The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
20
|
sequence length |
84
|
structure length |
81
|
Chain Sequence |
TAAQAYVRNVATAVEAERDPTTGALPQLPQACDQFVANPPASVTQCNVTANNDGVNFTVTAQLTYGSVSFDSSTGQFSFQL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure and Assembly of an Inner Membrane Platform for Initiation of Type Iv Pilus Biogenesis
pubmed doi rcsb |
molecule tags |
Cell adhesion
|
source organism |
Thermus thermophilus
|
molecule keywords |
PILIN, TYPE IV
|
total genus |
20
|
structure length |
81
|
sequence length |
84
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2013-04-05 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF18682 | PilA4 | Pilin A4 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Pantoate--beta-alanine Ligase; Chain: A,domain 2 | Pantoate--beta-alanine Ligase; Chain: A,domain 2 |
#chains in the Genus database with same CATH superfamily 4BHR A; 5G2F A; #chains in the Genus database with same CATH topology 2A84 A; 4DDK A; 1IHO A; 4BHR A; 2I52 A; 3AG6 A; 3LE8 A; 3IVX A; 2OGF A; 3ISJ A; 5BW0 B; 5KWV A; 3IUE A; 2GR8 A; 3IUB A; 2X3F A; 3MXT A; 1N2H A; 1MOP A; 5EXC A; 4MUH A; 3LF4 A; 4MUF A; 3Q12 A; 2A86 A; 4MUL A; 4MUK A; 1N2G A; 4MUJ A; 2IEC A; 3IMG A; 3IVC A; 2G2S A; 2A56 A; 3IOD A; 3CFH L; 2GR7 A; 3N8H A; 4G5Y A; 3UK2 A; 2A53 A; 2A88 A; 3COW A; 2LME A; 2EJC A; 3CFF L; 3IOE A; 4G5F A; 2RET A; 4MUI A; 4FZJ A; 4DDH A; 3CFI A; 3INN A; 3CI0 K; 3COZ A; 4MUE A; 4DDM A; 4EF6 A; 5G2F A; 4MQ6 A; 3IOB A; 3QTT A; 3UA0 A; 4IXJ A; 1N2O A; 4DE5 A; 2G16 A; 4MUG A; 3COY A; 3CI0 I; 3COV A; 1N2B A; 3UY4 A; 3Q10 A; 2A50 A; 3MUE A; 2GW4 A; 1N2E A; 3EMO A; 1N2I A; 5HG0 A; 1UFV A; 3IVG A; 2G5Z A; 3IMC A; 3CFA L; 3AG5 A; 2A7X A; 3HL6 A; 2A52 A; 2G3D A; 4MUN A; 3IME A; 4EFK A; 1V8F A; 3IOC A; 1N2J A; 2A54 A; #chains in the Genus database with same CATH homology 2A84 A; 4DDK A; 1IHO A; 4BHR A; 3AG6 A; 3LE8 A; 3IVX A; 3ISJ A; 5KWV A; 3IUE A; 3IUB A; 2X3F A; 3MXT A; 1N2H A; 1MOP A; 5EXC A; 4MUH A; 3LF4 A; 4MUF A; 3Q12 A; 2A86 A; 4MUL A; 4MUK A; 1N2G A; 4MUJ A; 3IMG A; 3IVC A; 2G2S A; 2A56 A; 3IOD A; 3CFH L; 3N8H A; 4G5Y A; 3UK2 A; 2A53 A; 2A88 A; 3COW A; 2EJC A; 3CFF L; 3IOE A; 4G5F A; 4MUI A; 4FZJ A; 4DDH A; 3INN A; 3COZ A; 4MUE A; 4DDM A; 4EF6 A; 5G2F A; 4MQ6 A; 3IOB A; 3QTT A; 3UA0 A; 4IXJ A; 1N2O A; 4DE5 A; 2G16 A; 4MUG A; 3COY A; 3COV A; 1N2B A; 3UY4 A; 3Q10 A; 2A50 A; 3MUE A; 2GW4 A; 1N2E A; 1N2I A; 5HG0 A; 1UFV A; 3IVG A; 2G5Z A; 3IMC A; 3CFA L; 3AG5 A; 2A7X A; 3HL6 A; 2A52 A; 2G3D A; 4MUN A; 3IME A; 4EFK A; 1V8F A; 3IOC A; 1N2J A; 2A54 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...