4DDKA

Pantothenate synthetase in complex with 1,3-benzodioxole-5-carboxylic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
289
structure length
289
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Pantothenate synthetase
publication title Integrated biophysical approach to fragment screening and validation for fragment-based lead discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 97
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4ddkA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4ddkA01
3A04A 1QNFA 1J20A 4F4HA 1EUQA 4KR7A 2PXHA 3SEQA 3QTBA 1LI5A 2DUMA 4NDAA 4YBRA 1IQ0A 1JGTA 1EXDA 1M8KA 4PBSA 4HJRA 1EFVB 1GZUA 4DDHA 2AKEA 3IH5A 3PNVA 3HGMA 1GPMA 2PZBA 4OUDA 4HJXA 1MB9A 3ZJTA 4CDMA 3F3MA 2R5WA 1UFVA 4U63A 2EL7A 4EF6A 4NATA 4K0RA 4EG8A 1XNHA 2A1TS 3HFJA 5IJXA 1U3CA 1Y42X 3ND7A 3TQOA 3TS1A 3KT3A 3I05A 2CV2A 2ZP1A 2V0CA 3FI0A 2X0KA 3P0HA 4PBTA 1WXGA 3FH0A 3X1MA 4DNXA 1EFVA 5KHAA 1J1ZA 1X6VA 2HZ7A 3SEZA 4MWBA 1XJQA 3VU8A 5J5AA 3L93A 3Q10A 3IOCA 1ZH6A 1YI8A 2C5SA 3UC5A 1LI7A 1VL2A 2E89A 4QBTA 5H7XA 4G5YA 2PZ8A 3AFHA 4MW9A 1COZA 3RJZA 1ULHA 2A7XA 1DNPA 3FOCA 1Q19A 1EFPB 2D13A 4EG5A 4EG6A 2IJGX 4EG7A 3HL4A 3MMXA 4NAHA 3CVWA 1U7XA 4MW6A 1YIDA 4MVWA 4I6JA 1G8GA 4PBRA 3H9BA 4DDMA 2QJTA 3G6KA 3KT6A 1J70A 1J09A 1O6BA 3IUBA 5TGTA 5TEWA 3PXUA 4I6GA 3ZJVA 1S4MA 2AZXA 1IQRA 4F3RA 3COWA 4TS1A 2QUHA 1EFPA 5KWVA 2A84A 2H2AA 2NZ2A 4EGAA 5FO1A 3INNA 1K4MA 4I6EA 4KPUB 4GU5A 3A2KA 5K0TA 1LW7A 4ZCPA 3BL5A 1KKUA 5DEOA 3U1VA 3CVVA 4ZT3A 4ARIA 3GMIA 1H1TA 3N2YA 1YUMA 5DASA 1QRTA 1JEDA 3E27A 1OBHA 2DLCX 4R2LA 1TEZA 1H3EA 3DLAA 2OQ2A 5J59A 2X1LA 3JXEA 3N9IA 3HZRA 4KPUA 4MW5A 4MWCA 1TYAE 2J4DA 1J21A 1U7DA 2JANA 1OBCA 2G36A 2Z08A 1WKBA 4DE5A 2DETA 1IVSA 5LFAA 2CV1A 2WSIA 3IOBA 1X8XA 1N2HA 1O0CA 4KKVA 1OWLA 3MXTA 4MUIA 3K9WA 1T6ZA 3ZGZA 2PZAA 1KH2A 3IVXA 4G5FA 4MVXA 3AL0C 4CT0A 1MB2A 1VBNA 4XSVA 4P2BA 1QU3A 2VXOA 2CV0A 3COYA 1QQTA 3PNBA 2BTEA 3GLVA 4YP6A 3CLRD 3P0JA 4XFJA 1RQGA 4NAUA 5JBNA 2D54A 2X3FA 2Z09A 3DO8A 2YY5A 3TZEA 1WXEA 1O5TA 3FETA 3AG6A 1SURA 3IDFA 1GAXA 4KR6A 3TQIA 4JXXA 2CYBA 5HUHA 1M8FA 4MULA 4MW2A 4QREA 1N2OA 4JZYA 1PFUA 1EJ2A 1PFYA 1WOYA 3IMCA 2JA2A 2PG3A 3FDXA 4WNYA 4EG4A 3H97A 4ZCRA 1G8FA 3AKZA 1WZ2A 1I6LA 1KP3A 3FWKA 4ZT4A 3NV7A 3FHJA 1A8HA 4MQ6A 1I6MA 2O8VA 3CLUC 3A05A 4YP7A 1T6YA 5DB4A 3ISJA 2OV4A 4PY2A 1IRXA 4MAFA 4MUGA 1NP7A 1F7UA 3VRHA 1F4LA 3CLUD 1NZJA 1OD6A 1R6TA 3ZXSA 3CVUA 1CT9A 3G59A 1TYCA 3CA8A 1EE1A 1NUPA 4X0EA 5FNZA 3SP1A 3HV0A 2A4MA 1WQ3A 4MVCA 1GLNA 4MW1A 3UOWA 1F7VA 2TS1A 3RHSA 1V8FA 1TYBE 1JIIA 1JZQA 3N05A 2DR2A 4MUJA 3X1JA 1WXIA 1Q15A 1JIJA 1NUSA 3L92A 1QTQA 4MUFA 3X1KA 1YULA 5KCMA 2BYTA 2O5RA 2AG6A 4RPIA 4YP5A 2GM3A 3OTWA 2J5BA 4CDNA 4MUKA 3ELBA 4OJMX 2A86A 3FY4A 2J09A 1HYBA 3FNRA 3ZUGA 4J75A 3QTTA 5EKDA 3COVA 3IMGA 1FYDA 1JIKA 5F23A 1WXHA 1M8GA 2D5BA 1I2DA 2WB2A 1NYLA 2PFSA 5TEVA 5LM3A 4ZCTA 4DDKA 2QJFA 2XRZA 2A1UB 3OP1A 5J58A 3ZIUA 1M8JA 4MLPA 4EFKA 4EG3A 3CLTC 1G8HA 4ZT6A 1V47A 1KORA 3M5WA 4GRIA 5FO0A 1BS2A 3CLTD 1MJHA 3SZ3A 1JHDA 3KFLA 4ZT7A 1OWNA 5TS2A 3GUZA 4AQ7A 1OWPA 3CVYA 1R6XA 1KH3A 1O97C 1R6UA 4E1AA 1T9GR 1U0BB 3IMEA 1VBKA 1K4KA 1NUUA 3G5AA 1ZJWA 1JMVA 3VGJA 4G6ZA 3COZA 1WJGA 2A1UA 2B7LA 1O97D 3RBAA 1I6KA 5BNZA 4ZT2A 4K03A 1D2RA 2QUIA 4ZCQA 1PFWA 2Z3VA 1GTSA 4WSOA 3N8HA 1TQ8A 2RE8A 4AS1A 2YWCA 4MVYA 1MBZA 1WY5A 3FG9A 1NUQA 2QTRA 1NSYA 3TNJA 3ZXIA 4BWVA 3SDBA 2VTBB 2RD2A 1WQ4A 3IVCA 1KQPA 3PNYA 3Q12A 3KT0A 3KT8A 5AHWA 4HK4A 4CQNA 1MOPA 1XNJA 4MWDA 1U3DA 2IELA 3H9CA 1PG2A 3IUEA 4MUHA 3TZLA 3C8ZA 4QRDA 1T6XA 4MW4A 5K0SA 3RK1A 1GTRA 4MW7A 1PG0A 1NUTA 2VTBA 2QTMA 2HMAA 1O95C 4U8HA 4KR9A 1JZSA 3NBAA 1M83A 4EG1A 3LCJA 3IODA 1IFXA 1O96B 2QJOA 2CYAA 5H16A 1JEEA 2CFOA 2E0IA 1O95D 1OWMA 5HG0A 4ND7A 1N2IA 2WQ6A 1F9AA 3UK2A 1JILA 3LE8A 1QRUA 1N2JA 2ZUEA 3P0IA 2A88A 4A91A 2YWBA 3DV2A 3MUEA 1N2BA 1O0BA 4JFAA 1QJCA 1XNGA 2DXIA 1YUNA 3D6VA 1O94C 4MW0A 3H99A 1O96A 3RFFA 5HUJA 3SZGA 1KP2A 4MWEA 2CYCA 1N77A 1O94D 3ND6A 2GKSA 1MAUA 4R0NA 1QU2A 3AIIA 1TFUA 2E18A 4ARCA 1N1DA 1FFYA 4ZT5A 2A1TR 2CT8A 3S3TA 1VBMA 3CLSC 1MC1A 2YXNA 4XFDA 5IHXA 1G59A 3CVXA 1M1ZA 3UMVA 1H3FA 1ZUNA 4MUEA 3K32A 3P52A 4DLPA 3CLSD 3CR8A 3ND5A 1P7PA 2WQ7A 2IP1A 1KAQA 1MAWA 1J1UA 2CUZA 3ZJUA 2GOYA 1GN8A 1IQUA 2DERA 1VLHA 1T9GS 2J07A 4JYZA 1M8PA 4S1OA 1NURA 3ILVA 4ZCSA 1JECA 1N2EA 2H29A 1PFVA 2QTNA 2ZUFA 1WXFA 2E21A 1KQNA 3A4IA 2EJCA 1OWOA 1YIAA 4JXZA 3D6UA 2DEUA 1N3LA 5LLTA 1KAMA 1NI5A 2HGZA 4NX2A 2V0GA 3AG5A 1EUYA 1MRZA 3MLBA 4HPWA 3SYTA 1N75A 2XRYA 2CSXA 4UZEA 2JAXA 3HMQA 4NZPA 3PRHA 1Q11A 1H3NA 1TYDE 1N78A 1Q77A 1ZH0A 1ILEA 4FZJA 4Q93A 4U7JA 1N2GA 4RUKA 3FIUA 4R2MA 1QRSA 1KH1A 4L2IB 2QUJA 3Q4GA 3IVGA 3H05A 3NBKA 3DPIA 4UZFA 2X1MA 1KR2A 3LOQA 3QE4A 1B6TA 2DPLA 1IH8A 1K97A 4J76A 3MLAA 1IHOA 4H3SA 4ND6A 2J08A 2I1LA 3UY4A 2QUKA 4Q16A 4DJAA 2NSYA 5DK4A 4OUDB 4YMIA 2PIDA 1KQOA 3CLRC 4L2IA 3RK0A 1K92A 4MUNA 3IOEA
chains in the Genus database with same CATH superfamily
3A04A 2AEMA 3VYTB 4F4HA 4MV4A 1Y63A 4FI3F 2A4KA 3LBNA 1P6UA 1YC5A 2QN3A 3EULA 2X8LA 3DTYA 1ECFA 1L5SA 5EP3A 1FNNA 1DWOA 5KNBA 2PMDA 3DZHA 1XTBA 4IFIA 1GZUA 1GP2A 2FMIA 4NI5A 5TVKA 1E6LA 2H1WA 2IXEA 3WLOA 1MENA 1S2LA 2R2GA 2JARA 3DAFA 1BEEA 1F0PA 1ZMTA 3H84A 3G2IA 3KPUA 3R3JA 4H6PA 5E38A 5DV9A 2WTNA 1EYZA 1IZ8A 5EIOA 4A2WA 2CFIA 4BC1A 3U7QA 2XEXA 4AZ3B 4P5PA 1RRPA 5F7OA 1BN6A 4KIFA 2R4QA 4IS3A 5K6AC 2PGAA 1R9MA 5COAA 1GUAA 1FRNA 2R8EA 4KRGA 3N70A 5B1YA 1PTJC 1RKVA 2YOGA 3NAMA 4XDYA 2H5JA 1UH5A 4ALLA 1T1RA 4PLVA 3K0AA 4ZEWA 4KTTE 3OPNA 2WUFA 1GILA 3WLFA 1T4BA 5ILGA 1P4AA 2O2JA 4INAA 4UHFA 1HZJA 2BFDA 3BERA 1OAOC 3GFPA 5LQSA 5C31A 4C6RA 1MDBA 2I5PO 3REQA 2QAGC 5EZQA 3PHLA 4RK7A 4OJKA 2A53A 5TS3A 5EYPA 4IVRA 1IXYA 3NS7A 4JVMA 1QO0D 3RYFA 2NNLD 4BXOA 2E89A 4EL5A 5FEMA 1CUZA 1U3WA 3D7KA 4PRYA 3T35A 3H2JA 4DIFA 3CE9A 1AUOA 4GW3A 5DCLA 1FDRA 3TEFA 5JS6A 4FX2A 4PF1A 2O0MA 5AVJA 2IJGX 1U90A 4PSCA 4QLOA 5KKNB 1QVAA 2W2KB 2B5OA 2G9VA 4W1SA 3QA3E 4WERA 4CQMA 2H85A 1JG6A 4KLAA 1O4VA 3HNRA 5L3ZA 4CTMA 3ADDA 5G0WA 3SXPA 3B2QA 3C7DB 4HAUA 1IJKA 1ZUWA 1G6OA 1SA0B 5A0TA 2M2IA 1SUWA 2XVAA 4MCHA 5IEBA 3AF1A 1JAHA 3KALA 3B36A 2Z2ZA 4JSTA 2GZSA 2WD7B 4QAQA 2WJPA 2MYUA 2KS6A 4D3YA 4OMFG 3RF6A 1TFRA 1XXHB 4QT4A 4TTQA 3H2YA 2ACWA 4LI3X 3V00A 2W6MA 3DJYA 5K4HA 1TF2A 3NWJA 4BQPA 2V96A 3COWA 4Q4HB 1FSGA 1Z2AA 2XT6A 4Y9TA 3WO0A 3GVPA 4EW6A 4AP6A 4X45A 2O59A 1IM8A 4B35A 4EECA 4EL0A 5EPOA 3KXPA 1VMEA 3LXRA 3P20A 1QZZA 4OHZA 1ZHFA 4P7BA 3MOSA 2QRKA 1W19A 1KMIY 2PD4A 3MM4A 4N3BA 2NZYA 4BP3A 3QYFA 3E9EA 3GT0A 3DEFA 5L9AA 3PEUA 3TH5A 3L5OA 3H1PA 1ENOA 5EA2A 1I3LA 5GGYA 2P1ZA 3H1GA 1S6YA 1G20E 4HSEA 1ZI8A 4G1UC 4DLAA 1WSBA 3JYOA 4YRLA 2ZFUA 4ZXPA 5JRJA 3UAWA 2R2AA 2HJSA 4WACA 2CJPA 2ZJ4A 4C29A 1LTHR 4EFLA 4ATNA 2UUAB 2P4SA 1VI5A 4IEEA 1AZWA 1HT3A 4IOMA 4G1FA 3ITNA 1IVSA 2DETA 4KAAA 2BBSA 1G7TA 3UA0A 4E21A 1XEFA 3TB6A 4F5YA 4A2CA 2O2SA 4X62B 4KLCA 4JJEA 3L02A 1EK0A 2WYIA 1NN1A 4FZ3A 1VGVA 4IWYA 1T6ZA 2Z83A 3MAAC 1JWBB 3DO5A 4G63A 2CNOA 2PZAA 4F96A 3DYVA 4WNIA 1NNEA 4UCQA 3L43A 2GZAA 2ZVQX 3URKA 1C30B 2VBFA 1CC1S 1LRKA 3CBQA 1K66A 2Q1XA 2GBLC 2UDPA 5A4IS 2VF7A 2VZ8A 2BGNA 2JATA 4P2BA 1U28C 3WNZA 1XDDA 4D9JA 1ABEA 1E7YA 1KO5A 2ZRKA 3AHFA 1IUKA 3BHIA 3FPBA 5AM0A 4AY5A 3NI2A 5JATA 2F1RA 2BUBA 2XTJA 5CLFA 1SXGA 2R47A 2YZMA 3L8YA 2CHFA 1G3RA 5K3BA 5GTDA 3DEAA 3KTAB 3CLRD 3BQNB 3ZZUA 1W47A 2LTAA 3IEMA 3RNOA 2YVQA 1PT8A 2GN6A 1P3Y1 4YRPA 4HDRA 3DBLB 4AN4A 2GHQA 2CUKA 1ORIA 2X3UA 3HDGA 4NCJA 3E2PA 3BMCB 1FDOA 1S9DA 4D3XA 1U8UA 2ZWAA 4PAGA 1VDZA 1Y48E 1NHGA 4DYHA 3HGTA 4YPOA 4QXRA 3JVVA 4P93A 1VG1A 4XSGA 3GR6A 3ZWMA 3KLBA 2YJ5A 1ODFA 2JIBA 4D5GA 5JHGB 4PYKA 2H4FA 1BYUA 4G84A 3I2FA 3AEQA 1F51E 4QTZA 3KTDA 4OL9A 2YFKA 1EHYA 4IEIA 3SM3A 4WNYA 4KZKA 4JDPA 3I72A 2JZCA 2VIIA 1I4EB 1Z47A 4XGIA 5M3BA 1XWFA 4DCUA 1NW9B 1X2EA 5AM1A 3VV2A 3V8MA 1XA3A 5K0BA 2FQWA 3O4HA 1XDWA 1Y5MA 4L57A 5TJ9A 2RI1A 4Q24A 4DMUB 1G4HA 1T4CA 3PNSA 1Y33E 2XMPA 3IHTA 1RKXA 2FMXA 5NULA 3LVFO 5T6MA 3UWKA 3QJGA 4H77A 4PC6A 2QL6A 3RTBA 3FHOA 3L77A 1T6YA 3HVIA 2AG5A 1AQYA 3I34X 5EHQA 1BG6A 1NAHA 3PPVA 4ZRNA 1G2IA 1XJ0A 4L08A 3LCUA 4ZQCB 3T1OA 4J1TC 3BG5A 4Q15A 3AZOA 2NU9A 5B37A 1X3LA 4WKPA 3CZMA 4UULA 4B4VA 1FQOA 5LB4A 3QXGA 3T1VA 3T3DA 5KX5A 5CXXA 5BVHB 3VZBA 5KYUB 4EY3A 1MVLA 1JT9A 2DJ5A 3EE6A 4BWYA 2I2FA 5HQ3B 1W36D 3RG8A 2A78A 3BAFA 3R77A 2QR5A 4DCNA 1NZFA 2QTTA 3F1LA 3G82C 5KYVA 5D6NA 3UJ7A 5ALDA 3SIXA 2ANCA 2V98A 4C2UA 3SEFA 1PGQA 3IKLA 2QQEA 2ODTX 4FJ2A 4ZALA 1GRQA 3W4KA 1BHSA 3B6ZA 4AL4A 5K03A 1TKRA 3QWIA 3ZU5A 3KKQA 3M6MD 1KO4A 5JDIC 4ZZ0A 1MPXA 4JQCA 3ZDDA 4JUAA 4COKA 1L9XA 2A3RA 2OENG 2WV7A 3UOGA 4A23A 4PO8A 1ZIYA 4XD2A 4XUGB 3TFQA 5KSYA 2JVIA 3EF3A 1OU4A 2AG6A 5D87A 3QJ5A 2JI7A 2FN4A 4G0XA 4F56A 3KUUA 5BSHA 3G1UA 1ZN8A 1GY8A 1PR3A 2ASVA 3PGMA 3QVJA 5FCDA 1KK0A 3SKXA 4CIAA 3G8BA 4DRZA 3DZCA 3GNTA 3BE6A 4EUSA 3QELB 3DXXA 3GH1A 3EGDB 5AHRA 3X1ZA 4IJKA 3EDQA 3SS9X 4UBJA 1UFOA 5K6AA 4F04A 1NE7A 1XZEA 1IJEA 1PTJA 3AKDA 4PO1A 5F23A 3C85A 5MDHA 1TJ3A 4O4LB 2AOUA 4KX5A 1WUYA 4EHFA 1P4JA 4IL5A 4UU8A 5TEVA 3PNQA 1JJ7A 3TMYA 4W5JA 4BKRA 5AUOB 1VLMA 4KGZA 5L3VA 1C8LA 1DQNA 1OAOA 1ZL0A 3BM5A 1UFKA 1UR5A 2B30A 3OP1A 1JH8A 2ISCA 3EVNA 1YKFA 3TW6A 2QAGA 4MLPA 1UQUA 1LPNA 1Y4SA 1E1QA 4D8WA 1G8HA 1AKEA 1QTRA 1MABB 3LLVA 1K7XB 2A7QA 4JYBA 1YB5A 3HI6A 3UPDA 5IJWA 2UYOA 2EYQA 3ABSB 1V5GA 4KBYA 4LJSA 4NZNA 3M83A 3RSLA 2QN8A 3VNQA 1YZHA 5J3JA 2EP5A 1UMCB 3DZJA 3NHKA 4ZYWA 3TW4A 2PL9A 3GJ8A 2P3OA 3FWYA 5A3QA 5BUQA 1CJBA 4KITB 3QKWA 1OXBB 3MWDB 4IG9A 4QQKA 3RH0A 2HPVA 2QVCA 2RKOA 4XQ9A 3S2EA 1RXYA 3FMIA 3GUUA 4NOLA 1R6UA 5BNIA 1U3TA 1T9GR 3P2IA 2XNDD 1BXGB 1UQRA 3R5TA 4JJ6A 4G0VA 1GQQA 2TECE 5FEUA 3COZA 1VSUA 3X1XA 1RBMA 1SBIA 3OTOB 1U8TA 4L73A 1P1FA 3DBVO 2J3EA 3BRSA 3OZAA 4RHEA 4WFQA 2OESA 3LSTA 1R18A 2QE6A 3OLCX 3QFHA 2RFLA 1BE8A 2XXBA 3M81A 2XDAA 4MGYR 5JOQA 4P4LA 1D09A 1QH1A 4UBLA 3WZLA 5KU7A 3MJSA 5ULLA 5F1YA 3W8NA 1ISHA 2RGNC 3E0QA 3FD8A 3ROTA 4HWTA 1IB0A 4NBSA 4CV3A 2DBRA 1QZXA 1W44A 1ULAA 4IXNA 1Z7EA 2IEZA 4EGJA 2PX0A 1R3UA 1QZTA 2QRLA 1WY5A 4DLUA 5AKKA 4Z0TA 5JH7F 1NSYA 5K05A 1T3HA 4YJ2B 3WS7A 4ND5A 1L4LA 2BE7A 2X7XA 3JAKA 1G55A 4OHPA 2OK8A 3FWNA 2JIDA 3GRRA 4DMRA 3LX4A 2CVOA 2W6PA 3FGZA 5L40A 4DREA 2QMHA 3H5RA 4MPDA 4OLHA 1XZNA 4D2IA 2FDCA 5DGTA 4MRMA 3IUEA 4MUHA 2P6RA 3MIZA 2J59A 2FUCA 3I5MA 4X8HA 4BNJA 5JNRA 3QYAA 1EFRA 2GF2A 2C3MA 3PNOA 2XWPA 2VF4X 1VJ0A 1GYRA 3FNHA 3WRWA 1XKLA 1HDZA 3ONNA 5DWDA 4KMRA 5AXBA 5ALEA 5ERXA 4CU2A 2FMKA 2C2KA 2EEZA 4LZJA 2HGSA 2XOKA 5JD3A 2PNJA 2V4MA 1CDDA 2E0IA 2YV3A 5C8DA 1YONA 2ORYA 2CLMB 2OAGA 3GRVA 2HK7A 5DI9A 1O95D 3JU3A 2OV6A 2GTIA 1XCJA 3IP8A 4OK5A 1EA5A 3BSSA 2ARKA 3UK2A 3O1HB 4DTCA 1FFHA 4M8LA 4A73A 1YZNA 3K2QA 4Q37A 4DC0A 4MR9A 5K3SA 4DBVO 3KO8A 5C52B 2BR5A 3DE6X 4G86A 3D0QA 4MKIA 2H2WA 4PYOA 4AYTA 4DIBA 1UDRA 3DV9A 1YZQA 3Q2OA 2GEKA 3QSGA 4MNTA 4A0HA 4LJKA 5AOVA 2Q0HA 3TNYA 3VO2A 4DMCA 1ADCA 3TZ6A 4J2TA 2GBLA 4I5DA 4W5WA 5AKEA 2APJA 4WEQA 2ZUCA 2BKXA 1U28A 2XA2A 4JR0A 4TS3A 4ZYVA 1VRWA 3HFGA 1WSWA 5HUJA 5JQGF 5T3UA 1TNDA 2H5EA 4OQDA 2EBFX 2CLEB 4MWEA 4GXNA 1O94D 1RM0A 3N2KA 3PR3A 4YRRA 1C4XA 2VBGA 1JVSA 2VPYA 3N0TA 4L28A 1AK1A 4M1QA 3FUCA 2E18A 3HA7A 5DN6D 5I9BA 2SICE 4S12A 3LTNC 4G2TA 1LLDA 4RDXA 2UXCB 1JFFB 1HL3A 1W88B 1E0SA 2OWDA 4Z8XA 4PAQA 4RAOA 1WY7A 2D1SA 1H3FA 2Z1NA 4JAVC 4UU0A 4MP8A 3CLSD 3B1JA 3ILSA 3TZHA 2G9QA 1F3LA 3RLFA 1GXSB 3IOMA 5KKAA 1RRFA 4I19A 4PHHA 4QLBA 2O8FB 1LTKA 1FYVA 4AKEA 2WKRA 3OJOA 4EUHA 3G23A 2GOYA 3I53A 5E0KB 4YY3B 1SIWA 1LKZA 1YR8A 4IIBA 1B93A 4LHZA 5D00A 4PAOA 1VJ1A 2WF6A 4GOND 2P79A 2I1QA 1GUDA 3L7BA 2Q7OE 1Y80A 2Y0CA 1TXGA 3KNZA 5BY2A 4B84A 1KEZA 2FMHA 2B36A 3KR9A 1QHYA 3HABA 4H31A 4ZIRA 4X9XA 3NJ8A 1TLLA 1N5IA 3DFZA 1XMIA 3ECAA 4XWTA 2LV8A 1DWQA 4NEQA 4NX2A 4PTZA 4LXYA 5KYWA 1WXWA 4J1TA 2UUOA 3DAPA 4BE4A 2Y1DA 2G6TA 4DR2B 3GG9A 1KKMA 521PA 5CFNA 4N0PA 2AX3A 3B3JA 4WY8A 3RRZA 1E96A 1LPSA 1PL6A 2BD0A 3AL2A 1WABA 3VPAA 1EVKA 2BJVA 4NFHA 1QJ4A 4BJ1A 2CVFA 3C3CA 4FYIA 2WE8A 2G09A 4GYWA 3LA8A 1ZH0A 3D3WA 1IL0A 3D8UA 3IUJA 1T3ZA 3HDTA 4JLSA 5DO9A 1QRSA 3E7FA 5FTLA 4YCBA 2ADOA 2BONA 2P2ZA 3TTTA 2AI3A 1U1FA 3PB3A 3EZNA 3ZLTA 5JDIA 1YVPA 1A76A 4GBJA 2QY9A 2DHRA 4AN0A 1EQAA 1QF7A 4J7CA 3T7SA 4P7FA 3PQ7A 4DCGA 2QL7A 3SDSA 2I4NA 2FSVC 1A8PA 4XJXA 4H3SA 1R00A 4ERXA 1PR0A 4F6RA 1UDBA 5JYCA 2WTEA 5MGBA 3W6NA 3VPSA 4XOIA 3PWKA 1QKIA 2L18A 1DRKA 5BYBA 5FOSA 1Z0KA 6LDHA 4OUDB 1NLMA 5AIBA 4NJOA 2GHRA 4G67A 1J33A 1F2UA 2FR0A 4HAOA 3LHDA 2GD6A 4K6MA 4MINA 3H3FA 4QU9A 4YV2A 4AO6A 4MUNA 3GGPA 3UANA 1L4BA 1M74A 4Y9DA 3A06A 4ND2A 5TQ2B 2YDYA 4N5LA 4MDHA 2DCMA 5AWFC 5IT5A 1EQUA 3WYFA 1EUQA 2XE4A 1UDAA 2PXHA 3NAGA 4TKVB 4F1WA 3ZVNA 2XNJA 2OO7A 5T4EA 1E98A 1PN3A 1XZFA 2B6NA 1V11B 2F90A 1ISFA 3LUCA 1EXDA 1I80A 5JCZA 4PBSA 2F3PA 2P5TB 4UFOA 4CKCA 1SXPA 3VX4A 4AY6A 3K5WA 3OWOA 3CLKA 4RVNA 4C76A 1E7RA 5AKIA 4M0PA 1UM8A 3HXPA 4JOBA 2DCUA 1E9AA 2G1UA 3L49A 2R5WA 2G5ZA 4C1BA 1UFVA 3NXSA 3W6ZA 2C78A 4R2JA 3TTSA 1LPBB 421PA 4CCSA 4CLXA 1M6HA 1JTFA 3V1KA 5EMLA 2VP5A 3J81A 1D1SA 1BOOA 2O3SA 3W6UA 3UHJA 1J06A 3BFJA 2ZBEA 1XQXA 2UAGA 3FJOA 1U3CA 3PDIA 5TPZA 4ALMA 4F06A 2RJ3A 2RDMA 2QP9X 2C84A 2O1EA 4NJEB 3DZIA 3N1UA 2X0KA 2NTVA 4K8RB 1WXGA 3X1MA 4D9CA 1XWWA 2QTVB 4M9CA 1VRCA 4KQCA 3TIIA 3LV8A 4E2FA 5E3IA 2OCAA 3K1AA 4WLEA 1EUDA 3WIBA 3F7TA 4JMLA 5DYNA 3EGXA 2XT9A 4E5SA 4P83A 4TQGA 2XUGA 3L1UA 2EGGA 3G2KA 3K7EA 3GN2A 2KPOA 5G4KA 2C61A 2P2YA 2N1MA 3VNRA 4YT8A 2J6HA 2RGNA 5FWXA 2HDNB 2AYZA 4BN0A 3ANLA 4DV2B 3K70B 3SQLA 3EQ2A 3LUGA 3L8GA 3MGGA 5T67A 1T6BY 2Q49A 5CMLA 4J2OA 1PI3A 3L0YA 4ALJA 2O7SA 3EDYA 1XCBA 5BRNA 4CT4B 3KELA 2YZGA 3HPQA 3KV1A 4GP7A 4FGSA 4MOWA 2WMOB 2G0NA 1SQGA 3K09A 3KVRA 3F4LA 2O5EA 5BSWA 2VZEA 1P7WA 1TZCA 1SEVA 1RBYA 1ELOA 2OBLA 5JALA 2R25B 2XTNA 3T0FA 4CIDA 4RGYA 4NCNA 4RJKA 3L1IA 5JJCA 1BEZA 3C3XA 3CFIA 3EA4A 1EBBA 1G9SA 1W93A 2JFUA 3T7EA 3AQIA 3H17A 5FI1B 5TGTA 4K9NA 1J00A 1X8JA 2H5IA 3INRA 4X6UA 1LVHA 1UC9A 2HXSA 1MFPA 2CNWD 2AV6A 3O26A 4BKOA 3DH0A 4YBZA 1CPYA 3IDOA 2UZ3A 3KKEA 4I6EA 4W1PA 1P2TA 2XCSB 4IIFA 1UL1X 1Y3BE 1ZJ4A 2F3RA 3AF3A 3L1JA 2DWQA 1NVBA 3I42A 2GARA 3OCJA 5HOQA 3EPKA 1SXJB 2W6NA 3H1TA 3VI4B 4CEIA 1QKKA 4GOXA 4B74A 5REQA 2VWHA 4WKBA 3VDRA 4BE7B 2EV9A 4Q7EA 3WP1B 1T36B 1ZXLA 2IPXA 2P2GA 1E8MA 2WKPA 3LFHA 4OXXA 2XH8A 5HP4A 4UTXA 2OGTA 2YNMC 4UTOA 3ZBQA 1DAPA 4X66B 2HUPA 4ZOBA 1PQ4A 3TPZA 2CNDA 2C7OA 2G5TA 4KXYA 1BCSB 5AKHA 4LZPA 3D1JA 2PFGA 3O75A 2RHGB 1KXZA 3AZPA 1U7DA 1OFIA 1PD0A 4V0SA 4EHHA 3WLRA 2G40A 2Z08A 1VIVA 2GT1A 5KJFA 1JEOA 3H5IA 5EQFA 1GQSA 4TQ9A 2JH3A 3LX5A 4GWGA 4L8VA 4UXIA 5DHRA 3M1IA 5LFAA 3IOBA 1YOBA 3COJA 2X2EA 1UMDA 5IUJC 2C7QA 3AMVA 1ZZEA 5K09A 1IHDA 3CZ9A 4MS4B 4MTLA 3WI7A 1SBTA 5CVVA 2ZJBA 4DQUA 5DNYB 5ALJA 1IPHA 1NASA 1T25A 4MK4A 2NYUA 5CVCA 1ES9A 3RU7A 3E9ZA 1E0JA 1EK6A 1Z35A 1SKUA 3HACA 1XD8A 2B92A 1Y7PA 2QA5A 1PWYE 3FCSB 3FDIA 3WMEA 1T8TA 2I4RA 3GDGA 3HRKA 4OVKA 1MQ9A 5D5HA 3G9TA 2GEFA 4C9BA 1ZOOA 1L5KA 3HB4X 5AOBA 1WDLA 4DB2A 3T1HB 3T8YA 1NJ2A 3F78A 4NAUA 5HF9A 3RABA 3R23A 4W5OA 1R6AA 3FBGA 2BE9A 4QEDA 2VJKA 5BV2P 2CHGA 5EMKA 4TLBA 5AVWA 2WLTA 1FDWA 1QWSA 4A92A 1S2GA 1P4SA 3HZOA 1THMA 1SURA 2QVZX 1II9A 2WABA 1UDCA 5AUPB 3IDFA 3G2QA 3KUKA 3NOXA 2JH8A 3LDUA 2BFCB 2G3DA 2B78A 3QVOA 3WTBA 1HYEA 1CZKA 2AG8A 1DARA 1HQKA 4Y2XA 4M6WB 2Q1UA 1VYTA 1N4DA 2WQZA 2ZRHA 5FRDA 4E1VA 1BOFA 1T2VA 3BE4A 2C2HA 2WG0A 4DLXA 2O2CA 2D4HA 3OPXA 2DFKB 2X8JA 3IE1A 4O4LF 2O3RA 4CMEC 5IM5A 1WULS 5CFOA 1E5TA 2WLSA 3O1JC 1GITA 4QUDA 3UJCA 1JR3D 4MQ6A 3AHDA 1CX9B 1QFYA 3EVZA 4KO3S 4YAWA 1W73A 3UPUA 4ISBA 1R6VA 4HDNA 5LLSA 4MAFA 3AI1A 3LLUA 1NP7A 3P2KA 2ZDQA 4MQLA 2NXCA 2R96A 5K2OA 4R83A 3UK7A 3B85A 1ULBA 1VGQA 3AO0B 2YHIB 3IFSA 2FEOA 4XIJA 1OE0A 3MRXA 4LZAA 5HSGA 2FSVA 3C8UA 3QFCA 3QBJA 1OILA 2GS9A 3V2GA 1RRVA 4X44A 4HVCA 4HWOA 1TYCA 4RHYA 5EIWA 1EAYA 4X0EA 1ZCFA 2OZLA 4H27A 3TBHA 3QEMB 3ZCPA 2IZZA 1JYSA 4FN5A 3ZY5A 3F3YA 2CK3D 1GYQA 5CB4A 1A9YA 2ZUWA 4KIWA 5EMHA 4R9VA 1I7DA 2PU5A 4JYMA 3UT5B 3B6EA 4AMBA 1NXOA 2HEGA 1E9VA 2W2VA 3AKEA 1EGAA 1I4LD 1RYMA 2K2WA 3I04M 3NAZA 5AK3A 1SU7A 2PL1A 1ZVVA 3H9QA 1KR5A 2D4AA 4OXIA 1CRZA 5I4KA 4XGRA 4XWAA 4PX3A 2JG3A 3ZEIA 3P0RA 3PU6A 1H9CA 4X7RA 1JFLA 3AEXA 4MDYA 3FYUB 1T13A 2GK3A 3C3KA 3R9XA 2FWNA 4MVJH 1GNPA 2F1IA 2XR1A 3PUHA 2FF7A 5E6UB 3ZUGA 5F51A 1MHPA 2O4CA 3BWYA 2BEWA 3K6RA 4YJ2F 1XPJA 2IEYA 4Z2YA 4GL4A 1GTG1 1UODA 3PC2A 5HQTA 3R1IA 1RZUA 1AKYA 3NTOA 3VXKA 3WHPA 3V7WA 4TVSA 2A35A 1ZINA 2VCHA 4UHJA 3TW8B 1KEPA 4CLEA 1E0DA 3QPCA 2VC2B 3FGNA 1CDZA 1HDYA 3DG9A 3DYBA 3LP6A 2E1RA 2A1UB 4BDSA 3ZIUA 3EWSA 1QX3A 1SVUA 3ZU3A 3OVMA 5C7IO 1OVGA 2V9CA 2QDKA 1A27A 5IM4F 4Z49A 3EPLA 1H4SA 3KVNA 3KOUA 1E79A 3D7NA 4OBXA 3ZXXA 1I1QB 3CLTD 3F1KA 3NRBA 3P2OA 8MHTA 2QR2A 1EG2A 1K63A 1OLXA 4IGKA 1T2AA 2G9RA 4M9SA 1P29A 3UK1A 4KK3A 3SQMA 1VPEA 3AY0A 3CVYA 2I29A 2ZJ2A 1U2RA 5JC8A 1U0BB 1N2XA 2M1ZA 4EVSA 1RZRA 3IMEA 3MJDA 3BTSA 4YUWA 1A1SA 3QHAA 3KYCB 1V8BA 1EM6A 2HA3A 1E7MA 4AVYA 1TZKA 2ODPA 1JW9B 3UJHA 4JLUA 4ARBA 5IEJA 4K03A 4C0HA 4DN6A 2G82A 1LRJA 5EIEA 3PSHA 4HDKB 2PX5A 3IAM1 5CPFA 1KI1A 1FRQA 1M2VB 1NRWA 2OHGA 4CM3A 4Z9XA 1G0OA 2RHHA 2VYND 3AOEC 3GEEA 5JRZA 1TMGE 1DO2A 3ZDCA 1Y6QA 2O8EA 1AS3A 1PW5A 1GZ3A 3FR7A 5ISMA 5G2FA 1EZZA 1GG8A 4OAQA 1LUAA 1K88A 3U9LA 1TAHA 1Y3DE 2JCGA 3AP3A 3QPAA 3IBSA 5F2OA 5FUMA 3S8EA 3VNAA 4FSXA 1EWYA 1R8XA 1V0JA 3LT0A 3NHLA 4BWVA 2RD2A 3RC8A 1JKFA 1MCZA 3AFIA 5HBGA 3OZIA 3EBLA 1Z5OA 2Y2UA 4MS3B 4JI1B 3FDZA 3SX2A 5HIJA 3VO9A 5FFFA 2AE2A 1K6IA 2RHDA 4C3ZA 1RJDA 1ZO8A 3INYA 3AF0A 5AW5A 3HCCA 2GLUA 5C51B 4FOOA 3E8SA 2BFEA 4W5TA 3MS7A 4CQNA 4DRXA 4TVKA 2PIAA 5MN4A 3ZE6A 2JI9A 4EAAA 4NK4A 5DSTA 5EFZA 1ZD4A 3I8SA 3JQ6A 1QGED 3OEHA 5GY7A 3AEUA 1VHQA 4DA9A 2A56A 3PUIA 1VKNA 1FXSA 2XB8A 1ORDA 2WFLA 3KB1A 4KQGA 2GD2A 2FF5A 4Q1VA 2JLXA 3F6EX 1DB3A 3KEOA 2ZSJA 4DCVA 3UIEA 4KR9A 1RXUA 1QYRA 2O7NA 3UZUA 3FPJA 1JB1A 1NBEA 1DT5A 3CB4A 5DLEA 3MJ4A 2ZB3A 4O4IB 2D2IA 3KYDB 2WZDA 4TV9A 2V8OA 4QBKA 4OUKX 3TQTA 1HETA 4MMXB 1D6MA 1P4RA 5KJ1A 2ZJ1A 1RPNA 2FPIA 3CONA 3DGFC 2ZT6A 1DIGA 1AKUA 3PUXA 3QOXA 5L7YA 4I1PA 5KWIA 3DVAB 1J0AA 1DOAA 5FH9A 3SHOA 1E99A 1DE0A 2OLEA 3WWZA 2PUWA 4YRBA 2RC5A 3THWA 1WSAA 3HJFA 1RQNA 4M8NE 3TM5A 4PPQA 2RH4A 1KO7A 4AMVA 2HIAA 1W76A 2Y0EA 5L3SB 1O96A 4W5NA 3HBAA 2C8KA 2QAJA 5GVSA 1M2OB 3C6MA 1EK2A 4M49A 1BWQA 2DUUA 3LQ1A 4RS3A 3RS4A 1AUVA 2GKSA 3PT5A 2JHFA 4JLOA 1QU2A 2JDIA 3QBVA 3TK1A 1TFUA 4RKEA 1N1DA 4RIIA 1FFWA 1T8RA 3A9RA 5B2ZA 2BZSA 3CMCO 4DCPA 4QOJA 3WL8A 2YXNA 1YJXA 1OMOA 5B6IA 2GXSA 2E5LB 1M1ZA 4HGQA 1YRHA 3IQGX 5FOVA 5TPWA 4LF7B 3DCIA 3K4PA 4ANFA 2ACVA 3JATA 1BS1A 1PWHA 1UANA 1P7PA 1ARZA 1WTAA 1GEEA 1OZGA 3X1DA 1XZPA 1CP3A 2VT7A 3CLVA 1KBZA 1P7VA 2IXFA 4FR5A 4HUQB 3TLAA 1E8DA 5ICSA 1H1LB 4CM9A 1R0LA 1H94A 1X80B 1A95A 4Z2AA 3USZA 2VF8A 2AN5A 1M1UA 2A0FA 3A7DA 5G3ZA 5HMLA 1ZN2A 5K8JB 2MMCA 2ECPA 1A9ZA 3RJTA 4C14A 4S1OA 4TS4A 5CNJA 1L5VA 4GSLA 3CO5A 4K86A 3D5QA 5DW3A 3VOTA 4CMEA 3AF2A 3ZIAD 2AFHE 4K6HA 2X6QA 1JQLB 3VNUA 3O38A 1B3RA 4ZVUA 4JOQA 4HD8A 3GDWA 3D4LA 3N3BC 4IJ6A 5CM8B 2GA9A 5E1MA 4PPYA 4Q34A 5HW0A 2DF8A 4B3MB 1Z4OA 2YMMA 2O0KA 1YS2X 3V42A 2I6TA 2WMDA 1LNSA 1XA0A 3SC3A 5J4HA 1OHHA 2P9EA 4FDMA 4Q66C 5CGZA 1Q7GA 2N47A 2WP8J 4ZDKA 2H3EA 3AONB 3VR3D 3BB4A 2EFCB 1G5TA 3OIVA 4BVAA 4DT1B 5I8WA 2N1BA 5KOJB 5B53A 1X7XA 1WHTB 2GO1A 1Q74A 3OM9A 3RFTA 1T9HA 4XWGA 1PG5A 1E64A 1RLMA 2JAOA 3QKSB 4PLTA 1SIBE 3U0BA 1Z8NA 5SV2A 4HDMA 1Y1LA 2YJNA 4EPRA 2QM0A 5ARCA 3GT7A 1Y5IA 1GGKA 4IY1A 3RFUA 3IILA 2R9VA 3ESXA 1D6NA 1I8TA 3H05A 3NBKA 4C0LA 1JA9A 4E5VA 2VDRB 1FQJA 2QEQA 4WZ6A 4LOAA 1UT8A 1AGRA 4X3CA 3OZ7A 3SBXA 4CLRB 3P1JA 3PC8C 4LFAB 3N7AA 1TT5A 3A8TA 3WE7A 4J9UE 3RTAA 3SFTA 3V34A 1ZMRA 1JDUA 2IUFA 2BEKA 2XSZA 1U2DC 1X1TA 2J08A 3QMWA 1YT5A 4JASB 3IAEA 4KYIB 1QG2A 5A3VA 3U31A 3S5UA 4Q16A 1OZFA 2G77B 3AHCA 3H8SA 3M4ZA 1BE1A 1E1RA 3AV0B 4DSAA 3VO1A 1CJUC 1AMUA 3MGBA 3MJFA 4U9HS 3GVHA 1E5LA 1P1KA 1LBSA 1K92A 1UPXA 3DP7A 3TB4A 1XR3A 3LDAA 4HLQB 1JP7A 2VF2A 4KR7A 4TTIA 4MUBA 2Z57A 2B7BA 2LRHA 2PD3A 4DEXA 4RQTA 1UFQA 1A97A 1YOVA 2WBLC 4PXAA 3QBDA 4YBRA 3F90A 3DGEC 3UFXB 4ZQHA 1A5AB 2JS7A 3NXKA 2EKQA 3WQQA 2CMGA 3L4KA 3EMVA 1ZU5A 3TEJA 3UMCA 4YV1A 1RAEA 1QQ6A 4IIXA 2AJDA 4X1IA 3K70D 4ABTA 4XR9A 2AE1A 3PEYA 4IDEA 4IEFB 4CDMA 4E22A 3RANA 1P2SA 5G0TA 5JASA 4Q9KA 5BV7A 1BC5A 2CZGA 3F5QA 5K3CA 2HRRA 3NJRA 4IGIA 4JLNA 3ZHOA 3CZCA 1ZD8A 4U39A 5ALQA 4XWKA 3KZ1E 4O02B 4GGOA 2J3QA 4RMGA 4NCKA 3TRJA 2CV2A 2G9NA 3JY6A 2X1HA 2ZP1A 1CDEA 1GNQA 1JDPA 2GAFA 2G5PA 2GYWA 2V0CA 2ZCUA 4PVDA 1KJYA 4FK8A 1ZC4A 4RO0A 1LDNA 1QE5A 2NQTA 5AR1A 2JIPA 5KMGB 3A1TA 3AETB 3HB5X 3UHOA 4TL8A 4TPKA 3SEZA 3ONDA 3STXA 3W8EA 1I0ZA 4MWBA 3A10A 4O33A 1TM2A 3R5XA 4DMLA 4RWEA 2NSJA 2BOVA 5DXJA 2GEDA 2RK4A 2O2DA 3AOEA 2RAFA 3LPAA 3N07A 5J4LA 2QWXA 3II6X 4Y0AA 1A4UA 4V1CA 3KAQA 1I6WA 3B52X 4QQFA 5KOHA 5BSUA 1O6GA 2IE0A 2Q3CA 3M3HA 1FYWA 3DVLA 1JTVA 1S7GA 3FMPB 3MS2A 4H1UA 4YJHB 4ZDWA 1QP8A 5FWYB 3K9QO 4F7DA 3U4MA 4TV8A 1MAHA 3FFAA 4R54A 2ONCA 4ON9A 2I3GA 1D2EA 3TMAA 1EUCA 4RJIA 5H81A 1AT1A 3HVKA 4UJ3A 2UZ0A 1H0KA 3S2UA 1AX9A 4J49A 4DYVA 1D9XA 3F5MA 5JSFA 2BMJA 4DDMA 4ITUA 4JP2A 1PZEA 4OL0A 2IZ5A 2JGRA 3VTAA 1YBMA 3LAWA 1R0WA 3IEUA 3ZWPA 2C9ZA 3EEIA 1E3TA 1GFSA 3KJHA 3MGKA 3I9LA 3AIOA 3W7VA 3IKTA 4UC0A 2ZSAA 4YRNA 4LXGA 4H0FA 5DLDA 3PWSA 1WRBA 2G1JA 3MJVA 4X5OA 5DRYA 5EEGA 5BWOA 3HCNA 1DRWA 4GZ5A 1CHDA 4UM5A 3B51X 3MD9A 5B57C 4LF8B 2QE7D 2XUIA 1D1TA 2FZVA 4OYLA 3ZW8A 4BQFA 2XUJA 2Z2JA 2GJ8A 3HV2A 3QYPA 1LDGA 2IUTA 4QDUA 1N9GB 2O0LA 1Z18A 4XVCA 4HB0A 4DZTA 5K0TA 1XT6A 3PENA 3FOZA 1UWKA 1X1DA 1M0SA 2E5FA 1FXUA 1P0QA 3FGPA 4ZYXA 4IJVA 3O8DA 3QEAZ 1ONNA 5DASA 1YBVA 3OQBA 1ABBA 1NBME 5DT9A 1C7IA 1M67A 2IIQA 3GLKA 2IH2A 3SCZA 3KPWA 1HMPA 2H59A 3OQIB 5BYAA 5B7PA 3U44B 4N41A 2JKZA 1IHPA 3ICWA 5EUQB 2OL4A 1GAJA 3T9DA 6Q21A 4WLNA 2NIPA 2OMEA 4NMHA 4RIEA 3T54A 2C9YA 5EAIA 1B42A 4QBGB 1RM5A 3C3WA 1AUXA 3OX1A 4RJLA 4NU8X 4RFSB 1ESMA 2WWHA 2XWQA 2BSXA 1X8XA 1SN7A 1O0CA 1UK8A 4MVJA 1JSCA 4TMZA 4F9EA 1KY5A 1CLEA 1HKHA 2ZRCA 2RIPA 3FNBA 1AKNA 2VJMA 3MJEA 2YQ5A 3B9QA 1S8OA 3EEBA 2QW0X 3PFCA 3S1SA 3I5XA 1GKUB 5BO5A 4C5CA 5ELXA 2GDJA 1P91A 3BPSA 3OU6A 2WJ3A 5CLHA 3HP4A 3TE6A 4NH0A 3UATA 4C6HA 3N8KA 1P4GA 4E32A 3RIHA 4H7PA 1T3LA 5K8UA 4EHJA 5G0UA 1MOZA 3AKYA 3E5NA 10MHA 2O8BA 4WBSA 1JR6A 2P7IA 4RLHA 4YJDA 2ZEJA 3GVIA 2ZIAA 4MWGA 3TVDA 4PSUA 1QG6A 2BKLA 4B3CA 3GMTA 3TQSA 3RS7A 4ILEA 1IXKA 1KZ4A 2Z43A 3VPHA 2XIQA 3EOBI 3PS9A 3IQEA 3GX1A 4FYVA 1GKYA 3GUHA 3FNFA 3U3DA 1CJCA 5SZJA 3OD5A 1D4AA 2C04A 1W0KA 2V7UA 1DHTA 1RLIA 4Q39A 4LV8B 3VAYA 1TT7A 1WXEA 2ZYWX 3NCTA 4Q3BA 1WPQA 5IG2A 3PGA1 5GONB 5LZ7A 4OU4A 2RC6A 4RA9A 2O2XA 3D54D 4AS2A 1UDXA 4YUZA 4L4ZA 1TE2A 4DJ5X 1AOXA 4W5QA 2AOTB 3VZPA 1UBEA 1S1CA 3FSGA 3IMCA 3A6ZA 4CMGA 2EIXA 2CB9A 2Y1KA 1CB7A 4DQKA 4V0ME 2FA9A 2J31A 4G0UA 2P40A 4JLJA 5HRAA 3ND8A 3VR5H 4CKZA 1IHYA 1YDWA 2AD1A 1NYQA 3CYFA 3E5MA 4LY3A 5CDYA 2EG9A 2I55A 1DKLA 1Z4QA 3CUYA 1CQZA 1S01A 1JEQB 1MG5A 2GCIA 3RFCA 3NQ41 3B7GA 1AVTA 4AJOA 1R5OA 5LOVA 3F4KA 3HUUA 2AMJA 5LJLA 4L1KA 3VDXA 4BO6A 2IPMA 3IP7A 4Y0NA 1YSCA 3PC8A 1W36C 1GVNB 1TF5A 2AFHB 5DH9A 2PUAA 3RUIA 1VE5A 3JPYA 1I1OA 5CVTA 5KPJA 1OI4A 1Q1GA 1U2DA 3M6VA 2HSJA 2JZOA 1RVDA 1VJCA 1NJ1A 3M8KA 4BO1A 2JAPA 1Z26A 3BSFA 3HV0A 5LZ4A 4OJNA 5FDFA 4ZAWA 1YBFA 1GLNA 1HA3A 2XRFA 3MWKA 4EI9A 1SHLA 4MW1A 2PSDA 5LP6B 1F7VA 3VISA 4N49A 2H63A 3EXEB 3M33A 4TRJA 3U09A 7MDHA 1EGVB 3VR4H 2VBIA 4Q02A 3GEHA 5KYYA 2DR2A 4D45A 3L40A 1DLJA 1QUEA 1P6QA 4NYMQ 3RQSA 3LC2O 1PJZA 3LIIA 3S28A 3H8JA 5DTEA 2NZUG 3N2EA 2Q8PA 1YDEA 3FWPA 3NCHA 4ZO4A 1K9VF 4GPEA 4Q6WA 1L9KA 1RR6A 3SC2A 3CF0A 2Y9MB 2A86A 2A52A 4FMPA 2OHXA 4YCNA 4MYUA 2J6BA 3BK7A 2WHPB 1RYNA 2OBNA 1DTWA 2VP9A 3TFWA 2QSYA 3ETLA 2AZMA 3K0FB 1VLZA 1YBHA 3SIWA 4PFQA 4AZWA 5C8VA 1QGZA 2ZDGA 1TTQB 5ARDA 1XQ9A 5HQJA 2QXTA 3BMOB 4YGYA 5A5FA 4UHCA 1T34A 2C2MA 1DO0A 1RCTE 2GEUA 2AFIA 1HGXA 3NHYA 4LI0A 3D2AA 3I2JA 4JWTA 2R0QC 3Q88A 4Z4QA 1RC8A 1YMQA 2FVYA 2W58A 1TAGA 3LZCA 4YV7A 4B6SA 4S1WA 2NMVA 1CY7A 1JLRA 1KSFX 1HT2E 2P65A 5ALSA 5FJIA 1P0CA 3RAPR 1JQAA 4DXAA 2ZWIA 4B3FX 1A5SB 1E4VA 1G6HA 1KMHB 3FUTA 3PXXA 1P1RA 5H83A 3AERB 1TO1E 3O9VA 4K9DA 4ZTZB 1EFHA 2F3SA 1XRLA 1RHMA 5EJAA 4V2UA 1T4MA 3SZ3A 4LDPA 3RS9A 3GUVA 2NTNA 2VK4A 2ZE7A 1BU5A 4BTLA 1ML3A 3HKEA 4LOLA 1U5BB 1FTSA 2CLKB 4IDQA 1E2LA 4URWR 5CBKA 3A9UA 3F8TA 4O4IF 2GZMA 3A14A 3RRXA 5EG5A 4L16A 1DKUA 1CRQA 1ML4A 3PXEA 4FFOA 4AF6A 5H8WA 3PTLA 4V03A 5F4BA 2BJWA 5B4TA 3ENNA 3PHCA 1P8JA 4A82A 2GN0A 5AUNB 4TYMA 1O7JA 1R12A 2OGSA 2YZ7A 4ZT2A 3QWBA 4OH1A 2IVFA 2CZQA 2NZJA 2QOEA 2NU8B 3S6JA 1J42A 2B8WA 3TVTA 4TMWA 1I36A 4O4JB 2Y71A 2R8XA 3RYHB 1A2BA 2FZEA 1A8SA 3P5SA 1DBWA 1F8GA 3M5CA 4JUFA 4L9SA 4MYSA 3GCGA 1AKVA 1EJ6A 1PBNA 2CXXA 4NE9A 4OQQA 3RRFA 3PRJA 3NC0C 3EK2A 3CWCA 4L72A 1UKVY 1OV4A 3U40A 3ZXIA 3A36A 4XW2A 3BILA 3QNUA 2ID7A 4WHMA 5C35A 2QRMA 1US8B 3OLQA 3ZK7A 2P5SA 3LO8A 1Z8HA 4YGXB 3W79A 1RP7A 1HF3A 5TV2A 1KVUA 5JTTA 1K75A 2PO5A 3JCZA 4OOFA 5TX7A 3TUZC 4U2DA 3W04A 3CSUA 3ASZA 2UUPA 2BBWA 2AFRA 2OM2A 3LZ6A 4RS4A 5KOJA 2IELA 2HK9A 3ZVKA 1G5FA 2CXTA 4UDOA 2Q5IA 3TZLA 3H86A 2A9QA 3H19A 3WK9A 4CLHA 1I51A 4OU5A 3A6FA 3Q1LA 3GEGA 3I32A 2J7PA 2P6PA 5L45A 4CV2A 1EDBA 5AVTA 2W83A 4TTSA 1KIMA 3MMNA 4O2BA 2LCQA 1YNOA 3SXUB 4DYDA 4CFSA 1O95C 2QK4A 1JZSA 1QHHA 3WB2A 4DSTA 3RR2A 3HY4A 4DEYA 3LP8A 4XQ0A 1TMOA 1Q0SA 1R4AA 5T41A 2VUHB 3U4AA 3LBIA 4LFCB 3ZWBA 3SBOA 4EO7A 3VBEA 1NYRA 2P9YA 4BMNA 5I4BA 2XVYA 4EB3A 4XYEA 3IJEB 2I7CA 2VPZA 2Q0XA 4HGYA 2A59A 3JZDA 5TF4A 3BWDD 4NZMA 9LDBA 1C9DB 3A6GA 4GEGA 5DPMA 1WG8A 2KMLA 1FVOA 4RMIA 1NJ8A 5BW4A 1G6Q1 1GARA 1G21E 1JX6A 1P0PA 1FE8A 1KU0A 1VIAA 2EHDA 2DQZA 1J0CA 2V7EA 2Q3HA 3BFKA 2YWBA 3BIOA 1ZUNB 3DV2A 4H08A 3UC9A 2F48A 4TLCA 3MUEA 3UV3A 1M76A 4JC4A 2LVBA 3NG1A 3LF2A 1O94C 1MX1A 5DBIA 2CXHA 1S8NA 5LDDC 1GZ6A 3LSYA 3RWBA 2X7JA 2BEVA 3FW1A 1FUKA 4P08A 1RLJA 4RTLA 4LGVA 2BT4A 3ESBA 4A8TA 1MAUA 1CP2A 2IHUA 2NW6A 1MVOA 2ZVDA 4U00A 4IV8A 1C4WA 1SQFA 3OE7D 1J4AA 3RS0A 2BI7A 3CLSC 3KHUA 4P3YA 4L6AA 3IC5A 5JO9A 2I6FA 1Q83A 5ALKA 4O63O 5DM2A 1IPFA 2IV2X 1OX5A 3CVXA 4FHGA 3WBBA 2WF5A 5JWHA 2YS7A 2FSPA 4D9BA 1Y8RB 1W94A 4DLPA 4XSHA 2PL3A 1ZGJA 1RYBA 2R8OA 3B6KA 3CB2A 3ND5A 2TMYA 3L46A 4BMYA 2OCYC 3T41A 2NO4A 4ZVVA 3RIGA 3ROKA 1L3IA 1Q0QA 3GW8A 3MT9A 3S27A 5DM60 4Z1MD 1ZH4A 1GN8A 1DKOA 2GN4A 2VJLA 3NZEA 2ENWA 4BNDA 1F6BA 2WJIA 1XZAA 4ZQBA 5J1TB 3IMFA 3LDGA 5FTKA 4HDCA 4IBOA 2MCFA 2H31A 3TZCA 5KNCH 3HJUA 3D6AA 4FWIB 1TVMA 5AK0A 2H1LA 4P92A 5LVAA 2HJHA 3EZ7A 3RFVA 2YMQA 4B71A 1KWGA 3DSRA 5BN3B 2OGUA 4DCCA 3HZZA 3OZEA 4B3GA 3FTNA 5DIFA 5SY4A 2LIPA 1GPDG 3OOHA 2IKSA 1AHHA 1WEHA 4HMQA 2DEUA 3LK7A 2INGX 3VDMA 5E9WA 1B16A 2Q29A 1VMKA 3DE4X 5J23A 3BHNA 1VB3A 1EUYA 3W5SA 1QPZA 1N75A 3I1JA 1N2CA 1DEKA 3R7LA 1P5ZB 1Y1KE 2JFNA 5EESA 2UU9B 1J0XO 1NW5A 1K7YA 4I1IA 3FA2A 1E2IA 4OSOA 1AGPA 3D4NA 5ITZA 1TU4A 2P35A 2RCNA 1XBTA 2EZ8A 2ZI9A 2VDWA 3ENZA 3ITEA 4NS4A 2FKNA 2VOEA 3AB7A 2REOA 3P8ZA 4KFSA 3GYGA 4FZJA 4NSNA 5ANRB 2YFHA 3PUKA 5IWAB 4ND4A 1Q22A 2KLHA 3VX3A 5KKCA 2CMDA 4R2MA 3C16C 1NIJA 4EEKA 3TTUA 1YACA 3N76A 1A0OA 4CT5A 1N25A 5D1HA 1T5SA 2V7GA 2OQIA 1CYDA 2OR3A 4RORA 5EPEA 3ZV6A 3OZVA 3PYLA 4FIDA 4IRXA 2XOXA 1NVVQ 1WCWA 1UMKA 4EGCB 2WYUA 1IN4A 1JAIA 2B69A 5CHYA 1MMFB 4AP5A 4TT3A 5FI0B 4QG3A 4DV0B 1Y8QA 4MV9A 3Q7RA 3ABQB 4MQFA 4NJMA 2QX8A 2Q9BA 3RC7A 1KNQA 3WNCA 1N5DA 3A28A 4TV9F 2GEBA 1WUHS 2JGKA 4XOUA 3OUTA 5T5QA 1HBJA 2BFFA 1GR1A 4QASA 4QULA 2RGGA 3MCWA 2JAHA 3BREA 3Q87B 1ATIA 3GEIA 3LYLA 2AXNA 2XE7A 2NSLA 4PYIA 5IUKC 5FL3A 3OBBA 3FNIA 1QH8A 4KBGA 4P3PA 2GRAA 3SHTA 3D8NA 4WECA 3L9XA 2XEDA 1ESDA 2H6EA 4UNSA 2JCVA 3AK4A 4WL0A 1S3GA 3TSOA 3NWEA 3D6TB 4UHBA 4KBFA 1GPBA 2BM0A 5ESDA 4UEKA 5HF6A 4WAUA 4TYWA 1EWQA 3GIDA 2D2FA 2UYYA 5IC5A 2GBIA 1LFAA 5CLGA 3K8ZA 4X3OA 4ZRDA 3KUDA 5I7OA 3P9IA 4PZZA 4II2A 3F8WA 2ID9A 3ZJTA 3N7TA 1XCOA 1GQOA 2E5WA 4IJQA 3RYIB 4AKSA 2BKVA 3NHMA 2YJ6A 3TJRA 2O8DB 2G80A 1NLUA 3HG7A 1CWUA 3V4SA 2XNDA 4V3CA 3C3MA 2ZUVA 1V16A 1W35A 221PA 2A1TS 2B98A 3RSHA 5CFPA 4M0CA 4P0TA 1JLSA 2RAPA 3B9RA 4PLYA 1AO3A 1J22A 2FV8A 4QXPA 2HU2A 4UBKA 4YXWA 5IJ9B 5ICEA 2Y0DA 3IX7A 3OECA 3OLVA 4NS1A 1N92A 2AW5A 3EWAA 2I71A 4UNRA 5ALXA 4BATA 3S8YA 5G41A 5E6SB 2HBZA 2X9QA 4PONA 1DKPA 5EQDA 1DG1G 4A5OA 5BVGB 4PGMA 4XIIA 2WHEA 4O1IA 2GAIA 3L8ZA 2A5JA 1VL2A 2NV0A 1IBMB 3H7AA 1X19A 1WPRA 3VKWA 3I28A 2NN3C 4YJKA 4HKTA 2GK7A 1FW8A 1XP5A 2F17A 2Q62A 2J87A 3W5BA 1FX0A 3EVCA 1VHLA 5EP1A 3JQPA 4BVEA 4BKQA 1LDEA 3ZWNA 5ABPA 1GG2A 2QPOA 2V4ZA 1EFPB 2OUKA 1R8JA 2FSHA 2OQRA 4I81A 5G0SA 2PUFA 4JUIA 1VECA 1QYDA 3PUZA 5L7TA 3UGTA 1CUBA 1XC7A 5CDFE 1WUTA 3DDUA 4XXHA 4AQDA 1J7KA 1MNQA 1MR3F 3KK0A 5DK6A 1G8GA 2LIVA 3RROA 5JS2A 4IUYA 2RGRA 3P32A 3K6SB 4QDOA 2WIDA 4XCXA 3WK8A 2HBYA 4PSKA 4GKBA 4BLPA 4M83A 1R5JA 1HLGA 3KZNA 4HTAA 1J09A 2A5LA 2ZYVX 5ALZA 1QK4A 2QGFA 5TEWA 4BRSA 5BPFA 4KXVA 3MFQA 3UYKA 3U26A 3H18A 1PD1A 4L3OA 3Q7QA 2VP0A 1XCPA 2GCOA 3MCAA 1HORA 1L7EA 4UREA 1O95A 4BJHB 3RVNA 2AXQA 2VZ0A 3KSDO 1M2HA 1X86B 2IXAA 2PGXA 3JALB 3Q1KA 3UT6A 1QE0A 2WTAA 2XITA 4KDFA 4GLBA 4I2VA 4PQGA 4UOEA 3D2BA 4FYMA 5KTNA 4LOJA 1JE0A 3BL5A 5AK5A 4MQBA 2Y1OA 4N65A 5B1EA 1MIHA 2H1RA 1X77A 3RBXA 3LT1A 2IYNA 1SCUA 3G5LA 3U4IA 2HM7A 3WYEA 3Q40A 1CU1A 4LF5B 5I45A 2REXB 3EYAA 5M2QA 3MBKA 2ZS9A 5GONF 1VFPA 4G1CA 3RT9A 3DLHA 2VP4A 1HX7A 4ALNA 4MV0A 4MAMA 3E27A 5MFPA 4BHRA 3T4XA 4EMTA 1VL1A 3ETDA 5C46F 2HK8A 2WJJA 5J59A 2AN9A 3DUFA 2X1LA 3JXEA 1E3EA 4Y2VA 1O94A 4JP8A 2PKRA 3LGSA 4JR1A 3DE3X 1GKKA 2JGFA 4G5XA 4HP8A 3RVSA 4IKEA 4KWHA 2D2XA 2FW7A 2R4TA 3IEKA 4HAZA 2PX6A 4HVLA 2WJWA 3R3SA 1SUPA 2FVXA 4TTAA 1M6VB 3FZYA 2BP7B 1ONOA 3V7FA 4F11A 1CV2A 2VJPA 4CGYA 4HDSB 3BXZA 3X1WA 2G67A 3WMFA 1YDMA 4Q3KA 1B0PA 4CODB 1O87A 2JGDB 3K9WA 1G98A 2FNAA 5FPSA 2IECA 3B3FA 4BGIA 3NEJA 5JZBA 3O8BA 5LQKA 3K73O 3PR1A 2FZLA 1MGPA 1HM5A 5GJBA 3W5UA 4HN9A 2D8AA 5IBRA 1QGDA 5GV7A 1YRAA 4QWWA 1OLOA 1ADGA 2P1RA 3GCZA 4XSVA 3CWQA 4TSFD 2VXOA 1XQ1A 4LXIA 5AI5A 3THRA 5K3FA 4CM8B 5B3KA 3GFVA 2FE1A 4LJ8A 2G72A 1G21B 1GGHA 2J3KA 1OC4A 2ZJYA 3A3KA 3ELUA 3LYUA 3TX2A 5HYVA 5KSWB 5LP6F 2CLFB 3WDKA 2JBAB 4BCBA 3FTCA 5KVSA 1Q84A 3IUMA 2MSNA 3RBZA 4OGKA 4JQSA 1N3BA 2TMDA 4PANA 2ZQYA 3FHCB 4MLDA 5KTMA 4H7KA 4K9QA 1YCHA 4M0FA 2QN6A 3W90A 4F60A 4D57A 2XNSA 4FQ5A 1T3GA 4RH3A 4V02A 3LLSA 5TGZA 1B3BA 4JBNA 2R6JA 4ENVA 2VRBA 1DDOA 2X6TA 5K99A 1T2CA 2XF8A 2ECQA 3FUXA 5AW0A 5T4FA 5AJXA 2BR4A 2X14A 4M55A 1AM4D 4CV1A 1WOYA 3ESYA 2Q2NA 3VR2A 1Z7WA 3A0RB 4R41A 4WZAE 4Y2YA 2QYTA 4H35A 3FWZA 2RGAA 2IXGA 2UYHA 2R8PA 5EERA 4Q4JB 2GFIA 3E4DA 1NYTA 1ZQ9A 2JJ2D 3WADA 2NSDA 2KSQA 3MWGA 2DG2A 3UAGA 4XKJA 3AUSA 3MT8A 2IITA 2B37A 2FEWB 2I7TA 1QZUA 3P9NA 5TDHA 1X9IA 4I5GA 2Y05A 4RMHA 4PZYA 3BL8A 5BSRA 1NXTA 4Q18A 3PGLA 5AJYA 2R87A 2FPWA 3BOSA 3ZXSA 5LD2C 2C57A 2R1VA 1Y3IA 1EPUA 1JQEA 1CUXA 2ZIXA 4L85A 5I6DA 4MR8B 2XCTB 3HWWA 2O4UX 5K20A 1BHQ1 2P4HX 3LQ4A 1XEAA 1H23A 4LGCA 3FI9A 3DT8A 3F73A 4MVCA 4RHUA 2I65A 5K6TA 1L4NA 4DAOA 8GPBA 3VA7A 1UJCA 3B8HA 3LCVB 1TYBE 2MINA 4R69A 4B40A 4BNYA 1BDIA 4S1PA 2D1TA 4U7FA 1W8IA 4HVTA 1NMQA 2Q3FA 4RK0A 3DHVA 2JGAA 4NK5A 3BULA 2I2CA 4MUFA 4NE2A 3DL2A 4NCBA 1YULA 3QUAA 2CL0X 1PQWA 1D2CA 4JYPA 3AI7A 1R5NA 2O5RA 3BMNA 3B89A 4CM4B 3H1BA 4K7JA 2AUTA 3RU2A 2ZM6B 1E1KA 1XYGA 3MRTA 2PVPA 1MXHA 3U6KA 3MELA 3GO4A 1VSBA 3FY4A 2QPAA 4DPKA 2ESRA 1ZD2P 4AX8A 3PPIA 2IC5A 4BZWA 4OKNA 3AHJA 2HSWA 3PDUA 3DPSA 4ZO8A 4XRRA 3EW9A 4ODIA 1CEEA 1JPNA 1I13A 3DKKA 4X41A 1Z75A 1WXHA 1Y9JA 1WBBA 1LB1B 1DC7A 2MHCA 3KYIB 4XFKA 5L4LA 2PS0A 4AS3A 3CRNA 4FMBB 4B31A 3R7DA 3EUAA 2DM6A 1AGYA 4I5FA 4YXFA 1QF6A 3BYZA 4HZGA 4BX8A 3UMSA 1SUCA 4KOAA 2ZRPA 3OJXA 4FS8A 2JHCA 3RSQA 2NG1A 2C5BA 2IHZA 5HE9A 3GELA 3GPDG 3CLTC 3ZNQA 3UFBA 2V45A 4BIIA 2G4LA 3BFPA 4DIUA 3IIMA 3SLGA 1A4IA 3WWOA 2YWDA 3CIFA 1VZ2A 2IE8A 4LHEA 4PIVA 1CS0B 5CA0B 1OH6A 4AY2A 2JAQA 2ZRLA 2XMCA 2A9VA 1U81A 3JZIA 4RVGA 5KNDD 3WDSA 1E9CA 5CXSA 1OR8A 2X2PA 3CZRA 2OD2A 3OLXA 3NC1C 4LMRA 3CCCA 4E7OA 4IFTA 2BGJA 3O8QA 5K9ZA 4B8WA 3OKFA 4ALKA 5DNAA 1MX3A 1O97D 3PFNA 2QVGA 3CCBA 4FHZA 4M87A 3NYRA 3E6AA 1BMFA 2FN7A 3E9RA 4G01B 3ECCA 3QFRA 3NDBB 2EX0A 3BE8A 3F9IA 1U8AA 5HKKA 1CRPA 1UJ2A 5D3MA 3GAAA 7YASA 4WN9B 3N8HA 1EGQA 3CCFA 4Q9JA 2C2XA 2ZRAA 3ZE1B 5AQEA 4JXKA 2XDYA 2IQ5A 2PY6A 1BD4A 1G4UR 1UEJA 2QTRA 4KDRA 4Q9NA 2IWRA 1AN9A 2GPBA 3CSSA 1C4KA 2YWFA 1SVLA 3GLIB 3ZVRA 1DKRA 5JD4A 3I2KA 1WAMA 4O4HB 3HA5A 1ORRA 1YDHA 3OMWA 3IAFA 5DTRA 1PZNA 3THOA 4OI0A 1CQXA 1YWGO 1SFRA 3ESZA 4X61A 4E1BA 3KT8A 5AK4A 3H3XA 2GK4A 5D5PA 4URVR 3L6CA 2V7TA 1USKA 4TLAA 2CXSA 1O9BA 5AW3A 1EP9A 1SEPA 1IB6A 4HPXB 3VYVA 4DJEC 3IMKA 4OEHA 5DOZA 4YDHB 2JH9A 3GI1A 2W22A 4R84A 3PXGA 2K87A 4GFDA 2ZTHA 4O3FA 4RMNA 1MRSA 3KL4A 1NBMD 1ODIA 4GF5A 2OXRA 4NPHA 2OBBA 3Q8XB 5F3WB 5HF8A 3QMMA 2D3TA 1DC6A 2VTBA 2YW2A 1I7NA 4FYKA 2QTMA 4ZOCA 3V4FA 3LFTA 5F5XA 4EG1A 3FTFA 2C4KA 2GILA 3A4NA 3EG9A 2WZQA 3N2IA 3U81A 2YHSA 5D86A 3FZNA 4EA7A 4D3DA 4L7VA 3ZHTA 3PQ5A 3L0SA 2Q6TA 5AJHA 2GUWA 1Z6YA 5KHOC 4LWOA 4JVNA 3N2NA 5P21A 4KR0A 3HUTA 1C3JA 2QLNA 3G5UA 1HSOA 2BUCA 2R7NA 3R6TA 4K05A 1I4DD 3RS2A 3WK6A 5DM0A 3E03A 3HSKA 1EZ1A 1YQGA 3KRTA 3R44A 4S1NA 1BD3A 5EJFA 1ZK2A 3TUIC 4C7OA 1ZS9A 1YR7A 2B1GA 1NQOA 2I66A 2AYYA 3KYBA 4FTWA 2OFWA 2GJKA 3V1YA 1TJ4A 2OCKA 3O95A 4S3MA 1YUNA 4HTFB 5F64A 4J4HA 2Q6IA 3ZQJA 5TJHA 2JGIA 4PYLA 1U4NA 4YR9A 3C3BA 3ZHUA 3ANSA 2K5UA 5HK9A 1K5HA 3DEYX 3HUEA 1L7QA 1JIXA 1LZKA 4R5MA 3U5TA 3K31A 4CEJB 1KZHA 1N77A 1M3SA 5DX0A 3I8XA 4PTLA 1M7HA 2OO5C 5FJJA 3TNLA 2WTXA 3VVLA 4DLWA 2AEEA 1C14A 3H1FA 4P34A 3O2QB 4FU0A 5CCBA 2AN4A 5BSFA 3WLSA 1JNYA 3UMRA 4ZYYA 1G1MA 2FN8A 5KYXB 1SOVA 2AI1A 2ZRNA 3HFSA 3QUTA 3R2JA 4UMFA 4YJ3A 4AUKA 5KQLA 1R88A 1I0IA 3ACCA 3K9HA 1X7YB 3PCXA 4EMUA 1K8XB 3GB9A 1QV6A 4GPIB 4OGLA 4UAVA 2OUIA 3U37A 2MYTA 3ASYA 1JAYA 3CC8A 5E6SA 2BGMA 3ZHSA 5AVZA 4AX4A 5CR9A 3GGCA 1I2CA 2CFTA 3RVOA 1DAOA 2CMKA 2Y68A 2DY0A 4ARUA 2CUZA 1ORWA 3CFYA 5AOCA 3ZHCA 2I67A 3KX2A 2XT0A 1WLSA 2ORED 2HDHA 3F4BA 1W0JD 3HCOA 2DERA 3NHPA 4FM9A 1HMYA 1G3QA 1AB5A 3PI6A 1VPDA 2R1UA 3FRIA 3ZWDA 1EX1A 2AN3A 3PRKE 1KFBB 2W2LA 5CM9C 4DDTA 1JR3A 3K1YA 4BLVA 4JQZA 4EJSB 1FFXA 1IAQA 3W2FA 2HCTA 2QTNA 4GUAA 1B8PA 2VSXA 5CPBA 3OOWA 4B4KA 2ZUFA 1JFTA 2E21A 2ID8A 3QV2A 5FA8A 4N3GA 1U11A 3E2IA 1Z68A 2RJNA 3EMBA 4FFRA 4QDTA 5FL7D 2C9BA 3D6UA 2Y27A 2E4AA 1SQ5A 2MYPA 3ZLUA 1RWKA 3O93A 2OFXA 2XHZA 5LKAA 3BCRA 3EVEA 4AWBA 1KQGA 3FM9A 4Q3LA 1D2AA 1LRLA 5LC1A 4EJFA 3ORRA 3X2FA 1O5IA 1E6EA 5EWMB 4R1SA 2I6QA 4ECAA 4LYEA 4PIPA 1QFJA 3TCNA 2HRDA 2H1SA 1R8YA 2VJCA 4X64B 2B8JA 1FZTA 1FRFS 2HQ1A 4RH1A 1QUFA 3T1TA 2FPPB 3RUCA 3FHTA 1B23P 2QZZA 5IPFA 2ECOA 3LA6A 1HDRA 2AK3A 4LYJA 3C7KA 5A9TA 5EKXA 4ZEXA 2L0XA 1G8AA 4WZAB 3I4LA 3ISVA 3AJEA 4L8FA 2ODWA 4MUMA 4BZQA 2XNKA 1TU0A 2C42A 3NHZA 2JLWA 3LT4A 3PX7A 1I2MA 2BGIA 4GE3A 3K35A 3SE0A 2Z5FA 1IMOA 3QE4A 4HMOA 2R97A 4AO8A 1VJDA 1K97A 1D1QA 2BMVA 2FMFA 2P8JA 2P4QA 2XX3A 3EGOA 4QQRA 2VHVA 5ENVA 5YASA 4ZMSA 1F8XA 4G8BA 4ZGWA 3L0OA 2I1LA 4D9NA 3A6HA 3KZMA 3BZBA 2QUKA 4I4LA 4LJ4A 3KKMA 2BH9A 4CFYA 4FNOA 4H1TA 5T64A 4MO2A 4D9MA 4KOEC 1Z3CA 3RJZA 3N74A 2GETA 1Z4MA 1FSSA 1W4RA 4U2KA 1R66A 4AG3A 1Q7CA 4X93A 5TQ0A 2IH5A 1NF9A 2IOFK 3THYB 4CF6A 4PC7A 4I50B 4GYKA 2CB0A 4J03A 4PHCA 1G4AE 3GNSA 4UASA 3SS7X 3D3EA 4EA8A 3SJAA 4EJ2A 4IIVA 4NMMA 2NUTA 1ZEMA 4X20A 1I0LA 3GGDA 4HNVA 5JAHA 4ESVA 4M2LA 4D9GA 2ZATA 1RKQA 5CAEA 5FNVB 3AVQA 2ZRIA 4RFLA 3T7AA 4BZPA 3ZDAA 1AB6A 2H1HA 3LECA 1CLUA 3RO7A 4Y9SA 4YAUA 1Q0ZA 2HHAA 2J41A 3HU5A 3UWMA 3CEMA 3IELA 4OQZA 4B8YA 4RTMA 1N57A 1MO5A 2VQDA 3BKWA 3DE5X 4RVCA 1KAHA 2FN9A 4KJZA 1Z17A 5K3DA 4MJ3A 3WNQA 4AFNA 3KQPA 2YJGA 1XD2B 1EFVA 2QUZA 3HJNA 1RVV1 4GXQA 2VYNA 1HYHA 1NVGA 4WKGA 3OZDA 4BJ5A 5CXUA 3EVDA 3ZTWA 3ZDRA 4YACA 2IFTA 3K92A 5EKSA 4TXMA 1ZH6A 1GPAA 1JLMA 6CHYA 1CQIA 1Y5RA 4H1WA 3CH6A 3Q3JB 5ALGA 3OOSA 4RL6A 4AF8A 3KOMA 2PZ8A 3B9PA 2C3UA 4L9RA 1NVKA 4WK0B 2YVLA 1DNPA 3STUA 5IJZA 3M5DA 5KHLB 4Z4CA 1ZJJA 2IIVA 1QHFA 2CC2A 1XWIA 2PGIA 3IEIA 1X9GA 1I9CA 3GBVA 4FGKA 1SKQA 3GLUA 4DMGA 1DUSA 4NAHA 5FP0A 3TLGA 3TFOA 5E9QA 4LC0A 4DCJA 3S0JA 3DM9B 1E6CA 2JFYA 3MCTA 1H2HA 4N5DA 1IBSA 1YGYA 1W34A 3NTRA 4N5HX 4PZEA 4KNYA 3EFEA 4FD3A 1TCVA 1YVDA 5HFAA 4P54A 3HE3A 3M6XA 2FRVA 2HUNA 3OX3A 1G20A 1QR2A 1TCUA 3UBMA 1CZUA 4QXQA 3PXUA 3WK7A 1B43A 2X6RA 1HTWA 1S4MA 3I6ZA 3Q15C 4TKLA 3VDNB 1D2MA 5FORA 1UPUA 3EFHA 1E4YA 1X7GA 2PANA 4IINA 1POWA 1E9SA 3MZ0A 1K4MA 5TT0A 3SFZA 5IN4A 2ONYA 1DDGA 5IDVA 2KBFA 3C43A 3FTDA 4C4RA 2UZAA 1BW9B 7REQB 3HU1A 4EY7A 4K88A 2EF1A 3RSZA 4MITA 3D8TA 4RIHA 3RUAA 3U1VA 1GNLA 4W63A 4UMDA 3EMOA 2ZBGA 3FUVA 3RHZA 2FSGA 2AA3A 5K4AA 3P94A 3MBOA 3A25A 4YDQA 4A0GA 4L78A 5DHAA 3X3HA 5DBFA 2OCGA 5LIRA 1QRTA 1E63A 1Z2NX 2YWGA 4D4KA 3EGWA 1QLWA 3H9GA 1UZLA 2JJ1D 2EWMA 5C1BA 1R0RE 1SD1A 2M1XA 4ADSG 5I9LA 2NQ8A 3C6BA 2K6GA 1Z88A 1WETA 1ZBQA 1VM6A 3H4IA 3RRMA 2ZAMA 4CMIB 1DJOA 3PGVA 2P9TA 4W99A 4YALA 2O3JA 5U4QA 5G0VA 2JI4A 1KSJA 2JVJA 2OO5A 5IU6A 1DLIA 3PPYA 4WXMA 4ZVQA 2V5AA 1T1EA 2XE6A 3BICA 1F1JA 4YO7A 3TRFA 4CMJA 3T12A 1CYEA 2WU4A 3B60A 3W9SA 4QM6A 1FUIA 2ZT8A 2MT9A 2Q2OA 3HKBA 3OPVA 5IAGA 1KYZA 3O7WA 2OV8A 1NHWA 1KH2A 3HBMA 4JT2A 4NOMA 4DBLE 3NWOA 3PLAE 5AW1A 3NGMA 1Y0BA 3BD6A 2H7XA 2QD5A 4P81A 3GLHE 4Q7MB 3ZCTA 2WU0A 4QU0A 3FWHA 3T5DA 1AS0A 1UJ5A 1YRYE 2ZSHA 4RSHA 1Z7YA 3ULKA 2Q3JA 3I2GA 2BTEA 3Q7IA 1RTKA 4I8XA 3CG4A 3DL0A 1GIAA 3OC0A 4MI9A 1M7BA 2C3PA 3P0EA 1YCFA 2YH2A 1E2HA 3GRUA 5ICCA 3OT5A 6REQA 4GPBA 3LC1O 4WLFA 2EJUA 4OHKA 4ZHSA 4I1VA 5CXQA 2Q5QA 2V0NA 3R41A 3M49A 2A33A 4HZUA 4K3VA 1P81A 3HBNA 1CUDA 2X8WA 1G5RA 3GXBA 3I4FA 4P4SA 4DBZA 2ZCVA 1W4AA 2ZAOA 3R7BA 2GZ2A 5B4UA 2RGDA 3T38A 2SCUA 1P17A 4LHXA 4ISCA 4JVSB 4QECA 2NWQA 1XFAA 3KOXA 3VR3A 4Q4AA 5FLKA 4W1QA 3GPBA 2GM4A 1PO7A 1UJBA 3GAZA 1PEKE 1M8FA 3N39C 3OPYB 1FF9A 1CEXA 1QRDA 1EJ2A 1JQ3A 1TYEB 1OXXK 1ZL2A 3CGWA 4Q82A 3WRXC 2IYYA 1XOIA 721PA 3KQOA 2I8LA 3CMMA 2XZDA 1Z6QA 2D5IA 2QMZA 4ZDIA 3QF4A 1S8FA 1TKBA 2NUAA 2QVXX 4I8IA 2D5CA 4O8ZA 4EYGA 4J4TA 4LN1A 1CZRA 4QFBA 1YFJA 3AEKB 3MTEA 5B7GA 4M86A 1EWKA 1GVHA 3OOJA 4YUAA 1DOZA 4DIDA 3PC4A 3GN1A 3Q11A 1QYCA 1IRXA 4X90A 4N6GA 4J0CA 4O59O 2PMEA 3SZOA 1YMVA 2YBEA 3BJIC 1WR8A 1MZPA 3WGVA 4MIKA 1KC1A 1RCUA 2BIFA 2LR0A 3OX4A 3LKBA 3CVUA 1U7OA 2NUPA 4OQPA 5CA0F 4RXUA 2BFBA 4A7PA 1W4CA 2FPRA 1P1HA 1QONA 3E18A 1ZIDA 4FFLA 4KWCA 4TQUS 2GZ3A 1TA0A 1Y3CE 1BMQA 3P9PA 4FT2A 4PICA 3FUWA 2PAFA 2TS1A 4YVFA 5L4SA 4H3KB 3MAGA 5BOSA 4NYIQ 1HO3A 1V41E 4YCLA 5EWLB 2FJPA 5AM4A 3AGQA 3GRCA 5H02A 2Q9CA 2PUHA 2R8ZA 3L92A 4K26A 3VUFA 1SZDA 1MB4A 5CNKA 4QUIA 4QKQA 5EXCA 3DE2X 2FE4A 2PSFA 5I7VA 3UJAA 2FZGA 5DNWA 1E3WA 4P4NA 2O0JA 5FPYA 5C0OE 4RPIA 3G88A 1O08A 1W5BA 4MMZB 1I4TD 1JTEA 1TQHA 3MIIA 3FCEA 4JHXA 4ZKEA 4P53A 3ROGA 2ODQA 4ZU6X 4FCCA 4FILA 2J09A 3ICQB 1ZD1A 2QRVB 3B6JA 1IBRA 3FMOB 1VBFA 4RVDA 1D04A 4B33A 4EHIA 3I30X 2H57A 1RD4A 1QSGA 2VPWA 1COWD 3SKVA 2K7ZA 1NXXA 2O23A 5CHEA 4O4HF 4TMKA 2QLMA 4HNHA 1MGOA 1U2QA 2PKQO 4ZHQA 3RASA 1UK6A 2W2MA 1YA4A 1Z2EA 2BTQA 4FWBA 2QXUA 4QDKA 5BR7A 4H7HA 4K6OA 2C4TA 3EZYA 1F0NA 4POAA 3RS8A 3MUNA 4NF2A 4FWTA 1FA9A 3TZQA 5JFGA 2XRZA 1Y1TA 2XUZA 3G9ZA 3KJQA 1DU4A 5C4GB 3T7IA 1M8JA 5BN5B 5J4YA 3PJRA 4MARA 4BMDA 3D1VA 5CDHA 2F64A 1UBKS 3N3AC 4ENSA 3IQWA 2M6KA 1TVKA 5SYMA 4KNWA 4JI2B 5BWCA 3WOHA 2PT6A 2XY4A 1FRVA 5FO0A 1ZRHA 3NBMA 1SCIA 3Q3CA 4FNAA 3DC2A 4BO8A 1SHKA 1B26A 4D9EA 3SJZA 1U9ZA 3LW8A 3M4YA 1MOSA 1E3DA 1PV1A 3IBCA 1QKJA 4KCGA 4QJIA 2Q2WA 4CQMB 1T0BA 1KOLA 1U1GA 4PFJA 2WVJA 2NX2A 3E58A 2IXTA 1QFZA 1EDZA 3NUQA 2RBEA 3U4DA 4N8SA 2PYDA 5JVDA 5TY0A 4B0OA 1XMPA 2CKMA 3GFRA 1H6AA 1ZDMA 2DR0A 3P19A 2QRNA 3JD4A 1E3SA 3RIMA 5K5EA 3C5CA 4DUGD 4JKYA 4PN7A 3VSBA 1D2RA 1TAQA 2XUFA 3T7RA 2G7ZA 3H5LA 2OBFA 4D26A 3OEED 1PX2A 1LX7A 1I4WA 4UAJA 4RZQA 4YTEA 4I8DA 3AUKA 4MV6A 1QCZA 2JNWA 2R00C 3RCBA 4OQ4A 3SEAA 4FDLA 3TNFA 4ZO6A 3L1VA 4YIKA 1ZOSA 2VK2A 5B1SA 5JY6A 4WGFA 1YKGA 5KWJA 3U7RA 4P8RA 2HCJB 2IP4A 3EVGA 1IY8A 5IN5A 1S02A 2HBRA 2QRGA 2VTKA 1WW2A 3OI7A 3CPJB 1PSZA 1GJRA 2RJOA 4LTDA 3QITA 3ZCQA 1FUUA 1SOAA 2I7DA 2OM6A 4GI7A 1ZUIA 1P5HA 3D3QA 4K2AA 5CK5A 4J94A 1HK7A 3KT0A 1H4QA 4YECA 3VAZA 5JE8A 1SHZA 2XXAB 3DHEA 3IIEA 1YZYA 3FPAA 5DU2A 5BR4A 3QSYA 1MF7A 2VHCA 3LLCA 3P96A 1OZ0A 3U3MA 4P82A 4WFJA 3ZGOA 2G5GX 1U3DA 5INTA 5BXQC 2JK1A 5EWJB 5FA5A 1SXIA 1M1XB 3JQAB 4IICA 4L3WA 4X1OA 4NV3A 5C32A 2ZULA 3V3TA 4ZAXA 3HJAA 5THQA 3ZU6A 1ZKMA 1MOQA 3KB2A 2DFLA 3R4VA 1XRJA 3PV0A 2XMBA 3LYHA 5A4FS 4UZEA 4Q47A 2DBZA 3OQVA 2YC2C 5CU7A 3GT3A 1N36B 3ASUA 2XQFA