZVA 2X41A 3OKPA 2WT4A 2WIFA 3NXSA 2IEGA 1GU1A 1YL5A 4ER0A 1PYDA 1GQFA 1UFQA 5LQNA 1ICEA 3KEQA 2Z83A 3ZG6A 2IUEA 3DFFA 3I76A 2HIMA 4QDKA 1UT6A 1P7WA 2HSJA 4GLFA 3S6JA 1ESDA 3DT6A 4PONA 4YCAA 1Z36A 2Y71A 3MJCA 5EVCA 1RE0A 3EGDB 2GZDA 3WGLA 1TFRA 4PBSA 4AN1A 1BSVA 2POQX 2ZRMA 3L9XA 4XR9A 4BZZA 5L4LA 4JSRA 1NYTA 4DLRA 1HYHA 3ND7A 3LXXA 2VO1A 2QDXA 3THYA 3K72B 1KYTA 4G84A 4KBGA 4LMRA 3B6MA 4N8SA 4TLBA 3QKTA 4X6YA 2DB3A 1VJTA 3DWGA 4CWAA 3TTYA 4UPVA 2XPCA 3ZS8A 4LGYA 4ACBA 5IMSA 3T12A 3HCWA 2GXAA 4BC0A 1MRSA 4BUZA 1LX7A 1Q7GA 2JVIA 3RS2A 4I4TF 1FFGA 1ORIA 2BFNA 3AZOA 2IEYA 4CCAA 7MDHA 1I7DA 3KJXA 3BRWA 2ROQA 3BE6A 5KJCA 1BDHA 2B30A 4MPDA 2DETA 4ZVOA 2ZYRA 3I2IA 3RKSA 3T4UA 3DZCA 4B3DA 1BXGA 1ZP6A 3I28A 5BOSB 2Q7OE 4ETMA 4K26A 1HG1A 1ECBA 5IJ0A 3DKVA 1NNUA 4YJGA 4DR1B 1GG2A 5CH8A 3T7SA 2DAPA 3O4GA 3VAAA 1MOQA 5HQJA 1KDPA 1NQWA 4IX1A 4J0JA 3KKKA 1W52X 1VE5A 3HVHA 2ZRDA 3EQZA 3CMCO 3QWFA 4HAWA 4I9HA 3PFHA 4PWZA 2QLBA 5IEJA 2OCDA 3TSZA 2FK8A 2WK1A 1Z34A 1P7YA 2FFJA 4IUDS 4OXKA 4YJ3A 1KO7A 2YZKA 1K63A 4WKOA 3R7NA 3T5PA 1IMJA 3FF4A 1SUBA 5FV7A 4B6JA 1M66A 3ZD8A 3KZXA 1IUNA 4QQFA 4C3OB 1YCFA 4Q7MB 4DLXA 5EJAA 3DZHA 5HDBB 4TVSA 2GAFA 2RGNC 1QO0D 3IAS6 4ZOCA 3H9GA 5J1TB 2JHAA 3RSQA 5LDHA 1NQUA 3NC4A 1RYZA 3ANMA 1TO2E 3VUEA 1U2TA 4GKBA 4IJVA 2SECE 3UWOA 4HS9A 4YAJA 3RC8A 1S2NA 4LRSB 4I8XA 1ZJWA 3NYIA 3D7KA 4FUTA 3R9KA 1U3FA 2ZSHA 3JPYA 2KBFA 1RWXA 3OBIA 5EOVA 2O7SA 3DO6A 5DM1A 5FLEX 2O2IA 3BM5A 3RVRA 2I9PA 1YL7A 4IVNA 4QBTA 1BKDR 1Z2EA 2FOXA 4PYRA 1BXRA 4XQGA 4XJXA 3AEUB 3VPDA 5FWXA 3SXUB 4ZZ0A 5LLDA 3EEYA 2O07A 3PX3A 5CVEA 5L3SA 2XNKA 4UD6A 1MLDA 2ACWA 2VZ9A 1KKLA 1QWSA 3O8CA 3TOXA 1GDDA 4R6XA 3GT4A 1J0BA 1I5EA 1H6BA 2HI0A 3BXEA 2YRFA 4MRMA 2H7YA 4M7WA 4PHTA 4B4OA 4EI7A 2HJ9A 2ORIA 4CL8A 5IHPA 4R1QA 2IV2X 1EDEA 2PRJA 1RD4A 3HDVA 4DMGA 3E5RA 3R6DA 1JDTA 2OC9A 1RWWA 4EZEA 5H3CA 4XQEA 2YHUA 3EC2A 1RZVA 3VZDA 1BX1A 4JAVC 5D6NA 2NO9A 5DMXA 3A36A 4Q19A 2Y1EA 1PG0A 4FEGA 1RYDA 4ZT2A 1POXA 3MUOA 2WJWA 4MGEA 4JBLA 4X62B 2GK4A 2K87A 1UFKA 3DM5A 3VU3A 3U1TA 1A7AA 3NANA 1XZDA 3H04A 1YJ5A 3L4EA 2B8EA 3MGCA 4BO7A 3U44B 2CLHB 3DTVD 3EWNA 1M0EA 4G4SP 1QVRA 2Y2VA 3AR7A 4EO7A 4D0SA 4KFCA 1GTG1 4IW3B 3B2QA 1EFVA 1NWHA 3QY0A 4TKUB 2X22A 4L22A 4H17A 1CJKC 2VTKA 5CXXA 2R8ZA 1IJBA 4PS1A 5H9VA 4DM4A 3AY3A 3EMDA 1HE1C 5B58T 2D06A 3C6ZA 3SDBA 4EY7A 1KS2A 2PLAA 1N4AA 4YMGA 1XZLA 1WAMA 1Y9EA 4G0MA 5TQVA 3QZUA 1ZIPA 3C5EA 3EEOA 2VJNA 1R4NB 2B35A 3RNOA 3B13B 5LZ9A 4GD3Q 4LBVA 4KR2A 3KFVA 1ADJA 5JBIA 1C2YA 1BS2A 2C58A 1MIHA 3WWDA 1WTAA 5AW0A 1SB9A 1UPAA 2FSUA 2O3JA 3T1NA 1MQAA 2UYCA 3DPSA 3WGZA 1HWYA 3SU8A 1HZZC 1SVSA 3FGZA 4KMRA 3KUCA 4PHFA 3RUPA 5ES3A 3A3OA 4GRDA 1AT1A 4HQRA 2GNOA 3VR2A 4DUGA 2C2WA 3II6X 4ML3A 3U3ZA 4YP5A 2P9GA 4I81A 5AM0A 2OCIA 4EVIA 4WL0A 3MIZA 4NDZA 2ORYA 3ZV4A 4EW6A 2NVWA 1VKZA 4TTVA 4RC9A 1KETA 4OREX 4B5LA 1QNFA 4X93A 1RYNA 1BNCA 3DZDA 1VKJA 2DFKB 4WLNA 1SZJG 4FFSA 2BOVA 3WL6A 1HEIA 3NHPA 2Z0MA 2QV0A 1RKUA 4LMAA 3VNSA 1NR1A 5IK2D 1WHSB 4KODA 3RFVA 2P0YA 4Q1BA 1XR3A 3GDGA 3ZQJA 5KVCA 2GX6A 2W6CX 1DOAA 3P9ZA 4IM7A 5DGHA 3WFJA 4JDUA 2E1PA 2RCNA 2B2CA 4PNPA 4W8GA 4R1PA 4ZO9A 3W2HA 3I3SR 4FMCB 3AJDA 2HMSA 1E1QD 2QQEA 2XTJA 5DULA 2PU7A 121PA 4AQDA 2XHZA 4RD6A 3SJBA 1FF9A 1JBQA 2EL7A 2EARA 3MJFA 3AX6A 1CX9B 1XZHA 2H1IA 3IJEB 3MTQA 4NFSA 3RLIA 4HAXA 1VG1A 4IDAA 1FSZA 2ORED 3PUHA 4LVNA 4AN4A 4Z3OA 1C0PA 4AS1A 2WJ6A 3W2GA 2FXVA 1WQ3A 1DKOA 3LYAA 2R1TB 5B53A 1UXHA 3KAPA 3DE7X 5JNWA 3NOOA 2SKCA 2QN1A 1KKUA 1GQOA 3EVAA 3I64A 5DNAA 4WLFA 4JK3A 1V9SA 4PG8A 1X7XA 5TPWA 4A8TA 2ZIEA 2ZTMA 3BOSA 2XWSA 2VDLB 4C4OA 3TR0A 4EYSA 4ZVMA 4UU7A 3VU0A 3V33A 4G1CA 4EPRA 1FLNA 1H0KA 1ANKA 2CMGA 1Z5GA 1TM1E 3UK6A 1TLFA 2PKCA 1OXBB 4RZUA 4MW4A 3PRKE 4E5VA 5I7VA 1LTHR 1SQ6A 3RVSA 1O97D 3IAS1 5AO9A 4HAVA 1U5BA 1UL1X 2DUNA 2GYUA 1QIIA 2WIJA 4FWBA 2QJTA 4RFVA 3TGLA 2XWBF 4Y18A 1A9SA 2QTVA 3KZCA 4HRAA 4YWHA 6YASA 3AKZA 3OZEA 2AXEA 2A86A 4R2WA 2EW8A 3GJ5A 3EDYA 1D8TA 4KU4A 4MGHA 2I8AA 3JQAA 4XYLA 1XZPA 4IMIB 3SI7A 3SBOA 3EZ9A 3RV3A 3NAGA 5DHSA 2FCAA 2CD7A 2BE9A 5F5NA 4KWIA 2FX2A 1KKMA 1S2LA 2VTDA 3KOYA 1AGNA 1FP2A 3HSYA 1GARA 1PYOA 3QXCA 5EYPA 4UKDA 5EMJA 3O8NA 9GPBA 2EJCA 4ZODA 4B4WA 4XVCA 1EJ6A 4KLZA 4QD3A 1SN7A 4GS5A 3ESZA 2OQVA 4AJ2A 1S89A 1DXYA 1UWKA 1SHKA 1K3FA 3SBEA 2CHGA 2WPNA 5EQFA 1ZM9A 3AQIA 1KHTA 3U5ZB 5J4KA 1XROA 3FMGA 4MS3A 2D5BA 2AKYA 4RHCA 2Q29A 1K75A 3ILSA 4IO0A 4ND8B 4WCFC 1GSHA 1I3LA 1OX4B 2C7BA 2QMOA 4HGRA 5FPYA 1KZHA 4GX5A 2VZEA 3TTWA 3B3FA 4KBFA 4M37A 2JHGA 2W71A 2CNWD 3V5NA 2IPLA 5FT9A 2QRKA 4H1TA 3C6QA 2Y0EA 3RVDA 5ICSA 1AQJA 2QN2A 5LMUB 2WJZB 3AF5A 3IVRA 2IYRA 5B7QA 1M1UA 1WLSA 4CKCA 1T4GA 4ZEMA 1SXGA 1E6MA 1BH6A 1NP6A 4LPKA 4CT4B 4D45A 1QFZA 2VPZA 1TGVA 2H1FA 3BMOB 1G16A 3BDVA 3WJ1A 2QT1A 2X0KA 5AVUA 5SZKB 4N47A 1USWA 2COEA 4QEKA 1VE3A 2ZLBA 3EFHA 1UFVA 3H3JA 4JYAB 1CKEA 5FWNA 1DBWA 3BERA 3JAKA 3OE4A 1G6HA 1PDWA 2P4QA 1NKTA 3C15C 2Z4SA 2PGOA 5JD5A 2WG2A 4FQ8A 1QU2A 3DT9A 2PUGA 2HCRA 1CEXA 3H84A 2V6BA 1V1RB 4YCBA 3FZYA 3IMCA 3DAGA 1U0OC 1NL3A 4XIJA 1KJJA 1RLTA 1VLJA 2EZ4A 1K8XB 4IQ4A 1EK5A 5CHEA 3SLKA 5A7FA 3T3HA 4A82A 2FG6C 2DCMA 2GOYA 4C89A 1AMUA 1NASA 3OBBA 5D3KA 2HJVA 3CX3A 4HN2A 2EW1A 4PXYA 3FB1A 1MHPA 4TV8B 3GEMA 2WOJA 2ZVJA 3V80A 4EEXA 2FMUA 3L1KA 2I62A 1FVFA 1JQEA 2C2BA 2V8OA 4OOFA 3AR4A 2LDBA 3RRJA 1C0EA 1XTPA 3O03A 2HBRA 1PW7A 4XARA 3KHKA 2WU8A 3K30A 4QDOA 3K4PA 4M1YA 1LK7A 3WKCA 3QW4B 1SQGA 3RUCA 2QD1A 5JAMA 2QD2A 5TEWA 4BRZA 1AKUA 2Q5LA 3L1JA 4WOJA 5DF1A 4MGKR 3DOOA 3RS9A 3VVLA 5BMVA 4LX0A 4JROA 2ZS9A 1VI2A 1XKLA 5CA1F 1N1EA 1ML3A 1ZOIA 2O0KA 5C1PA 4NENB 5FJJA 1J24A 3WICA 1E9BA 3AR9A 2WYIA 2NQ8A 1HDEA 1Q3TA 1YC2A 1Y5NA 1E79D 5A2GA 2NXEA 1X14A 5DGCA 2FR8A 2YXEA 3GD5A 3ACBA 1SO8A 3OPYI 4DV6B 1RRKA 1NMQA 1LBHA 1XWWA 1SR8A 2GD6A 2KQUA 3H2HA 1HQDA 5K03A 2IX9A 4RDIA 3GAFA 3CRQA 2QE7A 4FYYA 1DHTA 3W2FA 4LRWA 1AUPA 2PN1A 1UKAA 3GDWA 3C1TA 3FVWA 3C6MA 2HQRA 5MHTA 4HLDA 3ZH9B 2PMWB 3DDHA 4PCUA 4G37A 5EMHA 1Y89A 4CFYA 3CF4A 5LXTA 3DOHA 4OB8A 1VKHA 2VT7A 2BTQA 4HRXA 3UJ8A 3KHTA 3JD0A 3B1YA 1K86A 1Y1SA 2I80A 3S3TA 4JQZA 2E82A 4MB6A 3I6QA 5HF8A 4MQLA 3ANLA 3BHMA 4Y9DA 4BX9A 3HM9A 3SIXA 2NO6A 2PAFA 3CVYA 1SUAA 1E0DA 3GEIA 5CPBA 5CYOA 1FE8A 4YAKA 2GEVA 3WGMA 3VHXA 5ER6A 2V6FA 3OC6A 4Z4CA 3PKIA 3TBHA 4P93A 2ICAA 4U2BA 1CRZA 4KTTE 5DV9A 2FY8A 3UT6A 4V02A 1XSEA 4Q7EA 3LK7A 3G13A 2ZS7A 4YUVA 3HWRA 4FHEA 2QSUA 4U5QA 4YJ3B 1NW4A 2X1VA 3E0QA 2MU1A 1TUEA 4L0QA 3U3RA 1B6RA 4LJ6A 2EVWX 1T36A 2Y93A 5CEJA 2PGLA 3P26A 2DUJA 4GZLA 1I5OA 3AHEA 1SUCA 4H9GA 3AVOA 4IHAA 4NDAA 3GEEA 2HW8A 1ESZA 1HDYA 2ZIXB 3LOUA 3PQDA 3RH0A 1D03A 4D46A 1SBNE 2DBZA 3EZYA 2Q07A 1FRZA 2X9NA 3GL9A 4HFNA 5CCEA 1Z28A 2B21A 2NTEA 4CCYA 3FNGA 4G8BA 5EXPA 1U28C 3UHPA 1T2AA 3TFQA 4ENRA 2HU5A 1N0WA 5D5HA 3QE4A 3G88A 2VHZA 2IEAA 1FVOA 1E64A 5LYJB 3ITKA 1EXDA 1B1CA 1C7QA 2WJ3A 1XTVA 4M0DA 4Q4JB 1KSHA 5KJFA 2YDYA 3LLUA 4XYBA 2QVGA 3W90A 4EAQA 1P8JA 4HPJB 2EQAA 4INPA 5IF3A 1KK1A 1L4KA 4O4LB 3NRCA 2I65A 1OFTA 1G3UA 3OLZA 3WK8A 4HS4A 2H0RA 4PLWA 1Z5NA 4WD3A 4B6QA 4RJTA 3UUFA 5B2EA 3B36A 3FUXA 3OZFA 2RC6A 1HK7A 4UNPA 2PWYA 1DQYA 1KA9H 5F7ZA 4DIUA 3AG6A 5LC1A 1G9TA 3RYIB 4PSAA 4L9SA 1X1CA 4E2WA 4ENTA 2BI4A 5CVTA 2E55A 2R84A 1NQXA 3K8QA 5L3QA 3X1MA 3JQFA 3QMVA 5L3ZA 3ZBPA 1Y8CA 4JJEA 1YZ3A 4K86A 3W0LB 3NEYA 4R84A 3BCUA 2FFAA 3V8BA 2NV2B 5BYBA 3DTTA 1G63A 1LRJA 2Q9CA 3NM6B 4Q12A 4ASUD 2AG6A 5HMLA 3ENKA 3MRXA 3FMPB 3I9JA 3Q0EA 2QG9A 4ZVRA 4UTZA 3RHSA 3B3GA 3AFIA 3TTTA 1FMLA 1WB6A 2AN5A 5LZ2A 4XJSA 3GIWA 2WIKA 5K51A 5CDHA 5A6SA 1EA7A 1PEYA 1TTQB 2B7BA 1EFVB 2CMKA 3LJKA 2P2YA 3PR2B 2QRGA 4KE7A 3BHNA 4M9SA 4OP2A 3FUUA 5BVHA 1F7VA 3QHAA 1SXJE 1BDBA 1ZD4A 3VSCA 3A9TA 2FWRA 4EFDA 3TECE 1JRLA 1KDTA 4RQUA 2AE1A 5L9AA 1VI6A 1UKEA 3AZQA 4QJ3A 4R9UC 1K6JA 5CCDA 1YR7A 1FQOA 1U81A 2CL7X 3IYLW 3OX2A 3Q3CA 1C1XB 5IJXA 2O1XA 2XA9A 3ICQB 5AJTA 4Y1RA 5KYVA 3M82A 1D7OA 4G5XA 3W8NA 3ZHQA 5DM2A 1CP3A 1DB3A 4FN5A 4L0DA 4ZXPA 5JSFA 1PS0A 4UZEA 4AXXA 1YZVA 4JA2A 1WZIA 1H2RS 4RK7A 1IXSB 1K88A 2BI7A 5AVWA 1Q0PA 2VRCD 3M81A 1F2DA 1G66A 5GZ3A 1NY6A 1QCYA 1R64A 3F4BA 2UZ4A 1LDEA 4IIVA 3MCZA 4PW0A 4ZJPA 2G3DA 2IXAA 3F3MA 3GMTA 1GSIA 2P5YA 4OM8A 4ZOQI 3FVRA 4HX5A 2G04A 4HNHA 4MV3A 2H2GA 2NOAA 2P2GA 2Q1SA 5FBRB 3TQHA 3FWNA 2PUBA 2R6GA 3D8BA 2B4RO 4W6QA 4BMZA 2HQSA 5JASA 1CZKA 1VE1A 1WPXA 2H5LA 1J90A 3P4UA 3PL5A 4Q5IA 2G1PA 3ZHVA 1DKPA 2XF8A 4CMIB 5A6VA 4X97A 4G5GA 4NESA 1FP7A 4R8RA 2GPJA 3RT9A 4B4VA 1K08A 3V00A 3LLSA 5BSTA 3O3MB 3DEFA 2E3JA 3GEHA 3TLBA 5LN1A 5CW1A 4DSAA 5J43A 3UJ7A 1CP2A 3U1BA 3D5TA 4D3ZA 2AD5A 4HH0A 2BMDA 3EXAA 4LG1A 3T1YB 2V0NA 3T5MA 5CJPA 4LHSA 3E9CA 4E88A 2NT3A 3F5FA 2XD9A 4P4TA 4EPYA 5I47A 8ADHA 1V7QA 3G9TA 3GFSA 5CJ2A 3ZCTA 2JG3A 1V9CA 4WK0B 1JDPA 3EC7A 4LHEA 1P45A 2VH2A 4PZ9A 4YPVA 3UO8B 2XH8A 3VYSB 3V8VA 3NCTA 3RUDA 3NHMA 4KO1S 3UJ6A 1SU4A 1WW3A 3F46A 1ZSVA 1SEVA 1V5EA 2ZR9A 4NCKA 4QDJA 4L15A 4D97A 1GRVA 2HCJB 2X2EA 3EIXA 1SUSA 3FXAA 5CDSA 4KQWA 1N7IA 1Q0SA 4B6GA 4MWEA 1AV7A 1QDEA 2DF8A 2HT6A 2PK3A 2YWFA 3NBXX 4HNSA 4P82A 3JVDA 2XKKA 4MA5A 5GY7A 1YRWA 1JIXA 1OSNA 1VKOA 1XF1A 2FXIA 2WG0A 3JQAB 3WGTA 3HFGA 3LXMA 1YI8A 5C4IA 1E61A 3OFSA 3ZHOA 4MB2A 5LP6A 2JK1A 1JDJA 3I01A 3INRA 3CUKA 1XE3A 1EB8A 4A0RA 1TJPB 3I1JA 5EYPB 1I7NA 1XGKA 1JEEA 3EXHC 1X7ZB 3SQOA 1GUFA 4A2QA 2PD6A 5K6TA 1PK9A 4KK4A 2P9CA 4I9NA 3OJLA 1I9GA 3CS3A 1FVXA 3QVWA 2OUIA 2F4VB 1TVKA 3HGTA 4D6PA 2A9QA 3KQPA 1A04A 3MK31 2QT9A 1E1YA 3NDJA 4ISBA 5C0OE 3VAYA 1LFDB 4ZI7F 4MKXA 1B1AA 2WIAA 4ZHQF 3RK1A 4G1VA 5YASA 5E6UA 1G60A 1KJ8A 1XKXA 5K6AA 4RUKA 4YJ2F 1PLKA 1WTCA 2VP0A 2JBAB 2W2LD 4C14A 3KIPA 3PEEA 1I80A 2IEBA 1IN8A 3O9VA 1FSFA 4URHA 4AIIA 2EYQA 4XGQA 2FQXA 5ICCA 4D44A 1WCWA 2IF2A 2OOSA 2GBLA 1WO8A 3C3CA 5JVDF 4N48A 4XWTA 2VF4X 1VSQA 2WE7A 1AK1A 3BQNB 4LSZA 1UT8A 1SXJC 1ZH4A 1Q20A 3FTPA 4E5NA 4Q4AA 2BFBA 5H5JA 1KSFX 5TQ0A 4DIDA 3DPIA 5B6PA 1TVEA 3MLAA 1P4RA 2ORWA 4R2HA 1TA9A 4AUKA 1U3DA 3V8NA 5KTOA 4M1QA 3NBYC 1UKYA 2WU3A 2YXDA 2O20A 2OAGA 3B3QA 4YRQA 2FPGB 2IWRA 3KYCB 3W9BA 4EHKA 1V7PC 2EF0A 5H9WA 3F8SA 3E3OA 3G7SA 3N7AA 5JCXA 3ZWDA 5D8DA 3RROA 3WMWA 1TYEB 1FY2A 1UPTA 1BXZA 3FUCA 3VTZA 1WBDA 4NMLA 2FPXA 2OO7A 1ZC3A 2BGIA 2IOYA 2H08A 3D8TA 4AC9A 4BLQA 3CKLA 2FH5B 2ONYA 3H5NA 3K9GA 4L8YA 3ZV3A 3PNYA 3IHLA 3UY4A 1V8PA 1GPBA 1CNMA 4PAWA 2ZXEA 5HIKA 1QIJA 2WUEA 3VBCA 3D31A 1WPGA 2CJXA 2VQSA 2RGBA 4DDUA 2VQEB 1VGQA 2ISQA 2IYPA 1AZTA 3IRUA 4H7PA 3H1GA 2VSYA 3CUYA 1U0GA 1X7YA 1X80B 3L5OA 4I0WB 3IEIA 4R3UC 5FBKA 4XSHA 4O1MA 1YUBA 1HURA 3D64A 1JA9A 1Z6GA 2I4IA 1ZNWA 4Q7LA 3TIIA 1M76A 2P7HA 1GTZA 4JB3A 5TDHA 1CJTC 2A4MA 3R7FA 3WGGA 1KO1A 3LLMA 4YXWA 3PNMA 1NTRA 3N8GA 3OZXA 4KQ2A 5CVJA 4QDTA 2WF6A 1NWCA 4L5YA 1LPNA 1NI4A 2J5KA 3CUEF 3G5UA 1NATA 2GSDA 2DY1A 1MAAA 3DOJA 4G81A 4MP3A 4YCDA 3OY7A 1Q2UA 2C7VA 2EXXA 1GQQA 3FGNA 3OTWA 4RY9A 1O4VA 4ONEA 1V96A 4OJQA 4RA6B 2B94A 3VVCA 3DS8A 3T1VA 4B5KA 4PN7A 4MW1A 4C7MA 1L5QA 1OZ0A 4Q21A 5ARCA 1WZEA 4OV6B 4WMLA 2XXAB 1ZU5A 2HX1A 5ALDA 4P7KA 1N3IA 3O75A 2FMKA 4BYMA 3K3PA 4F2HA 3PFNA 4V0QA 2GXQA 3IUPA 3O3NB 2EBWA 1KIFA 1QQ6A 4L9WA 3ZLJA 1R8QA 4RDHA 4DPMA 2G5PA 3HGMA 3CG4A 3K5WA 2M1ZA 4OGGA 3IO3A 2PXAA 2AZ4A 2D8AA 4JHXA 1YK0A 3ORHA 1E3DA 1KYIA 3DWFA 3DNFA 3WP1B 2P67A 1DZ3A 1T4CA 3EVTA 1XWIA 1RXUA 4N5NA 4CMGA 1AH2A 4OHKA 4Q1EA 1CUJA 1BVRA 2AN9A 4M9QA 3T41A 1Z47A 4BMCA 1EWRA 3EZ6A 1BCRA 4LQ4A 4PAQA 5FOQA 2D2EA 2HWYA 1UKBA 3K1ZA 3NHBA 1QGUA 4HGOA 4HF7A 2C2XA 1QWOA 1P7VA 1QAQA 3DOFA 3K8OE 5ED0A 2OD7A 4BVBA 3UFXA 4IGKA 3IFSA 2O2HA 2D4AA 2XDAA 1J07A 4DWVA 3WLRA 4EFLA 4Y6SA 4BLOA 2BJVA 3P45A 2X40A 1D4AA 1R0ZA 1FNSA 1BDIA 2O4CA 4KL8S 4ZI2A 2HZ7A 4D80A 1Y6JA 2J30A 3CTMA 1NVXQ 4QUJA 1P9NA 2O2EA 3E7PA 2ZSJA 3JWJA 3RK4A 1FA9A 3CU5A 1XI2A 4WA8A 2C5FA 4QULA 4CCYB 1X1RA 4FLMA 2FE1A 1XTUA 3KOUA 3QIVA 4IFEA 1NSYA 3NALA 1JU3A 3DQPA 4BNGA 1C4OA 2O5VA 3ITEA 3MAJA 2D3TA 2I4LA 2NPOA 3I39X 4FDLA 1A27A 2ODWA 1Z4KA 1JQKA 1OKKA 3BGSA 4M0PA 3TIFA 4M53A 1UQTA 3D4LA 3A9SA 1OFGA 3EPKA 3ASVA 4BLRA 3V1MA 1VLZA 2N1BA 3GQBB 2VDVE 5EIWA 1TCCA 5CX4A 3ENQA 2O7VA 1TF2A 3RFCA 5K0EA 1P1KA 1PBNA 3PDIA 4BV9A 4LHXA 4EX6A 4Z0HO 1N78A 2AG0A 2HT1A 4MI9A 4BN4A 1YXMA 4QPDA 3LHDA 4JNKA 1ZONA 1A50B 4CQMA 2Z8YA 2FQ1A 3IT2A 1DIHA 2FLVA 2DU8A 2RG7A 1X9GA 2YOFA 3OT1B 4DIEA 3EDCA 3GRCA 2C2MA 2G16A 2C4UA 4KDRA 2CEKA 1WSAA 4EGSA 4IUYA 2W83A 3K1JA 4FDVA 4L6IA 5AM2A 5E0OA 4UUMA 3MSXA 2H9AA 3U16A 3IJRA 1YZYA 4Q3CA 3KSAC 3G2LA 2YZGA 1T5HX 1N2BA 2ADMA 4BFTA 4CPDA 4C76A 5MDHA 4YP1A 4E1AA 4YAUA 3N2KA 4ZP1A 2HD4A 3AY0A 4KFSA 4NJMB 1L5MA 4OSOA 1V4BA 4QE3A 3UUWA 1VMAA 3HP4A 3GRKA 1YBFA 4IINA 5A6SB 3MUEA 4A0GA 3DC2A 2XGGA 4B6OA 1C3OB 2OO5A 3DAOA 1CUFA 3A26A 1XDWA 4MIKA 4Y6QA 2FV8A 4MYDA 4EW1A 1GPMA 5A71A 1JR6A 3PV0A 4LJ5A 1ENOA 4ER3A 4AQYB 1XD8A 2QRUA 1XHFA 2MINA 4M99A 4MV4A 5TMBA 2FTKE 3L6BA 3W8EA 1T2VA 1J1ZA 1T15A 1Z4JA 1CQJA 1MV5A 2ADFA 3N8NA 1I5RA 4IFIA 3CO5A 1N77A 3PPVA 3LFHA 5AK3A 1HDRA 4ZVTA 1QB7A 3QU7A 2DWQA 1NVVQ 4WADA 2H4FA 5DNCA 3LRPA 2C4HA 2ZB8A 1PG2A 4BO8A 3HB4X 4XWGA 5EWLA 3C5VA 1MW8X 1RYHA 3C3DA 2A1TS 3EBPA 5GM2A 5C4GB 3TCXB 3Q2IA 1KYYA 4LOKA 4LXTA 4RVFA 1LW7A 4I4LA 1G8PA 5I9IA 5IC5A 2IITA 4NABA 1PBTA 5ENDA 2H16A 3HR8A 4RL4A 3RC9A 3S28A 3FTQA 3F7NA 3K16A 3ZHRA 4NG4A 4Z5XA 5ANRB 5BWMA 1DKUA 3QM1A 4RLFA 4L07A 1SA0A 3L8DA 1I3KA 2PBLA 4QYXA 2CMFA 3MEQA 2VSFA 2QROA 1JSRA 2PUDA 4P31A 1MABA 4PZYA 3D9QX 2ZCJA 4KKVA 2Q3LA 1U2QA 1ZRSA 3OIWA 4RXTA 2AQIA 3NP7A 1KYVA 1UDBA 4PANA 3AUJB 2YN4A 2B2XA 1EUYA 4WOPA 2CFIA 1DP4A 1RI3A 2AHOA 3GG9A 4KK3A 4Z2YA 1NUAA 4Q9IA 3TJZA 3EOZA 4ND2A 3QLEA 2GXUA 3LCRA 3T5GA 4AJEA 2V9PA 3QF4B 4H3KB 1CUYA 3PT9A 5JW6A 5BSRA 1KNXA 4EW3A 4WNYA 1Y9AA 1L5OA 4RPHA 3QA9A 3W3AA 2IL1A 2ZOSA 5EIEA 2OVBA 4IJQA 3BGIA 1IQUA 1V9LA 2WKSA 3KDAA 4MUJA 1C9EA 1GNVA 2VNAA 5EE0A 4DM3A 4RORA 3WHLA 1OXXK 3HYLA 1A9YA 3KOOA 1XZKA 4TKVB 1JHUA 1EFKA 2P78A 4Q9JA 4PTYA 1F20A 2G5ZA 2A0XA 4GKVA 4R6WA 3TVTA 4HWPA 3H4VA 4MVJM 4AUNA 4TXNA 4WUVA 2YHAA 4YP7A 4RKEA 2QL7A 4TV9F 1WNTA 5BV0A 2HRDA 3UAXA 5U9CA 2XIQA 2VHWA 4TT3A 3IAUA 1KZGB 3FMOB 3HJRA 4EM6A 1LPSA 2JGFA 4WVLA 3GGDA 5JG7A 3ENNA 4CTMA 4G41A 3ZYZA 3N75A 1U7HA 4RVGA 4UAGA 4RD1A 2HFJA 4DKXA 2QM7A 3RUIA 3JQEA 1DL5A 2W93A 2QUIA 1KGDA 4KUHA 3HA5A 5KDLA 4ZEXA 1JA0A 1Y5RA 1DBIA 4KQFA 3VKGA 3QITA 1NIPA 3WR5A 4N76A 2BFCA 3JALB 5C5EA 4IMPA 1BTOA 1HO3A 2H3EA 1B0ZA 4RKFA 2J9FB 2NO5A 3PK0A 4G0NA 3EPHA 1TVKB 2FP4B 4M36A 4U8GA 3JAMA 1JG1A 2VP6A 3EZLA 3OSUA 5ITZB 1TO1E 3EW7A 1M2OB 3MUNA 2JFOA 4AAYA 1PDVA 1T1RA 1RBMA 1ODLA 2VK4A 2VA9A 3ZHSA 2A30A 3ITNA 4M0UA 2XCLA 5CYFA 3CNQS 3KJEA 4F9FA 1H9BA 5EESA 2I4TA 4CIWA 2IHNA 2GDZA 5HKOA 2IC5A 4ABTA 2A5JA 4HQOA 2ZAOA 3E84A 3MD0A 4P3YA 3K09A 4TN5A 4IWXA 3AV0B 4UEWA 1JSLA 2BCEA 2B1GA 5D86A 3K05A 2JH3A 1JU9A 2XE6A 4PPYA 4KX5A 2WD8A 1DUIA 1MW9X 2JGAA 4TGLA 1IAVA 2I54A 1XCPA 3PQ8A 1UJMA 5DIZA 5IANA 3VNRA 3HGQA 1Y1TA 2BVNA 4V1CA 2XE4A 2Y1FA 3TLYA 5TQ0B 1BFUA 1BEZA 1SUDA 3CUSA 3KPVA 1JFRA 2PT5A 1Q12A 1U9CA 1VLQA 2ACVA 1SXJD 2FAXA 1CUVA 3KUDA 3QLVA 4PYQA 1R9JA 1PWXA 2E4VA 3WTCA 5JQGB 4OVKA 4MUMA 2E21A 2V7QA 1DKLA 3TG2A 4YJHB 5AJYA 3TTXA 1Z17A 4U7GA 1N8KA 1CS0B 5KNDD 4Y9SA 2X9QA 3FYUC 1C3JA 2EZ9A 1LVUA 1Z6AA 1Z39A 1MJGA 2F43B 4YI5A 2F62A 5JMPA 5K0SA 1GA6A 4ARBA 3G0HA 1B41A 1X1EA 3BUSA 5KEIA 3UMBA 4DNXA 2H8KA 3LMKA 1DVRA 3A10A 4I1YA 3D8RA 1JLLA 2R00A 3CN9A 4LHWA 2V74B 1OASA 2GBGA 3IVMA 3LQYA 3H99A 1X15A 1UZNA 3IVAA 3R1IA 3ANYB 4FCCA 5AW7A 4QHTA 4O4JA 1KOFA 2F9MA 3PYMA 2JLUA 5J40A 1LQTA 3S68A 2JLBA 4N01A 4LTDA 1Z75A 2BE7A 4FZVA 4MVXA 4B6SA 1SWWA 3VPCA 1HX7A 4OUDA 1WSDA 3DVLA 2Z2YA 4IXWA 2LCIA 3KFXA 3VDXA 4INZA 1ISGA 3N6VA 3A3NA 1ZGZA 1ZN8A 4EELA 3Q4GA 5FPKA 2WWTA 3RRYA 2OZLA 1CVRA 2V3VA 3KO8A 1H5QA 6ABPA 1GGMA 1PV1A 4PYOA 3GZ4A 3E05A 1J42A 3AO0B 5CFPA 3E9EA 4BLWA 5IDQA 2GD0A 5D85A 1ODIA 1TYCA 3ROTA 1YKSA 4DG8A 1W1UA 1HNZB 1NOKA 2JJ2A 2FMIA 3OF5A 1YE3A 2PSJA 5BNWA 1IEQA 5T4FA 2BTEA 4N5LA 2W2XA 3PC7A 3DQZA 3C2QA 3JD4A 4GGPA 3RRBA 1I8TA 4C04A 1GPKA 1QHSA 4DMFA 5EJ6A 5F2KA 4OQLA 5KNBD 1LW6E 2D3WA 4YUXA 1WU7A 3K73O 1PR1A 4ALKA 2NUPA 1RC0A 2XUZA 4KAFA 2YZMA 1V71A 3R3SA 4O2RA 1QHHB 4HCJA 4ZOAA 2WEKA 5ILOA 4LVOA 4F38A 2OV3A 2ZBQA 1FMFA 1GZ7A 3ACDA 3HYCA 1WXXA 3QUSA 1KFEB 5J58A 4ECEA 2A7XA 1MV8A 2SHKA 4RMGA 2UXDB 1DTSA 3EDRA 4QX6A 4AKGA 1T8YA 3HCPA 4IXNA 1LRLA 2H2WA 2CV2A 4E32A 2C5BA 3NXKA 3AKDA 3OZCA 2SBTA 3ZLBA 2QW1A 1EVLA 5ICGA 4UBNA 1G5FA 1SOMA 1G19A 3BTSA 4TTSA 3DW1X 3DBLA 4HZUB 5LZ7A 3VA7A 4HNUA 1XPOA 1LZKA 1QH1B 2WU0A 4BAZA 5FFFA 9LDBA 5AVVA 3QBJA 2FB9A 5EJMA 1M2EA 4TZ0A 2P3OA 3T5DA 1U9IA 2YYSA 3FCOA 4OA8A 3EUWA 1PVVA 1GG8A 2PZLA 3CZAA 2YJNA 4HYEA 4O8CA 5DBOA 5CXUA 3LWZA 2X1LA 1CJCA 5JROA 2VIIA 4FYMA 4XB2A 3U7RA 2GN6A 4EP1A 2YWDA 3R7LA 1UBKS 3H1BA 1R6AA 2QU8A 2DPGA 2XMCA 3HJHA 3PS9A 4EKEA 3E27A 2D7DA 4Y1EA 5ICMA 3GH1A 5AKYA 1EJBA 3WY9A 1QYRA 4BYGA 1EUQA 4HNVA 2EZTA 3OZDA 1XMVA 2JIOA 3C6YA 2ZR0A 1E7MA 3R23A 3OZGA 1EFUA 4LDJA 1US8A 4A0FA 1E6WA 1RW4A 2NYVA 4MVJP 2LP4Y 3RS0A 5HF6A 1W19A 3OA0A 4BX8A 2G0TA 2H0QA 8MHTA 5AI9A 2DG2A 5JSHA 1N2IA 1P9WA 4NVRA 4L27A 5FCDA 3U62A 3H97A 2Z08A 6ADHA 5A1TA 1UC9A 3E53A 2HDHA 4HMQA 1P0MA 2QF7A 4RHXA 1RAHA 1QVWA 3QKIA 4DYHA 3P9PA 5JUWA 4CEJB 1V16B 3KEGA 3FCCA 1SAYA 2OFPA 1OC4A 2QT0A 1F8GA 3NT5A 5C2JB 5BYKA 4QXOA 5DDIP 3UK1A 2OAQ1 4CM3A 1H5NA 1QO0A 3RVKA 5J4YA 4IJ5A 1WD7A 4W82A 4Y2TA 3CFHL 4YRKA 4HLCA 1AZWA 5DK6A 4ZQEA 3HXOA 2XLCA 2Z04A 2QQ5A 5JU6A 1JEAA 4RDCA 1OAOC 1T8TA 1E3LA 2H92A 2ZDQA 1PV2A 4NCXA 5DNUA 2DR3A 4FLEA 5BRNA 1V5FA 4GRIA 3D6TB 3HUEA 3SZOA 3HUFA 3CI0K 5EKDA 5JFOA 2QTZA 5B7GA 1WUTA 3UW1A 1SVLA 3VU8A 1QE0A 2WT9A 1TAGA 3GBPA 3GA5A 4O2AB 4OQZA 1VRWA 3ZCQA 2O8FB 2ZJ6A 1TYDE 3EXG1 1Y4SA 3JR3A 5TT0A 3OX1A 3RBAA 4ZICA 1GAXA 1JPVA 4J0GA 5BSUA 1XLTC 3OH8A 3FOFC 4QBGB 5DP2A 2J9GA 2DE0X 2PU5A 4GI7A 3T7DA 3ZE6A 4L3OA 5BNTA 4HDSA 3GCWA 2W6PA 1OTYA 3QF7A 4O4IF 2ECQA 4BBZA 4PC7A 3DE3X 3K9HA 4HI0E 3BWDD 2CSXA 2EGHA 2H85A 4PGMA 1W47A 1RBYA 4RELA 3OWXA 5GIOE 4OBBA 1E9CA 2AOVA 3DL7A 3E3NA 1W4ZA 4MTLA 1WZCA 1Z88A 4RJJA 4NE9A 3U80A 5EWLB 1VYHA 4JJ8A 1TUBA 2LR0A 2B8NA 3I8SA 2XAUA 3LCJA 3ZNPA 1T1SA 3SBDA 1WE2A 4J4HA 5TGTA 4YT8A 1USGA 1I4WA 4KPUA 1F3LA 1X7WA 5D3QA 2HH9A 4B81A 3DTVA 3GEPA 3LHKA 4YIHA 3GPDG 3WOHA 4MGIR 1FDRA 3AOEC 2P2LA 3PD0A 2OCPA 3ICPA 1BMFA 2I9KA 5FPHA 1W85B 4AG3A 5T8KC 1Q0LA 4FZRA 4G0XA 1TZBA 2TSYB 3H5OA 3LUAA 4LDZA 2P79A 3TMAA 2OOKA 3SVTA 1GNTA 3KV1A 4OSEA 4JC0A 3VR6H 3RIHA 1PS9A 2N42A 4GPTA 4G85A 5EZYA 5G4KA 2ZSIA 4C7XA 4DRZA 1IY9A 3BWBA 3RGWS 5IX8A 4KQHA 3W06A 1UAAA 3KXIA 3I92A 1R4ZA 1Y33E 4S12A 2F55A 2C9BA 5TS3A 4MW5A 1QLHA 4DDMA 1OLUA 2YZ7A 1Z29A 2O1SA 1EPUA 1UJBA 2JD2A 1SG6A 2IF0A 4UHKA 3V34A 4G23A 3NH9A 4A4DA 4D8WA 4D56A 1YTUA 1V8OA 3H5IA 1M2HA 3FOBA 4FMDB 4KW7A 4QYTA 4PCVA 4ALLA 4IH4A 1XDDA 2VK2A 4EL5A 1FOEB 3HTXA 1HNWB 3TH5A 1YQ9A 1ILWA 2W4MA 4P84A 5CLIA 1LWNA 1FJGB 1T9CA 2C9DA 2C8LA 3L7KA 3MGBA 3VZPA 5FF9A 1I7SB 5CD9A 5IVPA 3L04A 1UPCA 1OYWA 4OB6A 3RRMA 5E6SA 4IMRA 2VJKA 3DVRX 3ZLUA 4NV3A 4RSHA 1USIA 1J9ZA 3A1DA 4NF2A 4RENA 1H5UA 4QYWA 3I42A 5LBUA 3BORA 4BNMA 4XCXA 5IK2A 1J2RA 4GPBA 2QTMA 2I99A 3I45A 3BD7A 2AD1A 4RIGA 4MPJA 3R5JA 4LE2A 5I8ZA 5KB3A 4FFDA 2EGUA 2B69A 3REFA 1M72A 4FKBA 2JVJA 1TE2A 1E1QA 3A1VA 4HRVA 1GZ4A 3PR3A 4GDMA 2JLWA 1A5AB 3TG8A 1QP7A 3P5SA 1KGSA 1Y7LA 2DHRA 1RZ3A 1SCKA 5DWQA 4Z9FA 1ODTC 4QUHA 3RT7A 1CJBA 3USCS 2DPYA 2VI5A 1L7BA 3EH1A 4DIMA 3AI3A 2VBIA 2YV1A 4N5HX 1Y4DE 1UJCA 3ECAA 1NVBA 3L6CA 2O8EA 3WV5A 5EJEA 1Q1QA 2PS9A 3FSEA 2R2GA 2BGTA 4JKOA 4S35A 3DHVA 3DW3X 1SEPA 4BNHA 3R9XB 2VUUA 3NHFA 4X8MA 1NXSA 1ZW6A 1V8BA 2OT3B 4LCEA 1KI4A 3RFUA 1B73A 1W5TA 3B6ZA 3QP9A 1GKLA 4X85A 5IFLA 1Y6QA 3ED5A 3JQ8A 3RVQA 3A28A 2PUCA 4MTCA 2J4FA 2QAJA 2CXRA 4D02A 4FHDA 4DY4A 1S2GA 1GCUA 2I6UA 2WYUA 1CFJA 3BJIC 3H86A 1OWNA 4JVSB 4XRRA 5CT5A 1WQ4A 2HPHA 5JCPA 2QTGA 3NHAA 4QO7A 4Y3UA 5GADl 2BEVB 3TQCA 1A7UA 3VR3D 4ZYVA 3H2SA 3M8KA 1P9LA 3PA6A 1KIMA 2R751 3QFCA 3E58A 2WUWE 4GOLD 2FUNB 3ZYCA 5K09A 4NEHB 2BISA 5F76A 1JHRA 3OIUA 4S1OA 4P4NA 1CUHA 2J5QA 4I5EA 1J0DA 1JG3A 3Q85A 4PX9A 4FFNA 1E1NA 1YZLA 4K1LA 1IHOA 2GDJA 2N3ZA 1E7QA 1MMFB 1P7CA 2Z9DA 4I14A 4QGGA 1SPXA 1V41E 4EVRA 2IZ0A 1R50A 4LJ4A 4V03A 3HU3A 4BKPA 3D8UA 2A9RA 2JEYA 4HYTA 1QZUA 4G36A 5EJGA 3KQTA 3M9LA 2YL2A 5INTA 1ODSA 4NEQA 1ORVA 2PVSA 2Y0DA 4BQOA 1IBMB 2OM6A 2VDJA 1WV1A 4BO6A 5IUKC 1Z06A 5IKXA 2BUCA 1TYZA 3B9QA 3WRVA 4UVIA 5C8YF 2B83A 2VK8A 1DOHA 4GOOD 5KU7A 3HL4A 4J07A 2QRNA 1K7EB 3BF8A 1M34E 1XTJA 3IE2A 2CNWA 3DR5A 3JXEA 2BZ0A 3ZC3A 4BFXA 4DCUA 1XX6A 1THGA 4X8LA 3ND5A 1MQ8B 3RBVA 4QBFA 4YN3A 7YASA 5KREA 1ZLXA 4HBZA 3NVDA 4XX1A 3STYA 3ZCSA 4D5GA 2HJRA 3D6HA 1QFXA 4EUSA 4R0MA 1VHLA 3PDHA 1VL8A 1P2TA 4QT0A 1KZ7B 1JTVA 2XF2A 4WBSA 3WGJA 5CDUA 3ZTTA 3GHHA 1JT9A 4QOEA 5AI6A 1O96A 2A9VA 1YZHA 2R9VA 4XFJA 3CJTA 4IQFA 5EUCA 4K28A 4M1SA 3VTAA 3DVAA 4URFA 1JS1X 1QFSA 3SJZA 4LNUA 3MGAA 3W04A 1EDBA 5G1OA 2IP2A 1OGJA 2WM2A 2BBOA 3NM5A 2TMDA 4A03A 5ALSA 1KJQA 3QV2A 2NIPA 3LRTA 3R3UA 4JIMA 1DO2A 4PQFA 2F59A 2ZT8A 5JT1A 1Z4MA 2GWHA 3OTIA 5JO0A 3MF4A 4XVRA 4Z86A 1H05A 4C7BA 3HQ4O 2ATXA 4MKFA 3WLMA 4X00A 3F5SA 5T4HA 4WXEA 3B52X 1Z3CA 5H3LA 2CJPA 3TYXA 1YJBA 4HFRA 4AM8A 2BHTA 3WFZA 3TXXA 5JSZA 2XKAA 2PRSA 1H1DA 1VA4A 3WLKX 3LUFA 4GBED 3FVTA 4OGWA 2HF8A 5TXGA 2JHCA 3GGCA 5KTKA 1RM5A 1I1NA 1NVDA 3BCRA 4IRUB 5K0TA 2JFYA 4FHCA 4X64B 1VG8A 4EA8A 1T0IA 3GOQA 4CKBA 1MA3A 4J1TC 1FX0A 3LHIA 4FNGA 3SS7X 3W4IA 3SSOA 4C87A 2FSIA 1DQSA 4I5FA 2ILTA 4J7AA 1CDZA 5HS6A 3VPHA 3DEAA 4HUTA 2X13A 5DHAA 5EP1A 3V7NA 3HYNA 4JI8B 1WCV1 3EF0A 4QM7A 1XT6A 4Y2QA 3TLKA 3W79A 4DLZA 3WRXA 1P4GA 3R8FA 2ODNA 4HZGA 4DA9A 2YJ3A 2QPLA 3G5MA 1YR1A 3E9MA 4RESA 4ZEWA 1E79A 3RUHA 3I9FA 1Q83A 2A84A 5EE1A 1KE1A 4I1UA 1SUIA 1RACA 4MGZR 3SSMA 4PZDA 5KI6A 3ZVMA 1XEXA 4REQB 1G9XA 2IPOA 1S01A 1KMNA 1JU4A 2WAXA 3JZDA 4O2BA 4XB6B 3ZHXA 2BKAA 5GJBA 1TKRA 1Z0AA 2I66A 4PSDA 1UMDA 2MYNA 3EG9B 3CZPA 3KTFA 2EX0A 1H93A 5CH5A 4UM7A 3QOYA 2FHPA 4DLYA 2HQBA 3K9QO 4PEVA 4HB3A 4K9QA 5A3SA 5D3ZA 3ZWQA 5BR1A 4K2AA 1IVYA 8LDHA 1M2WA 5TSDA 2RH9B 3CH7A 5K0JA 5KKCA 3NDBB 3WLQA 2X23A 4NHEA 4DCNA 1A1SA 1DCMA 1D4OA 5GP1A 5KOHA 5LVAA 1MX5A 3FPFA 3HFRA 3M6LA 5EJ9A 1M8GA 4NAVA 1ZINA 4LYJA 3WMGA 5EG5A 2CW5A 4B3CA 2VSNA 4PPFA 1DAOA 4WXMA 3X43A 3PNBA 5ADVA 3FJ1A 5DTMA 3M9XA 3VV2A 3DF7A 1JQDA 4BS9A 1XMQB 1Y7HA 2OBMA 1C30B 3G79A 5THQA 4RCYA 4XCVA 3TMKA 4CCSA 2H65A 3OE5A 3SD7A 2YY5A 3PJDA 4GM0A 1SVKA 2Y27A 1YOBA 1R6BX 3NUZA 4JT4A 5AVQA 3TD6A 2DX7A 4F84A 2MYTA 3W5BA 3QE2A 4OMFG 2ZT7A 4IHJF 2W0SA 1MO4A 4P22A 3I9NA 3OPNA 1FP4A 3FROA 1YT5A 2DJ5A 2KI5A 2RGNA 1Z4IA 3DZIA 4QU5A 3JQ9A 4KMOA 4BO5A 4F56A 4C03A 1ZXBA 4KDFA 1CETA 1T9BA 3A11A 3H18A 4NZOA 3PTAA 2FVYA 3HCRA 3IAAA 1VDZA 4JGIA 2LMEA 1EEXB 5DBHX 1Y5LA 4BNYA 1C1HA 2IYEA 1DAGA 1Y8QA 5TF4A 3V8EA 4C6RA 4JKYA 2RHTA 4FOOA 4J0DA 5SZJA 2E18A 2IZ6A 3GUUA 3I04A 2NGRA 1GRCA 2OXEA 3IUMA 1C80A 3N2LA 4KHZA 4NECA 1EP3B 5DTJA 1V1MB 3QJGA 1EUDB 1ULTA 3L77A 3MOIA 4YECA 3R75A 1LLUA 3CLTC 4DLSA 4ZREA 2B2NA 1I24A 2CHUA 1M2JA 2XHEA 2J0UB 2J6CA 5ALNA 4YAWA 1PQWA 3R0XA 4K9PA 3PFKA 5DX8A 1GR0A 3EEFA 1XJCA 1Y3BE 5LFAA 1FIUA 4II2A 2OHIA 4ITUA 2WHYA 5FO0A 1TUBB 1JYSA 5KYUA 1F2VA 3P97A 5IVIA 2WJIA 3QLTA 1PKXA 4ME6A 1HXHA 4BHRA 4R2IA 2OGZA 1SQFA 4BIIA 1AZSC 4OQYA 2YJZA 3JY6A 4TXLA 4UOZA 3PQ5A 1ZMBA 1X7WB 2PRYA 1JEQB 3DTVB 3QPVA 4HC4A 3UYLA 1DRJA 4BTLA 1Y8ZA 1RWVA 3FYSA 1YL6A 4IXMA 2ETVA 2A50A 4CLRA 4B6PA 1VP3A 5TC4A 2PTHA 4I6JA 2PMEA 2WAOA 5IM4F 3HS3A 2JD0A 3GLFA 3KKEA 3EWAA 4RADA 3PNVA 2C07A 2YIVX 5FPQA 5DP1A 3R8XA 4PLYA 3HPRA 4WHMA 1FQWA 4C5BA 1FDTA 5DH9A 5E7JA 4WUTA 3WHPA 3OQBA 2B4TO 5CW2A 5EXXA 1QH9A 1IPHA 2B0CA 3VPFA 4F5WA 3IELA 1BYUA 2XOEA 3EN0A 1PZXA 1R0YA 1PFYA 2HA7A 4JLAA 4IS3A 4LBZA 1Z7BA 4TUYF 3VR4H 4EA6A 3HXKA 3AF4A 3H7IA 4N65A 1YDWA 4W99A 5E1BA 3UXYA 3GRUA 3H65A 2XDQB 3ORYA 4F3CA 2QTAA 2GAOA 2VJMA 3KT0A 3D7MA 2GEUA 3ASYA 4WA7A 1LEHA 5DSXA 3UJAA 3WLFA 2EBHX 3QPBA 4FGWA 2RH8A 3B1KA 2CB9A 4KB5A 4CNQA 3HWX1 1RHJA 1HZZA 2OHXA 2VRCA 3H1AA 4URXR 2C98A 3RIXA 1DKRA 1YCHA 4D8VA 4ZV4A 2H59A 5CFOA 4W5OA 1D2NA 2EDAA 4L75A 1FU7A 1G3RA 5KYYA 2Z6AA 3C3EA 3CF0A 3ZX5A 2ZRKA 3W6OA 3WDMA 1TCAA 1W7AA 1YO6A 2XCUA 1Y82A 4GRAA 2FRXA 3IDOA 3QVJA 3UATA 3L01A 2W2MA 4XYGA 1HQYE 5BQOA 5HFAA 3S2YA 2CLEB 3NTOA 4OXXA 1KPIA 2CHEA 3LX4A 3G5LA 3M3HA 4US2R 1LC3A 2VKQA 2XDYA 3HKCB 4FMCF 4N0DA 1EXVA 1DJPA 3PUIA 4M8KA 4NMHA 3T3OA 4XJVA 3LF4A 4Q4HA 1NR7A 3OFJA 3R9IA 2WSYB 3Q12A 3IUEA 2LV8A 2VG8A 3NYQA 4HGNA 4NAHA 5KCMA 1GFSA 1KC3A 1MO6A 2BI8A 3HA7A 3TZLA 3P0IA 4E4YA 1B6TA 1JDVA 4PLCA 5SYAA 3SGLA 4REMA 3GVXA 1AQUA 4QFBA 3PFIA 3RYTC 3TEFA 4EGFA 4OY3A 4TS4A 2O8EB 3LXRA 4KQCA 5HDQA 3TLJA 1MB0A 2ZJ4A 2Z8ZA 4V38A 4XYEA 2K4MA 2BFWA 1JAZA 1BDMA 4B3HA 4F86A 4WBNB 2XA1A 1E5XA 3F3YA 2B9VA 1YSCA 1PR6A 1OA1A 1PK8A 1Q1BA 5E9AA 4S1WA 4EHHA 2GPWA 3D6UA 2CLCX 1XMOB 1L4UA 1ZSNA 4CL0A 1STOA 3STXA 2QNIA 3E6AA 2GBIA 1KYXA 2Q3MA 1YBAA 4OGFA 4MUEA 1E8NA 3Q9SA 2DPLA 2JL1A 4WRRA 5CT4A 1Q7EA 1MDBA 1K3TA 2GD1O 3BHJA 4RKQA 5A04A 1H85A 1XO1A 1II8A 3WA6A 5BN5B 4ZC1A 3GLGB 1JBKA 4ZT7A 1P1FA 2JJ8A 1JVSA 4OHCA 4PPNA 3WMRA 1U7DA 4DDWA 3FDIA 5E2AA 1OI2A 3B5JA 2HUPA 2YUTA 1O03A 3HACA 1UDWA 5I4CA 3B7WA 2AZDA 4RFSA 1F06A 4OI2A 1N5LA 3N28A 4O8ZA 4W9NC 4B17A 3QKWA 4DDVA 5ALPA 4E07A 1JYEA 3B2EA 4KFRA 4B3XA 2J33A 1H2YA 5LL6P 3JRXA 1UBSB 3OT5A 1K97A 1RAEA 4KYVA 3BXOA 2HAEA 4IG9A 3S2UA 2YQ5A 5FJIA 3CVOA 4GM4A 4HNGA 4P58A 1V48A 1DXQA 2R5WA 3KQYA 1WV0A 3QEJA 1FFXA 2X2OA 3QPWA 4TSRA 4DT1A 2WVJA 1U8ZA 2BGMA 2Z1DA 3DAYA 4WCFA 1HSZA 2CXSA 3L40A 4I5IA 1O77A 3U3XA 1I1OA 3BXFA 1U1IA 3GCXA 4D96A 1T8PA 3SQWA 4GR9A 3IKJA 3JZFA 5PNTA 3MBKA 3TSCA 1I6LA 1O6ZA 4H18A 1ADYA 2FWBA 1I4LD 5IJ9B 2IHTA 1MBZA 4FFOA 4HTAA 1YGPA 4QUKA 2E89A 3T35A 2W4IA 1W8IA 3WK4A 4N5DA 1EVYA 4BXOB 4EJSA 4N82A 2QSYA 2ZJBA 2BM1A 4I36A 3KEOA 4MJXA 4YAEA 2R65A 4A0HA 4O3MA 3P4XA 5I7AA 2WWXA 1HA3A 2EFJA 3R5HA 4YRAA 2V98A 1JNYA 4ER7A 2IVZA 4OLFA 4EABA 1WG8A 2I3ZA 1IPFA 1MH9A 3WX0A 4E33A 2A54A 1I0ZA 3SYKA 4NI5A 1Y8AA 2REXB 1JTFA 1THMA 1RJFA 2P2NA 3O8QB 3OTQA 1P1IA 5BPFA 2HNKA 5CFMA 2YBEA 4D8UA 1IRXA 1Z8NA 1UPBA 2FPWA 2ZIAA 3WZ2A 4CU2A 3LO5A 4HDNB 3K71B 5DFAA 3H5WA 4KSBA 4A36A 3B48A 1GNPA 1JQ5A 1KFKB 1FX0B 3ZQ6A 3IHTA 2AC4A 2CLFB 4ND7A 4TQGA 3Q8MA 3TUIC 5FD8A 2WD7A 2Z1MA 5C34B 3UV6A 3BPSA 2UV8A 3WLSA 3T9BA 1BYIA 4QOSA 2AZMA 3W9YA 3OZIA 3Q3GE 4BZQA 3C4QA 3PXCX 3CA8A 4ZGGA 3INNA 1SU7A 3O38A 3B6JA 3WB0A 1NJ1A 2D54A 4N0QA 5FOVA 3EDOA 3CX8A 4OHBA 2X5JO 2UXBB 5BRAA 1GZVA 3CGGA 3KQHA 3P0JA 4HD8A 4I8DA 4KRGA 5ICFA 1PJCA 1U2GC 3C6BA 4WKGA 1ULUA 3PSHA 5AUOB 2MHCA 2XNJA 4IIEA 3A4LA 4L4UA 1YQQA 1MENA 4CJXA 2J0QA 5KMGA 1SNYA 2Q6VA 4ARIA 5F5LA 4WY8A 4MLDA 1RIIA 3DZ8A 4Y2PA 1L8XA 5EJIA 3ZZ0A 3A31A 1Q57A 3L8HA 5KWIA 1JWBB 3GUZA 3B1JA 3S7TA 1Y3DE 1Q77A 5CU7A 3R0JA 5D5PA 2X0EA 3EISA 1W75A 4D99A 4OAOA 4EYGA 3L92A 3RDPA 2W22A 3RK0A 2R60A 4RQAA 3RB8A 3MD9A 1PKEA 1QKKA 3ESDA 4PAMA 4CE6A 4I1PA 4YREA 5HE8A 2YY6A 2XNSA 1UOPA 2NAFA 3BBPA 5GAJA 4LOJA 4DLPA 2WD9A 3HRHA 2NTYC 3L1HA 1GZUA 3LM8A 3QE0A 4MV1A 3CCCA 5ALUA 4YYEA 4CL3A 4F2WA 2O9JA 3H9UA 3P71T 3ZGOA 5F2NA 1WUYA 1KEVA 5EJ2A 5J2TB 4CT5A 5IW8A 3NMUF 2C83A 1XL1A 5CR9A 3AR2A 3LTEA 2P8SA 4YJ3F 5FH9A 2Q5HA 1KI7A 5H80A 3JZAA 1SOAA 2C42A 1YVDA 1I2CA 2C9ZA 2XYVA 2IH2A 5JSYA 1K0UA 2R8OA 1C3VA 1ACLA 1DDGA 3QBDA 1ZNZA 4LA4A 1WPRA 2QYTA 4NS4A 3D8NA 4R2LA 1IVNA 2HK9A 4LOLA 2M6RA 3F67A 4WEOA 2W0MA 4F1WA 1RWOA 3L0IB 4R41A 5B4TA 5C53B 1K2VN 1FP4B 3DC7A 3I58A 3LZ6A 4LRXA 2P1ZA 4RVCA 5JXIA 4TRRA 1DTWB 1KI3A 3V9AA 1H2XA 4L4XA 3SZGA 4DIFA 2DCUA 5ADHA 2A1UA 1MX9A 4C3ZA 5G02A 1QFJA 1U28A 3GX1A 2AIRA 2I2FA 1RU3A 1JIUA 1TJ3A 3MB5A 4MR9A 3V46A 1SQSA 2PUFA 2V1UA 4WSOA 4MUHA 3EQ9A 1JFSA 1XUOA 2EV9A 1PR3A 3SG0A 2HNBA 1B6GA 2XRYA 3UK2A 3DZBA 2AOUA 3SHFA 5UKDA 3AR5A 5ALIA 2MJLA 5JEEA 1Z25A 3FPSA 5G3ZA 3VYVA 1RLIA 1UJ4A 2ZJFA 3TE7A 3KQVA 4YRCA 1P4SA 5GZ1A 2J46A 2NV0A 4KIWA 5K0ZA 3AOGA 4KN6A 4B40A 3QFHA 5JYDA 4OLAA 1V95A 3NGXA 1S2MA 3ESCA 4NEGA 2W2PA 5AJWA 4BB9A 3B9BA 5HEKA 4KP7A 3OO0A 3NETA 4OXQA 2I7VA 3CLTD 4M1TA 2Q5FA 4L28A 2Q6TA 4DR4B 5F51A 1O95C 1NW5A 3TQTA 2M6LA 3A2MA 1CB7A 3OQIB 4I50B 5LB2A 4K8OA 3RJZA 2C4MA 4DR6B 3K15A 1LCIA 2BPOA 2XZOA 1OCEA 2L69A 3BE4A 3N3AC 4OQPA 4OHMA 3S70A 4LFAB 1DBSA 2IUTA 1Z7YA 2OV2A 4C1BA 1LRKA 3MLEA 2R8YA 1HLFA 4NL4H 1SZDA 2ARKA 4ATNA 1XTTA 2VEDA 1G64A 2RDMA 3M5WA 3ZY4A 5CCXA 1E96A 4BFWA 1WXWA 3QTBA 3M5DA 2VDUE 1C1DA 4MS1B 2QBYA 5PGMA 3DZFA 1NQAO 5AHOA 5A4JA 3O92A 2CJWB 3COSA 2Z58A 1EWYA 4GEKA 3P2JA 4AY6A 2IK8A 3KXKA 3RUAA 2WFMA 5DKFA 4DA6A 4AURA 2GLTA 4R9RA 3TGWA 2R1VB 1QVZA 1S8AA 2YFKA 3CVXA 2REQA 3FN4A 3SX2A 4DAOA 3MMXA 1VE9A 1FTGA 5E6RA 3QUCA 1RE1A 5IKPA 3ELWA 2IBTA 2Q3DA 4H7EA 1ES9A 3KSBC 1O3YA 1S1MA 2X5NA 2NVUA 3DOUA 3G2NA 4G9EA 2Q21A 4HK4A 4JLKA 4BBAA 4EUFA 3QMPA 3AIMA 4NBUA 4BN5A 2VJMB 3GJ0A 4H2DA 3DUFB 4QXAA 2H3HA 2I6TA 4OI4A 3W78A 4LK3A 3K9BA 5A7GA 4CEIB 3BICA 2RHGB 1Q21A 3HKDA 4U7PB 1JKMA 2JLRA 2VCEA 4IOMA 5ENVA 2VNHA 3I1YA 3P96A 3C1AA 2H8GA 2ET6A 1J7KA 3ZCPA 2YDXA 3E9QA 3EXFA 3TNJA 5A2QA 4CI0B 1Z4NA 3DYBA 2VUHB 4RE5A 1CXZA 2GO1A 3LRXA 1RS0A 5FUYA 4YUZA 4HHEA 1Y9ZA 4M0KA 3IA2A 3CVWA 3RSLA 1M0TA 3AJ8A 3IEXA 3TD2A 3ZCVA 3FBTA 4Q7QA 3RSOA 3COZA 4BTEA 4B32A 4BQPA 1ISSA 1BW9A 2G5GX 2Z57A 3AI7A 4KFUA 1CJMA 4D4IA 3H5RA 3FRIA 1FNMA 1ZJYA 2BGJA 1ZISA 1NXTA 4GYKA 1KIAA 2WIGA 4NU0A 2O2CA 1ZC4A 3AR8A 4MQUA 5EEGA 4QUBA 3H2ZA 2R8EA 2RB4A 4RVUA 4Q4HB 1UUFA 4UVEA 2D1FA 4EUHA 2PTGA 4BGVA 1VIDA 3QH4A 3L06A 2IH4A 2AFHE 4BWGA 1E1CA 2FN3A<