3Q12A

Pantoate-beta-alanine ligase from yersinia pestis in complex with pantoate.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
285
structure length
285
Chain Sequence
AMLIIETLPLLRQQIRRWRQEGKRIALVPTMGNLHEGHMTLVDEAKTRADVVVVTIFVNPLQFERPDDLAHYPRTLQEDCEKLTRHGADLVFAPAAADIYPAGLEKQTYVDVPALSTILEGASRPGHFRGVSTIVSKLFNLIQPDVACFGEKDYQQLALIRKMVADMGYDINIVGVPTVRAKDGLALSSRNGYLTEEERQIAPQLSKIMWALAEKMALGERQIDALLEEAAAQLLRVGFTPDELFIRDAETLQPLTVDSQQAVILMAAWLGKARLIDNQLVDLRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pantoate-beta-alanine ligase from Yersinia pestis.
rcsb
source organism Yersinia pestis
molecule tags Ligase
molecule keywords Pantoate--beta-alanine ligase
total genus 96
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3q12A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3q12A01
3PRHA 4G5FA 1M8PA 1D2RA 3FH0A 1GPMA 3CVWA 3ND7A 1HYBA 2IELA 3CLRC 1WXIA 3X1KA 2G36A 2E0IA 1M8FA 2HZ7A 4MVYA 4XFJA 1ULHA 3IOBA 1P7PA 4GRIA 2A84A 1H3NA 4XSVA 3P52A 4MW2A 1GLNA 1ZJWA 3FWKA 3KT0A 4ZCTA 3ELBA 3UOWA 2CV2A 1IVSA 3CLTD 1QRSA 1IRXA 2CUZA 1LI5A 2E18A 1H1TA 1F9AA 3IOEA 5IJXA 5HG0A 1KP3A 2EL7A 3HL4A 4EG5A 1T6YA 3KT6A 3ND6A 4CT0A 1M1ZA 2V0GA 2CYAA 1VL2A 2CV1A 4WSOA 1KORA 1N2HA 3LE8A 3IH5A 3RK1A 1ZH6A 3CVUA 2B7LA 4RPIA 3RJZA 2ZUEA 1J09A 5HUJA 4KR7A 3H97A 2YXNA 1XNHA 4U63A 3KFLA 4EG4A 2J09A 1F7VA 1F7UA 1YI8A 1O95C 1F4LA 1MBZA 1OBHA 4MAFA 1GZUA 5J5AA 4PBRA 1EFVB 3L93A 3TNJA 1OWMA 3TZEA 4EG6A 3A4IA 4BWVA 4EG1A 1JIIA 4I6JA 1M8JA 3CVXA 3VRHA 3CLUC 1O0BA 1K97A 1FYDA 4P2BA 4ND7A 2QJFA 3H05A 5DASA 4F3RA 1KQPA 1N75A 2A1TS 4NX2A 3IVCA 1A8HA 3MLAA 4YP7A 1WXFA 3CLRD 1NSYA 1KQOA 1CT9A 2WQ7A 3G59A 3FY4A 2JA2A 1PFUA 1S4MA 3COZA 1MJHA 2VTBA 2PXHA 1N1DA 1G59A 4CQNA 1OWLA 3X1JA 1XNJA 3SZ3A 2X3FA 2GOYA 1J21A 3X1MA 2CFOA 1Q15A 1ILEA 4MW1A 1JIKA 4MLPA 4MW5A 4R2LA 2AKEA 4I6EA 3GUZA 4MW9A 4KPUA 1NUUA 3NBKA 3RHSA 4S1OA 4JFAA 1YIDA 2VTBB 2H29A 1N2BA 4HJXA 1N2IA 4MUKA 2D54A 2YWBA 2QTMA 3N2YA 4KKVA 4DE5A 3GMIA 1IFXA 3K32A 4MUNA 2OQ2A 1IH8A 3IOCA 1R6UA 1PFWA 2DPLA 4QBTA 3QTTA 3AKZA 3ZGZA 1J20A 4FZJA 1SURA 1G8HA 1M83A 2PZ8A 1EUYA 1G8GA 1NP7A 5F23A 3G6KA 3OP1A 1IQUA 3ZJVA 3N9IA 1OWNA 3VU8A 1KR2A 2J4DA 4KR9A 1G8FA 4OUDB 5LM3A 1YUMA 1YIAA 1VBNA 2PZBA 3ZUGA 1Q11A 1JECA 2DEUA 1R6XA 3CVVA 3UMVA 1KH2A 1COZA 3SEQA 3CLUD 3H9CA 3IMGA 2D5BA 4DLPA 4EG7A 1N78A 3S3TA 3ZXSA 1KH3A 2QUJA 3K9WA 1N2JA 3COYA 2PIDA 4ZCRA 1O95D 1JMVA 4PBTA 1KQNA 1MB2A 1QRTA 3H9BA 1EXDA 3TZLA 1JGTA 2X1LA 3FIUA 5FO0A 2I1LA 2QUHA 4MW0A 3ZIUA 2E21A 3P0HA 4QREA 3KT8A 1KH1A 2NZ2A 1VLHA 4H3SA 2PZAA 4ZT7A 1WXGA 2PG3A 3FDXA 2WB2A 4MVWA 3MLBA 4ZCPA 3IODA 1PG2A 4MUJA 2YY5A 3BL5A 3SZGA 5J58A 3FHJA 2XRZA 3AG6A 2A1UA 1U7XA 4UZFA 3FNRA 4J75A 1MC1A 4OJMX 4JXZA 1VBKA 3RBAA 1VBMA 5KCMA 3Q10A 1MOPA 1K92A 3AIIA 1J70A 1BS2A 2QTRA 3IDFA 1TYAE 1WXEA 1WXHA 4U7JA 2A1UB 2DETA 2CYBA 4MWDA 4JXXA 1R6TA 1WQ4A 5BNZA 1PFYA 1IQRA 2ZUFA 4ND6A 1EUQA 1NUQA 1TEZA 3UY4A 2GM3A 1PFVA 1IHOA 1KAQA 3DLAA 4EG3A 5TS2A 1JZQA 1WQ3A 3FG9A 1JILA 4K03A 5K0TA 2A7XA 4NAHA 4MW7A 1NUSA 1EFPA 4QRDA 1WY5A 3CR8A 2X1MA 3CLSC 2BYTA 1QRUA 1JEDA 1GN8A 3SP1A 4XFDA 5FNZA 1MAWA 4JZYA 1X6VA 1XNGA 5LFAA 1T6ZA 1U3CA 3HGMA 3P0JA 3A2KA 1M8KA 1JEEA 3H99A 3INNA 3L92A 4TS1A 4MVCA 4ZT6A 4DDKA 2HMAA 3MUEA 4OUDA 2O8VA 4A91A 4DJAA 5HUHA 5TGTA 2QJTA 1N2GA 1V8FA 1M8GA 1I6KA 3CA8A 4MUIA 2X0KA 3N8HA 3AL0C 3COVA 2ZP1A 3HZRA 4I6GA 3QTBA 2VXOA 1RQGA 1WOYA 1WKBA 2AZXA 2QTNA 3JXEA 5K0SA 2J07A 1O94D 2O5RA 3M5WA 1O0CA 4HPWA 1N77A 3KT3A 4Q93A 1T6XA 3LOQA 4EGAA 3ND5A 4R2MA 3HV0A 3RFFA 3F3MA 5IHXA 1TQ8A 3FOCA 2Z08A 4KPUB 1XJQA 4L2IB 4MUEA 1V47A 2A4MA 4X0EA 4EF6A 4NZPA 1JHDA 1O94C 4DNXA 5J59A 3ZXIA 2R5WA 4ZT5A 3HMQA 2YWCA 1JZSA 3CLTC 1KKUA 1MRZA 2GKSA 1OBCA 2CV0A 3P0IA 5EKDA 2J5BA 3FI0A 3C8ZA 2CYCA 1T9GR 4ZCSA 4MUGA 1N2OA 1YULA 1Q19A 2IP1A 2IJGX 4YP6A 1U0BB 2DUMA 2TS1A 2Z09A 3AG5A 4EG8A 3IUEA 4ZT4A 1GTRA 1QU2A 4MUFA 1GTSA 1NI5A 1NZJA 1YUNA 2D13A 1LI7A 2J08A 1GAXA 5DB4A 1EFVA 1NUTA 1O96B 2EJCA 2RE8A 1NURA 1KP2A 1TYDE 4AS1A 1U7DA 4WNYA 1MAUA 4ZT3A 1K4MA 1IQ0A 3HFJA 4R0NA 4MUHA 1O96A 4MVXA 3VGJA 2WSIA 3N05A 3PXUA 2HGZA 3UC5A 1LW7A 3FETA 3IUBA 1JIJA 1WZ2A 1T9GS 4G6ZA 2DLCX 1QQTA 1N3LA 2NSYA 4MW6A 4NAUA 5DK4A 4ARCA 3U1VA 4RUKA 2DR2A 4YP5A 4ZCQA 1QU3A 4G5YA 1I6MA 1PG0A 4F4HA 3D6VA 2A88A 1I6LA 4ARIA 1K4KA 4E1AA 2QUKA 1DNPA 5JBNA 1B6TA 1O5TA 1OWOA 3I05A 5TEVA 5DEOA 1J1ZA 3A04A 1EJ2A 4HJRA 1O6BA 1Y42X 3IVXA 3IVGA 2A86A 3CLSD 1OWPA 3SDBA 1N2EA 3GLVA 2PFSA 3AFHA 2QUIA 4CDNA 5KHAA 1MB9A 2H2AA 3PNBA 3MXTA 3DV2A 3NV7A 4L2IA 2JANA 2OV4A 3E27A 5TEWA 2CSXA 5AHWA 3OTWA 1ZH0A 2QJOA 2BTEA 3RK0A 3MMXA 1TFUA 3ZJTA 3ISJA 1QNFA 1TYCA 1Q77A 1OD6A 1U3DA 3A05A 2Z3VA 1ZUNA 4ZT2A 4NDAA 1TYBE 4UZEA 3PNYA 1O97D 4EFKA 2DXIA 3Q12A 4PY2A 4DDHA 2AG6A 4NATA 4KR6A 2DERA 3Q4GA 3SYTA 3TQOA 4GU5A 3UK2A 4U8HA 4MULA 1UFVA 1NUPA 2WQ6A 1QTQA 1EE1A 1J1UA 1I2DA 4YBRA 4YMIA 1KAMA 3G5AA 3ILVA 3IMEA 4PBSA 2RD2A 3QE4A 3LCJA 3NBAA 3SEZA 1QJCA 5LLTA 3IMCA 3DPIA 2CT8A 1H3EA 1H3FA 3TS1A 4CDMA 3TQIA 1O97C 4J76A 4MW4A 2XRYA 4AQ7A 3ZJUA 1NYLA 4MWBA 4HK4A 4MQ6A 3PNVA 4MWEA 2E89A 2C5SA 1FFYA 5KWVA 4DDMA 4K0RA 5H7XA 4MWCA 3D6UA 2A1TR 2V0CA 1WJGA 1EFPB 3CVYA 5FO1A 5H16A 3DO8A 4Q16A 1X8XA 3COWA 2JAXA 4JYZA
chains in the Genus database with same CATH superfamily
4JH0A 3W06A 3SEAA 3IPXA 4NULA 2WT4A 1PNRA 3GVPA 3QXXA 4X6UA 4DBVO 4LDJA 4CW7A 4C21A 3A6HA 3MFQA 3TLKA 1HYBA 3UZUA 4UREA 1Q2XA 5IASA 3I2IA 2GTHA 3KJEA 4HAIA 2Q3CA 2VHJA 4AYWA 1HDZA 3LU1A 4K6FA 4XSHA 3NNDA 1JFTA 5HRAA 2MIIA 2QRMA 3E48A 3TIVA 3IOBA 3L04A 4YPVA 4S04A 3AUJB 1FF9A 4OGFA 2A84A 2CNWA 3N7UA 4WA7A 3I1FA 4N4AA 1SKMA 3ZW8A 3G82C 1X13A 4M0UA 2BGJA 2A3RA 3EGWA 4PICA 1JNYA 1LXCA 3FWKA 3U80A 1T9DA 3HU3A 1A5BB 1N7JA 3X1DA 5D2CA 4C7XA 5INTA 1D6NA 4IS3A 5J4YA 1E7WA 4KXMA 2X9GA 3JQ9C 1H9BA 4BJ5A 4KDRA 3AI3A 1BMDA 4NBKA 5A6VA 2NVUB 2X9LA 3THOA 4P98A 4RSRA 5D5QA 2GCOB 3L43A 1ESZA 3CUEF 1E1LA 3G2HA 3KT6A 3ND6A 1TO2E 3O8OB 4W8GA 5EJMA 3ZTTA 4BPRA 2V0GA 1ZMXA 1UKZA 1X94A 3Q6IA 5D6OA 1OR8A 2AOTB 2FMUA 1YJ8A 2J3IA 3AIOA 3B6ZA 3M4NA 4GYJA 1EGVB 1IDN1 5DU2A 5BR4A 1JG4A 1EM8A 1HA3A 1KZ1A 2N3ZA 1FBNA 4L16A 1XDZA 1F0NA 4LJ8A 4XARA 3UUGA 4G8BA 3W7AA 3ZE9A 1DFHA 3ZX5A 4DA0A 3I0MA 2XB2A 4NBUA 5C1OA 3M1IA 3E81A 5HUJA 1X8JA 3MTGA 4O2LA 4ERNA 3E22A 2H8GA 1LQTA 3RRYA 5ECWA 2RHHA 3C8HA 3E3LA 1ZOIA 3KB2A 4LUCA 1RCTE 3UB3A 1YHNA 4B4KA 2JCXA 4LZWA 3HLTA 4MAFA 3FYUC 3OFJA 1RXYA 1T2VA 4EG6A 3A4IA 3AYXB 2BE7A 2OHVA 3C3KA 4XQCA 5AJTA 4GKJB 3J7TA 1YR3A 3VX4A 4HVTA 1RU3A 5LQCA 1XCJA 4YCJA 3A0RB 3CCBA 5HCUA 1M8JA 4Q4HA 3WMEA 4NYJQ 3F4KA 5FFNA 3P9RA 2W6MA 3L5OA 5J40A 4X20A 3KR2A 1M2EA 2NUAA 3AKCA 1ST2A 2DHRA 1W0JA 4QO8A 1CS0A 3LVFO 4P2BA 4WUTA 1E9VA 5HQJA 3I3OA 5AHXA 4RKRA 3RV4A 3SYNA 2GZSA 3I6IA 4CMIB 2XVXA 1DADA 2V7PA 2IYEA 2BJHA 3ZNOA 2NNWB 3QBDA 3DMRA 4WNAA 4DLUA 5GOZA 3S2IA 2PU5A 3UK6A 3AJEA 5DT9A 5K0FA 1UOPA 4L0CA 1H42A 1YHYA 2FAXA 1KNXA 2JA2A 3FPBA 5B2EA 2XVAA 3MSXA 3RH0A 5EWMA 5DIZA 4WKCA 3THRA 3KSBC 4Y3UA 4F4FA 4YQFA 4OX9B 2A0KA 4KRXA 4L4YA 4F21A 1IBMB 4GI1A 3DKIA 5E1BA 4ZAYA 2O19A 1CUCA 2C2HA 2CFOA 1WPGA 2L82A 2W2MA 1H0HA 4IXTA 1CR4A 4YA6A 2BFMA 4R2LA 1RP1A 2Y2VA 1PVDA 3IKJA 2P1RA 2Q2NA 4U5XA 3NJ8A 3NEJA 2HWWA 3AHIA 2RHRA 4WEOA 2JIDA 1F2DA 3GEPA 4WK6A 4RELA 3VZBA 3GNTA 4MUKA 4PXAA 5BSMA 1W85A 4OK3A 1AB6A 3EK2A 3QFCA 4G5RA 5KNCD 1Z5VA 2YWDA 1L7PA 3BD8A 3L4BC 1M9NA 2R8RA 5KKNB 4WNAB 5T4HA 4C08A 4DIFA 1RYZA 1SUWA 1ULAA 3ROXA 2EYQA 1CNFA 1KYVA 2OQ2A 4QRHA 1XJ5A 1KY3A 3RUIA 1HX7A 3C6ZA 4O29A 2F7SA 2JLWA 1OIVA 3R0VA 5D7BA 1GFZA 2HXYA 4YUVA 2P78A 3RJ5A 3ZCQA 1P4AA 3E9QA 3NUGA 1J20A 2ONYA 3PDIA 2DF8A 3EXG2 1P2UA 2LE0A 4RACA 4ZQFA 3RWMB 3K5WA 4IHKA 3KFXA 1T5SA 3L3BA 4F11A 4D6XA 4YJ2A 1QAMA 2CL5A 3VJLA 5F21A 3AUFA 4C05A 4RJTA 1IPHA 3ZJVA 2WZQA 4AFNA 3C1OA 2ZS8A 4IF6A 3CZ4A 1YB5A 4TQUS 4YJ3F 5EIXA 4C88A 3WKAA 1Q16A 1J2UA 1Z17A 3DNMA 5ARDA 4B9AA 3PHJA 1NW9B 3VSAA 4R1NA 2VOEA 3NDPA 4BBZA 4DA9A 1IJFA 2P7HA 2QAIA 3PUJA 5BN5B 1PO7A 4PZLA 4EA9A 1NXOA 4RHUA 2G16A 2DULA 3OOHA 3EGOA 1HNWB 4DLYA 3N8KA 4M2LA 4M9SA 3ONDA 1E79D 2FQXA 2FA9A 4JSRA 1BCRB 1JTVA 1R8SA 2FFAA 2OORC 4HZUA 1YIOA 1YACA 1P4SA 1PS8A 4WERA 4EK9A 4ZIRB 3RSGA 1UWKA 2H5IA 3OKCA 1JFRA 4J90A 1EX6A 4YVFA 3VYTB 4DHEA 4KODA 1BG6A 4Q3LA 4DCNA 4HGZA 2KE5A 5AJXA 3K3PA 3DXFA 5FEUA 1X74A 1YASA 2A57A 3L7DA 3Q7RA 4MVWA 3U9LA 4PN3A 4IBOA 4UJ5A 1QZZA 4LRUA 4RPGA 5BSUA 4Q66C 1S96A 3O3OB 4FNOA 5T41A 3NETA 1CY4A 2JD1A 4HDNB 2I1WA 4KMMA 3OHPA 3BE8A 3FNRA 5C8YB 5TMPA 2GS9A 1T5HX 2RG7A 3U49A 2CMKA 2YJ4A 2PWYA 1LVUA 1Z16A 2FDXA 5KCMA 1GFIA 3A1WA 4AICA 1DJPA 1E4YA 2IHVA 1DPFA 4PINA 4NEHB 1D2EA 4PW0A 3WWYA 4FFBB 2Z30A 4MYDA 4XX1A 1K7YA 4Z4FA 4MV6A 2JIBA 2PSDA 2PNJA 2D7DA 2C7GA 1KEVA 2ZLBA 4TLAA 3ZGXA 1U4OA 2UYYA 5DMHA 2FN3A 1C5KA 3NWEA 4JP1A 4ZYTA 2P9GA 4FOOA 4R05A 5LYJF 2AK2A 1GGVA 2B98A 3G7UA 5KYUA 1NE7A 3UY4A 1GPUA 1Y1KE 2JFFA 4W5JA 4L5JA 3UFXA 4CV0A 3HJFA 4LMPA 3PHGA 1P5ZB 1HZZA 1E8DA 2Z04A 1MOZA 4JN6B 4Y2SA 4Z8YA 2D3TA 5K0TA 2MCFA 1IY8A 1P19A 5GVSA 1Y1LA 2AI3A 2K87A 4WLOA 5LA6B 1KK0A 1L4YA 1CX9B 2Q1WA 1ONBA 1QHHB 2FKNA 2GVDC 2VDLB 3LXUX 4JOCA 4L75A 4MVJP 4MWTA 3SMQA 2BYTA 4JR0A 1M7BA 4BP3A 4WFKA 4IYRA 2P8JA 5BN5A 2JF0A 5K8LA 1IMOA 2I22A 4JFRA 2ZXEA 2C9BA 1U3CA 1A4RA 3ZWKA 5U4QA 2JLYA 2C2XA 2H1VA 1ZD4A 2QMYA 3GH3A 2VP9A 1NMQA 1SULA 3BPSA 3A1CA 2GAOA 3MJVA 4Z53A 1UOQA 1X38A 2Z0MA 1M1YE 2AOUA 1TMOA 3ENNA 4A91A 4DJAA 1OT3A 1Z5UA 3BL6A 1M2OB 2W70A 4TV8F 5EYPA 5EXPA 1A27A 5ILGA 1WPRA 4R1PA 1R4AA 2H1HA 3B60A 3CA8A 3KOXA 4ETMA 2Q3FA 2ZSDA 1NQUA 1VLVA 4RCVA 4LS3A 2W11A 1NVMB 3L7OA 1UJBA 3COVA 5ABPA 3U3JA 3SNKA 1SXPA 1C14A 1EK6A 2QTGA 1FQWA 2ZJ6A 1OCEA 2C84A 2XUGA 1LDNA 3TCXB 2YQZA 1AF4A 3R09A 4Y8VA 2Z98A 4X1YA 2QZSA 1XLUA 1ZNWA 4HPWA 3KLPX 2PX0A 1BDIA 2F3RA 1UMBA 3B89A 1XPRA 1E6LA 2DHDA 4D43A 4HN9A 4G85A 2EIXA 3ISTA 4M0MA 3HVRA 2VYVA 3H0KA 4C5CA 1LSUA 1OX4B 2Y1XA 1V47A 3GT0A 2Y27A 5MN6A 3CZAA 5H4GA 3LF2A 2FZGA 3PQ3A 1IU9A 2V97A 2RONA 1CNMA 3N07A 2XOEA 1VIDA 5J59A 4ZCIA 1B3BA 4AF8A 2R5FA 4AJJA 3GPLA 2ZBRA 3WYNA 1TA0A 3HU1A 3S7ZA 3ZHTA 2WBLC 1ENOA 3CCFA 4GRAA 4JLKA 1VIYA 4LC0A 4J7XA 5IVKA 1VKZA 1YOVB 2A9OA 3OFND 2PKCA 5EQJB 4O2AA 3SXJA 4DNFA 1UWCA 4DQUA 3O84A 3OM8A 4IMPA 1TVMA 4OXKA 1BQ4A 3UATA 2V6BA 5EJ8A 1NXQA 4MAMA 2FFRA 5LCXA 2XUZA 3VNAA 2IYRA 3P0IA 4FFDA 3W5BA 1E7QA 1XVAA 1PR0A 2JBHA 2W6NA 4U2GA 4ZCSA 3S29A 4MIYA 4WLUA 3UMSA 3ZQUA 3BT7A 3HEBA 1Z2EA 1YULA 4Y1FA 4NJMA 4OFBA 1UXJA 2H57A 1JYSA 4DSAA 4GUAA 1TAQA 4AN4A 3DOIA 3U9SA 1H2FA 4UNNA 2NZWA 3IOMA 4L4RA 3ZWAA 3AG5A 1NPDA 3MWEB 1PGJA 2GW4A 1KEUA 2J6CA 3QQPA 4PLGA 5CK5A 4ZT4A 3U4DA 3VZCA 1QHGA 1A9RA 3N74A 1GTRA 1KRXA 4IG9A 4IEEA 1HETA 4W82A 5EZQA 1GTL1 4YCMA 3S4YA 4CCAA 1NI5A 4AMVA 3FA2A 1SR8A 4O4LA 2ALJA 3BWXA 3NC1C 5IAAA 1B15A 1SCUA 3A6ZA 1C7FA 2B6NA 1YKGA 1JYFA 2ZBQA 3OWXA 4E2WA 5B36A 4ME6A 1DCFA 2IGTA 2ZYUX 3GZNB 4GPBA 4LF9B 1GGKA 1RP7A 1V7QA 1RI5A 4JUIA 3P9XA 1ESCA 2IDZA 5LU9A 1U9YA 3B2NA 3HFJA 3VU9A 4AJ4A 1SCUB 1KDOA 4TX1A 5BXYA 3Q2OA 4KB5A 2GWRA 1UKAA 2R97A 1GOTA 4WCFA 3O94A 5COQA 1L8LA 1LPMA 4GYYA 3Q5GA 3GJ8A 5B30A 1I7SB 5FQOA 4PVDA 1MUUA 2GCOA 4O6VA 5DK4A 2HZBA 2OGTA 1YL7A 3I9V1 2GYUA 5IVPA 1U02A 5GZ6A 1XCLA 1B43A 1JDBC 4O4HF 5FOXA 1E8MA 1QPZA 2IHNA 3O4JA 3PZRA 2P41A 4PC2A 1NFFA 1I6LA 2XCOA 4BMCA 3V97A 1U0HC 1CUIA 5AO9A 1ORHA 2QUKA 3HJGA 3PLAE 3GA7A 1MN6A 2EKQA 1CQPA 1KZHA 1UXGA 1AZTA 2LCQA 1SU6A 2YZGA 3FB1A 2R8EA 3SYRA 4CKXA 2FSVC 5TEVA 5A62A 2WJVA 3RAGA 4EUEA 2CLSA 3LT2A 3E58A 3O4IA 1E2GA 4MNTA 1VKNA 2BFBA 3RIXA 2ASEA 2G88A 3SK0A 4R2XA 1RQ2A 4DC0A 3SJUA 2G17A 3HJCA 4N0MA 2OFWA 3BWVA 4D80A 2ZZNA 2ZJ8A 3CRMA 5T57A 2GNPA 2JLUA 2N0SA 1KZ6A 1HG0A 4I99A 5DLYA 3ESBA 2XTZA 4MQ4A 4E07A 1LQUA 1TYEB 2JANA 4JT8A 2WLSA 2FPSA 1BYUA 2V6JA 5IU6A 2P6NA 4AYXA 2RGRA 1SHZA 4YT2A 2XQKA 1NF3A 2ZBDA 3ISJA 4WECA 5CDTA 3H2HA 1Q3HA 3WK7A 2FQYA 1U7OA 2C9MA 4LQDA 1LA2A 2WICA 4K8OA 5JSUA 1EDBA 1OPRA 5DX1A 3HUDA 4ZT2A 4YRCA 4P33A 5TVGA 3TRDA 4F45A 1T5DX 4OF4A 7YASA 3AW8A 4HAXA 4DXHA 1T5LA 2DC1A 3BCSA 4YIKA 1JT2A 3BJRA 1Q21A 2FSGA 4MJ7A 3SGLA 4PGAA 4DADA 3AFNA 2WMNB 4DJTA 1LQ2A 4PZEA 3SYTA 4CLDA 5B5SA 2H54A 2JKZA 5L3ZA 3ZE6A 4Z4CA 2EKBA 5KJCA 2IQ5A 3SQOA 1AO0A 4NZMA 1XFAA 5LB2A 1IUNA 1X7XB 2FP4B 4YRFA 5JSQA 2OBFA 4HQOA 4MQFA 4R40A 3BFXA 3G5AA 4UJ3A 4WZBB 5EINA 1GSAA 5FNVA 1V16B 1JQJC 3RJMA 3L9WA 4RHXA 2CJFA 1M3SA 1GAQA 5ITZB 5CVUA 5IC4A 1R3DA 1CUFA 1UT8A 3QENA 2AJ8A 4YI3A 1XEWX 4GBGA 4MRAA 3RTAA 4Z0NA 1MO2A 3KSDO 4N47A 4O4IB 2Q28A 2ECQA 1RXVA 1RAEA 2HADA 5FWXA 2R96A 4G4SO 3S2SA 1H3EA 3TJZA 4CQMD 3K0FA 3KKQA 1VG9B 2OO3A 4QPJC 1NVAA 3R8XA 2QE7D 3CUYA 4H7EA 5EY5B 2WV9A 5E9QA 2E89A 5LSAA 3T5MA 2NVWA 2R751 5H7XA 1KYZA 4K0RA 1D1TA 4MB2A 3TXAA 4OXQA 3V46A 4EPYA 1OV4A 3V48A 1K3UB 1JF8A 2JI7A 1Z4MA 4YB8A 2WMOB 2E6UX 2VN8A 5DW0A 4EGQA 4YCSA 5BRAA 2VBCA 2V1UA 3PQ7A 2CJWA 2FJPA 2ZK7A 1OMOA 2PS1A 2F1HA 4P0TA 3E1SA 3MCTA 5CIQA 3HKEB 4ZANA 3ZK7A 5A4AA 4AKGA 4JEIA 2EJUA 3J81k 2BMJA 4QE3A 5KYUB 3F0TA 3KYBA 2HU2A 3U09A 1NXWA 3H16A 1BSVA 3OLQA 1R0LA 3PGJA 3HXMA 1D6MA 1GN9A 2YV4A 5AM4A 3W1EA 1XTBA 3C48A 2O1XA 3RU3A 3GRKA 5ICMA 5IT9A 2VDWB 4H4CA 3FWZA 4JOBA 1C4WA 1T4GA 3DBHB 3JZAA 2IYXA 5KQMA 2RK3A 2AK3A 1N4DA 2BGIA 4RY9A 4RHCA 5DYNA 5TPZD 3KE8A 4JJ4A 5DCWA 2JI4A 2XCIA 4HQFA 3RUFA 5KWJA 2NSLA 5LQUA 1JJFA 4JYPA 4ZU1X 1XRRA 4EMBA 4MVJF 1JX6A 3QXCA 5C4GB 2MYNA 1P0MA 4PHFA 1NJ2A 1ZJWA 2ZVPX 1CB0A 1J9EA 1OZFA 2Q2QA 2WT8A 3ELBA 4NF2A 1ZBDA 2XSZD 4D3XA 1V11B 3BSWA 5EZYF 3DDOA 4XWKA 3PCRB 4DCOA 2A0UA 5EE3A 4BKMA 3HSKA 1QR2A 2NN3C 1BU5A 2BKVA 4I3HA 3ICOA 3AB7A 2EGUA 3QU4A 3CISA 2VJBA 2LGJA 2QR2A 5JI2E 1BC5A 1JLMA 4TKMA 2IV3A 1W7AA 3ZI0A 2PDAA 1VFPA 5ETJA 3TO5A 4EYEA 5H68A 4X8OA 4UC0A 1W9HA 3WIBA 5I6DA 3LV8A 1JR4A 2Y9MB 1FRZA 1PTJA 2QT9A 2IF0A 4P0QB 3DOUA 4RBNA 1HTTA 3EARA 4Z99A 3CBGA 1KKLA 1G42A 3H97A 3PNMA 4PTZA 5F5XA 4P4GA 3KFLA 5LBIA 4PZAA 2D7JA 3E15A 1BCSA 1UXIA 4EG4A 5EUQB 2J09A 1QFSA 2XMBA 4FZVA 3R7FA 1BDBA 3MYYA 2C2OA 3SM3A 2DQZA 4Z54A 2QRZA 2A5YB 4DWJA 1UBGA 3M1AA 3R40A 2Q3HA 1FSSA 1S2IA 2WQ7A 1COWD 1CDDA 2ZI4A 4WD3A 1GO2A 3H5IA 5JANA 4Z2YA 2X5XA 2AJTA 2FSFA 2VI5A 1NNI1 4TVKA 1Y89A 4YJ2B 1U9ZA 421PA 1NLYA 1XTZA 4P7JA 4YROA 4E4RA 1GAWA 4JJAA 5U4XA 1GZ4A 3JALA 5C32A 2BMDA 4ND7A 1YF3A 4KGDA 2EJTA 3G8AA 2B36A 3G9QA 2PVCA 3DL0A 3QVGB 3UAYA 1N75A 1QAQA 4B6OA 1FP7A 4HVAA 5LU8A 3V1NA 4WGGA 2Z8ZA 2F55A 2VBIA 1NSFA 1KGDA 3P4UA 4YP7A 2JW5A 4NH4A 5L6LB 4CJXA 1GR0A 3VPFA 2QU7A 5A6SA 4YTEA 3E5HA 4FEGA 4PZYA 2JD0A 3KZVA 2O5CA 4YJFA 2HA6A 2FPWA 3M3DA 1I1NA 3ZHYA 3X1JA 3I9NA 5CBPA 1HDGO 1NBEA 2NPOA 2ODQA 2JFBA 3DZFA 4L6CA 1Q3KA 2DP4E 2GOYA 4AD8A 3J80A 4IDCA 1L5ZA 2CL0X 3B6IA 3L6BA 2C97A 2VHUA 4KYTA 5B7QA 4JV5B 3EZFA 3GL9A 4ITUA 3MS7A 1F20A 3NBKA 4NI5A 3ZZUA 5EKSA 2VUIB 2WF8A 4LXXA 3C5HA 2D06A 5L3VA 5L8VA 1NN0A 3ZHQA 4KAAA 1XU4A 5LJLA 4LDQA 3LYAA 2P40A 4UCXA 5F5LA 4EX7A 1ADJA 2XTJA 5JXGA 3LWDA 2ZUWA 3C8DA 3DTVD 1FTQA 2QTMA 1RTKA 4GOJA 1N6HA 4YGYA 2X22A 5JXJA 4OP1A 2QYTA 1MXFA 3ILSA 2JBWA 3NI2A 1MIOA 1WVIA 3L6OO 3OF5A 4JJGA 1U81A 5HZMA 3ICQB 4HNAB 3BILA 3DXZA 4RAOA 5FYDA 1ZI6A 2NV0A 1LBTA 1WU7A 2PO5A 3JWJA 4L85A 1ONPA 3DZGA 3VZSA 5ADUS 1CS0B 2XQGA 4TTQA 1SURA 4AKEA 2CNDA 4I50A 1X14A 4L73A 2KLBA 4HRYA 1GFSA 2WUFA 1IQUA 1NBAA 3RYTC 3N9IA 2XMDA 1U2SA 9ATCA 3BBLA 4IHJA 2D7CA 3AGQA 4YMSA 3D7NA 4N65A 3WLEA 3JU3A 1OH7A 1CPYA 2JGEA 1BD4A 2G1JA 4GICA 2OSBA 3MAGA 3SIRA 1XTTA 2BZSA 3ER8A 1X1QA 1KY4A 3DFKA 2W2VA 3TTTA 2ZSKA 3IAEA 3O26A 4IXNA 2GBFA 2AFRA 5FBHA 4Y2VA 2CDAA 2IFTA 1KQFA 1A97A 5LYYA 1P62B 1OHHD 4L51A 4FXOA 4MMYB 1E9SA 2WKRA 3OZRA 1JFFA 1KOGA 3RT7A 5C81A 1L8XA 2XHZA 1DBPA 2YBDA 3KUUA 1EZ1A 2OILA 1OUMA 2BEJA 3II6X 4F71A 2PHZA 1KBOA 4QODA 1VPTA 5PNTA 3TTWA 4F84A 3T15A 4YJHB 3C97A 2VYFA 4EW3A 3OPNA 2W4QA 3BSSA 5E4FA 1KH1A 4IV8A 3AF6A 1E4EB 2PG3A 3PDCA 3QX7A 4HWGA 5EOVA 5F52A 5FBQB 1TTTA 4ENTA 3G2LA 4ZVVA 1PG2A 3PLNA 4OAQA 4BLQA 2RB5A 1Y1RA 1U0FA 2BEVB 3BD7A 3Q3VA 5G02A 4IY1A 4YXWA 2ZPAA 4DJFC 4M1TA 2JI6A 2XNDD 1ODKA 3QYFA 1GTJ1 4UMDA 1VBMA 1VL1A 4PTLA 4MWZA 2D1RA 5HF9A 4FFNA 3VHXA 5J4HA 4P9NA 4WWHA 1XA3A 3S1AB 3S28A 3SFVA 4L6IA 5JDCA 3JR7A 3V8PA 2QE7A 1JVBA 1EK5A 1DRVA 2GNAA 4MRRA 1G9SA 1BHJA 5K0LA 1QVVA 2XRMA 3H1AA 4B6GA 1QYVA 1JUDA 2WFAA 5GPBA 1ZZEA 5DULA 1U0NA 4QA9A 5KNDH 2WVJA 3MJTA 5NLLA 2QD1A 4WJKB 1DDIA 3V1KA 2GAJA 3F1KA 5CH8A 3O1IC 2C0QA 5EJFA 2C78A 6CHYA 4C0QC 2HYIC 1BE8A 1JBQA 3LGAA 5D5PA 4CM4A 3GARA 1BZYA 3IO5A 4GR5A 3DAOA 2OZLB 1KOLA 4K03A 4MCAA 3GIDA 2IOFA 4G0WA 4UCWA 1AUPA 3ESZA 1RRGA 2R9VA 2DU8A 4QDKA 1VFNA 2ZT5A 2OB2A 3M6UA 3TDMA 2DG2A 4S12A 1QZTA 3PC3A 2BFDA 3G9UA 2C3PA 1GU0A 2EERA 3CXRA 2R5NA 4ZEVA 3UMBA 4DV3B 2BKUA 3OY2A 4E11A 1IHDA 4BQSA 3NXSA 2PX2A 2X6TA 3HM2A 3JVEA 2Y66A 2QXUA 2VQ3A 5I9TA 3LCUA 3OQHA 2JVIA 1ZRNA 4AWXA 2HF9A 3IAS6 4MVCA 3OZGA 1QHNA 3N3BC 3L6UA 2O8VA 2EYUA 5BSHA 4ON9A 4KR0A 5JT1A 3AUYA 3FNEA 4I2VA 1Z8HA 2PAFA 4Q1BA 1CUEA 4I1SA 4PR0A 5CX4A 3ABSB 3A1SA 3O1HB 4MPDA 5J9FA 1DIBA 5AUNB 1BDMA 4KPEC 4B73A 2C54A 3ZDRA 2V74B 3HY6A 1JU3A 2XJ9A 1CR0A 3HXTA 5JCOA 1T10A 3ZGYA 1ADGA 3QTBA 5IAKA 1HRDA 2MDTA 3ZWYA 1F8YA 5FOSA 2AOXA 4HRAA 4RMIA 4YC7A 3FUCA 3KSRA 2GZ3A 3VKHA 1G1AA 1P1FA 3LC1O 4JA2A 4PFQA 3ORFA 4H0CA 5FT9A 4B85A 4CM6A 1N33B 4P4NA 3P94A 1B41A 1JG6A 2J41A 3ESXA 1WO8A 3LOQA 2PZFA 3I62A 1A8QA 3AINA 5JS6A 2VH5R 4FJ1A 3EH2A 3GJ0A 2WC1A 4P5DA 3T9AA 4KWHA 3QWAA 3ZBQA 3QKIA 4RFSB 3R3VA 4XLTA 3D2BA 2BCJQ 1DBSA 3LBHA 3RIYA 2O7RA 3GLHE 3SAJA 1XLVA 3HDYA 2C92A 3ZY2A 4UASA 1A9SA 4A8JA 3GEHA 1H5NA 5FUXA 3SN6A 1NVDA 3N86A 4AYTA 3DV9A 1IEXA 4WLNA 1YGYA 4YJGA 3U4HA 4MDYA 4MB6A 2XNSA 3CG4A 3HDJA 4UU8A 1F8UA 3P45A 2BHLA 2JEZA 3SZUA 2O07A 1JR3A 3NX4A 4RPHA 1SD5A 3E2PA 3TLEA 3NASA 2FSVA 1HM5A 4WH0A 2QLLA 3VR2A 3AB3A 5D5HA 4D82A 5BRNA 4ZZ3A 3FI0A 1AS3A 4LSZA 2AF4C 4B09A 1K5GA 1FK8A 3FOZA 3O4HA 1WDTA 4NBWA 1SUEA 2PRYA 4OU4A 4EF4A 3PG5A 4D0LB 3E18A 1JN0A 2KQUA 3LSTA 4HMPA 4DF3A 4JJIA 1T8UA 5EIBD 4YT4A 1SC1A 3P26A 4PWYA 4XEUA 1FFBA 4MUFA 3IUSA 2JD2A 1WOMA 1NDUA 1NQOA 1W9MA 2D13A 3HB4X 4ZEOA 4WN3A 2FF5A 5CT8A 4BN0A 1DEKA 4IXWA 4W5QA 1C9NA 1ULUA 1JLLB 4LSGA 3J7AC 2VPTA 3IKMB 3H8SA 5JTUA 1DXYA 2RE8A 3DCJA 4QBKA 4XGKA 3ESCA 2LUOA 2DPHA 1O57A 2GD6A 1KP2A 4HLNA 2F4NA 1ZN2A 4W7HA 4KYIB 2NP6A 1SU7A 5JG7A 2FPMA 2W90A 1JFSA 1G38A 3MGKA 4ZT3A 2EXXA 1I32A 3MUNA 4HDKB 4R0NA 5CB4A 1OOEA 4CTKA 3OX4A 3L40A 1WCV1 4D3FA 3EY9A 1SPBS 2OV2A 4UHCA 4UXJA 3TG8A 2WPDD 1ZVKA 3ASZA 4NL4H 4QTTB 1I7DA 3VTKA 2QT1A 1M54A 1P4JA 5BSFA 3B6KA 4CIBA 2D4HA 4V3CA 1W88B 4V24A 4QUJA 4KEAA 3UBMA 2R65A 4AUEA 3B53X 3KOMA 1NV8A 1DAIA 1RI1A 3MJEA 4ZCQA 1TM5E 3D3WB 3MYRA 3K9FC 4R68A 1GAJA 1OGJA 1UK6A 3MN1A 1KI6B 1NBME 4XWYA 5B7NA 1H2EA 3ADKA 4RDXA 4RGVA 4XB6B 2JIOA 3KSMA 5TPWB 2GILA 3OJXA 1C4KA 2Q9UA 2XWBF 3D9QX 3PRKE 3JVIA 1QZ3A 1XVVA 3CR3C 4ZQGA 3AESB 3W2TA 2RAFA 3V4FA 5IK2D 4DR7B 1CE8B 3H65A 3Q3EA 2HO5A 2AB0A 4R6WA 4J4TA 1X3SA 3SOPA 4LKRA 3F2VA 1MB9A 1AK9A 4TUYB 5K1ZA 4TYPA 1RKXA 3F6RA 4BO8A 5DI3A 1L9KA 3E27A 4P84A 2YV3A 3E2MA 2ZJ2A 1JLRA 1OA0A 1PGPA 1ZCFA 1E6KA 2CVQA 4NH0A 4AMGA 2JJ1D 1DBRA 4UXHA 5DXJA 1H05A 3CZMA 4CMEA 4C7BA 2EEZA 3FTNA 2OGUA 1PNOA 1ZUNA 2Z1DA 2OKGA 2Z3VA 4DBLE 4EY3A 1G5FA 4N8SA 1G21B 1AGXA 5FAKA 3T9CA 5KYGA 2PR7A 2OO5C 3OQIA 3WVNA 4JJFA 2I65A 3WLQA 1PG5A 2HBRA 3WHPA 4OYLA 4ZEWA 2MSDB 2G71A 3NTUA 3PQ2A 4DCCA 1OKKA 1W2GA 3SI7A 1QHEA 1Y9DA 2W4MA 3TDNA 3QUQA 1TA9A 5AXAA 3EVEA 4IQFA 3U4QB 1EAMA 3ONWA 2O57A 3PCXA 4MPRA 1VLMA 4RTMA 1T9KA 3HGQA 4S1TA 1KZYC 1S6YA 1MKYA 5DZSA 2BGNA 3VR5D 4CUJA 4DILA 2W0SA 5IH7A 3RS2A 3W77A 4K9LA 1A9YA 1QQ5A 4HNVA 4A0FA 3TKLA 2HUNA 4K6GA 2JLVA 1G5PA 1DC7A 3KAKA 4K9DA 4MYRA 1QJCA 1K06A 2UUPA 3O5AA 5DN9A 5C8DA 1GTMA 2XGSA 3K6RA 4JQCA 3TZBA 1K0UA 4CLOB 1U5BB 4CDMA 3TGPA 4XI9A 2E55A 5AJYA 1NYLA 1WL8A 1TCCA 4JB2A 3INRA 2O3SA 2BR3A 4HYEA 4KIFA 4F4DA 1VL0A 1CXZA 4INOA 4ESOA 1YR2A 3UHPA 3AM4A 4BDTA 2MSEB 3DR5A 4I14A 5B1HA 3VO1A 3FBGA 2FWMX 2IPAB 2MYPA 2W48A 1K8YB 4KW7A 5E4TA 4A5OA 2WHYA 3VUEA 4JP3A 5GM1A 2OWEA 1QGUB 1LTKA 1VPEA 3DLTA 2NTJA 1E9CA 4NJOA 5KYYA 2WJIA 1GTG1 4I3FA 4II3A 1L7NA 2AG8A 2WZCA 2HDHA 2Q2OA 2O0LA 2RKOA 3FNIA 3THXA 1P5RA 1PZGA 3IRVA 1EBFA 2JK0A 1FL9A 2CHVA 2GD1O 3B1YA 4OQDA 2LVBA 4CKBA 5CT9A 4BDSA 1S8AA 3ROTA 3WSWA 4AP9A 2ZIVB 3O1JC 3ND9A 4TUYA 3PTLA 4E5KA 3TRJA 5AW7A 2FMTA 3DAPA 1FFGA 1P74A 1KHTA 2RHWA 3A25A 3LCVB 3RE1A 1HSOA 3EQ8A 3K9GA 3OCZA 4HTFB 4J0IA 4JP8A 3LP8A 1YVPA 1BJKA 4IDAA 3T34A 5B4VA 2VJKA 3A3YA 2P91A 4IZIA 1H1LA 3QVVA 3PR2B 1R4NA 4KNYA 1Y9AA 2YC2C 3FD8A 1ZGZA 5JPDA 4MARA 3KT0A 2JAOA 4V2IA 4W1SA 1XU7A 5KTPA 4TTRA 1LBEA 3IAHA 4A1FA 4L74A 1HY3A 1R7RA 1HNZB 4BNDA 5LMZA 1FUUA 1VB5A 1ZONA 2VHYA 2JJ2A 3KAJA 2EEPA 1UPXA 3HR8A 3ZV7A 1LI5A 2XZPA 4EAAA 5G40A 1M34A 3K6SB 1QM5A 2JK1A 3TH5A 4Q3NA 1DO8A 1XAHA 1ABBA 2E87A 1HEIA 1ZMRA 2DBRA 2PVPA 3CH5A 5TQ0B 3ZWQA 1L4UA 1MF7A 5KOIA 1IZYA 1SRRA 3S2ZA 3P9CA 3RIEA 4CMKA 2VNKA 1UEJA 2A5JA 4WSOA 1YS4A 4U9HS 1T2EA 2HMTA 2GM5A 3STYA 2IXGA 2F1KA 1XRQA 4TXMA 2N1MA 1ISIA 2O8NA 1YB2A 3BSYA 5A06A 1CJCA 5LIPA 1CY6A 3U19A 4ZZ0A 2OXRA 2Q5EA 4CTJA 4XX0A 1VSUA 4NRDA 4HVCA 1OJ7A 1ZUD1 5JVDB 2IUFA 2PMEA 4PCUA 2CLDX 5EEHA 5EIBC 2VDOB 1UP4A 4IO0A 4WQMA 2L18A 3ZDAA 1OYWA 4ZDWA 2C3YA 3MPUA 3QF7A 3AWDA 2CC2A 4E12A 2PBRA 2Y1LA 1QZUA 1Y3BE 2DPMA 3EVTA 1ZKMA 1PW5A 5HJ2A 2JGDB 3AHGA 4TMFA 1GG2A 4MYUA 4YMVA 2NO9A 3A6DA 5AMXA 4WX2B 4QOFA 2QX7A 3LXXA 4GW3A 3CSDA 1Q83A 5T4EA 4MDEA 2CN1A 5LOVA 3H5NA 4A92A 1M2NA 4AJ2A 3A58B 2PWAA 3TD2A 1BMFA 1NMXA 3OIDA 4KE8A 2MINB 1DSSG 3KB6A 3C7DB 1PSDA 3THSA 2J3DA 4G9EA 4JUAA 1Z62A 1STOA 3U26A 4ZYVA 1C9EA 4NX2A 3ET4A 3TW0A 1L7EA 2R87A 2FPIA 1OYOA 4I7EA 1RKUA 6PFKA 4ZYYA 2Q0QA 1LB1B 2OCXA 2PBFA 3NTVA 4QAQA 4LRSB 4UUPA 1C9MA 4F2DA 5IDQA 3C3XA 5BR1A 1ZM2A 1JMYA 4RQUA 3W5DA 1F48A 3GLFE 4J3FA 2ODNA 3K8ZA 3IC5A 3H1TA 3WYFA 3AEXA 3BICA 3CXUA 4RF2A 3TTYA 2G5PA 3DZKA 5JFOA 2QZ9A 1GCGA 3KWLA 4BRSA 2C95A 1A76A 2P9BA 2WUWE 3ZW7A 2OD2A 4MW5A 4U7GA 4XDGA 4OV6B 4Z7NB 3CKYA 4N5MA 3TNDA 1X2BA 4K9SA 2BMAA 4D98A 4YDQA 4BFTA 5HTOA 4RKYA 2B1IA 3HZHA 4NYIQ 3VGPA 5CVEA 4DEVA 4TV9B 2HJSA 5I4BA 4ENRA 1N2IA 2ZI3A 4MYHA 1ULSA 2BISA 3L1UA 3I0NA 1GWNA 4EMUA 1FLVA 2K5UA 2I7XA 2YYYA 2FRXA 1NKTA 4LC9A 3GMIA 4LFCB 4ZGBA 5FULA 1ZCJA 3TZHA 5DPMA 5M2QA 1NZFA 3UXHA 5K9ZA 2P0AA 4DCUA 1N2ZA 1Q0QA 2QVZX 3CE6A 3AKZA 3ZGZA 1AHIA 1LF5A 1BS9A 3MZ0A 4FZJA 4AS3A 4AF6A 4B2PA 4EA6A 1Q7GA 5DHPA 1OLUB 1M5TA 2W43A 2ZBUA 3OESA 3RUPA 3EXHC 5K0BA 5KMGB 2O5EA 3IXMA 5EJGA 3GUUA 3VAAA 1S4QA 4J43A 3G2QA 4E5VA 4F9TA 1KR2A 5DNAA 1DJLA 5HGXA 2PZMA 3LVBA 1NV9A 4Q1EA 4R2IA 3KSUA 5B3LA 5K3OA 2XWSA 3BBPA 1TX4B 4DEXA 4QWMA 3JATB 2VP4A 4KH1A 1GL6A 1GGMA 1N3IA 2HWXA 4AULA 4AN1A 1C80A 2WILA 2HNAA 4E94A 3ZTYA 1Y5IA 2VCYA 2J3LA 5CURA 4D9NA 2BSQA 4AIIA 1DEXA 4KU4A 1JBKA 1GYQA 3MRSA 4GXQA 3M4JA 4I55B 1ZDMA 3ANXA 3AR5A 4N54A 4OQMA 4Q1AA 2B9VA 3WICA 2VNHA 1USWA 3I1YA 1RW4A 4O4LF 4YCBA 5B3JA 4OXNA 3TQRA 4ZHQF 1EWQA 3EQ9A 1KU0A 2BLLA 2JB9A 2XQJA 4FDVA 3WYEA 1W4AA 2OZLA 1XLTA 1E77A 4ND8A 3V4PB 4PYIA 3DLHA 5SICE 2YFQA 5I7OA 1YU9A 2A5LA 5AVZA 1LLQA 4BQFA 3QYAA 1IOWA 3U56A 1LZKA 1WXQA 2B8NA 2IEBA 3BULA 4GRDA 3ZXXA 4GL4A 5JC8A 4X8HA 3KT8A 4ZVQA 4MICA 2PL9A 1R88A 2HY7A 3H6HA 5D3MB 2B20A 1WMEA 3G5UA 2DPGA 4E30A 1CEEA 1RRPA 4N0QA 2DUWA 3TXXA 5J58A 2ORYA 1EFKA 4I9NA 3CSUA 1A7JA 4ARZA 4D25A 3WYDA 1W36B 4WZAE 2XQIA 1Z2AA 3HRIA 1QHSA 4M88A 3AXSA 2HPAA 1Y1QA 2RSLA 1LW6E 3UW1A 4U39A 2COUA 4UULA 5GJVC 4ID3A 1EFDN 3Q10A 2DUUA 3NIBA 3BREA 3SS9X 4BVLA 5DIFA 2O6HA 1HMPA 2R6DA 5KNDD 3KE9A 1IBLB 3DZJA 2HU7A 4EIWA 3UAWA 5DSTA 1VA4A 3KTFA 4HTFA 2XNDA 3I5MA 4GR4A 2BEVA 4JC4A 5IHPA 4DR2B 3FLMA 4RXMA 2CYBA 2BGWA 2OAEA 1FYXA 5SV2A 3QSYA 3KTOA 1FP1D 2GZMA 2XCUA 4XVRA 3PIRA 5BYKA 1JWLA 2YH2A 2WM9B 2D74A 2IVFA 1RADA 4B7AA 1VKHA 4Y2JA 3CW2A 5IP5A 3LLSA 3UG7A 1TEZA 3SC3A 1TIPA 2R00C 4YV7A 5FHRA 3ZHVA 5FWNA 2QTVB 1YL5A 4IIJA 1UM9A 3JZIA 4Y6PA 3K15A 4DM7A 3OQ6A 1CQJA 2IS6A 1QIMA 5T4FA 2OQVA 2ZQZA 4IMJB 3OSUA 4ZKDA 1DKUA 3F96A 2ZIXA 3LUKA 2OZKA 1VE6A 2O0KA 3FZEA 4WLVA 5FI5A 1Z0UA 1XEWY 1G5RA 4MQLA 4DIUA 2RAVA 4DIEA 4LRTB 3MOSA 1C2TA 4E14A 1JB9A 4LJSA 4MEJA 5AUOB 3JAKA 4PC1A 3MJ4A 3ZHXA 3WBFA 2GZ2A 3SYKA 2FG7C 3KPJA 5BURA 3NIWA 1KAGA 2NYVA 3FCEA 1AJEA 3H99A 3VMMA 2F9FA 2XB9A 1NAHA 2WTEA 3A3NA 1HFKA 1AKTA 3L6DA 3UAVA 3VAZA 4OUDA 5DBGA 1T5BA 4Q15A 1QG6A 4X7BA 3VOBA 3L7IA 4JGGA 4IYJA 2BEKA 5I8PA 2PLWA 3C7KA 3OJFA 4XCVA 1B93A 3UXYA 5KMGA 4I50B 2Z6QA 1OXVA 3RT1A 2XYPA 4DIMA 2R79A 5G0UA 1ULZA 4XE5A 3HFSA 2HC9A 2J3HA 4FKBA 4HGQA 3VHQA 2ZYAA 4B34A 3ZWBA 1B23P 3AL0C 3U40A 4G0OA 4LHVA 4I46A 5B12A 1OA1A 2QTNA 3JQRA 2YXLA 4AI6A 1CUUA 3B1VA 1QHYA 2DCMA 2YWGA 2YFKA 1O94D 4PX2A 1TQ2A 4GE0A 4YUWA 5M29A 2QN7A 2VVTA 4L0QA 5B1EA 2RC5A 4RPCA 3D7MA 3HWWA 2I9PA 1QIKA 1NW7A 2XKBA 3AX6A 3BMQB 3C24A 3QFHA 4K05A 5HIIA 4NXNB 5EG5A 1YZUA 2GBLC 3EPPA 1M2VB 4PRYA 3RKRA 2H8KA 1KVTA 1BFUA 2YJNA 2X15A 4ZVTA 3FF1A 5SY4A 3KU4A 3FCOA 1WDKA 3VJKA 4PLPA 1ZOLA 2FOXA 5C5CA 1GL3A 4GXTA 3EMOA 1BJRE 3D4PA 5EMJA 4FYWA 4PGMA 5C0OE 1E2BA 2ZDQA 3KKLA 3N0TA 4JLSA 4E4TA 3H8JA 4LHSA 5FBVB 3U16A 1GQRA 4UM5A 1XZGA 4L4UA 2A56A 4IZOA 3K71B 3JQAD 1BXZA 3A4MA 3PHHA 3T7AA 3UJBA 4BMXA 2AA3A 3LRPA 4JLJA 3E7XA 4DRZA 3IHTA 4DYHA 5CLIA 3LIPA 1V39A 4DQDA 4Q1DA 1WZNA 4Z8XA 4M0LA 4U7DA 4YRBA 4G24A 2M9MA 2P9TA 3MHPA 3HMKA 2FW1A 3CWCA 4YCCA 5IDWA 4EYSA 2K4MA 2QN6A 3UW3A 4R8RA 1NYTA 2R8PA 1RDFA 4IQ0A 1DO0A 3D3WA 1YVEI 2QTBA 1NNSA 2X5KO 3JQAB 1G66A 4MV4A 2ZVJA 5DTEA 2IY8A 2QXYA 4MQMA 4XTCS 4LJ6A 5IARA 1YI0A 3UJCA 2PZKA 5BQOA 1JHRA 3UKOA 1C0EA 2OOSA 1Z88A 2NU7B 4QDTA 4PANA 4YRRA 4F3KA 4C2TA 2OA0A 1QU2A 3PFHA 1GNLA 2XW6A 5G0WA 4GEKA 1LBHA 2FR0A 2IBSA 3MRVA 3H9UA 1T3GA 1QYCA 2OMKA 3BEDA 3ETJA 2EJCA 2BFEA 3NT5A 4HDKA 2FPPB 2Z5LA 3KOZA 4UVGA 1SU4A 4IIXA 2QBYA 1EVJA 1KYQA 2IS2A 4O08A 3WGYA 1PHRA 4RTNA 1BJTA 1YQEA 3H4IA 4BBJA 5C46F 5C53B 3PUWA 1C0KA 1M1XB 4LXQA 3VKVA 4DCPA 3BKXA 1WUIS 2WSIA 3NQ41 1U8TA 4I2NA 4JKYA 4R0MA 3LQYA 3OUZA 1FUEA 3FUXA 4Q39A 1LSJA 5J5CA 4LHYA 3NHMA 1OGYA 2D8AA 2GEVA 5JJIA 1G21E 2IYLD 1XVUA 1Y8QB 4MV1A 2R3SA 3DZBA 3QLVC 5A7FA 1YZHA 1SOVA 4LPKA 1NONA 4TSRA 3PE3A 3N0VA 3JQAA 3F7NA 1QUEA 4ZEMA 5K5EA 1NRWA 4FFPA 3WL3A 2Y0PA 4JMLA 1DAOA 1NQTA 3GFOA 5ER9A 3IR7A 2WJHA 1IONA 1F1BA 3IRUA 4PC6A 1JG3A 2PRSA 5JNLA 3HRHA 1GZHB 3L7JA 1W1IA 4REOA 1SQ0A 2EX0A 4ERXA 1O5TA 5A7GA 4JOSA 5TVKA 3KZNA 2FEWB 3D8UA 1FQKA 4ITRC 3IVXA 2Z1NA 3DWIA 4BNIA 4C76A 2Z3WA 2NO5A 4H3KB 4B35A 2DYKA 3KQNA 4UUNA 4NSNA 3AXTA 2JDIA 2H2AA 4UE6A 1QNLA 1P33A 3B9BA 3KQSA 3RVDA 5TEWA 4N3NA 4C4OA 4FMBB 4XUGB 3RVNA 2XQFA 4IILA 1JEYA 3PR1A 2KJQA 4I5DA 1B7GO 2OCAA 5HKLA 1FTNA 3ZOKA 1D2NA 1FTSA 2QTTA 2YBEA 3FCSB 4O2RA 4RZHA 3IQDB 4UZEA 4IIHA 3RASA 2EFYA 2JJ1A 4RVOA 1JG1A 1Z75A 4HFNA 2J3MA 2I2CA 2W37A 2A2ZA 4F9FA 2JJYA 4NATA 1BEUB 3GN2A 1MFPA 4G9BA 3THWB 3I4LA 3F4BA 1YUBA 3C16C 3RFUA 2HMYB 1CRQA 3EVDA 2XITA 1JXAA 4M1ZA 1U4NA 4YV2A 1YZKA 2CGEA 3KQMA 3P97A 2PGDA 2Q5CA 2X8JA 3WRYA 5CA0B 3ND8A 4B6EA 3MCWA 4IW3B 2I78A 3VISA 4PBSA 1PLKA 1TT7A 2Y8EA 4FIDA 1W36D 5DVZA 5LVAA 1M7HA 5BQ3A 5K09A 2FZLA 2QJWA 2CW5A 3OU2A 1J8MF 4OFXA 1NP3A 1KJNA 4JT2A 4OLFA 1XFDA 2GPNA 3TS1A 5EXEA 4IDGA 3RR2A 1E6UA 3T7DA 3QG1A 4MROA 4HN4B 3D0KA 1YR1A 2VAXA 3IR6A 5F4BA 5JU6A 4BCCA 1OH6A 1DX6A 1B8VA 3B13B 1JDNA 2HYDA 4UKDA 3UAGA 5AW4A 1IHPA 1NJFA 1OREA 4Y1EA 1Q57A 1RXIA 4QU5A 5DM4A 1JQEA 1KARA 3FVVA 5EJIA 2WTUA 3LKDA 4P53A 1ZUNB 1DIRA 1EGMB 1C30B 1P2TA 2GHQA 4KN8A 1NBIA 1EG2A 5LD2B 5EZSA 4K9MA 2WINI 2D1SA 1K63A 5KVQA 1EE2A 3L6EA 4QL3A 1E2FA 2F3SA 3I92A 4DOMA 5LJIA 2P2SA 4B82A 5DM60 1EDEA 4X63A 2LD4A 1UMDB 4DLLA 3I23A 1NGSA 1RJGA 1GY8A 3BB3A 1OH5A 1E66A 1K86A 3X1KA 1P8AA 2C82A 2RCYA 3Q5DA 4IHAA 2HZ7A 5CNKA 1GPLA 3AR7A 2E85A 3IB3A 1ORTA 2Z2XA 4MRVA 4FT4A 1QP4A 4IXJA 4XSVA 4FSDA 3WJAA 2FRVA 5ICSA 3UGQA 4XR4A 3VVBA 2V5VA 2AE1A 3TZQA 1JSLA 3PJEA 4HVLA 2J7PA 4QUGA 3TMAA 3W4IA 4F7DA 1W5SA 2Q49A 3LKVA 4URWR 1BVRA 3QWHA 2XPCA 3SYMA 5CXUA 4A6DA 4YMHA 4C89A 1U8AA 3IQGX 4Z0HO 4AIRA 3IBCA 3T52A 1S9HA 4OL0A 5HIMA 1H22A 2WD7B 2ID7A 4WDQA 1I5EA 3FWYA 2KMLA 2O1WA 2XUQA 2F00A 4ED9A 3MILA 5EZ5A 4C4PA 2F1JA 1BN6A 5JCJD 5IW8A 4TWRA 2XRFA 2ZE7A 3GA5A 3LT4A 1DQNA 2DQ4A 3R5JA 4PVCA 4Z0TA 3RLFA 4RO0A 1YQ9A 4YN3A 3HJBA 1G2PA 3L1VA 4EOGA 1I80A 4NOKA 4B8WA 4F4UA 2IIVA 1XTPA 3RUEA 1P6XA 4PX5A 4QNRA 1KIMA 2P5SA 4Q3EA 4DJ5X 1WETA 4N41A 2EX4A 2WTAA 1C81A 2AYYA 4C5BA 2WE7A 1YJQA 1E3TA 2YHIA 2OCYC 3WR5A 4E51A 4W5NA 4LDPA 3ECAA 3PXGA 5KOYA 1P7YA 3L18A 3FXAA 1NYQA 1SUPA 1XA4A 3FB4A 4OJKA 3TOVA 3OPYA 4DV7B 1QC5A 2V65A 5CIWA 3I61A 3KV3O 4FKZA 4EQ6B 1J2YA 1NXPA 2H9AA 3TNJA 5H0IA 3UA0A 2WEKA 4Q18A 3M3HA 3W2GA 4EW2A 3ERCA 4BB0A 2JFXA 4EB6B 1K98A 1Z26A 1Q91A 2A9QA 2CBGA 3NVDA 3NC4A 4JBWA 2OM6A 3RB8A 3V2GA 4C22A 2HU5A 1LDEA 5EJ4A 1I4TD 3UUEA 1UC9A 3EIWA 2PLAA 5C51B 1N2CA 1OLUA 2W2TA 3DEFA 3HBAA 4TT8A 5CVVA 3OVMA 5FTJA 2MSCB 4LPSA 4PQGA 2QJFA 4D41A 3EUEA 3U81A 5IJWA 3MTBA 3KKNA 4GIBA 3VH1A 1DAKA 3B3GA 3C3BA 1A2QA 4WMLA 1VZ3A 1TVCA 3EUAA 4F2GA 1UCFA 5AD1A 5AVRA 2H7VA 3ZHOA 3IVCA 1CSEE 3OEHD 3KZMA 1ZYUA 1UBMS 2WNSA 2QU8A 5EP2A 5ALTA 5HJ5A 3SS7X 1JAXA 1WXFA 1Q50A 1KIFA 1N5LA 1WD5A 1KR5A 2CD7A 2IX9A 2MR5A 4J6FA 4M1MA 5DNDA 5EMHA 1U0JA 1O8BA 1MB3A 1NQXA 2JIQA 1FTGA 1P39A 4FFLA 4LHZA 3WTBA 3U44A 1KRWA 1H69A 1TD9A 4KXVA 3VI4B 1VXRA 5T8KA 3S1LA 3KLOA 4DW8A 5A2QA 1RRFA 1ZN9A 3HH8A 4DWOA 5E1MA 1KJQA 2QMUA 1C41A 1YQUA 2KB0A 4FMDF 2F8LA 3X1MA 4MRPA 4KXWA 1Q15A 1ZM7A 5GOTA 2RI6A 2QN8A 1RT9A 3SBEA 3R5FA 1E3IA 1LC3A 4OB7A 4EO9A 1YZTA 4KGXA 3E61A 3ENQA 3QJ5A 2BFOA 2OORA 1R6AA 1EHYA 3DMHA 4ZVOA 2CLMB 3R3ZA 3ZBUA 5LN1A 2YJ6A 5IWCA 2SKCA 3OIUA 1Y3IA 1XIVA 3KUCA 4A5SA 5AW2A 4KKVA 4D0NA 4V3BA 3ZDYB 1B00A 3K32A 2QVYX 4L7QA 4JLBA 3OUTA 4PQRA 4XRRA 3TR5A 4X7RA 3LPLA 2OMEA 3ZVMA 3AQ4A 2P5UA 4M8LA 5IXYA 2GETA 3IBTA 2HUPA 5ALUA 2JEOA 2PJRA 4LJRA 3W8DA 1T1SA 5E4YA 5KJEA 3A2LA 4KE6A 4DHWA 1L2TA 1XRMA 3H4TA 3STXA 3DVAB 1EUYA 1A69A 4REMA 3DHNA 4QAJA 2WM8A 2XGOA 1G2OA 4Q02A 2DTDA 2I1QA 4DG8A 4JB3A 2P3OA 5HBGA 4EB3A 2BP7A 3CGWA 2WWGA 3OF3A 1DS6A 1FXUA 1KK1A 5TJ9A 1JVSA 1J2EA 1QF9A 3N76A 3UHFA 3DE0X 4QU9A 2PR2A 2IP2A 4A2CA 3GBSA 3HNRA 1DV1A 2BSXA 1ZUIA 4UXIA 4CG0A 4AZ3A 1F2TB 1JEOA 1PK7A 3SX2A 4A0SA 3K2QA 3AY7A 4FILA 3DE6X 5KQSA 2BGKA 1B16A 4OXRA 2V9CA 4J91A 3OD1A 2UUBB 3U61B 2GEJA 4CM8A 5CPBA 2B3TA 1RAHA 3ROMA 2G04A 1I24A 3PGVA 1F0KA 4M0KA 3FIUA 3ZCPA 4MWOA 1A9XA 2Q6TA 1RAFA 1LNSA 5LQMA 3CRRA 1FP6A 1UOEA 1YJCA 3TDKA 2QDKA 3OPYI 4B44A 1EBUA 1YFKA 2NZ2A 1ODSA 3VYUB 4EELA 5L45A 1OXTA 1O58A 1ABFA 1JDBB 2DX7A 4JI2B 2GZ1A 4RPKA 3NEYA 4BNDB 4HXYA 2R7AA 3I5XA 1QG0A 2O52A 5COBA 2YX1A 3LPCA 4UQPA 2R1UA 3I83A 2AH5A 3S1AA 3HJUA 4JXZA 3EPLA 2J87A 3AY6A 1KHHA 3EXIB 4OJYA 3TAHA 1DRKA 2RH8A 5DN6D 3GP8A 2I6GA 4IDEA 1Z33A 3F74A 2GM4A 1MPXA 4GOXA 3VC2A 5JS1A 3IXQA 1Y6FA 5L3SB 1EX1A 4M8SA 2XKJE 2YUTA 1WXHA 4NU5A 4LOKA 4MR7B 4TL7A 2A1UB 2QRUA 4GOLD 4OM8A 1NQ5A 2AS0A 1C1XB 2AI2A 3CBQA 1MENA 4PXSA 3PF8A 2XH8A 3CS3A 4TMYA 1D4OA 3AT1A 3PIIA 1JDZA 2YRFA 2YIVX 3NOQA 1EUQA 1ZBQA 1ETHA 2IH2A 2DFTA 4OI4A 3IL2A 2W98A 1Y5LA 3IJPA 1QX4A 1SIBE 3HEAA 4XYBA 4Y2YA 3WDKA 4HQNA 5HX7A 4DJJA 3DLAA 5EP4A 2ZCUA 4G65A 5KYYB 1XK7A 3MCZA 3QP9A 1VJRA 3UBTA 4K0KB 2FQ1A 4JVLA 1SK8A 3EPRA 3PXEA 2Q3LA 3G7SA 2A7XA 1I2AA 2J0EA 2R7MA 2VRCD 4GMXA 5AKZA 4RTQA 1OI7A 1KNQA 2EOAA 3I76A 1GPNA 4FDTA 5DHQA 4M1EA 5GWXA 4JJKA 5H4HA 1Z82A 2WPNA 3BJMA 1UZNA 4RZ2A 3A1TA 4ENWA 3KJIA 4ZU6X 2PANA 2JFHA 4OM7A 1ETUA 2MSLA 3CN9A 4M98A 4DMHA 4GYKA 4LZNA 1Z5OA 4HMOA 2Z43A 1EFCA 2H0QA 2LDXA 1Q1ZA 2P5TB 2QQGA 2VBGA 3ANSA 2O7NA 3FPLA 3HVUA 3DBLA 3GGGA 4L0DA 1IK4A 4Q3CA 4ZFNA 8OHMA 2OYCA 4RE5A 2CNOA 4QPPA 3AQIA 4XM0A 3VR4H 1CB7A 4C03A 1LC0A 4FS8A 4B7ZA 3MD9A 1YZQA 2CXTA 2E2WA 1T35A 1YC5A 2I8CA 2PK3A 3KX2A 4WNCA 3HR4A 1IATA 5AQEA 5CLJA 2NXCA 1U11A 4QXMA 4A6XA 4JT9A 1GQYA 3VR5A 3DQZA 5KTOA 5I9NA 2CXSA 4D92A 2GA9A 4BNFA 1VPDA 5ICGA 3PFBA 2WG1A 3D6AA 4ZC1A 4ZN6A 1E7RA 2JLRA 3WLKX 3JWEA 3EDRA 1U31A 3F6YA 3WLNA 5KJFA 1Y1PA 2FPGB 5BSRA 4BTVA 1GDTA 2AXNA 3N8IA 1NY5A 3MIZA 1GVHA 5MGNA 2WAAA 1AKVA 4DUGD 3UAZA 3ADDA 3WXBA 2C7RA 2AQIA 2FEMA 1Z8DA 5D1NA 4WFIA 4ZDJA 4H27A 4MZXA 5BW8A 3L8ZA 5D85A 5CJJA 1TQ8A 4C5AA 4DZTA 1TCBA 4RKWA 3BYZA 4LY6A 2LBPA 3FPKA 3AIKA 3ZDZB 5LPNA 1E1MA 2G4CA 2I7VA 2FQWA 5BW5A 1QS0B 4DGQA 5AIBA 3GC6A 5FFFA 2DGDA 2G67A 2OZVA 2X6QA 4N76A 2R2GA 1XCGB 4AUMA 4JI5B 2CD9A 3GLHA 4LV5B 1PK8A 4FJ2A 3JW8A 3QMWA 1PD0A 1GKKA 3PNKA 2DM6A 1DXHA 1SVNA 2O48X 2R5WA 3RKSA 1CE8A 4ZI5A 1NF2A 4YY3B 1JZSA 4FKMA 3BZUA 4MI9A 2CY0A 2DT5A 2XWJI 1IBCA 2IRWA 3T5DA 2ZGVA 3NT4A 4B87A 3U1TA 7MDHA 2VJOA 4IDFA 2R6ZA 3HM9A 1T9GR 1TKCA 3D8HA 3IP6A 5I7FA 1JSZA 2C7OA 4RY8A 3G8BA 3I04A 2IP1A 3M49A 5DTMA 3VR6D 3TW8A 4Q3DA 5C31A 1E2JA 2WIBA 2MMGA 4KYUA 5EI5A 1W0JD 4TMXA 3D0RA 1KK2A 1SXJE 4R3UC 3EIFA 3PE4A 4RXTA 4GSLA 2FSUA 3UIEA 3ROQA 5DK6A 2R1TA 4DG9A 2UZ0A 1Z15A 3VSCA 2DBZA 2F3UA 1DP4A 3LUGA 3ZWDA 1Z63A 5EIAA 1EFVA 4DUGA 4JUFA 3JQFA 1QO9A 1R50A 2OECA 3W04A 4MV3A 2IP4A 3KWMA 4KVFA 4X64B 2EAUA 1UBSB 1MGOA 2CEAA 4KQ6A 1M7GA 4FZ5A 4HFJA 2NQTA 1XRSB 2G8NA 4YK7A 5LQKA 3VR3A 5IM4A 4A73A 4NONA 1TUIA 3IP5A 1RAIA 1PTJC 5KEIA 1EIZA 2NZXA 2NUBA 3OC0A 4LZOA 5IBRA 1D9XA 1RYMA 1TKBA 3FTQA 1U04A 3IE2A 3LHFA 4RL4A 5D3QA 5ALSA 3GDOA 5KOHB 1US8A 3MMZA 4N5IX 3Q11A 4KO2S 3CX8A 3A1NA 2AMVA 1T9GS 2ID4A 1KTVA 2PJDA 2ZRNA 1CWUA 1QIJA 4B71A 5AW9A 1OF1A 5IWAB 1JQBA 3GZJA 3WSTA 4NCNA 4ZYZA 5C1DA 1M76A 5HKBA 2I4LA 2WSLA 1GRNA 3AR3A 3B3AA 4G4IA 4YP5A 1QORA 2Q5QA 3WK8A 1L5WA 4B83A 1WMBA 4IJUA 2BJWA 4YV0A 2FN4A 1ODLA 2EVWX 3GX1A 4LWPA 4NMXB 1EVEA 3BTVA 4O4HA 3FMGA 4DLRA 1RXSA 4EDFA 2GR9A 4HV4A 1C3XA 3HPQA 4AC9A 1P1HA 4C2BA 5CM2Z 3B52X 4D9EA 3RYCA 3H3JA 2I2DA 1ULBA 2BOVA 1DELA 3NU1A 1EJ2A 1RYYA 2PXAA 2Y67A 1Y42X 5EQDA 3ZCRA 3D3KA 1CK4A 3LQQA 5DOVA 1GZ7A 1LPOA 3CLSD 1OWPA 1RYBA 1YS1X 3O3NB 1OV6A 4PSAA 1AZWA 1CUWA 1P0QA 2W2PA 4O0MA 5E7MA 3GQBB 1MRNA 4IIYA 1F5NA 3OMLA 1T0UA 3F5QA 1GPDG 1V1RA 2AD5A 1MP0A 2WJ3A 1ECBA 1XROA 1HT2E 1ESNA 1NSTA 1C9JA 3B38A 3RGGA 2OV4A 4KG7A 1RWVA 3KZOA 3EOAI 1W30A 1ZC3A 1KMNA 4OKSA 2QJOA 3QY9A 3BK1A 1ZK0A 2QL7A 4QYSA 3WB2A 5ALYA 1IMJA 4F8EA 3TL3A 1BIFA 4II7A 3ANYB 3LYUA 3SHFA 1XQYA 1N1MA 4CKEB 5U1PA 4UQLA 1G5QA 2HREA 3U7EB 4OHMA 2OYRA 1XYYA 4N40A 5AJHA 4OUKX 9GPBA 5E6RB 1J90A 1I4EB 1OAKA 2H1RA 2XYVA 4C0LA 1C29B 2FCRA 1G9TA 1RXUA 3TR6A 2SECE 2B83A 4XLZA 1YA8A 1IWPB 3CH4B 3L77A 3PHIA 4KNWA 4OHBA 2QA5A 2QL9A 1G291 3X1XA 3D3QA 2P67A 3LJKA 3QELA 4ER5A 2JIZA 4ZAWA 1TIBA 1UF9A 4HDOB 4KMSA 2ZYGA 2GPTA 2ZBPA 1I2DA 4IGFA 2XV1A 3H42B 5JSYA 2HTEA 3E23A 3GG2A 3CF0A 4PSUA 4YO7A 4TQ9A 3SBOA 2HDOA 2J6BA 2CVOA 2ZDHA 1U2EA 3WGVA 5BSVA 1NASA 3R5HA 2X4DA 4U02A 1JSRA 1RQXA 3AKEA 2Y93A 3OZDA 1CLUA 4GECA 5BN4B 3SEZA 5FPYA 1EWVA 4KOEC 4LXHA 1O03A 5LLTA 3VO9A 2X14A 3I8SA 3RUCA 3NHJA 4CIYA 4MS1B 5EMNA 4X62B 1D09A 2NWQA 3TFOA 2PZEA 2J0UB 1WRBA 4K2AA 3I2JA 2OFFA 4CPDA 4KCGA 2XUOA 1FMCA 2NAFA 4OH1A 4QVKA 4HEHA 2FZ5A 4TWAA 2RBGA 2ODBA 4M55A 1MDBA 1DTWB 4ZVSA 1JXOA 4IRUB 3P9KA 2R4TA 3IMFA 1QX3A 1U0OC 1XYVA 1EK2A 3GMSA 2BDUA 2V54A 3KYIB 3O03A 3DHEA 4P86A 4TTJA 4TXHA 1BDHA 2FEXA 1OFUA 1TF7A 2OD7A 3BS4A 1X8XA 4RIIA 1ZN7A 3IP8A 4RD1A 5DLDA 5BSWA 5E0KB 4IXDA 1KBZA 3A6LA 1SA0A 3VPDA 3SYLA 1E9EA 1MC8A 3I2YX 4FNGA 1RPAA 2VRWA 3IBSA 5LP6B 1W5EA 4QTXA 1OPXA 4KXUA 4ZHQA 3G5LA 1IWBB 5E9WA 4CEJB 1Z5WA 4IJ6A 2O8FA 2V7WA 1EJ6A 1XZAA 3ADPA 3VU0A 3WLFA 4OMDA 1E2DA 1Z6QA 4HLUC 3R23A 1NI3A 2MU1A 3UPUA 3D64A 4MO2A 1NW3A 3MTJA 1A95A 1X80B 2FEKA 3C6QA 3EAGA 4Q3KA 1W8IA 5AJZA 2J0SA 2BFBB 3A2NA 4GPAA 2LIVA 3G2JA 4RTSA 3GRUA 4CQMB 2R25B 5CVTA 4TTIA 3KEOA 4INZA 4MW2A 1JL3A 3HKCA 1DG9A 2KBEA 5AVTA 2RHBA 1Y9JA 1RWOA 3P0RA 1QH1A 3WFIA 1C3OA 4C4SA 2XZOA 1YZ3A 4H77A 3EGDB 3L06A 4S0ZA 5DBIA 3TQSA 5TV2A 1P2SA 4UBIA 5ARBA 3GWZA 5DI9A 3MCAA 3KEMA 2HRZA 3AEYA 4X84A 2GD0A 4F92B 1X7WA 1C1DB 2QLFA 4XWWA 2ZB2A 2YICA 3WGOA 2AYXA 2IXTA 3KZKA 1SQFA 2I4OA 2NSHA 1Y8CA 5ALKA 3R74A 1BO6A 2H85A 3OG9A 1Y8AA 1EK1A 1T6YA 5A9TA 4F6CA 1HC7A 5KB3A 4FGLA 2CYAA 2EFEB 3V33A 3NBUA 4M0PA 2V7EA 3NHSA 4MUAA 4WCFB 4HLDA 5E3HA 4V0SA 1J0CA 3PX2A 4RLSA 3IE0A 3R6WA 5A3QA 3EA5A 2Z4SA 4TQGA 2UZIR 1IEVA 1QWOA 2AQ8A 1THGA 2GCEA 4LHEA 4RH1A 2V5AA 3Q6NA 3TZKA 1RZRD 1ZH6A 4RPIA 5F1YA 3HB7A 2Q5OA 3GZTB 2YXNA 4TYNA 1FUIA 1W0CA 1W52X 2XVYA 1LUAA 1RM3A 2XUHA 3I6QA 4LXUA 4G0QA 1F7UA 1RQ7A 4BN4A 3R3WA 4AAYA 3JPWA 5CX1B 3CMMA 3A1FA 5IKXA 4AJHA 1I0LA 4QARA 3K0HA 3CY6A 4R1TA 1Z37A 4O4LB 2A4KA 1UDXA 4WDRA 2WTNA 2C8JA 5EWJB 4Y0VA 4N3BA 1UJCA 2QBYB 2XECA 4EYKA 3E53A 2JKYA 3QU7A 1K1EA 4P36A 2DBQA 4AJOA 3TPFA 5I9BA 3HL6A 1TJ3A 1O0BA 3KHTA 1RE0A 1LGYA 1NPTO 2QUBA 3ENWA 2HLHA 3GVCA 1U6JA 1Y3FE 3EEYA 3TW8B 4BEJA 4QG3A 2Z4RA 2DB3A 5FXMA 1LLUA 4ENQA 5E3JA 3FCYA 3BMOB 4OTZA 2Q0SA 3L0ZA 1OE0A 3CB2A 5CNJA 1E98A 4LIPD 4N49A 3QGMA 4NG4A 5FL3A 5KINB 5AW3A 5GJBA 1UP7A 3QG5A 4TMTA 2O2DA 3AY3A 2Q4TA 5CCEA 2IYFA 2YCLA 1L7DA 3OEWA 3HJAA 4TVSA 2VG8A 2ZWMA 4LGYA 2AFIB 2DBVO 4L5YA 3WLSA 1HI9A 4AY3A 5I9LA 4YRMA 3A4LA 4LV8B 3EGVA 3IVRA 1PFUA 2QYHA 2QORA 2QLJA 3C1AA 1EXVA 2PD3A 2HDWA 4HNQA 4IQGA 1VLQA 3A3OA 3LBIA 2CLFB 1IRIA 1V3TA 1M0SA 1Q0SA 2AHOA 4MW1A 1F3OA 4NLLA 4DPMA 2ISCA 4IOMA 4TOIA 5CEEA 4UVEA 5AHOA 3QXSA 1NUUA 3AP1A 2VDKB 4DT1A 2BF4A 4YUYA 6GPBA 2CMDA 5BV1A 1CUYA 4A16A 3VPGA 4TVOA 3V6LA 4ES6A 3IELA 3DBRA 1HYGA 1P6UA 3N2YA 3ONFA 3LSYA 5BSKA 1EP3B 1T3TA 1JS1X 3RVSA 1I4WA 1WZUA 1QK4A 3RSLA 1EQAA 4OYHA 3FSEA 3F46A 3NUQA 5L40A 3L46A 2ONZA 2HH9A 3FCUB 2C5AA 1E89A 5I48A 2ZRBA 3GD5A 1XHLA 3MK31 3PR3A 4JLPA 3TX6A 5J47A 1W2HA 3BWDD 4QSHA 2E1PA 5EL0A 1LTQA 4XVUA 4EJMA 3K5HA 1XBTA 3K0AA 4JGIA 4YACA 1MJGM 5EWLA 4F12A 1VMAA 3OT1B 4FFSA 1O6CA 2YWRA 1RJEA 3AFMA 3OKPA 3I73A 1ZSVA 1E5QA 4GP7A 3WQQA 4RNCA 4ZALA 3E9RA 3PVCA 3V7UA 1I3KA 2PGAA 4JI3B 4OBEA 2ZTMA 5DH9A 3RS3A 1W48A 4CF4A 1IY0A 2Y1FA 3G2PA 3IQFA 4G09A 1ZMTA 4YRJA 3ZJYA 5T64A 1OLSA 3EYAA 5AVJA 3K96A 2NTEA 5ALFA 1I2CA 3GMDA 4FDMA 1GPBA 1W1UA 2P4QA 2QUJA 4K87A 4KTVE 2ZREA 1TECE 1UT6A 1VL5A 4PLFA 5SZIA 3GEMA 1KQNA 3ABIA 2D2IA 3DL2A 3NGMA 1Q22A 2WKWA 3GEIA 3M33A 1TJ5A 5EMLA 5CD9A 1FVOA 2XXAB 4EVQA 3G13A 1QH8B 3IURA 3L4KA 2I1LA 2QUHA 3O8OA 3F1LA 2I2WA 1FRQA 3SIXA 1Q0LA 2ZPTX 1H2WA 3P0HA 1JHQA 2NVUA 3UJ7A 5FX2A 4G9GA 1E0KA 4LEIA 4LQ4A 1XNRB 2JCVA 3FDXA 2GK7A 3ZK9A 2IWRA 1L8QA 4RLHA 3IODA 5T3UA 5ALPA 2I6TA 1QV6A 3B3JA 5HWSA 3CH6A 1V11A 2B1QA 4UZFA 2FLWA 3OTQA 1XCMA 1C3LA 3ETCA 3EUWA 4M9XA 3RRBA 3SS8A 4X24A 2ZULA 3D6NB 3DEYX 2DQKA 2ZSHA 3A32A 5FBRB 3HKCB 4B7CA 1FVHA 1V5FA 5FUWA 4FM9A 5GONA 4EARA 3U13A 3TE6A 1E2UA 1NW6A 3N2NA 4EPTA 5JISA 1T9CA 4HX5A 4MV5A 4P4SA 2PLFA 1OXSC 2G07A 2H1SA 3GJYA 1PQ4A 4XD7D 5EZ6B 3MMPA 3WWDA 4NDZA 2EIHA 4QEKA 5K6TA 2QG6A 5G0SA 3MUFA 3W4JA 2EJBA 1SC4A 5LB4A 3K0EA 5JH7A 3IUJA 2P9CA 3ME5A 2PGIA 4TV8B 5JJBA 4CEJA 3JWHA 2C8KA 3MJDA 1SUSA 1EUCA 4WADA 4Q9JA 1Y9EA 1PR9A 3TR0A 2YVQA 1MQ9A 3OHSX 3PEUA 1E2MA 3BMNB 2VXCA 1Y6ZA 1AKEA 1VSQA 4BLSA 1NOIA 3TJMA 3I2HA 2XGMA 2XZTA 4EBBA 2WYIA 1UOOA 1NUSA 1A5ZA 3AL2A 2OL4A 3QU2A 4R69A 1N9KA 2QX8A 2YYAA 3TKYA 5KNCH 2J0QA 3F7MA 2X1MA 1U99A 2P2ZA 3Q5EA 4OGWA 5THKA 2HSZA 3V9PA 4Y98A 4HNGA 4IR7A 2BH2A 3HP4A 3GK3A 4O25A 1ZD8A 1KEKA 1F2TA 3Q3HA 1E7SA 3FYUB 5G4KB 3ZZMA 3WXMA 5C7LO 2EARA 1HF3A 1T6ZA 3DV0A 3K7EA 1YRYE 3HTXA 1JEEA 3D8RA 3DE1X 2WD8A 2X0EA 3INNA 1P2VA 2DWCA 1E4OA 3BE4A 1PU2A 3OAAA 4Z9YA 5F7OA 2PY6A 2WY2D 3MUEA 1BMFD 4BOYA 3PWTA 1W8DA 1V8OA 1VPVA 2Q21A 2Q46A 4OLHA 2JAPA 3OTIA 4Q19A 1N2GA 2WF7A 3DVAA 4RABA 4X60A 2WJZB 3M6MD 4J3NA 3OQPA 4RD6A 1IJKA 2QYSA 3LKBA 3STTA 1OFIA 5J2TB 3OQNA 5DBHX 1EGHA 1R0XA 1XZBA 4N3AA 3RU7A 1Y9ZA 2KW5A 2CE7A 1C9DB 1SBTA 4RC9A 1X7HA 1OB2A 3IAM1 1XT6A 4GWGA 4J16C 4LYFA 1CP3A 1P2BA 1DXQA 1WOYA 4GPD1 4CZ2A 1JAIA 2R6HA 4WA8A 3UWPA 1QE3A 4TM7A 5DM0A 5HIJA 4PYKA 3PC8A 4A3SA 2A8YA 2AEEA 2ZBEA 3ZVLA 1WZCA 2F2TA 3AEQA 4LF7B 2UYQA 5EUCA 5IHXA 3B1XA 3A14A 1D4AA 2A5DA 4H7PA 1P31A 4BX2A 5LQDA 4NFSA 1YDMA 4NECA 5EJEA 3I1IA 1R6DA 2ECOA 1NZDA 2QAGC 3N59A 2XMRA 1SIOA 4L5IA 4BC1A 5FTMA 1SC9A 3OI7A 1X1RA 4K6HA 1XXLA 2VA9A 3B6MA 3B7WA 4HGRA 5AVKA 4DNXA 4CTMA 1QTNA 1P17A 3H7IA 3LLMA 4LI0A 4P4UA 1CCWA 1IDOA 4NEGA 4R98A 1ZI9A 5D1HA 4KR2A 2YMMA 5ITVA 2ZI9A 2A58A 1PUXA 1ZQ9A 2NYAA 4IO1A 4OBXA 4W9NA 4S2UA 1VKRA 5ESDA 3WO1A 5C5IA 2WJ6A 2W2LD 1E7YA 4HY3A 5KPJA 4LC1A 4NFYA 4KLAA 5IJAA 3ZE1B 4G07A 5EAIA 2BD0A 3R8CA 2L69A 1WB4A 1YI1A 1Z7EA 2OM2A 3ACDA 3UO8B 3ZKAA 4AKSA 4BV3A 2ZQ5A 1AUVA 1GLVA 3AUAA 5FTNA 5JYDA 3E03A 5FA5A 2W6PA 1S2LA 3D31A 1RZUA 1ZIOA 2TS1A 5EC8A 4J94A 4YRPA 3SLRA 3SSOA 3OIGA 2HK6A 2Y6UA 2JGJA 1PQPA 4WZAB 1Y3AA 4URHA 5TX7A 4Q4HB 3TBHA 1XTRA 5TSDA 1CETA 1GTSA 4XWAA 4EB6A 5UKDA 1ZRMA 4N03A 1TJYA 2G76A 2V7QD 3BA6A 1OSNA 4QASA 1DTEA 2GI4A 3MFYA 3DXXA 1HTWA 1B42A 3WYCA 5G0VA 3FN4A 1IAQA 3SHQA 5KU7A 2JHFA 2CMHA 2VSFA 3UYLA 2J6IA 4PSDA 4C04A 1SOAA 1NURA 4A8HA 4ND2A 4U8GA 3C70A 1LKZA 3GZNA 3CUTA 5BVHA 5JH7F 1L3IA 5AM1A 4J0EA 1TEXA 4I4LA 2C77A 3GUVA 3T54A 5C80A 3GCDA 3V8VA 2C31A 3JQFC 3H04A 5IT0A 4W99A 5ALJA 3TFWA 3ZR4B 4DIDA 3DXYA 2W2XA 5DFAA 3NOOA 5EFOA 3QKSA 5LQNA 1Z29A 1EVKA 1W6UA 4KDFA 2WM3A 3QVTA 1TKAA 3NCHA