4DDKA

Pantothenate synthetase in complex with 1,3-benzodioxole-5-carboxylic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
289
structure length
289
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated biophysical approach to fragment screening and validation for fragment-based lead discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Pantothenate synthetase
total genus 97
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4ddkA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4ddkA01
5J59A 5TS2A 3FH0A 3RJZA 1KORA 2ZUEA 2J08A 2CV2A 1G8FA 4MW6A 3PNVA 1YIDA 1MBZA 1J20A 2E89A 2A4MA 5BNZA 3CA8A 1B6TA 1WXFA 3CLUD 1KAMA 3MMXA 4JZYA 4U63A 4CQNA 1LI7A 1O94D 3CLRC 2H2AA 2DPLA 1WJGA 1MB9A 1G8HA 1HYBA 4ZCSA 4JXZA 1G8GA 2CT8A 1O95D 3INNA 4CDMA 1VBKA 1U3CA 4NX2A 4JXXA 4XFDA 4DDHA 1R6TA 3IVCA 1EE1A 1JZSA 2DLCX 1J1ZA 1EFPB 1EFVB 4MW4A 5KHAA 1NP7A 2QUHA 1NSYA 2PZ8A 4EG8A 1QRUA 1GTRA 2E0IA 5EKDA 2YY5A 1KQNA 2VTBB 1T9GS 5TEWA 3MXTA 3Q4GA 1WKBA 3ZIUA 4ARIA 2YWBA 1N2IA 3IOEA 3RFFA 1N78A 1TYCA 3COVA 3HV0A 3CLSD 1I6LA 3TS1A 1IHOA 1LW7A 1OBCA 3COWA 4Q93A 2D54A 2Z09A 4MUKA 2X1LA 3QTTA 3ND7A 4MW2A 1OBHA 2IP1A 1N2HA 1M1ZA 4ZT7A 3RHSA 4MUIA 3PNYA 3DPIA 3HL4A 1FFYA 2WQ6A 5LFAA 1S4MA 3ISJA 1JGTA 1N2EA 1EJ2A 1PG2A 4MWCA 4S1OA 4EGAA 4AQ7A 3C8ZA 3H05A 3PNBA 4YP7A 3N05A 4G5FA 1KQPA 1WZ2A 1I6KA 4MW7A 3G5AA 1TYDE 4I6JA 2RE8A 1O6BA 3ND5A 1GN8A 4MWEA 2EJCA 4DJAA 3RK0A 2WQ7A 3E27A 3NV7A 3CVYA 2A84A 3IDFA 2YWCA 1MC1A 3ZJTA 3HGMA 3LOQA 4KR9A 2A1UA 3IMEA 2A1UB 4ZCTA 2A88A 1WXEA 1M8GA 4L2IB 1NUUA 4WSOA 1JIIA 4ZCQA 1N2OA 1QNFA 5DASA 5LM3A 3A2KA 3ZJVA 2C5SA 1GLNA 3A05A 4TS1A 1WXHA 1PG0A 4MW9A 3K32A 3KT6A 4YBRA 1SURA 4ZT6A 4ZT3A 1MRZA 3H9CA 3LCJA 1H3FA 3L92A 3ND6A 1N2GA 1A8HA 1CT9A 1O94C 3SZ3A 4ZT5A 3RK1A 4NZPA 2HMAA 2PXHA 2RD2A 5IHXA 5FO0A 4KPUA 2B7LA 2DERA 1QU3A 2H29A 4HJXA 4PBRA 1WXGA 2X1MA 3COZA 2VXOA 1UFVA 1EFVA 1K92A 1WQ4A 1KH3A 2PZAA 1O97D 4R0NA 4J75A 2E21A 1N75A 1U3DA 3UY4A 2D13A 4ND7A 1Q77A 4X0EA 3H9BA 4U8HA 3G6KA 1H3NA 1G59A 4CT0A 1WY5A 3SZGA 3SDBA 1ZH6A 3CLTD 4OUDA 2BTEA 2IELA 2CYAA 1NYLA 4EFKA 2WSIA 1H3EA 3TNJA 1O96A 1M8KA 1Q19A 1QRTA 1BS2A 2R5WA 3DO8A 3GUZA 3P52A 1J09A 1IH8A 3UK2A 3RBAA 1Y42X 5DEOA 2JANA 1O96B 4DE5A 1OWNA 3FWKA 1OWLA 4H3SA 1XNJA 1WOYA 1MOPA 1QU2A 4OUDB 2A1TS 3P0IA 3P0HA 3DLAA 1FYDA 1VBMA 4DDMA 4UZEA 3HMQA 2VTBA 4NAUA 4L2IA 1O0BA 1Q11A 2QUJA 2BYTA 2XRZA 1P7PA 2QTMA 1N2BA 1D2RA 2Z3VA 5TEVA 3CR8A 3X1KA 1V47A 4F4HA 1OWMA 5DK4A 3IODA 3H97A 4QBTA 4MUNA 1IQRA 3N2YA 5HUHA 5KWVA 5IJXA 1NZJA 1Q15A 4U7JA 3FI0A 5K0SA 2OQ2A 3AG5A 2G36A 1OWPA 3CLRD 1EUQA 3MLBA 1COZA 4WNYA 5KCMA 1KAQA 2CYCA 4AS1A 1GPMA 4MVWA 4MWBA 3ZJUA 2O5RA 4E1AA 4HJRA 4KPUB 3H99A 1TYAE 1T6YA 2QJFA 4YP6A 2NZ2A 1OWOA 1F7VA 1KH1A 3SP1A 3PRHA 4JFAA 1N3LA 4EG5A 1JMVA 4EG3A 2HGZA 1R6XA 3A04A 2V0CA 2J09A 2JAXA 4R2LA 4G6ZA 3AKZA 3MLAA 1K4KA 5HG0A 3F3MA 3FDXA 4DNXA 2PFSA 5JBNA 2IJGX 3BL5A 3FG9A 3CVWA 2I1LA 2GM3A 3CVUA 4QREA 4MUHA 1MAWA 3COYA 4Q16A 3QE4A 5FNZA 1TEZA 1TFUA 3GLVA 4YMIA 4QRDA 5DB4A 1PFYA 3IOCA 2QJOA 3ZUGA 5H16A 1KR2A 4MULA 1IQUA 3UOWA 3VU8A 4KR7A 3CVVA 3TQIA 2CSXA 3MUEA 3ELBA 2NSYA 1U0BB 4K0RA 3AIIA 2EL7A 1N1DA 1KKUA 4I6GA 3D6VA 3PXUA 3IMCA 1J70A 4MW5A 3JXEA 3X1MA 1EUYA 4ZCPA 1WXIA 3FOCA 3K9WA 1VL2A 4OJMX 1KH2A 1XNHA 1IFXA 1VLHA 2QTNA 4DLPA 1YULA 5K0TA 1YUMA 2OV4A 3ZXIA 4A91A 5F23A 1EXDA 2XRYA 1IQ0A 1KQOA 3Q10A 1X6VA 1O0CA 1GAXA 3FHJA 2AG6A 2D5BA 1I6MA 3OTWA 2GOYA 1TYBE 3IVXA 1JEEA 1QTQA 3LE8A 1JECA 5H7XA 1QJCA 1QQTA 1I2DA 2E18A 5TGTA 4I6EA 2PZBA 3UMVA 1IRXA 1ZUNA 1F4LA 1NUSA 1X8XA 1PFVA 3IVGA 4BWVA 3N9IA 2AKEA 1M8PA 1NURA 2JA2A 4EG1A 3CLTC 3I05A 4F3RA 1QRSA 3M5WA 4R2MA 3IH5A 2A1TR 1XJQA 4NATA 1O5TA 2QJTA 3P0JA 5J58A 4MVCA 1O97C 4P2BA 4MUGA 1EFPA 1MB2A 2Z08A 4MUEA 3DV2A 1RQGA 1NI5A 2WB2A 2HZ7A 4PY2A 3IUEA 3ILVA 3VRHA 1NUPA 1F7UA 3GMIA 1DNPA 4HPWA 1ULHA 1U7XA 2A86A 1T6XA 3OP1A 3FNRA 3SYTA 3VGJA 4MUJA 1YUNA 1YI8A 4RPIA 1XNGA 2J4DA 2AZXA 4PBSA 4ZCRA 4EG6A 1MAUA 1KP3A 3CVXA 4MW0A 4FZJA 3SEZA 2DR2A 3G59A 3KT3A 4UZFA 2TS1A 4ND6A 1WQ3A 3AG6A 4MW1A 1JHDA 1H1TA 3HZRA 1PFWA 1NUTA 2GKSA 2PG3A 4GRIA 5J5AA 4DDKA 4GU5A 1ZJWA 3IUBA 1R6UA 3ZXSA 3TZLA 3S3TA 4MVXA 3IMGA 3L93A 4G5YA 1ZH0A 1JIJA 2DETA 3HFJA 4ARCA 4KKVA 1K97A 2DUMA 1K4MA 1T9GR 3KFLA 5FO1A 1OD6A 1N2JA 3FY4A 2CV1A 4MWDA 2CUZA 3AFHA 4J76A 4PBTA 2CYBA 4MQ6A 1M8JA 3NBAA 1KP2A 4ZT4A 3A4IA 1TQ8A 2QUKA 2QUIA 1PFUA 3KT0A 1JILA 1F9AA 4MAFA 2CFOA 3UC5A 4MVYA 1IVSA 2DEUA 2J07A 2ZUFA 2A7XA 1M83A 4K03A 4JYZA 2PIDA 4NDAA 4XSVA 4MUFA 2DXIA 1JIKA 1T6ZA 4HK4A 3NBKA 2CV0A 5HUJA 1U7DA 3IOBA 1VBNA 3QTBA 1MJHA 4KR6A 1N77A 2X0KA 3FETA 5AHWA 3KT8A 3X1JA 3CLSC 2X3FA 2V0GA 4CDNA 1V8FA 1NUQA 3AL0C 3TQOA 3ZGZA 3D6UA 4EG4A 1LI5A 4EG7A 4RUKA 3CLUC 1JEDA 1GZUA 4XFJA 4ZT2A 3N8HA 3TZEA 1O95C 1YIAA 5LLTA 1J1UA 1GTSA 2ZP1A 2YXNA 2O8VA 4NAHA 3Q12A 4YP5A 1M8FA 1J21A 2J5BA 3U1VA 4MLPA 3SEQA 1ILEA 3FIUA 4EF6A 2QTRA 1JZQA
chains in the Genus database with same CATH superfamily
4CU5A 3K1AB 1KORA 2C07A 4UE3S 4X60A 2HIMA 4EFDA 2NTVA 3F1KA 5HDQA 4K9QA 3QVMA 4EHIA 1W48A 1VPDA 3L0DA 4CCAA 3G2QA 3QOXA 2C2ZA 1KAMA 3PDIB 1FP4A 2ZYAA 3MT8A 1BE8A 1XQXA 2QPAA 3CLRC 3LIIA 1SULA 3QX7A 2N46A 4UVHA 1JR3A 4EY7A 5JD4A 1E3MA 2BGJA 3MCZA 3RS7A 2ZJOA 4R81A 4MKZA 3C1UA 4FQ8A 4GX2A 3E03A 5SZJA 1WP9A 2B8TA 5JUWA 3KQLA 3UK0A 1K3FA 4W6ZA 4B3XA 1V0JA 1J23A 4DCCA 2BCJQ 1XDDA 3DGEC 3TIIA 3PV0A 1Z75A 4XB6B 4CQLA 3AJ9A 3EHDA 4M83A 1YJ5A 4LV8B 3RRJA 4Q7QA 1NSYA 4EG8A 2XZLA 4HDMA 1T5TA 1UMBA 2TSYB 4G1EB 1SC6A 4LNAA 1MEOA 2HT1A 2EGUA 4WNIA 1QGED 5DO9A 1IBKB 1RI4A 2WAAA 4AO8A 1PDWA 4AUNA 5LU8A 1IWBB 1W36D 1PJSA 1SOWA 4G23A 1Q0QA 1RABA 3MXTA 1U1EA 3TRIA 3BMQB 2FHPA 4CM9D 5J2UA 2PSEA 1GG8A 3ZV7A 2BKEA 3R5FA 1OYOA 4HVAA 6GPBA 2P7HA 1FFXA 3R44A 1BKDR 4HBGA 3HTXA 1R66A 2BKLA 1C1DA 3GR6A 3COVA 2FMIA 4Q3OA 4EHLA 2F3QA 2XT0A 3IQDB 1SQFA 4OBBA 5IVDA 3W1VA 2AZMA 2QM7A 3NGLA 5DI3A 4AMGA 3JQDA 5IS2A 1VM6A 3AYZB 2A50A 2AQHA 1SRRA 4HWOA 1Z4OA 1CY7A 5EESA 4CIBA 3DM9B 1JA0A 3DE5X 4LYDA 4RDCA 2QTHA 3GPLA 2HJRA 2FMKA 4YRFA 4AJLA 2X1LA 3K9LA 4F6RA 2ZJAA 3O4JA 4FZVA 4ZTBA 1ZRSA 2F59A 1Q2UA 2PH5A 2PVPA 1ANKA 5DIFA 1Q7RA 1JXOA 1RVV1 3IRVA 2WM3A 1E8MA 2RK3A 2ZBVA 2SBTA 2FWPA 2CE7A 3LJKA 3NP9A 4I9HA 4NOLA 5CURA 3TBHA 5JVDF 1GZ3A 3ABSB 3CW8X 4LJYA 1NJSA 1GL6A 1CZLA 3HBLA 4L8GA 4Q4LA 3UAXA 4HFRA 4OIMA 4WT7A 1JG7A 1P7YA 1QKKA 2PYIA 1NU8A 2I62A 2CBZA 2NV6A 3QUAA 3WDMA 5BMVB 2R6DA 1J2RA 1AZWA 1LX6A 3C97A 2PMBA 5LQRA 1DCFA 1IXKA 4NDNE 2OLJA 2XE6A 3Q2IA 2ENWA 3TMAA 1TM4E 1YNOA 4CMJA 4TKVA 4TSFD 4RNCA 1ZA1A 2RGBA 4P1ZA 3A9WA 3K9FC 4NQZA 5TMBA 3B9PA 3NWBA 4LGVA 2Q45A 4KFUA 4P2GA 3CUVA 2FSVC 1QUFA 4TUYB 3UCFA 4BJHB 4YQEA 5J2UB 5B7GA 1S2OA 2M1XA 2P35A 2WIJA 2YWCA 3N2ZB 3I6MA 3WAKA 4DWWA 3L46A 4HS9A 5JBQA 5EXSA 2EFYA 1E9RA 3FCUB 3I58A 3GO4A 1X1EA 1PZHA 3GA7A 2DPMA 2PXCA 3GFVA 4I9UA 4P3KA 4UD6A 1M1NB 1GLVA 4BMOB 3ZJVA 1PW7A 1AO3A 2B98A 1NAHA 1V5EA 3HXPA 3EXG2 4XFKA 1P17A 4WGGA 4BE7B 4W8GA 3B2NA 5EWLA 1M2VB 5FPTA 3UUFA 5I7EA 3O03A 1U11A 4IWXA 4E32A 4F85A 4JR2A 2DPGA 3SHVA 2AOUA 3BE8A 5IJZA 2Y1KA 5DM60 3B1FA 1BQEA 5CBPB 1I7NA 1XRPA 1ZFNA 5JPCA 3DEKA 4AF6A 3MMNA 4RXMA 5F52A 5KEIA 1B23P 4PHCA 4FYXA 1LTHR 3N87A 1E79A 1XWFA 2GJ9A 5IASA 2IYTA 1AHHA 1E0DA 2H51A 2ZRIA 4TL7A 4EAAA 1C0LA 1M76A 2GYUA 1CY4A 2I7CA 3AF6A 2FSVA 1IMJA 2CLFB 2JFYA 2ZJ3A 3OCWA 2BR3A 3OH8A 1MFZA 4YK7A 2DG2A 3W6UA 4B35A 1HLGA 5L6MB 3DDHA 5BNIA 1G8MA 1NQAO 2ICAA 2ZB4A 2FCRA 4QICA 3GZNA 4J43A 5HZMA 1K92A 2E4ZA 5I5EA 5DSZA 3BIXA 3WMGA 3Q2OA 1NRXA 1P0CA 4GXNA 4AQYB 2X0IA 4I3GA 1E3JA 1TU3A 1N75A 2FP3A 2GCPA 3R8XA 4A73A 4ESVA 2CN1A 2H1SA 1Z5UA 4ILEA 1MT0A 1F0NA 2H2GA 2ZRFA 4S1PA 1DPGA 1E9BA 4LZWA 2E87A 1UKCA 3W1EA 4GPD1 2G80A 3UANA 4U8HA 1HDCA 1E60A 3AILA 1EFKA 1G5RA 1I51A 3ROKA 5JYBA 1PJZA 4DFDA 2C4MA 2PKRA 2QZJA 2PJZA 3GJ8A 5ILGA 3VHXA 1WBDA 4IDGA 5YASA 1GPLA 3LKBA 1P2VA 1RJEA 2Y6VA 3R20A 1I2AA 3HBMA 1U81A 1XRNA 2R5WA 2PXAA 4R8MA 4YRIA 2ZU6A 2A6PA 5I45A 3I0ZA 5ALTA 5EL0A 1T6BY 4HX5A 4P0PB 1OWNA 4CODB 2QMUA 2YN2A 4WNAA 1F4VA 3AFMA 5M7EA 2BZ0A 4MV8A 3TL2A 4D9FA 1IAQA 1NVFA 3J7TA 2A1TS 1ZM4A 1UZMA 4Q03A 4FP9A 2ZJBA 3FA2A 1UBHS 1T26A 2B4KA 2OFPA 4WWHA 1K8QA 2VTBA 4EHHA 4BV8A 2XMRA 4U2BA 5E6RB 4YRJA 2QQFA 3DNFA 1X70A 2BLLA 2FWMX 2CFTA 3JQ9C 2G8NA 4IWNA 2UVPA 2C99A 2W8BB 3AY3A 1SD1A 1Y5NA 4UM8B 1E1KA 3IUQA 3PTZA 1TMKA 3UT0A 4NVRA 3QEBZ 2GYWA 4IEEA 1COWA 3CRVA 3LTEA 3QZUA 4IFEA 4F4HA 3ILXA 4GI1A 5AI5A 3VR1A 2XNCA 2C94A 1NOKA 2JH9A 3G68A 1Z07A 1Z62A 4WKBA 4PCUA 4XD7D 3O3CA 2MIIA 4M9UA 4ARSA 3B13B 4DT1B 5B36A 4HMQA 2DR3A 5BN1A 2QQ5A 4C3UA 4C5BA 5DDIP 1Q57A 3V8EA 2OXRA 2XV1A 3VDMA 3K70B 3TW6A 2DJ5A 3P45A 5SZIA 2GSWA 1YRQA 2AJTA 3QHAA 4A3SA 1ZU5A 3SVLA 1ZL0A 3PHLA 1ECFA 2HADA 3V34A 4F3KA 4ALNA 3DQZA 4BMNA 2CFSA 2QOEA 4ZO8A 3IAUA 5KAMA 1Z45A 1F2UA 5DBGA 3MWJA 1CJCA 2CUKA 4RKWA 3KYJB 4X44A 3UJ3X 5K6RA 3E4DA 1F8GA 2GXQA 4IXNA 4Y2HA 1G42A 3I9V6 1E1MA 2VSXA 4OI4A 3MJVA 2VF8A 3AHHA 5CB0A 4Z6KA 1LPAB 3HBFA 3FGPA 4DPKA 1MX1A 5EHNA 3U60B 1LPOA 4YI3A 3SP1A 3A28A 4YAFA 3TJMA 1A7KA 2IYXA 2DSNA 2Y67A 3GLUA 1XUOA 1NMZA 2GBGA 3DFFA 3QU7A 5I7RA 5EZYF 2XADA 3LKZA 1BQ3A 1HSOA 5DOZA 1UP4A 1TK9A 3B1XA 5LXTA 4RTSA 4JP8A 2ADFA 5LA6B 3DZBA 4I55A 1XQ6A 2CD9A 4XGQA 4BUJA 4GVXA 2ZIWB 1Y4AE 3RABA 2EDAA 4JV5B 4RZ3A 1ZXLA 1PGOA 4EUFA 5CCBA 2PFSA 3BTOA 4OJQA 4DR1B 1E9SA 2J45A 3JWIA 1TJ3A 3QVGA 2D1QA 2EZTA 2GFIA 2HO4A 2JEYA 3ANTA 5AM2A 3MTBA 3TSOA 2JJQA 3K9GA 2ZJ4A 1EP2B 3LY9A 4BRWA 1MB0A 5TC4A 5L3QA 1EVLA 1DTEA 1W0KA 1QF7A 4QXPA 3ZVNA 3Q88A 3ZLVA 3JYHA 1R4NB 2HJWA 3HU2A 4DLXA 4ZVMA 1IY0A 3EIEA 5IN4A 2OSBA 3A37A 2J33A 3L7LA 3Q8XB 4FVTA 4Y0NA 4NS1A 4MDFA 3BWVA 2H1VA 1AS0A 2YWGA 3BMOB 1TO2E 1P72A 5HCIA 2DP4E 2PMFA 4JUCA 4PLZA 1JMYA 2J85A 2ZIXA 4W99A 5K0NA 5M3BA 1ZM2A 3SX4A 5BQXA 1KOGA 1W9MA 1N5IA 1FYVA 2GCGA 2ODTX 4J9UE 5CHEA 5CM2Z 4BN4A 3VO1A 1RHQA 1E2IA 4FOOA 2ZRQA 3RAGA 5I9IA 3W5CA 1RSZA 3D8SA 1E4EA 3LHDA 3RF6A 2OBXA 3ZLBA 3PTAA 1KPIA 2JFPA 1XZGA 3OA0A 4TKUA 3TCNA 3ZXXA 1P45A 4RWEA 4XE5A 4C0WA 3QBDA 3DLPX 3PUHA 1IG3A 1AZLA 1EEHA 2F3UA 4LDNA 4TS9A 4DRXA 2ZSHA 1U31A 5JOQA 5JPIA 1W85B 1CUBA 2C5HA 4IVNA 5JQGB 3SQWA 4LC9A 1U3UA 2EKPA 1BROA 1FFHA 2F9MA 4LWQA 1JTEA 4J2HA 1RAEA 1TGYA 3NWOA 2DBYA 4J0QA 5JCZA 2EEZA 3IR5A 5H7XA 3FFWA 1U0LA 1L3CA 4RMNA 4LBYA 3GGSA 5DF1A 3QUQA 3WQBA 3DEYX 4IZ6A 3LD9A 4JA0A 4AF8A 5D51S 1PZMA 1FIUA 1P1KA 4PAGA 2WWWA 4DB2A 2R79A 1ONNA 1KP9A 3O82A 1SPXA 2W2QA 3ORHA 4Z4IA 1T4BA 3WLKX 3O26A 2LPMA 2XAAA 3AW9A 3G82C 5JCXA 2AR9A 3PC6A 5EIFA 1AUQA 1PHRA 3E1GA 3KELA 1UJ6A 3KYDB 3LY5A 4P08A 1PZNA 3OX2A 3SHQA 4JBXA 1C4KA 1NOJA 3AOEC 4P7JA 4GL4A 2JFNA 4HQLA 1K8ZB 4HGQA 1Y3CE 2F1IA 5CLHA 2PL3A 3OTHA 1O97C 2R1TB 4ARUA 4QPZA 3HMKA 2FB9A 3DZGA 5DXJA 1L5MA 3MB8A 1N0HA 3K1YA 5BVHA 1WDKA 4B3CA 1J9GA 2ZSAA 1U80A 5DLDA 1K2WA 2ZREA 3FWYA 5FEUA 1FDRA 3IAHA 3WJ1A 2GEJA 3U7JA 5ALWA 2UVDA 2G25A 4DIOA 1Q1GA 3UAWA 2FPIA 2N1MA 4JX9A 1YI8A 3L02A 5KYUA 4JOCA 1C9YA 2VBGA 2QTCA 1AKQA 4ISCA 1GRNA 3LX5A 2VC2B 4MK4A 2FPWA 2QL7A 1OLOA 3P2EA 5JTTA 2XGJA 3M6FA 3N8DA 2AFHE 4G8BA 2NVBA 2YFYA 3IQEA 4JDPA 2OSVA 2DBQA 5AKLA 1IM5A 4BBAA 4QYMA 3QHPA 1M34E 4UU1A 4LJAA 4PX9A 3TKYA 2HCFA 3UVEA 2D1YA 3OHSX 4L16A 4OXQA 1BGWA 3R24A 5KNBA 2OBFA 2QNIA 3KPVA 5MN4A 2GD0A 3SJUA 4KBYA 4PQGA 3WIBA 1R4MB 1SUBA 1V1RB 4UMDA 2IZ0A 4KPFC 2ZS9A 2J0UA 1GCAA 3IXLA 3NHJA 5A5FA 1A4IA 1E3TA 3E5HA 4NBWA 2FSUA 1DC6A 1IDOA 4LSWA 3TLMA 3VAAA 4Z4EA 2FSPA 1CDEA 4L1KA 4M1ZA 4WMLA 3RS2A 2BFDB 2CV1A 4CM1A 5KU1A 4NENB 1TK2A 2JGRA 2V7GA 1M8JA 2AW5A 3EAQA 3V32A 3GEMA 1QMPA 1U8FO 1DRWA 5JCOA 1E7YA 1E2HA 1ICIA 1LSSA 4O4LF 5IC5A 2Q6VA 2V7UA 2HGSA 3DBHA 1F9AA 3GIWA 4OYHA 5HFJA 2GR8A 2I33A 3DZIA 7MHTA 2WV7A 3GJ5A 1REQA 1OUMA 2C4TA 3PNQA 2UYYA 4DBLE 1TZCA 4GMFA 5C8VA 3LYAA 2OXIA 1CNMA 1TJNA 1Y9DA 2IYFA 2FGKA 1L4LA 1TJYA 2OO3A 2W0SA 3BXPA 4M7PA 2B2CA 4L50A 1CNEA 5KYYA 1PGPA 2ACVA 2IGBA 3HO6A 3GRZA 1XPUA 3TIVA 3CKYA 2YHIA 1JSZA 1VE3A 3QVSA 4BNVA 1TNDA 2PX2A 3MS4A 4JENA 4MI3A 3ICCA 4Q66C 2XDYA 3AIKA 3U40A 4JL6A 1QH8A 2HCTA 3K4HA 1H05A 3ZGXA 5CITA 3SR4A 4XFJA 1FDSA 1Z0ZA 4Q00A 4LF7B 2OPBA 3ZHYA 3RV3A 3VUEA 4P82A 4B17A 2B1JA 3GCGA 4ZQIA 4JC0A 1TCAA 3AF2A 2CLSA 1II8B 2PR7A 3OTGA 4A6DA 3K0FA 2RBKA 3D64A 1QV9A 1K1EA 2R25B 3T6KA 1FSZA 5IKPA 1QJ4A 1FBNA 3TUJC 1UJCA 5HRCA 2R60A 1MC5A 4LW8A 1W5SA 4QODA 3G7UA 3AF3A 3EFOB 4M8NE 1GADO 1FLDA 1SCIA 2FW1A 2P3QA 4FJ1A 3NFYA 1D2CA 4RFVA 1POXA 2ZTVA 1ISFA 1NNSA 2D00A 3DXYA 4IH4A 4LMRA 1R8YA 1CP2A 4S2EA 2ZUUA 3P2YA 1UMDA 4KGVA 1KS2A 2ZUEA 3MZ0A 2DHCA 4ER7A 4LI3X 2GA8A 4FDVA 4AJHA 1XRRA 3K2EA 3OFND 2BGIA 1GU1A 3IBCA 1DMRA 3DPUA 4E2YA 1DELA 1NRWA 2Q5IA 1KMNA 2WHYA 3GK3A 3H5IA 3KK0A 4YRKA 1YJBA 1G3UA 1ZK0A 4Z53A 1C5KA 1OAKA 4RD1A 3ZHZA 1ECCA 1NBMA 4XLTA 1I9CA 4JLNA 3BGSA 1JQDA 1YA6A 4RE5A 1MOZA 1D7AA 3WP1B 2VPIA 3AWIA 5CYOA 3UH1A 3DCYA 1J9EA 2AN5A 2BFMA 2OVFA 2P0YA 4C88A 4BC1A 5HK9A 3WDKA 3GLKA 4GGMX 5HHTA 4FDAA 2BFEA 5L40A 4REQA 4MQUA 3PF8A 3I9OA 4YBZA 2BE9A 2ENUA 2IIVA 4JB0A 4A1FA 3E53A 4LXQA 4JR0A 3RQIA 3S8YA 3KRTA 4TYYA 3DVSX 4NPAA 1SIWA 4TTTS 4BNTA 2C9YA 2CHGA 2C2BA 1N2CA 3CLVA 3EY4A 2RGWA 2BI7A 2D2VA 2VEDA 4XWTA 3RIMA 4LDZA 1LNSA 1VE5A 3QVJA 1MV5A 4OHVA 2AG1A 2W2LA 2F1HA 2X8WA 5BN5B 1RBZA 1KVTA 1A9ZA 2H07A 2R68A 2CWDA 2W2TA 3DOOA 3DEFA 2IQIA 4NH4A 1O03A 4HN4B 3OF5A 4JLBA 2FQQA 2D5IA 1BXGB 2I6UA 3HYRA 3TL3A 4AT1A 5A9SA 1UPAA 3ELYA 1PL7A 3L7DA 4B87A 5CB4F 4FUTA 4KWTA 2G3DA 4S1TA 1GUZA 1PWYE 4ZI3A 3TS1A 2H4HA 2GBFA 2ZXFA 4A7PA 3N0TA 4UHJA 1DSSG 3CSSA 1SKUA 2CVPA 3DPSA 2DFLA 4G2NA 2IWHA 3T54A 3USCS 3OZWA 2OZEA 2XMDA 5GPBA 4RM3A 1AKRA 1OLUA 1KEVA 2Q8NA 2WU0A 3VPCA 4GRAA 4YRZA 4YMLA 2XVXA 1E9AA 1GPKA 4ZU1X 1L8OA 2RGGA 3L9WA 3TK1A 1P75A 4P86A 4D4IA 2ZSIA 4H7FA 3B1ZA 2QENA 4PG8A 1IZYA 4L4RA 3NTOA 3FCYA 3WK7A 1VQ1A 3PA6A 3DO5A 1FFYA 4JT2A 1I7PA 1KDZA 3ISJA 1CZKA 3R41A 4RE6A 4XOIA 1XLTC 3H11B 1GYPA 3TNYA 1Y7PA 3DVAA 5IW8A 1EHYA 3EQ2A 3IUNA 2Z95A 4D42A 1SXJA 2H08A 3AQ4A 4QOJA 1P0QA 4G5FA 1XCPA 3OUUA 3AM3A 4W9NC 1KQPA 1UL1X 2AK2A 2IHJA 3OEHD 3TIFA 1BOFA 3PGKA 3FFBA 1JAHA 3JPYA 3EG9A 2NU8B 3SSMA 1W2WB 1NJ2A 4B6QA 1A72A 2VAXA 4HMOA 4BAZA 4DNQA 1DRVA 4ZOQI 1N34B 5AHKA 5KHLB 4I2NA 2W83A 4D9NA 4LFAB 4FT2A 2P27A 2ZRGA 1DV2A 3PFCA 1PT6A 1R9GA 1Z2DA 2H18A 4GP9A 1ML4A 1OKKD 5CPFA 2XB4A 2PS0A 3NYQA 3L18A 2Z9CA 4MYUA 2I4NA 1W85A 3HCNA 1KMHA 3LXRA 4O4LA 4P7FA 3UGJA 5I7WA 5THKA 1N8KA 1U9ZA 1ZIYA 3LDFA 3JQAD 1HXHA 4M21A 2Y0EA 4ZOLF 4RMIA 4Q82A 4B31A 3BMOA 2D2EA 2RHTA 3AKDA 3KS9A 2QVZX 5TXGA 3DV9A 2EYUA 5CT9A 3M5PA 4EJSB 3F71A 3G2OA 4MCAA 3STTA 1C80A 1NPTO 4YBRA 1IZ7A 3P7MA 3FDZB 3FTNA 3UICA 4TKMA 4ZZ0A 3DBLB 1SKAA 4I9NA 5KOIA 3FMGA 3V2GA 4W5WA 3F1LA 5G40A 4O4IB 3BTVA 2GN2A 4WXPA 3R0IA 2O2CA 2ASEA 3MBOA 2CDNA 1FY2A 1M1XB 3R75A 1GILA 1I24A 1JL3A 1PNTA 1CJUC 1BU8A 2IEBA 4LCBA 4P84A 3W5UA 2E4VA 5J63A 1Z7WA 3OIVA 1CR1A 3U0VA 5ESRA 1X8LA 1XEXA 3L8ZA 1HMPA 4JJ6A 4QIHA 4XJSA 3C4QA 3G5TA 4RCVA 2LKDA 4MO9A 3OQIA 5CCEA 3I61A 3HU5A 2PZAA 4HVLA 4N3AA 3UAGA 4MJXA 4J6FA 4WZAE 3PE6A 1T9CA 2Q5FA 1SWVA 3UY4A 5ITWA 3NNSA 4TQ9A 3L4KA 1XWWA 1H4VB 2I4IA 1JZTA 3NXKA 3DZFA 2J59A 3KJXA 1W96A 1MP0A 1CVRA 4LC1A 2FLKA 1QO0D 2O23A 4LMAA 1H93A 1RWVA 3DYVA 3GOHA 4ON9A 3U9SA 2OQIA 1QV7A 2RH9B 3BBLA 3GZ4A 5CDSA 1BJKA 2EX1A 3IURA 4H4DA 3FUCA 1E3IA 2B25A 4LX8A 2L82A 2V9PA 3GLIA 3KZMA 3BIFA 3CH4B 1SHTX 4CTJA 1J06A 5F78A 1Y33E 3HBJA 4QDKA 2W6ZA 4AN4A 1LJUA 3Q9SA 5D00A 3K5IA 3FB1A 4TLCA 1UADA 1VJ5A 1TVKA 1Z15A 4R01A 1OH5A 4BNIA 2X4GA 4L3OA 2OO7A 1PFQA 4IIJB 1UBUS 3H8VA 3I8OA 3M4NA 4GC5A 2DBZA 2CW5A 4E5MA 1A9RA 1P2SA 4B46A 3JVDA 3RANA 3QNUA 1UK6A 5H4GA 1XKXA 2JI7A 2Z2KA 4O5AA 3IP5A 2GWRA 3BB1A 4GKAA 4Y1FA 5JO9A 2PUBA 1ZVMA 3NM6B 2XCQA 4LC0A 2FVXA 3F78A 4Y6OA 1ISMA 4R3UC 5D3ZA 2VDRB 1GSOA 4GOOD 4U00A 5ALNA 2XRZA 1Q74A 3PNSA 1WDTA 5TEVA 2J1LA 1GNSA 1QXSA 2I4OA 1X0XA 4I8DA 4O1HA 4TMTA 1KA9H 1KI1A 1UOPA 2R7AA 3PTLA 1RAAA 1E89A 5L4LA 3KR1A 5DK4A 1DV1A 1VGVA 3T7TA 4ZDWA 5K8JB 2GCOA 4AXXA 2BHLA 3PITA 4MARA 2WA1A 1XNRB 3Q5GA 2NO0A 3CNHA 2K5UA 4EP1A 2IEYA 3HKEB 3ML1A 3FDIA 4A82A 3DHEA 5KWEA 2FWNA 2B94A 3PRKE 2L18A 5CJPA 4RXTA 3LLUA 4M86A 5DBEX 4HNHA 3RBZA 5KAPA 4FFMA 4ZZ3A 1HE1C 5JJBA 3OX3A 1AV7A 3GRKA 4IDBA 4UOQA 5LQUA 4AS1A 2AT1A 3NBQA 3C6KA 4CLRB 1U99A 3VR0A 4ASUA 4IGAA 2HWXA 4JLDA 3TRHA 4EARA 4QGSA 4YJGA 3VMFA 5IM4A 4E13A 2P1RA 3ZDEA 4GS5A 4UOZA 5DNYB 1U7UA 2QPTA 1OGJA 2ZQZA 2AMVA 3KZCA 2R62A 3GT3A 3ND8A 3R6GA 4R4JA 3Q11A 3V7NA 4B4WA 1YQWA 4C4YA 2CE2X 5HW0A 1G18A 3EVTA 4U2CA 3WBBA 3AR8A 4ZZ2A 3D8NA 5CFQA 3GAMA 3PB3A 1R64A 2JJ1A 5ARBA 1EVYA 2P30A 3Q3IA 3AY0A 1HMYA 1KY2A 4ARZA 3NAQA 2F8TA 1YB7A 1ISSA 2WU3A 3A04A 1U5BB 3ZZ0A 5HQTA 4UXIA 3A1EA 2OENG 1YOVA 3BE4A 1E1CA 2KJQA 3BORA 4RVCA 5K8VA 2A0KA 4RMJA 3B7GA 4U7GA 4C0BA 4RHTA 2FP4A 4QUDA 3HLTA 4PAMA 4DLKA 5IYZB 1QYWA 4HYEA 4HH0A 3DLHA 1GSHA 1T8UA 3A3KA 1D6NA 4D9GA 3WTBA 1Z22A 2OBLA 3KOXA 2CEKA 1XMVA 2VI5A 4NE2A 4YAWA 5EZ5A 2ES4A 3ABZA 4JU9A 2EC5A 2UUCB 2XNKA 1K27A 2W6MA 1FFGA 2GCOB 2ZI4A 5IVIA 5B12A 1ZCFA 1A9OA 1DWOA 4ERNA 4B48A 1B1AA 1HEYA 2F4VB 1I4DD 4M99A 4HD8A 1M6WA 3BKXA 4NOMA 1C30B 3H04A 1P61B 1EZZA 2QI9C 2YC4C 4DCVA 1PGJA 1MLDA 4KE9A 5EJ8A 3IQZA 1CUXA 1QIHA 4KQ1A 2FN8A 1RRVA 1S2NA 5EJ2A 5JG7A 4PF1A 2OV6A 1Z82A 3RVDA 1Y7LA 1LPMA 4XQ9A 1J97A 3NDPA 1VSBA 1JR3D 2AF3C 2HDOA 3MIZA 1J2JA 4PEVA 1YJXA 1EWVA 4UE2A 4CKZA 3E7DA 3GDOA 3VI4B 1D2GA 3AP1A 1UJNA 2ZYSA 3FGOA 5CXUA 3ANXA 1X3LA 4YIHA 3DHNA 4IDNA 1I6WA 3GLGB 1J2YA 4RPGA 5E9AA 1V7ZA 3D6FA 4FSHA 2YDXA 4CLDA 4V1CI 1JEYB 2DGDA 2XYRA 4RM2A 4N4AA 2JLVA 2WWVD 4IL5A 2Q3DA 1TYEB 2M32A 2PX3A 2W93A 4A0SA 2XQJA 2A9VA 2QDKA 3HRHA 2JFHA 3R7DA 3DMYA 3OE1A 2LIVA 1XZJA 1OJ7A 2X0RA 3GFPA 4KQIA 3HVIA 4UHCA 4C43A 1IRXA 1FZQA 1K08A 2WTBA 3EF0A 3SDZA 4QTTB 3SAJA 3HN6A 4K3UA 4AECA 4D3XA 1OXVA 1WBJB 2IOHA 1ZUWA 3JYPA 3PNLA 4IVPA 1AK2A 3I05A 4NICA 4FGUA 2C4KA 5EN4A 1II9A 5JSZB 4FCTA 3T3NA 4GBMA 1ES9A 5I5GA 4DCGA 3V80A 2JDID 3M0EA 5AVYA 3I1JA 5IARA 1YS7A 1NT2A 3JWJA 1SY7A 1RRFA 3DQQA 2VH5R 1FFAA 3JASA 4DY6A 3V4RA 4HF7A 2O3TA 3WL7A 2O8FA 4HS4A 1S1MA 1NBIA 5FBLB 1SUIA 3EIXA 3BD9A 3RUFA 1VZ2A 3PR3A 2GKGA 5GMOA 3DKKA 5SY4A 1SQSA 1YVDA 1PJ4A 2OGSA 2J6CA 4HC4A 3OP1A 4UDNA 2WAOA 2ZEJA 3B36A 3BS4A 5E8RA 5D3MA 1E9VA 2W48A 3SYTA 5HQJA 1VMIA 2H7XA 2NG1A 2H1OA 2R8XA 1GVHA 4OHBA 4UPVA 2FZLA 2OD9A 3LKDA 2ZB7A 3RVQA 1YDEA 2QRGA 3UQYS 4KLNA 4DQ0A 2ET6A 4FZJA 5JXWA 2Q3LA 2WJGA 1ILWA 3TR5A 5K3CA 3CGWA 2C5AA 1EX7A 2IU4A 2XQFA 2C58A 2ZI9A 5E1OA 2VTEA 3DEHA 4J4HA 5BSRA 4N76A 2Z3WA 2YASA 2J48A 1CQPA 1QE5A 2QP4A 1NXQA 4UNPA 3VMMA 3ZE8A 4QT4A 5JI3E 4W5RA 4E46A 2JIZD 2P1ZA 4PWZA 5CH8A 3DOIA 1MVLA 1RPTA 4B6JA 1U2DC 2PG3A 2YZGA 2H2IA 4H59A 5A6SB 10MHA 2WNSA 1NMSA 1PFKA 4MRMA 4J3FA 1VKNA 3HYNA 5CX4A 2PSJA 4HBZA 4KRXA 4MGYR 4A1OA 2WT9A 2CHEA 2R86A 3LDUA 1U2GC 1C7FA 1K98A 3HFJA 3MK31 2OFFA 5JNSA 4BFXA 5EVCA 3V7FA 621PA 3GPBA 5EVJA 5LQAA 1PQWA 3TNDA 3X44A 2QSJA 4HATA 3F8WA 1JH9A 2P9EA 1R0CA 2BBOA 2XRFA 2ZBGA 3PGVA 4MQ6A 3OPYB 1FVOA 1QDLB 1LY1A 4PBTA 4WFJA 4EMTA 4CIXA 1TQ8A 4CRWB 2HLPA 4DBLC 3JS5A 3KT0A 3S81A 1EX9A 4CV0A 3GLFB 4XKJA 4YCMA 3ESZA 4OMDA 3LCCA 1N92A 2VK8A 3EULA 2VDWB 2YUIA 3COPA 3NORA 2RI6A 1V41E 1RLMA 1B0ZA 1O8CA 1JKMA 1VJ1A 1Y1SA 1Y6ZA 5G4LA 1FSSA 2XLCA 2CHFA 4MTLA 2POCA 4HO1X 4KO4S 5A5EA 3FKQA 5K0GA 2Q7OE 3OKPA 3UKOA 4CQMD 2CNBA 4XQEA 3ROEA 1NXSA 4QGAA 2P3OA 1WSDA 1XC7A 1U6IA 4AKHA 2PZGA 3K7EA 1BDBA 4EGFA 2O7SA 2P9JA 1XT6A 5IUJC 1I14A 4GKBA 1U8UA 3FF1A 1U7HA 3ITNA 3MILA 3RRNA 1AHIA 3MEQA 4HYQA 2O3RA 2QGZA 3FLBA 1Z4IA 4K87A 3Q98A 1MTOA 1OT3A 5D3MB 4CHGA 1ZD5A 1W6RA 4ZT2A 3S1SA 4CMCA 2PJDA 4BEBA 3H9JA 2REQA 3SZLA 1WD7A 2ONYA 4OB8A 1AY0A 2Y4NA 1I4LD 3URKA 1KMIY 2JBAB 3WKAA 2JAQA 3UPTA 5JZOA 3IQWA 1U28A 1PK9A 1SOVA 3KJEA 4J0JA 3LC7O 2CVQA 3C43A 4JL8A 1YHNA 3QRWA 4PNHA 3LA8A 1FUUA 3WWZA 1WXWA 2G83A 3BXGA 4AKTA 2NQ2C 5KCZA 2J0SA 4NAVA 1JAYA 4L8VA 3A27A 5I6DA 3SFVA 4RSHA 5J59A 1Q1AA 3KLBA 2RBGA 3Q72A 3PZRA 1C0KA 3K6JA 4EEXA 1T2NA 2D0DA 2EX0A 3AVOA 2PQ0A 4JFRA 4FKZA 4M0KA 2EFJA 5C81A 3OD1A 4C1NA 3KEOA 1RRGA 2XYHA 1T8SA 4Q9HA 4ABYA 4MW6A 2Y1CA 721PA 3A6ZA 4FMDF 5B3JA 1GJRA 2D5CA 2Q8PA 2FPMA 2GARA 3BSSA 1DXQA 1QHYA 3LQ2A 1D09A 4XJVA 4X65B 4TKVB 4K6GA 1BGXT 4AC9A 4BJ1A 1SOUA 1SR8A 4CFSA 1FTGA 3KSUA 1E5LA 3LL4A 3VU9B 1HDYA 3TTVA 3ILYA 4NV1A 2CT8A 5JT1A 4C01A 1YMQA 4FW9A 1GOTA 1OX4B 2HPHA 2NYVA 4EKDA 1HFEL 1XVTA 4JEHA 4ZCMA 3P27A 5KYXA 1ABFA 3EGWA 4QC2A 3W06A 4PO9A 5IVPA 2C2YA 4XX1A 4YP1A 3RFUA 2H9YA 1DC5A 1KHHA 3EZLA 1A2KC 3T7JA 4C0XA 1KK0A 1T9HA 3LUFA 3ZPXA 3UH0A 1DKQA 4NR0A 1KJJA 1EFPB 4W82A 3U3ZA 4KSBA 3NP7A 2O07A 1RMQA 5EMLA 4RVGA 2XGOA 4X90A 4GW3A 1NBHA 2IPNA 1W49A 4Y2QA 3JQ8B 4D8UA 4ZU3A 3IERA 1P9NA 3UWOA 2BCEA 5AVTA 2QX4A 3A1DA 5FLYA 4DEXA 2OCKA 1ZD3A 5BR8B 3TAUA 4MQLA 5A5VA 1V1MA 1Z5NA 1OYYA 1WXXA 2GO1A 4IDFA 5AYVA 3ZU3A 4RDXA 3S0JA 4BJ6A 3GRUA 2C2XA 3ZKWB 3RG2A 2H4ZA 4X8HA 4KNWA 4MXDA 3V4LA 1WCXA 1A76A 4JU8A 4EJSA 1XDGA 2DZDA 3TI7A 3RVJA 4CR7A 9GPBA 4EY5A 2VDNB 1UIRA 4J2TA 5GM1A 1SUCA 2OAEA 3ZI4A 3VH3A 1FRFS 3CNOA 1HURA 1LW7A 4Q48A 2H59A 4POOA 3UMMA 1OBCA 2R2AA 1C4WA 4I0WB 2I6FA 4Q1AA 2GWHA 3UJAA 5BVGA 2Q1XA 1P80A 2IYSA 5ANRB 5E9WA 4WEQA 2XDQA 5L3RA 2DQZA 3LVFO 1MGOA 1OBHA 5FA6A 4URVR 5AVQA 1Z8DA 5K0LA 4QXMA 2JFVA 4BQPA 1V3TA 3ND9A 3WMEA 1EEXB 1KO1A 2ZANA 4OM7A 5T5QA 2GT1A 1W94A 1NMXA 2HA0A 3FMOB 1UBLS 1DLJA 1XAJA 4HSGA 4MQ5A 4QQRA 5GJWC 4E5SA 3L6EA 4DGQA 1DIGA 1IONA 1UT5A 4CIDA 3PE3A 1YFKA 1DLIA 3AM4A 3MSXA 4JLJA 3UK6A 5A7FA 1EWTA 1EBBA 4GPAA 3VISA 1DWUA 3PNOA 1I6KA 3DWFA 3G5AA 1EKXA 1EGVB 2P9HA 1BE0A 2WDPA 1QOZA 3C14C 1OV6A 3IEXA 1KHTA 3DV0B 4MVJH 4OIFA 5G4KA 2IXGA 3WXMA 4DARA 4DDTA 1QHFA 2PT5A 3QBTA 4RA6B 4O1MA 4KXFB 2QLTA 3CR7A 3IAAA 4OY3A 3L77A 1ODJA 1Z74A 2BF4A 2PX0A 1TQHA 5DYTA 4ZVUA 1FDWA 3U31A 2Z8XA 1FB5A 4OXRA 1HI9A 3DVAB 3IPAA 2IYPA 1PT5A 3DVRX 4P8RA 5IYZA 3CKLA 4I50A 4ZCTA 5FFMA 1FXSA 4S0XA 4OH1A 1XZAA 4AUEA 4BVAA 5AJUA 5FBHA 1AA6A 4DRZA 1PR3A 2ZUWA 1XK6A 3O9MA 1RC8A 4ZOAA 2DPHA 1IHXA 1U1GA 2NP6A 4A36A 1JHPA 1VI2A 3CXRA 2A9JA 1ZM3A 3WMFA 1RYYA 4UHHA 1O58A 5A9SB 4MW9A 2X7JA 3K32A 3ZR4B 5D8DA 3O0DA 1GUBA 3LC2O 2FPPA 5CLJA 4OGFA 4GAEA 5HZKA 2GH1A 3SG0A 5JAUA 1DXYA 1IZ9A 1RIFA 4GMDA 4P7BA 4ENRA 3E48A 4YV2A 3CZ4A 4H31A 4U8GA 2OOKA 1M33A 3DFMA 5IHXA 5ISMA 3OOYA 1EI9A 2IF2A 1YBAA 3LI2A 3LW7A 4DLVA 1W5TA 2NADA 3JR7A 1UFVA 4BHRA 3EBPA 3LLMA 2GR9A 3AM1A 4YALA 1DDGA 5M29A 4F93B 3VVBA 2EVWX 3EVFA 1KETA 3KKMA 1WD5A 2ZIEA 1GGKA 4CIVA 1M0EA 1TPZA 3AR4A 1TPYA 1QWSA 3MWDA 3K3PA 1QRRA 4HYYA 4CM7A 1BWSA 5KDLA 5KKAA 1TZ2A 1DAEA 1GPDG 4PHGA 5F2KA 5A1JA 5DBHX 4MB2A 5DXAA 1T9ZA 3WTCA 4BTVA 3TSYA 3OLQA 1X2EA 2ZCUA 1OI7A 3PPVA 2QL5A 4LAFA 4W1SA 2BM9A 2VHCA 4IJMA 4WBNA 2OORC 3CLTD 3LRXA 2F9FA 1EH5A 1P6XA 1TIKA 3S68A 4KYTA 2EW2A 3H1FA 2WUFA 2PGIA 3DDZX 4JVOA 2CKDA 4GD3Q 4N82A 4URUR 4U7TB 3QVOA 3ANNA 3E9EA 2EP7A 1SU7A 1D3AA 4JQCA 1CLUA 4KW7A 4FMBB 1HDOA 3TWOA 5IH7A 2BGGA 4CKBA 2WVAA 4CTKA 4ZGBA 3RODA 2OFWA 4GM1A 4HXEB 4TM8A 4H3SA 2R7LA 5ALGA 3MUOA 4IIJA 4YO8A 1P3Y1 2Q6IA 5HA5A 1C1XB 1Y4DE 4G4IA 4BVEA 5C4IA 5AW7A 3M2TA 1Y6GA 4MV9A 5ELXA 3P0IA 4PTZA 5DN9A 2VSNA 5LP6C 3O7WA 3M6XA 2P67A 1FYDA 4S3MA 3RYCB 3IKJA 1Z2EA 4BRUA 4RJTA 3W6PA 4F21A 5BVGB 1Y98A 3LK6A 1H6AA 4EQ6A 2JIDA 3M3HA 4ZAZA 4JT9A 1ODFA 1Q11A 5AVWA 2IH2A 3SFZA 4KGXA 1N4DA 1QIKA 3FNEA 3FSGA 1W5EA 2PMEA 1SFRA 4QHYA 3U44A 1BHJA 4LYJA 3OZVA 4FONA 1IJBA 4LJSA 3LBNA 2GHTA 2H7VA 3BWEA 4DR7B 2QWXA 4BFLA 4D25A 2QE7A 5ESWA 5E4TA 3SIXA 3FKSA 4AI6A 3NT4A 1GT91 4D0NA 2PKQP 2HSWA 1KOLA 3RS8A 2HMTA 2NTYC 1T5HX 3IUMA 4QUKA 5HFNA 1JEQA 3KZOA 5KWVA 4OJTA 1JQKA 2YY6A 3L7CA 4DIMA 1E1YA 2VJQA 3SBDA 3SR3A 4DBZA 1V3VA 1XB2A 1RMYA 2ZI5A 1G7TA 3GUYA 5G0WA 3AHFA 4BB6A 2RFLA 1LVGA 1FXWA 4O02B 2QVBA 3DZDA 4ZZIA 4YDQA 1KAQA 1IUNA 4BNDB 2BTQA 1GPMA 2V59A 3ICOA 3E2IA 2JB9A 3RM3A 5EZYA 2X0JA 4YCCA 3G2MA 5K2OA 3K8ZA 1BGVA 1V11A 2CL7X 3EEQA 4BMVA 3EXG1 2C2KA 2IX9A 4G1MB 3UT6A 3UWMA 4DYHA 3WYCA 3DUFB 2ZJ8A 3M3PA 1ZD2P 3FPBA 3O4VA 1LV7A 3D9QX 1ZD4A 1Z33A 3IDOA 1KGSA 3JQ6A 3OPVA 3ETGA 4YLEA 4F84A 2C59A 2FI1A 3HDJA 1N3LA 4WOKA 4L3VA 4Z9AA 1Y37A 1T2EA 1Z0IA 3LX8A 4II7A 2DLNA 1P4GA 1XHFA 2FSGA 3I2IA 3KKOA 3WLFA 2VHTA 3L8FA 1Q6YA 3KUUA 3OPQA 1SBCA 2OESA 3PENA 1AT1A 5IPFA 3T95A 3BFXA 1C50A 3QV1A 1KZ9A 3PJFA 4V0OA 4MLZA 4ZN6A 2H63A 2C04A 3QXXA 2REBA 4URHA 3W2IA 4H0NA 3ZCQA 4ZTZB 3TAHA 5EJMA 3VBCA 5DNUA 3D7LA 4HGRA 1GUAA 1UP7A 3OY2A 3RIGA 2GM3A 4PHHA 3CVUA 1H2BA 1GNQA 1OIWA 2AGVA 2PLRA 2ZRPA 3CMCO 1DT5A 1RHMA 4NLLA 5DNWA 3PPIA 5K2MA 4BFYA 3ZQKA 4NYMQ 3GG2A 1W34A 3R23A 5DB4A 3RLFA 3ZUGA 3MJHA 3RVRA 5H16A 4Q3NA 2ZWOA 5BSTA 1GPYA 3D4NA 1H5UA 4FFOA 1RU3A 1IB6A 4US1R 4W5QA 1IBMB 2GBPA 4GWGA 3STXA 1KPHA 4UVEA 3O75A 3GCDA 2J3DA 1GAQA 4NPCA 1UZUA 3MJ4A 3KSAC 2CLEB 1ODKA 1W5FA 3D2LA 1OFUX 1IUPA 2C9MA 1U04A 2IBMA 3A31A 4WY2A 3X1MA 4OH7A 4DZRA 3VO8A 2XUHA 4KTTE 1VHTA 3C3PA 5ALIA 5DHQA 1T1SA 1JDTA 4I36A 1XZBA 4N5NA 4Z7NB 5LZ9A 2HSJA 2XEDA 4Q7MB 5IKXA 1OIVA 1D1SA 4HQ6A 1F48A 4IIXA 3GFOA 4BFCA 4PZPA 1JHOA 2G67A 3UYLA 2OBMA 2FPGB 4L7QA 5K20A 2IH4A 4DG8A 3EQZA 2GESA 3KKLA 4ZOBA 3W2FA 4QQKA 3IQIX 1FDIA 2BFDA 3F8TA 5CA1F 5LB2A 3G0DA 4XYGA 4IQ0A 3BERA 1IQ0A 1Z5VA 2WD7B 4I5GA 5E6SB 4KE8A 4Y3UA 4ITRC 5C1IA 2EL9A 3IP9A 2F9LA 5BV1A 4F0JA 4W5HA 1IM2A 4AF7A 1KYVA 3E22B 3C3EA 5B2ZA 1E1RD 1K68A 2QL9A 1ID1A 2HY7A 2I7VA 2QRPA 1ZVQA 2C2GA 3JSAA 4RS3A 5AJYA 4FEEA 1VCHA 1CY8A 5HQ3A 1H23A 3ER6A 4BWVA 2AD5A 5L53A 5J2TA 2GBLC 5H8WA 4R2MA 2NQ8A 2KHZA 4LQDA 4MV5A 4RZ2A 4V03A 2QR5A 3M1YA 4HFJA 4G5GA 2X9VA 4DPMA 4IQGA 4KXUA 1UFOA 3FOWA 3QVKA 3MGAA 2H52A 1ONOA 4JCOA 4BMYA 2OECA 3ZWKA 2X42A 3N6VA 4OQZA 1E5DA 4AJKA 3EDOA 2WU8A 3V00A 2PZMA 1R8SA 1P1CA 3OT5A 2WPNA 3T35A 1E20A 5CEFA 3ILVA 1T24A 3AK4A 4RKRA 5HYVA 5LN1A 4HAVA 3FBGA 2WHXA 1HE4A 1P4AA 2X0DA 3H5AA 4JD5A 1W7AA 3HVKA 4XJTA 4MUJA 1T4GA 3QYFA 2J4DA 3U5TA 2XCLA 1YK0A 1X92A 3BZWA 1IEXA 2DE0X 3HCDA 3SNKA 4Z7OB 1ZNQO 5KQGA 1PJLA 2O20A 2VA8A 2I4MA 1LQ2A 4MW0A 4DABA 3OZTA 3KT3A 2COKA 3MN1A 2ZIXB 3AONB 3WFZA 3F5MA 4BHTA 1GRVA 3H42B 4QJBA 4MS1A 3ZCPA 1AKTA 1Y48E 2HUPA 1JKJA 2QPOA 1I4EB 3ETHA 3O8BA 4LF5B 1U8CB 3R5HA 3UUWA 3WGVA 4D2IA 5KX5F 2G17A 1U2RA 1FVXA 2WAXA 4OQQA 2R66A 1TD1A 1IN7A 3F7OA 3H19A 5EEHA 3EGCA 3U39A 1TKBA 2NPOA 1G9XA 3DDCA 3FBTA 3FD8A 4YMSA 1QM5A 5BSMA 5TT1A 3UHAA 5EYPA 5CA1A 3KV3O 2KMLA 3PLRA 1T4MA 2EBUA 5E1MA 3AOGA 4IQFA 2PN1A 1TZKA 4KKVA 3NBFA 3TUIC 3QLVC 4N0QA 4IMJB 1FVHA 4ZOLA 4PPFA 1RZRD 3HCCA 3E9DA 3VYTB 3A4IA 5FLXA 1CUCA 1E7RA 4GX0A 4X8OA 3IULA 4KVAA 3BQMB 1Z5PA 3U7EB 1QP7A 1XZMA 4GPEA 3R0QA 4MAAA 5H5JA 1IJEA 4YQYA 3JYQA 4C08A 4RK1A 4TGLA 4IXJA 3LCRA 5AVRA 2J07A 3CEPB 1T8WA 4IG9A 4G1FA 4P36A 4PLWA 1IY9A 5HZGA 4ZI5A 1A7UA 5DCLA 4IOMA 4G0WA 2PIDA 2N42A 4TL6A 5I7FA 1DAIA 1FTQA 3KZXA 4LSGA 2UDPA 1QZXA 2DUNA 1T2AA 2DXIA 4L75A 1G5QA 5I9BA 4F46A 5I7HA 4WLOA 4OMCA 2XLBA 1KDRA 2W70A 1YC5A 4NBLA 4OSEA 1J00A 1VIDA 4INAA 4ZICA 4KNYA 2VTDA 1PVVA 1Q1QA 3NETA 3X0DA 1TUBA 2Y9PB 1PEKE 4E31A 5JH7A 2VZLA 2VK4A 3O95A 4Q4HA 2QTVB 1QYDA 4U3JA 4KUHA 1W6UA 3GNSA 2RONA 3QYPA 3S2YA 4CYMA 1J56A 3BZBA 4EW6A 1G6Q1 1KI3A 3C4VA 5ICGA 1GTJ1 1RAIA 4DR4B 1X7WA 1J1UA 2PSSA 2C83A 4BRZA 5ICSA 1H4TA 3HJAA 4KNVA 4FC7A 4YP5A 2G5CA 2UUPA 3HJRA 3JWPA 3KEQA 1A2OA 3DHWC 4ZJUA 3UMCA 3WIOA 2X9NA 2CJFA 2ZB3A 4LHEA 1LV8A 3QJ5A 5ALMA 3SF8B 2W8BA 5TF0A 2E5LB 1UOEA 5BQ3A 4KHPB 4PSDA 3CFFL 3Q2KA 4XB1A 1EFRD 1STOA 1W47A 3TKAA 4E6PA 3DS8A 1E5VA 1JLSA 3F90A 3M83A 5EKXA 4ZIRB 1Y0BA 1NVVQ 2BHTA 3DAPA 3F49S 1MGPA 3NT5A 1ML3A 4FZRA 4DHEA 4ZYTA 2IYRA 5EJ9A 3G0OA 3EC7A 3KLOA 5KQPA 2ATVA 3BKWA 5JS1A 1DQZA 1JYSA 5THQA 3PDHA 3D4IA 1XZNA 5EIHA 4MNTA 5ECYA 1QBKC 1N5KA 2WT8A 4TOIA 4Y6RA 3FZQA 3ACBA 1I9GA 1SCDA 3H5VA 4H7PA 3CPSA 5FADA 4WDQA 3WBKA 3EIOA 4DW8A 3AVXA 2CVFA 4BEJA 5C1DA 1ATIA 4HX2A 1AOXA 4ZAFA 4HEJA 1D5WA 1DRKA 1T2VA 2QXUA 4DDHA 2OCAA 3TPZA 2IYEA 3WNVA 3CMMA 5K0BA 5CLLA 1LTQA 5KOHA 4ZDKA 1CB0A 13PKA 2JAOA 2BMWA 4LECA 3QUCA 1GR0A 2GF2A 2QUHA 3G1WA 1QRUA 5SZKB 1RZUA 4BLUA 1CUIA 1YR6A 3HWWA 4OXKA 3NOOA 2I91A 2XYVA 3F9IA 3DD5A 2AV6A 2XEXA 4KAJA 2W71A 1RM0A 2OMKA 1MENA 1MAHA 2HWWA 2KS6A 1S3SA 1L7MA 5TEWA 4EX6A 1NVBA 3M9WA 1YGYA 3HKEA 3Q4GA 2WYIA 1LDYA 1GYRA 2PJUA 3TAXA 4ENTA 2JCVA 3E23A 1O3YA 2BKAA 4OI1A 2IVFA 4DLBA 2LUOA 2XXJA 3SM9A 2YWBA 1FP1D 3IOEA 1GL9B 2Z1MA 2QI9F 4UTXA 1O08A 1DC7A 2AMYA 1QIEA 3EZGA 4PX3A 3GELA 3L8CA 4DOMA 4RMGA 3HV0A 3T9EA 2AJDA 2O4UX 4EJFA 2GN1A 2C3UA 4MRMB 5KQMA 1E6LA 5JD6A 1XMSA 3VOAA 5JCOC 2IPAB 3IEKA 3L7OA 3BWMA 3C15C 5DV9A 3STVA 4YAOA 3K9HA 5A4JA 3COJA 3OZIA 1VDMA 3JD0A 1PUJA 4MA5A 4QPCA 4DRXB 3SHFA 2DHQA 3Q9NA 1GQ2A 1W4BA 2NACA 2HOQA 3L1VA 3NT2A 3AU8A 4AURA 4DB4A 4TUYA 4MUIA 3BDAA 4I19A 4Q18A 3DDOA 1VP9A 2RC5A 3T3HA 2BFCB 2IK8A 4AP5A 3OX1A 3TVDA 1W2HA 3OLCX 4PR3A 5JHHB 3QEMB 4UQLA 2AL7A 4EHAA 1T1GA 4RJLA 4WOBA 4BP8A 4RPHA 4EBFA 3PNBA 1DFGA 1PJAA 1PEDA 1YQTA 2AD1A 3MJFA 1UP6A 3STHA 2WW8A 1Z06A 2ZE8A 1ONSA 4F6LA 5DK6A 2H1HA 2HJVA 1BE1A 2QD3A 5JNTA 3TG2A 2XJ9A 4AZ0A 1HH4A 1VSTA 4CF4A 3ZKAA 4EHFA 5TIIA 2HXSA 2WJPA 4I6JA 4KLAA 3RJ9A 1EAYA 1P33A 2X5KO 2RKWA 4LCJA 5GONB 5GIPE 1NN0A 1X9HA 2ISCA 2OG2A 3IR7A 4G36A 1TM3E 3ZIAD 3UUGA 1XLUA 3CNBA 1Y3HA 4IH9A 4KOAA 4M6WA 3T7KA 2HFJA 5L8VA 4JXKA 4BVFA 4RAOA 1U02A 4I1SA 2WYWA 3L4BA 4RJIA 1AX9A 3EQ7A 4HKTA 4HRXA 3I6BA 1L1RA 1ZVJA 5ITZB 1KZYC 3B3JA 3DKVA 1RYDA 2YHBA 2YXPX 2FEPA 3IIJA 3PX2A 4KR9A 3VJMA 1IZZA 1BVUA 5EJ5A 1NUUA 3P9NA 3ZZMA 1NC1A 3W9BA 2QMYA 4BKRA 1B15A 2I66A 4B6GA 1T0JB 3H5LA 2F2TA 4B3TB 1GRCA 5JRZA 3A2KA 3KLMX 1RTKA 1RKBA 5IJAA 5FV4A 3WI7A 4KE6A 2XUDA 4TS1A 1QGUB 1A27A 4CMBA 3KT6A 4ZT6A 1SURA 3VTZA 4O59O 4QEKA 4A26A 4LOLA 4XD2A 1BVHA 4R54A 4H77A 4ID9A 3LT4A 3IVRA 2B1IA 1EX6A 4QL3A 1H3FA 3DKPA 1QIIA 5T4FA 3V7YA 2QTBA 4L95C 2VBFA 3UA0A 3U3DA 2IXFA 2PXHA 3BF8A 1G64A 2QP9X 3RRFA 3JVEA 5C1PA 5EIEA 1BCSA 1X7ZA 2O06A 2OLKA 5T4HA 1WXGA 2IYAA 3IP1A 4BO6A 3G89A 1NOIA 2QTGA 3C6XA 5HF9A 5REQB 4BJ3A 5JEDA 4NOKA 4HQOA 1KH3A 2G9UA 4HPXB 3T1YB 4TTPA 3QFSA 5CH3A 3W4KA 4A15A 5JAOA 5EUQB 3QHQA 4V1CA 2D13A 4WKNA 1K0FA 5IG2A 4RV9A 1Y9AA 3EN0A 2BFCA 3JZIA 3WK5A 5JMOA 4P4SB 3LHIA 2ZULA 3B9QA 3G6KA 3I2JA 3G5MA 2JHPA 5BPHA 3OTOB 3HA5A 4BO5A 1H8HA 3G9UA 5KNCA 1LVHA 1NF3A 3NVDA 1H1LB 3RE1A 4E2XA 3R74A 3CNLA 2A0YA 2FYTA 3EG9B 4K28A 4IXDA 2NU8A 4C4TA 5C5EA 3TUZC 1ZNYA 4KXLA 1GWNA 1N3YA 1NC3A 3I01A 1A8SA 3HJBA 2DX7A 4TZKA 1U90A 4P58A 2PUWA 1ZWLA 3H0CA 2ESRA 1GXSB 4WJKB 2I2WA 1VIYA 2HBRA 1XMQB 1T91A 2ZG6A 1H65A 1T43A 3A1VA 3UV6A 1KI4A 1JR3E 2RIRA 4DMMA 2GK7A 4D7AA 4TWJA 2CLHB 4N7MA 2RI1A 2QRVB 2XF8A 3KETA 2B0CA 4DDMA 1NKTA 2C9DA 2RK6A 3I2FA 1X94A 2CNWA 3N6RA 4UZEA 3TRJA 4YAGA 4CG3A 4KQCA 5FNVF 2C31A 2EZ4A 2XPCA 3E70C 4FSDA 2QK4A 3TLCA 3UWDA 1M2HA 2GM5A 1BFUA 3PDJA 3H2YA 2Z3VA 1JB1A 1V8OA 3BD6A 3JYNA 4UAUA 2P77A 5LWQA 4JVSB 2FW9A 1OPXA 2QIPA 1R0LA 4HMPA 1MH1A 3TFOA 5CDTA 1KGDA 1S02A 1UXKA 1I0IA 4N47A 4BO1A 2Y93A 2JFFA 4TTJA 3T4EA 3VDRA 4F2GA 3HNPA 2DUUA 2CXRA 1TOAA 1E9EA 2A35A 2X2OA 1ZN8A 4MYDA 4CZ2A 1VLJA 3I62A 4KQXA 5AJTA 5FI3A 4YT2A 1W30A 1Y1TA 1CETA 3RW9A 3G8YA 2JJ2D 4WNYA 1KY3A 3DMNA 2CYCA 1RJ9B 4FNGA 1J0DA 4C7VA 4E5PA 3VSEA 5HIKA 5ALYA 1DTWB 3ZWDA 5D5HA 1JDZA 1YU9A 1X74A 1ZMTA 3B6ZA 5H9WA 1WZEA 1TECE 2ZSJA 4KXMA 4YP6A 3LMKA 1J8YF 3QPDA 5KYWB 1ID8A 4QUAA 1UWKA 3DAOA 5BMVA 5I01A 3JZDA 3VHLB 4EO7A 1SHZA 2JEZA 1W52X 3BHIA 4JP5A 4FMCF 3T3OA 4O0LA 3PRHA 1RADA 4MPTA 5M5BA 5DM4A 4TT3D 2VYVA 3LQ4A 4KTVE 1KIAA 2QF7A 1VJDA 1LZKA 4ML3A 5SZHB 3SCZA 5AI8A 2Q5CA 1SBIA 1X7GA 1IM8A 2LIPA 1ZC4A 3L7YA 1GPWB 2Q7DA 5A04A 5AI0A 5KNDD 3HKDA 1S2IA 5DTMA 3QMMA 2PYZA 2WHEA 5IRCD 3T06B 1G2IA 1S5PA 4M0CA 2RJOA 1M9NA 4X92A 4EH1A 5C53B 3MHTA 2D6FA 2VXCA 3KOYA 1ZM9A 3ODGA 1SAYA 2YUTA 4EI9A 3EEOA 4JJEA 3CVWA 4HEA6 1O95A 2G06A 1AH2A 5IJWA 3N8NA 3OD5A 5EZ6B 3RJ5A 5JH7B 4O5OA 1ZUHA 1KYXA 3GLVA 2WJAA 5BT8A 4MDYA 1OSNA 4IZOA 3UAVA 3ZWWA 1XQYA 1XDBA 1IQUA 3WICA 3TSAA 2AJ8A 4UEQA 5LDDC 1XMOB 1JAXA 1SVNA 4G1BA 1U0TA 7REQB 2C84A 4KVGA 3UBTA 1MX3A 1YE5A 3EXEA 3CX8A 1A4XA 4J7AA 4PYKA 1QVWA 4B1FA 4BGEA 5NULA 4BFTA 4QDTA 4M1TA 3LY8A 4Q9AA 4GQIA 3NJ8A 3HEBA 4AUMA 3GCWA 3M89A 3L7JA 2CNLA 2ZIAA 3TTYA 2QVLA 3M82A 4MMZB 5E3JA 3H84A 4AY4A 1Z08A 5KSOA 3FE2A 2VATA 5F4ZA 2UU9B 2PKEA 1GZ4A 2V4MA 3CU5A 1WKCA 2NU6A 3KUDA 3HVUA 4QJ4A 1VPLA 1UFKA 2I71A 2NM0A 5CMLA 5LCXA 1JPVA 2RHRA 2Y1XA 3BD8A 2GLTA 4FWIB 2CMHA 4QHTA 5TGDA 2GZHA 3S99A 1TJ4A 2QAGB 4DLPA 3VA7A 4X54A 2IXAA 3OLVA 4MMXB 3Q7EA 4TV8F 2GD6A 4WOPA 1YR8A 3H75A 5DHSA 3OOJA 2FP4B 4IR7A 1O0CA 2C77A 2HMWA 4G0QA 4QM7A 2FA9A 2DHEA 1WPRA 4NABA 4TV9F 3W90A 2X41A 4F4FA 3EDYA 5IT4A 1CLEA 3F5SA 3RH0A 3PC8A 3H11A 1JEEA 4P33A 1PEAA 2FRVA 2ZTLA 2GD1O 4HGNA 3QKUA 1EGQA 1TVMA 4ZQEA 5F3DA 5TGTA 2Y0PA 3AMVA 1TTTA 2VH2A 2VYNA 4Y7DA 3ZBTA 3GRPA 1CY2A 2AX4A 2HIGA 3P26A 4LFBB 5ADWA 2PQ6A 2YHSA 5KOHB 2JA2A 3K9BA 1VYHA 2FRDC 3TCKA 1F6BA 3UM9A 3AKEA 1QFMA 4ZKEA 2IZ1A 3BGDA 1XVAA 1UR5A 1MDFA 2VT3A 3ENZA 2OV8A 3D5TA 1O6GA 3BAZA 3P0JA 1W2GA 5B5SA 1V6AA 1UANA 4KVZA 1I2BA 3TVYA 1IAVA 3A9UA 3AESA 4GXQA 2JNWA 4UW9A 5JWOA 2BUCA 4RD6A 1TLTA 1RQGA 1E3LA 2B8EA 1IDN1 4JIMA 4CQJA 1V5IA 3V8RA 5L7TA 2DFTA 1O77A 1P5RA 4B32A 8MHTA 2Y1OA 3NHAA 1ENZA 1KEEA 1IEWA 2QUZA 5UKDA 2B3TA 2VK2A 4TYNA 5K8TA 2JASA 4XGNA 5HVNA 3JW8A 4UM9B 1BXRB 3GGOA 1SXJB 3P0EA 4Q9JA 3ZGNA 2J7PD 4CMEC 1XNGA 3E2MA 2Q1YA 2AZXA 1Z8HA 3CW9A 3P9QA 4PBSA 4IIYA 4DV1B 2HA2A 2J5XA 4EG6A 1J7KA 4Q1DA 1ZESA 1N1MA 3C2QA 4IJ5A 2ONKA 4EKNB 5M2QA 1VSQA 3MB5A 1NUHA 1I1QB 1YQQA 3AOEA 3V5NA 4HWTA 5E4JA 5JYEA 2WTNA 2BEUA 3BTSA 2UXBB 3KEMA 3AG6A 4GOXA 4X1IB 3R3HA 1R74A 1C3OA 4LF9B 3GEHA 4UPDA 1J0XO 3BGIA 3F0TA 3HL0A 2VYCA 3JR3A 4MO2A 4W7IA 4ZYWA 1B76A 1TMOA 5ILQA 2HZBA 1NI4B 3KUKA 4G25A 4P3XA 4YVFA 4PFKA 3L0SA 3GF4A 2IV2X 4B3SB 3DMGA 3S3TA 2IL1A 2ERCA 1ODSA 3L2OB 4AY5A 2P4EA 5EWMA 5LNK1 1K75A 4JJ8A 4BNLA 3K71B 1TM2A 2CXQA 4CMEA 2A78A 5T3YA 5E38A 5FO1A 4LPKA 1V8DA 1YS4A 4Q9DA 2WF6A 4P3OA 3EUFA 1CY1A 1NJGA 1OX6A 3HYSA 4HCJA 1MX9A 4MUMA 5EG5A 4BFSA 4DQKA 4JC8A 4CV2A 2Q0HA 1E2NA 2ZZNA 2SCUA 2OBBA 2CHVA 4HNQA 3AF0A 3DMRA 4FHFA 3JU3A 1QCCA 1PFUA 2CXNA 3A14A 5K3BA 3VYRB 3KR2A 5U4QA 4LJRA 2IS2A 2ZLBA 1ULUA 2CFOA 1B3BA 4WZ6A 2VK1A 3E5MA 2XWPA 5AHXA 3GMTA 4N6NA 3DBRA 3H1EA 1CC1S 2QS9A 4O2AB 4V02A 1IVSA 4FFWA 4QVIA 1KY5A 2WP0A 5F1OA 2F43A 3V1KA 1DAOA 5DIZA 5E7MA 4BVLA 2P9CA 2Q4DA 2XXAA 4R2XA 1U7WA 2ZDHA 4X6YA 4BNGA 3C6MA 3TQSA 3GEPA 3ZD6A 1JEQB 3T1VA 3VZDA 5FBWB 3ZE0B 1VA4A 1MJHA 2D59A 2RSLA 3G0IA 4G01B 1N77A 3FUTA 1PZFA 3I04A 1OHHA 1YBVA 3SC3A 1TEVA 3VJLA 1JQBA 4D9JA 4DJDC 2DFVA 1BD4A 2MSEB 3M2PA 1SVKA 1XDWA 4D3SA 1WBBA 4HNSA 4W63A 3HN2A 3KJZA 1UQTA 2DHDA 3CXUA 3GEGA 4PC3A 4QOGA 4B0PA 4P4LA 1R18A 3BWCA 4DJEC 3N8HA 3W2EA 2K6GA 3TRKA 1VSUA 2XHEA 4HEQA 3ZY3A 1SVSA 2GTIA 1I36A 5C3MA 1J42A 2E5WA 4EELA 4LF6B 3VJKA 1YA4A 2V4UA 5IDXA 5F33A 1DKUA 2FFQA 2AVDA 2HH9A 2GETA 1YS2X 1AKVA 2K2WA 5AKGA 1ECBA 2HWKA 3HG7A 4IZIA 4RGYA 4TYWA 4MLPA 2YW9A 3UMFA 4MVJD 3BXHA 1LVUA 5FPYA 4YR7A 1ZKMA 3L0ZA 2W6CX 3UMSA 2NVOA 2K7ZA 5EXCA 3GRRA 1PBTA 2QZPA 4MVJM 1VCMA 2DU8A 2J08A 4PTYA 3VPXA 1Y5LA 2FUG6 5CA0A 3T94A 1WNFA 1FJXA 4IHJB 1QQAA 3HO8A 4X97A 4R71A 3KQNA 3PNVA 4R1LA 1MBZA 3EEIA 3ZV6A 4BYGA 1RP7A 2XNSA 3I42A 2KM1A 3ONFA 2BTQB 2VJPA 5EJIA 1D2EA 1XXHE 4G5RA 7ADHA 4CQNA 1LI7A 1AS3A 1U4SA 2DPLA 2HDHA 2FPKA 2H9AA 1HYBA 2IFTA 3MINB 4UJ5A 4KQHA 1UK7A 2ZTHA 3PHBE 1O95D 2JHAA 3NDBB 5AT1A 4UUPA 5JISA 1UUFA 3RD5A 2ODBA 3X43A 4P6VF 1OYWA 4G63A 4CM6A 2Q7XA 1I13A 1CDZA 2Q2QA 4I3FA 2EHJA 4D46A 3G2LA 4LRYA 3R7LA 1K89A 2YVQA 5KYNA 4TVBA 3FVVA 3S7TA 3VR3A 2GZ3A 3OTQA 4O4JF 3WA6A 4FFDA 5TARA 1JR4A 1QHNA 5JWHA 2W11A 3QWIA 4N7JA 5AK0A 4WHMA 1AD2A 3MGCA 4KAXA 1UMKA 2V45A 5FA8A 1RAHA 3MAGA 3ZV4A 4LDJA 5ER9A 1PJTA 1VHLA 1Z6PA 2BIFA 3ZQUA 3EOBI 1QHHA 1Z0FA 4M8IA 5G1PA 3LF4A 1GO2A 4DUYB 1EK2A 4FKBA 4Y2VA 2Q8QA 5CCDA 3W77A 3QE2A 2WC1A 4FLFA 4Q3CA 4XQGA 1RM3A 4ARIA 4Z9XA 1NULA 3F4BA 4BQOA 3G02A 1TYCA 2IHYA 4G07A 3BM5A 4R2WA 4M55A 1YDGA 3DJYA 4HQFA 1W88B 2J0VA 3WZMA 4A23A 1FNCA 1V1RA 4PNPA 4A6XA 3AU9A 4O2RA 1A1VA 4M54A 3EMKA 4RZXA 2I22A 3BT7A 2AJLI 3A1UA 3TZKA 4MUKA 4F8JA 1BN7A 2WTMA 3OIYA 4QUGA 5JSYA 4JROA 3HEAA 1PRYA 3X2SA 4QU9A 5A9TA 1Z26A 3WSTA 1FMJA 2HRZA 1C7JA 1HYHA 1IVNA 1KVSA 1QYIA 2X8AA 2XQGA 5DVZA 3GL9A 4EPWA 1EPUA 2ZJFA 1P0IA 3WL8A 1VHDA 3JV7A 2C7OA 4PZAA 1TUEA 3AJ8A 4KRFA 4E30A 2DMRA 2B5VA 3MSCA 5JMWA 3VO9A 3PEWA 2GVDC 1RT9A 1VP3A 2FMHA 3AHIA 3ONEA 2HIAA 1TZMA 2R65A 4HG2A 5BYJA 3THWB 3EGDB 1CZRA 4J0GA 2EERA 2PQ2A 4CKYA 5EEGA 1MB4A 2A3RA 1M5UA 2QRJA 4IKOA 1LD3A 4BN0A 1Q0TA 3NHSA 4G1VA 4ZO6A 4B09A 2IUYA 3ISVA 4EL5A 2BGNA 5JSQA 4MRAA 3TXAA 3ECSA 5AK3A 1IOVA 1VDZA 5ALKA 1FTNA 3H2BA 4NJOA 1X1DA 4H6XA 3LPLA 2C7PA 2RIPA 3DB2A 1AQYA 2UVPB 4V0RA 1C8VB 2G0TA 2HMYB 5AXBA 3WLNA 1ISRA 2ORYA 4RH1A 5BWLA 4PO3X 2PUDA 2P5UA 4LSZA 1KRWA 4YLGA 3LO5A 3HJNA 4WSOA 1DFIA 1JG4A 2VYQA 2GXUA 3PQ2A 4FXOA 3U2QA 4ZQFA 3HWX1 3EF3A 1R5NA 5GV8A 3OKFA 3R7BA 3OJ0A 5JAHA 5IK2A 1GLNA 2ZSBA 5EQDA 4DLZA 1T0IA 1BYUA 2FEKA 3QH4A 3IQXA 2VRWA 3A05A 3M34A 1Z3CA 3WLRA 3K0FB 4NJMB 2OA0A 3REQB 2VXBA 1RI3A 2RARA 1KI9A 3H65A 3H6GA 4EPYA 2J3EA 3HBNA 1NQOA 1EGMB 3CX6A 4TLAA 3UG6A 3AFNA 4OTZA 1YC2A 4UU7A 4XR4A 3ZWOA 5JAIA 3D2BA 2GUGA 1XA4A 1QH1A 2OGTA 2J3MA 4JR1A 4ZRDA 1FXUA 4Z2YA 5CB6A 5AIAA 5C51B 2B4QA 3D3EA 4NFSA 2HMUA 2YJ6A 3KSZO 2VXOA 2W2KA 4TWBA 5ALRA 4U02A 3WIVA 1KOFA 3AXTA 3QF4B 4UE6A 2VKTA 3GJYA 3VDXA 4DUPA 2CXTA 2OLEA 3HCPA 1T9DA 2FUCA 3GVXA 4IIEA 1U3DA 4BLSA 5DN6D 1QLHA 2PX5A 2X14A 4E7PA 5A0FA 1D6SA 1CJMA 3WJ7A 1EE2A 3SDSA 2EJTA 2ZZMA 3NBZC 5IX8A 3QJGA 1TM1E 2QTWB 1NNLA 2EFGA 2H1WA 3BUSA 3EXHB 4O1IA 5EIWA 4TTIA 4EHDA 1T4CB 2RH4A 2G40A 4CT0A 7ABPA 4OP2A 1YD7A 3RBVA 4BO7A 4CIAA 2ZYDA 2IT1A 4NCHA 1USGA 1NYLA 1I94B 4BPBA 2RAPA 3KZNA 1EDBA 1PYDA 2C78A 3UN1A 4P7GA 3V7UA 5CDYA 3IHWA 1W59A 4GI7A 3NNDA 3A0RB 4YJDA 4KFCA 5A03A 3DZHA 1EFRA 4RJKA 2RHLA 1J09A 2A5LA 4PO1A 2PMKA 2YFQA 2CNKA 1BMFA 3WWOA 1IH8A 2QG9A 3FYDA 1LLQA 3DF9A 4ZXPA 4EY8A 4JI7B 1NP3A 1O96B 1RTTA 3UJNA 1ISIA 3RAPR 3O9VA 4B6PA 1UK8A 2PWBA 2QAGA 1WMDA 4OXNA 3TQHA 1CK4A 1DJQA 2DRIA 2PYDA 2Y9MB 1MOPA 2QSYA 4LYGA 4Q7KA 4BCCA 4J49A 2PXXA 2E4UA 2PEYA 2REXB 1OZGA 3GY0A 3CN7A 1CF4A 4OATA 3WB9A 2GRAA 4FW8A 5CLIA 1A9XA 1V4VA 3UFBA 3F9CA 2NOAA 4IV0A 4YFVA 2QL6A 1O0BA 3VKHA 1WHSB 5BW4A 2REQB 1M2JA 3OI7A 5K8IA 1ST2A 2AN4A 4QDZA 1E0KA 3MWDB 4B75A 1YA8A 1P5ZB 1Z35A 4UFOA 1F1JA 3REQA 4LGYA 5FCDA 1G5FA 3X1KA 5CB8A 5EJ6A 2NGRA 4XVHA 1P1HA 4R9NA 4LJ8A 4TM7A 4TKZA 4DMGA 1E3WA 4FHCA 3VSDA 4P98A 4BMSA 3H97A 3OIWA 1YHYA 1A5BB 1DXHA 3EUEA 3QPBA 4QBTA 4EHKA 3L8DA 4YMWA 3TECE 5BWCA 1OLUB 3RHFA 5ECGC 3GJTA 3C8HA 4M9QA 1UXGA 5FUXA 3T3PB 1HTBA 1WCV1 4E5DA 5FKJA 1AM4D 4BQRA 5EP3A 4D9KA 2VJCA 1JA1A 1VB5A 3OFSA 1A4UA 5KTMA 1ZI9A 2F48A 4NWIA 3U48A 3IBFA 1NN3A 2BLNA 1XEAA 2C5LA 1AB6A 4N41A 2HRQA 3W5JA 3VNAA 1AF7A 3H99A 4F4DA 2DFNA 3HXKA 3Q7TA 5FIUA 4AZTA 3OJCA 1DBWA 4P22A 2MSNA 4DR6B 1F17A 3EIHA 2HREA 4GSYA 4Q47A 3PSHA 5FQOA 2IP4A 4IO1A 1F7VA 1XAIA 3O7MA 3CISA 2OHFA 4LE1A 5DHPA 4C2TA 2P1DA 4WDRA 3R9IA 3WA7A 1DDIA 2QR3A 2O4CA 4R6WA 3CFHL 4Q19A 4BFVA 5CDUA 1XHEA 1XU4A 1BMQA 2V6JA 3BSFA 4Z0HO 4Z3DA 2XB6A 3WGLA 3DTTA 4ZC1A 3SZOA 3PT5A 1I2ZA 3E9NA 2QPLA 4UBKA 4EKIA 4Q4CA 1BCRA 1E69A 3DKRA 3KOMA 4YAUA 2J09A 3ADCA 3SS8A 1YZ3A 2AZDA 4NEQA 4KQJA 3R9KA 3WYEA 3V8MA 1F8FA 3MLAA 4BPRA 4BX0A 5MGBA 3VV3A 4PICA 4QWWA 4ZWNA 4DA0A 2GCNA 3S40A 3C5WP 1GZDA 4TV9A 3FG9A 1K9SA 4BV2A 2WG0A 4OQFA 3VR5H 5G3YA 4ZVPA 4MUHA 1EFTA 16PKA 4PSKA 4C4ZA 1HEIA 3ABIA 4Q1FA 1TFUA 1ZR2A 2WBLC 1Z4MA 2GDJA 4Q7LA 2B6HA 2GEBA 2OP0A 4R05A 1RAFA 5CFOA 3CF0A 1GL7A 1HDIA 4PC7A 5JNUA 3ZE9A 1ZUD1 2P79A 1K8RA 3EA5A 1NVEA 4IIGA 4LWPA 3L40A 4KR7A 5IJ9A 5B3KA 2G5ZA 3ITKA 4C7OB 4HLDA 4GP6A 4A2PA 2JCYA 3RVPA 1JR6A 1TU0A 2YWHA 3BXFA 3HDHA 2RGXA 3V4FA 1HT2E 3JQAB 4UCWA 3FTDA 4ZAGA 2ZCVA 5LU9A 1N1DA 1CYEA 3W5AA 3G23A 4BY9E 3D6VA 5JANA 5FI1B 3FPCA 3EWSA 4YYZA 1N6OA 1ZJZA 3QA3E 4HADA 5GVRA 2NO6A 2ORVA 4EYSA 4X66B 2AZ4A 3DMTA 4KLCA 4N1AA 1F3LA 4Q21A 3DMTC 1DAGA 3JWGA 4DMFA 1BWPA 1H0RA 2KPOA 3OCUA 4LHZA 4LNUA 5REQA 1LB1B 1XNHA 3NTQA 3PJDA 2DTXA 4HFMA 3S1LA 1QNLA 4C6RA 1A3CA 1UBCA 2OCLA 3GBPA 1GTG1 3ABQB 1XJ0A 3OWHA 4CCYB 2NZYA 2R9VA 3HB5X 2NMVA 5FRDA 3DOHA 3LQQA 1AGXA 3FHOA 1P4JA 1S2MA 4Q0MA 5G0VA 3UF0A 3R9XB 3B6EA 4TKLA 4D9BA 4MPDA 3ANLA 3VR6D 1NG1A 1IATA 1NBAA 1E3QA 2XCIA 3SF8A 4E33A 4PIMA 4B3MB 4BOYA 1M2WA 2FXVA 1ZWKA 5GP1A 1GPBA 3OOEA 3OZDA 2PZBA 2PSDA 1RAGA 1WZCA 1ND5A 3IBGA 4S04A 2PUHA 1MW8X 1NUSA 2ZBQA 3K6KA 2I78A 4DMLA 4AKIA 3NH9A 2JI8A 2WTUA 1BHQ1 2VNHA 3X1ZA 4RZHA 3CLTC 3RKRA 4P7KA 4H1WA 4ES6A 2R85A 4M7WA 1E7QA 1FP7A 2ABWA 5IDYA 2VSQA 2R1UA 2AYZA 5AVOA 3AEKB 1Q7TA 3A36A 3GA5A 5DI3B 2PX6A 4X8LA 5HOQA 1SH7A 3NC4A 3R3VA 3O93A 1MB2A 3ZU5A 4M6WB 4FGJA