3Q12A

Pantoate-beta-alanine ligase from yersinia pestis in complex with pantoate.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
285
structure length
285
Chain Sequence
AMLIIETLPLLRQQIRRWRQEGKRIALVPTMGNLHEGHMTLVDEAKTRADVVVVTIFVNPLQFERPDDLAHYPRTLQEDCEKLTRHGADLVFAPAAADIYPAGLEKQTYVDVPALSTILEGASRPGHFRGVSTIVSKLFNLIQPDVACFGEKDYQQLALIRKMVADMGYDINIVGVPTVRAKDGLALSSRNGYLTEEERQIAPQLSKIMWALAEKMALGERQIDALLEEAAAQLLRVGFTPDELFIRDAETLQPLTVDSQQAVILMAAWLGKARLIDNQLVDLRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantoate--beta-alanine ligase
publication title Pantoate-beta-alanine ligase from Yersinia pestis.
rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 96
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3q12A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3q12A01
1OWMA 1P7PA 3CLUC 3RJZA 2V0GA 1G8HA 1TYCA 4MWCA 3RK1A 1WXIA 4MWEA 1N3LA 1EUQA 4A91A 1F4LA 3GLVA 2IP1A 1XNJA 2D5BA 2QUJA 3H97A 3KT8A 3A4IA 3K9WA 1I6MA 3PNVA 2J07A 2J09A 3PXUA 3KT0A 3CVUA 3ZGZA 1WQ3A 1O5TA 4QBTA 2QJTA 1LI5A 2A1UA 1KAMA 1MC1A 4UZFA 5KHAA 3CA8A 2DXIA 2EJCA 1M83A 4ZCPA 3ND6A 1FFYA 1IHOA 2HGZA 5KCMA 1IQ0A 1KH1A 1O96B 4DJAA 2QTRA 2AKEA 1OBHA 2PG3A 2GM3A 1N78A 1WOYA 3CLSD 4G5FA 3RHSA 4OJMX 3D6VA 2DEUA 5FNZA 2QUKA 4K0RA 2CYBA 3U1VA 1QJCA 3TNJA 4AS1A 3ISJA 3Q4GA 1ILEA 3S3TA 1JILA 2CV2A 3FNRA 3Q12A 4JZYA 1VL2A 3CLRD 4CT0A 2E21A 1O97D 4MW2A 2G36A 1QRTA 4ZT6A 1YI8A 2B7LA 3G6KA 3MUEA 5DB4A 3LOQA 4JYZA 1S4MA 3CLSC 1Q19A 4S1OA 1U3CA 3FIUA 1KQNA 1J70A 4MUGA 3IOBA 2J4DA 2PZAA 1QRUA 1PG0A 3RK0A 1JEDA 3MMXA 1TEZA 4WSOA 3CVXA 1J1ZA 1EE1A 2YWBA 1KORA 4KR7A 3CLRC 1QTQA 1OWPA 1EFVB 4PBSA 1O94D 2PXHA 1JEEA 3F3MA 2Z3VA 5F23A 4E1AA 4MVWA 1TFUA 1OBCA 4EG8A 3TQOA 3ND5A 4I6JA 4FZJA 2QUIA 2XRYA 4MUIA 2WQ7A 2H29A 1IVSA 1LI7A 1QQTA 1NI5A 1N2OA 4AQ7A 3ZJUA 1V8FA 1COZA 2DPLA 5KWVA 2PZBA 2EL7A 3G5AA 4DLPA 5J58A 1PFWA 5DEOA 1EUYA 1EXDA 3ELBA 1O94C 4L2IA 1R6UA 3FWKA 4MUKA 2QUHA 1H1TA 5J5AA 5LM3A 1I6KA 3AFHA 2VTBA 3INNA 1OWNA 3X1KA 3H9BA 4KR6A 4ZT3A 1N2BA 4Q93A 2CSXA 1RQGA 3X1JA 1WXEA 4HJRA 4XFDA 3FG9A 2OQ2A 3P0JA 3HL4A 3HFJA 4R0NA 3PRHA 3UOWA 4EG1A 5DK4A 4ZCQA 1ZH0A 1MJHA 2ZUEA 1IRXA 4GRIA 2VXOA 4MULA 1YUNA 4MLPA 5HUJA 1YULA 1OWOA 2A84A 2YWCA 3FH0A 2Z09A 4Q16A 1QNFA 4MUEA 3SEQA 1K92A 4MW9A 4QRDA 2A1UB 1JECA 2IELA 4NAHA 3TQIA 3X1MA 1JIJA 4MVCA 4G6ZA 4I6EA 2IJGX 2BYTA 3IOEA 3JXEA 5JBNA 1T6ZA 1NZJA 3TZEA 4JXZA 3MLAA 1KR2A 1U7XA 4J75A 1JZSA 3K32A 4MW0A 4EG3A 4KPUA 2A86A 2CFOA 3CVWA 3RFFA 3IDFA 3LCJA 2CYAA 4X0EA 3BL5A 1GPMA 1XNGA 4MWBA 1XNHA 2DETA 1R6TA 2NSYA 2BTEA 1WJGA 3IMCA 3VGJA 1NYLA 4BWVA 1IH8A 1TQ8A 1GN8A 1YIAA 2HMAA 3HGMA 4MWDA 5EKDA 2A1TS 3KFLA 1TYBE 4ARIA 3CVVA 3Q10A 3FOCA 1MRZA 3A2KA 3SZ3A 3ZXSA 1J20A 1YUMA 1J09A 1WKBA 3HMQA 4YP5A 2DR2A 1NSYA 4MUHA 1ULHA 3N05A 4JXXA 5TEWA 2A1TR 4CDMA 1GTSA 3E27A 4HPWA 1TYDE 5FO1A 1U0BB 2R5WA 2NZ2A 5DASA 2I1LA 3VU8A 1ZJWA 1B6TA 2Z08A 4R2MA 4PBTA 1CT9A 2X3FA 4CDNA 4MW5A 4DDKA 1EFPB 4NZPA 2CT8A 1H3EA 1IQUA 1JZQA 3AG6A 1I2DA 3M5WA 4RPIA 2WB2A 3AG5A 2PFSA 1T9GS 3SDBA 3IODA 3COVA 1O97C 1KP3A 2RE8A 1Y42X 4L2IB 1N2HA 1KH3A 1IFXA 2ZUFA 1KAQA 2VTBB 1T9GR 3ZIUA 1DNPA 3PNYA 2CYCA 3IUBA 1NP7A 2PZ8A 3UMVA 1QU3A 4MQ6A 3UK2A 1EFPA 4KKVA 2QJFA 4MW6A 4UZEA 2H2AA 1IQRA 3IH5A 2ZP1A 2CV1A 4DDMA 1BS2A 1G8GA 1ZUNA 4OUDA 5K0TA 3FDXA 1M8KA 1VLHA 3P0HA 1KQOA 3G59A 4U63A 1TYAE 5FO0A 4DNXA 2WSIA 1M8JA 3AL0C 4EG6A 1WXHA 4CQNA 1U7DA 3IMGA 4R2LA 2RD2A 1N77A 4HJXA 2J08A 2OV4A 4MUNA 1KKUA 4ARCA 4ZCSA 2GOYA 1PFYA 1FYDA 3COYA 3IVCA 4MVYA 1H3NA 4I6GA 1F7VA 1MBZA 2V0CA 2X1LA 1HYBA 1X8XA 4YP6A 3CVYA 4KPUB 4PBRA 1H3FA 5K0SA 2X0KA 4HK4A 1JGTA 3N2YA 3P0IA 1Q11A 3FHJA 3COWA 1PFUA 1O6BA 5H16A 3A04A 2QTNA 3KT3A 1J21A 3L93A 4ZCRA 3AKZA 4P2BA 1O0BA 1NUUA 1LW7A 1T6YA 2HZ7A 2YY5A 3ZUGA 1A8HA 4ND6A 5HUHA 1F7UA 5J59A 2QJOA 1I6LA 1K97A 4MAFA 2E18A 3UC5A 2D13A 3DO8A 3QE4A 4NATA 3ILVA 3DV2A 3QTBA 1N2GA 1EJ2A 5TGTA 1K4KA 3FETA 2J5BA 3OP1A 1KH2A 3MXTA 1M8GA 4J76A 1OWLA 4MVXA 1J1UA 2JA2A 3UY4A 2DUMA 1M1ZA 1JIKA 3FI0A 1Q77A 1KP2A 4MW1A 1NUSA 1N1DA 5BNZA 1N2JA 4G5YA 4MUFA 4ZCTA 1MB2A 4EF6A 3I05A 1NURA 3A05A 1N75A 2X1MA 1GTRA 5IHXA 4QREA 1NUQA 1VBNA 4GU5A 1MOPA 2C5SA 4XSVA 4K03A 1G8FA 1U3DA 3KT6A 3VRHA 2GKSA 2WQ6A 4NAUA 1GLNA 4PY2A 3COZA 3ZXIA 1Q15A 3GUZA 1WXFA 1M8PA 2YXNA 3H9CA 1O96A 4NDAA 3LE8A 4ZT4A 3C8ZA 1K4MA 2O8VA 4KR9A 3IVGA 3AIIA 5LLTA 4OUDB 3PNBA 4MW4A 1T6XA 3H05A 4RUKA 4WNYA 3GMIA 4MUJA 1O0CA 4EFKA 2E0IA 1PFVA 2D54A 1M8FA 3SZGA 3MLBA 1OD6A 4EG5A 4EG4A 1ZH6A 3CLTD 2A4MA 3SEZA 3SP1A 1WZ2A 3NBKA 1VBMA 5IJXA 1QRSA 4DE5A 4ND7A 1MAWA 4ZT2A 3SYTA 1O95D 1N2EA 3FY4A 3CR8A 3TS1A 4F4HA 2A7XA 3HZRA 1WQ4A 3QTTA 4EGAA 1JHDA 2XRZA 3ZJTA 1JIIA 2CV0A 4XFJA 1X6VA 5HG0A 2O5RA 1KQPA 1G59A 3OTWA 4YBRA 3RBAA 1XJQA 1MAUA 1QU2A 1YIDA 3CLTC 3IOCA 3D6UA 1WY5A 2JANA 1EFVA 3ZJVA 1GZUA 4ZT7A 2E89A 4U7JA 3L92A 3NBAA 3N8HA 3IVXA 1O95C 3TZLA 1JMVA 3H99A 3IUEA 2AG6A 3DLAA 1MB9A 3DPIA 5LFAA 4NX2A 4U8HA 2QTMA 4YP7A 3IMEA 1WXGA 3CLUD 1R6XA 4YMIA 1VBKA 3NV7A 1F9AA 1NUTA 2CUZA 1D2RA 3P52A 1UFVA 2TS1A 1PG2A 1N2IA 3ND7A 2PIDA 3N9IA 4MW7A 4EG7A 4ZT5A 4JFAA 5H7XA 5TEVA 4TS1A 1V47A 5AHWA 1SURA 2AZXA 4H3SA 2DLCX 2A88A 1GAXA 2JAXA 3HV0A 5TS2A 4F3RA 2DERA 1NUPA 4DDHA
chains in the Genus database with same CATH superfamily
1G21B 1YJQA 2GETA 4FB4A 2UVPB 2ZJ2A 3W2TA 3GIDA 2DHCA 1IY9A 4ICIA 3H4IA 2YMQA 4KNWA 4MCIA 5BSEA 5KYXA 3DEFA 2BMVA 4MCJA 4P3PA 2EWWA 4P4TA 1GKYA 1L7BA 1LW6E 2P3LA 2OBLA 4UHFA 2DFVA 4I1PA 1FQJA 1Z0SA 4XYBA 3A4IA 2PL9A 3D8RA 4OOFA 5M34A 1SCJA 3THSA 4MV0A 4ND2A 2ZJAA 5CHEA 3LOUA 5DM0A 3P20A 3RTEA 3TJMA 4V0ME 2IEGA 3U9TA 4BTVA 4TV8B 2PFKA 4C4RA 3D1JA 3HB0A 3WLLA 3PFWO 2C95A 2RHTA 4UEQA 2QXYA 2CDNA 4AJ2A 4B7AA 3RVLA 4ES6A 2HGZA 5JANA 5BURA 1O96B 2WZQA 2BW0A 3PYLA 2R96A 1NXPA 4DDVA 3TTSA 5AW9A 1UODA 3QELB 4Q9LA 2RBGA 3A6EA 1D1SA 1W88A 3GLUA 4FQ5A 3QPCA 3SS7X 3MILA 4M1MA 4XSHA 2YJ3A 3G9XA 2VHVA 1Z17A 4NNPA 1VKOA 2EERA 5HP4A 1V96A 1NPYA 2FWMX 2P78A 2PR2A 3DULA 1N36B 2FPKA 1NKVA 1ZIOA 2NO0A 1YRYE 3BWBA 2X1HA 4GPD1 3KQTA 3REOA 5DIFA 2IZ0A 5DRTA 1ILEA 2CZQA 2Q4EA 3IQZA 2LP4Y 4GPAA 1NN1A 3K31A 5B36A 4D0NA 5HCUA 1J2UA 4AKTA 1V2HE 5IAOA 1MDFA 4UVHA 2ENWA 2ROQA 3CF6R 5FR1A 5AQ1A 2IX3A 2VLIA 1ICIA 5GQSA 3MUEA 2JD2A 2YC2C 4W9RA 5JUWA 1U2PA 4GQBA 1ZNZA 3ZKAA 5GJBA 3OA2A 2C5BA 2IF2A 1XDZA 4BECA 3EASA 2HJ9A 3C8DA 1HT2E 2WTBA 4Q01A 4UTXA 1ACMA 2B3TA 2BFDB 1QPGA 1V71A 1T1EA 1YS4A 1TRHA 2PH5A 4FDVA 5ENZA 3TYXA 2R6GA 1CUGA 2P9CA 1P17A 1P80A 3MWLA 3EGWA 5AHKA 3TDNA 3G9ZA 2WFAA 3AJRA 5CRIA 4LHWA 2Q3BA 3FNGA 5DGHA 3GPCA 4OI0A 4EELA 1R9NA 1O94D 3A1WA 4CW7A 2WUWE 3EA5A 5F64A 2P1DA 3F9RA 3HKCB 3BIFA 1N4AA 5IWCA 2BIFA 2PT9A 1Y4UA 1DO8A 3LS2A 4WY2A 4C0LA 2IPAB 3OT4A 1D4OA 4ZVOA 2JLZA 4Z4IA 2RBEA 3TLKA 5IHPA 1KZYC 1E2JA 2JJQA 3C3BA 4CKYA 4PQGA 4FZJA 3KZOA 1GZ3A 1L4BA 1MX3A 1NXTA 4J4TA 5IK2A 4LNHA 3BE6A 4IWNA 4UASA 5BNWA 2GI4A 2N42A 2QBYB 4CGZA 1KEWA 3H6HA 3IDOA 4AQ7A 3WLSA 4F8YA 5KWVA 1W49A 2X9QA 4MV6A 2EJBA 2EL7A 2PBRA 2HUPA 3MPOA 3QG1A 5DE3A 5FPPA 3QEMA 3MFQA 4YRLA 2EKZA 3SU8A 3LLUA 5J2UF 1O94C 1QO0A 2ZWIA 4IIVA 4L2IA 1FDUA 2EEPA 3FFBA 3GGDA 2FCRA 3D6JA 3AFHA 4JLKA 4TV9A 4HY3A 1SQFA 3JQCA 2IYAA 1R4NB 4A5SA 1XA3A 4LNUB 5LIPA 1QG2A 3LIPA 4YT4A 1PEYA 3UVEA 1D04A 2LXNA 3SBOA 4DG5A 2QIPA 3V1UA 5LL6P 3FG9A 5EJ8A 1UXJA 4PONA 3HJNA 5DP2A 4OJNA 4UNIA 1Z45A 4ND8A 1WW3A 3SNKA 4X62B 4S0ZA 3CEJA 3QYJA 1NJ8A 1DQYA 3GRUA 3M2PA 1UOQA 2XUPA 4XX0A 4HS4A 3BHNA 2R1VA 4QSHA 4BCDA 2DJIA 3AETB 2FP4A 1UJNA 4KMOA 2QORA 5C3UA 5H59A 4KC0A 1MV5A 1UPUA 1VRCA 2VYCA 2WAOA 4ZJZA 3FTCA 4EY8A 1QNFA 1Z75A 3AV3A 4Q6WA 4KO4S 2X0FA 5K3OA 2Q27A 2JIMA 4W1SA 1X39A 3QNMA 4MUAA 2YTZA 5ECGC 4EJFA 1VXRA 2DKOA 2RG7A 2Y0EA 4OLJA 3LP6A 2W22A 4CXMA 4Y6QA 5JS8A 2GR9A 4DS3A 2GESA 4JGIA 3RASA 3TVTA 1VIYA 2O6LA 4I9UA 3EBPA 3M5CA 5JLAA 5TQ2B 5E7IA 4DIFA 4M76B 3V4RA 3FLMA 4KUHA 4LRSB 2WJIA 3UXYA 4CM3A 3SZUA 2GZRA 3IUPA 3HO8A 3HE3A 1Q1BA 3OQVA 3SC4A 5C1OA 5KREA 3U5ZB 4RULA 2A86A 4NK4A 1PJ2A 2ECOA 4WKBA 1NN0A 2IT1A 1XMVA 4X0EA 5I6DA 4R31A 4JLNA 3R7WA 2C96A 2ZAYA 3VMFA 4KQMA 2NMVA 1FXWF 4U3JA 4NDNE 5IH3A 3WWDA 3JQAA 1R0LA 2GYYA 4L1KA 3X44A 5ELXA 2G70A 5J5CA 3T1TA 3GJYA 5GWXA 2QVGA 3Q11A 3GAFA 4WECA 2NVUA 1M0EA 3M9WA 1ODFA 3AM4A 3ME5A 1ZA1A 2HMSA 4KO8A 3VGJA 3MIIA 3MMSA 1B0UA 2H5EA 1GZHB 1AGNA 4UAUA 5LMUB 3VR4H 2HJHA 2Q1XA 1OAOC 1Z6QA 4JI1B 4EX6A 4BZZA 3FOCA 1AQIA 4LYEA 1G3QA 1J2YA 2DRIA 3OWOA 1JLKA 3NWBA 5HKOA 5KNCH 3MS4A 1QTNA 3IURA 1W0KD 4X8HA 4YRFA 2QR2A 4CHTA 2QI9F 3KJGA 4AF6A 2YV1A 1S2LA 2QY9A 3AUTA 3JD1A 3QBEA 4P0TA 5LOVB 1U0BB 4P84A 5ITZA 3KCQA 3ABZA 3PTZA 4M9CA 4EVQA 3WK5A 2BM1A 3AEZA 5FUXA 4E22A 1RZ3A 4YXWD 4ESVA 1NFFA 4ZHQB 1W85B 1BH6A 3D8TA 2I8CA 1NVMB 2X3FA 1PJRA 5I7HA 4MW5A 5BW5A 3ZI0A 2IH5A 3KHKA 5BSKA 4P54A 3ABIA 3THYA 2DBRA 3AG5A 1VJTA 2OZEA 4IOKA 3ZWVA 1D2EA 1RC0A 4S1VA 1YQGA 1DQZA 4I0WB 1KYXA 1EGQA 2BF4A 4LS3A 5KTTA 1E1RA 3LX4A 3B13B 4TMVA 2JFNA 1J56A 3MJRA 4KBGA 5AOVA 5AXCA 3BE8A 2ZSKA 1UR5A 1C9JA 3K73O 4DCMA 5JVDA 3RSHA 5ALNA 2A52A 3MWEB 3JW8A 3PGLA 4LHXA 1GPUA 1T9GR 4ALJA 3NATA 2P9ZA 5A62A 5CD1A 3RVSA 4HTAA 2OHFA 1V25A 1GQ2A 2FMXA 2P6OA 4Y2TA 4CNBA 1CUEA 2H2IA 4GR9A 1PJLA 3CW9A 1ZP6A 3LM8A 3Q87B 5B1SA 2VBCA 3I2KA 3VVCA 3B89A 2A94A 1EXWA 2QDKA 3L8HA 4C9BA 4DF3A 4LV6A 3ZHXA 3SEFA 4J03A 1NRXA 3M81A 4LDPA 1WDMA 2A58A 5TNXA 3R9XA 3E9DA 3ZD8A 2P40A 1H85A 3RBZA 1YZNA 1H94A 2AA3A 1G8GA 1HYEA 3I6QA 1IHDA 4IIJF 4JHXA 4OUDA 5EVJA 4CKXA 1QANA 3LUAA 1M8KA 2O2YA 3QV1A 4G89A 2K2QB 5IXJA 2C5LA 2GJ9A 5I3CA 1U0EA 3FUXA 1GG9A 1YRLA 3S2FA 2FHSA 2WE8A 2XR1A 4LF4B 3R7NA 1EHYA 2HZBA 4DNXA 2R68A 3W5CA 2XHEA 4ENPA 1R1DA 1NVEA 1FS5A 3WDLA 4BP9A 1G1MA 4CKBB 1FS4A 3WGKA 1AK9A 1MGOA 4F21A 3EFOB 1Z5UA 2Y68A 3K6KA 2ZUSA 3AHGA 4C78A 4R2JA 3EE6A 4KQ6A 4Q9AA 2CHGA 4JJEA 4L76A 1S8AA 3QRWA 3NVMB 1QIDA 3HABA 2WF5A 1A8UA 4H7KA 4F5YA 4I6GA 1J8MF 1GV0A 3BSSA 4CI0B 1KZ4A 1EP9A 5DISB 4C89A 3L7DA 2CLCX 2NZYA 2EGUA 2I2BA 1NXVA 4I8XA 2HWUA 3D6FA 4H1UA 4KPUB 1XWWA 3G7SA 3C0KA 3NFRA 4Y2GA 4YXFA 1C4XA 3VDNB 5JY1A 3V7FA 5KYYB 1P2BA 5A5EA 3HXOA 3P9PA 2Q7DA 4HD8A 2HIAA 4HATA 2V8OA 3VOAA 1DBQA 4E5KA 1JKXA 4WQMA 3FOEC 5HQ3A 1ZHOA 1R16A 4ZAWA 3ROZA 2JH3A 3CFYA 4D7AA 3F2IA 5IANA 2QTNA 3DWEX 2R1UA 1SC6A 2AF4C 5B7QA 4ZVLA 3AFMA 4D9JA 5FT9A 1QQAA 3REQA 2X4DA 1T2UA 4XUDA 1T9CA 3B51X 3L0ZA 3VTKA 1SEPA 5J59A 2WJPA 3ID6C 2QJOA 4NICA 1B7GO 4QC2A 1YCFA 1Z28A 2GZ3A 3P9YA 4FMDB 4GPEA 1QE3A 1YRBA 4RAOA 3BFPA 3QVLA 2GASA 3DO8A 3RABA 4PG6A 4WFQA 3QXSA 4ATNA 2CBGA 1IPHA 2L19A 1ZO8A 1GITA 2L2QA 1ULZA 2ONCA 1E5DA 3HGQA 4YUWA 1E4VA 2P4QA 2SBTA 3NXKA 2R6FA 1XSEA 3IYLW 5KO2A 2ZBQA 2JLCA 4AWXA 3NDJA 3IJ5A 3JVEA 1U9YA 3H8VA 4HQFA 4S2UA 3MMPA 5JARA 2A5YB 1KU0A 2J5QA 3DTVB 5TJHA 1PR3A 3FYUC 4YAKA 1E3TA 3I23A 3SFVA 5I7OA 5IXSA 5DWDA 1WDLA 1CFJA 3G5MA 2EYUA 3GEBA 4L4YA 2P27A 3L7BA 3E7PA 4G0YA 3WLOA 3P2JA 4E5UA 1X38A 1MB2A 1R4ZA 2OD7A 3HUFA 3P2OA 3DL0A 4E5MA 3LPCA 5KKNB 1KAHA 1GTZA 1IAQA 1VHTA 2X1MA 1SK9A 3WHLA 4LSZA 3T52A 5IVPA 2ODPA 3RC8A 3VJKA 1G18A 2O07A 3DPUA 5DM2A 3GMSA 3RJ9A 1G8FA 1U3DA 3MTJA 5K99A 2JAQA 3AM3A 1RTTA 4DR2B 5CH5A 2DH6A 4KQ9A 3MGBA 3ETCA 1T8PA 2M32A 4WLUA 1M76A 5T8KC 3LP5A 3RWBA 3SQDA 4RANA 2QX6A 1MO3A 2RK4A 1ZHFA 4U7GA 1QK4A 4Y2JA 1IIBA 2JJ2A 1FLAA 1EJ0A 2I54A 3DBLB 3KOYA 2XX3A 3UHAA 4B0OA 2YXNA 2O0KA 2QVZX 4UBMA 3AVWA 2WJWA 4A1OA 3ER8A 4TWZA 1XJ5A 3QQ5A 4LBWA 1PR2A 1WRBA 4PYMA 3JQFA 1IOVA 3K5IA 2BI4A 1TCUA 1XD9A 4K9KA 1IY0A 4ALNA 1EVKA 1R2QA 1WX1A 1W25A 3WIUA 1ZQ9A 2Q2WA 3JQGA 3TOCA 1SVKA 4F6RA 4ZTBA 2E0IA 5L3QA 1KO5A 1Z8FA 2I9KA 1XRRA 4KMMA 2RONA 3E1KA 3IEIA 4LCEA 4WY5A 5EYPA 4HVCA 1H0RA 1H6AA 1PVVA 2CC2A 1GPAA 2WNSA 2YJGA 3IERA 3PGKA 3SR0A 4B1FA 1PNTA 3OQIB 2E85A 1SO8A 2V4MA 2H9AA 5AIBA 2VSOA 3FUVA 1YV9A 5H0IA 4JUIA 5BOVA 5F1YA 3U4IA 4FNMA 1ADJA 2VPZA 3PI7A 2XOEA 1ZBDA 4GI7A 1RPJA 3VXKA 4FZ5A 2J0UB 4GXNA 3RNOA 3HZRA 2WR8A 4UQPA 1UFKA 4QXOA 3L8DA 3LP8A 4HYTA 4U0JA 3G2IA 5E7QA 2GYWA 3T3GA 1W4AA 2GYUA 3TNYA 4A92A 4DRYA 3S2UA 3CCFA 4B8WA 5CCEA 3WWYA 2RGUA 2ZTSA 1BXRA 1N92A 4KVAA 1BWQA 3VZRA 4MKXA 1U0JA 1T10A 3BH6A 3Q0EA 4J2HA 5G0TA 4LZAA 1Z8DA 3Q5EA 1JG4A 4PM4A 3TB6A 1EESA 1U94A 1C8VB 5LWHA 2C7VA 1C14A 1F8YA 3CWCA 3GRFA 3RTDA 4KMSA 3D6AA 1PZGA 3DLAA 3WL6A 5CYGA 5LFAA 3TSOA 2ZBVA 5K3CA 3NRCA 4F3YA 1GN9A 3MAAC 3RBVA 1WXGA 4DA4A 4N82A 3HCFA 1W1UA 3RKUA 4CF7A 3JD4A 3JY6A 3BL8A 2V4UA 2QSUA 2JAPA 2XUJA 3EQ7A 2ADMA 4UEWA 5HOEA 5ILQA 4S05A 5EZYA 4U7PB 4MI6A 3UFXA 4C08A 3SXUA 1DAPA 2ZJOA 3I8OA 3LCMA 3NC4A 4YJ2F 1NNUA 1R37A 4RJTA 2IYFA 2AG5A 5TEVA 2NU8A 3DR3A 4A0RA 3Q8KA 5FWNA 3L0CA 1KOGA 3DWFA 4ITUA 5DNCA 1VDMA 4EAQA 2VWGA 2CJFA 3DM9B 4DMCA 1JEOA 3RROA 2XXAB 2J3LA 4EBBA 2QQFA 2QMHA 3NANA 2JAXA 2VRNA 1KYYA 1J9EA 5AKLA 2PKCA 1VE7A 2JZOA 2XMGA 4GPBA 2BC9A 4OHOA 4UDOA 2Y1CA 3LDUA 1GSOA 1P2FA 2OLJA 4J0FA 2PZMA 5LZ2A 1Y1RA 4RIHA 1BG6A 4MQ5A 1KYIA 2QD2A 3CZAA 4PICA 5FEMA 3LT5A 3CBGA 1PUIA 4M9ZA 5HFAA 2R6DA 1FZTA 4IZ6A 2H9IA 4FHFA 4NTZA 2JJYA 1C3OB 2SNIE 3WFJA 3KU4A 4F5WA 3RUFA 3WP0A 1A5SB 4M98A 2CDBA 2QUJA 3NYRA 1NJ6A 1N6RA 2OK7A 3NB0A 3QKTA 3R0JA 4IJKA 3UMSA 2WSYB 2FOIA 4BVEA 4EECA 1UUFA 3PNVA 1HT3A 3BMOB 1NVGA 1TZBA 1U90A 1OXMA 2XWJI 2ZRPA 1A9OA 2YZKA 2O3SA 3LVFO 4RCZA 5LQSA 3ZC3A 3RYCA 2D1TA 3EVNA 4RSRA 2VUUA 2GFIA 4JHLA 4AB1A 5AD1A 3SS9X 1Y8ZA 3AHJA 1X7WB 4FSDA 2QRUA 4L8LA 4CMAA 2G9QA 4Q34A 1ESEA 2H2FA 2IA5A 2VJMB 1FFYA 3HJAA 4KSYA 4MIOA 4DCUA 3P0FA 1KFBB 1X86B 4F72A 5JZVA 4JS0A 2IIBA 5F2KA 3N6VA 4CNQA 3JCZA 4ITRC 4OBWA 4NH4A 3K9QO 3BMNB 3RHSA 3H5IA 5ITWA 2YWGA 1QNLA 2P4SA 3PXDA 1JQBA 4DBZA 5DSTA 1JR3A 3JTMA 121PA 1QYCA 4JKIA 3ZDXB 1C1XA 1WS6A 3FUUA 4UXHA 1PFGA 3BGOS 3OZDA 1ZNXA 4RLQA 3HU5A 1N3YA 4HXGA 4IRMA 2F55A 4JVSB 5G2OA 1JU3A 3L1VA 4Z4QA 5KNBD 5KVVA 5J2TB 4KNYA 4MW2A 4AP5A 3C3AA 4MR9A 2JI7A 4UATA 3ZCUA 2Z6QA 1ODIA 4WOCA 3LT4A 3OQBA 4GZLA 4M0DA 3AJ9A 4KAFA 3T06B 3LHSA 1W5FA 3IV6A 5L51A 5K09A 4M22A 1E2QA 5DLYA 4XWGA 1THZA 1Z7WA 2O54A 3MFYA 4MYTA 1C80A 3RK0A 5BWCA 3L7NA 3VSEA 1T29A 4BX8A 3VZSA 1DEKA 5BQOA 3BD7A 2C2WA 4XCXA 2XUKA 3T9EA 3PL5A 4AT1A 1W7AA 1XMJA 4BEVA 2GYVA 4JY7A 1NBEA 3A9SA 3NHLA 4KU4A 1BVUA 4J9UE 4P83A 2EX0A 1ST2A 2JGLA 1JTVA 5KSOA 4Z49A 4H15A 4JJFA 3KZNA 1SUFA 1BNCA 3KUXA 1Y1TA 1BDMA 1KVQA 1AGYA 1JQEA 4RX1A 1U1CA 3AJ8A 5JAIA 5KQSA 2GWHA 1PGOA 2E2WA 1OQAA 4ZZ3A 1T9HA 3RC1A 2OC4A 3FKJA 4QGSA 2FH5B 3SMQA 4BV3A 4NEHB 1Y6JA 4KE7A 3TLCA 2VDRB 2DPLA 2IEYA 4LUCA 4R83A 2GPSA 2X7XA 4EJ0A 5DEOA 3PBKA 2UUCB 1TZCA 1GR1A 1CPYA 2NT3A 1JV2B 3HVIA 5BXQC 2W43A 1XLTA 5FTNA 5AESA 5JV5A 1YA6A 4I3HA 1RZRA 5CVVA 5IBCA 3A28A 5JT1A 3R9WA 1SIUA 2AB0A 2X42A 5AKGA 2AH5A 3GGSA 2DFDA 2P5UA 2UZIR 4Q3KA 3P0JA 2LBPA 4D81A 1N2CE 1Z7BA 4ZOBA 4F1KA 5KYXB 4YAFA 3AEKA 1ISPA 4LSWA 2FSSA 2DWOA 3I3OA 1OFUX 1HM5A 2CLHB 2IHKA 5K03A 1EQUA 1GRVA 4P0QB 1H93A 1I7NA 3ZQJA 1KZ9A 1ID8A 1Q5PA 4TX1A 1VIAA 3P2YA 4MINA 1OWOA 4JLUA 2OECA 3I2YX 4UULA 4ARVA 3EEQA 4N4AA 3OCUA 3MNFA 2H11A 1IRIA 3WNDA 4HLDA 3KYCA 1V5EA 2ST1A 1ZHHA 2MSEB 2W6ID 3G5LA 1ORWA 7MDHA 4MKZA 4B4KA 3FOWA 4MDEA 5CT4A 1HY3A 3FPKA 4GS5A 4I6EA 4IIBA 2ZIVB 3A1VA 4OYYA 1F12A 5CIQA 2HQOA 1XC7A 2KLBA 5KNDA 4CUJA 3KVNA 4W9NA 1OZGA 1JL3A 4QDUA 1S5PA 3N1UA 3R9KA 2JIZD 4C0BA 1W88B 1BKDR 1MHTA 1PV4A 2BKUA 2ATEA 1PZEA 2I62A 1UDAA 3DDNA 2VHEA 3PEFA 1QGUA 4MQBA 5B3AA 2CFOA 1NR5A 2JLXA 2PGNA 2A53A 4F2PA 3O8DA 1ECFA 3FRHA 2F9FA 3E82A 2WUVA 2APJA 1M0TA 2UYQA 5CW1A 5JYBA 4DV6B 1DS6A 4XSGA 5B57C 1C3EA 2CSUA 2WP8J 2VNIA 4A16A 1J5XA 1OH6A 2DETA 1R6TA 4ENTA 1MP0A 1GVHA 2XGSA 3BD6A 1JEQB 4WOPA 1RAGA 2B78A 2BR3A 5AICA 4DIBA 4EW2A 2BTEA 1RQPA 3DO6A 5HXAA 1QH8B 4QYIA 4B6FA 3JQ6A 4JJ6A 3BCSA 1WDWB 1P75A 1TFRA 4FMCF 4J2OA 3K0AA 4PZYA 4YHBA 2FRDA 1JP7A 1T4MA 1E4EA 3OPYI 1DELA 5CX1A 1T9KA 1TM4E 3ZNQA 4B3CA 4HUTA 3PHCA 3T1YB 1GADO 2HMTA 4BBJA 1GIAA 1W73A 2YYSA 3L8GA 2FFJA 2X5OA 4J1QA 5F1PA 3UPDA 3KLOA 3VR1A 5I7RA 3DZ8A 2GK4A 4RVNA 1L7XA 4NWIA 2CHFA 3O74A 4UAGA 5JNVA 4QPCA 5FUBA 2ZIEA 3EC1A 3VVMA 4FDMA 4OYLA 2W2OA 1P60A 2C2GA 3VU8A 2BM0A 1YWGO 4QYMA 3TW4A 4Y7DA 1RJDA 4GKJB 2V54A 2DKNA 5H81A 5IKEA 1TXGA 1ZCZA 3AP3A 3F6CA 2OHVA 4NK5A 3HYNA 2BFMA 4CIXA 5JALA 4KXNA 3ORHA 3OPNA 1Y3AA 2VTKA 3SX2A 2PFSA 2WSSD 1LX6A 1A9RA 1Q14A 1GOTA 2WW8A 3KPWA 3Q8WA 4IEEA 2O0JA 4C3ZA 5I51A 3LT0A 2VZ8A 3L7YA 2QN2A 1R74A 2MINA 1H6DA 1JZTA 4MV5A 4Q4CA 2Z2XA 1RKVA 3QUTA 3QEMB 4L2IB 4YJ3F 2AJDA 3KJQA 4RJJA 3CVUA 2D0OB 1C30A 5MDHA 2EBUA 4GWLA 2Q5HA 3F71A 5L3RA 2Z4SA 3P9XA 1QU3A 3EODA 4WIAA 2FN9A 5H9VA 2QENA 3A32A 2IXFA 3R09A 4CN9A 2YQ5A 2VA9A 2HRZA 1P2DA 1EHIA 2MMGA 4M46A 2CXSA 4IHJA 4IQ0A 5AW1A 2I91A 4N7BA 4ND8B 5FUVA 1WBJB 1VI5A 4JEMA 1WXWA 3GFFA 2WT9A 3IAHA 4J49A 3FOFC 3QEAZ 3T41A 2C98A 3WX0A 2R1VB 2QROA 3MJFA 5CLIA 2HLDA 3IS3A 2FP4B 3OEHD 3OOYA 2QTFA 3UG7A 1I3MA 5JYDA 2XOKA 5AVZA 5JNLA 5DDIP 5FH9A 4N5IX 3CO5A 1JT9A 1TM3E 2QM7A 3ILSA 4WK6A 2C92A 2DCUA 2G09A 2QN8A 2WTEA 3FMVA 3I9V6 3N0RA 1Z26A 3ZWDA 4Z3KA 2FVYA 1LSSA 1C9MA 1M6YA 3AR7A 4D4MA 2DG2A 2DFTA 4DREA 2ZCVA 2R66A 2PSEA 2OV4A 3ENVA 2GN9A 3ZCVA 4CU5A 3MCTA 2OGFA 4H6WA 5J1SB 1FP1D 4CYMA 3I6IA 3T7RA 4LN1A 5DHRA 3PNPA 4PS0A 4W8OA 1CUJA 3DVLA 1M5RA 4LWOA 1F1BA 1WABA 5CXQA 2FKAA 3WLJA 3HWX1 3N8IA 3T7SA 5KQPA 3RGGA 2X8AA 3RFUA 1HYBA 1M7HA 3WYBA 3QE9Y 2G9UA 1VM6A 4OHYA 1N25A 1XRNA 3W9UA 1DJPA 3MOSA 4IIGA 4CF6A 2QYOA 4G4SO 3UGKA 5CXXA 5COBA 1JGTA 3N76A 2HF7A 1OILA 2Q7XA 3P0IA 4KTVE 1R15A 4JKYA 5HILA 1XZIA 2IY9A 4TTQA 1NF2A 3R7WB 4GMHA 4U3JB 3MAJA 3DEHA 3CE6A 3G8BA 5DCYA 5GGYA 3JQAB 2RGRA 2GM4A 4KHZA 2ASEA 3BWYA 3JARA 2FMFA 4EMBA 1ZVKA 4KN6A 2YW2A 1EVYA 2JIPA 2NVUB 1GZSA 1XP8A 2HA5A 3NBXX 4GWGA 4TLBA 3TQTA 3OU7A 1ULTA 3UICA 4CG3A 4ZCRA 4RTNA 2ZT8A 3L0IB 4HAXA 1SHZA 1T6YA 1BDJA 1UAYA 2GFQA 3TTYA 1GZ7A 2AI2A 1SK8A 2IQIA 2OYCA 3WWZA 1F7UA 3MVEA 4MGKR 5F2EA 4NBUA 2X6QA 1RD4A 2C4WA 721PA 3VYTB 1PT5A 2JGMA 1EU1A 1RVV1 5KWSA 2W48A 3NKLA 4PX3A 4YTEA 3JD2A 2VDUE 3ANSA 5A5VA 2Q49A 3NRJA 5FL3A 5B7NA 4HVTA 3WMFA 4ACBA 5I48A 2Y1XA 4R8KA 5EIHA 1E99A 4G36A 3RUEA 2AOTA 4XDZA 3WADA 3F78A 1RAIA 4O5AA 4CM7A 2J5BA 4M1EA 4NLLA 3VYVA 3MXTA 1NDUA 1SUPA 2IZ5A 3DE6X 4QJ4A 4F71A 5ALKA 2O1EA 2CBXA 1PJTA 1SA0A 3OZRA 1J1UA 2HV8A 3UAOA 5A7FA 1H4QA 1B76A 2ZAIA 5FJIA 1P1FA 3GLKA 3DONA 2GEJA 1E2PA 3Q0IA 5BNZA 4X3CA 4G5YA 3PIDA 5EUBA 1Q0ZA 1SELA 3THYB 2EWVA 3D64A 1XZPA 3G02A 3I37X 2W11A 3ZH2A 4JI5B 3R8FA 5JCZA 3JR7A 1DINA 1OASA 3PFNA 4II3A 5LP1A 4IY1A 2HMWA 4B4UA 4Q7QA 1VYUA 2WFMA 2WV7A 2CNWD 5DTRA 3K8ZA 2CCJA 3F5MA 2O7SA 5AKZA 5ESWA 2WU8A 4AMGA 2HHHB 1GSAA 5JVDB 3WP1B 3DAHA 3DTVD 4UTOA 2KMLA 5LZ8A 1J2RA 4MVJF 2WP0A 1PW5A 2CY0A 1ATIA 4OGKA 4QL3A 3TX2A 4AKSA 1S3SA 3TUIC 1USVA 1ZCAA 4BZWA 3BGDA 3ZXIA 1K9SA 4D4HA 4PCUA 5U1PA 1YOBA 2V97A 3O7WA 3GUZA 4QDOA 4YRBA 1QIFA 1UC9A 2AFHA 3IXLA 4N3AA 3UPTA 3R9XB 3IIKA 1AB5A 1H2HA 1OFTA 4NZOA 4O4JF 3T1QA 5CIYA 1GA6A 4YRCA 3H5OA 4F38A 4OUDB 3L7JA 2PRYA 1NXWA 3VH2A 3OT1A 3WDMA 4MW4A 5KNDH 4ZOEA 3D7SA 4QGHA 4GVXA 3T7JA 4F93B 3CLKA 1X9IA 1CB0A 4EH1A 5F3DA 4UE6A 1V26A 2YWRA 1I3KA 1DI0A 1JXOA 4R51A 1PJQA 3R6TA 3SVTA 1PLLA 1HDIA 3IP9A 5H1YA 3OJFA 1XDBA 1Y63A 3HB5X 4NMMA 3I9OA 1W5TA 1ZCFA 4FE7A 4TMXA 4HXFB 1P18A 3NT5A 4GBED 4LOAA 3TI7A 1QRSA 4ESOA 3CYFA 2HL6A 3DXYA 3AEQA 1NZFA 1T6NA 4FS3A 4QWMA 3PDJA 4IDDA 1HT0A 1I0IA 1QXSA 1E7WA 3GBSA 2FMUA 4TT3D 4HH4A 5DV9A 1J2EA 1KAOA 3ZXYA 4BP1A 4DJFC 4EI9A 2WU3A 3LUFA 1Z4MA 3U81A 4N01A 2XDAA 2DLDA 3ABQB 4N41A 3ZJTA 4OAPA 5D85A 2OO5C 3QF4A 4GH5A 4RZXA 4B6JA 2VRCA 4D9MA 4DIDA 3OM1A 5HG0A 2YINC 4X20A 5LUBA 2JFWA 3HI4A 3SM9A 1N6KA 1VJCA 5B37A 1ZNYA 4RS4A 9ABPA 3H65A 1Z5NA 4KGZA 2WABA 4QQNA 3WQQA 3Q8LA 1ZUIA 4MIYA 1JVSA 3DMYA 1WY5A 5CDFE 1Q7EA 2Q2OA 4EGFA 4D3DA 5HQ3B 1QCYA 1P91A 4IH9A 2GDZA 4B3JA 3IIIA 2O1WA 2H7VA 2PH3A 4JSYA 3TZLA 4DLNA 4FGZA 4RS3A 3DMTC 3H99A 1YRQA 2WWTA 3ZWYA 3KTDA 3REQB 1JR6A 5IN5A 2UYGA 1NT2A 1Q0SA 1KI6A 4WZAE 5A0TA 4PSKA 3IULA 3TNDA 4OLBA 1NNI1 3ENZA 5JCJD 2SKDA 3GOHA 3QIVA 3NM4A 4UD6A 2ODEA 2YHBA 4FZ3A 3A1UA 1PYOA 4YCJA 4HDOB 3KQSA 1CUHA 4NBVA 1NMSA 4MKFA 4P31A 4ALLA 3G49A 2A5DA 2PSHA 4YACA 4OQMA 2Q0HA 4PPGA 1RYNA 2CJXA 4XTRA 1X7XA 2C4TA 3PENA 1XKLA 4C4PA 1N1EA 1WNFA 4OJTA 3DFFA 1Q74A 4R1TA 1OGJA 4PSUA 2K7FA 2A88A 3LVQE 1EE9A 1ZN8A 2PMEA 1KJZA 2C31A 1G4AE 3DB2A 4N76A 2YVLA 3RJZA 1X15A 2MU1A 3U9SA 2FG6C 2XQVA 1XZLA 2VPWA 3BMCA 3B5JA 2DQZA 3PGMA 3PNQA 1QOZA 2X2FA 4OAQA 1EUQA 5TY0A 1HE2A 2AD1A 4EIWA 5C7YA 1UIMA 4URUR 4L5BA 5DFAA 1SHKA 1R88A 3AGPA 2VAWA 3ODPA 4NDZA 5E9QA 2FJ0A 4O1IA 3I9KA 1M1NA 3II6X 1ZGHA 3AHFA 3MUOA 4RHUA 2XKBA 3FZEA 5U4QA 3FOZA 1WF3A 2JHFA 1EG2A 5DHSA 4ZCPA 2VG8A 3ND6A 4DQXA 4J1NA 3L1UA 2E48A 5KVQA 1HYHA 4W9MC 1E3DA 4ML3A 2AKEA 4PC3A 3PNOA 2EIXA 4FTWA 1JHQA 4A9AA 4NXMB 2OMEA 1OXSC 1T5DX 3EISA 1NMEA 3MS7A 3ZBTA 4BN0A 3OM9A 2JK1A 4X24A 2CMKA 3Q88A 4NABA 3HXQA 1WUJS 2H00A 4I5DA 1A04A 3B6IA 2KS6A 3H5VA 2GD6A 2QAGA 1EBUA 1H2YA 1ISSA 3LKZA 4N1AA 4OUKX 3JQGB 2VYFA 2A33A 4UTZA 3U1TA 4F6RB 5L3QB 4J0EA 5C8XA 1IEQA 3EC7A 5ECDA 5EYPB 4H59A 5AVKA 1E9FA 2W0MA 3CCBA 4UREA 3OWXA 4WCFA 3ZCXA 4S24A 5HE9A 1G9TA 5TVKA 1A4IA 4MLCA 3A1FA 1JG7A 1PR1A 3MJVA 2B7LA 3EVAA 3VR6D 5KPDA 1GCIA 1R0SA 2R60A 2VH1A 3KEFA 3SY8A 3DV0A 1C7FA 1P2SA 3H2YA 3LGAA 3ZIAD 4D8XA 1IBSA 1DX9A 1X7ZA 2FN4A 4INPA 2F8MA 4CE6A 1DPFA 2PM8A 3NYQA 4BIIA 1J0CA 1PG0A 4N8DA 4KRGA 3RV4A 2E49A 1G5HA 3QPVA 5GONA 2R47A 5JSHA 4DNPA 1NF8A 4D2IA 1R0XA 2ERCA 1TVKB 1NQTA 2JGDB 1QRDA 3P97A 4WBNF 1A72A 2PH7A 3VX4A 2QE7D 4JK3A 4DOMA 5C80A 4GMDA 2WEKA 3D6TB 5NLLA 3S2IA 1D1QA 4KWCA 1SG6A 1XA4A 5FOSA 4ENQA 1QTQA 5CU7A 2ZT6A 3A70A 1GT91 3H1BA 3WQHA 1NJ5A 4HNQA 5F23A 1TAGA 5LP6A 1A3CA 1JKFA 1MNAA 4MVWA 4BMDA 5I9MA 1TFUA 2VPTA 2PZLA 4NU8X 1DRJA 4D26A 3BMXA 1E92A 1XN4A 3GL9A 3QPAA 3VPAA 1OW3B 2HB6A 2W6JD 1PX2A 4OO3A 2ZB3A 1YNOA 5A9SA 2XEDA 3GH3A 4IFTA 3A37A 3RG2A 3DMRA 4MUIA 4QTTB 4RMHA 4HNTA 5SZJA 5L7WA 2RAUA 1YR6A 2Y0CA 1YDHA 2D1SA 3ESCA 4M55A 1QF6A 5EZYB 1ODCA 3LUJA 3UFXB 4YASA 3SXUB 5LN1A 1P5ZB 4C0HA 1CEYA 3LGXA 1H2XA 2NU8B 4QJ5A 3LBYA 1D6SA 3A3PA 1GDHA 3B8HA 3C3DA 4BYMA 4C14A 3INNA 1KFEB 2KSQA 2XMPA 5FORA 4DQLA 3C8HA 3G6WA 1RQGA 1U8FO 1WXEA 3P9NA 2HO4A 3PUKA 3PVSA 5BWNA 5KMGA 3ZWBA 4EL0A 5KNCD 1AKMA 4B3FX 3QOFA 2XYRA 3BJRA 4XAQA 5F5LA 4EDHA 5AUNB 1SRQA 4H17A 3DZKA 2CVQA 3A2LA 4JNKA 4EY7A 3DH0A 3A7EA 3VZDA 1RKXA 1GNSA 2GKGA 1HK7A 3NALA 3OCZA 2ZUEA 4PRYA 1AIPA 3VU0A 4LY9A 3NO4A 1NONA 4MLPA 1YULA 3W79A 3BORA 5BN5A 1AH2A 2LRHA 1CJBA 2NU7A 3DR5A 3UV6A 1VLLA 2YWCA 4CU2A 2RHJA 2A2ZA 3F74A 2VJDA 4ZVTA 1W8DA 3K8YA 1JKIA 4MA0A 4YHHB 2BDEA 5TC4A 3RFVA 2HD4A 4M1OA 1ZMTA 3WQBA 3RYCB 4PZCA 4P38A 1K6EA 1VL6A 1R6DA 2ZJ7A 4TUYA 3WGIA 3W5BA 1WBBA 1V5GA 4Q9KA 4V39A 1PVOA 4BVKA 1P45A 4WKGA 3L7LA 4G6ZA 1YD7A 2C4MA 1SKBA 1VC2A 3OIGA 3KOOA 1U7OA 4IUYA 1LDGA 2FUCA 2Q6IA 3MLAA 3U7QA 2OPBA 2LIPA 1L6IA 3KL4A 5DW3A 4ZWNA 5CG1A 3ZN2A 3D02A 3ZHZA 1HDOA 3BRSA 4D3XA 1KK1A 5LQAA 1FMFA 4F06A 1E58A 5BRNA 4L3WA 1XAGA 4II7A 4MQEA 1RR6A 3V5NA 1W6RA 1O89A 3ET4A 2F1JA 2CKDA 4DMLA 2OORA 4UNSA 4E2WA 3G8DA 1E8DA 4YB8A 4FHCA 5FLKA 5G53C 3WLAA 2O06A 2ZVPX 3W5UA 4D6YA 2QRZA 4YYZA 1BJKA 1FFHA 3OTGA 5F7JA 5IRCD 3D2BA 2GBIA 5LMZA 4MI3A 4MR9B 4JITA 4IH1A 3ON5A 1J8QA 2NSYA 3D7NA 1L5MA 1PK8A 3S2ZA 4RF5A 5K0JA 5JECA 3KSDO 2F67A 5FPQA 1OFVA 2AG0A 2PHZA 1NKTA 2B5OA 3QOXA 4F3CA 1T3ZA 2V7BA 3VVBA 3HGMA 1VGVA 4ZDWA 1GUFA 4LMBA 5IBQA 2X2OA 2EV9A 3GAAA 2Z5VA 4M0EA 4TMYA 4OQZA 2OGSA 1DJMA 3M34A 3RVNA 1YB6A 1XMOB 4U2EA 3I6YA 4E6PA 2ZG6A 4KOEC 3UUWA 5A03A 1IATA 2R8ZA 4GYYA 2OGTA 2O8NA 3LBIA 2BKAA 1XF1A 4U2CA 4OP1A 4MTLA 2BCGY 3X1XA 3CZ4A 1BMTA 2AR9A 4Q3LA 3RANA 2BLLA 2DSTA 4PHGA 1LNZA 3JSXA 2AN4A 5TPZA 4DILA 4LF7B 3FWPA 2WWGA 2HRDA 1XDDA 1DZ3A 5ALGA 3STYA 2ZJ0A 4B4VA 1KP9A 4HX2A 4NOKA 4DG9A 3PJRA 2YV4A 1NVVR 2HMUA 3WJ7A 4MQFA 1H3EA 1P0IA 4Z9FA 2QQ5A 4MOWA 2ZYUX 4HI0E 4JBGA 3ZQKA 4QRHA 1M9NA 2P3OA 4ND3A 3ZZUA 4A23A 4GF5A 1QG6A 1RJEA 1O77A 2JGKA 3OEYA 1FP2A 3SJAA 5BYBA 3I45A 3WFZA 4D0GA 2FPGA 2HADA 3WSVA 1E0KA 1FRNA 1VI6A 4B75A 1IWOA 3KSRA 1WUYA 5J47A 2EKLA 5T4EA 2O0HA 3WBKA 4AJLA 4F86A 5BQFA 1AV6A 4PCLA 1P9OA 4TL6A 3PPXA 2ZJ4A 3AC0A 1KAEA 5IK2D 2P1ZA 1GUZA 3EWSA 4PZ0A 3MTGA 4MQ6A 2FSIA 4LRYA 2VQDA 4ZI5A 4LHVA 5JZOA 1OXTA 1PWYE 3E9MA 3DVAA 4YVFA 1IM2A 4WCDA 2OCDA 4MYSA 4N18A 2J3DA 3G0IA 3YASA 1D4ZA 3AR3A 5LNK6 4YA6A 2GLTA 3W8FA 3AEKB 2FR1A 1ZS9A 1NDQA 1U6JA 3RSQA 2LMEA 4IV5A 1A8QA 2GEBA 3WIBA 1QO0D 1KEVA 1YZVA 4MMYB 2QGFA 3BQ9A 4X7PA 3FDXA 1HFWA 4FYYA 4YMUA 4BB6A 4D9CA 4OBXA 4MQ4A 4FKBA 4MMZB 1WW2A 1MRSA 1EA7A 3IAXA 1SBTA 1TJ3A 1YBMA 2VNJA 3FLBA 4QBIA 4E51A 3L8ZA 4PQEA 1M0WA 3V00A 5I4BA 4OXQA 3KYCB 2FQQA 4Q7LA 2KB0A 3EWNA 2PPLA 1XQ1A 4FS8A 4RY2A 4V1CI 5CTJA 1JSZA 4YX9A 3TQFA 2L0XA 1NNLA 3GFQA 2CFSA 3S70A 3T0FA 4DEVA 4QYSA 2YV2A 2Q41A 1N5LA 4QGGA 1USWA 4PGFA 4R8SA 4BEBA 2EJUA 3K2QA 3G13A 3A6ZA 4AUEA 3WB2A 4REMA 1OAKA 2F1KA 1J90A 3PR3A 3ZE8A 4XQ0A 4CLDA 5J4LA 1U28A 1CQJA 1ZIYA 3NDRA 4HL6A 3A06A 4FW8A 3EPLA 4S3MA 3W2GA 2ZR7A 1W4RA 5C8YF 2ZXUA 2PN1A 1QGUB 4PBRA 5G0SA 3D2AA 2X0KA 4IXJA 1WNTA 2QX9A 3LVRE 1KDPA 4YRKA 4AXXA 5LP6F 4RORA 3D0RA 1DBSA 4LIPD 5F77A 2IY8A 1MG5A 5DLEA 1JR2A 2CFIA 5LQRA 3COWA 2DTDA 1GGFA 3JD0A 4O2LA 4Q0MA 4PIVA 4EYOA 4EYSA 1QLHA 3EHEA 4C04A 4JD5A 3OIDA 4ROTA 3WNQA 1N34B 2IYZA 4RIIA 2PLAA 4LJ9A 5ALIA 3PQ2A 1J21A 4HTFA 1ZW6A 4WV3A 3FZYA 2OSVA 4QYIB 2Q46A 1R8XA 1AMOA 4LTNA 1ZXBA 1GWNA 3DP9A 2G7ZA 4KN9S 2VUIB 4U39A 3HO6A 3P7MA 4HO1X 1JVBA 2Y2VA 3K0AB 1CU1A 1D2AA 1E4EB 2BBSA 3A1CA 5E95A 3WOVA 1XTQA 3BTSA 1YB2A 3B52X 5CX1B 4C0AC 5IPFA 3I01M 1ZSVA 2MSDB 4DV2B 3QE4A 4M88A 1CETA 3JQAD 5BWMA 2ZIUB 1C0IA 4EPTA 3I01A 2PY6A 3U60B 4MQLA 5ENDA 1GEEA 1XQVA 1DC4A 2MDTA 2VJQA 5E3HA 2QNIA 1F17A 1U2QA 2NTJA 4CEHA 2P69A 1CQIA 4U00A 3P94A 1GUAA 4P5DA 3RRBA 3JRNA 2UZ1A 3FETA 2CNBA 5CT6A 4N8SA 4YJFA 4E1BA 4J6FA 3M8KA 4N0MA 4ANFA 3PUXA 3AERA 2FW7A 3B5EA 3QVJA 4C7OB 3BHIA 3N7UA 4ER6A 3SIRA 3PEWA 5ALTA 4P8RA 2ZAMA 3SBXA 1ZDMA 2AYZA 2WC1A 2FEOA 4MEJA 5JCXA 1CY0A 2DBYA 3IAS6 3OQOA 2VF7A 1KP2A 2YHAA 3GGGA 4Y2XA 1VYTA 1W35A 1N2JA 2ZB8A 2WJJA 2JF0A 3RV3A 3ZK7A 4B7UA 3OUZA 1I2ZA 5H4GA 4Y2UA 4B31A 4B3RB 4EHHA 2G5ZA 2MINB 1S0UA 3EXG1 3FZGA 1FDOA 3KSMA 4IMPA 1JJAA 4RVDA 2GRUA 4WMLA 5E7JA 1XEXA 2XUIA 3HYCA 3Q7TA 4QREA 1NUQA 2PL5A 2YBDA 4QLAA 5DM1A 1DT3A 2KBFA 3PXCX 3RC7A 3RREA 1RQNA 1A4XA 2IZ1A 1QMGA 2WAYA 4NJOA 1YRHA 4RESA 4XSVA 2H4HA 4V0MA 1C30B 1HDRA 4WLFA 4WKCA 5EZ5A 3K9FC 1KSHA 3FN4A 3L1IA 5K0GA 2GKSA 4JLWA 4L6AA 2GVDC 2QLTA 3VSCA 3WFIA 4JYAB 2HDHA 4YRQA 1IPFA 1O54A 2W42A 3Q7SA 3DHYA 2V0NA 2CDCA 2Y71A 2IH4A 4QATA 5F9MA 3S5UA 4BNNA 4JV5B 4XEHA 1A5AB 1SUEA 3G3EA 4IHJB 1MQAA 1TQDA 3VSDA 4KJXA 2QW1A 5ALVA 4LBYA 2HKIA 1NT4A 2WZBA 1AY0A 2W9XA 2P11A 4PLCA 1E1RD 1SMKA 4RSHA 1Z62A 5FX2A 3A9VA 3FUTA 1M67A 3DAYA 4CGYA 1TUGA 3GJXC 5LZ5A 2XMQA 4I1OA 1T6XA 2OCBA 1ZC3A 3P0EA 2I4MA 3WKBA 3E0QA 4X65B 1DC6A 3DDSA 4JVNA 1VG8A 4I4TA 1MFPA 1CS4C 1TEVA 2GHTA 4CG0A 5IC4A 4ZZ0A 2AMLA 2ODWA 4B2YA 1H9BA 5C18A 3QJYA 1LPBB 4E0BA 1IN4A 3OEEA 1Q1NA 3E35A 3R40A 2JA1A 3H1AA 1F0NA 1M66A 2SKCA 3AVXA 1WZCA 3ZX4A 3QVWA 2XTJA 3GCXA 1EFTA 2P35A 4GGPA 4BJHB 3L6BA 5FAKA 5EHZA 1DKQA 4DUYB 3R3XA 3TRDA 3CV3A 2FEAA 4BO6A 1DRVA 1ZCJA 2VJYA 3GUUA 3N7AA 4F4HA 1KMCA 1AKVA 2ZEJA 3OCJA 3EZ2A 4EK9A 3AZOA 1Z35A 3PGXA 4YPVA 4RZ2A 2PTHA 3LX5A 1JUDA 1Z0KA 1FY2A 4A8TA 4CF3A 3ZWNA 1JDSA 2VHXA 3HLTA 1FNMA 1YIDA 2Q45A 3O2SB 7YASA 1MC5A 2FVXA 1J2JA 4L07A 4L3VA 3KTFA 3ACCA 1Z15A 4M7RA 3D6UA 1OC2A 4RA9A 4RVHA 4MRVA 2FI1A 3PB3A 3S40A 1IBKB 3ZJVA 3JARB 4BQSA 4UE3S 3O1IC 2ZSFA 2Y66A 3L92A 5C8VA 3O83A 1X80A 2GBGA 2O7VA 1HFEL 5JSZA 3M4ZA 4EHKA 1JMVA 3VO8A 2AC7A 2J5RA 4HRYA 4JI6B 4YWJA 4NCAA 4F4UA 3VJMA 1KYTA 3LF2A 4LE2A 4YP7A 3FMGA 1G0OA 2UVDA 3H11B 3AF6A 3I53A 3QY9A 4BNTA 1R6XA 3EPPA 3WYNA 1VBKA 3HCBA 1F20A 1N8KA 1YZUA 3RIXA 2PLNA 1D2RA 4RZSA 2C5AA 1OT3A 1TT7A 2ZB4A 3KOWA 2I1WA 3JQ8A 5DP1A 2R6AA 1LPNA 2R1TA 3P96A 1NVAA 3QHPA 3R5HA 5E6UB 4B84A 4AK9A 4BFTA 3D3WA 3G85A 1TA4A 3PHIA 2AOTB 4KXVA 2OKGA 4TTAA 3F7TA 2PT5A 2EF1A 4XQEA 4C0JA 5D5HA 1QCZA 5D5PA 5AJVB 3UWOA 1J22A 2ZVQX 4I4IA 2DC1A 1SA0B 4L8FA 2QX4A 2RGEA 1GAXA 3CRMA 5K3FA 2ZSIA 1PFQA 5LJLA 1GNTA 1E1KA 1Y4DE 2JIRA 3AIKA 4WKOA 2TYSB 2A0FA 1G7CA 4P22A 1AKQA 2PGLA 4LW8A 4AL4A 1IG3A 1HUQA 1YUBA 5ADVA 1GR0A 1I3OA 3FPAA 2BHTA 1VGQA 5EJAA 1YQDA 1EZ4A 2OCKA 4JB8A 4EHLA 1VPVA 2Z2KA 3LUKA 1EWQA 5E38A 1X7HA 1J4AA 1ZK2A 1T8YA 1XNJA 5D7NA 3WK7A 4YREA 2WI8A 3TQCA 5LQNA 4PEVA 1F6BA 2PRIA 3WAJA 1KXZA 3TIVA 1XZJA 4KYVA 1WKCA 1NLUA 4RKWA 1YONA 2DUJA 3SN6A 1OV6A 3KUUA 2UYCA 2J0QA 2E1PA 1VECA 2I6SA 2FW0A 2JFHA 2JRLA 2QPLA 3KJZA 1R12A 3GOQA 3OTIA 5EAIA 4AO6A 3L6EA 4ZOLA 4ZVUA 5DMXA 1BGVA 2AFHB 5KCMA 3T6KA 1H2WA 3E18A 2FEPA 2EW2A 1DRKA 1QDEA 2HHJA 4CIDA 3C39A 4XWWA 1RWQA 4BRWA 4KAJA 2C20A 3OT1B 5CPBA 1KL7A 1DRWA 2GEKA 3BCRA 3D6VA 1GCUA 1EH5A 1SULA 1X92A 2HFKA 5CLLA 1H22A 2XF2A 2JCVA 2JKZA 4XYLA 5KEIA 1JH8A 2Z57A 2JJ2D 3G0DA 3RKSA 1KVTA 1JILA 4X8OA 1QX3A 2XECA 3IT1A 3KQMA 4IJQA 1N33B 2VPYA 3UTDA 1VBFA 5H70A 5CCXA 5CBPA 3LF1A 4IJUA 2FZKA 4C20A 4CTNA 3ED1A 1HYGA 2QTTA 4Z1MA 3K9LA 4DLLA 1O9HA 4BKUA 1FNNA 2C2YA 2LPMA 1S4MA 2VDOB 2YJZA 3M70A 4HMPA 4YJHA 5CNIA 2CXQA 4RHYA 5JNWA 1TM5E 3GEHA 1SVOA 2J3HA 4PHHA 3ZW9A 1EX9A 1YB5A 2P2ZA 3HN2A 4Q00A 3AYXB 3FJOA 4BO5A 4RMJA 3QF4B 3OQPA 3RSFA 4PPQA 2P7HA 4X20B 3Q3VA 1JR4A 2RFLA 3BJIC 1JHYA 3ZV3A 3IO3A 3AWDA 4Y9UA 3I04M 2WWHA 2JS7A 1NRJB 1U1EA 4H7HA 1SVLA 3GJQA 3I04A 1XJWA 3PQ6A 4GD3Q 3JQFC 1L4HA 3S2GA 3IV9A 5DGDA 1XXLA 3TSYA 3ZGNA 1D6JA 1JPJA 4PZAA 3M3HA 1JG2A 2IPMA 2YRXA 1QGZA 3TQOA 1KEEA 4ALKA 1G2QA 4L27A 4ZVVA 1YTLA 2GK6A 1CNEA 3COPA 2UU9B 4I6JA 1KI6B 1JQ5A 2D62A 3DLIA 2WQ7A 1Z56C 4PC2A 1Y33E 3DZJA 1M54A 4C22A 3PUIA 1GUBA 4NI5A 4WJKB 3LC2O 4DR5B 1A0OA 1EMDA 3DOFA 2WV9A 4DLPA 4BNKA 5B1HA 1GYPA 1RBQA 3LY9A 2HLNA 3ELBA 3NNSA 1G20A 1DKMA 1X7XB 4LRXA 5AP9A 4ETWA 4YRGA 4DC1A 1RWPA 4MCHA 5C1DA 3TPCA 4JEUA 4RYDA 4RPCA 2HCTA 2QR5A 2Q3CA 4AMVA 1K8RA 2ACEA 2XE7A 1E3EA 1I0ZA 3A3NA 2ONZA 2GCGA 4PXYA 4DR7B 3RQSA 4O63O 2D8AA 1RP7A 5AOAA 5GOZA 3ZY6A 3FMOB 2JCBA 2PQ6A 4ZK2A 5CDSA 4BNWA 1K6XA 1JDBC 3KLNA 3DNFA 4QXAA 1GSIA 3BMCB 3IEXA 1P39A 4IJWA 3K53A 3IQHX 4X3PA 1QG4A 4MAAA 4ZA2A 4C4SA 4V0NA 1MW8X 1YUNA 2JGFA 3BICA 3L02A 3OESA 2OA0A 1BFKA 5HYVA 1Y7LA 1GDTA 1FW8A 4BMCA 1UZMA 4Q16A 1W1IA 1E0JA 1M1NB 1OAAA 1YCDA 1RRVA 1T1JA 4PW0A 4PZZA 4R6XA 4ZGBA 5KX5A 4HG2A 3RRZA 1KGSA 1VMAA 4NAHA 4EW3A 3U1BA 1C0EA 1BJTA 4Y30A 1WP4A 1E5LA 2XBLA 3C3MA 2QT9A 4CF4A 4KHPB 2X22A 1TPYA 1ZJZA 3IO5A 4QQ8A 4YRTA 1WAMA 4AX4A 4DHEA 4HB2A 3ZCQA 4CTJA 3B36A 3PS9A 5JBNA 1T6ZA 1AHPA 5HJEA 2CK3A 4DCSA 1BA2A 3HKEA 3Q3EA 4IS3A 1BVRA 4OOEA 4PZUA 621PA 1LJUA 1U7XA 5ALXA 4JBHA 5FR2A 5ES4B 2ZYHA 3B20A 4DMMA 5CB8A 2F3SA 4ZD6A 4XVCA 3VNUA 1GM5A 3BRCA 5KYUB 2QL9A 3GFSA 4S1PA 1I94B 4TXNA 3IDFA 2R7MA 4URFA 3F8SA 2O8BA 5FLEX 2Q9CA 2OBNA 3LNCA 4XVUA 1W19A 3JALA 4MCAA 2PX4A 3FDJA 3FSGA 2G04A 2P6RA 4BY9E 2CLSA 3IIEA 4IYJA 2XCRB 4FCVA 4WCFB 5EPEA 1Y3DE 2YIJA 3GWGA 2QTZA 5GOTA 3H8SA 2OBXA 3WKDA 4KOAA 2RBKA 1PHPA 1FQWA 3IP6A 3L0DA 3CSDA 4MYHA 3DV0B 3IMCA 1JR3D 1NYLA 1X7ZB 4H6PA 1RT9A 2ZWPA 5FBQB 2O2DA 3T35A 1GN8A 1GQSA 1K86A 5LQJA 2HMAA 4C76A 1DKUA 1OCEA 1U2DA 1ZXLA 2XB6A 4EUKA 4EWLA 5B3KA 2XI4A 3MB5A 4OK3A 1Q1AA 2O7QA 4OTZA 5HIIA 3IXQA 3LPAA 1O5OA 1QF9A 5GONB 4D9IA 5DYTA 1PEKE 1J20A 1TK3A 2CB9A 1MORA 3H1FA 1WKBA 4GI3A 4E5SA 1F9EA 2VNAA 4BCBA 5TDHA 4JR0A 3RS7A 3I6ZA 3PXBA 4EHDA 5JC8A 1AV7A 3DBHA 3IP1A 4RQUA 2PSDA 4WH0A 5DYGA 5TLSA 2QF7A 5DHTA 5LP6B 3O4GA 2B8WA 1GA4A 4GOKA 1EBFA 4JWKA 4YAWA 1NHWA 2A1IA 2EJWA 2AHOA 3R7SA 4EB6A 1OIVA 2DECA 1F2UA 4YY3B 2AW5A 1BDBA 2C9BA 3EC2A 4U9HS 2I34A 4CR7A 3W5AA 3SNHA 3SX4A 2YVKA 1ACLA 2ZIZA 3GJRA 4YLGA 5A9SB 3KZXA 3E2PA 4H3HB 4HQLA 4IF4A 1B8PA 4BVLA 2WB2A 3N5CA 4BHRA 4YC7A 2JC3A 4GRDA 4PE5B 4QGFA 4GZ3A 3O94A 3TRJA 3DUFA 4K9PA 5K1ZA 4C7KA 4HN4B 2ZBDA 1Q1GA 2VF2A 4DVJA 1O97C 3N8NA 3WLIA 3ANLA 2A9RA 2BRUC 1CKEA 2N3ZA 3C7AA 2HF8A 1H8HA 1NOIA 4HLUA 3OH8A 4LGCA 3LMKA 5BPFA 3W3AA 1WDKA 4M37A 6GPBA 2E5FA 2V9CA 2ZRKA 1RWBA 2CYCA 3JATA 3EDCA 4P58A 3BB4A 3UANA 3QY0A 1WVIA 3KS9A 5KMGB 1VJGA 1TK9A 1FJ2A 4Q1EA 3NIGB 4JYMA 3PC3A 3R5TA 2QRGA 2CLOB 1I7DA 3UG6A 3RB8A 4G0NA 1ONPA 3DWGA 3DT8A 3WK4A 1MQ9A 1QM5A 1NW6A 3CS3A 1TYZA 2RAFA 3TQHA 4BTLA 5B1IA 3RDPA 1M1YE 4DMGA 4WEOA 1RZRD 3HXTA 3KKMA 1PIWA 1ZL0A 5BN5B 1JNXX 1RYZA 2FLVA 4HAOA 1FS6A 1XD8A 2NU7B 2R48A 4FIZA 4U7TB 1B26A 3OCVA 2HSWA 4D96A 2K6GA 5CEFA 4I9NA 4NE2A 2VSQA 4IOLA 4Q1AA 4TUYB 1HETA 1Q6ZA 3P27A 4KQGA 1UBOS 1G1AA 1M6VA 1EFAA 2J08A 4J3JA 3THWA 4DKXA 1J39A 3HS3A 1E6UA 2H0RA 3CIFA 5IUKC 4UTNA 1FRZA 1YB4A 1JIXA 3DP7A 1T3HA 3GY0A 3AB3A 3H75A 3ONVA 2X40A 3Q2IA 4FMBB 5FFMA 3UMBA 2OFFA 3U7QB 1PZXA 3LSYA 4P80A 2L69A 1QQ6A 4QDKA 2LKDA 5TMBA 3A25A 4NYMR 4RJKA 3LCRA 4R41A 3UWMA 3E7XA 2ZJ8A 1ADBA 2ZI3A 4OLHA 5EJ4A 1XROA 2H4ZA 1B6GA 1F0YA 4MQEB 2Z43A 4V0QA 2B4AA 2ZOSA 5IJ0A 4M0KA 1VL0A 1EK2A 3E81A 1KI4A 1T2NA 4N65A 2QN7A 4TMWA 4DLXA 4C2TA 3CI0I 2VDWA 5FLYA 1MT0A 5ALLA 3C5HA 3JYQA 3OOSA 4AO8A 3H87A 3GQBA 4YN3A 2GN2A 4PR3A 4CL0A 1OX4A 5IARA 1UC4B 2WHEA 3OBBA 3QUAA 1E59A 3KDPA 1X1BA 1XVAA 3F96A 2HDOA 3K7EA 4RJLA 5ANRB 3FPFA 5EN4A 2RKBA 3GPLA 4TVKA 1SVSA 2PA3A 1NQAO 1EEXB 4ZK6A 1M2EA 4Z1OA 2XQIA 4N54A 2HT1A 1A82A 5EJIA 1VKRA 4KQEA 1TJ4A 4D25A 4DAEA 5HUHA 3ZGOA 3DE5X 1K0FA 2JH9A 2XUQA 4YCBA 3FFWA 4BKPA 2VSFA 4P4GA 2HIGA 3MCZA 3DMGA 4N7RA 5HBGA 2I8AA 1KHTA 1Z08A 4KTTE 1PQ4A 3W04A 3PCXA 5EXXA 4H35A 3EYAA 4I1IA 4AN4A 3MINA 1ESNA 2DP4E 2HNAA 1QWOA 1Q0RA 3AEYA 2ZULA 3HKDA 3UK7A 4W9NC 1XF9A 3I73A 3VI4B 4K6HA 3WJ1A 1BCRA 1E2UA 1P72A 3CE9A 1NYRA 3R0IA 3U7EB 1U5BA 4QUJA 5HRAA 3PD7A 3HBJA 3ST7A 3NOQA 4D6PA 3CT4A 2XTZA 4O4IF 1UWVA 4DVGA 1C8KA 2YN0A 1KNQA 4MQFB 1CR4A 3SBEA 3SHFA 3WOHA 5ADWA 3WGNA 1SCNE 5LQKA 3GNQA 1DWQA 4C0SA 3PTAA 2DPMA 5EXCA 1ZJYA 2WMDA 1OLXA 5EIEA 1YU6A 3H0EA 4B6PA 2VK8A 1II8A 1ONSA 3LZ6A 5CXSA 4XJTA 2ON6A 3TIXB 1U63A 3AWIA 3G9TA 2C9ZA 2FPGB 4OB7A 1MO5A 4KV7A 4GU5A 4IFBA 5HE8A 1BVHA 3H9GA 4IVPA 4J94A 4D9KA 4P08A 2WM2A 2QTHA 3A9CA 1W2HA 3GYGA 3VRHA 3E1GA 5IM4F 5DJ5A 3V8NA 1YBHA 2IUSA 1NMQA 2PWBA 4D45A 2PE5A 3CVOA 2XLBA 2FRDC 5IULC 3P26A 3EMVA 3F4BA 4IINA 2HWKA 3NS7A 2Z5LA 6YASA 2WJHA 3DVAB 2YFYA 3O38A 1UPAA 1P1BA 4C6SA 1VPTA 2VP0A 4IDGA 4BVAA 1DPGA 3ZZNA 2GJKA 3OM0A 3S44A 3EUEA 3OQ6A 5ECYA 2IUUA 3AUAA 4QLOA 1AQUA 2BR5A 4DGQA 5B1YA 4OGGA 4HWPA 5TT0A 2KHZA 3WZLA 3D6MA 2Z95A 4G5HA 4TYNA 1R5OA 2IU3A 2PYZA 3HZOA 4DLZA 2IZOA 1BQ3A 4RUKA 1XPUA 1PBNA 2J48A 3JU3A 4KDEA 3JWHA 2XNDA 1G42A 2X2EA 3HRIA 1YE5A 3AMVA 1C3VA 1ZWLA 3M9LA 4EFLA 4FONA 3RFXA 3N7TA 4D57A 1EP2B 2MHCA 4EBFA 1XDGA 3DEIA 4N49A 3T7AA 1CNFA 3PJGA 4HKTA 3U31A 4K6CA 1CY7A 2OFPA 1PGPA 1GAWA 4K2AA 5HIKA 1GZ4A 2OZLA 1MAWA 1QK3A 4E3ZA 2HLDD 4JKOA 1GRQA 5KDDA 3IHTA 2XOKD 1SD2A 2ODTX 2H54A 1CQJB 2I6QA 1VB3A 2AX3A 2GJ8A 1C81A 3T15A 1JJBA 4KQ2A 1TMGE 4UHBA 2A9JA 2H1VA 3A6DA 3DTNA 1JIIA 4M53A 4W8GA 1I5OA 5DN6A 1XLVA 2F17A 1AG9A 2QQ0A 2AFVA 2FN8A 2GN8A 1A2BA 4HFMA 4P3OA 1VP9A 1Z6YA 3UXHA 5AKKA 1QO9A 1Q1ZA 1K68A 4RPGA 2ALJA 4Z1MD 3TGLA 3EEBA 5ER6A 3EQ2A 1XKQA 3IALA 3IUSA 3OC6A 4B3IA 3CB4A 4LJKA 4DBVO 4N3BA 4JLOA 4EF4A 1QTIA 4R1PA 2X77A 4ZT7A 3WB1A 5A0FA 1YVEI 4GNRA 3NVKI 4YNBA 1QV9A 2HM7A 4Q66C 5KKCA 3R0XA 2FSFA 4DBLC 3AVVA 2AG6A 1B6SA 3RWOA 1HE8B 2F62A 5CAEA 5EP1A 4TXHA 4JQZA 1WY7A 3PQ3A 2Q7OE 1YJ5A 1U7HA 2E4AA 1UXGA 1MX1A 1Y1SA 4H16A 1M2FA 2XZDA 3OF3A 3BD8A 1WWKA 2CHVA 4HB3A 1B23P 2VRBA 1U8UA 2GPWA 3HB1A 2XB8A 1V45E 4JOBA 3Q2OA 1XVLA 3PQ5A 5JS7A 3LY7A 2R4TA 3ONWA 1Z06A 3KOZA 4DAOA 1D1PA 2RGGA 1Y7PA 2WG1A 1NTOA 1VI2A 2WSLA 3HA5A 1CQIB 3JRXA 1XZCA 2O3RA 1DXYA 3H17A 4CEHB 2UZ1B 2P91A 3DMHA 4YJFB 1V8BA 1TC1A 3UH0A 4M86A 4DYHA 4GVLA 1DAMA 4QBKA 4QM6A 3AERB 4WGGA 3MJDA 1KWKA 3W34A 3W3AH 4OI1A 2ES4A 1FJXA 1N2CA 8ABPA 3I1IA 4ZKEA 5KQRA 3EZFA 4IM7A 4LYHA 5H68A 3RT9A 4C4AA 1NUPA 1W9HA 3FVTA 1R0WA 4DLSA 3U19A 2NT4A 1P7PA 3NWOA 5IYZF 4R9VA 5DYIA 1ZJ4A 1YGPA 1P73A 3BDIA 4I36A 3T1NA 4IRUB 1QQ7A 1QOQB 3E9YA 3PWZA 3RK1A 4CMEA 2Y4OA 1POXA 4PLGA 2VT3A 2WU1A 2DULA 3Q9UA 4ILKA 4XW2A 1W9MA 1H2AS 4HX5A 2IP1A 1D4FA 1IEXA 1OVMA 4RNDB 1JSLA 1XTTA 4IDEA 3V2GA 2EATA 1P5RA 2GR7A 1F8XA 1W2GA 3D3KA 3W5IA 1P2VA 1WDTA 2AHRA 2R7KA 4L72A 1EFCA 1JEAA 2FXIA 1LS6A 3IBFA 4NV1A 2X0DA 4XD2A 3WLNA 2PUGA 5JNSA 1B4DA 1XCBA 1QLJA 1YS6A 1KYVA 3PE4A 2QAJA 4MPDA 2IEZA 1MC1A 2C7PA 4TV8F 1LI4A 1N1MA 2OXTA 5HBRA 4JZKA 4LOJA 3ZQ4A 1IHOA 2ZSEA 1UJCA 3HEMA 3AV0B 3DE7X 1E3QA 2O3UA 4JP8A 2RHMA 3GVHA 3I62A 1I1HA 2JPDA 3CLSD 4WK2B 3TKLA 1BRTA 1UPTA 1CW2B 1L9XA 4WASA 1GXSB 3MJHA 3DQPA 1CF9A 3LL7A 1ZLXA 5AUOB 3WLKX 1F3LA 1NYQA 1W30A 3NPAA 3ISJA 2C1XA 1X9HA 1J06A 1PEAA 5LDHA 1YZYA 4UMFA 1SNYA 2A9VA 2XYVA 1XVTA 3H2SA 3HCNA 4JI0B 4BE9A 2WE7A 3S68A 1TLTA 4NG4A 4BOYA 3WQRA 4QVIA 1U8CB 2PZKA 4M9XA 3DPSA 1UIRA 1K3UB 4TLMB 4ZT6A 3ZJYA 4E14A 3OE1A 4B44A 5KSZA 3OLQA 3LOQA 4K9SA 1F51E 3CLSC 4ESHA 1L4EA 1JX6A 3M6FA 4W99A 2W2LA 1WZIA 5KBYA 1PJSA 2EDAA 2RKWA 4QOJA 5TT1A 5BMVB 1HNXB 5E0KB 1GZDA 1NXQA 1FJGB 1T3GA 3EGEA 3WL3A 5ICMA 3TO5A 4Y9DA 3VNRA 2UV8A 4UCXA 5ALQA 3REGA 4PYIA 4QEKA 4Z5XA 3WV5A 4BAZA 3NETA 4RENA 5LPNA 1N32B 4QOIA 4UDYX 3O9MA 2ZE5A 5BWBA 3RC2A 1PWZA 4ZN6A 4RA9B 2LCQA 3OEWA 4PLVA 2PXHA 2V9ZA 1GSHA 3CR3C 3OQMA 2JFZA 3KYDA 2JBWA 3OUUA 4P2GA 1X80B 4E4TA 1WMFA 3K20A 4A2CA 5JSZB 3ICEA 2QPAA 5TMDA 1OBOA 5AI9A 4EX7A 4KWEA 4RMNA 1QZZA 3EK2A 5MN4A 1YBFA 4FE4A 1Y9JA 2VRCD 3TDMA 3EFHA 3UMJA 2ISSD 2XRYA 3VHLB 1QQTA 2GX6A 2ANCA 2ZR0A 5IAEA 4F2DA 1B0AA 4W7IA 2FWPA 5K5EA 3PFKA 3JQ8B 2FN3A 4YWHA 4EHJA 1COZA 1S8NA 1L7EA 4EJMA 4EM6A 5CB6A 4Z4GA 2HWXA 2RK3A 3G5AA 2OZVA 2Q0SA 3L4SO 1DO0A 1PFWA 4BX0A 2GEVA 2H7XA 3D3WB 4X85A 4EKDA 1IU9A 1EUYA 4EI2A 1R6UA 2JGNA 2Q2QA 4MUKA 2R25B 1EJ6A 2P4UA 2WWWA 3B2EA 4JB3A 1I6KA 1L4LA 4AMUA 2VTBA 2IHNA 2OBBA 5EKUA 1BN6A 5EZSA 4RV4A 3DCIA 1CJMA 2ATIA 5IFLA 3CFIA 2NP6A 3HYSA 4JP3A 3WIEA 1DCMA 2UUPA 3KK0A 3QNUA 4ENUA 2XAUA 4I1SA 3JQDA 3OX4A 3VX3A 1QGYA 3PRHA 5BNFA 4EG1A 4EVIA 5B3JA 3D8HA 4OBEA 1D6NA 4P81A 3QBDA 2Z1MA 5J2UA 1T4DA 4EYKA 4IFEA 3KHUA 3GLQA 1LKZA 3VV2A 3CEPB 3NM5A 4O59O 2HCRA 2Q3HA 2V5UA 3B6JA 4DR4B 2J6BA 3DMDA 2XUOA 4XYGA 2Q5OA 2VAVA 2ZT5A 4JOCA 2EFHB 4BKMA 4CLRA 4G5XA 1TAHA 4CUZA 3GVIA 3OZVA 4JL6A 5F35A 4DABA 1J33A 1BWPA 1MCZA 1TJNA 3SVZA 3KQHA 3HJUA 4OX9B 1LDYA 1P0CA 1X2BA 4ZOLB 2FY8A 3QUSA 3TOZA 2O1SA 4WI1A 1OXVA 4D4GA 4EHAA 2BYTA 2H57A 2B21A 2XNJA 2AVNA 3T3PB 2OFOA 2C61A 2PXCA 3I2IA 2IZ6A 1JAIA 1HLFA 3NTVA 1VMKA 5BPHA 4KL8S 2DUWA 3AK4A 1N4DA 2YCBA 1NVBA 2YOFA 1QAQA 2AQKA 5A4MS 1BDIA 2BDUA 1SC1A 2CL6X 3R3SA 4RL4A 3DZBA 1LVUA 4LTMA 4RPHA 3RFFA 2E6UX 2FPLA 3QU9A 5KTNA 1E9SA 4L85A 3RYHA 1EK0A 3KX2A 2WVAA 1R00A 2QTAA 3NHAA 3DOIA 2XB9A 2WMYA 2OG1A 1GPKA 3T1OA 3WSTA 1JE1A 5CBPB 4BVFA 3GCWA 2BGNA 2OV8A 3E3OA 3B48A 3Q40A 4JGGA 1E2MA 2FMKA 2Q8QA 4PPNA 4CMKA 1E20A 4ISCA 2JVJA 5BUCA 3CIOA 4YJHB 1PL7A 3W9SA 5F9HA 2TRSB 1E96A 1OXBB 5K3AA 3UIEA 1EWYA 4UU7A 1R18A 3J81A 2OESA 3KFLA 2Q1UA 3TEMA 4W5OA 2G6BA 3CVVA 5AK6A 3ZDAA 2FLWA 3UKDA 5KINB 1AMNA 2CF6A 3SZ3A 1FXWA 2GD2A 2QLNA 2R8EA 4U5QA 5A1JA 1CZHA 1IPEA 5H4HA 1NSFA 5BT9A 1L5HA 1CYDA 1B6RA 1QOPB 3CZQA 4CDMA 1X1SA 2NZJA 3BN3A 5K51A 4A0SA 5HKKA 4UC0A 9LDTA 4GPZA 4AQYB 4WUVA 5AIAA 3MWYW 2QX7A 1NBOA 3MGAA 4M38A 3CHYA 2EGGA 2FG7C 2O3QA 4ER5A 5JEEA 1K7CA 2Q50A 3EIQA 1QV6A 1KEEB 3V80A 3SZOA 1ZMRA 2O3JA 2QAGC 4N7MA 2PJZA 4L9RA 3THXA 4ON9A 2P8SA 3ZOKA 5DPMA 1WSBA 2EZ8A 3GQVA 5JAUA 3AG6A 1D1TA 5C4IA 2X1VA 2ZSAA 5EJ7A 2ZBPA 4FK8A 5MFZA 1GZVA 1Z8NA 4WXYB 1OFHA 4CFSA 3C3WA 1KMMA 4C4XA 2OV1A 4JUDX 2GERA 2QM0A 2QN6A 1R0YA 2YWJA 4LKRA 4WCFC 3UMFA 2JJ1D 2D8MA 2NYUA 3GPDG 1NR7A 2O2SA 4JJ4A 2PLFA 3LU1A 4PYJA 1WL8A 5A5DA 2RE8A 2X5XA 4MX8A 1G20B 3CZCA 5BSMA 1UMDA 3ISVA 4G01B 3AVTA 1Q3KA 4QHSA 2HBZA 1AJEA 5EESA 3QEKA 2Y1OA 1ICEA 2NP7A 5AW3A 3HSYA 5JO9A 1WQ1R 2AJCA 1Y5IA 1CZUA 1DCKA 1PG5A 1XZBA 3ZVRA 4KO1S 3AR6A 4S35A 3UK2A 3LL4A 2UUOA 2IYXA 2JFVA 3BWDD 1QIKA 2QMQA 4GP7A 1LQ2A 1W4LA 4OFBA 3AVQA 1O4WA 3QYFA 2IKSA 4LK2A 3K9NA 3DVRX 2NSLA 5AI8A 3E9NA 2NTNA 4IICA 4L28A 3I92A 3U37A 5LP6C 1Z6XA 1KJWA 1RYMA 1QF7A 5ADUS 5BSWA 2P2SA 4F4CA 5A4AA 2HPVA 1HDZA 1HRDA 3DE0X 1MABA 1ABFA 1DIOB 4FOPA 4K6MA 4PLZA 5DRYA 4RQTA 5KX5B 4WZZA 1WMAA 3H2KA 4JUCA 1ZZGA 1XOIA 1P4HA 4R2KA 5JAPA 5LR6A 4TT8A 4XQGA 4WK4B 4DADA 2DKFA 5K3BA 5EMNA 3W4KA 1Y82A 3I4LA 3HCAA 1L4FA 3LD9A 4HQ6A 2IYVA 5D3MA 3PUZA 3HCEA 3I9V1 5SZHB 3HJRA 2ICAA 4IIJA 1EBBA 1LLFA 3F6SA 1FLDA 2ZWMA 4HFJA 1JYFA 3HKEB 5BQ5A 3FFAA 2PGDA 1K89A 2QL7A 4GG1A 4H27A 1FU7A 2AL7A 2DM6A 1F7VA 1QMPA 2GZ2A 3B53X 3CXUA 3FWHA 5CITA 3MF4A 4OHBA 4Y6GB 3OCWA 3CRRA 1U2GC 1KJJA 1OI7A 4X60A 3BH7A 3GLRA 3VU1A 2O8BB 2RI1A 1CDOA 3A26A 3T7CA 5H8WA 5FHQA 5CDFA 1FC0A 3BDAA 3JALB 4UEJA 4UJ5A 5FAXA 4LDZA 4MRMA 1MIOB 4ZQFA 4OQXA 3THOA 3I6MA 5LXTF 1KDVA 3IAM6 3A10A 3A6GA 4MV1A 2BEJA 1WB6A 1FTSA 5H16A 1U7ZA 3D43A 4AKGA 4KDFA 3GJ8A 3KT3A 2Z9BA 2OHOA 3E23A 4K9QA 6Q21A 1QE5A 2HA3A 3AVUA 5B55A 3ETDA 4IF6A 4WZAA 3U39A 2W8ZA 3X0DA 3QMMA 5J40A 1AB6A 2ZIXA 5J1TB 4CL2A 4KQIA 3EPHA 2YXDA 2C83A 3BKWA 3BMQA 4LDRA 4UEOA 4C88A 3DA8A 4MR8A 1UZLA 1PRYA 1RRPA 2E6KA 1N5IA 4WVFA 5FBVB 4GZMA