2RETA

The crystal structure of a binary complex of two pseudopilins: epsi and epsj from the type 2 secretion system of vibrio vulnificus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
84
structure length
84
Chain Sequence
TVGYLEQKMFAAMVADNQMAMVMLNPKNLKASNGEEELAGQTWYWKVAPVATTQPLLKAFDVSVAATTQASPIITVRSYVASEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudopilin EpsI
publication title The crystal structure of a binary complex of two pseudopilins: EpsI and EpsJ from the type 2 secretion system of Vibrio vulnificus.
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Protein transport
total genus 12
structure length 84
sequence length 84
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02501 T2SSI Type II secretion system (T2SS), protein I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.30 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 GSPII I/J protein-like 2retA00
2GR7A 2RETA 3CI0K 3CFIA 2LMEA 3EMOA 5BW0B 3CI0I 2GR8A
chains in the Genus database with same CATH superfamily
2G5ZA 3IUBA 2A52A 4MUIA 3LE8A 2A56A 3EMOA 4MUKA 1UFVA 5KWVA 4MQ6A 2A7XA 2A86A 4IXJA 3CI0I 2A53A 2G16A 3IMEA 3UY4A 3Q12A 4G5FA 4BHRA 3CI0K 4DDMA 5HG0A 3MXTA 3QTTA 3IUEA 2GW4A 1MOPA 1IHOA 3LF4A 3Q10A 4EFKA 2GR8A 2GR7A 4MUFA 1N2JA 3CFFL 3CFAL 3IMCA 3IODA 4MUHA 3UA0A 2RETA 4G5YA 4MUGA 5BW0B 3IOBA 1N2EA 2X3FA 2A50A 1N2GA 3IOCA 3COYA 5EXCA 2A88A 4MULA 1N2HA 3UK2A 4DE5A 3IMGA 2A84A 3IOEA 4MUEA 3INNA 3AG5A 3IVXA 3AG6A 3ISJA 2G2SA 3HL6A 2A54A 3N8HA 3CFHL 1N2OA 2LMEA 3COWA 2I52A 3COVA 4DDKA 3MUEA 2EJCA 2OGFA 1V8FA 3CFIA 4EF6A 3IVGA 4DDHA 5G2FA 3COZA 2G3DA 1N2BA 4MUNA 4MUJA 2IECA 1N2IA 4FZJA 3IVCA
chains in the Genus database with same CATH topology
2GR7A 2RETA 3CI0K 3CFIA 2LMEA 3CI0J 3EMOA 5BW0B 3CI0I 2GR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GR7 A;  2RET A;  3CI0 K;  3CFI A;  2LME A;  3EMO A;  5BW0 B;  3CI0 I;  2GR8 A; 
#chains in the Genus database with same CATH topology
 2G5Z A;  3IUB A;  2A52 A;  4MUI A;  3LE8 A;  2A56 A;  3EMO A;  4MUK A;  1UFV A;  5KWV A;  4MQ6 A;  2A7X A;  2A86 A;  4IXJ A;  3CI0 I;  2A53 A;  2G16 A;  3IME A;  3UY4 A;  3Q12 A;  4G5F A;  4BHR A;  3CI0 K;  4DDM A;  5HG0 A;  3MXT A;  3QTT A;  3IUE A;  2GW4 A;  1MOP A;  1IHO A;  3LF4 A;  3Q10 A;  4EFK A;  2GR8 A;  2GR7 A;  4MUF A;  1N2J A;  3CFF L;  3CFA L;  3IMC A;  3IOD A;  4MUH A;  3UA0 A;  2RET A;  4G5Y A;  4MUG A;  5BW0 B;  3IOB A;  1N2E A;  2X3F A;  2A50 A;  1N2G A;  3IOC A;  3COY A;  5EXC A;  2A88 A;  4MUL A;  1N2H A;  3UK2 A;  4DE5 A;  3IMG A;  2A84 A;  3IOE A;  4MUE A;  3INN A;  3AG5 A;  3IVX A;  3AG6 A;  3ISJ A;  2G2S A;  3HL6 A;  2A54 A;  3N8H A;  3CFH L;  1N2O A;  2LME A;  3COW A;  2I52 A;  3COV A;  4DDK A;  3MUE A;  2EJC A;  2OGF A;  1V8F A;  3CFI A;  4EF6 A;  3IVG A;  4DDH A;  5G2F A;  3COZ A;  2G3D A;  1N2B A;  4MUN A;  4MUJ A;  2IEC A;  1N2I A;  4FZJ A;  3IVC A; 
#chains in the Genus database with same CATH homology
 2GR7 A;  2RET A;  3CI0 K;  3CFI A;  2LME A;  3CI0 J;  3EMO A;  5BW0 B;  3CI0 I;  2GR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...