The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
22
|
sequence length |
86
|
structure length |
86
|
Chain Sequence |
ANLAAGQSYVRNVALALEAQRDPSTGALPTHLTDCLSGFGQRPKTVTACTITYLNALDYVIEASLDGAALKKVVYKSSDGTLTSLP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structures of Type Iv Pilins from Thermus Thermophilus Demonstrate Similarities with Type II Secretion System Pseudopilins
pubmed doi rcsb |
molecule tags |
Unknown function
|
source organism |
Thermus thermophilus
|
molecule keywords |
TYPE-IV LIKE PILIN TTHA1222
|
total genus |
22
|
structure length |
86
|
sequence length |
86
|
chains with identical sequence |
B, C
|
ec nomenclature | |
pdb deposition date | 2016-04-07 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF18682 | PilA4 | Pilin A4 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Pantoate--beta-alanine Ligase; Chain: A,domain 2 | Pantoate--beta-alanine Ligase; Chain: A,domain 2 |
#chains in the Genus database with same CATH superfamily 4BHR A; 5G2F A; #chains in the Genus database with same CATH topology 4EFK A; 3IME A; 3UY4 A; 3IUB A; 1N2B A; 5G2F A; 2GR8 A; 3CFA L; 3IOD A; 1N2O A; 2A53 A; 1UFV A; 2IEC A; 5BW0 B; 2OGF A; 4DE5 A; 1N2G A; 4DDH A; 1IHO A; 2G2S A; 2A52 A; 3MXT A; 4MUF A; 3INN A; 1N2I A; 2X3F A; 2A88 A; 3COV A; 4IXJ A; 2LME A; 4MUI A; 3QTT A; 3LF4 A; 2G3D A; 4MUL A; 3LE8 A; 3CI0 K; 4MUH A; 3CI0 I; 4MUG A; 3N8H A; 3IVC A; 2G5Z A; 2GR7 A; 3AG6 A; 2RET A; 2A56 A; 3Q12 A; 2A86 A; 3IUE A; 1N2J A; 3IOB A; 3MUE A; 3IMC A; 2A7X A; 4DDK A; 1N2H A; 3IOE A; 3ISJ A; 3COW A; 1N2E A; 4DDM A; 4MUJ A; 3HL6 A; 4MUN A; 3CFH L; 3IVG A; 4EF6 A; 3IVX A; 2EJC A; 3CFF L; 3IOC A; 2G16 A; 3IMG A; 4MUE A; 2GW4 A; 4FZJ A; 3CFI A; 4G5Y A; 3AG5 A; 1MOP A; 4G5F A; 2A84 A; 4MUK A; 2I52 A; 5EXC A; 1V8F A; 3UK2 A; 3Q10 A; 5KWV A; 3COY A; 3COZ A; 4BHR A; 2A50 A; 2A54 A; 5HG0 A; 4MQ6 A; 3EMO A; 3UA0 A; #chains in the Genus database with same CATH homology 4EFK A; 3IME A; 3UY4 A; 3IUB A; 1N2B A; 5G2F A; 3IOD A; 3CFA L; 1N2O A; 2A53 A; 1UFV A; 4DE5 A; 1N2G A; 4DDH A; 1IHO A; 2G2S A; 2A52 A; 3MXT A; 4MUF A; 3INN A; 1N2I A; 2X3F A; 2A88 A; 3COV A; 4IXJ A; 4MUI A; 3QTT A; 3LF4 A; 2G3D A; 4MUL A; 3LE8 A; 4MUH A; 4MUG A; 3N8H A; 3IVC A; 2G5Z A; 3AG6 A; 2A56 A; 3Q12 A; 2A86 A; 3IUE A; 1N2J A; 3IOB A; 3MUE A; 3IMC A; 2A7X A; 4DDK A; 1N2H A; 3IOE A; 3ISJ A; 3COW A; 1N2E A; 4DDM A; 4MUJ A; 3HL6 A; 4MUN A; 3CFH L; 3IVG A; 4EF6 A; 3IVX A; 2EJC A; 3CFF L; 3IOC A; 2G16 A; 3IMG A; 4MUE A; 2GW4 A; 4FZJ A; 4G5Y A; 3AG5 A; 1MOP A; 4G5F A; 2A84 A; 4MUK A; 5EXC A; 1V8F A; 3UK2 A; 3Q10 A; 5KWV A; 3COY A; 3COZ A; 4BHR A; 2A50 A; 2A54 A; 5HG0 A; 4MQ6 A; 3UA0 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...