5K1SA

Crystal structure of aibc
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
358
structure length
358
Chain Sequence
HHHHHAENLYFQGHMKAVVLRSFGEAGNLKMETMPMPRPGRGEVLLRVHACGVCYHDVINRRGNLPRTSVPAILGHEAAGEVIEVGPDTPGWKTGDRAATLQRMSCGDCALCRSGRNSLCKTDNRFFGEELPGGYAQFMVAPVGGLGRVPASLPWNEAATVCCTTGTAVHTVRTRGKVRAGETVLITGASGGVGLSSVQLARLDGARVIAVTSSEAKVQALKEAGADEVIVSRGLDFASDVRKRTQGAGVDVAVEIVGSATFDQTLKSMAPGGRVVVVGNLESGMVQLNPGLVIVKELEILGAYATTQAELDEALRLTATGGVRQFVTDAVPLAEAAKAHFRLENREVAGRLVLVPPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of AibC, a reductase involved in alternative de novo isovaleryl coenzyme A biosynthesis in Myxococcus xanthus.
pubmed doi rcsb
source organism Myxococcus xanthus (strain dk 1622)
molecule tags Oxidoreductase
molecule keywords Oxidoreductase, zinc-binding dehydrogenase family
total genus 104
structure length 358
sequence length 358
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 5k1sA00
1ADGA 4JBIA 1YQDA 4RVSA 4B7XA 1LDYA 2NVBA 1QV6A 1O89A 2EERA 3HZZA 3IP1A 4OH1A 5ENVA 2CF6A 2W4QA 8ADHA 1PL7A 3WIEA 2ZB4A 1TEHA 1IZ0A 2X1HA 3BTOA 5DP1A 4DXHA 1P0CA 4RQTA 4EEXA 5KJCA 4IDFA 4EJ6A 2JHFA 1GU7A 2C0CA 4IDBA 4L0QA 3B6ZA 4HFMA 5H81A 4GI2A 4MKRA 2B5WA 1N9GB 1MGOA 1QLHA 6ADHA 1MA0A 2J3JA 1QORA 2VZ8A 5DP2A 3TQHA 2VWGA 1Q1NA 1U3TA 1ZSVA 3KRTA 2D8AA 3JYLA 5A3VA 5A3JA 3S1LA 1PIWA 1E3JA 3JYNA 3GAZA 5H82A 2OBYA 4DWVA 1ADCA 2FZEA 1BXZA 1YKFA 1A72A 3GMSA 4W9NA 5KIAA 7ADHA 3QWAA 1YB5A 4OAQA 1KOLA 2FZWA 4C4OA 3UKOA 3WLFA 2H6EA 4JBHA 1RJWA 1A71A 1P1RA 4A10A 4WE3A 4A27A 5CDGA 1PEDA 4GKVA 4WGGA 1QLJA 2OHXA 2J3IA 2CDCA 1ZSYA 4NFSA 1XA0A 2OXIA 4A2CA 4EEZA 2DFVA 1DEHA 1LLUA 1D1SA 1KEVA 1O8CA 2VCYA 4HFNA 1D1TA 1HETA 1HDYA 1WLYA 2WEKA 3FPLA 4IDCA 3PI7A 1CDOA 5TNXA 4XD2A 4A0SA 4JJIA 5H83A 4DLBA 4Z6KA 4UEJA 5KJFA 1V3VA 1AXGA 2B5VA 4GL4A 1QV7A 4NH4A 1VJ0A 2CDAA 5KCZA 1MG0A 1R37A 3GFBA 5KJ1A 4JXKA 2OUIA 2ZB8A 5CDTA 3MEQA 5DOVA 4IDAA 3WLEA 2CDBA 4DL9A 3FBGA 2VWQA 2JHGA 3UOGA 2ZB3A 5ADHA 1E3IA 4IDEA 1AXEA 1JQBA 3S2FA 2CD9A 4NFHA 4NG5A 4RVUA 2Y05A 1Y9AA 1M6HA 4IDDA 5FI5A 1ADBA 1U3UA 4ILKA 3S2GA 3FTNA 4EYEA 4WASA 1E3EA 3SLKA 2VZ9A 4RQUA 3WNQA 2B83A 3I4CA 2EIHA 2DQ4A 4B7CA 5CDSA 1EE2A 1PL8A 3HUDA 1HLDA 2CF5A 2J3HA 1HSZA 1F8FA 1JU9A 1MP0A 1V3UA 1NTOA 4W99A 3FPCA 3S2IA 2VWHA 1H2BA 4UEOA 1U3WA 1VJ1A 2DPHA 2VWPA 4J6FA 4DVJA 1PL6A 4W9NC 2J3KA 5KJ6A 1GUFA 1N9GA 2J8ZA 5CDUA 3QWBA 3JV7A 4CPDA 1YQXA 2X7HA 5DOZA 3S2EA 5K1SA 1MC5A 3WICA 4HFJA 1HDXA 4JBGA 1YE3A 4DUPA 3QE3A 1ADFA 3OQ6A 1UUFA 2VNAA 4EJMA 2XAAA 3IUPA 3FSRA 1N8KA 1HDZA 1M6WA 1P0FA 2DM6A 4JLWA 3WIDA 1TT7A 5FI3A 1IYZA 1JVBA 4W82A 5KJEA 1N92A 1H0KA 1BTOA 1LDEA 1HF3A 4UEKA 1HT0A 3COSA 3PIIA 1HTBA 4DLAA 1AGNA 1E3LA 3GOHA 3M6IA 3NX4A 1HSOA 4W6ZA 1NVGA 3B70A 1GYRA 3TWOA 1U3VA 3GQVA 2W98A 2VN8A 2ZB7A 1V3TA 1PS0A 1Y9EA 1HEUA 3QJ5A 5A4DA 2EJVA
chains in the Genus database with same CATH superfamily
1ADGA 4JBIA 1YQDA 4RVSA 4B7XA 1LDYA 2NVBA 1QV6A 1O89A 2EERA 3HZZA 3IP1A 4OH1A 5ENVA 2CF6A 2W4QA 8ADHA 1PL7A 3WIEA 2ZB4A 1TEHA 1IZ0A 2X1HA 3BTOA 5DP1A 4DXHA 1P0CA 4RQTA 4EEXA 5KJCA 4IDFA 4EJ6A 2JHFA 1GU7A 2C0CA 4IDBA 4L0QA 3B6ZA 4HFMA 5H81A 4GI2A 4MKRA 2B5WA 1N9GB 1MGOA 1QLHA 6ADHA 1MA0A 2J3JA 1QORA 2VZ8A 5DP2A 3TQHA 2VWGA 1Q1NA 1U3TA 1ZSVA 3KRTA 2D8AA 3JYLA 5A3VA 5A3JA 3S1LA 1PIWA 1E3JA 3JYNA 3GAZA 5H82A 2OBYA 4DWVA 1ADCA 2FZEA 1BXZA 1YKFA 1A72A 3GMSA 4W9NA 5KIAA 7ADHA 3QWAA 1YB5A 4OAQA 1KOLA 2FZWA 4C4OA 3UKOA 3WLFA 2H6EA 4JBHA 1RJWA 1A71A 1P1RA 4A10A 4WE3A 4A27A 5CDGA 1PEDA 4GKVA 4WGGA 1QLJA 2OHXA 2J3IA 2CDCA 1ZSYA 4NFSA 1XA0A 2OXIA 4A2CA 4EEZA 2DFVA 1DEHA 1LLUA 1D1SA 1KEVA 1O8CA 2VCYA 4HFNA 1D1TA 1HETA 1HDYA 1WLYA 2WEKA 3FPLA 4IDCA 3PI7A 1CDOA 5TNXA 4XD2A 4A0SA 4JJIA 5H83A 4DLBA 4Z6KA 4UEJA 5KJFA 1V3VA 1AXGA 2B5VA 4GL4A 1QV7A 4NH4A 1VJ0A 2CDAA 5KCZA 1MG0A 1R37A 3GFBA 5KJ1A 4JXKA 2OUIA 2ZB8A 5CDTA 3MEQA 5DOVA 4IDAA 3WLEA 2CDBA 4DL9A 3FBGA 2VWQA 2JHGA 3UOGA 2ZB3A 5ADHA 1E3IA 4IDEA 1AXEA 1JQBA 3S2FA 2CD9A 4NFHA 4NG5A 4RVUA 2Y05A 1Y9AA 1M6HA 4IDDA 5FI5A 1ADBA 1U3UA 4ILKA 3S2GA 3FTNA 4EYEA 4WASA 1E3EA 3SLKA 2VZ9A 4RQUA 3WNQA 2B83A 3I4CA 2EIHA 2DQ4A 4B7CA 5CDSA 1EE2A 1PL8A 3HUDA 1HLDA 2CF5A 2J3HA 1HSZA 1F8FA 1JU9A 1MP0A 1V3UA 1NTOA 4W99A 3FPCA 3S2IA 2VWHA 1H2BA 4UEOA 1U3WA 1VJ1A 2DPHA 2VWPA 4J6FA 4DVJA 1PL6A 4W9NC 2J3KA 5KJ6A 1GUFA 1N9GA 2J8ZA 5CDUA 3QWBA 3JV7A 4CPDA 1YQXA 2X7HA 5DOZA 3S2EA 5K1SA 1MC5A 3WICA 4HFJA 1HDXA 4JBGA 1YE3A 4DUPA 3QE3A 1ADFA 3OQ6A 1UUFA 2VNAA 4EJMA 2XAAA 3IUPA 3FSRA 1N8KA 1HDZA 1M6WA 1P0FA 2DM6A 4JLWA 3WIDA 1TT7A 5FI3A 1IYZA 1JVBA 4W82A 5KJEA 1N92A 1H0KA 1BTOA 1LDEA 1HF3A 4UEKA 1HT0A 3COSA 3PIIA 1HTBA 4DLAA 1AGNA 1E3LA 3GOHA 3M6IA 3NX4A 1HSOA 4W6ZA 1NVGA 3B70A 1GYRA 3TWOA 1U3VA 3GQVA 2W98A 2VN8A 2ZB7A 1V3TA 1PS0A 1Y9EA 1HEUA 3QJ5A 5A4DA 2EJVA
chains in the Genus database with same CATH topology
1ADGA 4JBIA 1YQDA 4RVSA 4B7XA 1LDYA 2NVBA 1QV6A 1O89A 2EERA 3HZZA 3IP1A 4OH1A 5ENVA 2CF6A 2W4QA 8ADHA 1PL7A 3WIEA 2ZB4A 1TEHA 1IZ0A 2X1HA 3BTOA 5DP1A 4DXHA 1P0CA 4RQTA 4EEXA 5KJCA 4IDFA 4EJ6A 2JHFA 1GU7A 2C0CA 4IDBA 4L0QA 3B6ZA 4HFMA 5H81A 4GI2A 4MKRA 2B5WA 1N9GB 1MGOA 1QLHA 6ADHA 1MA0A 2J3JA 1QORA 2VZ8A 5DP2A 3TQHA 2VWGA 1Q1NA 1U3TA 1ZSVA 3KRTA 2D8AA 3JYLA 5A3VA 5A3JA 3S1LA 1PIWA 1E3JA 3JYNA 3GAZA 5H82A 2OBYA 4DWVA 1ADCA 2FZEA 1BXZA 1YKFA 1A72A 3GMSA 4W9NA 5KIAA 7ADHA 3QWAA 1YB5A 4OAQA 1KOLA 2FZWA 4C4OA 3UKOA 3WLFA 2H6EA 4JBHA 1RJWA 1A71A 1P1RA 4A10A 4WE3A 4A27A 5CDGA 1PEDA 4GKVA 4WGGA 1QLJA 2OHXA 2J3IA 2CDCA 1ZSYA 4NFSA 1XA0A 2OXIA 4A2CA 4EEZA 2DFVA 1DEHA 1LLUA 1D1SA 1KEVA 1O8CA 2VCYA 4HFNA 1D1TA 1HETA 1HDYA 1WLYA 2WEKA 3FPLA 4IDCA 3PI7A 1CDOA 5TNXA 4XD2A 4A0SA 4JJIA 5H83A 4DLBA 4Z6KA 4UEJA 5KJFA 1V3VA 1AXGA 2B5VA 4GL4A 1QV7A 4NH4A 1VJ0A 2CDAA 5KCZA 1MG0A 1R37A 3GFBA 5KJ1A 4JXKA 2OUIA 2ZB8A 5CDTA 3MEQA 5DOVA 4IDAA 3WLEA 2CDBA 4DL9A 3FBGA 2VWQA 2JHGA 3UOGA 2ZB3A 5ADHA 1E3IA 4IDEA 1AXEA 1JQBA 3S2FA 2CD9A 4NFHA 4NG5A 4RVUA 2Y05A 1Y9AA 1M6HA 4IDDA 5FI5A 1ADBA 1U3UA 4ILKA 3S2GA 3FTNA 4EYEA 4WASA 1E3EA 3SLKA 2VZ9A 4RQUA 3WNQA 2B83A 3I4CA 2EIHA 2DQ4A 4B7CA 5CDSA 1EE2A 1PL8A 3HUDA 1HLDA 2CF5A 2J3HA 1HSZA 1F8FA 1JU9A 1MP0A 1V3UA 1NTOA 4W99A 3FPCA 3S2IA 2VWHA 1H2BA 4UEOA 1U3WA 1VJ1A 2DPHA 2VWPA 4J6FA 4DVJA 1PL6A 4W9NC 2J3KA 5KJ6A 1GUFA 1N9GA 2J8ZA 5CDUA 3QWBA 3JV7A 4CPDA 1YQXA 2X7HA 5DOZA 3S2EA 5K1SA 1MC5A 3WICA 4HFJA 1HDXA 4JBGA 1YE3A 4DUPA 3QE3A 1ADFA 3OQ6A 1UUFA 2VNAA 4EJMA 2XAAA 3IUPA 3FSRA 1N8KA 1HDZA 1M6WA 1P0FA 2DM6A 4JLWA 3WIDA 1TT7A 5FI3A 1IYZA 1JVBA 4W82A 5KJEA 1N92A 1H0KA 1BTOA 1LDEA 1HF3A 4UEKA 1HT0A 3COSA 3PIIA 1HTBA 4DLAA 1AGNA 1E3LA 3GOHA 3M6IA 3NX4A 1HSOA 4W6ZA 1NVGA 3B70A 1GYRA 3TWOA 1U3VA 3GQVA 2W98A 2VN8A 2ZB7A 1V3TA 1PS0A 1Y9EA 1HEUA 3QJ5A 5A4DA 2EJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ADG A;  4JBI A;  1YQD A;  4RVS A;  4B7X A;  1LDY A;  2NVB A;  1QV6 A;  1O89 A;  2EER A;  3HZZ A;  3IP1 A;  4OH1 A;  5ENV A;  2CF6 A;  2W4Q A;  8ADH A;  1PL7 A;  3WIE A;  2ZB4 A;  1TEH A;  1IZ0 A;  2X1H A;  3BTO A;  5DP1 A;  4DXH A;  1P0C A;  4RQT A;  4EEX A;  5KJC A;  4IDF A;  4EJ6 A;  2JHF A;  1GU7 A;  2C0C A;  4IDB A;  4L0Q A;  3B6Z A;  4HFM A;  5H81 A;  4GI2 A;  4MKR A;  2B5W A;  1N9G B;  1MGO A;  1QLH A;  6ADH A;  1MA0 A;  2J3J A;  1QOR A;  2VZ8 A;  5DP2 A;  3TQH A;  2VWG A;  1Q1N A;  1U3T A;  1ZSV A;  3KRT A;  2D8A A;  3JYL A;  5A3V A;  5A3J A;  3S1L A;  1PIW A;  1E3J A;  3JYN A;  3GAZ A;  5H82 A;  2OBY A;  4DWV A;  1ADC A;  2FZE A;  1BXZ A;  1YKF A;  1A72 A;  3GMS A;  4W9N A;  5KIA A;  7ADH A;  3QWA A;  1YB5 A;  4OAQ A;  1KOL A;  2FZW A;  4C4O A;  3UKO A;  3WLF A;  2H6E A;  4JBH A;  1RJW A;  1A71 A;  1P1R A;  4A10 A;  4WE3 A;  4A27 A;  5CDG A;  1PED A;  4GKV A;  4WGG A;  1QLJ A;  2OHX A;  2J3I A;  2CDC A;  1ZSY A;  4NFS A;  1XA0 A;  2OXI A;  4A2C A;  4EEZ A;  2DFV A;  1DEH A;  1LLU A;  1D1S A;  1KEV A;  1O8C A;  2VCY A;  4HFN A;  1D1T A;  1HET A;  1HDY A;  1WLY A;  2WEK A;  3FPL A;  4IDC A;  3PI7 A;  1CDO A;  5TNX A;  4XD2 A;  4A0S A;  4JJI A;  5H83 A;  4DLB A;  4Z6K A;  4UEJ A;  5KJF A;  1V3V A;  1AXG A;  2B5V A;  4GL4 A;  1QV7 A;  4NH4 A;  1VJ0 A;  2CDA A;  5KCZ A;  1MG0 A;  1R37 A;  3GFB A;  5KJ1 A;  4JXK A;  2OUI A;  2ZB8 A;  5CDT A;  3MEQ A;  5DOV A;  4IDA A;  3WLE A;  2CDB A;  4DL9 A;  3FBG A;  2VWQ A;  2JHG A;  3UOG A;  2ZB3 A;  5ADH A;  1E3I A;  4IDE A;  1AXE A;  1JQB A;  3S2F A;  2CD9 A;  4NFH A;  4NG5 A;  4RVU A;  2Y05 A;  1Y9A A;  1M6H A;  4IDD A;  5FI5 A;  1ADB A;  1U3U A;  4ILK A;  3S2G A;  3FTN A;  4EYE A;  4WAS A;  1E3E A;  3SLK A;  2VZ9 A;  4RQU A;  3WNQ A;  2B83 A;  3I4C A;  2EIH A;  2DQ4 A;  4B7C A;  5CDS A;  1EE2 A;  1PL8 A;  3HUD A;  1HLD A;  2CF5 A;  2J3H A;  1HSZ A;  1F8F A;  1JU9 A;  1MP0 A;  1V3U A;  1NTO A;  4W99 A;  3FPC A;  3S2I A;  2VWH A;  1H2B A;  4UEO A;  1U3W A;  1VJ1 A;  2DPH A;  2VWP A;  4J6F A;  4DVJ A;  1PL6 A;  4W9N C;  2J3K A;  5KJ6 A;  1GUF A;  1N9G A;  2J8Z A;  5CDU A;  3QWB A;  3JV7 A;  4CPD A;  1YQX A;  2X7H A;  5DOZ A;  3S2E A;  5K1S A;  1MC5 A;  3WIC A;  4HFJ A;  1HDX A;  4JBG A;  1YE3 A;  4DUP A;  3QE3 A;  1ADF A;  3OQ6 A;  1UUF A;  2VNA A;  4EJM A;  2XAA A;  3IUP A;  3FSR A;  1N8K A;  1HDZ A;  1M6W A;  1P0F A;  2DM6 A;  4JLW A;  3WID A;  1TT7 A;  5FI3 A;  1IYZ A;  1JVB A;  4W82 A;  5KJE A;  1N92 A;  1H0K A;  1BTO A;  1LDE A;  1HF3 A;  4UEK A;  1HT0 A;  3COS A;  3PII A;  1HTB A;  4DLA A;  1AGN A;  1E3L A;  3GOH A;  3M6I A;  3NX4 A;  1HSO A;  4W6Z A;  1NVG A;  3B70 A;  1GYR A;  3TWO A;  1U3V A;  3GQV A;  2W98 A;  2VN8 A;  2ZB7 A;  1V3T A;  1PS0 A;  1Y9E A;  1HEU A;  3QJ5 A;  5A4D A;  2EJV A; 
#chains in the Genus database with same CATH topology
 1ADG A;  4JBI A;  1YQD A;  4RVS A;  4B7X A;  1LDY A;  2NVB A;  1QV6 A;  1O89 A;  2EER A;  3HZZ A;  3IP1 A;  4OH1 A;  5ENV A;  2CF6 A;  2W4Q A;  8ADH A;  1PL7 A;  3WIE A;  2ZB4 A;  1TEH A;  1IZ0 A;  2X1H A;  3BTO A;  5DP1 A;  4DXH A;  1P0C A;  4RQT A;  4EEX A;  5KJC A;  4IDF A;  4EJ6 A;  2JHF A;  1GU7 A;  2C0C A;  4IDB A;  4L0Q A;  3B6Z A;  4HFM A;  5H81 A;  4GI2 A;  4MKR A;  2B5W A;  1N9G B;  1MGO A;  1QLH A;  6ADH A;  1MA0 A;  2J3J A;  1QOR A;  2VZ8 A;  5DP2 A;  3TQH A;  2VWG A;  1Q1N A;  1U3T A;  1ZSV A;  3KRT A;  2D8A A;  3JYL A;  5A3V A;  5A3J A;  3S1L A;  1PIW A;  1E3J A;  3JYN A;  3GAZ A;  5H82 A;  2OBY A;  4DWV A;  1ADC A;  2FZE A;  1BXZ A;  1YKF A;  1A72 A;  3GMS A;  4W9N A;  5KIA A;  7ADH A;  3QWA A;  1YB5 A;  4OAQ A;  1KOL A;  2FZW A;  4C4O A;  3UKO A;  3WLF A;  2H6E A;  4JBH A;  1RJW A;  1A71 A;  1P1R A;  4A10 A;  4WE3 A;  4A27 A;  5CDG A;  1PED A;  4GKV A;  4WGG A;  1QLJ A;  2OHX A;  2J3I A;  2CDC A;  1ZSY A;  4NFS A;  1XA0 A;  2OXI A;  4A2C A;  4EEZ A;  2DFV A;  1DEH A;  1LLU A;  1D1S A;  1KEV A;  1O8C A;  2VCY A;  4HFN A;  1D1T A;  1HET A;  1HDY A;  1WLY A;  2WEK A;  3FPL A;  4IDC A;  3PI7 A;  1CDO A;  5TNX A;  4XD2 A;  4A0S A;  4JJI A;  5H83 A;  4DLB A;  4Z6K A;  4UEJ A;  5KJF A;  1V3V A;  1AXG A;  2B5V A;  4GL4 A;  1QV7 A;  4NH4 A;  1VJ0 A;  2CDA A;  5KCZ A;  1MG0 A;  1R37 A;  3GFB A;  5KJ1 A;  4JXK A;  2OUI A;  2ZB8 A;  5CDT A;  3MEQ A;  5DOV A;  4IDA A;  3WLE A;  2CDB A;  4DL9 A;  3FBG A;  2VWQ A;  2JHG A;  3UOG A;  2ZB3 A;  5ADH A;  1E3I A;  4IDE A;  1AXE A;  1JQB A;  3S2F A;  2CD9 A;  4NFH A;  4NG5 A;  4RVU A;  2Y05 A;  1Y9A A;  1M6H A;  4IDD A;  5FI5 A;  1ADB A;  1U3U A;  4ILK A;  3S2G A;  3FTN A;  4EYE A;  4WAS A;  1E3E A;  3SLK A;  2VZ9 A;  4RQU A;  3WNQ A;  2B83 A;  3I4C A;  2EIH A;  2DQ4 A;  4B7C A;  5CDS A;  1EE2 A;  1PL8 A;  3HUD A;  1HLD A;  2CF5 A;  2J3H A;  1HSZ A;  1F8F A;  1JU9 A;  1MP0 A;  1V3U A;  1NTO A;  4W99 A;  3FPC A;  3S2I A;  2VWH A;  1H2B A;  4UEO A;  1U3W A;  1VJ1 A;  2DPH A;  2VWP A;  4J6F A;  4DVJ A;  1PL6 A;  4W9N C;  2J3K A;  5KJ6 A;  1GUF A;  1N9G A;  2J8Z A;  5CDU A;  3QWB A;  3JV7 A;  4CPD A;  1YQX A;  2X7H A;  5DOZ A;  3S2E A;  5K1S A;  1MC5 A;  3WIC A;  4HFJ A;  1HDX A;  4JBG A;  1YE3 A;  4DUP A;  3QE3 A;  1ADF A;  3OQ6 A;  1UUF A;  2VNA A;  4EJM A;  2XAA A;  3IUP A;  3FSR A;  1N8K A;  1HDZ A;  1M6W A;  1P0F A;  2DM6 A;  4JLW A;  3WID A;  1TT7 A;  5FI3 A;  1IYZ A;  1JVB A;  4W82 A;  5KJE A;  1N92 A;  1H0K A;  1BTO A;  1LDE A;  1HF3 A;  4UEK A;  1HT0 A;  3COS A;  3PII A;  1HTB A;  4DLA A;  1AGN A;  1E3L A;  3GOH A;  3M6I A;  3NX4 A;  1HSO A;  4W6Z A;  1NVG A;  3B70 A;  1GYR A;  3TWO A;  1U3V A;  3GQV A;  2W98 A;  2VN8 A;  2ZB7 A;  1V3T A;  1PS0 A;  1Y9E A;  1HEU A;  3QJ5 A;  5A4D A;  2EJV A; 
#chains in the Genus database with same CATH homology
 1ADG A;  4JBI A;  1YQD A;  4RVS A;  4B7X A;  1LDY A;  2NVB A;  1QV6 A;  1O89 A;  2EER A;  3HZZ A;  3IP1 A;  4OH1 A;  5ENV A;  2CF6 A;  2W4Q A;  8ADH A;  1PL7 A;  3WIE A;  2ZB4 A;  1TEH A;  1IZ0 A;  2X1H A;  3BTO A;  5DP1 A;  4DXH A;  1P0C A;  4RQT A;  4EEX A;  5KJC A;  4IDF A;  4EJ6 A;  2JHF A;  1GU7 A;  2C0C A;  4IDB A;  4L0Q A;  3B6Z A;  4HFM A;  5H81 A;  4GI2 A;  4MKR A;  2B5W A;  1N9G B;  1MGO A;  1QLH A;  6ADH A;  1MA0 A;  2J3J A;  1QOR A;  2VZ8 A;  5DP2 A;  3TQH A;  2VWG A;  1Q1N A;  1U3T A;  1ZSV A;  3KRT A;  2D8A A;  3JYL A;  5A3V A;  5A3J A;  3S1L A;  1PIW A;  1E3J A;  3JYN A;  3GAZ A;  5H82 A;  2OBY A;  4DWV A;  1ADC A;  2FZE A;  1BXZ A;  1YKF A;  1A72 A;  3GMS A;  4W9N A;  5KIA A;  7ADH A;  3QWA A;  1YB5 A;  4OAQ A;  1KOL A;  2FZW A;  4C4O A;  3UKO A;  3WLF A;  2H6E A;  4JBH A;  1RJW A;  1A71 A;  1P1R A;  4A10 A;  4WE3 A;  4A27 A;  5CDG A;  1PED A;  4GKV A;  4WGG A;  1QLJ A;  2OHX A;  2J3I A;  2CDC A;  1ZSY A;  4NFS A;  1XA0 A;  2OXI A;  4A2C A;  4EEZ A;  2DFV A;  1DEH A;  1LLU A;  1D1S A;  1KEV A;  1O8C A;  2VCY A;  4HFN A;  1D1T A;  1HET A;  1HDY A;  1WLY A;  2WEK A;  3FPL A;  4IDC A;  3PI7 A;  1CDO A;  5TNX A;  4XD2 A;  4A0S A;  4JJI A;  5H83 A;  4DLB A;  4Z6K A;  4UEJ A;  5KJF A;  1V3V A;  1AXG A;  2B5V A;  4GL4 A;  1QV7 A;  4NH4 A;  1VJ0 A;  2CDA A;  5KCZ A;  1MG0 A;  1R37 A;  3GFB A;  5KJ1 A;  4JXK A;  2OUI A;  2ZB8 A;  5CDT A;  3MEQ A;  5DOV A;  4IDA A;  3WLE A;  2CDB A;  4DL9 A;  3FBG A;  2VWQ A;  2JHG A;  3UOG A;  2ZB3 A;  5ADH A;  1E3I A;  4IDE A;  1AXE A;  1JQB A;  3S2F A;  2CD9 A;  4NFH A;  4NG5 A;  4RVU A;  2Y05 A;  1Y9A A;  1M6H A;  4IDD A;  5FI5 A;  1ADB A;  1U3U A;  4ILK A;  3S2G A;  3FTN A;  4EYE A;  4WAS A;  1E3E A;  3SLK A;  2VZ9 A;  4RQU A;  3WNQ A;  2B83 A;  3I4C A;  2EIH A;  2DQ4 A;  4B7C A;  5CDS A;  1EE2 A;  1PL8 A;  3HUD A;  1HLD A;  2CF5 A;  2J3H A;  1HSZ A;  1F8F A;  1JU9 A;  1MP0 A;  1V3U A;  1NTO A;  4W99 A;  3FPC A;  3S2I A;  2VWH A;  1H2B A;  4UEO A;  1U3W A;  1VJ1 A;  2DPH A;  2VWP A;  4J6F A;  4DVJ A;  1PL6 A;  4W9N C;  2J3K A;  5KJ6 A;  1GUF A;  1N9G A;  2J8Z A;  5CDU A;  3QWB A;  3JV7 A;  4CPD A;  1YQX A;  2X7H A;  5DOZ A;  3S2E A;  5K1S A;  1MC5 A;  3WIC A;  4HFJ A;  1HDX A;  4JBG A;  1YE3 A;  4DUP A;  3QE3 A;  1ADF A;  3OQ6 A;  1UUF A;  2VNA A;  4EJM A;  2XAA A;  3IUP A;  3FSR A;  1N8K A;  1HDZ A;  1M6W A;  1P0F A;  2DM6 A;  4JLW A;  3WID A;  1TT7 A;  5FI3 A;  1IYZ A;  1JVB A;  4W82 A;  5KJE A;  1N92 A;  1H0K A;  1BTO A;  1LDE A;  1HF3 A;  4UEK A;  1HT0 A;  3COS A;  3PII A;  1HTB A;  4DLA A;  1AGN A;  1E3L A;  3GOH A;  3M6I A;  3NX4 A;  1HSO A;  4W6Z A;  1NVG A;  3B70 A;  1GYR A;  3TWO A;  1U3V A;  3GQV A;  2W98 A;  2VN8 A;  2ZB7 A;  1V3T A;  1PS0 A;  1Y9E A;  1HEU A;  3QJ5 A;  5A4D A;  2EJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...