5K1SA

Crystal structure of aibc
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
358
structure length
358
Chain Sequence
HHHHHAENLYFQGHMKAVVLRSFGEAGNLKMETMPMPRPGRGEVLLRVHACGVCYHDVINRRGNLPRTSVPAILGHEAAGEVIEVGPDTPGWKTGDRAATLQRMSCGDCALCRSGRNSLCKTDNRFFGEELPGGYAQFMVAPVGGLGRVPASLPWNEAATVCCTTGTAVHTVRTRGKVRAGETVLITGASGGVGLSSVQLARLDGARVIAVTSSEAKVQALKEAGADEVIVSRGLDFASDVRKRTQGAGVDVAVEIVGSATFDQTLKSMAPGGRVVVVGNLESGMVQLNPGLVIVKELEILGAYATTQAELDEALRLTATGGVRQFVTDAVPLAEAAKAHFRLENREVAGRLVLVPPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of AibC, a reductase involved in alternative de novo isovaleryl coenzyme A biosynthesis in Myxococcus xanthus.
pubmed doi rcsb
source organism Myxococcus xanthus (strain dk 1622)
molecule tags Oxidoreductase
molecule keywords Oxidoreductase, zinc-binding dehydrogenase family
total genus 104
structure length 358
sequence length 358
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 5k1sA00
4Z6KA 4RQTA 3OQ6A 2B5VA 1N9GB 5H82A 1QV6A 1TEHA 4HFMA 3IP1A 2CF5A 3NX4A 1GUFA 4JBGA 1V3TA 4NFSA 3WIDA 3WNQA 3B70A 2FZWA 5CDTA 2FZEA 1MP0A 1P0FA 4W82A 5KJ1A 3IUPA 1NTOA 1MGOA 2Y05A 3JV7A 3WLFA 4JBIA 2NVBA 4A0SA 1U3VA 2ZB7A 1E3JA 1H0KA 1O89A 3GAZA 1KEVA 1YKFA 1PEDA 2XAAA 1HSZA 2OHXA 1KOLA 1GYRA 1U3UA 2W98A 1IZ0A 3HZZA 2EJVA 5FI3A 5A3JA 4MKRA 3TWOA 4DXHA 1F8FA 1JVBA 4DVJA 1ADCA 3QJ5A 1U3WA 1MC5A 4EJ6A 1AXEA 3QWBA 2VWGA 5DP2A 1MA0A 1H2BA 1BXZA 2CD9A 1R37A 2ZB3A 3GOHA 1D1SA 4JJIA 5FI5A 4DL9A 1LDEA 1HETA 4EJMA 3HUDA 3GMSA 1JU9A 2EIHA 1HDYA 4JLWA 5K1SA 4IDEA 1ADBA 2DPHA 1ADFA 4GKVA 4NFHA 1UUFA 4WE3A 4DLBA 4ILKA 1HDXA 4B7CA 1PL8A 2H6EA 3COSA 3WLEA 4A10A 5ADHA 5KIAA 2CDBA 1HEUA 1LDYA 1V3VA 1Y9AA 2D8AA 4A2CA 7ADHA 1DEHA 1AGNA 4EEXA 5A3VA 3QE3A 1N92A 2VNAA 3S2FA 4L0QA 3BTOA 4NH4A 2JHFA 4XD2A 3WIEA 4CPDA 5KJ6A 2W4QA 5DOZA 6ADHA 1PIWA 1QLJA 4C4OA 1ZSYA 1RJWA 1QORA 3WICA 1VJ0A 1XA0A 1E3LA 5H83A 2J3KA 2VWPA 4DUPA 4EYEA 3S2IA 3GQVA 2EERA 1NVGA 1YQXA 3JYLA 4IDAA 1PL6A 3KRTA 3UKOA 2VN8A 4JBHA 4EEZA 4WGGA 1N8KA 3GFBA 3SLKA 3JYNA 2VZ9A 4GI2A 3B6ZA 4RQUA 1A72A 1WLYA 3PI7A 1E3IA 5A4DA 1YB5A 1V3UA 5CDUA 1P0CA 1PL7A 2B5WA 4IDCA 2C0CA 2CF6A 1D1TA 4B7XA 5KCZA 1A71A 2OUIA 5CDGA 1Y9EA 4W9NA 1TT7A 2B83A 4W6ZA 5DP1A 5KJCA 1JQBA 2J3IA 3FTNA 8ADHA 2DFVA 5DOVA 3M6IA 2OXIA 2VWQA 4W9NC 3S1LA 1M6WA 2X1HA 4OH1A 4JXKA 3UOGA 5KJFA 1ZSVA 5TNXA 2CDCA 4RVSA 3FPLA 5KJEA 2X7HA 1O8CA 2CDAA 2WEKA 4OAQA 3FPCA 2DQ4A 4WASA 2DM6A 1HDZA 3S2GA 5CDSA 1ADGA 1VJ1A 3MEQA 5ENVA 1E3EA 4UEJA 1HLDA 1PS0A 1YQDA 2J8ZA 4IDDA 4J6FA 3QWAA 5H81A 1BTOA 2ZB8A 4GL4A 1CDOA 1QV7A 1MG0A 2J3HA 1IYZA 3FSRA 2VZ8A 3FBGA 4UEOA 2VCYA 1HT0A 4UEKA 1QLHA 3TQHA 1P1RA 4W99A 1HSOA 4HFNA 4IDFA 4RVUA 1EE2A 1N9GA 1LLUA 2VWHA 2ZB4A 4DLAA 1GU7A 4DWVA 1M6HA 2OBYA 4IDBA 1YE3A 4NG5A 1AXGA 3PIIA 2J3JA 4HFJA 2JHGA 1HF3A 4A27A 3I4CA 1Q1NA 1U3TA 1HTBA 3S2EA
chains in the Genus database with same CATH superfamily
4Z6KA 4RQTA 3OQ6A 2B5VA 1N9GB 5H82A 1QV6A 1TEHA 4HFMA 3IP1A 2CF5A 3NX4A 1GUFA 4JBGA 1V3TA 4NFSA 3WIDA 3WNQA 3B70A 2FZWA 5CDTA 2FZEA 1MP0A 1P0FA 4W82A 5KJ1A 3IUPA 1NTOA 1MGOA 2Y05A 3JV7A 3WLFA 4JBIA 2NVBA 4A0SA 1U3VA 2ZB7A 1E3JA 1H0KA 1O89A 3GAZA 1KEVA 1YKFA 1PEDA 2XAAA 1HSZA 2OHXA 1KOLA 1GYRA 1U3UA 2W98A 1IZ0A 3HZZA 2EJVA 5FI3A 5A3JA 4MKRA 3TWOA 4DXHA 1F8FA 1JVBA 4DVJA 1ADCA 3QJ5A 1U3WA 1MC5A 4EJ6A 1AXEA 3QWBA 2VWGA 5DP2A 1MA0A 1H2BA 1BXZA 2CD9A 1R37A 2ZB3A 3GOHA 1D1SA 4JJIA 5FI5A 4DL9A 1LDEA 1HETA 4EJMA 3HUDA 3GMSA 1JU9A 2EIHA 1HDYA 4JLWA 5K1SA 4IDEA 1ADBA 2DPHA 1ADFA 4GKVA 4NFHA 1UUFA 4WE3A 4DLBA 4ILKA 1HDXA 4B7CA 1PL8A 2H6EA 3COSA 3WLEA 4A10A 5ADHA 5KIAA 2CDBA 1HEUA 1LDYA 1V3VA 1Y9AA 2D8AA 4A2CA 7ADHA 1DEHA 1AGNA 4EEXA 5A3VA 3QE3A 1N92A 2VNAA 3S2FA 4L0QA 3BTOA 4NH4A 2JHFA 4XD2A 3WIEA 4CPDA 5KJ6A 2W4QA 5DOZA 6ADHA 1PIWA 1QLJA 4C4OA 1ZSYA 1RJWA 1QORA 3WICA 1VJ0A 1XA0A 1E3LA 5H83A 2J3KA 2VWPA 4DUPA 4EYEA 3S2IA 3GQVA 2EERA 1NVGA 1YQXA 3JYLA 4IDAA 1PL6A 3KRTA 3UKOA 2VN8A 4JBHA 4EEZA 4WGGA 1N8KA 3GFBA 3SLKA 3JYNA 2VZ9A 4GI2A 3B6ZA 4RQUA 1A72A 1WLYA 3PI7A 1E3IA 5A4DA 1YB5A 1V3UA 5CDUA 1P0CA 1PL7A 2B5WA 4IDCA 2C0CA 2CF6A 1D1TA 4B7XA 5KCZA 1A71A 2OUIA 5CDGA 1Y9EA 4W9NA 1TT7A 2B83A 4W6ZA 5DP1A 5KJCA 1JQBA 2J3IA 3FTNA 8ADHA 2DFVA 5DOVA 3M6IA 2OXIA 2VWQA 4W9NC 3S1LA 1M6WA 2X1HA 4OH1A 4JXKA 3UOGA 5KJFA 1ZSVA 5TNXA 2CDCA 4RVSA 3FPLA 5KJEA 2X7HA 1O8CA 2CDAA 2WEKA 4OAQA 3FPCA 2DQ4A 4WASA 2DM6A 1HDZA 3S2GA 5CDSA 1ADGA 1VJ1A 3MEQA 5ENVA 1E3EA 4UEJA 1HLDA 1PS0A 1YQDA 2J8ZA 4IDDA 4J6FA 3QWAA 5H81A 1BTOA 2ZB8A 4GL4A 1CDOA 1QV7A 1MG0A 2J3HA 1IYZA 3FSRA 2VZ8A 3FBGA 4UEOA 2VCYA 1HT0A 4UEKA 1QLHA 3TQHA 1P1RA 4W99A 1HSOA 4HFNA 4IDFA 4RVUA 1EE2A 1N9GA 1LLUA 2VWHA 2ZB4A 4DLAA 1GU7A 4DWVA 1M6HA 2OBYA 4IDBA 1YE3A 4NG5A 1AXGA 3PIIA 2J3JA 4HFJA 2JHGA 1HF3A 4A27A 3I4CA 1Q1NA 1U3TA 1HTBA 3S2EA
chains in the Genus database with same CATH topology
4Z6KA 4RQTA 3OQ6A 2B5VA 1N9GB 5H82A 1QV6A 1TEHA 4HFMA 3IP1A 2CF5A 3NX4A 1GUFA 4JBGA 1V3TA 4NFSA 3WIDA 3WNQA 3B70A 2FZWA 5CDTA 2FZEA 1MP0A 1P0FA 4W82A 5KJ1A 3IUPA 1NTOA 1MGOA 2Y05A 3JV7A 3WLFA 4JBIA 2NVBA 4A0SA 1U3VA 2ZB7A 1E3JA 1H0KA 1O89A 3GAZA 1KEVA 1YKFA 1PEDA 2XAAA 1HSZA 2OHXA 1KOLA 1GYRA 1U3UA 2W98A 1IZ0A 3HZZA 2EJVA 5FI3A 5A3JA 4MKRA 3TWOA 4DXHA 1F8FA 1JVBA 4DVJA 1ADCA 3QJ5A 1U3WA 1MC5A 4EJ6A 1AXEA 3QWBA 2VWGA 5DP2A 1MA0A 1H2BA 1BXZA 2CD9A 1R37A 2ZB3A 3GOHA 1D1SA 4JJIA 5FI5A 4DL9A 1LDEA 1HETA 4EJMA 3HUDA 3GMSA 1JU9A 2EIHA 1HDYA 4JLWA 5K1SA 4IDEA 1ADBA 2DPHA 1ADFA 4GKVA 4NFHA 1UUFA 4WE3A 4DLBA 4ILKA 1HDXA 4B7CA 1PL8A 2H6EA 3COSA 3WLEA 4A10A 5ADHA 5KIAA 2CDBA 1HEUA 1LDYA 1V3VA 1Y9AA 2D8AA 4A2CA 7ADHA 1DEHA 1AGNA 4EEXA 5A3VA 3QE3A 1N92A 2VNAA 3S2FA 4L0QA 3BTOA 4NH4A 2JHFA 4XD2A 3WIEA 4CPDA 5KJ6A 2W4QA 5DOZA 6ADHA 1PIWA 1QLJA 4C4OA 1ZSYA 1RJWA 1QORA 3WICA 1VJ0A 1XA0A 1E3LA 5H83A 2J3KA 2VWPA 4DUPA 4EYEA 3S2IA 3GQVA 2EERA 1NVGA 1YQXA 3JYLA 4IDAA 1PL6A 3KRTA 3UKOA 2VN8A 4JBHA 4EEZA 4WGGA 1N8KA 3GFBA 3SLKA 3JYNA 2VZ9A 4GI2A 3B6ZA 4RQUA 1A72A 1WLYA 3PI7A 1E3IA 5A4DA 1YB5A 1V3UA 5CDUA 1P0CA 1PL7A 2B5WA 4IDCA 2C0CA 2CF6A 1D1TA 4B7XA 5KCZA 1A71A 2OUIA 5CDGA 1Y9EA 4W9NA 1TT7A 2B83A 4W6ZA 5DP1A 5KJCA 1JQBA 2J3IA 3FTNA 8ADHA 2DFVA 5DOVA 3M6IA 2OXIA 2VWQA 4W9NC 3S1LA 1M6WA 2X1HA 4OH1A 4JXKA 3UOGA 5KJFA 1ZSVA 5TNXA 2CDCA 4RVSA 3FPLA 5KJEA 2X7HA 1O8CA 2CDAA 2WEKA 4OAQA 3FPCA 2DQ4A 4WASA 2DM6A 1HDZA 3S2GA 5CDSA 1ADGA 1VJ1A 3MEQA 5ENVA 1E3EA 4UEJA 1HLDA 1PS0A 1YQDA 2J8ZA 4IDDA 4J6FA 3QWAA 5H81A 1BTOA 2ZB8A 4GL4A 1CDOA 1QV7A 1MG0A 2J3HA 1IYZA 3FSRA 2VZ8A 3FBGA 4UEOA 2VCYA 1HT0A 4UEKA 1QLHA 3TQHA 1P1RA 4W99A 1HSOA 4HFNA 4IDFA 4RVUA 1EE2A 1N9GA 1LLUA 2VWHA 2ZB4A 4DLAA 1GU7A 4DWVA 1M6HA 2OBYA 4IDBA 1YE3A 4NG5A 1AXGA 3PIIA 2J3JA 4HFJA 2JHGA 1HF3A 4A27A 3I4CA 1Q1NA 1U3TA 1HTBA 3S2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z6K A;  4RQT A;  3OQ6 A;  2B5V A;  1N9G B;  5H82 A;  1QV6 A;  1TEH A;  4HFM A;  3IP1 A;  2CF5 A;  3NX4 A;  1GUF A;  4JBG A;  1V3T A;  4NFS A;  3WID A;  3WNQ A;  3B70 A;  2FZW A;  5CDT A;  2FZE A;  1MP0 A;  1P0F A;  4W82 A;  5KJ1 A;  3IUP A;  1NTO A;  1MGO A;  2Y05 A;  3JV7 A;  3WLF A;  4JBI A;  2NVB A;  4A0S A;  1U3V A;  2ZB7 A;  1E3J A;  1H0K A;  1O89 A;  3GAZ A;  1KEV A;  1YKF A;  1PED A;  2XAA A;  1HSZ A;  2OHX A;  1KOL A;  1GYR A;  1U3U A;  2W98 A;  1IZ0 A;  3HZZ A;  2EJV A;  5FI3 A;  5A3J A;  4MKR A;  3TWO A;  4DXH A;  1F8F A;  1JVB A;  4DVJ A;  1ADC A;  3QJ5 A;  1U3W A;  1MC5 A;  4EJ6 A;  1AXE A;  3QWB A;  2VWG A;  5DP2 A;  1MA0 A;  1H2B A;  1BXZ A;  2CD9 A;  1R37 A;  2ZB3 A;  3GOH A;  1D1S A;  4JJI A;  5FI5 A;  4DL9 A;  1LDE A;  1HET A;  4EJM A;  3HUD A;  3GMS A;  1JU9 A;  2EIH A;  1HDY A;  4JLW A;  5K1S A;  4IDE A;  1ADB A;  2DPH A;  1ADF A;  4GKV A;  4NFH A;  1UUF A;  4WE3 A;  4DLB A;  4ILK A;  1HDX A;  4B7C A;  1PL8 A;  2H6E A;  3COS A;  3WLE A;  4A10 A;  5ADH A;  5KIA A;  2CDB A;  1HEU A;  1LDY A;  1V3V A;  1Y9A A;  2D8A A;  4A2C A;  7ADH A;  1DEH A;  1AGN A;  4EEX A;  5A3V A;  3QE3 A;  1N92 A;  2VNA A;  3S2F A;  4L0Q A;  3BTO A;  4NH4 A;  2JHF A;  4XD2 A;  3WIE A;  4CPD A;  5KJ6 A;  2W4Q A;  5DOZ A;  6ADH A;  1PIW A;  1QLJ A;  4C4O A;  1ZSY A;  1RJW A;  1QOR A;  3WIC A;  1VJ0 A;  1XA0 A;  1E3L A;  5H83 A;  2J3K A;  2VWP A;  4DUP A;  4EYE A;  3S2I A;  3GQV A;  2EER A;  1NVG A;  1YQX A;  3JYL A;  4IDA A;  1PL6 A;  3KRT A;  3UKO A;  2VN8 A;  4JBH A;  4EEZ A;  4WGG A;  1N8K A;  3GFB A;  3SLK A;  3JYN A;  2VZ9 A;  4GI2 A;  3B6Z A;  4RQU A;  1A72 A;  1WLY A;  3PI7 A;  1E3I A;  5A4D A;  1YB5 A;  1V3U A;  5CDU A;  1P0C A;  1PL7 A;  2B5W A;  4IDC A;  2C0C A;  2CF6 A;  1D1T A;  4B7X A;  5KCZ A;  1A71 A;  2OUI A;  5CDG A;  1Y9E A;  4W9N A;  1TT7 A;  2B83 A;  4W6Z A;  5DP1 A;  5KJC A;  1JQB A;  2J3I A;  3FTN A;  8ADH A;  2DFV A;  5DOV A;  3M6I A;  2OXI A;  2VWQ A;  4W9N C;  3S1L A;  1M6W A;  2X1H A;  4OH1 A;  4JXK A;  3UOG A;  5KJF A;  1ZSV A;  5TNX A;  2CDC A;  4RVS A;  3FPL A;  5KJE A;  2X7H A;  1O8C A;  2CDA A;  2WEK A;  4OAQ A;  3FPC A;  2DQ4 A;  4WAS A;  2DM6 A;  1HDZ A;  3S2G A;  5CDS A;  1ADG A;  1VJ1 A;  3MEQ A;  5ENV A;  1E3E A;  4UEJ A;  1HLD A;  1PS0 A;  1YQD A;  2J8Z A;  4IDD A;  4J6F A;  3QWA A;  5H81 A;  1BTO A;  2ZB8 A;  4GL4 A;  1CDO A;  1QV7 A;  1MG0 A;  2J3H A;  1IYZ A;  3FSR A;  2VZ8 A;  3FBG A;  4UEO A;  2VCY A;  1HT0 A;  4UEK A;  1QLH A;  3TQH A;  1P1R A;  4W99 A;  1HSO A;  4HFN A;  4IDF A;  4RVU A;  1EE2 A;  1N9G A;  1LLU A;  2VWH A;  2ZB4 A;  4DLA A;  1GU7 A;  4DWV A;  1M6H A;  2OBY A;  4IDB A;  1YE3 A;  4NG5 A;  1AXG A;  3PII A;  2J3J A;  4HFJ A;  2JHG A;  1HF3 A;  4A27 A;  3I4C A;  1Q1N A;  1U3T A;  1HTB A;  3S2E A; 
#chains in the Genus database with same CATH topology
 4Z6K A;  4RQT A;  3OQ6 A;  2B5V A;  1N9G B;  5H82 A;  1QV6 A;  1TEH A;  4HFM A;  3IP1 A;  2CF5 A;  3NX4 A;  1GUF A;  4JBG A;  1V3T A;  4NFS A;  3WID A;  3WNQ A;  3B70 A;  2FZW A;  5CDT A;  2FZE A;  1MP0 A;  1P0F A;  4W82 A;  5KJ1 A;  3IUP A;  1NTO A;  1MGO A;  2Y05 A;  3JV7 A;  3WLF A;  4JBI A;  2NVB A;  4A0S A;  1U3V A;  2ZB7 A;  1E3J A;  1H0K A;  1O89 A;  3GAZ A;  1KEV A;  1YKF A;  1PED A;  2XAA A;  1HSZ A;  2OHX A;  1KOL A;  1GYR A;  1U3U A;  2W98 A;  1IZ0 A;  3HZZ A;  2EJV A;  5FI3 A;  5A3J A;  4MKR A;  3TWO A;  4DXH A;  1F8F A;  1JVB A;  4DVJ A;  1ADC A;  3QJ5 A;  1U3W A;  1MC5 A;  4EJ6 A;  1AXE A;  3QWB A;  2VWG A;  5DP2 A;  1MA0 A;  1H2B A;  1BXZ A;  2CD9 A;  1R37 A;  2ZB3 A;  3GOH A;  1D1S A;  4JJI A;  5FI5 A;  4DL9 A;  1LDE A;  1HET A;  4EJM A;  3HUD A;  3GMS A;  1JU9 A;  2EIH A;  1HDY A;  4JLW A;  5K1S A;  4IDE A;  1ADB A;  2DPH A;  1ADF A;  4GKV A;  4NFH A;  1UUF A;  4WE3 A;  4DLB A;  4ILK A;  1HDX A;  4B7C A;  1PL8 A;  2H6E A;  3COS A;  3WLE A;  4A10 A;  5ADH A;  5KIA A;  2CDB A;  1HEU A;  1LDY A;  1V3V A;  1Y9A A;  2D8A A;  4A2C A;  7ADH A;  1DEH A;  1AGN A;  4EEX A;  5A3V A;  3QE3 A;  1N92 A;  2VNA A;  3S2F A;  4L0Q A;  3BTO A;  4NH4 A;  2JHF A;  4XD2 A;  3WIE A;  4CPD A;  5KJ6 A;  2W4Q A;  5DOZ A;  6ADH A;  1PIW A;  1QLJ A;  4C4O A;  1ZSY A;  1RJW A;  1QOR A;  3WIC A;  1VJ0 A;  1XA0 A;  1E3L A;  5H83 A;  2J3K A;  2VWP A;  4DUP A;  4EYE A;  3S2I A;  3GQV A;  2EER A;  1NVG A;  1YQX A;  3JYL A;  4IDA A;  1PL6 A;  3KRT A;  3UKO A;  2VN8 A;  4JBH A;  4EEZ A;  4WGG A;  1N8K A;  3GFB A;  3SLK A;  3JYN A;  2VZ9 A;  4GI2 A;  3B6Z A;  4RQU A;  1A72 A;  1WLY A;  3PI7 A;  1E3I A;  5A4D A;  1YB5 A;  1V3U A;  5CDU A;  1P0C A;  1PL7 A;  2B5W A;  4IDC A;  2C0C A;  2CF6 A;  1D1T A;  4B7X A;  5KCZ A;  1A71 A;  2OUI A;  5CDG A;  1Y9E A;  4W9N A;  1TT7 A;  2B83 A;  4W6Z A;  5DP1 A;  5KJC A;  1JQB A;  2J3I A;  3FTN A;  8ADH A;  2DFV A;  5DOV A;  3M6I A;  2OXI A;  2VWQ A;  4W9N C;  3S1L A;  1M6W A;  2X1H A;  4OH1 A;  4JXK A;  3UOG A;  5KJF A;  1ZSV A;  5TNX A;  2CDC A;  4RVS A;  3FPL A;  5KJE A;  2X7H A;  1O8C A;  2CDA A;  2WEK A;  4OAQ A;  3FPC A;  2DQ4 A;  4WAS A;  2DM6 A;  1HDZ A;  3S2G A;  5CDS A;  1ADG A;  1VJ1 A;  3MEQ A;  5ENV A;  1E3E A;  4UEJ A;  1HLD A;  1PS0 A;  1YQD A;  2J8Z A;  4IDD A;  4J6F A;  3QWA A;  5H81 A;  1BTO A;  2ZB8 A;  4GL4 A;  1CDO A;  1QV7 A;  1MG0 A;  2J3H A;  1IYZ A;  3FSR A;  2VZ8 A;  3FBG A;  4UEO A;  2VCY A;  1HT0 A;  4UEK A;  1QLH A;  3TQH A;  1P1R A;  4W99 A;  1HSO A;  4HFN A;  4IDF A;  4RVU A;  1EE2 A;  1N9G A;  1LLU A;  2VWH A;  2ZB4 A;  4DLA A;  1GU7 A;  4DWV A;  1M6H A;  2OBY A;  4IDB A;  1YE3 A;  4NG5 A;  1AXG A;  3PII A;  2J3J A;  4HFJ A;  2JHG A;  1HF3 A;  4A27 A;  3I4C A;  1Q1N A;  1U3T A;  1HTB A;  3S2E A; 
#chains in the Genus database with same CATH homology
 4Z6K A;  4RQT A;  3OQ6 A;  2B5V A;  1N9G B;  5H82 A;  1QV6 A;  1TEH A;  4HFM A;  3IP1 A;  2CF5 A;  3NX4 A;  1GUF A;  4JBG A;  1V3T A;  4NFS A;  3WID A;  3WNQ A;  3B70 A;  2FZW A;  5CDT A;  2FZE A;  1MP0 A;  1P0F A;  4W82 A;  5KJ1 A;  3IUP A;  1NTO A;  1MGO A;  2Y05 A;  3JV7 A;  3WLF A;  4JBI A;  2NVB A;  4A0S A;  1U3V A;  2ZB7 A;  1E3J A;  1H0K A;  1O89 A;  3GAZ A;  1KEV A;  1YKF A;  1PED A;  2XAA A;  1HSZ A;  2OHX A;  1KOL A;  1GYR A;  1U3U A;  2W98 A;  1IZ0 A;  3HZZ A;  2EJV A;  5FI3 A;  5A3J A;  4MKR A;  3TWO A;  4DXH A;  1F8F A;  1JVB A;  4DVJ A;  1ADC A;  3QJ5 A;  1U3W A;  1MC5 A;  4EJ6 A;  1AXE A;  3QWB A;  2VWG A;  5DP2 A;  1MA0 A;  1H2B A;  1BXZ A;  2CD9 A;  1R37 A;  2ZB3 A;  3GOH A;  1D1S A;  4JJI A;  5FI5 A;  4DL9 A;  1LDE A;  1HET A;  4EJM A;  3HUD A;  3GMS A;  1JU9 A;  2EIH A;  1HDY A;  4JLW A;  5K1S A;  4IDE A;  1ADB A;  2DPH A;  1ADF A;  4GKV A;  4NFH A;  1UUF A;  4WE3 A;  4DLB A;  4ILK A;  1HDX A;  4B7C A;  1PL8 A;  2H6E A;  3COS A;  3WLE A;  4A10 A;  5ADH A;  5KIA A;  2CDB A;  1HEU A;  1LDY A;  1V3V A;  1Y9A A;  2D8A A;  4A2C A;  7ADH A;  1DEH A;  1AGN A;  4EEX A;  5A3V A;  3QE3 A;  1N92 A;  2VNA A;  3S2F A;  4L0Q A;  3BTO A;  4NH4 A;  2JHF A;  4XD2 A;  3WIE A;  4CPD A;  5KJ6 A;  2W4Q A;  5DOZ A;  6ADH A;  1PIW A;  1QLJ A;  4C4O A;  1ZSY A;  1RJW A;  1QOR A;  3WIC A;  1VJ0 A;  1XA0 A;  1E3L A;  5H83 A;  2J3K A;  2VWP A;  4DUP A;  4EYE A;  3S2I A;  3GQV A;  2EER A;  1NVG A;  1YQX A;  3JYL A;  4IDA A;  1PL6 A;  3KRT A;  3UKO A;  2VN8 A;  4JBH A;  4EEZ A;  4WGG A;  1N8K A;  3GFB A;  3SLK A;  3JYN A;  2VZ9 A;  4GI2 A;  3B6Z A;  4RQU A;  1A72 A;  1WLY A;  3PI7 A;  1E3I A;  5A4D A;  1YB5 A;  1V3U A;  5CDU A;  1P0C A;  1PL7 A;  2B5W A;  4IDC A;  2C0C A;  2CF6 A;  1D1T A;  4B7X A;  5KCZ A;  1A71 A;  2OUI A;  5CDG A;  1Y9E A;  4W9N A;  1TT7 A;  2B83 A;  4W6Z A;  5DP1 A;  5KJC A;  1JQB A;  2J3I A;  3FTN A;  8ADH A;  2DFV A;  5DOV A;  3M6I A;  2OXI A;  2VWQ A;  4W9N C;  3S1L A;  1M6W A;  2X1H A;  4OH1 A;  4JXK A;  3UOG A;  5KJF A;  1ZSV A;  5TNX A;  2CDC A;  4RVS A;  3FPL A;  5KJE A;  2X7H A;  1O8C A;  2CDA A;  2WEK A;  4OAQ A;  3FPC A;  2DQ4 A;  4WAS A;  2DM6 A;  1HDZ A;  3S2G A;  5CDS A;  1ADG A;  1VJ1 A;  3MEQ A;  5ENV A;  1E3E A;  4UEJ A;  1HLD A;  1PS0 A;  1YQD A;  2J8Z A;  4IDD A;  4J6F A;  3QWA A;  5H81 A;  1BTO A;  2ZB8 A;  4GL4 A;  1CDO A;  1QV7 A;  1MG0 A;  2J3H A;  1IYZ A;  3FSR A;  2VZ8 A;  3FBG A;  4UEO A;  2VCY A;  1HT0 A;  4UEK A;  1QLH A;  3TQH A;  1P1R A;  4W99 A;  1HSO A;  4HFN A;  4IDF A;  4RVU A;  1EE2 A;  1N9G A;  1LLU A;  2VWH A;  2ZB4 A;  4DLA A;  1GU7 A;  4DWV A;  1M6H A;  2OBY A;  4IDB A;  1YE3 A;  4NG5 A;  1AXG A;  3PII A;  2J3J A;  4HFJ A;  2JHG A;  1HF3 A;  4A27 A;  3I4C A;  1Q1N A;  1U3T A;  1HTB A;  3S2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...