1BXZA

Crystal structure of a thermophilic alcohol dehydrogenase substrate complex from thermoanaerobacter brockii
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
352
structure length
352
Chain Sequence
MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAELADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLVTHVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a thermophilic alcohol dehydrogenase substrate complex suggests determinants of substrate specificity and thermostability.
pubmed doi rcsb
source organism Thermoanaerobacter brockii
molecule tags Oxidoreductase
molecule keywords NADP-DEPENDENT ALCOHOL DEHYDROGENASE
total genus 104
structure length 352
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 1998-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1bxzA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1bxzA01
1NWCA 1OBFO 3DBLA 1T26A 3A06A 4IJVA 5IAAA 3TL2A 2Q46A 2WD7A 5H81A 1Y9EA 1A71A 1H0KA 3GR6A 4MIOA 3NRCA 1QORA 4HWKA 4WK6A 4E2WA 5I7VA 3MTJA 1GQQA 1J5PA 3ANMA 4ND3A 4CQMB 1KVTA 4J91A 4LVUA 3JQ7B 4LGVA 1UP4A 1ZXLA 2IYOA 2UYYA 3I6QA 4CMIB 4NIMA 4Z6KA 4GX5A 3ADPA 4J1SA 2DT5A 2Y1EA 3QV1A 1H2HA 4YJFB 1YH3A 4ND2A 4B7UA 1VC2A 5GY7A 3WOHA 3GFBA 1LC0A 3F3SA 4GWKA 4L0QA 2Z1NA 1O6ZA 3S2GA 3DAGA 3GVXA 3JQFC 2DU8A 3HDJA 3HHPA 4FDAA 4J43A 4XIJA 3IUSA 4N18A 1HDCA 4Z9YA 3WLEA 3FNEA 1HSZA 2VT3A 1PZHA 3BMCA 4J1TA 5C7LO 3PJGA 3OICA 2ZYDA 3GN2A 3JQEA 3RC9A 1PWXA 4CMKA 1U3VA 1E92A 3M1LA 2I3AA 5ILOA 4GH5A 4DYVA 3MJCA 3RSHA 4WLVA 5F1KA 3TDKA 4CMEA 4R1SA 4E13A 1GZ6A 2GR9A 4E0BA 3FPCA 3AOEC 1T2CA 1ZJZA 4OQZA 5DULA 3WGZA 3V8BA 2BI8A 2PR2A 3D3WB 3CMMA 3NJ8A 1Q7GA 4KUHA 1UXJA 3DOCA 1ENYA 1Y1PA 3EC7A 4CM8A 1EUZA 3QVXA 5I9LA 4N5MA 1SCUA 4FFMA 1ZK3A 3E1KA 4TZKA 2POQX 5EJ2A 1DFHA 5AVOA 3I9KA 4JQCA 5KVSA 4Z0HO 3F5SA 3ASUA 3BMQB 5KIAA 4IIUA 3VVBA 3WJAA 3X2EA 3KUXA 4AG3A 4DIFA 5EL0A 5J23A 1C0PA 2WJPA 4UEJA 3ZW9A 2ZB7A 5KKAA 5ES3A 3EUWA 1MC5A 2AG8A 2JFFA 3F4LA 4PVDA 5GZ6A 2IE0A 1ISHA 1A7AA 2PFGA 3JYNA 1HT0A 1E77A 1R4MA 3W4KA 3PFFA 5K1SA 3WFJA 4OOEA 4MVJA 2D4AA 4NZ9A 1CF2O 1YBMA 4FN4A 4BB6A 1XR3A 3ZN2A 2PTGA 1BTOA 3HN2A 4RVUA 1JDJA 4OXKA 1TA4A 4NFSA 2BGMA 4KTTE 4RPJA 4YJHA 1AUPA 1LDBA 2BFAA 3H9EO 3QVOA 1Y8RB 3OMLA 3PEFA 2WYVA 1EE2A 1A4UA 4YQZA 1UZLA 1Y8RA 1T1SA 2AE2A 5CPBA 4PN3A 5L4NA 2GRAA 3WGYA 1P1RA 4LMRA 4J7XA 3H9GA 5JCJA 1MB4A 2UDPA 3HFSA 4RF4A 2WD8A 4BO4A 1ZFNA 5JCXA 3GGGA 3FNHA 4BVAA 4GPD1 1EZ4A 3A4VA 4YXFA 3A1NA 3WMWA 3PHIA 1E3IA 1F8GA 2ZQZA 2Z1MA 1QKIA 4CM4A 3C1AA 3VVCA 1JU9A 2VWPA 3CSDA 1FDWA 5L95A 1LA2A 3DL2A 3DHYA 1Y81A 3H3FA 3K73O 3ROKA 2X4GA 5L4LA 2Q49A 3DMYA 1ID1A 3TOZA 1CDOA 1EQUA 1F0YA 1PL8A 4IPTA 5FI3A 1WDMA 5CPFA 1FK8A 2Y05A 1D8AA 1R66A 4QFCA 4J0FA 3ENKA 2WM3A 4QTZA 2GN9A 3WYCA 5EN4A 1E1KA 2ZJ1A 2HK7A 2Y93A 2CVQA 1M66A 4FJ2A 3DO5A 2Q45A 4DLAA 4GLLA 2EKPA 2VQ3A 4IMRA 3KM0A 3I9JA 2DUWA 3UW3A 4LMPA 4E32A 3DBRA 4KDEA 3S8MA 1PEDA 2C54A 2RH4A 3MEQA 4CMGA 5H82A 1GUZA 4CV3A 3H9UA 2I99A 2J3KA 4DGSA 1ISFA 1PSDA 2B5VA 4Z9XA 1IHXA 2EP5A 4RV9A 3OIDA 4R16A 4CMAA 2VZ0A 4K28A 2HO5A 3PYMA 3FBTA 3RWBA 3TFOA 4ALNA 4ZN6A 4KUEA 5COBA 4Z0TA 5A9SB 2B69A 2C2XA 5LDHA 4PG6A 1YXMA 3OQBA 2X23A 1ISGA 3ICPA 4PLZA 4PZCA 3U4HA 3AY3A 1YB5A 4CL8A 4W7HA 2VHXA 3GDGA 3LF1A 2CVZA 2O3JA 2P5YA 2P68A 4O5OA 4XGIA 4YT4A 3AI3A 3CH6A 1H6CA 3DTTA 3K5PA 4HBGA 1YBAA 2VN8A 2FY8A 1EQ2A 1GD1O 3PHLA 1MC4A 2BMAA 3JQGB 2UUOA 2DQ4A 3JSAA 3PQFA 1PJSA 3ANNA 3R1IA 2QZ9A 5I9NA 5L7TA 4HFMA 3PPIA 4YB8A 4H15A 4YYZA 2J3JA 3WWZA 2D8AA 3GC6A 3I3OA 4GMFA 3LSYA 4RCVA 3VTZA 1DIAA 3MJEA 1YS4A 3PWKA 4B3JA 2NU9A 4WJZA 3E18A 2I9PA 4L75A 4JK3A 2CZCA 3QE3A 3OH8A 3BIOA 1S6YA 4YT2A 1TXGA 3BHJA 5EINA 2CNBA 5DBIA 2X7HA 4CQLB 1KOLA 1ZK4A 4LK3A 4MVJP 4EZBA 3JQFA 2LDBA 5JC8A 4D43A 2ZJ0A 2YFHA 2D1YA 3KYBA 3KYDB 3MCVA 3QP9A 4II3A 4QSMA 3U3XA 1VKOA 5AYVA 1ZJYA 2IODA 3F9IA 3AK4A 2BHLA 4JBGA 3WBBA 5JW6A 3PK0A 4G5HA 2IZ0A 4WE3A 3ZU3A 4NQZA 1EVZA 3E03A 3PWSA 4B4VA 1P3DA 2B0JA 1OAAA 4GSLA 1LLDA 1HZZA 1J0XO 2ZQYA 2RHCA 4MOWA 4CUJA 3G17A 4M8SA 1PTJA 4R01A 2D59A 2FRDA 3LF2A 5A5EA 1NBOA 1C14A 2BELA 4A26A 1OC2A 1F17A 3U4IA 4J9UE 4N5LA 5A06A 2DKNA 3ZHBA 4BGEA 2X5OA 4IJUA 2HK8A 5CG1A 4LISA 4Q3EA 2PA3A 4YQYA 2D3TA 1ORRA 3FR8A 4Q3AA 2ET6A 2OP1A 3B6ZA 4D0RA 2AQ8A 4TRNA 1R0LA 5A02A 2PGDA 3HDQA 3RUIA 4CM7A 2FHSA 2HQ1A 1OMOA 1SEVA 1UR5A 3ONDA 5TJHA 5AXCA 2Q2WA 3VH1A 3OM9A 4G2NA 1EUCA 1JKIA 3V1TC 1JAXA 4EEXA 4CUKA 4KDFA 1R12A 2EJWA 4CM9D 4WUVA 2CDCA 1B0AA 4J9VA 2Y1FA 5L9AA 1MV8A 3JQAD 5BNTA 4AJJA 5MGBA 2VHYA 1ENOA 4BNFA 3JV7A 2RIRA 5JO0A 3I9MA 3LLSA 3O4RA 4AJNA 1X7GA 5B4VA 3ZV3A 3F46A 2JCYA 3OEWA 3AW9A 4M1QA 1K89A 2EGHA 3D0OA 4L4RA 4O6VA 3LC7O 1MX3A 2OZPA 4RF3A 1R4NB 2C7VA 4MVJI 3GN1A 1UDAA 3NTRA 4CR6A 2V6BA 1F14A 2W90A 4N7RA 1CQIA 1RYDA 3N7UA 2PKQO 1U3TA 4BS9A 2DTDA 3AOEA 3FWZA 1T2AA 5JMWA 3NGLA 1XSEA 3DOOA 1N1GA 4Q39A 1I8TA 3K31A 3C85A 4YAKA 1R6DA 2HSDA 3HQ4O 4RQTA 3E9MA 3ZWMA 4CLRA 3QVWA 1LSUA 3RBZA 1Y5MA 1J6UA 4LRSB 4TKMA 1I3KA 3CZMA 4BKQA 5KJ6A 3LU1A 4Z3DA 1EFLA 1GPJA 3FHLA 3JQBA 3OQ1A 2RH8A 2V65A 1LQUA 2Y0EA 4W7IA 4CM4B 2IEDA 4DWVA 4RLHA 1Z74A 2I6TA 2CDBA 4MO2A 3ROPA 3LLVA 2Y1OA 4WLOA 2QQ5A 2P2SA 4EJ6A 4UAGA 1QP8A 8ADHA 4ALMA 5KJCA 1SEPA 3ROMA 1K6IA 3P19A 1DAOA 4NJMB 3FR7A 4EJ0A 1UZNA 2W2LA 4NHEA 1T2FA 3BTSA 4C7KA 2JAHA 1N5DA 2D0IA 3AY7A 4OSOA 1YQGA 4E3ZA 3NT2A 3HE3A 2GERA 4A5OA 4CMIA 1W8DA 3L07A 1T24A 2Q1WA 3RFXA 2GN6A 4RZHA 2PV7A 1JWBB 1CJCA 1C0IA 3GZNB 4JP2A 4PIVA 2JL1A 1BDBA 1DHTA 1PJ3A 1WPQA 3HSKA 4NBUA 1U9JA 4HADA 3T7EA 2VWHA 2HK9A 3JYLA 3ZNPA 3VAZA 4J90A 1GAEO 4UUOA 4DQVA 5EIOA 4YR9A 5JMPA 3FN4A 3DMTC 3OECA 3CIFA 3INRA 4JNKA 2P9EA 4PZDA 5F5NA 4BNXA 1NFFA 4BO7A 2F1KA 3RI3A 1NM5A 5F1OA 3WLFA 1PQPA 3TF5A 2LDXA 2X1HA 4RL6A 2G17A 4DBVO 3DBRB 2JKVA 4ZQGA 5IDWA 1B8PA 3GA0A 3H5RA 2HAEA 3W6ZA 1M6HA 2Q1UA 4CLRB 2VCYA 2FN7A 4GKVA 1E7YA 4FIZA 4Q3CA 2NNLD 2Y0CA 3DAPA 2X5JO 3F47A 1LNQA 4KWIA 4RPLA 1CRWG 2CY0A 1P1FA 3OQ6A 4CM8B 1E6WA 3I9OA 3IOYA 1ISIA 5U9CA 5FYDA 2PKRA 1E0DA 3RC7A 3DBVO 4I9UA 1BW9B 3PGJA 3Q3CA 3UVEA 4F3YA 4QQRA 4OQYA 4YAJA 5I7FA 2PGJA 4XD2A 4F45A 4GKBA 2OL4A 1PU2A 3RASA 3WX0A 1KEVA 3CMCO 1B26A 3RUDA 3SJ7A 2B5WA 1M6WA 5JCJD 1H6BA 1PQWA 2A94A 4CUZA 4DPKA 4D7AA 5ER6A 1NFRA 3AUUA 2NVUB 3MJSA 2FOIA 5DF1A 4HX5A 1ENZA 1ZSVA 4L73A 2XXJA 3F5QA 3MJVA 3KETA 1CEQA 3RVDA 3JQ8A 2VOJA 1AGNA 1N92A 4JIGA 5DOZA 4XJSA 3NDJA 2Y0DA 4TWRA 2O4CA 3RFTA 5F5LA 3OEYA 3WDSA 3L9WA 4CMEC 3TRIA 4EUEA 5KOIA 3I5MA 3D1LA 4JGBA 4IQ8A 3VPHA 1Y8QB 4DLBA 4K26A 3JQBC 5JSFA 1Q2XA 1B7GO 1PQUA 2GLXA 3RU9A 4E2XA 4EUFA 5IZ4A 3QY9A 5CDGA 2GZ1A 1BW9A 1F06A 4D46A 1I32A 3WQQA 1GV1A 1MG0A 3DDNA 1HDZA 3MJ4A 2EERA 5F1PA 1EVIA 4M55A 3DEYX 2I67A 3UOGA 4RDHA 2GYYA 3PJDA 4BL5A 1DDOA 1N9GA 2QZZA 3DHEA 3TN7A 3B70A 1GU7A 3FTNA 2W2KB 4NU6A 4DBZA 1NQTA 2CUKA 2QYTA 1PX0A 4BQRA 2CSUA 3GHHA 3UCXA 2OP0A 4WCDA 4J4BA 2QRLA 4IGEA 4B4OA 4Z3KA 3DFZA 1MG5A 1ZW1A 4I9HA 1UJMA 1HF3A 4ZRNA 3GHYA 2ZTMA 2TMDA 4I9NA 5LCXA 3AU9A 1YQDA 5FI5A 4N5NA 4IBOA 3GY0A 3PIDA 5DOVA 1ZK0A 2OHXA 1PR9A 1BGVA 1P1KA 4ZQEA 3RUCA 3BAZA 4H3VA 3AI1A 5COAA 1L1FA 4E4YA 1F12A 1GZ4A 2F00A 4PRLA 4LN1A 4XRRA 5BNFA 2D5CA 3O03A 1X13A 3BMOA 3WSWA 2GF2A 2RBEA 2FSVA 2VUUA 2E48A 1Y7TA 1U3WA 3PDJA 1W6UA 5U1PA 3ZNNA 3CKYA 1DPGA 2WYUA 4R41A 3QVSA 1KEPA 1TLTA 4D0SA 4DPLA 3GPIA 3D5TA 1ENPA 3AFNA 4MVJF 3WWYA 3ABIA 3WIEA 5C5IA 3PJEA 2SCUA 4PLTA 2X9NA 4DRYA 4ILKA 1ZCJA 4O63O 4IDCA 1C1DB 1M75A 1VRWA 2JCXA 4WKGA 4ND5A 1C1DA 2GASA 4OAQA 3F1LA 3PDUA 1ZNQO 4R4JA 2WE8A 3HN7A 1RWBA 4RVFA 5AXAA 4BV8A 1HL3A 3ZWVA 1RYEA 4NBRA 4WOKA 1P1HA 2W2KA 4ID9A 4BO5A 2FPGA 1A4IA 2GN4A 4ITUA 5TGDA 3TWOA 4FFLA 1ADCA 2G5CA 3D4PA 4XGKA 5DT9A 3NKLA 1I10A 4XB2A 2ZTUA 2XAAA 4J2HA 3QQPA 4XYEA 4EI2A 2IYPA 1Z45A 1UXHA 2B83A 1BVRA 4YRAA 2DLDA 3DQPA 3NTQA 4GVXA 1N2SA 4BO9A 2BGKA 3RIHA 1Z7EA 2EKQA 4YT8A 1N1EA 3ZWNA 1B15A 1LSJA 1CIVA 3GNQA 2EHDA 2OGUA 2ZIZA 2I76A 1YDWA 1PZEA 2O48X 4XB1A 3C7AA 4DC0A 4FR5A 1V3TA 5A9TA 3IUPA 3GVIA 4J7UA 1B14A 5G2OA 5DBFA 7MDHA 4KUGA 5JBIA 2H9IA 1HDOA 3PRJA 1V9LA 4EYEA 3WGHA 5JYEA 1SNYA 4FW8A 4RVHA 1VM6A 1DIGA 3I4FA 3JD3A 5K9ZA 3AM3A 3NAQA 2C07A 2QG4A 3I23A 1RJWA 3ON5A 5JAZA 5G4LA 5ICSA 3QIVA 1Z6ZA 3H5NA 4YJDA 3WQRA 1DJNA 3V2GA 1LQTA 5H83A 4TRRA 3RC2A 1XA0A 5LC1A 2DBZA 3TZHA 4RDIA 3WIDA 1TB4A 1GV0A 3UFXA 3FNFA 4CM6A 1NQ5A 4PLWA 5L7YA 1ZMOA 3FI9A 3ZWPA 4B79A 2NTJA 2P91A 3GMDA 3S2IA 3B1KA 3LT4A 5DCYA 4NDNE 2FSSA 4JBHA 4JBIA 4MJLA 4OM8A 3VDRA 3W4IA 5ADHA 2GD1O 4XR9A 4QO7A 3EZLA 3DXFA 3RQSA 1OOEA 4CLOB 2O3UA 2QW8A 1OFGA 3ADOA 3U0BA 3VH3A 3L6DA 4XQ9A 1XEAA 1T2DA 1QMGA 5KVCA 1DO8A 4G65A 4ZHSA 5KVQA 1JVBA 1UAYA 1ZH8A 3O38A 3ITKA 1EVYA 2JD1A 1LUAA 3DBHB 4BMVA 1WP4A 3JD2A 2HU2A 1GTMA 1UXGA 2E4AA 4S3MA 1YVEI 3H9QA 3BMCB 2XOXA 2Y99A 2VHWA 2DTXA 2Y1GA 4JJFA 2VNAA 4BO6A 3A14A 3W8EA 3OJFA 2FMUA 1IL0A 4I5EA 1MFPA 3JQ6A 4IS2A 1F8FA 1YB4A 3JQAA 2GO1A 4IJKA 4GVLA 4NFYA 1R16A 4TQGA 5G0VA 1BRMA 3WJ7A 4AJ1A 1HE3A 4CLDA 3SVTA 1P1IA 2X6TA 2ZK7A 1PIWA 3ETEA 1K6XA 2EW2A 4U6SA 1JA9A 5F3RA 5KTKA 2VWGA 1LDEA 3HJAA 2X5KO 5T64A 3U49A 3VZQA 2WE7A 3RUAA 2YJZA 4CV1A 1D3AA 5EQDA 4K1LA 1I36A 3S55A 1Z75A 1PJQA 4ZQBA 1VKNA 4UEOA 4UVDA 4J16A 2J5QA 4UEKA 3B1FA 2E37A 3GOHA 2JD2A 2AEMA 2O7SA 3WYEA 3ZU4A 4O0LA 1IULA 1N9GB 1NXQA 4H16A 2JAPA 2OMEA 1JVSA 5EMHA 1XCBA 5DP2A 4WNCA 3UH1A 5ILGA 1QYXA 5DBGA 2X22A 2OUIA 1V8BA 4O59O 4WASA 3LT2A 4R54A 5HS6A 4IM7A 5DCUA 1C3VA 3LT0A 1ZKMA 3WGQA 2HUNA 1KVUA 4PVCA 3RAJA 2QRJA 3EAGA 1PJ2A 1ZEMA 2D5AA 3E6AA 3L9XA 3ZWAA 1HYGA 5TSDA 3OF2A 2NU8A 1Q7CA 4NNJA 1U5CA 1HLDA 2XPCA 4YPOA 1ZEJA 2NVWA 3H2ZA 1KBZA 4WLNA 4CR8A 4EEZA 2AQKA 5TX7A 5JAQA 1GQ2A 4BNWA 2EGGA 1XLTA 1IY8A 4B8WA 2YHUA 3Q0EA 1Q0QA 4Y6RA 4DQUA 4ZA2A 4OJNA 3C1TA 5A9SA 4HP8A 1IUKA 4URFA 4CMHA 4G81A 1KC3A 4I1IA 5IJZA 3EK2A 3MWDB 1B3RA 3JQ9A 1PZGA 2FZWA 1BDMA 1LDMA 1JKFA 3GH3A 1E1MA 3Q2IA 4M87A 4XA8A 4XZ3A 2DAPA 3ZGYA 4UVHA 4CM9A 2AXQA 1YRLA 2EG9A 1LDGA 3JQGA 3FNGA 3VPXA 4WLFA 3RJ9A 3RBXA 1FF9A 4MVJG 4AJHA 3ULKA 1UZMA 4XDZA 4I8XA 5ICMA 4FS3A 1ONNA 4CM5A 4AFNA 5L4SA 4B7XA 3GZNA 2AE1A 1A7KA 1U3UA 1VJ1A 4FGWA 4EDFA 2CF5A 1BHSA 2Y67A 2DTEA 2ZTVA 2NU7A 4CMBA 1JW9B 5G0UA 5JY1A 1EFKA 4CJXA 3DMTA 4YT5A 4CPDA 3TZKA 1C0LA 1T25A 1V0JA 1GYPA 4EBFA 3TZ6A 3MWEB 4Y6SA 3IP3A 3RD5A 1M2WA 2YHIB 4HUJA 3GAFA 1EDZA 1KYQA 1YOVA 3UHAA 1GZ3A 1QR6A 3C7DB 4YTEA 4CM1A 3GFGA 1GCUA 2VRCA 3WFIA 2RHRA 4Q3NA 3WMXA 2YV3A 1QRRA 4E6PA 4D3SA 4ZGWA 3BHMA 5ENDA 1K6JA 3P2YA 2B35A 4IJWA 3TPCA 2VNSA 4BNUA 1E3WA 1U7TA 2UV8A 3QWHA 1U1IA 3BYZA 3EHEA 4K6CA 1GR0A 3U09A 4IZIA 4GBJA 4Q9NA 3UCEA 2FPPA 1M76A 4RLSA 1DEHA 3UXYA 2DPGA 5AOVA 3I4CA 1XQ1A 3ONEA 3UAGA 4U8GA 1QYWA 4INAA 3KYDA 2BD0A 5T6BA 4PLPA 3PHGA 3K8ZA 4TMFA 3WS7A 2W8ZA 4D42A 4PG5A 4EJMA 3NT4A 4U5QA 2W4QA 1SZJG 2P9GA 5AQ1A 1YKFA 3GGPA 4I5GA 3PZRA 4ZRMA 3EVNA 3V2UA 1J49A 1KEUA 4II2A 1LLCA 2BGLA 1Q0HA 3FD8A 2C29D 2BFMA 4H7PA 3TNLA 4IDFA 3IIEA 1SMKA 1E7RA 2JD0A 4RPGA 1NR1A 4WEQA 5I7SA 3DZKA 4FC6A 2B4RO 2EXXA 4B7CA 1AN9A 1DC4A 2NADA 3IS3A 4Y98A 5JYDA 1DRVA 1MXFA 1A27A 4MKXA 4MVJH 4AJ2A 4RQUA 1NTOA 4MINA 4IGFA 3GDOA 4FOSA 3U4CA 3F6YA 3ENNA 3JQ8B 1NAIA 4CMJA 1MXHA 9LDTA 2W98A 4M89A 3UUWA 3AI2A 2J5RA 1C0KA 1I3LA 1X1EA 1E3LA 4JXKA 3WR5A 3WSVA 4PG8A 4FB5A 3C7CB 2GDZA 1G6KA 2NSDA 4TZTA 1O9BA 5CFZA 4GAEA 2G1UA 5U4QA 2ZB3A 3CTMA 1GY8A 1LRKA 1D4FA 2YDXA 3OA2A 5A4DA 4Q3BA 1X0VA 1ZIDA 4OGWA 2PZMA 3KLMX 1VSVA 5CEFA 1VJ0A 2OXIA 1WXDA 2HMSA 1I2CA 3MJTA 5THQA 1X0XA 1X7HA 3ZHZA 3EDMA 1ZUD1 4KMSA 5JPIA 2PZJA 4R9SA 4ALLA 1QYVA 3L77A 4CLOA 4OKIA 1NQOA 2E6UX 5FFFA 4AJ4A 1HDXA 2C59A 3BMQA 3G49A 5B1YA 3AY6A 5JY6A 1NX6A 2I65A 3FWNA 2ZKLA 3C3XA 1PJCA 1LRLA 5A5FA 1DLIA 4J6FA 4RF2A 5JLAA 4BKOA 1M67A 3I1JA 5DDIP 4OSPA 2X9GA 1B2LA 5I7EA 4BV9A 3CE6A 2EIHA 3GUYA 4BO0A 1LLUA 3BXXA 1SAYA 1RM3A 2Q1TA 3E82A 1AHIA 2W2LD 4JN6B 1MUUA 2I5PO 2RCYA 4KP7A 5DCWA 4J49A 3ZWWA 3RUHA 4PLHA 1Z73A 2R6JA 4XYGA 1LRJA 4E5PA 3GVHA 5K6AA 1NAHA 2NACA 3AUSA 3JYQA 5HBRA 4DIBA 4JJIA 6ADHA 1EEHA 8LDHA 1EK6A 4UVEA 3Q2KA 1LXCA 1K3TA 4YWJA 3HWRA 4E2ZA 1G0OA 1DJQA 1Y6JA 1W4ZA 2A92A 4ND1A 3KYCA 4QO8A 3WGOA 2HKIA 4RF5A 4Y67A 5A3VA 5BNIA 5L45A 5KWEA 2HJRA 4EGFA 4M86A 1GYRA 3G79A 1XYGA 1CWUA 4F46A 1P33A 1NPDA 1BXZA 4P38A 1HLPA 4OMUA 5JXWA 1P77A 2HCTA 2YZ7A 4XR4A 3DAFA 1LDNA 3NV9A 4IXTA 4EITA 2DPHA 3W4JA 3GK3A 4D41A 1P9LA 5TT1A 2O3QA 2PK3A 1YGYA 2NUAA 2X0JA 2JCVA 2PLAA 3I9NA 3KV3O 4OHUA 2VUSA 3O9ZA 3AWDA 3K2EA 4F6LA 1IOLA 1I24A 1WNTA 4YVFA 3BA1A 5IXYA 2GZ2A 3DZJA 1FXSA 3FF4A 1K0UA 5L7WA 3IDSA 1EUDA 2Q99A 1IHYA 4JX8A 2ILTA 3A9WA 1MGOA 5IZCA 4IMPA 2J3HA 5T67A 3VPGA 5CEJA 3OBBA 4YEDA 5G0WA 4ZICA 3SJUA 3CXRA 2Q3EA 1HETA 1IE3A 3B1JA 1FDUA 4WCFC 5DZSA 1W73A 4NK4A 2CDAA 4RORA 1JKJA 3OIFA 4FQ8A 4DXHA 1BWSA 2EKLA 2H63A 4PFJA 5BSGA 1HXHA 2O23A 5CAEA 4DA9A 5FWNA 1HTBA 5TT0A 5ITWA 4B3IA 4JJGA 2ZCUA 3VC7A 1DAPA 4HV4A 1FDTA 1PGQA 4FD3A 4J4HA 5THKA 3VZPA 3ZWCA 3LC1O 3HUDA 4NJMA 1VSUA 2X8LA 4WLUA 5T57A 1E7QA 1UUFA 3SBOA 4HNHA 5HS4A 1BXKA 5KKCA 4FJ0A 4QFDA 5L3ZA 3JYPA 1MLDA 4XYLA 4AJEA 1NPYA 5EERA 2GSDA 5IN4A 4ONEA 4YRBA 3KBOA 3QSGA 2CFCA 3ETDA 3OA0A 1HSOA 4IXWA 3KXDA 2YW9A 4Q3DA 2AHRA 1LU9A 3ONFA 5KNLA 1HDYA 1RM4A 3ZU5A 4CV0A 5JE8A 1G1AA 4HY3A 2X0IA 4YJGB 1PJTA 1QLJA 4OOFA 4J4TA 4JCOA 3BTUA 1Z82A 3VKVA 1E7WA 4HXYA 1X14A 1BG6A 3RBVA 4C4OA 3WYBA 4RJTA 3JQ9C 3BZUA 2B36A 3ZI0A 3G1UA 1O89A 4UULA 4NBTA 2X86A 2IXAA 3TZQA 1IZ0A 2IXBA 4R5MA 4YCAA 3VPFA 4CLHA 2DC1A 2GPTA 4U0KA 4B4UA 2ZYAA 3PI7A 3H9JA 3ITDA 4UUMA 2E82A 1FDVA 4WCFA 3ETGA 2AQIA 4A2CA 2Q1SA 4XX0A 1NNUA 3GAZA 4TSKA 2D2IA 1VL6A 4D3FA 4BNNA 4E30A 4W4TA 2Z95A 5T8KA 3ICCA 3JQ7A 2PZLA 4GL4A 3WBFA 1A9YA 5TC4A 4W99A 1E7MA 1DFIA 2X0NA 2DBRA 3JQCA 4O1MA 1WWKA 2WDZA 5G4KB 3GNTA 1T4DA 3IKTA 1V35A 1PJBA 3CZRA 4KZPA 2O50A 1ZZEA 4DL9A 2GNAA 4HFNA 2GCGA 3ZU2A 3ZWXA 4BB5A 2AEFA 1RKXA 4DUPA 1DC5A 5TJ9A 4R9RA 3TSCA 2H1SA 3EVTA 2DFDA 3RCBA 4YAIA 1DLJA 1J4AA 5C7IO 3V2HA 1GCOA 3H65A 3E9QA 1XELA 1ZSNA 3PYLA 3GVCA 1I33A 1V6AA 3U4DA 3L4SO 2NTVA 4E5NA 4DMMA 1YQXA 1ML3A 1U28A 3ROQA 4CQLA 4CLXA 1X1TA 4DTIA 1U2GA 2Y1DA 4NJOA 2NU6A 1ZK2A 4HFJA 5EQFA 4F6CA 3QA9A 1EBUA 5DP1A 3KLPX 4DYDA 3BTVA 1KEWA 1GEEA 4NMHA 1D7OA 1SOWA 3QWFA 3VHRA 1DBVO 1I01A 2VHVA 3G3EA 4PLCA 4DIOA 4BUCA 1H6DA 3GDFA 4MIEA 3COSA 4OO3A 3GG9A 5G0SA 4ZU3A 3K96A 3LQFA 4NH4A 3DFUA 4E2YA 4YA6A 3R3JA 4UVGA 2HMVA 3OP4A 3FSRA 4IIVA 1I5RA 4NBWA 4S1VA 3AM4A 3V1YA 3H7AA 1ZMTA 4WLEA 1DRWA 4OH1A 4RO0A 1ISMA 3FBGA 4FFNA 3SC6A 1Q7BA 3LYLA 3VKUA 5JFOA 5TIIA 2YY7A 3DR3A 3FTPA 5TS3A 4ZD6A 4CQMD 1ZO8A 3RUEA 3UICA 4RZIA 4I08A 4YACA 4CR7A 3I52A 1SB9A 3BTOA 1VJTA 1RPNA 2PWZA 1EMDA 3R3SA 1ZBQA 2R00A 4BKPA 3PYXA 5COQA 2QHXA 4AJIA 2DBVO 4ALIA 5B12A 1E3WB 3WGGA 3NT5A 1O95A 3M1AA 4XDYA 2WYWA 2Q2VA 3KSDO 4BNHA 2O4UX 3ORFA 2OFPA 2P9CA 1SOVA 3QWIA 3AU8A 4R1NA 3QWAA 4NFHA 5JDCC 4AVYA 5K0ZA 1DHRA 3TFQA 1L7DA 2YHIA 4W82A 4LRTB 5MDHA 3ZHYA 1NVGA 3DHNA 5AXBA 1HKUA 4XYBA 2VZ8A 4TVOA 3S1LA 4P4NA 3OJEA 4D44A 4I5DA 1DIBA 1BXGB 1Y5RA 3AOGA 2FWMX 3L4BC 1KERA 1U8XX 3OHSX 4RVDA 2JHGA 4GX2A 4L74A 4YBZA 4PGFA 4ROSA 1NVMB 3ZWYA 5BSHA 3HG7A 4KTVE 4WECA 4BNJA 4E33A 1KC1A 3D3WA 4XGNA 1X15A 3BMOB 4FPXA 1HDRA 2C2YA 2EV9A 3ZV4A 2PD6A 3IJPA 1V3UA 3NYWA 4R68A 1H9AA 2XXBA 1DC6A 1VLLA 1IB6A 3IAHA 4WPGA 4E12A 1I3MA 3LT1A 2H6EA 5A03A 5A3JA 2BI7A 3I9LA 3PGXA 3DTYA 1PGJA 1QV7A 1UP7A 4FBGA 2O2SA 2C20A 1DIHA 1QG6A 1SO8A 3PXXA 4FOOA 1JAYA 1JTVA 1CQJA 1G0NA 1U8FO 2VYND 4QECA 4BNYA 3GG2A 3WGIA 3KHUA 4PG4A 4DPMA 3PQEA 1SB8A 2EW8A 1CETA 2GN8A 4LCJA 1B8VA 1HRDA 3H5AA 3R0IA 1PGPA 2BKAA 4BHTA 4FCCA 2HRZA 4CMCA 2Y1CA 3PHJA 3GT0A 5CDUA 3WTBA 3M6IA 1WMBA 3L4BA 3NEPX 3QRWA 4U0JA 2P4QA 1XKQA 1H9BA 1JN0A 2O2YA 2GZ3A 3QVTA 3ZH2A 5FEUA 2GGSA 1XWFA 4L4XA 1QLHA 5AXDA 4AICA 1R15A 4PLFA 1A9ZA 1YL6A 3Q9NA 4PLYA 3P2OA 1I2BA 3IL2A 5GMOA 2B37A 1E6EA 3WXBA 5BSEA 1X7DA 3CPSA 3DB2A 2X0RA 1RM0A 1VL0A 2HMWA 2OOSA 4IDEA 2YQ5A 1LX6A 1XIVA 1YJ8A 4BOYA 2X9VA 5IZCC 2EJVA 3G1TA 4IQGA 1WVGA 5F21A 4W9NA 4NK5A 3WB9A 1TEHA 3KTDA 3X2FA 3ZV6A 1LBEA 3TQHA 1I30A 5BR7A 3T7CA 3IC5A 1N8KA 3KRTA 4GWGA 3GZ4A 2PD4A 5JAIA 2VTDA 5JAMA 3K2BA 4PLVA 4XEHA 4AJKA 1WDKA 1ULUA 1D1SA 4PCVA 1P45A 5JO9A 1VE9A 4MP6A 4AJLA 4OKNA 1P31A 2XF8A 2A9FA 2YYYA 4IDDA 4TRJA 3P7MA 3DONA 2RAFA 5FF9A 4KQWA 4FC7A 1DXYA 3C8MA 3UKOA 1YL5A 3KB6A 5IFLA 3JQDA 5IDXA 5TRTA 3GEDA 3WICA 2Z5LA 4CV2A 1NR7A 1B3BA 1QXSA 4ND4A 2ZYGA 1D1TA 1QYDA 3BHIA 3W8DA 3HDHA 5TQVA 4LSMA 2NVBA 1GEGA 3KO8A 3BMNA 3E5RA 1T1RA 2YQ4A 4U6QA 4Z0PA 3VTFA 1H2BA 1NASA 3IQDB 4IY1A 3ZHXA 4LW8A 5HRUA 4A03A 2NWQA 2ZB8A 4DLLA 2E49A 5JDIC 4MP8A 4JP3A 4MDHA 3O8QB 1LSOA 9LDBA 4BIIA 3V5NA 3H2SA 4OYRA 1NFQA 2A35A 3SEFA 2BH9A 4UREA 1P74A 4NU5A 1FJHA 1WAMA 1ADBA 4PZEA 1KY5A 1PS0A 1N7GA 2WWRA 3U9LA 5G4KA 2YV1A 4R69A 3N74A 2VWQA 3PVZA 4AJOA 2ZCVA 3HADA 1XDWA 4YJGA 3DBHA 1GPDG 2C5EA 2HLPA 4RVSA 4UUNA 2VHZA 4WOJA 1YO6A 3DC2A 4I5FA 4KWHA 4M49A 4BNVA 4DC1A 4ALKA 2DBQA 1P0CA 1WZIA 4PRKA 4A10A 1O5IA 4ZQFA 3DWFA 4R1UA 1EE9A 2NVUA 4FFRA 4D79A 4MPDA 3INGA 2YDYA 4NBVA 3O8QA 3NUGA 4LSWA 4QUKA 4BNKA 5GZ3A 4GGPA 1ISJA 3VH2A 1BXGA 4Z9FA 2WMDA 1EBFA 4A7PA 1TI7A 1XGKA 5CDTA 5HA5A 4BMNA 4ESOA 1GDHA 1NYTA 1LDYA 2H5LA 2AEJA 3GQVA 4IDGA 4XYMA 4AL4A 2EWMA 2DVMA 5JDCA 2EF1A 5EESA 5TNXA 1GUYA 4L4SA 5KJ1A 1YOVB 4GX1A 3MOGA 4N54A 5T8KC 1K2WA 1S7CA 4XQEA 5JC1A 4J0EA 4W6ZA 2P5UA 1AHHA 1R37A 1BSVA 3HZZA 3PTZA 4EUHA 3ZCXA 1KIFA 3LK7A 4QT0A 3DZHA 5BQFA 4WCFB 2BLLA 3RKRA 3HDYA 5IDQA 2C82A 1E3JA 3PQDA 4BNMA 4BGIA 4FFPA 3VZRA 4ZVVA 2OBNA 1DB3A 3UCFA 1CYDA 4B8ZA 2R2GA 5B37A 3HFGA 3V1UA 5CEEA 3HB5X 3KEOA 4IZHA 4FJ1A 1ARZA 1P0FA 3KSZO 4RPHA 1IPFA 2QIOA 2O3SA 3OJ0A 2JHFA 2UUPA 5CG2A 3E8XA 3M2PA 1EVJA 2HJSA 3K6JA 1AXEA 3U5TA 4QX6A 2JFGA 3JD4A 1SBYA 2CVOA 3KOUA 2V7PA 1IZ9A 2I3GA 5GZ1A 4OIMA 3GEGA 2YUTA 2PH3A 3AM5A 1DIRA 4ZQHA 4XIYA 3ZNOA 4BO1A 5L53A 4BNGA 1UP6A 2PY6A 3GNSA 1PGNA 4J3FA 5KVVA 1A5ZA 2Y66A 3OFSA 4FSHA 2J6IA 1PGOA 2OBYA 3KVOA 3Q6IA 1JQBA 1LC3A 3B20A 3W8FA 3LC2O 1Y8QA 4J7CA 1SPXA 4MIYA 1WLYA 1YL7A 5DN9A 2HMUA 1LJ8A 1UDBA 1PS8A 3VDQA 2O7QA 1LSSA 1MFZA 4P8RA 1T4BA 4BNZA 4HKTA 5T5QA 5I8ZA 1U4OA 4R3NA 1LTHR 1Z7BA 3JQAB 3ZZNA 1HDGO 4XQCA 1YJQA 1TT5B 5IF3A 4CM3A 1E1NA 3VH4A 4L8VA 2YV2A 4JLWA 1W0CA 4A27A 3PJFA 3W1VA 2NQ8A 4XKJA 1Q1NA 3E48A 1U7HA 5IDYA 4KQXA 5TLSA 3F1KA 3JTMA 4NR0A 1KY4A 2NTNA 1DSSG 2A4KA 4J2OA 4NPCA 2PD3A 4CL3A 1B16A 5ER9A 3NX4A 4OXNA 3PIIA 4CLEA 3JD0A 3RFVA 1HYEA 2VYNA 2GUGA 1NWHA 1R0KA 3OJOA 1PS9A 4IDAA 3W6UA 4CODB 2FR1A 3I83A 5A9RA 3PHHA 5HM8A 2VUTA 1H94A 1DC3A 2VZ9A 3JYOA 3EYWA 2AW5A 3NDIA 4KOAA 4P4LA 5CP8A 1E3SA 2V6GA 1B8UA 1FDSA 1ONOA 2AG5A 4AJPA 3E9NA 4IQ0A 2BFPA 4J1QA 2FZEA 4DMLA 1N7HA 3ZV5A 4Y6PA 4E31A 1L7EA 5HWSA 4HNGA 5TF4A 1E7SA 4Y8VA 3UN1A 4LCEA 1HE5A 2QYSA 3GLQA 5A04A 1UDCA 1R4NA 1E5LA 4BKUA 2CD9A 3LDHA 2C5AA 2NLOA 3GVPA 4L9RA 3IP1A 1O0SA 4YAGA 3GPDG 2G76A 4E5KA 3VZSA 1XG5A 2J5KA 1XQ6A 3CEAA 3DZFA 3R6DA 4QXMA 3OJLA 1HE4A 4BQPA 4HFRA 3CINA 4J1NA 3K30A 3GMSA 4BGUA 3ZWBA 2VTEA 1I3NA 1IPEA 1H93A 1WMAA 2R00C 1ADFA 3K9QO 3L0DA 1FMCA 3DOJA 3NTOA 4OL9A 3TJRA 3WNQA 3N58A 2JFHA 5KCZA 1ZVMA 3EGOA 2CMDA 3SLKA 1EK5A 1TT5A 1VPDA 4BKRA 3BMNB 4A73A 4K6FA 4XJTA 2ZB4A 2FR0A 4YJFA 2EEZA 4BO3A 5B4UA 5DNAA 1UXIA 4MVJE 3VPSA 4YAEA 1ONPA 2FR8A 2IRWA 2DFVA 3ZWOA 1QV6A 3WG9A 5C3MA 4R5HA 2PGLA 1KVSA 4CQMA 1NPTO 2JJYA 3EW7A 2J8ZA 3H3JA 3PP8A 4W9NC 4XQGA 5JS6A 4GI2A 2BFOA 2G82A 2WD7B 3PFWO 2YFQA 4GLOA 3S2FA 2IDZA 5C7OO 1PR3A 2VRCD 3O26A 3PLNA 3ANLA 1U5AA 3IKVA 4B3HA 4BNLA 1LEHA 1ZSYA 5BSFA 2I66A 1NQAO 1PL6A 3MZ0A 2NM0A 2G0TA 3FRJA 4BNTA 5C37A 5IG2A 3Q9UA 3RUFA 1UXKA 5K6AC 1U2DA 1DOHA 3SLGA 3WTCA 3KZVA 2V6FA 3PZBA 1HWYA 1GFSA 2B4QA 3EZYA 4M54A 4QEDA 4BMSA 4BO2A 3RJ5A 4UUPA 2HMTA 2FPIA 2VYVD 5I9MA 3U62A 5B4TA 5I8WA 1HYHA 1AE1A 3K92A 4E5YA 4YJHB 4Y9DA 2VRBA 4IS3A 2IZZA 3DZBA 1P1JA 3FPLA 1Y9AA 3KSUA 3LZ6A 1NHWA 2BF7A 1KS9A 3AUTA 1ULSA 3ASVA 4NG5A 3OSUA 3RU7A 3AJRA 2V6MA 5KJFA 1YWGO 1O8CA 3WNVA 1YBVA 2PH5A 4XWYA 1YE3A 1CERA 5KJEA 4P22A 1OI7A 4R51A 3T4XA 5HTOA 1BMDA 1E6UA 3GGOA 3M2TA 2NV6A 1IYZA 2UVDA 3QJ5A 1K5HA 4IDBA 6LDHA 1P44A 3JD1A 4TRMA 2Y68A 3RROA 1XU9A 2VYVA 1TVEA 2PKQP 5L51A 2WTBA 1OC4A 4A0SA 2AMFA 4MKZA 5JDIA 1HZJA 1YDEA 3LVFO 3ST7A 1GUFA 3KYCB 3OIGA 2O3TA 3H6KA 3NDRA 1WDLA 3UF0A 4WNIA 4MVJM 1GYQA 1BVUA 4OXYA 1YB1A 4TROA 1QSGA 2HDHA 4E5MA 3HNPA 4GMGA 3L6EA 3JCZA 3Q11A 3EY4A 1U4SA 2ZATA 2OO5A 5A1TA 1XHLA 1Q0LA 3IMFA 3TZCA 2QX7A 2IEBA 2VOEA 4FFOA 2IZ1A 3GRKA 5A05A 3QHAA 4YRDA 4PLGA 3E5MA 3QLJA 3TL3A 4K9DA 2P4HX 1E5QA 3AUAA 3TOXA 2PNFA 4IINA 1T2EA 4EW6A 4C7JA 1GQYA 4RVGA 3DZGA 4BGVA 5ENVA 4D45A 1TT7A 1HEUA 1NHGA 2C0CA 2Q2QA 4IUYA 5CHEA 3ZNQA 4MP3A 4D3DA 1KVRA 2CF6A 4DQXA 1H5QA 3IJRA 1A72A 3D3EA 1WZEA 3S2EA 1JWAB 3F4BA 4RPKA 3L6OO 1SC6A 1GL3A 1XU7A 2J3IA 3C1OA 1V3VA 5CDYA 4UVIA 1UAGA 5L40A 2DM6A 5IXSA 3D64A 1C1XA 4NI5A 1DRUA 3D7LA 5CDSA 3RKUA 3PLRA 3H4VA 1PL7A 3GEMA 3Q1LA 3AFMA 3PWZA 4MKRA 4U7WA 4LVCA 3T4EA 3WQSB 1NVTA 3QW2A 2WEKA 3FCOA 4R1TA 2ZTLA 4GQAA 3UGKA 4E21A 1KETA 5JNLA 2FP4A 3MOIA 2AQHA 3CUKA 4DREA 3EMKA 3SXPA 3VOSA 4XCVA 1VL8A 2QRKA 3P5SA 5G0TA 3SX2A 1PJ4A 1C1XB 3STHA 4YDRA 3NGXA 2C7GA 4MVJD 1RM5A 3GUCA 1LI4A 3OETA 1VI2A 3C24A 3QWBA 3D4NA 3HB4X 4WEOA 5EPOA 4ZJUA 1E3EA 4XRGA 1KVQA 4R3WA 2AA3A 2HRBA 2VT2A 2WSBA 2UAGA 3KEQA 4GX0A 1HE2A 2EP7A 1O94A 1MP0A 2O3RA 3H8VA 2PZKA 5IN5A 3NJ4A 3ZDFA 4BNIA 1AXGA 3G0OA 4DVJA 1ADGA 3WGTA 1MA0A 1OZAA 1UH5A 3SC4A 2Q4BA 1PZFA 4BO8A 4WGGA 7ADHA 3A28A 2OORA 1I2ZA 2Q4EA 1YONA 2TMGA 2B4TO 3D5QA 3ZW8A 4B4WA 1PJLA 4TKLA 1R0SA 1R4MB 1ZXBA 3MTGA 4L76A 1ZK1A 2BRUA 4P4GA 4GGOA 2X58A 2Q50A 3DBLB 1LLQA 5BT9A 1EDOA 1GADO 1E1LA 1JLLA 1NP3A 1PWZA 2DUUA 1I0ZA 4GSKA 3DZIA 3RC1A 3D4OA 1DFGA 1QYCA 4X54A 5LDGA 1WW8A 3GF4A 3GRPA 3INTA 5ITVA 4TVBA 2NQTA 1H6AA 4ALJA 4RGBA 4PG7A 3I6IA 4FGSA 4JROA
chains in the Genus database with same CATH superfamily
2G9QA 1OBFO 1T26A 3A06A 1OXMA 3ZCRA 1Y3HA 4OQNA 4BWVA 1TVKA 3G2PA 2H3EA 4P98A 4Y30A 1JPVA 3RUPA 2F3UA 1WPXA 3V42A 1H0KA 1O6GA 3GR6A 3Q8LA 3NRCA 1QORA 2PJZA 4HWKA 3R5FA 4ZJZA 2QVYX 3RC8A 4X7MA 4CQMB 4F5ZA 3FE2A 1CUHA 3L02A 4BLOA 1SOAA 4J91A 3K1TA 4KAFA 4N12A 1TIBA 4LGVA 2W42A 1DX4A 1ZXLA 3DEJA 1XPRA 1E64A 5TQ0A 2KPOA 1HT2E 5CCEA 3VBCA 2H1OA 5E9AA 1TMGE 4LYJA 4N0EA 1NMXA 1VBNA 1H2HA 2Y1LA 5F2EA 1NR5A 1YH3A 4ND2A 4YJFB 3VSBA 4WACA 2H16A 3W6PA 2Q3HA 1KKUA 3DSRA 4DAEA 2GJKA 2CYBA 4NBSA 3FZEA 3HO6A 4BYMA 3D2AA 4LZPA 3AR5A 4KLNA 5EHQA 1O6ZA 2AIRA 4JHXA 3S2GA 2REXB 2X1LA 3NTXA 4ZVOA 3U7QA 1JEJA 3GVXA 1U80A 1RQRA 2B9EA 2VH5R 3TSWA 4AULA 4MWGA 4N18A 4BC1A 4TSFA 1P5ZB 2GKGA 3MFYA 1RVDA 1TEXA 1HFEL 1JHRA 4J1TA 2FPIB 1JEAA 1V4BA 3PJGA 1XZNA 3AJ9A 3JVIA 3SZGA 4ENRA 1SPBS 1YIOA 1KE2A 3B1VA 5ALKA 3RG8A 4GVPA 3KVRA 3WRXC 2BWJA 1D6MA 4AECA 1GPMA 2XYHA 4I14A 3LLUA 1MRSA 4GH5A 1VJGA 4N41A 4M0PA 4DR5B 3GIDA 2P5SA 1GZ6A 1KYWA 4QYWA 3KBBA 2XRMA 4E0BA 4WHMA 3FPCA 1YIAA 3AOEC 2ZWAA 5JJIA 4CF3A 4F86A 4TLLB 4OQZA 4GOLD 5DULA 5E6UA 4CTOA 2C3MA 3C5EA 3SF8B 2AKAB 4C0WA 1C7FA 2E2WA 1PT9A 3B36A 3EC7A 4YRKA 2YWJA 1AQNA 1EUZA 4GL2A 1N0HA 1EXMA 5I9LA 1Z0ZA 1DZ3A 2R65A 2PPVA 2XCUA 2XZPA 4OBWA 4WFIA 4AZ3B 3KJEA 4EATA 3THRA 5J47A 5GJBA 4JJKA 4X7RA 4KBGA 4OP3A 5H9WA 4XIIA 4XH9B 5JISA 3KT0A 1XZ8A 1JHDA 2IW1A 3IDOA 2C95A 4FOPA 2V5AA 3PXUA 2P30A 1UBGA 3SFVA 2QJFA 1G8JA 3WJAA 1B76A 1Y1RA 1GXSB 4ZPJA 2WJPA 3PE4A 4YECA 5KKAA 1Y82A 2ECKA 1ZUIA 2AG8A 3F4LA 2IE0A 1A7AA 2PFGA 1Z0KA 4X63A 3NP9A 2EFYA 1WXFA 3W4KA 2CVFA 4QM7A 2WFMA 4JYAB 3PFFA 3M4NA 1OPXA 2PCLA 2YXBA 4MVJA 2IDMA 2PWYA 1ZL0A 3KL2A 4JKYA 3GUZA 5TGTA 4GKKB 2LBPA 4FN4A 2DKOA 4PR3A 5E9QA 2IY7A 4BB6A 2ONKA 3JWHA 3NHMA 3M1YA 1ISPA 1BTOA 1L5QA 2J6CA 3GGCA 4Q0MA 2C99A 1DRJA 1XDDA 3G2QA 4P0TA 2W2QA 1TA4A 2BGMA 1Q17A 1FS5A 5DEOA 5F7OA 1AUPA 2X7JA 2BFAA 3AG6A 1SKAA 2JGFA 1LQ2A 3H9EO 1YMVA 1Y48E 4TV9F 4L7QA 4I1PA 1E61A 2COKA 3KKOA 5CVVA 3TG8A 1JAZA 2YWCA 2CUNA 3IELA 3PEFA 4ZYUA 3T3PB 2D62A 4ZI7B 1Q0TA 4G4IA 4FYMA 1T1SA 3SHTA 1LFAA 2FG5A 2GRAA 5EUCA 2PQ2A 3D3QA 1P1RA 4LMRA 1K97A 3PQ3A 4IWXA 4J7XA 1RQ7A 3G0HA 1ZINA 3LUKA 2OVFA 4PNEA 1T9CA 2NP7A 3HFSA 2AGVA 2AKYA 4RF4A 2NZXA 4E94A 1Z0UA 3SY8A 4L1KA 2BKEA 3AIIA 5JCXA 3PUHA 3UPTA 3E3AA 1L4HA 3GGGA 3ZDZB 2G5TA 4TV8B 1W1WA 1EZ4A 3A4VA 4GPD1 5CT4A 4YUVA 3S4YA 4BVAA 4D9CA 5B2EA 2JCBA 5HM6A 2ZJZA 1YFJA 5KSZA 5IMBA 4Y1FA 4I1SA 4CM4A 3C1AA 2DPXA 2FSPA 1JU9A 1DJMA 3TQTA 4A82A 1LKZA 3KPUA 2X8WA 3U81A 5AJWA 4KNYA 1EHIA 1G5RA 5IVHA 3DHYA 1Y81A 2EJBA 4PAWA 2VSXA 4E88A 3HKDB 1RAIA 5EKUA 1T35A 1IBCA 3JALA 2A1TS 5ED0A 3W5IA 5L4LA 3FOFC 2XUJA 1NZJA 1R6AA 5KMGB 4FLEA 4IPTA 1WDMA 2R8EA 3IDAA 2IDKA 1YZQA 1NIJA 2IV3A 3VO2A 1LVUA 2YMLA 3EISA 5IAGA 2FXVA 1TZKA 2X6RA 3AHEA 2PUEA 2G6TA 4ZI7F 2GF9A 1Y0BA 2ZYWX 3UATA 4FLFA 4KU4A 1A7JA 1ZOLA 4TTRA 3OZXA 4YGYA 3SGLA 5HDBB 1OIVA 4KFUA 2RHDA 5E2AA 3ZQ4A 1CQIB 1ND6A 3L1JA 2AN9A 4P3YA 3ZE7A 1X1RA 3GJ3A 3BGIA 4IMRA 2RB5A 5ARDA 3UXMA 2P0EA 3FGNA 1LD3A 3HYSA 4E32A 1MB2A 2C54A 2RH4A 1MPXA 3BIJA 3PUJA 2DHQA 4Y2TA 4F38A 4R0NA 3H9UA 1KJ8A 1ISFA 1E8MA 1KY2A 1N1MA 2O1XA 1W0JA 4HG2A 1IHXA 3VQTA 4NHOA 1QHIA 1E2LA 2EP5A 3H3XA 5AHOA 5DGCA 1KDZA 1WB6A 4QGFA 3RLIA 3TIXB 4RA6A 1GRVA 4M88A 1VA5A 4Q6BA 5DB4A 2JI4A 2F9FA 4HMPA 1QOQB 1H3NA 4GNRA 3HZRA 3E9DA 4QRHA 3DVSX 4ZN6A 1G6HA 3PCTA 4G09A 4KUEA 5COBA 4Z0TA 3VDXA 4C6SA 4PG6A 1YXMA 1JDBB 3OQBA 4PZCA 3TIIA 3U4AA 2FPXA 3AY3A 2ZRKA 1YB5A 5KNDA 4CL8A 4BLVA 2DLCX 1BX3A 2CVZA 3LF1A 4HWOA 5K99A 4XWTA 1XZBA 4EAAA 2VPZA 3OJXA 4K9SA 4YT4A 3DO8A 3AI3A 1CUXA 3CH6A 3DM9B 3N3AC 4AYXA 5GAJA 3ZCTA 4EA8A 1R9JA 2XTAA 1WCWA 3ESDA 5HIMA 3B1XA 5LZ8A 3M6LA 1RPJA 1T29A 4FT4A 4UTVA 5E3IA 3HWSA 4FI3C 5DYNA 4Z7JA 1A4RA 4ZEXA 1OB2A 3PHLA 2BMAA 4D4HA 1TO6A 1WUJS 3MS7A 1Y3FE 3LV8A 5L7TA 3FPBA 3HABA 3H0EA 3IOCA 1YQWA 2PMWB 1ODKA 2A33A 4MQ5A 2PEZA 1AURA 3CZCA 4G4SP 4EQ6B 3VTZA 3ONNA 1DIAA 4ZZIA 4X1YA 3EUEA 3FVTA 3JZAA 3PWKA 2HF7A 1PNRA 1XMOB 3R6TA 4L75A 3HCPA 5HFNA 1JR4A 4LC1A 3HVUA 3OE4A 5EHIA 2P69A 1W4CA 5ITZB 1T2UA 3PJRA 3HA5A 3N2ZB 5EINA 3VSDA 4WY5A 1B8NA 2NPOA 3G89A 5L3SA 4ND7A 1MJHA 3I1YA 3OLQA 3TZLA 4CQLB 1ZK4A 4YP5A 1Y5IA 3A3PA 4DNXA 4EZBA 5G02A 1GHTA 4Q3LA 3F78A 5JC8A 1YD7A 4OATA 1Q6ZA 3KYBA 2D1YA 1NVXQ 1XJWA 2RGYA 5AHKA 2SKDA 2J4CA 2DH5A 5DHSA 5AYVA 4EB8A 1MJFA 1RJEA 2Q6OA 1ZJYA 4JBGA 4WW0A 3JZIA 4BB9A 2B4AA 4G5HA 2IZ0A 2H4XA 3C8HA 3ZU3A 3JATA 2BZSA 3PWSA 4KACA 4HRXA 1VKZA 1OAAA 4GSLA 4WESA 4X1KB 5CLLA 2RH5A 4KV9A 4EJSB 5IX8A 2RHCA 1VIVA 2E87A 2DPYA 5LQMA 4QDZA 3TW8A 4DT1A 1RQPA 2H1LA 3DWEX 4FNGA 2UXDB 2HDNB 1IQRA 1L4UA 1QFYA 2OTCA 2R6HA 3GWZA 4KCGA 4RKYA 3VHLB 1E3DA 2UKDA 2UZIR 2O5EA 1LNZA 4A0FA 3LX8A 3QXJA 4CDGA 3PR2B 1Y7HA 1OC2A 4LGYA 2VKQA 3WLIA 3RYFA 2DY1A 4MS3A 4EFMA 2XIJA 3U7HB 3IPLA 2D1RA 4LDZA 3AUJB 3DC7A 1D09A 1PR2A 2PFKA 1P3Y1 1DELA 2X5OA 2XMDA 2ZSUA 4IJUA 3T35A 4EPTA 5CG1A 4MITA 2D3TA 2VXBA 4Q3AA 3AZPA 2ET6A 4D0RA 2XUHA 3OLYA 4NBLA 5CT8A 4ZVLA 3ZJYA 2L42A 4AF7A 3HDQA 4WY2A 3CZQA 3RUIA 3UMJA 2OAEA 5MN4A 1MN6A 5BXQC 2VTVA 3WJ1A 1RJGA 3GGJA 1H69A 3PT5A 1KO8A 4ZOLF 2YH2A 3PQ5A 5AXCA 5TJHA 1QZXA 5IJWA 3OM9A 4G2NA 5I9SA 3LTNC 1PRYA 3DNPA 4OAOA 4CM9D 3DF9A 4FHEA 4P35A 2OG2A 1LBSA 3EIXA 4C87A 4J0GA 2B82A 4YJ2F 5L9AA 5BNTA 5MGBA 2HRCA 3KE8A 2VHYA 4XM2A 4DZZA 2JAQA 2XUQA 3DCNA 3O7MA 2RIRA 4I0WB 3RYCB 2BMWA 3LLSA 4Q1CA 4PX2A 5FOWA 1X7GA 5A6SB 3ZQ6A 4B47A 1E94E 5P8WA 4CIVA 5B4VA 4W1PA 4FQ5A 2WV9A 2X2EA 1K08A 1KSGA 4M1QA 3AW9A 3QEKA 3D0OA 9GPBA 2D1QA 1U7PA 5JI3E 4WT7A 1U2RA 3VVLA 3SFZA 3M89A 4RF3A 2KS6A 3FDFA 2A6PA 4MVJI 1X1BA 2HCBA 4ESEA 1JHQA 3VAYA 2WABA 1UDAA 2AN5A 2H5IA 5EI5A 4DLRA 1IHUA 3SPXA 1BO6A 1UPCA 1W4AA 1VJDA 1SOMA 1KO1A 2V6BA 2BDUA 1THGA 4Q18A 1V2HE 1D2CA 1RXSA 4MTCA 5D1HA 2GS9A 3G2KA 1SCAA 1U5BA 3M6VA 1EINA 3LOUA 3OIYA 3JU3A 1BKDR 1RI2A 2PKQO 5HOQA 3M5WA 4JL8A 2CXTA 1JDPA 2GD6A 3AERB 2ZPAA 4TN1A 3DCYA 3FWZA 4I4IA 4E7PA 2E85A 3FAZA 2ZIFA 1UBKS 2VR1A 1NN3A 2QDKA 4PCLA 1SIUA 4U7GA 4QUIA 4NV0A 1I8TA 2IFTA 1L5RA 2OEPA 5HKKD 1QGYA 2CHVA 4YAKA 1ZGHA 5JQGB 4F11A 4DY6A 2ZSEA 2WHRA 3ZWMA 1WU8A 5BV1A 3R76A 2A8YA 2PMKA 3G9QA 4HPXB 4EKGA 3AHIA 3QVUA 2AMVA 1CX9B 2XIQA 2A1IA 3CPEA 3PGMA 1LS6A 4HX2A 4BFLA 4CIDA 3JR7A 2V3WA 5HJ7A 3OQMA 1XVVA 4YMSA 3G0DA 4RS4A 5THXA 3OE7D 3TXYA 5LXTB 1ABFA 1RJ9A 2XZDA 4YHBA 3WL3A 4ADSG 3BCRA 3G1WA 3KEMA 3KPJA 1UJCA 1W9MA 4M98A 4OI4A 3N87A 5HF6A 5K4GA 4BVBA 2REOA 3MT8A 4RLHA 4EYSA 2WWFA 2ZCJA 4JDPA 5K3EA 3QMWA 5GIOE 2DR3A 4IO1A 1A9QA 4YMLA 1UOQA 4WADA 2CLDX 3T9AA 3KFXA 4JASB 1GA1A 4DIKA 3LE8A 4E5VA 4EJ6A 1AGYA 1KJIA 3B82A 1IN1A 3QXCA 3K32A 1QP8A 4IIFA 4ALMA 1SEPA 4G25A 2DJ5A 2YRWA 1K6IA 2PO5A 2Y92A 3P2EA 4NJMB 5FPQA 3STUA 3FR7A 2V7WA 5EXDA 4BMCA 4D9JA 1YR2A 2O0LA 1M5UA 2ZE5A 4ASUA 4BVLA 4IMJB 3VDNB 1N5DA 3DYVA 2MYPA 1E9DA 1Q22A 4CG0A 3HBNA 5DCLA 1NOIA 3TLBA 2K7ZA 1NF8A 2ZBGA 3OZSA 3N0XA 4A5OA 2J9XB 1W8DA 3FUCA 3L07A 3NIDB 3O0DA 2Q1WA 4KI7A 2ID4A 4PC2A 3RFXA 2AN3A 2G07A 3HA7A 3S7ZA 4EY3A 4BB0A 5B1IA 1Q16A 4W6QA 4M1TA 1F0NA 2GRJA 1CJCA 3DDWA 1QHYA 4P33A 2X0KA 3GZNB 4PIVA 5EVJA 1WPQA 2BJHA 1S8AA 3A4TA 2D7JA 1ZMXA 3LVRE 4NBUA 4DMFA 2OO5C 3OEHA 1E2IA 4QIHA 1KQFA 5B7QA 1GAEO 2XDQB 2IVZA 2XODA 3E05A 5D3KA 4OFZA 3FN4A 5EIOA 4DQVA 2GT1A 4KO4S 5JJLA 1AUXA 5B58C 2XB6A 3A1TA 4YLGA 4RA6B 2X77A 1RXUA 1QANA 4YQEA 4BNXA 4MV7A 1JMVA 1GKLA 4IH4A 4BO7A 1O94C 1YAJA 3COYA 4I8IA 4ZTBA 5A3SA 3BGDA 1YZTA 1NM5A 1WUHS 2Q5EA 5LLTA 3F2IA 2XYQA 2I7DA 3TF5A 4EUSA 2O2GA 2VDJA 1QOPB 2DF8A 3CF0A 4MHOA 2NTYC 2XB9A 1AKUA 2J45A 4GI5A 4J7AA 1PEAA 2Q1UA 4I50A 2WHQA 2W2OA 2WTAA 2WSSA 2XE4A 4YDSA 2GBGA 4F4FA 3F3MA 1E7YA 4MRMB 4X85A 5BYAA 3PG5A 2CN1A 3WQHA 3KPWA 4GDMA 4YUAA 2GHTA 3F47A 5FAKA 5KYXB 1BX0A 4BXOA 1I4LD 4J1TC 2OV4A 1P1FA 2XCIA 3MSCA 4QVGA 4CM8B 4QUJA 2PCJA 4L2IB 3S29A 5U9CA 2ADMA 1YS9A 4JFAA 5FYDA 4HB0A 1QHXA 3V8PA 2VF4X 3RC7A 1ECPA 1U7OA 4Q4AB 3OAAA 2XRZA 3ASZA 1JNXX 3ZX4A 5IF9A 4QQRA 2NXCA 4OQYA 5AK0A 3B60A 3ZWDA 2A0XA 1B8OA 2PGJA 4F45A 1XLWA 1U8UA 4A15A 2OL4A 1LJUA 1N2OA 4C04A 4ZCTA 4EKNB 2QN6A 1CHDA 4LHYA 5KU7A 3PEEA 5BWBA 4AK9A 4XX0B 2RK4A 3FCSB 1TKBA 1VHJA 2J4FA 2LPMA 1MW8X 2BFNA 3A10A 2HDWA 4DPKA 4D7AA 5ER6A 1A1VA 2OZVA 3MJSA 3KJGA 4DDVA 4L73A 3OQIB 3LW7A 2XXJA 3F5QA 4HDOB 4UBMA 3RRYA 3KETA 4D25A 2G8LA 3AV0B 1VDMA 3JQ8A 3HKCB 4ARSA 2VXYA 2FVYA 3GLHB 2ERXA 4OHXA 4R2MA 5DOZA 3LBNA 3NDJA 2O4CA 2L18A 3OEYA 3O8CA 1KXJA 3NMUF 3L9WA 2WU8A 3TRIA 2DX7A 2JIPA 3WIUA 2KYRA 2M1ZA 2G8NA 3L93A 4IQ8A 3SS9X 4JODA 1CIPA 3VPHA 4DDTA 3LDFA 1RZRA 1P75A 3K72B 3D2BA 3JQBC 3NPMA 4JUDX 1M34E 4GI1A 3U6KA 4FGJA 1E6LA 3CVXA 2GZ1A 4LXQA 1BW9A 4W8OA 4A4DA 4D46A 5DGIA 1GAQA 1IDN1 1AK2A 3PUIA 4MV3A 2J9YB 2IXFA 5JCOA 4JR1A 1MG0A 3DDNA 4LKRA 2C31A 3IHTA 3K15A 4QG7A 3R44A 2W58A 3FA2A 5DLDA 5EOVA 3PXDA 2IH5A 5EXTA 1HNZB 3DEYX 2ONYA 3EXHC 4RDHA 4BL5A 3SVLA 1E20A 1S4MA 4G5YA 3UOAB 3FTNA 4NU6A 4DBZA 5BSTA 3B5JA 2CHQA 3AGPA 4ZQCB 3D81A 5I7HA 2JFXA 4RSHA 3DDUA 4WCDA 4J4BA 4YRCA 1T9DA 3T8YA 5LQSA 1XCPA 3JATB 1MG5A 5FUYA 4B5KA 1Z12A 2DFNA 2WZDA 4H1VA 3SQLA 4QYMA 3E7PA 1Z5OA 2FZVA 2ZTMA 3M5CA 4I9NA 4RADA 3UEOA 4ZZ1A 5FI5A 2IW3A 3KLNA 3GY0A 1A3CA 4ROTA 1OYWA 1P1KA 4ZQEA 4QVKA 5CJJA 2O7RA 2RGUA 5DHUA 2AV6A 1ZM9A 2R60A 5HIKA 3CJTA 3OX3A 3CUSA 3OE1A 3Q98A 4FNMA 1L1FA 5IJXA 3ILYA 3TI9A 3V00A 4XRRA 5BNFA 2ETVA 4AO6A 3O03A 4K6HA 4MCIA 3BMOA 4RD0A 2GF2A 1GAJA 2F1OA 2QTMA 4MICA 1JBEA 3QLEA 3ZE9A 5FV7A 5A2GA 4KPGA 4KDCA 1HEYA 4HDMA 3CRZA 1G2QA 3ZY4A 1TLTA 4RJ2A 2C9MA 2R6R1 3RNLA 3TGLA 3PEYA 3ACCA 3F9RA 3N2YA 3RKSA 1N6HA 3TMAA 2B5OA 1VDZA 2IHYA 3HJUA 2JGAA 3ZDRA 4HWPA 3ABIA 3OOJA 4LOLA 4ZP1A 2PH1A 4BATA 2OGZA 2HL6A 3PJEA 2SCUA 4TVKA 5IHXA 1RQGA 3BWDD 3R2JA 4O1HA 1E4YA 2PWAA 3QTBA 4L5YA 1C1YA 4O63O 4RJJA 3TSAA 1C1DB 1M75A 2JCXA 1GRNA 2OT3B 4WCVA 3UTCA 4O25A 4WZBA 1JZTA 4OAQA 5JVDF 4NE7A 3M9XA 5ITVA 3CGGA 1RWVA 4R4JA 1HG1A 2A9KA 5CYFA 3HN7A 2ZBDA 1XQYA 4RVFA 1VPVA 4XJVA 3KZMA 4BV8A 4OXIA 1HL3A 2OV1A 4EF5A 3O7WA 1KOGA 3HK2A 1F0PA 3Q7PA 4WOKA 5KYYB 4EI8A 2FPGA 3SHWA 4QGAA 2XA9A 2GN4A 1EGAA 1K4YA 3KAQA 4AI6A 5F64A 1TVCA 1BZYA 1ADCA 1DBWA 4JLPA 5CX1B 4JMPA 3CJRA 4AU1A 2WKQA 1I10A 4XB2A 2ZTUA 4XYEA 4J2HA 1CHNA 3FPKA 1GDTA 1TGYA 3STVA 1Z45A 3M83A 4FWIB 1MBZA 1OFUA 2DMRA 4FXPA 3G2MA 2BGKA 3NQ41 3RIHA 5CJ2A 1VLJA 1NN1A 5JALA 1U7ZA 1C5KA 5PNTA 1CIVA 1Z88A 2EHDA 1UBMS 4L51A 4KX5A 5LM3A 1KZ9A 2DBYA 2H1FA 2ZIZA 3K9CA 3T0GA 4P08A 3UANA 3SQMA 4PXYA 3L6CA 4ZFNA 3M6XA 1CQZA 2P65A 2I76A 3VR5A 2O48X 1P4SA 4XB1A 3VMFA 5H0IA 2BGGA 1GDDA 2R4QA 1L7PA 3I12A 5H3HA 4QKQA 1V3TA 1RYMA 4CRWB 3PEUA 4AIIA 3IUPA 2RG1A 2IPXA 4V1CB 4M0MA 5EFOA 3KOMA 3QKSB 5TR9A 4X95A 2G36A 1NIPA 2L82A 2Q6LA 2Q28A 2PL3A 3CWZA 4Q21A 4QJIA 4BE4A 2X2FA 3L41A 2XB4A 1SKMA 3C3BA 621PA 3IMKA 4C7BA 2WQ7A 4EYEA 2PAFA 3TEJA 4YPVA 3ROFA 1MEJA 3L0PA 2FMHA 3QNUA 4RVHA 4YCMA 4EJ2A 3RAGA 4RHCA 4LRYA 3AF6A 1UINA 2C07A 2QG4A 1RI1A 4CFZA 1QQTA 1V1RB 5KQGA 3D7KA 1RC8A 3MWLA 3H9BA 3N3BC 1UPFA 2KI5A 2JJ8A 4FU0A 3V46A 1CV2A 3WQRA 1Q50A 2ECOA 4H3HB 1CLUA 1XZIA 1L1RA 4TRRA 3RSZA 1XN1A 4U2EA 3DXYA 4RDIA 3SJBA 2WIGA 1GV0A 3CS3A 1WMSA 2AJTA 1ZVKA 3FYUC 3UFXA 3TDMA 2QENA 5IT4A 4B79A 4C4YA 2NU7B 4UCFA 2C4MA 3EXG1 4X00A 3B1KA 3O90A 1ONSA 1VIAA 2QG9A 4RYDA 2ZVQX 4ZI2A 1CY0A 1W2WB 3VDRA 4N7BA 1RI5A 1JLKA 3PFKA 3IAM1 3SMVA 2GZAA 1U8ZA 2X2PA 4QO7A 1UKCA 2A0WA 3ND6A 4CGZA 4C1NA 1SURA 3OO0A 4RK4A 1E79A 1DC8A 3PFNA 4CZ2A 4B3DA 3PC8C 4XOIA 1JLLB 2JLSA 3QEAZ 4TZ6A 1T2DA 2GVNA 3HDVA 3PE6A 5ALZA 2Q5FA 4UD6A 3K0BA 1JVBA 2ZYVX 3G2NA 2HXGA 5ICCA 1JG3A 3ITKA 1LBIA 3D4IA 3AL2A 1KARA 4IJQA 5EZYB 4ZZ0A 5JFTA 4QPZA 2BYTA 3FRIA 1PW5A 1WP4A 3K9WA 2FEAA 2ZRQA 3HKEB 1SVWA 3KHKA 8MHTA 4PC1A 2IPAB 1W87A 2HFKA 3N8HA 1GTMA 1UXGA 1YZGA 4IXMA 4OFBA 4LDNA 2E4AA 4S3MA 3H9QA 3AV3A 3PIRA 1NJ2A 1XF1A 2Y99A 3BMCB 3ICVA 4KXXA 3PFGA 4A2PA 3KPYA 1Z47A 4RFVA 2QBYA 5ENZA 2ISQA 3K3PA 4MCHA 3AETB 3S70A 5I7UA 4REQB 4KHPB 2QT1A 4JDUA 3S1AB 1Y3CE 3P0FA 3LKVA 3JQAA 1NJFA 1XJQA 3WJ7A 4QDUA 1H8ED 1DJLA 2ODNA 2OLJA 3TX2A 2JIZD 4CLDA 2XA2A 2OB1A 2VAWA 1PIWA 3ETEA 3PNKA 2PBZA 2C8LA 2VI5A 3NAZA 1N0VC 4JH0A 3C16C 5CT9A 5T64A 1LDEA 2C58A 2I2FA 3HJAA 3JAKB 1TIKA 1NE2A 2R48A 3HB1A 1I2AA 4LTMA 4O4HB 1Z75A 1PJQA 4ZQBA 1IAQA 4JOSA 4QGBA 1II8A 1WXHA 3KZOA 3NLLA 3P27A 4UVDA 4H31A 2J5QA 1PTJC 3FMOB 2XWQA 4EW1A 2FKNA 3B1FA 2E37A 2JD2A 3BXEA 3QVKA 1GTL1 2IH4A 1K8RA 3ZU4A 2UYQA 4O0LA 3K1ZA 3B38A 2JAPA 1SH7A 2YOHA 3GARA 4KR2A 3LZCA 1UBNA 3QOXA 1TVKB 1SCKA 4MDYA 1HTWA 5I9BA 3FLBA 4NOJA 4U5XA 5ILGA 4UFPA 2GA8A 3PLAE 3VHXA 1YS6A 4OG2A 2BMJA 4TMKA 2FE4A 3QTTA 4WASA 3QENA 3LT2A 3G2LA 5DLYA 2ZI5A 5BN3A 5DCUA 4S24A 4Q00A 3LT0A 3TVYA 3ZIUA 3BT7A 3F6SA 5GM2A 1DV1A 1A8HA 3EAGA 4MW4A 4PICA 2PUFA 1ZH4A 2FW1A 5TSDA 2GAJA 1C8VB 2XSZA 4L9SA 1SVUA 3RSQA 5KYWA 3QFHA 2QI9C 1LFDB 1WQ4A 1JJVA 4LOIA 4EECA 2NVWA 2QAGB 1H65A 2XRFA 3H2ZA 3ANYB 3OKAA 4U3JA 4W1RA 2AQKA 3BSWA 3K05A 3OZAA 2Q8NA 2W00A 5TX7A 3WRYA 3D5EA 2FG7C 1GGHA 1DPFA 2ZBUA 4XWWA 1PKXA 2FAXA 1QK4A 3DNMA 4DXAA 2YHUA 3EHDA 4NVRA 1BEZA 4Y6RA 2ZI7A 3WV5A 4C6TB 1CZRA 1ECGA 1USIA 1GZDA 1W0KD 4UU8A 4A16A 1J2TA 4G81A 1KC3A 1OCEA 4FTWA 1Z07A 3EK2A 3MWDB 1B3RA 1UIMA 2CVHA 1D9XA 1KP9A 2JJ2D 3UAXA 2IDJA 4GECA 3AKZA 2CLKB 3GH3A 2VATA 1C81A 1ZJ5A 2BEUA 2BSXA 4G9GA 4XA8A 4CG2A 3NDBB 2NO0A 2Q3MA 3U39A 2EG9A 1LDGA 2WWWA 4TYYA 1NONA 3CCFA 2ZP1A 4XDZA 3G13A 3SC2A 4QT4A 2EF0A 4I8XA 4MUBA 5DW0A 2I2BA 1H85A 4BQFA 2QM3A 4FS3A 3U31A 4F4DA 5ICMA 5F77A 4QU8A 4S1PA 1KL7A 1QH1B 1A7KA 4KE6A 4MVWA 4B7AA 5KYGA 4FGWA 4HTFA 5JPDA 4KWEA 2CF5A 2ZTVA 2NU7A 2WJGA 1JW9B 1SKUA 4K3VA 4WOPA 5JY1A 2XZLA 3O82A 2C2OA 4I4LA 3DMTA 4W1SA 2P35A 3DVLA 2QGNA 1I6WA 3TZKA 1ZESA 1C2TA 1T25A 1SQSA 1T9AA 1RC1A 3LRXA 3VV2A 4EBFA 1WSWA 2ONCA 4GT1A 3ZDQA 1CJUC 2EC5A 3TTTA 3PF8A 4RFSB 1KYQA 4M9QA 1GZ3A 2CJWA 5IAOA 1U7DA 2W0SA 4YTEA 4PONA 1U65A 4QBHA 4Y0VA 3GGDA 4EG0A 2RHRA 1FFEA 1AGXA 2RGWA 1FMLA 2ALJA 1CBUA 4XWOA 2XNJA 3EZ2A 3P4XA 1K6JA 3OFJA 4BNUA 2N47A 2E5FA 521PA 1YFKA 5HIIA 1SBHA 3BERA 3DOEA 3JRNA 3PF9A 3BYZA 3UWDA 4DFDA 1ZMBA 2C7QA 3QQ5A 1GR0A 2BHRA 4P4UA 3TR0A 5HBGA 4BXOB 1KJYA 3TS1A 3KHTA 2PQ6A 2ZAIA 5AJTA 1ZVJA 4IZIA 2NAPA 3AHFA 3HSYA 3UCEA 3UG7A 4D5GA 5KQSA 1M76A 4RLSA 3COJA 1DEHA 3U4QA 3LUAA 3BE5A 3IUQA 3WLQA 2VO1A 1XQ1A 3I4CA 3UAGA 4U8GA 3KC2A 4IHJA 3VR2A 3IQXA 3WMGA 1AZLA 2BD0A 2H9YA 2VDWB 3GWGA 3QFRA 2Z8YM 1BS9A 4BBPA 4NCBA 4TWBA 3K8ZA 3H2KA 5MFPA 5AKGA 2W8ZA 2ONJA 1VG0B 4PG5A 4EJMA 1A2QA 1BROA 5H5JA 1T0IA 2HJWA 5AQ1A 3GRYA 1YKFA 1JWLA 4TYPA 3DUWA 1UEXC 2P2CA 4PPFA 1KEUA 1OY1A 1UOEA 3AEUA 3CEHA 3MWJA 2BGLA 4M1MA 2VJAA 3OIVA 2IYXA 1CZOA 1S8NA 1T36A 1CY2A 3VGJA 2BFMA 1RBMA 4RXUA 5IYZF 3LDGA 3LHFA 1L7VC 1JJFA 2WMYA 4C4RA 4GXTA 2BKVA 2JD0A 3GLGA 1SCDA 2GZSA 1AUOA 4UBJA 4IX9A 2NNWB 5E7MA 4Z53A 2DPMA 4C4ZA 1NXXA 3TB6A 1JQDA 1TTHA 4HPJB 4HAOA 5DWQA 4E1AA 2WG0A 1DZIA 1WR8A 2FEMA 1AD2A 3OLVA 4HDSB 1PV4A 5ALGA 2F3RA 4ZDIA 1DC4A 2NADA 3IMCA 3IS3A 4N01A 3WK9A 3LUCA 4CE6A 3S5JA 2CFOA 3WA7A 5HQTA 2BM1A 4Q9IA 3BSSA 3GDOA 1ECFA 2VJKA 2ZI9A 4GLJA 4IDPA 4ICIA 3ITEA 4HNAA 5I5GA 5U4XA 1JXAA 3U4CA 4BQOA 9LDTA 5LYJA 3WZLA 1QFJA 1C0KA 2XX3A 1E3LA 3UM9A 4E09A 4FB5A 1U99A 2RMKA 1ZUNA 3FPGA 4V3BA 3D8BA 1GT91 2WJVA 5KHLB 4NLLA 2NZ8A 3TX6A 5AI4A 1H2YA 1OBHA 1GY8A 2ZB3A 5HF8A 3CYFA 3S28A 1LRKA 5H80A 1QP7A 1MENA 1TAGA 4C29A 4UASA 1X0VA 2I2WA 4HXEB 5DMHA 2VPPA 1W5SA 3QELA 4DQ0A 1AA9A 4CIWA 4TUYA 2OXIA 1MKYA 1Y1SA 2HMSA 3I8XA 3BX1A 4FCTA 4PC6A 5GJCA 2JHPA 3MJTA 2EWWA 4XJXA 5TQ0B 5LLDA 4HLQB 4LRWA 2YINC 4UDOA 1G5TA 3CPHA 2ES4A 1JQAA 3L06A 3MC1A 5I7AA 3FTQA 4KMSA 1L9KA 4R9SA 4B84A 1QYVA 1W7AA 2R751 3PUKA 4OKIA 5LP6F 1GN9A 1V9SA 3UHPA 2OYCA 3G49A 3BMQA 3MAAC 5B1YA 2DWPA 5BWMA 2WJAA 2I65A 3L8HA 3JVUA 1SG0A 2OBMA 3H11A 1RZRD 1LRLA 1SKQA 4FDTA 1JBKA 1UDRA 1FQWA 3Q4GA 4HGRA 4Q1EA 5CTAA 5JLAA 4F8JA 1CTQA 2PRYA 1RC0A 5AR1A 5M04A 5EP1A 4H9GA 2JNWA 3CE6A 4PZUA 4Z4GA 1U9IA 3LLCA 4I99A 3ZZTA 1LLUA 4PQYA 1SAYA 4JLKA 2HOQA 4LBYA 3REQA 3W1EA 1DC7A 1Y6ZA 2JATA 4IUBS 4KP7A 4X6YA 1AHIA 4MRPA 3AKEA 3T3HA 2J0UA 4J49A 3L5OA 1W85A 5CB4F 4Z1MA 1AQUA 3KQTA 5K6AA 3KV1A 5D3MA 3AUSA 4M8LA 5AUQA 4ZGBA 4QHYA 1JDTA 3BWBA 5HBRA 1ZM4A 3HBFA 4JJIA 2WLTA 4BLWA 6ADHA 3F73A 8LDHA 3DFFA 2GX6A 4PZAA 2PN1A 1VSTA 1EK6A 2VJBA 2YICA 1H2WA 1A77A 3D6NB 1OH7A 1PVVA 2PL5A 5HKBA 1A04A 2LCIA 3CB4A 3SHFA 4DNFA 4E2ZA 2DLNA 2AHOA 1W4ZA 2WNIA 2XQIA 3G7SA 3KYCA 4RF5A 1P5JA 1U31A 4PX3A 4Y67A 4ARVA 5BWCA 1H1LB 4B46A 4EGFA 3I9V6 5FBRB 1DKRA 2JGNA 1CWUA 4IX1A 5FBVB 2GYUA 3LA8A 4H59A 5EXPA 2O8FA 1BXZA 3B8EA 2B1JA 4C2AA 3IP6A 2CKMA 2P2DA 1JXOA 3CSUA 4Q4LA 1L5GB 1AG9A 5IABA 4KK3A 5JXWA 4C0BA 2OCLA 2HU5A 5JWOA 1LDNA 3NV9A 3Q7IA 4EY6A 2DPHA 1U9IC 1XMXA 2PK3A 1YGYA 3AC0A 3QUTA 2NUAA 4QTTB 1NKSA 1MVNA 2JCVA 4DDHA 4L6CA 2WIFA 4GE0A 4M60A 3KS9A 5BMVA 3K2EA 2QL6A 4CNBA 4NXMB 5HW0A 1ONBA 2GZ2A 2V3VA 1FXSA 1UFQA 5CIQA 5LZ2A 1J1UA 4ZCLA 3RCBA 4I5IA 1X3LA 3BH0A 3R3VA 1EUDA 4BP1A 1ILEA 3ZE2B 4F4HA 4DSNA 2PKCA 1PG2A 3K6SA 1IHYA 1RU3A 3O5AA 4HGPA 1L4LA 2WILA 1MGOA 4ZOBA 3MTDA 1ZY2A 3M4XA 5FWXA 1W52X 5AJVB 3OQOA 1TFUA 5CEJA 4Q7MB 4YEDA 3QBDA 4ZICA 3CXRA 3I0ZA 3FOAA 3OCUA 4IIXA 1GLGA 1SC4A 4WCFC 4ETMA 1W73A 2CDAA 1PJ8A 2JF0A 2WF9A 1PNOA 2QPOA 3ODGA 5KWVA 3OIFA 3RAEC 5BSGA 4MX8A 1UAAA 1KH1A 2P4SA 1H3FA 2VF2A 4DA9A 2XYRA 4ND6A 1MNQA 2QR2A 4XAQA 1NGSA 1JR3A 4JJGA 4LPKA 1DTEA 1KO7A 1DDIA 3QLTA 1DAPA 3TQRA 3WOVA 4UHFA 1WS6A 5DN6D 3IDFA 2IP1A 2BP7B 1Y4UA 5DHFA 2WF6A 3HR7A 5DWDA 4EG7A 3ICOA 5LZ4A 2SCUB 4MB0A 1UKZA 3HUDA 5FL7D 5AIBA 3BG5A 2X8LA 1IWOA 3F4KA 1IH8A 4WLUA 4YUXA 1NNLA 2YXEA 3K0SA 2EU8A 4QOIA 4D4MA 2QUKA 4HNHA 1MGPA 1FYEA 1GPH1 4IFIA 4IOKA 5EHGA 3ZCVA 4BGDA 5KSOA 2PWBA 1BXKA 2YXDA 2CLFB 1WUTA 2AEEA 4DCSA 2O8EA 2R1VB 2FP4B 4PEVA 3N0RA 3UT5B 4AJEA 4TMTA 2GSDA 4N47A 3ZGLA 3KBOA 4C7OA 1N0UA 1EUYA 2GAIA 2WB2A 1AH2A 4BDSA 4PZZA 2BISA 3MTEA 4S35A 1LU9A 3FJOA 3ONFA 3KT6A 3ZC3A 2IS1A 1KKLA 1U2SA 4CV0A 1II8B 1HQDA 2V4UA 2H18A 1UPXA 3F8SA 3C8UA 4OOFA 3ZGNA 1N3BA 1HNXB 1SCBA 1TUBA 4HXYA 4ZCIA 2VTBA 3TQFA 1XZAA 3EFBA 2NO4A 4MAAA 3JW8A 1O2DA 3WYBA 1M2NA 1E2KA 3GEIA 2H4WA 1YS7A 1WHTB 4KODA 4Q9DA 3X1KA 1O89A 2WIDA 4EA9A 1UBRS 3KWLA 2K87A 2YS6A 1EFVB 4UULA 3GPLA 2XNSA 2IXAA 1AO3A 5LP6B 4M21A 3VV3A 4JLUA 3RYIB 3TBHA 1OV6A 1R00A 3D8TA 5DEIA 1QYIA 1VMDA 2DC1A 2FB9A 2O52A 3LCCA 3CZ4A 3PI7A 2VJCA 4H3SA 3H9JA 1UBCA 1VBMA 1YZVA 1XC7A 2A1TR 5EWMA 2DHCA 1NYQA 2WVAA 1JFTA 2XUOA 3A25A 1N5LA 1REQA 1XTVA 2Q1SA 1OF1A 4MWOA 5FLKA 1KRWA 4LY3A 4TSKA 2D2IA 1AKRA 1ZOSA 3O0TA 5KPJA 3G2JA 4MUFA 2FZCA 3A6EA 4LZWA 2Z95A 1M8GA 1EDBA 4NOKA 4GL4A 2PZLA 5JD4A 3EF0A 2D0DA 4UM7A 4M0EA 1E7MA 2ZUSA 1R0CA 3NOQA 2I2AA 2DBRA 2X0NA 4O1MA 3RRJA 1PO7A 1L3BA 3PITA 4WK0B 2QKYA 4DV1B 3AVYA 2ERYA 4R6XA 5CA0F 1YR8A 1OKKD 3JAWA 3MRXA 1OLXA 1V8DA 2ATIA 5E6RA 5K3BA 1N3IA 3VR6D 1EX1A 1P2TA 4WZBE 5LKAA 3I4LA 3LSTA 1RWQA 3IKLA 4JLDA 4DUPA 4Q47A 5ISMA 4A8JA 1FS6A 4KAJA 3SJCA 3TM4A 4WGFA 1UT5A 2H1SA 2FPUA 2X13A 5AMXA 4DMGA 3KQWA 4I4TB 3V2HA 3H65A 1FDOA 2KMLA 4DLTA 1UBOS 2HPVA 3E9QA 4UAJA 1N78A 2O0HA 2ID9A 1XFAA 4XFKA 5BNZA 1GN8A 2OXEA 3PYLA 2NX2A 1CRLA 1I33A 2CCGA 2QM0A 5J59A 3HA2A 1SXGA 1Q7TA 1Y80A 2JVKA 3ELWA 5ALJA 1YI1A 4KR7A 1CLEA 3L8EA 5JY6A 4DTIA 5KDLA 5TMEA 4WUTA 2Q5LA 3NC1C 5K01A 1ZHOA 4N48A 2QN2A 4HFJA