5K1SA

Crystal structure of aibc
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
358
structure length
358
Chain Sequence
b'HHHHHAENLYFQGHMKAVVLRSFGEAGNLKMETMPMPRPGRGEVLLRVHACGVCYHDVINRRGNLPRTSVPAILGHEAAGEVIEVGPDTPGWKTGDRAATLQRMSCGDCALCRSGRNSLCKTDNRFFGEELPGGYAQFMVAPVGGLGRVPASLPWNEAATVCCTTGTAVHTVRTRGKVRAGETVLITGASGGVGLSSVQLARLDGARVIAVTSSEAKVQALKEAGADEVIVSRGLDFASDVRKRTQGAGVDVAVEIVGSATFDQTLKSMAPGGRVVVVGNLESGMVQLNPGLVIVKELEILGAYATTQAELDEALRLTATGGVRQFVTDAVPLAEAAKAHFRLENREVAGRLVLVPPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxidoreductase, zinc-binding dehydrogenase family
publication title Crystal structure of AibC, a reductase involved in alternative de novo isovaleryl coenzyme A biosynthesis in Myxococcus xanthus.
pubmed doi rcsb
source organism Myxococcus xanthus (strain dk 1622)
molecule tags Oxidoreductase
total genus 104
structure length 358
sequence length 358
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 5k1sA00
5DOVA 1YQXA 3FBGA 2VWHA 4DLBA 4EEXA 4IDCA 1HDZA 5K1SA 2CD9A 1LLUA 4GL4A 5KJEA 2VZ8A 4MKRA 4RQTA 3IUPA 2J3HA 3QWBA 4JBGA 4GKVA 2OXIA 2DQ4A 1E3LA 3QJ5A 4XD2A 4DXHA 4JJIA 2Y05A 1PL6A 3HZZA 3WLFA 3TWOA 1PL7A 3QE3A 3FPCA 3S2IA 1JVBA 4NG5A 4DL9A 4DUPA 1GYRA 4HFNA 1U3VA 4UEOA 1IYZA 1H0KA 5H82A 3UKOA 1QLHA 2CDAA 1KEVA 3WNQA 3BTOA 2CDBA 1M6WA 1MGOA 1ZSVA 1D1TA 2DFVA 3HUDA 1UUFA 4W9NC 5ENVA 1Y9AA 3S2GA 1O8CA 1ADGA 2J3IA 2FZWA 3GFBA 4A27A 1ZSYA 1JQBA 1V3TA 4NFHA 1WLYA 5KJ6A 1V3VA 5KJCA 2VWPA 2DPHA 2OBYA 4WE3A 5H83A 4A10A 1RJWA 1HEUA 1N9GB 2H6EA 1KOLA 5KCZA 1ADFA 2OUIA 3WIDA 1TT7A 1HF3A 1A72A 5FI3A 2W4QA 2WEKA 3UOGA 5CDUA 1HT0A 2CF6A 2CF5A 4A2CA 1YE3A 4DLAA 5H81A 3GOHA 1E3JA 1ADCA 4DWVA 3QWAA 3SLKA 1LDEA 1D1SA 2J8ZA 1N9GA 4IDDA 4JBIA 2X7HA 2ZB4A 7ADHA 4EJMA 1Y9EA 3S2FA 1P1RA 5DOZA 1NTOA 1U3TA 1QV7A 4WASA 5KJFA 1YB5A 1F8FA 1JU9A 1PL8A 1YQDA 2EERA 2VZ9A 4GI2A 2VCYA 5KIAA 4WGGA 5DP1A 1HDYA 2VN8A 2C0CA 3IP1A 3JYNA 1VJ1A 3WICA 1BTOA 4UEJA 1QORA 5A3JA 4EEZA 4IDFA 1BXZA 1R37A 2VWGA 3GAZA 2NVBA 1HLDA 1QLJA 3PIIA 4HFMA 3PI7A 1MC5A 4W82A 2EJVA 2J3KA 1O89A 2X1HA 2B83A 3FTNA 4RVSA 4W99A 4CPDA 2JHFA 1IZ0A 2B5WA 5TNXA 4B7CA 1MP0A 4Z6KA 2XAAA 4L0QA 2D8AA 5CDTA 4NFSA 1P0FA 1EE2A 1HTBA 3S1LA 1E3EA 1CDOA 1HDXA 4JBHA 1U3WA 2DM6A 3FPLA 4IDAA 4IDEA 3TQHA 2VWQA 2CDCA 2OHXA 1M6HA 1N92A 1PEDA 1TEHA 1VJ0A 2VNAA 2EIHA 1GUFA 1MA0A 1HSOA 1YKFA 1H2BA 3OQ6A 4RQUA 3JYLA 1DEHA 1Q1NA 4RVUA 5A3VA 2J3JA 4EYEA 3KRTA 2ZB3A 3FSRA 3M6IA 1P0CA 1AGNA 3MEQA 5DP2A 8ADHA 2ZB8A 1PS0A 1A71A 1PIWA 5A4DA 4ILKA 1E3IA 4IDBA 4OAQA 4DVJA 4EJ6A 4JLWA 1AXGA 1LDYA 5FI5A 1HETA 3COSA 1XA0A 1V3UA 4B7XA 4C4OA 5ADHA 3WLEA 2FZEA 4A0SA 3GQVA 4W6ZA 1GU7A 1ADBA 4JXKA 3S2EA 3WIEA 1HSZA 2B5VA 2ZB7A 1QV6A 3GMSA 4J6FA 5CDSA 5CDGA 3NX4A 5KJ1A 3I4CA 4NH4A 3B70A 1N8KA 3JV7A 4W9NA 1MG0A 2W98A 6ADHA 1NVGA 3B6ZA 1U3UA 4OH1A 4HFJA 4UEKA 1AXEA 2JHGA
chains in the Genus database with same CATH superfamily
5DOVA 1YQXA 3FBGA 2VWHA 4DLBA 4EEXA 4IDCA 1HDZA 5K1SA 2CD9A 1LLUA 4GL4A 5KJEA 2VZ8A 4MKRA 4RQTA 3IUPA 2J3HA 3QWBA 4JBGA 4GKVA 2OXIA 2DQ4A 1E3LA 3QJ5A 4XD2A 4DXHA 4JJIA 2Y05A 1PL6A 3HZZA 3WLFA 3TWOA 1PL7A 3QE3A 3FPCA 3S2IA 1JVBA 4NG5A 4DL9A 4DUPA 1GYRA 4HFNA 1U3VA 4UEOA 1IYZA 1H0KA 5H82A 3UKOA 1QLHA 2CDAA 1KEVA 3WNQA 3BTOA 2CDBA 1M6WA 1MGOA 1ZSVA 1D1TA 2DFVA 3HUDA 1UUFA 4W9NC 5ENVA 1Y9AA 3S2GA 1O8CA 1ADGA 2J3IA 2FZWA 3GFBA 4A27A 1ZSYA 1JQBA 1V3TA 4NFHA 1WLYA 5KJ6A 1V3VA 5KJCA 2VWPA 2DPHA 2OBYA 4WE3A 5H83A 4A10A 1RJWA 1HEUA 1N9GB 2H6EA 1KOLA 5KCZA 1ADFA 2OUIA 3WIDA 1TT7A 1HF3A 1A72A 5FI3A 2W4QA 2WEKA 3UOGA 5CDUA 1HT0A 2CF6A 2CF5A 4A2CA 1YE3A 4DLAA 5H81A 3GOHA 1E3JA 1ADCA 4DWVA 3QWAA 3SLKA 1LDEA 1D1SA 2J8ZA 1N9GA 4IDDA 4JBIA 2X7HA 2ZB4A 7ADHA 4EJMA 1Y9EA 3S2FA 1P1RA 5DOZA 1NTOA 1U3TA 1QV7A 4WASA 5KJFA 1YB5A 1F8FA 1JU9A 1PL8A 1YQDA 2EERA 2VZ9A 4GI2A 2VCYA 5KIAA 4WGGA 5DP1A 1HDYA 2VN8A 2C0CA 3IP1A 3JYNA 1VJ1A 3WICA 1BTOA 4UEJA 1QORA 5A3JA 4EEZA 4IDFA 1BXZA 1R37A 2VWGA 3GAZA 2NVBA 1HLDA 1QLJA 3PIIA 4HFMA 3PI7A 1MC5A 4W82A 2EJVA 2J3KA 1O89A 2X1HA 2B83A 3FTNA 4RVSA 4W99A 4CPDA 2JHFA 1IZ0A 2B5WA 5TNXA 4B7CA 1MP0A 4Z6KA 2XAAA 4L0QA 2D8AA 5CDTA 4NFSA 1P0FA 1EE2A 1HTBA 3S1LA 1E3EA 1CDOA 1HDXA 4JBHA 1U3WA 2DM6A 3FPLA 4IDAA 4IDEA 3TQHA 2VWQA 2CDCA 2OHXA 1M6HA 1N92A 1PEDA 1TEHA 1VJ0A 2VNAA 2EIHA 1GUFA 1MA0A 1HSOA 1YKFA 1H2BA 3OQ6A 4RQUA 3JYLA 1DEHA 1Q1NA 4RVUA 5A3VA 2J3JA 4EYEA 3KRTA 2ZB3A 3FSRA 3M6IA 1P0CA 1AGNA 3MEQA 5DP2A 8ADHA 2ZB8A 1PS0A 1A71A 1PIWA 5A4DA 4ILKA 1E3IA 4IDBA 4OAQA 4DVJA 4EJ6A 4JLWA 1AXGA 1LDYA 5FI5A 1HETA 3COSA 1XA0A 1V3UA 4B7XA 4C4OA 5ADHA 3WLEA 2FZEA 4A0SA 3GQVA 4W6ZA 1GU7A 1ADBA 4JXKA 3S2EA 3WIEA 1HSZA 2B5VA 2ZB7A 1QV6A 3GMSA 4J6FA 5CDSA 5CDGA 3NX4A 5KJ1A 3I4CA 4NH4A 3B70A 1N8KA 3JV7A 4W9NA 1MG0A 2W98A 6ADHA 1NVGA 3B6ZA 1U3UA 4OH1A 4HFJA 4UEKA 1AXEA 2JHGA
chains in the Genus database with same CATH topology
5DOVA 1YQXA 3FBGA 2VWHA 4DLBA 4EEXA 4IDCA 1HDZA 5K1SA 2CD9A 1LLUA 4GL4A 5KJEA 2VZ8A 4MKRA 4RQTA 3IUPA 2J3HA 3QWBA 4JBGA 4GKVA 2OXIA 2DQ4A 1E3LA 3QJ5A 4XD2A 4DXHA 4JJIA 2Y05A 1PL6A 3HZZA 3WLFA 3TWOA 1PL7A 3QE3A 3FPCA 3S2IA 1JVBA 4NG5A 4DL9A 4DUPA 1GYRA 4HFNA 1U3VA 4UEOA 1IYZA 1H0KA 5H82A 3UKOA 1QLHA 2CDAA 1KEVA 3WNQA 3BTOA 2CDBA 1M6WA 1MGOA 1ZSVA 1D1TA 2DFVA 3HUDA 1UUFA 4W9NC 5ENVA 1Y9AA 3S2GA 1O8CA 1ADGA 2J3IA 2FZWA 3GFBA 4A27A 1ZSYA 1JQBA 1V3TA 4NFHA 1WLYA 5KJ6A 1V3VA 5KJCA 2VWPA 2DPHA 2OBYA 4WE3A 5H83A 4A10A 1RJWA 1HEUA 1N9GB 2H6EA 1KOLA 5KCZA 1ADFA 2OUIA 3WIDA 1TT7A 1HF3A 1A72A 5FI3A 2W4QA 2WEKA 3UOGA 5CDUA 1HT0A 2CF6A 2CF5A 4A2CA 1YE3A 4DLAA 5H81A 3GOHA 1E3JA 1ADCA 4DWVA 3QWAA 3SLKA 1LDEA 1D1SA 2J8ZA 1N9GA 4IDDA 4JBIA 2X7HA 2ZB4A 7ADHA 4EJMA 1Y9EA 3S2FA 1P1RA 5DOZA 1NTOA 1U3TA 1QV7A 4WASA 5KJFA 1YB5A 1F8FA 1JU9A 1PL8A 1YQDA 2EERA 2VZ9A 4GI2A 2VCYA 5KIAA 4WGGA 5DP1A 1HDYA 2VN8A 2C0CA 3IP1A 3JYNA 1VJ1A 3WICA 1BTOA 4UEJA 1QORA 5A3JA 4EEZA 4IDFA 1BXZA 1R37A 2VWGA 3GAZA 2NVBA 1HLDA 1QLJA 3PIIA 4HFMA 3PI7A 1MC5A 4W82A 2EJVA 2J3KA 1O89A 2X1HA 2B83A 3FTNA 4RVSA 4W99A 4CPDA 2JHFA 1IZ0A 2B5WA 5TNXA 4B7CA 1MP0A 4Z6KA 2XAAA 4L0QA 2D8AA 5CDTA 4NFSA 1P0FA 1EE2A 1HTBA 3S1LA 1E3EA 1CDOA 1HDXA 4JBHA 1U3WA 2DM6A 3FPLA 4IDAA 4IDEA 3TQHA 2VWQA 2CDCA 2OHXA 1M6HA 1N92A 1PEDA 1TEHA 1VJ0A 2VNAA 2EIHA 1GUFA 1MA0A 1HSOA 1YKFA 1H2BA 3OQ6A 4RQUA 3JYLA 1DEHA 1Q1NA 4RVUA 5A3VA 2J3JA 4EYEA 3KRTA 2ZB3A 3FSRA 3M6IA 1P0CA 1AGNA 3MEQA 5DP2A 8ADHA 2ZB8A 1PS0A 1A71A 1PIWA 5A4DA 4ILKA 1E3IA 4IDBA 4OAQA 4DVJA 4EJ6A 4JLWA 1AXGA 1LDYA 5FI5A 1HETA 3COSA 1XA0A 1V3UA 4B7XA 4C4OA 5ADHA 3WLEA 2FZEA 4A0SA 3GQVA 4W6ZA 1GU7A 1ADBA 4JXKA 3S2EA 3WIEA 1HSZA 2B5VA 2ZB7A 1QV6A 3GMSA 4J6FA 5CDSA 5CDGA 3NX4A 5KJ1A 3I4CA 4NH4A 3B70A 1N8KA 3JV7A 4W9NA 1MG0A 2W98A 6ADHA 1NVGA 3B6ZA 1U3UA 4OH1A 4HFJA 4UEKA 1AXEA 2JHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DOV A;  1YQX A;  3FBG A;  2VWH A;  4DLB A;  4EEX A;  4IDC A;  1HDZ A;  5K1S A;  2CD9 A;  1LLU A;  4GL4 A;  5KJE A;  2VZ8 A;  4MKR A;  4RQT A;  3IUP A;  2J3H A;  3QWB A;  4JBG A;  4GKV A;  2OXI A;  2DQ4 A;  1E3L A;  3QJ5 A;  4XD2 A;  4DXH A;  4JJI A;  2Y05 A;  1PL6 A;  3HZZ A;  3WLF A;  3TWO A;  1PL7 A;  3QE3 A;  3FPC A;  3S2I A;  1JVB A;  4NG5 A;  4DL9 A;  4DUP A;  1GYR A;  4HFN A;  1U3V A;  4UEO A;  1IYZ A;  1H0K A;  5H82 A;  3UKO A;  1QLH A;  2CDA A;  1KEV A;  3WNQ A;  3BTO A;  2CDB A;  1M6W A;  1MGO A;  1ZSV A;  1D1T A;  2DFV A;  3HUD A;  1UUF A;  4W9N C;  5ENV A;  1Y9A A;  3S2G A;  1O8C A;  1ADG A;  2J3I A;  2FZW A;  3GFB A;  4A27 A;  1ZSY A;  1JQB A;  1V3T A;  4NFH A;  1WLY A;  5KJ6 A;  1V3V A;  5KJC A;  2VWP A;  2DPH A;  2OBY A;  4WE3 A;  5H83 A;  4A10 A;  1RJW A;  1HEU A;  1N9G B;  2H6E A;  1KOL A;  5KCZ A;  1ADF A;  2OUI A;  3WID A;  1TT7 A;  1HF3 A;  1A72 A;  5FI3 A;  2W4Q A;  2WEK A;  3UOG A;  5CDU A;  1HT0 A;  2CF6 A;  2CF5 A;  4A2C A;  1YE3 A;  4DLA A;  5H81 A;  3GOH A;  1E3J A;  1ADC A;  4DWV A;  3QWA A;  3SLK A;  1LDE A;  1D1S A;  2J8Z A;  1N9G A;  4IDD A;  4JBI A;  2X7H A;  2ZB4 A;  7ADH A;  4EJM A;  1Y9E A;  3S2F A;  1P1R A;  5DOZ A;  1NTO A;  1U3T A;  1QV7 A;  4WAS A;  5KJF A;  1YB5 A;  1F8F A;  1JU9 A;  1PL8 A;  1YQD A;  2EER A;  2VZ9 A;  4GI2 A;  2VCY A;  5KIA A;  4WGG A;  5DP1 A;  1HDY A;  2VN8 A;  2C0C A;  3IP1 A;  3JYN A;  1VJ1 A;  3WIC A;  1BTO A;  4UEJ A;  1QOR A;  5A3J A;  4EEZ A;  4IDF A;  1BXZ A;  1R37 A;  2VWG A;  3GAZ A;  2NVB A;  1HLD A;  1QLJ A;  3PII A;  4HFM A;  3PI7 A;  1MC5 A;  4W82 A;  2EJV A;  2J3K A;  1O89 A;  2X1H A;  2B83 A;  3FTN A;  4RVS A;  4W99 A;  4CPD A;  2JHF A;  1IZ0 A;  2B5W A;  5TNX A;  4B7C A;  1MP0 A;  4Z6K A;  2XAA A;  4L0Q A;  2D8A A;  5CDT A;  4NFS A;  1P0F A;  1EE2 A;  1HTB A;  3S1L A;  1E3E A;  1CDO A;  1HDX A;  4JBH A;  1U3W A;  2DM6 A;  3FPL A;  4IDA A;  4IDE A;  3TQH A;  2VWQ A;  2CDC A;  2OHX A;  1M6H A;  1N92 A;  1PED A;  1TEH A;  1VJ0 A;  2VNA A;  2EIH A;  1GUF A;  1MA0 A;  1HSO A;  1YKF A;  1H2B A;  3OQ6 A;  4RQU A;  3JYL A;  1DEH A;  1Q1N A;  4RVU A;  5A3V A;  2J3J A;  4EYE A;  3KRT A;  2ZB3 A;  3FSR A;  3M6I A;  1P0C A;  1AGN A;  3MEQ A;  5DP2 A;  8ADH A;  2ZB8 A;  1PS0 A;  1A71 A;  1PIW A;  5A4D A;  4ILK A;  1E3I A;  4IDB A;  4OAQ A;  4DVJ A;  4EJ6 A;  4JLW A;  1AXG A;  1LDY A;  5FI5 A;  1HET A;  3COS A;  1XA0 A;  1V3U A;  4B7X A;  4C4O A;  5ADH A;  3WLE A;  2FZE A;  4A0S A;  3GQV A;  4W6Z A;  1GU7 A;  1ADB A;  4JXK A;  3S2E A;  3WIE A;  1HSZ A;  2B5V A;  2ZB7 A;  1QV6 A;  3GMS A;  4J6F A;  5CDS A;  5CDG A;  3NX4 A;  5KJ1 A;  3I4C A;  4NH4 A;  3B70 A;  1N8K A;  3JV7 A;  4W9N A;  1MG0 A;  2W98 A;  6ADH A;  1NVG A;  3B6Z A;  1U3U A;  4OH1 A;  4HFJ A;  4UEK A;  1AXE A;  2JHG A; 
#chains in the Genus database with same CATH topology
 5DOV A;  1YQX A;  3FBG A;  2VWH A;  4DLB A;  4EEX A;  4IDC A;  1HDZ A;  5K1S A;  2CD9 A;  1LLU A;  4GL4 A;  5KJE A;  2VZ8 A;  4MKR A;  4RQT A;  3IUP A;  2J3H A;  3QWB A;  4JBG A;  4GKV A;  2OXI A;  2DQ4 A;  1E3L A;  3QJ5 A;  4XD2 A;  4DXH A;  4JJI A;  2Y05 A;  1PL6 A;  3HZZ A;  3WLF A;  3TWO A;  1PL7 A;  3QE3 A;  3FPC A;  3S2I A;  1JVB A;  4NG5 A;  4DL9 A;  4DUP A;  1GYR A;  4HFN A;  1U3V A;  4UEO A;  1IYZ A;  1H0K A;  5H82 A;  3UKO A;  1QLH A;  2CDA A;  1KEV A;  3WNQ A;  3BTO A;  2CDB A;  1M6W A;  1MGO A;  1ZSV A;  1D1T A;  2DFV A;  3HUD A;  1UUF A;  4W9N C;  5ENV A;  1Y9A A;  3S2G A;  1O8C A;  1ADG A;  2J3I A;  2FZW A;  3GFB A;  4A27 A;  1ZSY A;  1JQB A;  1V3T A;  4NFH A;  1WLY A;  5KJ6 A;  1V3V A;  5KJC A;  2VWP A;  2DPH A;  2OBY A;  4WE3 A;  5H83 A;  4A10 A;  1RJW A;  1HEU A;  1N9G B;  2H6E A;  1KOL A;  5KCZ A;  1ADF A;  2OUI A;  3WID A;  1TT7 A;  1HF3 A;  1A72 A;  5FI3 A;  2W4Q A;  2WEK A;  3UOG A;  5CDU A;  1HT0 A;  2CF6 A;  2CF5 A;  4A2C A;  1YE3 A;  4DLA A;  5H81 A;  3GOH A;  1E3J A;  1ADC A;  4DWV A;  3QWA A;  3SLK A;  1LDE A;  1D1S A;  2J8Z A;  1N9G A;  4IDD A;  4JBI A;  2X7H A;  2ZB4 A;  7ADH A;  4EJM A;  1Y9E A;  3S2F A;  1P1R A;  5DOZ A;  1NTO A;  1U3T A;  1QV7 A;  4WAS A;  5KJF A;  1YB5 A;  1F8F A;  1JU9 A;  1PL8 A;  1YQD A;  2EER A;  2VZ9 A;  4GI2 A;  2VCY A;  5KIA A;  4WGG A;  5DP1 A;  1HDY A;  2VN8 A;  2C0C A;  3IP1 A;  3JYN A;  1VJ1 A;  3WIC A;  1BTO A;  4UEJ A;  1QOR A;  5A3J A;  4EEZ A;  4IDF A;  1BXZ A;  1R37 A;  2VWG A;  3GAZ A;  2NVB A;  1HLD A;  1QLJ A;  3PII A;  4HFM A;  3PI7 A;  1MC5 A;  4W82 A;  2EJV A;  2J3K A;  1O89 A;  2X1H A;  2B83 A;  3FTN A;  4RVS A;  4W99 A;  4CPD A;  2JHF A;  1IZ0 A;  2B5W A;  5TNX A;  4B7C A;  1MP0 A;  4Z6K A;  2XAA A;  4L0Q A;  2D8A A;  5CDT A;  4NFS A;  1P0F A;  1EE2 A;  1HTB A;  3S1L A;  1E3E A;  1CDO A;  1HDX A;  4JBH A;  1U3W A;  2DM6 A;  3FPL A;  4IDA A;  4IDE A;  3TQH A;  2VWQ A;  2CDC A;  2OHX A;  1M6H A;  1N92 A;  1PED A;  1TEH A;  1VJ0 A;  2VNA A;  2EIH A;  1GUF A;  1MA0 A;  1HSO A;  1YKF A;  1H2B A;  3OQ6 A;  4RQU A;  3JYL A;  1DEH A;  1Q1N A;  4RVU A;  5A3V A;  2J3J A;  4EYE A;  3KRT A;  2ZB3 A;  3FSR A;  3M6I A;  1P0C A;  1AGN A;  3MEQ A;  5DP2 A;  8ADH A;  2ZB8 A;  1PS0 A;  1A71 A;  1PIW A;  5A4D A;  4ILK A;  1E3I A;  4IDB A;  4OAQ A;  4DVJ A;  4EJ6 A;  4JLW A;  1AXG A;  1LDY A;  5FI5 A;  1HET A;  3COS A;  1XA0 A;  1V3U A;  4B7X A;  4C4O A;  5ADH A;  3WLE A;  2FZE A;  4A0S A;  3GQV A;  4W6Z A;  1GU7 A;  1ADB A;  4JXK A;  3S2E A;  3WIE A;  1HSZ A;  2B5V A;  2ZB7 A;  1QV6 A;  3GMS A;  4J6F A;  5CDS A;  5CDG A;  3NX4 A;  5KJ1 A;  3I4C A;  4NH4 A;  3B70 A;  1N8K A;  3JV7 A;  4W9N A;  1MG0 A;  2W98 A;  6ADH A;  1NVG A;  3B6Z A;  1U3U A;  4OH1 A;  4HFJ A;  4UEK A;  1AXE A;  2JHG A; 
#chains in the Genus database with same CATH homology
 5DOV A;  1YQX A;  3FBG A;  2VWH A;  4DLB A;  4EEX A;  4IDC A;  1HDZ A;  5K1S A;  2CD9 A;  1LLU A;  4GL4 A;  5KJE A;  2VZ8 A;  4MKR A;  4RQT A;  3IUP A;  2J3H A;  3QWB A;  4JBG A;  4GKV A;  2OXI A;  2DQ4 A;  1E3L A;  3QJ5 A;  4XD2 A;  4DXH A;  4JJI A;  2Y05 A;  1PL6 A;  3HZZ A;  3WLF A;  3TWO A;  1PL7 A;  3QE3 A;  3FPC A;  3S2I A;  1JVB A;  4NG5 A;  4DL9 A;  4DUP A;  1GYR A;  4HFN A;  1U3V A;  4UEO A;  1IYZ A;  1H0K A;  5H82 A;  3UKO A;  1QLH A;  2CDA A;  1KEV A;  3WNQ A;  3BTO A;  2CDB A;  1M6W A;  1MGO A;  1ZSV A;  1D1T A;  2DFV A;  3HUD A;  1UUF A;  4W9N C;  5ENV A;  1Y9A A;  3S2G A;  1O8C A;  1ADG A;  2J3I A;  2FZW A;  3GFB A;  4A27 A;  1ZSY A;  1JQB A;  1V3T A;  4NFH A;  1WLY A;  5KJ6 A;  1V3V A;  5KJC A;  2VWP A;  2DPH A;  2OBY A;  4WE3 A;  5H83 A;  4A10 A;  1RJW A;  1HEU A;  1N9G B;  2H6E A;  1KOL A;  5KCZ A;  1ADF A;  2OUI A;  3WID A;  1TT7 A;  1HF3 A;  1A72 A;  5FI3 A;  2W4Q A;  2WEK A;  3UOG A;  5CDU A;  1HT0 A;  2CF6 A;  2CF5 A;  4A2C A;  1YE3 A;  4DLA A;  5H81 A;  3GOH A;  1E3J A;  1ADC A;  4DWV A;  3QWA A;  3SLK A;  1LDE A;  1D1S A;  2J8Z A;  1N9G A;  4IDD A;  4JBI A;  2X7H A;  2ZB4 A;  7ADH A;  4EJM A;  1Y9E A;  3S2F A;  1P1R A;  5DOZ A;  1NTO A;  1U3T A;  1QV7 A;  4WAS A;  5KJF A;  1YB5 A;  1F8F A;  1JU9 A;  1PL8 A;  1YQD A;  2EER A;  2VZ9 A;  4GI2 A;  2VCY A;  5KIA A;  4WGG A;  5DP1 A;  1HDY A;  2VN8 A;  2C0C A;  3IP1 A;  3JYN A;  1VJ1 A;  3WIC A;  1BTO A;  4UEJ A;  1QOR A;  5A3J A;  4EEZ A;  4IDF A;  1BXZ A;  1R37 A;  2VWG A;  3GAZ A;  2NVB A;  1HLD A;  1QLJ A;  3PII A;  4HFM A;  3PI7 A;  1MC5 A;  4W82 A;  2EJV A;  2J3K A;  1O89 A;  2X1H A;  2B83 A;  3FTN A;  4RVS A;  4W99 A;  4CPD A;  2JHF A;  1IZ0 A;  2B5W A;  5TNX A;  4B7C A;  1MP0 A;  4Z6K A;  2XAA A;  4L0Q A;  2D8A A;  5CDT A;  4NFS A;  1P0F A;  1EE2 A;  1HTB A;  3S1L A;  1E3E A;  1CDO A;  1HDX A;  4JBH A;  1U3W A;  2DM6 A;  3FPL A;  4IDA A;  4IDE A;  3TQH A;  2VWQ A;  2CDC A;  2OHX A;  1M6H A;  1N92 A;  1PED A;  1TEH A;  1VJ0 A;  2VNA A;  2EIH A;  1GUF A;  1MA0 A;  1HSO A;  1YKF A;  1H2B A;  3OQ6 A;  4RQU A;  3JYL A;  1DEH A;  1Q1N A;  4RVU A;  5A3V A;  2J3J A;  4EYE A;  3KRT A;  2ZB3 A;  3FSR A;  3M6I A;  1P0C A;  1AGN A;  3MEQ A;  5DP2 A;  8ADH A;  2ZB8 A;  1PS0 A;  1A71 A;  1PIW A;  5A4D A;  4ILK A;  1E3I A;  4IDB A;  4OAQ A;  4DVJ A;  4EJ6 A;  4JLW A;  1AXG A;  1LDY A;  5FI5 A;  1HET A;  3COS A;  1XA0 A;  1V3U A;  4B7X A;  4C4O A;  5ADH A;  3WLE A;  2FZE A;  4A0S A;  3GQV A;  4W6Z A;  1GU7 A;  1ADB A;  4JXK A;  3S2E A;  3WIE A;  1HSZ A;  2B5V A;  2ZB7 A;  1QV6 A;  3GMS A;  4J6F A;  5CDS A;  5CDG A;  3NX4 A;  5KJ1 A;  3I4C A;  4NH4 A;  3B70 A;  1N8K A;  3JV7 A;  4W9N A;  1MG0 A;  2W98 A;  6ADH A;  1NVG A;  3B6Z A;  1U3U A;  4OH1 A;  4HFJ A;  4UEK A;  1AXE A;  2JHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...