1BXZA

Crystal structure of a thermophilic alcohol dehydrogenase substrate complex from thermoanaerobacter brockii
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
352
structure length
352
Chain Sequence
MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAELADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLVTHVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a thermophilic alcohol dehydrogenase substrate complex suggests determinants of substrate specificity and thermostability.
pubmed doi rcsb
source organism Thermoanaerobacter brockii
molecule tags Oxidoreductase
molecule keywords NADP-DEPENDENT ALCOHOL DEHYDROGENASE
total genus 104
structure length 352
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 1998-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1bxzA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1bxzA01
3QJ5A 4J7CA 1L1FA 4RPHA 3GUCA 2GR9A 2HLPA 2Q4EA 3JYLA 2Q2QA 2QZ9A 4PRKA 2IRWA 4QFCA 3KBOA 1UZLA 1PZFA 5U9CA 2P4QA 4DPLA 4HFJA 4KTTE 5BSHA 4BO3A 5TQVA 5HS4A 3D0OA 7ADHA 5JNLA 2Y93A 3ROKA 1EUDA 4DXHA 3FNHA 2G1UA 3DBRB 4BO4A 3UAGA 3CXRA 4PG8A 3WGYA 3AUUA 3VPGA 3RKUA 4E3ZA 1Z73A 4ALJA 2AG5A 5C3MA 1Y5RA 1U1IA 3DBHB 3Q2KA 4YAJA 5DF1A 3UCEA 4EGFA 4JGBA 3F5QA 5MDHA 2C59A 3E5RA 2BHLA 1X0VA 5IG2A 5MGBA 2O3QA 3JQCA 1KERA 3PZRA 2R6JA 5TIIA 1PS0A 2W8ZA 1NFQA 2C29D 2GO1A 1N8KA 2Y05A 5L45A 4HKTA 5IXYA 1U7HA 4JNKA 4LSWA 5EERA 4GAEA 3G17A 1UAYA 4RPKA 5HM8A 4XQGA 2AQ8A 4YQZA 2FPGA 1E1MA 5J23A 2GDZA 3GLQA 4NPCA 1HWYA 4NBVA 1LDMA 3I4CA 3MJVA 4ND2A 1H9BA 4DPKA 3ASVA 3Q3CA 5BNIA 4GSKA 1M75A 2ILTA 2JCVA 4ZVVA 4YBZA 2G17A 1VE9A 3GEMA 4BNZA 1DC5A 2X6TA 2E37A 2OZPA 3DBRA 1ZIDA 3WGZA 4IBOA 1ENOA 1PS8A 3JSAA 4BGVA 3PJGA 1S7CA 3V2GA 1ISGA 3EUWA 5JXWA 1P1HA 3WGGA 4H3VA 4RPGA 4C7KA 5T67A 1KEUA 2BFMA 4FC7A 5K9ZA 3KV3O 2G0TA 4CR8A 2ZATA 3E48A 4Y6PA 3SC6A 1L7EA 4INAA 1RWBA 1I3NA 1YQXA 3OBBA 1X7GA 4PLZA 4Z0PA 2C2XA 1NP3A 3ZCXA 4BO5A 2ZTUA 1B8VA 2X8LA 3PIDA 4O59O 3BHJA 1NVMB 1M6WA 4AJJA 4NFSA 3V8BA 3AY7A 3DAFA 3AOGA 3NAQA 4AJHA 1DHTA 1SPXA 4D45A 1EFLA 1N7GA 1PIWA 2EW8A 3AUSA 1E3SA 1GTMA 3BMQA 1VPDA 3IC5A 3D5TA 3MJEA 3T7EA 5KJ6A 1R37A 3BMCB 3NT5A 5JY6A 2BGKA 1Z7EA 2XF8A 3DOJA 4FJ2A 3IKTA 1RM3A 3ETEA 4G65A 1UXGA 3WSVA 3HNPA 1EDZA 2Q46A 4CUJA 2AE1A 4BNJA 1B8UA 4J2HA 4AJ4A 5KVVA 4IDAA 1CIVA 3HN2A 2NADA 4FOOA 3F4BA 4XYBA 4ZJUA 3LC7O 1UP6A 2RIRA 1VL0A 3LF1A 3DTYA 3B1FA 3I9OA 5CPFA 4A27A 4DA9A 1HF3A 1CETA 3QWFA 4QEDA 4CJXA 4LVCA 4LW8A 3SEFA 2CDBA 3GRKA 1C3VA 2WJPA 1P1JA 2EJWA 3HN7A 1QKIA 4NBRA 4M55A 3O8QA 1XHLA 3IJPA 1BMDA 3FBGA 1LU9A 1BDBA 3FN4A 4P4NA 3ZWMA 5GZ1A 4J2OA 3WYCA 2X7HA 4BNFA 2PY6A 1T4BA 2EEZA 3GDFA 1XKQA 3I6QA 4WPGA 2I3AA 2NUAA 4GX5A 2HK9A 2PFGA 1O9BA 3KYBA 1WAMA 3D7LA 3K6JA 1ZBQA 1EUCA 3GVHA 1X15A 4WNIA 3OP4A 1SCUA 3C7AA 3EVTA 4XX0A 1V9LA 4G81A 2YUTA 1DOHA 3W6UA 5KVQA 4Q3DA 2D4AA 4E12A 2EJVA 5JLAA 3RJ9A 2ZJ1A 3DWFA 5TLSA 2PLAA 2D8AA 3ANMA 4I8XA 3KRTA 3DEYX 4NK5A 3UH1A 3C1TA 4IGFA 5JDCC 2Z1NA 5JDCA 1EBUA 1V3VA 5ICMA 1R4NA 4IMRA 1TA4A 3B70A 5DULA 3GA0A 3CMCO 4CLHA 1VSVA 3I83A 1B15A 4XYGA 4B7UA 4XYEA 1DAPA 1GV0A 1YB5A 3MWDB 4IXWA 4J9UE 2EG9A 3JQBC 4DQUA 1WVGA 3GNQA 5DP1A 1ISMA 1U7TA 4CM6A 1YJ8A 2C20A 1HDRA 1ORRA 4CQMA 3MJCA 4HV4A 4FSHA 1TT5B 1B26A 2NNLD 2O2YA 3KLPX 3SVTA 1UXKA 1ENZA 4WKGA 1QRRA 3DFUA 4QUKA 1ULSA 3AM3A 1HE3A 4OKNA 3V5NA 4XD2A 2GUGA 4ZRMA 1LRJA 2O23A 2PD4A 4MVJP 4YR9A 1LX6A 5TT1A 4FGWA 4OKIA 5BNTA 5KTKA 4R1UA 5HBRA 4GH5A 1NASA 4KUHA 4NQZA 1WP4A 2RCYA 1IYZA 4YEDA 2JAHA 4KZPA 4NJMB 3EK2A 2X9GA 4QO7A 1EZ4A 1PGNA 5I8ZA 4CM4B 4ALIA 4YT8A 4QO8A 3MOGA 3TRIA 1N92A 3ZWPA 3DHYA 1E3WB 1JU9A 1EFKA 3PGJA 3H7AA 1CWUA 1EVJA 1Q7GA 2FY8A 1F0YA 3DZKA 3NT4A 1QYCA 3H9EO 1K6JA 2G82A 2VNAA 3DAPA 3RKRA 4EEZA 3PVZA 3AWDA 5TNXA 4E31A 4YPOA 4OIMA 4FGSA 2FMUA 1E0DA 1ZMTA 3ONDA 1GR0A 2OHXA 1R0LA 4ZQBA 4D79A 5KVSA 4Y6SA 1HZZA 4U6SA 4WK6A 4XWYA 4DC0A 2NVUB 3RUIA 2QRLA 2YHUA 2VHVA 4F3YA 4RVHA 3AUAA 1EUZA 2I66A 4DREA 3QLJA 4I1IA 4YCAA 5JC8A 1I2CA 1PU2A 3MWEB 3RBZA 2QRJA 1R12A 1LDGA 1KVQA 3WSWA 5G4KA 1RKXA 2FPPA 5BSFA 3OM9A 3JD0A 2NACA 4RGBA 2BELA 4RF2A 3IS3A 4MPDA 4U5QA 1UR5A 1W6UA 4LMPA 3X2EA 1ISFA 1H93A 1LLCA 2HKIA 4NR0A 3FWZA 4L8VA 1ISHA 2CF5A 3G79A 3F47A 4KDFA 3PHGA 1X7DA 2ZTLA 4OXKA 1XA0A 4IDEA 3T4XA 5I7VA 5ITWA 3UF0A 1KVRA 3O38A 3PFFA 4EJ0A 4EW6A 3ZWVA 4TSKA 4E13A 3OA0A 1LSOA 4GMGA 3LSYA 1UAGA 1PJ2A 3OEWA 1Z7BA 3JQGB 3GPIA 4FS3A 1XQ6A 2XAAA 3ZWCA 4EUFA 2TMDA 3ICCA 1XEAA 3JQAA 5LC1A 4EJ6A 5JDIA 4IPTA 1PJ3A 2CVQA 4D43A 3GVCA 1Z82A 1EBFA 4DL9A 3CUKA 3VKUA 4OJNA 2PWZA 1OC2A 2HQ1A 3QQPA 4J1SA 1YBAA 1ZK3A 4XZ3A 4OO3A 3RC1A 4CQMB 4CQMD 3JQFC 1JKIA 3ADPA 3INTA 4K1LA 4BV9A 2HRBA 2O7SA 4JCOA 5I7FA 1GCUA 3A1NA 4NZ9A 3GZNB 4WGGA 4MVJF 3E03A 4RL6A 2YYYA 4OGWA 5JCXA 2NM0A 1DDOA 4P38A 5DNAA 1U5CA 1I01A 1NTOA 4I9HA 4BNIA 1A9ZA 5B12A 5A06A 4YRBA 5DBFA 2BFAA 1UUFA 4AJ1A 3GNSA 4JX8A 5F5NA 3M1AA 1NPDA 1O8CA 2VZ8A 4MP8A 2X0RA 2F1KA 2QX7A 4PLVA 1ONNA 4Y8VA 4ALMA 1ZKMA 4X54A 4YJHB 2NQTA 2X5KO 3ADOA 1BVRA 4CLOB 1AXGA 4XRGA 5ES3A 3K8ZA 1MLDA 1XLTA 4PLGA 3PYMA 1NPTO 4CV3A 3IL2A 2C54A 5C7LO 1LSJA 2RAFA 4MP3A 2FZWA 3JD2A 4JP3A 5T5QA 4CM8B 3LLSA 3CTMA 2VZ9A 3QW2A 4UUNA 5B1YA 8ADHA 5FWNA 3GMDA 4B3IA 2RHRA 4CMGA 4RF5A 2NTVA 2OGUA 2OP1A 1S6YA 1C0PA 5A4DA 1QORA 1YRLA 1VJTA 2Z1MA 4RVDA 4U0KA 4AJ2A 4B8WA 3DZFA 2VYVD 3VTZA 1OI7A 3H6KA 1LDNA 3H2SA 5IXSA 3DDNA 3RJ5A 4J43A 3BTVA 4Y6RA 3QWAA 1XU7A 4K6FA 4FDAA 2BGMA 4R1TA 2VHZA 1XELA 4OYRA 3JD4A 3ULKA 1R0SA 4ZN6A 3ABIA 3WWYA 1LNQA 4CM9A 1AXEA 4BMNA 2OBYA 3JQBA 1ID1A 2H6EA 3BMNA 4HWKA 3VZRA 4E6PA 1UXJA 4J0EA 1Y1PA 3PEFA 3ZW9A 3DXFA 1T2DA 3PWKA 1XG5A 1HT0A 3UOGA 1U2DA 4WOKA 5H82A 2OORA 2GASA 1PGOA 1QLHA 3DZHA 4RLHA 3WWZA 1SO8A 5CP8A 3ST7A 3U09A 3E18A 5IZCC 1W73A 3C85A 2VRCA 4ALLA 5ILOA 3HADA 3G0OA 3IJRA 3WTCA 2UUOA 3H9UA 4XQ9A 1I2BA 4EDFA 1PZEA 1DIAA 1YVEI 2G5CA 3P2YA 5F21A 1Z6ZA 4AJOA 3IP1A 1RYEA 2WE8A 2WM3A 4QSMA 2HK7A 4R3NA 1AN9A 3NTOA 2O3JA 4CMHA 4GWKA 2GCGA 3UCFA 4XQEA 1OZAA 4DRYA 1IB6A 4AG3A 3JQ9A 3FCOA 3MTJA 1YL5A 2NTJA 2WYVA 5U4QA 2QZZA 1ZJYA 3TZQA 4ITUA 3U0BA 5A9RA 1BVUA 1NPYA 4H16A 1P9LA 4IQGA 1ZFNA 3G3EA 3OJFA 1XR3A 4RORA 1HRDA 3UW3A 3JV7A 3K5PA 1JWAB 1U3TA 2ZTMA 3OIGA 2VZ0A 1K89A 4WLOA 3T7CA 3WICA 2I99A 4HBGA 4NIMA 3OICA 1I3LA 4YJDA 1GYPA 1HYGA 2O4CA 3NDJA 3NEPX 3D3WB 3FNFA 1ML3A 4MKRA 2BH9A 1E5LA 1HDCA 4ESOA 5K0ZA 3DZGA 3LT2A 1JLLA 2OBNA 5IFLA 3R6DA 2FHSA 3E9QA 1DJNA 3Q0EA 3DZIA 4KQWA 1VJ0A 4HADA 3FHLA 3B6ZA 2J3HA 2IZZA 1CEQA 3MZ0A 2ZQYA 3WBFA 3FTNA 2FP4A 1JDJA 4EEXA 4WE3A 1QMGA 4GKVA 4HXYA 4UUMA 3WMXA 1NQTA 3PHJA 2VNSA 2X0IA 1VL8A 2VTEA 1QG6A 1B2LA 1DRWA 4D42A 2DQ4A 4PLPA 4R01A 1FDVA 3DOOA 1IHXA 4JBHA 1PWZA 1ZEJA 3RQSA 4UVIA 3NX4A 3ZV3A 4AJNA 4BGEA 3LT1A 1JW9B 3PQEA 3BTOA 3I52A 2J3KA 1K6IA 2VYND 2O4UX 5EPOA 2O3UA 5DDIP 2PH3A 2YV3A 3W8FA 3KZVA 4YJHA 4JN6B 4CM1A 5I9NA 1E77A 3D5QA 5JMWA 2CD9A 4DC1A 3TZ6A 1NWCA 2VWPA 3ZWOA 1H94A 3FNGA 3X2FA 3DMTC 1Y8RA 3JQAD 4L76A 2A9FA 3EVNA 1FMCA 3HWRA 3IQDB 2VUSA 4U8GA 4B4OA 4WLEA 1HDYA 3ITDA 3KYCB 4A5OA 4XJTA 1WPQA 5C5IA 2C5AA 2GN4A 1K2WA 3PHHA 4GX2A 4MIEA 3VH2A 1A71A 2JD2A 3ZZNA 4JBIA 4QFDA 5KNLA 5I7EA 3G49A 1BW9A 1E7SA 1DRVA 1Y6JA 3AY6A 4UVHA 3WB9A 1ADGA 2Y1CA 1E6UA 3S1LA 5CEJA 3TDKA 1JWBB 5BNFA 1N2SA 3GK3A 2WWRA 2P5UA 4EUHA 3SXPA 4E2YA 1SOWA 1UJMA 3VDQA 3COSA 3KYDA 4J91A 5JAZA 1NWHA 1YE3A 3OFSA 2FSVA 4N5LA 5TGDA 1AHIA 3OEYA 4OQZA 3OJEA 3LK7A 3ZNQA 3JQGA 3EDMA 4AJIA 5IN5A 3RUAA 3ZNPA 3HDJA 3L4SO 4B4WA 1DC6A 2AEMA 2GSDA 1SNYA 4KWHA 5DT9A 5H81A 1HDXA 2Y0EA 3NTQA 4R3WA 4GSLA 4LISA 3RU7A 1CYDA 4EITA 3UGKA 5KKAA 1HDGO 4OQYA 5GMOA 5B37A 4WOJA 2DFDA 5JE8A 4RV9A 3WGQA 4EI2A 1IE3A 4OOEA 4LRTB 1HE5A 4DIOA 3H9JA 1DHRA 4B7CA 2H63A 1T4DA 3HE3A 3KYDB 5IZCA 3JTMA 1A9YA 1OC4A 4MVJE 3KOUA 1LSSA 3DFZA 2VOEA 2DVMA 1H2BA 2YDXA 1TT5A 4TWRA 3WDSA 3F4LA 5FEUA 4W99A 3QIVA 5TJ9A 1BWSA 4ZD6A 2NVUA 4J90A 3NRCA 3WG9A 3PHLA 1J49A 1F17A 1U3UA 2Y66A 3VH4A 4DWVA 3H3JA 3LYLA 9LDTA 3KYCA 2B69A 2FRDA 3F1LA 5G0TA 1MGOA 1VKNA 1QXSA 2VWHA 3BMOA 4NBTA 3KSDO 1RPNA 3L0DA 3U5TA 4YJGB 4YJFB 2PGDA 2D5CA 1ARZA 4OOFA 5JS6A 2YW9A 4DTIA 1VL6A 4PZDA 1LDBA 5HWSA 3ZU3A 1PWXA 3RROA 2WTBA 4ND4A 4Z3DA 3PK0A 2PV7A 5F1OA 3H5AA 1EE9A 5F5LA 2VWQA 1A72A 5B4TA 3FF4A 4ND1A 3WYBA 3WQSB 4CR6A 3STHA 4RVSA 3R1IA 3Q11A 2WD7B 4MIYA 1IUKA 1GQQA 1ZSNA 2ZYGA 3HQ4O 5KCZA 1YXMA 1LLUA 3CMMA 4JXKA 3AFMA 4FFLA 2GD1O 2I9PA 5IDYA 5BSEA 2ZKLA 2C5EA 3O4RA 4IDDA 1XSEA 3E9NA 2VUTA 4H7PA 1BXGA 2JJYA 2V6BA 3EC7A 3VH3A 1ZK0A 3VHRA 5ER6A 4E2WA 1PX0A 3ZHZA 2VHWA 5A03A 1MP0A 1NAIA 4PLCA 3U4DA 5FI3A 4BNLA 2IYOA 2AHRA 1KEPA 5HRUA 5KKCA 2W2KA 4D3FA 3RBXA 4IJKA 1BHSA 2DUUA 3OJOA 1NXQA 2J5QA 1Y8QA 1HYEA 5CDUA 2RH4A 5JAMA 4HP8A 4RO0A 2GLXA 4TZKA 1JAYA 3LT0A 1ADFA 5THKA 1KC3A 4P22A 3PWZA 2Q50A 5AXDA 1GUFA 1MB4A 4BGIA 3DBVO 3ETDA 3RFXA 1GUYA 5B4UA 3FWNA 4LCJA 4E0BA 3PWSA 1ENPA 1NQOA 3ZWNA 4N18A 3ASUA 1DIRA 3M6IA 2J5RA 2AW5A 4CMAA 3UFXA 5F1PA 5KVCA 1VI2A 3QA9A 4ZQHA 5L40A 3GZ4A 1W0CA 3EZLA 4BOYA 5A3JA 1E7WA 2DTEA 3WFJA 3HHPA 3AOEA 4A2CA 2GZ2A 2AEFA 1A7KA 2OO5A 4W7IA 4N7RA 4WLFA 1XQ1A 2YJZA 2O48X 2C0CA 3OA2A 4YAGA 4U6QA 3BIOA 1B14A 1RM5A 1A4UA 3DC2A 3I9KA 4YRDA 5ILGA 3ENNA 5HA5A 1PS9A 4BIIA 4ND3A 2J8ZA 5TX7A 3KVOA 3S2IA 4TRJA 1GEGA 1LQUA 1U3VA 4FIZA 3I9MA 4J1NA 3K31A 3PP8A 1T26A 3RSHA 4KDEA 3OQ1A 3WXBA 3DR3A 5CDGA 3L9WA 3BHIA 2YQ5A 4I5EA 4Q3NA 1B8PA 1UZMA 6LDHA 4XB1A 1CF2O 5TJHA 1ZMOA 2WD8A 3DTTA 3ROPA 1UDCA 4XEHA 2YV1A 2XXBA 4YT5A 5KJEA 4LN1A 4J1QA 2BGLA 5DOVA 4IM7A 4XGKA 1V0JA 1PQUA 2VRCD 4PLHA 4XDZA 3PYLA 1F8GA 3PQDA 2IZ1A 2B4RO 5EIOA 1P1IA 1RM0A 4XR9A 5EQDA 4PN3A 4IXTA 4YAEA 4IINA 4GMFA 3SBOA 4E5MA 2AE2A 2PGLA 2EW2A 1C1DA 3GN1A 3VKVA 3MJSA 5JYDA 3KTDA 4EBFA 1WW8A 4CV2A 2I5PO 3DBHA 4R16A 4CMKA 1ZH8A 8LDHA 4FW8A 1ONPA 4IZHA 2IEDA 3GG9A 4GLOA 2O3SA 3GF4A 5JAIA 2JHGA 4BO1A 1M2WA 4BNNA 5EJ2A 1LRLA 4Z9YA 3H8VA 1JQBA 4WLUA 2P5YA 5TC4A 4OHUA 3RUFA 3S8MA 4M87A 2Y68A 1OBFO 3K73O 4QT0A 1I3KA 4CUZA 2R2GA 3OH8A 4BMVA 1P33A 4P4GA 3LZ6A 3L6EA 1NHGA 3U49A 4B7XA 1T2FA 1YH3A 1VLLA 4I5FA 4WEQA 3LC2O 4RQUA 1K6XA 1FDUA 1WDLA 2IYPA 1TXGA 2P4HX 1BXZA 4IY1A 4PVCA 1EEHA 2B35A 3WX0A 1C1DB 1FJHA 1BTOA 3GAZA 1GZ4A 1ZSYA 3K9QO 3M1LA 5KOIA 3K30A 4E2XA 1E1NA 3WJAA 1ZK1A 4NJOA 1KC1A 5JAQA 3DO5A 1KEWA 5A05A 2P9EA 1I32A 3EHEA 3F3SA 3IMFA 4OXYA 3O26A 4CL8A 4PZEA 4XQCA 1X14A 4MVJD 3F9IA 1MFZA 3D3WA 1Y81A 1M66A 1T2CA 4PG6A 4UAGA 5H83A 1K0UA 1U9JA 4XR4A 1K3TA 3UHAA 4CQLA 1NFRA 3UUWA 1A27A 3SC4A 4HNGA 1GU7A 4ZU3A 2CZCA 5THQA 3HG7A 1HLDA 3VZQA 3HFSA 3NT2A 5LDGA 1G0NA 1BXKA 1GQ2A 4DYDA 4LSMA 3HDQA 3KEOA 3OHSX 3S2EA 5COBA 4IS2A 1D8AA 2E48A 4R41A 4RF4A 4GBJA 1UZNA 3DZBA 1EDOA 2UV8A 3JQ8B 4WCDA 5G0WA 4E21A 4E5YA 2O3RA 4QQRA 4WASA 3EMKA 1UDAA 4BNTA 3F5SA 1KS9A 4PG5A 3E6AA 1FF9A 5DP2A 2Y0DA 3E82A 3FBTA 4YRAA 1W8DA 4EZBA 5JSFA 2HMTA 4CM3A 4JJFA 1E3LA 1YGYA 3GMSA 2NSDA 3GPDG 5JY1A 2YQ4A 3PIIA 4BNUA 4WECA 3MJ4A 4ZGWA 1E3JA 3OIDA 5G0UA 3TSCA 1XWFA 3VC7A 3UICA 4PLTA 1N1GA 5C7OO 4KTVE 4CLRB 4C4OA 1ZJZA 3IP3A 1I36A 3GHYA 2J3JA 2VYNA 3DHEA 1KVUA 3DL2A 1LSUA 4PIVA 2Y1GA 4L0QA 4DQVA 1GYRA 3LU1A 3WNVA 3KETA 4WCFA 5TSDA 2WYWA 4DMLA 3U3XA 3C1OA 2NU6A 3D64A 4TVOA 3RUEA 3GUYA 3RFVA 1M6HA 2UAGA 5ICSA 1IULA 1NR7A 4QECA 5L53A 2DFVA 1QP8A 1YB4A 5DCWA 2IXAA 3OJLA 4MVJI 2HMUA 4UEKA 1I0ZA 5I8WA 1DJQA 3KSUA 2J5KA 4FOSA 2XXJA 5AQ1A 1G6KA 1L7DA 1PJBA 1YQGA 2YDYA 3N7UA 4D41A 3OJ0A 4YXFA 2DBVO 1J5PA 2OL4A 4LRSB 1HSZA 1VSUA 2QQ5A 1P77A 3WJ7A 1T2AA 2PH5A 4CM8A 4W6ZA 2X4GA 3JD1A 4Z9FA 3QWIA 1ZUD1 3V2UA 1DSSG 1MA0A 1JTVA 3AI1A 1P31A 1SMKA 1MUUA 3Q9NA 4KMSA 4ROSA 3GQVA 1N7HA 2GNAA 5KJCA 1QSGA 2G76A 4DGSA 4M49A 5G2OA 2W4QA 3GVPA 2Q99A 1HL3A 1ZZEA 3AI3A 2JFHA 4Z0HO 2I65A 5FI5A 1NX6A 3GGGA 3RC9A 1E7QA 1H9AA 4L4XA 4L75A 2HMSA 1R16A 4RZHA 4FD3A 4BNXA 2AEJA 1UP7A 2A35A 2SCUA 4YACA 3D3EA 3C8MA 4QXMA 1QV7A 3E8XA 5ITVA 3EAGA 4HX5A 4DLBA 4F45A 1C14A 1Q7BA 3EY4A 4FJ0A 1E92A 4UUOA 4Z9XA 1PGJA 1N1EA 1WNTA 1B7GO 2V65A 3GZNA 1QR6A 3SLKA 4WCFC 4M1QA 1HETA 2CY0A 2ZYAA 3GR6A 2E82A 2Q1TA 3OIFA 4W4TA 3PHIA 4RZIA 4IGEA 1PJQA 3LF2A 1E7MA 2PZLA 1V3UA 2CNBA 4FFMA 4DPMA 5JDIC 4GPD1 3EW7A 3G1TA 3PRJA 1Y7TA 2O2SA 3TF5A 1B16A 3ZV4A 5U1PA 3ZDFA 3ZHBA 3GHHA 2DT5A 1U8XX 3I6IA 2CF6A 5LCXA 4K9DA 2HCTA 3GGPA 3FPCA 1U4OA 3QE3A 1I8TA 5FFFA 4B79A 3RIHA 1HXHA 3P2OA 2WD7A 2XOXA 4WEOA 4OAQA 1P44A 1LI4A 4AVYA 1LRKA 2CVOA 2AXQA 4WNCA 3DONA 2QYSA 4I9UA 5BQFA 5L95A 1ENYA 2NQ8A 3CINA 4I9NA 5LDHA 4ZQEA 3RVDA 1C0KA 4BL5A 1CERA 2IXBA 3V1YA 1GCOA 5DZSA 2RHCA 5BT9A 1E5QA 2E6UX 1RM4A 4QTZA 2B4TO 3ZW8A 4MVJM 4ND5A 4BNMA 4IIUA 4BNGA 3PFWO 3HUDA 2HO5A 2P9CA 3QVTA 1PQWA 4CLXA 2I3GA 2DPGA 3OQ6A 1LC3A 3KEQA 1T1RA 2EF1A 2CFCA 3GFGA 1PZHA 2PKQO 2EXXA 3I1JA 3U62A 2NU9A 2GZ1A 3ZI0A 3PLRA 3QRWA 3ANNA 4YAKA 4BNVA 4ZA2A 3UKOA 4IMPA 1F8FA 4BUCA 1E7RA 3ZWYA 1MXHA 1WLYA 4R54A 3K2EA 1EK6A 1I33A 1U2GA 1ONOA 2Y1FA 4JQCA 5EN4A 3CSDA 5I9MA 3H4VA 2DBRA 2QIOA 3TNLA 3ON5A 2DBQA 2GPTA 3DMYA 3QSGA 3IUSA 1BG6A 4XGNA 4L4SA 4E30A 4RVGA 5KWEA 1E3WA 3ZU5A 3UN1A 1PSDA 3H9QA 3E9MA 3JD3A 3TQHA 4BB6A 3W8EA 4DIFA 4M8SA 1NAHA 1H2HA 4CV0A 4CMEA 2NLOA 4GKBA 3QVSA 1U5AA 3A4VA 3HZZA 1BDMA 3D1LA 4R9SA 2JKVA 2QRKA 2B0JA 4TRNA 1AUPA 4Q3EA 4QX6A 4BHTA 3ETGA 1DLIA 2EIHA 1PGPA 3PYXA 1YWGO 3BTSA 1Q0QA 3GDGA 3M2TA 4F46A 3GN2A 2ZQZA 4Z0TA 1FK8A 1BW9B 1BRMA 1V6AA 5CEEA 3VPHA 4KOAA 4RDHA 1HDZA 5CDTA 1T2EA 2Q1SA 4JBGA 1ISJA 1IL0A 4YAIA 4IS3A 5JYEA 1JA9A 2A94A 2DPHA 3W6ZA 3GEGA 4N54A 4XYMA 1WXDA 5A04A 3NV9A 1IHYA 4NK4A 1YS4A 3GEDA 1TB4A 3RBVA 5T57A 4CMCA 2UYYA 1J6UA 3RUHA 4CM9D 4W82A 4W9NC 1DXYA 1F14A 2JFFA 4IUYA 4K26A 3VVCA 2GF2A 4FQ8A 3L6DA 3GOHA 4PCVA 1XIVA 3RCBA 2OXIA 1X13A 5DCUA 4IDCA 4CR7A 1LTHR 5AXAA 4FFRA 2HUNA 3RASA 4J0FA 4DBVO 1ZEMA 3S55A 3H5RA 3ZWWA 4PRLA 2CSUA 4L4RA 5CEFA 3U4CA 4R9RA 3P5SA 2JAPA 3ZWAA 3K96A 2EGGA 4BB5A 4M54A 4CMIB 4XIYA 1M67A 4ZRNA 1IZ0A 4LK3A 1VM6A 1E1KA 2ZB4A 4PFJA 3TOXA 1R4MB 3I4FA 1PR3A 2LDXA 2DM6A 5COAA 3DHNA 4TQGA 3FSRA 1GV1A 3PGXA 3HJAA 3AM4A 4II2A 3RWBA 2Q45A 1P3DA 2WSBA 1I5RA 4TZTA 3GGOA 2HMVA 3JQEA 3L4BC 4I5DA 3JYPA 2VHXA 1P74A 2P9GA 3FPLA 4BNKA 5L4NA 3KO8A 4UVGA 3R3SA 2YFHA 2Y1DA 4P4LA 3EYWA 5JCJD 3AM5A 3IIEA 2EHDA 1MG0A 1P0FA 1SEPA 1PJLA 2OFPA 3KB6A 1KOLA 3VZSA 1N9GB 1IPEA 5L3ZA 1CQJA 4GQAA 4E32A 2ZTVA 3ZGYA 4IDFA 3BMCA 5TS3A 1EK5A 2YFQA 3D4OA 4OM8A 2UUPA 3F1KA 3H9GA 3RFTA 2WE7A 3TZCA 3AU9A 4J7UA 4YTEA 1R4MA 5CDYA 4LMRA 3S2GA 1YL7A 5FYDA 2JL1A 3JYOA 1J0XO 1KY4A 4XGIA 3WGTA 1V3TA 2P91A 4NBWA 1SBYA 1DRUA 3SJUA 2VUUA 5L4LA 2FN7A 4YDRA 3W1VA 3INGA 2H5LA 1I3MA 4I5GA 3DBLB 1U8FO 1LLQA 1O89A 1X1EA 3WGOA 3NJ4A 4Y9DA 3WTBA 3ZU2A 4DLLA 5T64A 4UVDA 1HEUA 3VTFA 3PJEA 5L7YA 1QYVA 2PKQP 5AXBA 3QY9A 3DMTA 1SEVA 3PJDA 5F3RA 4Q3BA 1QLJA 3L07A 3RUDA 4IIVA 4R68A 3QVXA 4J6FA 4R5MA 2EP5A 4U7WA 4KWIA 5EESA 4HUJA 2EWMA 2D2IA 2VT2A 4MVJH 4YVFA 6ADHA 2C2YA 2GN6A 3SX2A 1E6EA 2GN8A 4R51A 4XA8A 5A9SB 2I6TA 3JYQA 5EINA 1YOVA 4GLLA 2C7GA 4MP6A 5AYVA 3U4HA 3I9JA 2WYUA 2WDZA 2Q1WA 4ZQGA 1U3WA 1JAXA 4F6CA 1DEHA 1DIGA 3GH3A 3SJ7A 4BVAA 1YBMA 3GVIA 5EQFA 4HFMA 1FDSA 3H3FA 3MTGA 3WQQA 1D1SA 1B3BA 1AGNA 1WZIA 1LUAA 3GT0A 2ZCUA 1PJCA 3P19A 4KUEA 4AL4A 1BXGB 3FR8A 3PLNA 2EKQA 4IJVA 5TT0A 1TT7A 1HDOA 5L7TA 4OMUA 1EVYA 5TRTA 3BAZA 4D46A 4NFYA 3NJ8A 4D3SA 3JQAB 4RDIA 1H6DA 3KM0A 5C37A 3VVBA 1BSVA 2VN8A 2PZMA 4EJMA 2D1YA 3FTPA 1DC3A 2X23A 4ZQFA 5G0SA 1YBVA 1NBOA 3VAZA 3I5MA 4A03A 4OSOA 4O63O 1DAOA 1H5QA 3VPFA 4CM7A 4GI2A 2WEKA 7MDHA 4BQPA 1DFGA 5A3VA 5BSGA 4MO2A 1DB3A 1I24A 4XKJA 4D0RA 4W9NA 1KEVA 1UH5A 4ONEA 3PJFA 1PGQA 5KJFA 1MFPA 4YJFA 1FDWA 4YJGA 4G2NA 5EMHA 3JQ7B 1F12A 4BNHA 5ADHA 3GAFA 2Y67A 5G4KB 4DUPA 5DN9A 2WMDA 3FRJA 1GZ6A 1E3EA 1YONA 1AE1A 3NGLA 3U9LA 3GY0A 3CPSA 3TZHA 3IAHA 3WS7A 2HU2A 4B3HA 4HFNA 4E5PA 3CIFA 1X7HA 1SZJG 4XYLA 4AJKA 4JJIA 4OSPA 1XCBA 3JQ9C 3WGIA 3WIDA 1VRWA 2B5WA 2FSSA 3FR7A 4BKPA 3QVWA 1VJ1A 3FNEA 3NUGA 4UREA 4NI5A 4IQ8A 3S2FA 2NVBA 2Y1OA 2VRBA 4YT4A 1DC4A 4LGVA 2HJSA 3KXDA 4M86A 2BFPA 2BFOA 2GZ3A 3RU9A 2FWMX 3WQRA 5CG2A 3ORFA 2X5OA 1KETA 1NHWA 2O7QA 3TFOA 1WZEA 1LDYA 5AVOA 1ZO8A 4GX0A 3HSKA 3B1KA 2VT3A 4CLDA 5GZ3A 3EGOA 3A06A 2GGSA 4GWGA 4U0JA 3NDIA 1NFFA 2JHFA 3LLVA 4CMJA 2X58A 5IF3A 5A1TA 3D4PA 2H9IA 4FC6A 1NQAO 3ZH2A 1EVZA 2CUKA 2W2LA 1B0AA 3KSZO 2FPIA 1O6ZA 3GRPA 4PG7A 3DB2A 4NJMA 1ZVMA 3CH6A 1G0OA 2HSDA 4L73A 4MINA 2PD6A 1R6DA 2D5AA 4PZCA 1E7YA 1E1LA 1FDTA 3WR5A 3DOCA 4PG4A 3IDSA 2AG8A 4ALKA 4OH1A 1MC5A 4AJPA 4BKOA 1T1SA 3L77A 1QYWA 2Q1UA 2IDZA 4KUGA 1Z74A 4O5OA 3VOSA 3B1JA 4UEOA 2VTDA 1WDMA 1RJWA 4UVEA 5CAEA 3W4JA 2DBZA 5DBGA 3AJRA 4GGPA 1CJCA 1GD1O 1UDBA 2Q2VA 1YB1A 3GFBA 1DFHA 2BF7A 2DTDA 1LXCA 3LQFA 1XGKA 4YA6A 4BGUA 1UP4A 3PZBA 4DIBA 1W4ZA 3ONFA 2JFGA 4DMMA 5DCYA 1ZCJA 1PZGA 3NDRA 2B83A 3OECA 4BQRA 3A14A 3PPIA 3K2BA 4N5MA 4W7HA 1PJTA 1Q0HA 3WGHA 3SLGA 5HTOA 4Q9NA 1DBVO 1Y8RB 1TLTA 3Q6IA 3ZV6A 3ZN2A 4J49A 1R4NB 4R1NA 3BTUA 5GZ6A 5A9TA 5I9LA 5JCJA 5ENDA 4Q3CA 4H15A 1T25A 4M89A 3NGXA 1CDOA 3OMLA 2B37A 2B5VA 3IOYA 2I67A 3BZUA 4J9VA 5AOVA 1B3RA 4CM4A 5BR7A 3AW9A 4RJTA 1QYXA 4FFNA 3OQBA 4FFPA 3IUPA 4BO9A 4RF3A 4TMFA 1MG5A 3BYZA 3GG2A 3DBLA 4FBGA 3AUTA 3MCVA 3GVXA 4CLEA 3WYEA 5HS6A 4E33A 2PGJA 1QYDA 2VOJA 5JBIA 4FPXA 2EKPA 3AI2A 4NU5A 1GYQA 2ZB3A 4CMBA 2AMFA 2PD3A 2X22A 5K6AA 1HLPA 2HK8A 2ZK7A 1AHHA 5ER9A 5JW6A 2BI8A 3T4EA 3ROMA 2X1HA 2ZIZA 2P2SA 1PEDA 3TZKA 3W4KA 2NVWA 2QHXA 1PQPA 5T6BA 4CODB 5CFZA 5IDQA 3RI3A 1N9GA 3EZYA 2O50A 1EQUA 5DBIA 2ET6A 4HFRA 1MX3A 4NDNE 2QYTA 3LVFO 4E4YA 3PDUA 4JK3A 1YOVB 3V1UA 1P1KA 2FOIA 1YKFA 2PZKA 3ITKA 3ONEA 4PVDA 4WCFB 1WMBA 3AFNA 3ZHXA 4EYEA 2FR8A 4A26A 4E2ZA 5I7SA 2DUWA 4BMSA 4R1SA 2ZJ0A 3I9LA 4B4UA 2AQHA 2R00C 1A4IA 2YY7A 2C7VA 5IZ4A 4O1MA 4AJEA 1TVEA 4YB8A 2DAPA 3DZJA 4GVXA 4XDYA 3RC2A 3A9WA 2VWGA 3TL2A 1ZXBA 3W8DA 3ZU4A 2Q49A 2HAEA 4TKMA 2TMGA 4WLVA 4K6CA 2OOSA 2HRZA 4J1TA 2GN9A 1NNUA 1PJSA 3L4BA 3PTZA 4JLWA 1Y9EA 1Q2XA 4A7PA 2PR2A 4CMIA 2PNFA 4HNHA 1R0KA 4XJSA 3QWHA 2XPCA 3R3JA 2P68A 3TWOA 1X0XA 4D7AA 1LDEA 1V35A 2X86A 4NG5A 1GDHA 3DQPA 4Q3AA 3WFIA 2EP7A 2H1SA 3O8QB 3Q1LA 4DLAA 3GC6A 1J4AA 4OXNA 2B4QA 4RCVA 1HZJA 1SC6A 3H5NA 1EVIA 3JQDA 1N5DA 3O03A 1HSOA 2Q4BA 2RH8A 3GDOA 2VYVA 1H6CA 4Z6KA 4CQLB 4JJGA 1ZK4A 3BMNB 2A4KA 4S3MA 1SB8A 4P8RA 3V2HA 3Q2IA 5A02A 3IKVA 3QHAA 1R15A 1LJ8A 3RAJA 1ZSVA 1ISIA 2D0IA 2YV2A 2Z5LA 4WJZA 4CM5A 4OL9A 3RD5A 5AXCA 1P1RA 5K6AC 2RBEA 4CUKA 1OFGA 1EQ2A 1C0LA 1PJ4A 2VHYA 3C1AA 3INRA 3VH1A 5KJ1A 1ADCA 1I10A 3MOIA 3CKYA 4N5NA 4TROA 1WMAA 5FF9A 1E6WA 2ZCVA 1U28A 4IZIA 4NBUA 3ZNNA 3MJTA 5JPIA 4D3DA 3NKLA 3DAGA 1DIHA 2D3TA 1XU9A 3KLMX 4IQ0A 4XRRA 2AA3A 1D7OA 5COQA 3VPSA 1H6AA 1HE4A 1KBZA 3FD8A 5TF4A 4DVJA 2B36A 1O94A 1T24A 3MEQA 5JC1A 4HY3A 1TEHA 2DC1A 3A28A 1OOEA 3D4NA 3AY3A 3K92A 4WLNA 3RC7A 4BO8A 4ID9A 3ICPA 1U4SA 2GYYA 3LDHA 1D3AA 3HDYA 4YWJA 4CLOA 1JKJA 4I08A 5L7WA 2NU8A 2BD0A 4O0LA 2LDBA 3TL3A 1UXHA 5KIAA 3ZWBA 3WMWA 4GVLA 5G4LA 4CV1A 4CL3A 4RPJA 1D1TA 3TPCA 1A7AA 1I30A 4B3JA 1YO6A 4GX1A 2EGHA 1GQYA 4JIGA 1P0CA 3UVEA 5JFOA 3ZNOA 4AICA 5L51A 1BGVA 1GAEO 3L6OO 4XIJA 5JMPA 4C7JA 3R0IA 3C3XA 1HE2A 2W2LD 4BO0A 1WWKA 1E3IA 3AK4A 2I76A 4BO2A 2AQKA 4TRRA 3QP9A 2HDHA 1ZK2A 2FR0A 2IODA 4EUEA 3E5MA 1XDWA 3I23A 3Q9UA 1Z75A 2JCXA 1G1AA 2X0JA 4KQXA 1I2ZA 4YQYA 1NYTA 3C7CB 1SB9A 3JYNA 2ZB8A 2W90A 4UUPA 1OAAA 2J3IA 3H2ZA 3HB5X 2GRAA 1JVSA 1IOLA 4ZICA 1GY8A 4BKQA 2QW8A 4J16A 3BA1A 2UVDA 4FJ1A 4B8ZA 1CQIA 1YDEA 2CMDA 4LVUA 1D4FA 4R5HA 3N58A 3OF2A 5CHEA 3G1UA 1ZW1A 4TKLA 5L9AA 3LT4A 1YDWA 1KYQA 4XCVA 5DOZA 3WNQA 1ADBA 4DBZA 1KIFA 1PL6A 2D59A 4J7XA 3ROQA 4A0SA 1CRWG 3NYWA 2V6GA 1VKOA 5IN4A 2IEBA 1M76A 1YQDA 3O9ZA 3E1KA 5F1KA 2GERA 3ENKA 3ZV5A 1IZ9A 1Y9AA 4MKZA 1GPDG 3PI7A 4FR5A 4PLYA 1C0IA 4IJUA 1HTBA 1O95A 2C07A 2EKLA 4PGFA 4RVFA 1UXIA 1XYGA 3TFQA 4BS9A 3QWBA 2NU7A 1LA2A 2YZ7A 4IDGA 5JO9A 4A73A 4DYVA 1IPFA 4IDBA 4NNJA 4NHEA 1OMOA 2JCYA 4BO6A 2FZEA 4MVJA 1GZ3A 2JD0A 1C1XA 2BMAA 1PR9A 5ENVA 5G0VA 5CDSA 2OP0A 4ILKA 4J4TA 4MDHA 3F6YA 4J4BA 5B4VA 1Y8QB 2Y1EA 3JQ7A 1RYDA 4LCEA 4CPDA 4NFHA 2J6IA 2W2KB 5JO0A 2V7PA 1GL3A 4RVUA 1KVSA 1JN0A 4XB2A 1SAYA 3W4IA 4KP7A 1JVBA 2YHIA 2VQ3A 3HB4X 3I9NA 3PXXA 2HJRA 2PK3A 1Q1NA 1NR1A 1DO8A 2AQIA 1GFSA 4FN4A 2IZ0A 5T8KC 9LDBA 1NVTA 4Y98A 2PKRA 2E4AA 1DLJA 5L4SA 4UEJA 3V1TC 3RUCA 5K1SA 3AOEC 3VPXA 4K28A 2DLDA 1MXFA 2NTNA 4R69A 1Y5MA 2W98A 4E5KA 2Q2WA 4J3FA 2CDCA 1Q7CA 2VCYA 2UDPA 2NWQA 1GPJA 1V8BA 5GY7A 4BNYA 2OMEA 3OSUA 2A92A 2E49A 2BI7A 1IY8A 1MV8A 3BXXA 3P7MA 4JP2A 4FCCA 1EMDA 1F06A 1NQ5A 2PZJA 2X9NA 3N74A 3QV1A 1YJQA 3JCZA 4GGOA 3C7DB 3F46A 3H65A 2Y0CA 2FR1A 1Q0LA 2IE0A 3ANLA 2Y99A 5IJZA 1PL7A 1GUZA 2Z95A 4MIOA 2BLLA 3CZMA 4R4JA 4TRMA 1FXSA 2POQX 1R66A 2V6MA 4MVJG 3UXYA 3UCXA 2PTGA 5A9SA 3WLEA 3BMOB 1LQTA 4PLFA 2OUIA 4AFNA 3PDJA 3WBBA 3HDHA 3BHMA 1C1XB 1VC2A 1JKFA 2BRUA 4BKRA 2C82A 3KUXA 2HMWA 2Q3EA 5A5EA 2R00A 4DQXA 4B4VA 4JROA 4A10A 1WDKA 4GL4A 4L74A 1GADO 3WIEA 3C24A 5IAAA 2F00A 4RPLA 4BV8A 1EE2A 1NVGA 1SOVA 3TOZA 3VDRA 3JQ6A 4TVBA 3AU8A 5T8KA 1HKUA 5IDWA 4NMHA 1TI7A 4L9RA 3JQFA 1K5HA 1P45A 2EV9A 2CDAA 2X9VA 4CMEC 3B20A 4O6VA 3OETA 3CE6A 2ZYDA 4Y67A 2X5JO 4II3A 2PA3A 4J4HA 1LC0A 2QG4A 4MKXA 3JQ8A 4RLSA 3WLFA 1PL8A 3QVOA 4ALNA 1PTJA 4IJWA 3LC1O 2JD1A 1KVTA 2DU8A 3ZWXA 2NV6A 2BKAA 4WUVA 1QV6A 2X0NA 3HFGA 1ZXLA 2EERA 1X1TA 2YHIB 2ZB7A 1YL6A 3FI9A 4G5HA 4NU6A 4ZHSA 5A5FA 1Z45A 4D0SA 4RQTA 3WOHA 1A5ZA 4MOWA 1P1FA 3M2PA 3KHUA 1ULUA 4AJLA 4BO7A 3I3OA 1DFIA 1LEHA 2DTXA 3NTRA 4YT2A 4Z3KA 4PLWA 2DKNA 1DPGA 3ZHYA 4E5NA 3U4IA 4NH4A 1DIBA 5C7IO 5EL0A 1ZNQO 4FFOA 4MJLA 4CLRA 4UULA 1HYHA 3GNTA 1MC4A 5CG1A 3PQFA 1O0SA 4S1VA 4D44A 4URFA 3BMQB 3TN7A 4F6LA 4YYZA 1H0KA 1O5IA 3VZPA 3L9XA 3CZRA 3TJRA 1NM5A 4Q39A 3CEAA 1KY5A 1LLDA 1GEEA 1LBEA 4BKUA 2CVZA 4FB5A 5IDXA 5CPBA 2O3TA 4BNWA 2V6FA 1H6BA
chains in the Genus database with same CATH superfamily
1AKEA 4JHLA 1N5JA 1PQYA 5CYFA 2KLBA 2FEOA 1SXGA 2ZYWX 4RPHA 4BJ1A 1PG0A 3AETA 1TOAA 2Q2QA 3S2SA 1JHMA 1REQA 3LHDA 2H92A 4JUCA 3CKMA 4UFOA 4C30A 2OENG 2C7PA 4FYXA 4X24A 2DQYA 4LRYA 4E4TA 4B31A 5A4KA 3ZV7A 4PWYA 4DPLA 4IOJA 4CG1A 1BEZA 3OMWA 5AJYA 4BO3A 4KYVA 2XMQA 4RTKA 2YWDA 3EGEA 2Y93A 1G8KA 3ROKA 2O2HA 3FNHA 2G1UA 3DBRB 4BO4A 3RRXA 3CXRA 4CT5A 2FPMA 5A62A 1GGNA 1AB5A 3AUUA 3DEIA 2FPSA 1Z73A 5AW5A 3C6MA 1V1RB 2I22A 1ULAA 2AFHB 2F43B 1JVNA 4WY2A 5DF1A 2COKA 4JHXA 3UCEA 2W2QA 4JGBA 3MCAA 3K2IA 1WTCA 2B78A 2J0UB 2R60A 1X0VA 1GLGA 2PBFA 4K3UA 4AI6A 1Q5PA 2AUTA 1ZNWA 3JQCA 1H2RS 1KERA 2HTFA 3PZRA 1N6RA 1UMCA 1V41E 2R6JA 1IQRA 3LLCA 4FEYA 4G9EA 3DV9A 3DVQX 3MBOA 4OIFA 2GO1A 5CH3A 5L45A 2Y05A 1JQJC 1IHUA 2PNJA 5EERA 3LHFA 4G0XA 3QK7A 4KXFB 2OXEA 4XQGA 2PZEA 3WIUA 2PBLA 4YQZA 4Q4DA 5I9BA 2OCIA 2OCBA 5F76A 3U2QA 4UHHA 2I7VA 4WXEA 5DRTA 3I4CA 1H9BA 3SI7A 1NJ8A 1G4HA 5BNIA 4GSKA 1V8ZA 4S0ZA 2ILTA 3VZBA 2YNMC 4Z4EA 3IKMB 4YMSA 2ASEA 2MR5A 2QPAA 5HRCA 2HJWA 2FWAA 3GEMA 1VCNA 3BA6A 3WL8A 2FDXA 4L6AA 5TS2A 1A9SA 3DBRA 4ZAVA 1QGUB 4YRPA 4XE5A 5I3CA 1S7CA 1UDWA 3FTQA 1ISGA 2YWBA 3EUWA 3O95A 1X42A 4MUYA 3SYNA 3WGGA 3MWKA 4GZ5A 3UHFA 3TR5A 3G82C 4XXHA 3PHCA 3EZ9A 4PFKA 4KN5A 5DVZA 1KDZA 2NXJA 5DWDA 4IGKA 3FMPB 4LJYA 4CN9A 2JLXA 1D1QA 1B4DA 3IPRA 4LY9A 4GG1A 3EJ6A 2WU4A 3RSQA 5E1OA 4Z0PA 3SE7A 4EGSA 3AT1A 5AI4A 4XASA 4ZKDA 1AURA 3BSYA 2X8LA 3RRMA 4HMOA 3N6XA 1H3FA 1CUUA 3AY0A 3BHJA 4UMEA 1KFJB 3GJYA 3KT6A 3NBZC 4AJJA 3B1WA 4CW7A 4NFSA 4AS3A 3P26A 1FCJA 2MJLA 2YZGA 1SPXA 1TVMA 4NNPA 1R5NA 1N7GA 1PIWA 1I3CA 3D6TB 3ILVA 4FUQA 1FNMA 1E3SA 3C5HA 1W4BA 4GOLD 2VBGA 4AY4A 5T4BA 2MYUA 4EG0A 2X2EA 3BMCB 1Q50A 1Y9DA 1Z7EA 2QMQA 2VC2B 4NU0A 5EG5A 1JG6A 4P7GA 5AMXA 3HNPA 2J6CA 1EDZA 3D9QX 2Q46A 3BJZA 3I04A 4DQ0A 4AJ4A 5E6RA 4IDAA 1CIVA 1XZIA 4J0KA 4MRSA 5CT6A 3L0IB 4CQJA 1UANA 1TJNA 3F4BA 4ZJUA 3LC7O 3O8DA 1VL0A 4WXRA 4MRNA 3SQXA 4DLNA 3SJBA 3TTVA 1C3OB 2GPAA 4A27A 2ONZA 5LYJF 1CETA 3EH2A 3QWFA 2IU6A 1NZDA 4TYQA 5EIWA 3BCHA 4EHDA 2NXEA 1TECE 4KVAA 4LW8A 1L4NA 1C3VA 4LYEA 3SEFA 4KRFA 1P1JA 3KJQA 3IVAA 1K75A 4HH0A 2Z08A 4HS9A 4NBRA 3O8QA 1IEXA 3IJPA 2E9SA 3FN4A 5FADA 3T7IA 1OGIA 3ZWMA 5EZYF 4J2OA 3AKYA 1PHPA 2X7HA 2UVQA 4BNFA 3CZ5A 5GINE 1RRCA 5FBRB 2AUNA 2OG2A 2Y1WA 3V9AA 1WUIS 2G0NA 2I3AA 2NUAA 2YRFA 2H2FA 1GLVA 2HSWA 3O1HB 4IEFB 3A6GA 4NMWA 4WQMA 3NAZA 4B3CA 1FL9A 2SECE 3UMSA 3KYBA 1A8PA 5KHLB 3SQDA 5TE9A 1XEWY 1ZBQA 2PPLA 3PDWA 3NG1A 1S1CA 4WNIA 4AUEA 3OP4A 1SCUA 4KPUB 4WWHA 1SHUX 3ESYA 1CQZA 2P5TB 4RULA 3WZMA 4W7SA 1SCKA 1J06A 2FMKA 3R0ZA 1IMJA 2WJHA 4KN6A 4BMCA 4DRZA 4EYQA 1WZ2A 1IN1A 3ZBUA 3OPYB 1Y9ZA 2EJVA 2ZJ1A 2C98A 2G77B 3DWFA 4MW9A 4RHTA 2PLAA 5TLSA 2D8AA 3CPEA 1ZGJA 4Y2HA 3DEYX 1ISSA 1SUDA 4FEAA 3T9BA 3JAMA 1MC1A 3BH7A 4KNWA 1EBUA 2COEA 4IF4A 4JR1A 4LTDA 4WN3A 4H08A 3ONVA 3RHFA 5ICMA 2IHJA 1CJUC 3LIIA 1VPTA 4Z1MA 3GA0A 2GFQA 2HU7A 4RK4A 4YROA 2VO1A 2O5EA 3I83A 1Z8NA 2QZJA 1M0WA 3R6LA 1G3QA 4BVFA 3C7KA 4XYEA 1DKPA 1U81A 2NUBA 1EHYA 4AROA 4XSVA 5E4TA 5KOYA 3T5CA 4K1XA 1EDEA 1M0SA 5IJ0B 4IXWA 1GPMA 2EG9A 2RHOA 2F64A 3JQBC 3QA3E 4Z2YA 1WS6A 1JU3A 3CVOA 3OZIA 3L1IA 4MWCA 1OT5A 4O2BB 2BKUA 4ZZ3A 4AQ7A 3RAFC 3SZOA 4G41A 2C20A 4QNNA 5DNYB 1UOPA 1X8KA 4Z0NA 2J0SA 3KAPA 3SNKA 4HV4A 1LPPA 1TT5B 1E2EA 1MGPA 1TC2A 1Z35A 3EASA 3M6LA 4EB0A 5KBYA 2PX6A 2WHRA 3DFUA 1C7QA 2WF7A 4WKGA 1IZ8A 4QUKA 5JJBA 1YR2A 2V97A 1HE3A 2H2GA 2QL5A 3FRHA 3GT4A 3GUHA 3HB0A 5FWDA 1BCRA 3ETJA 3V5NA 4ZI7B 5C8XA 1ZICA 1BOFA 2O23A 2PD4A 4HN9A 1U0GA 4G5QA 1JAZA 2OM2A 4JWKA 1LX6A 1KZGB 1V5FA 4FGWA 4LRWA 2JIOA 3PC3A 1T5IA 3N2ZB 5AK0A 2D2EA 4NQZA 1WP4A 2ATVA 3NHJA 4NEGA 2IQIA 5CJPA 1IYZA 1W59A 1QPGA 1KXJA 2JAHA 1GOTA 2QR3A 2ZSKA 3FCSB 4NJMB 1SHJA 1RQPA 3R3VA 1EZ4A 4BB9A 1GA6A 2O52A 1T9GS 3WSTA 3EZGA 4EIWA 3DOFA 2G25A 3OEED 1H42A 1QMPA 4ENQA 2F17A 4RHXA 4F96A 1PLJA 1PKEA 2R6CA 4ZO4A 4CM4B 1SOUA 2NO6A 4WNYA 2X8WA 3X1DA 4LC9A 3A2LA 1EESA 2JJ2A 3U26A 3B52X 1FPMA 4JJKA 2NP6A 1T9DA 1LLFA 3DWEX 1F3LA 3PNLA 3S2ZA 3ANXA 3UYLA 1E4OA 3EIUA 2FY8A 3A25A 4NF2A 2ZBFA 4PQRA 1CUGA 3A9RA 2W93A 3HBAA 1K6JA 2OLKA 3QBJA 4EEZA 5ALOA 5KYUB 3WOVA 3UB4A 1APBA 2X2OA 2BEWA 4GPBA 4I4CA 4RHEA 3PFKA 2GM4A 2OG1A 3JAWA 4D79A 2IXEA 1GTZA 3GP5A 1MDFA 3C74A 1S89A 3BE8A 4WVFA 4Y6SA 2VK1A 3R8XA 1OZ0A 2YHUA 4PZAA 2VHVA 3GRFA 5KHAA 5JFTA 2KMLA 3ITNA 4F3YA 3NORA 2H4HA 4L5AA 5LYYA 5B6JA 1OLXB 2WKQA 1NOKA 3IR7A 5TF0A 4ERXA 4D4KA 2ATCA 5PGMA 4YR7A 4OLHA 2J33A 2QRJA 4YNBA 1R12A 4CDNA 5JANA 4XM2A 3NGMA 1JR3E 4DMRA 4B6GA 4YUZA 1RKXA 3ETCA 1UT5A 3LQRA 5BSFA 3GRUA 5J63A 4BU1A 4RC9A 1CJBA 2ZI6A 1E59A 3LPDA 4GOJA 2Q1YA 4Q1CA 3QLEA 3V8NA 1XMJA 3IS3A 5FR1A 1NV9A 3OC0A 3VKWA 1YS6A 4LMPA 2BJHA 3T38A 4WJLA 3VPCA 2C2HA 5PNTA 2CF5A 4ZVMA 4KDFA 1PNQA 4UM8B 3PHGA 4F8YA 4A6PA 2ZWVA 4CZ2A 2ZTLA 2ZM5A 5I7VA 1BDIA 1ZGAA 3E3NA 1RP1A 4K05A 1AB6A 4P80A 3T1YB 1FZQA 1N0IA 2G4CA 2QMHA 3AF0A 4EJ0A 3PLAE 2E1RA 1V7QA 3R8FA 2GLUA 1IY1A 4ZI7F 4YDSA 2B8JA 4KE8A 3KSRA 4JXXA 1Z7BA 1SD2A 1QQAA 4EUFA 5CA1B 4NCAA 2GAOA 3FWKA 3K05A 1SULA 5F3DA 2VP9A 2Y0PA 3FNRA 5T7BA 3BZBA 2VH5R 2D0PB 4EJ6A 4IPTA 4J29A 3P9SA 4C43A 2LZ0A 2QRVB 2V4ZA 1K8ZB 3GVCA 3E61A 2XIJA 2QTMA 3GLKA 1NN0A 2VPQA 2NNWB 4WMLA 1TQ4A 4RTPA 5E8RA 3FCEA 2C4MA 2V7VA 3VKUA 1SCJA 4W1RA 2HQ1A 4IAOA 3BC1A 1SUEA 1UPCA 1YBAA 4XZ3A 1IOZA 3HYCA 4OO3A 3WK7A 3RC1A 4IJMA 5BRAA 2Z6AA 2YYZA 1Y98A 3OJWA 3JQFC 5GVRA 2WUWE 2R96A 4BV9A 2GZHA 4PS0A 4ER3A 3AW8A 3SC3A 1GCUA 3A1NA 4XIIA 3K6SA 3BWCA 1NBME 1WQ4A 4WGGA 3I32A 4MVJF 4DSOA 1DJPA 4RL6A 4YI3A 2I7DA 1DDOA 3HYRA 3PNQA 4RYDA 1I01A 3UAYA 3V7FA 3WRWA 4JYZA 4P7FA 4C0JA 4W5NA 1SBTA 5SICE 4YRBA 2UYCA 5DBFA 2R9VA 2BFAA 4AJ1A 1P29A 3CX7A 3GNSA 4JX8A 4BFZA 5FOWA 2J67A 5GWXA 4RK7A 3ETHA 4M1YA 3HKCA 4ZT5A 5FLYA 3ZY2A 2B3DA 4CCYA 1ONNA 1VIVA 2H1WA 4ALMA 5FL3A 5EJ5A 4X54A 1AUQA 2HUPA 3D4BA 1RI4A 4GZ6A 3VSBA 3PJRA 2G6TA 2JGMA 4R8MA 1AXGA 2XT6A 1ZGGA 3HCPA 3K8ZA 4UU7A 2CHGA 5DI9A 1QC5A 5JZOA 2G9ZA 2HNKA 1IM5A 1YKSA 4WACA 2IA5A 3GRVA 1RJGA 4AWXA 3I12A 2F7SA 1ULZA 1U9CA 3FUVA 4LRQA 4YAFA 4U7HA 2IK8A 3CGGA 2RAFA 4TTTS 5AHRA 4MP3A 3HCNA 1A7JA 4Z5XA 3JD2A 4EG3A 1U90A 1UWLA 2HI0A 1G6HA 3QW2A 5FWNA 2ZVJA 3ISJA 4XGQA 3V48A 1KYVA 1BU8A 1NOIA 3DYVA 3VNAA 4AP9A 4CMGA 2FWNA 5CDFE 3ASZA 2JCGA 2QVGA 2Z1MA 1F8YA 3IQWA 3OT4A 2CJWA 3DZFA 5E7MA 1ZGHA 3VTZA 4YDQA 1D6SA 2JAWA 1Q3HA 3C97A 4ISCA 2FK7A 2JK0A 5TMBA 1LDNA 3GJ4A 2N46A 3OPYI 4UXIA 1RABA 3FRIA 4CU2A 5G1OA 1Q11A 1KY2A 3AC0A 2GKOA 1J8DA 1M8GA 3HWSA 2AX4A 3RJ5A 4E22A 3Q98A 4R0NA 3U7HB 3GP8A 1P5FA 3T9CA 4AY6A 4XVCA 2B8NA 2P30A 5JCOA 4UM5A 3JD4A 1TMYA 1PO7A 4QKQA 4ZN6A 1P0PA 1U3FA 3K1TA 3TVDA 3ZGNA 1P39A 2AG0A 3QOYA 3WWYA 4GXRA 3O8BA 3ZX5A 2OBYA 1E2LA 1IWPB 4FYJA 3SDBA 3STWA 1ID1A 4I66A 4MQMA 2HX1A 2H6EA 4Q3KA 4Y6GB 5IC6A 3V80A 4J0EA 1SWWA 4KAAA 5BV7A 3QPAA 4TV8A 2IP4A 3PWKA 2BEJA 3H86A 1Y1LA 4IXMA 5A2QA 3MTAA 1EM6A 4DDHA 5KQSA 3SM3A 3UOGA 3WLAA 1Z7GA 1LVUA 2WAMA 3MFQA 4MW2A 4D99A 3Q8MA 5H82A 1G8HA 3OCCA 3W5UA 2IX9A 3DZHA 1AUXA 3HJUA 3WWZA 1Z4LA 1SO8A 5AM4A 3EULA 2QLTA 1G5RA 1ZD8A 2QRZA 4DIKA 2HRRA 2VP3A 2GYUA 3HADA 3H9UA 4ILEA 1EZ1A 1WUHS 4V2IA 1PZEA 1DIAA 1YVEI 2G5CA 4TMXA 5JSKA 4EUSA 1X80A 3P2YA 1GRCA 4C0BA 1Z6ZA 3CF0A 2PXXA 3EAQA 1RYEA 1II0A 1QDUA 3SXUB 4J76A 1KRHA 2HK7A 3KOZA 1T2UA 4R3NA 4C0HA 1E18A 1E4EA 4ARCA 4G85A 1RYYA 2G7ZA 3REFA 5B2EA 3PNOA 4JXZA 5ALIA 1G8SA 1YHZA 3EG5A 2G1PA 2OYCA 2FQ1A 3GU3A 4XQEA 1KSGA 1SXIA 4CFSA 4TV9A 4AG3A 1UEXC 1DCKA 1YL5A 3SAJA 4Z53A 1ZHOA 2Q27A 4L6CA 4I6GA 4AKEA 2H1FA 3U0BA 4RKYA 1XCOA 5A9RA 2Z98A 1NPYA 1G9TA 1LCIA 4H16A 3AHCA 1PKXA 2XYQA 4Z4GA 4KNYA 4O2AB 3A7DA 3JSXA 4EF4A 4ZMRA 1DAGA 1XR3A 3A4NA 1NM5C 4LTMA 4F9TA 1VKJA 3HKCB 3K5PA 1U3TA 3VC2A 4ZTZB 4YQEA 4FT2A 3FTCA 1K89A 3A1DA 1IDOA 2I78A 3OIWA 3T7CA 2I99A 5KWSA 3HVKA 4HBGA 5K3OA 1OWOA 1Y7HA 2D13A 3CWQA 1I3LA 1GYPA 1UDXA 1VGVA 1ZNYA 3FNFA 4TKVA 2YIJA 4M0DA 2VJCA 1EH5A 3LI2A 3IOBA 4G0OA 5CM2Z 2ZTHA 2FHSA 5ANRB 2XEXA 2RI0A 1DJNA 3KK0A 1JJFA 1N33B 3H2IA 3NEYA 1VJ0A 3E0QA 3FHLA 1DG9A 2IZZA 3QOWA 1ND5A 1LPMA 2J46A 4RZUA 1VZ3A 4U2DA 5LQMA 3UXEA 2Z3VA 1WA5A 1AD2A 2RHHA 4FN5A 1SKYB 1M2VA 1H1LB 5BURA 4D5GA 3QG1A 4M9XA 1Q6ZA 5FXMA 3ZZ1A 5HHTA 3Q5GA 3H8JA 3QYJA 2OZVA 2ZRDA 4LF7B 1J2EA 3FE2A 2H5JA 1V43A 1SVNA 2H8GA 3D6JA 1QG6A 3AVXA 1XN1A 1TYBE 4PLPA 1QZ3A 4KK4A 2DOKA 4KXWA 1FDVA 3DOOA 3RQSA 4AJNA 1DX4A 2FQXA 3D8TA 3ZV3A 5FNVF 5JS8A 2F67A 1JW9B 3PQEA 3BTOA 3MIIA 3TD6A 2W0SA 4V1CB 5AVZA 2J3KA 1U3CA 3VR2A 3CF4A 2JAUA 1RAHA 3VNSA 5LOVF 4UEWA 1GPKA 5DDIP 3RK0A 3QTLA 4AYWA 4NS1A 3D5QA 3RE1A 2EQ5A 4HEQA 2VATA 1F5NA 3NBAA 5FH9A 1H94A 4ZI5A 1WXFA 1E66A 2QLNA 2CYBA 2J09A 4NH0A 3ZIDA 3MQFA 4JOCA 2GTIA 2WW8A 3JQAD 1RXIA 1VG9B 2GTPA 4L76A 3UJBA 5BWBA 2E4XA 4EARA 2HT1A 3OE7A 3IQDB 4A1FA 4LFAB 1C80A 3KYCB 2Z2YA 2C5LA 4HLUA 2HU8A 3OLVA 4BE7B 1OFVA 1EB8A 1HZZC 1WPQA 4XIGS 1PQ4A 2GN4A 5EJEA 1FDIA 4WDQA 5JNWA 2JD2A 1X74A 3HSSA 4KPFC 4UU8A 2ZZNA 3KOOA 1FJ2A 4QFDA 4F5YA 2QOEA 1E7SA 1DRVA 1SKUA 3AY6A 1NW4A 3BX1A 1ADGA 2SKDA 2BGUA 1E6UA 1D2NA 2W58A 4MRPA 2BMEA 3PDIA 4EJFA 1JWBB 2R7AA 5BNFA 5CEJA 3GK3A 4N6OA 1K8QA 3SXPA 1SOWA 1ZG3A 1E63A 1ETUA 1NVDA 3DT9A 4OP1A 5JAZA 1YE3A 4GMXA 4F8JA 3RRNA 4YP0A 4DCCA 1VG0B 1JG7A 3OEYA 1IAQA 3ZVMA 1G3MA 3ABQB 3I9V1 3G85A 1J25A 4O4IB 1ILWA 4LPSA 2JEOA 3IBFA 4OHOA 1NVXQ 4V0LA 5A4FS 1VL5A 2AEMA 5L6MB 2VZEA 4KRXA 5DRYA 2R8PA 3VUEA 2E0IA 3AEUB 5JIBA 1CYDA 2QN8A 4EITA 5IWAB 4DR3B 3UGKA 4LJ5A 5KKAA 4YMGA 5KOJB 1X7YB 5EGNA 4OQYA 5GMOA 4D0LB 1FLNA 3E9DA 5LL6P 1D6NA 1AGPA 1UBOS 2WR8A 1GFZA 3BDAA 1EVEA 2FEXA 3WGQA 5HKKD 1IE3A 4A36A 4FEEA 4H7EA 3HHEA 3A70A 4ZWNA 5JUWA 4DDMA 2XCOA 3DEKA 1U2ZA 2D54A 4IDPA 4NOJA 3VR6D 2FE4A 3B5EA 3H9JA 4KH0A 4EWLA 4ZHQB 8ATCA 4BP1A 1T4DA 2DX7A 2EWWA 2D1FA 3FCCA 4XFJA 3F3YA 3I1FA 3OURA 5LQCA 1R6XA 1PK7A 3TZEA 4K0KB 2WDPA 3L7IA 4RTJA 2R97A 3DFZA 2WNHA 4A0FA 4AT1A 2DVMA 1H2BA 1ACLA 1TT5A 2XWPA 4EKGA 3F4LA 3U3RA 2VA8A 9MHTA 2FQYA 4H1TA 2ACKA 4ZD6A 4OU5A 3TLJA 1UBMS 2NVUA 5G41A 2GEJA 4B81A 5B7NA 4D25A 1U3UA 1NLZA 1UJ5A 2CL0X 4QAJA 3VH4A 3LYLA 4X6UA 2B69A 2FRDA 2YXLA 3X1KA 5CCXA 2XVZA 1VKNA 1QXSA 2A67A 4NBTA 3KSDO 3IT2A 4YJGB 4GLJA 1Z47A 3D6UA 3PFGA 1X39A 2QVBA 4D8UA 4OOFA 4C4RA 4HGQA 4QJIA 1W2HA 2QUJA 2F8LA 2IE8A 1FU8A 2PWBA 3DVLA 1DX9A 4GOND 4JUFA 2OD2A 3EVBA 3S44A 2GBPA 2HHCA 3MHTA 1C9KA 1Z18A 2QTVB 5F1OA 3ZD7A 4PRZA 4WZBB 3FF4A 3VXKA 2ZYRA 2I54A 1I0IA 5IAKA 1KYTA 3L5KA 1VIDA 3VJMA 3W5BA 1D2AA 5BUQA 1JV2B 3Q11A 4D9CA 1UKBA 1IUKA 2O2CA 3H6HA 2ID8A 3HQ4O 5KCZA 1TUIA 1KZ1A 3ONNA 3C16C 4DLSA 3CMMA 3CB4A 4RY2A 3FI0A 2M1ZA 2GEUA 3MXTA 2JGNA 4FFLA 2GD1O 2I9PA 5BSEA 3ZJTA 2ZKLA 2C5EA 2OPBA 5L3SB 4IDDA 3E9NA 2C4HA 3NBYC 4H7PA 2JJYA 3NCTA 4RW0A 1NT4A 1LK5A 3N8HA 2ZJ8A 4KU4A 5ER6A 4XWWA 5IP5A 4CKEB 2H2IA 1PX0A 3UTCA 1IZZA 3HA7A 3IVXA 3OHPA 1JHYA 3C3YA 4PLCA 1NAIA 2XODA 5FI3A 1DQZA 2YHAA 5BQPA 3AH8A 1QDLB 3N0RA 4HVAA 1V4VA 1W36B 5HRUA 2HDWA 4IX1A 1D2GA 1QRSA 1IOWA 1U0SY 4IJKA 4IJ6A 2MYNA 5JSZB 1NXQA 2J5QA 3U4QB 3IEVA 4C21A 1HYEA 2OCDA 3BD6A 1Z5VA 3VI4B 3HBJA 3PVSA 4X7RA 5LOVB 4E15A 1YJ5A 4HOYA 4ZZ1A 2GK7A 4EKIA 1B42A 2VDNB 1U0JA 1DKOA 1R74A 3OOHA 2PU7A 2ATIA 3HY6A 4M1TA 5FNVB 1BFUA 4PO1A 2IYEA 3PWZA 2Q50A 3W06A 1YUMA 1MB4A 3BRCA 4ZYXA 3RFXA 3ETDA 5LJLA 2QI9C 1GUYA 3TLKA 3NHUA 4ARZA 4W5QA 1YFJA 3U40A 3PKZA 3CX8A 3C41J 3QLVC 5CIQA 3PWSA 3ZWNA 1QFJA 1JPNA 1ABFA 2E18A 4UBJA 2LVBA 4ZT6A 5CLGA 3SR0A 2P35A 1DIRA 2J5RA 4CMAA 3J7AC 2UXBB 4EENA 2BI4A 3MF4A 4JASB 3UK0A 5KVCA 3QA9A 1E64A 3BXHA 2YINC 5LNK6 3GZ4A 2AXNA 1Q1BA 3WLQA 5A3JA 3IPXA 1Z4IA 2A1UA 1K08A 1SIWA 3IOCA 1VPLA 4MA5A 4EHJA 4OGFA 2HWKA 3SX4A 1Q74A 3DDZX 3H4MA 1TIKA 4W7IA 3WGLA 4PNZA 4N7RA 3QUTA 4RADA 4WLFA 2YJZA 1PZXA 2O06A 1OLSB 4GC5A 3OA2A 2ALJA 4HPWA 4LDZA 4YAGA 5KOJA 1HFEL 1A4UA 3GRZA 4GXQA 1ZCAA 1ZQ1A 4BIIA 1PS9A 1UMDB 3O9MA 2ACEA 4R05A 3S2IA 2QJWA 5AKIA 4NFLA 3K9LA 4FIZA 2YY6A 2E55A 3I9MA 3CLUD 3K31A 3WJ2A 4BFSA 4QEZA 1A0OA 1T26A 1TU4A 3GBSA 4C0WA 2YQZA 4Z4IA 1TQ6A 2D3WA 1G20A 1MN6A 3OQ1A 4X7BA 1L8AA 3SP1A 3U39A 3WXBA 5GJBA 4BNDB 5LQRA 5KX5A 1M34E 2YQ5A 4PTZA 4Q3NA 3W5CA 4ZOAA 4R2KA 1W85A 2IIVA 4M8LA 4MI6A 4R7GA 4AN0A 4QC2A 3QFTA 1R2QA 1TFUA 2RAPA 3BE5A 1BKSB 1UDCA 5JJCA 5BVHA 5ITZA 5DTEA 1V3QE 2XXBA 2A0KA 2C58A 1QZUA 1YE5A 2HPVA 3CR7A 3N0XA 4G01B 4MRAA 3VR1A 2SBTA 1SM4A 2FKNA 4CIAA 1GVNB 4CIXA 5IKMA 1OX6A 2HIAA 2VRCD 3WLPA 2HLDD 2ROQA 3W05A 5JXJA 3FPAA 4ZVOA 3DH0A 5EIOA 3HKBB 1RM0A 4PN3A 1TLFA 3DNFA 1W29A 2VTKA 4G5OA 4IINA 4YAEA 5SYMA 4DZTA 5ESWA 4GMFA 2QAGC 1GAJA 3SBOA 2FKAA 4E5MA 1W0JD 1E9BA 3NNNA 1C1DA 5BV1A 1E2PA 3SJZA 1NE2A 3G8AA 4RTNA 4EBFA 2UXCB 2QTZA 3ABSB 1Z16A 3EY9A 4E5VA 2XMRA 2WJ4A 2ZAGA 4IR7A 4LXIA 3GPLA 4FW8A 1JFTA 1CLUA 2ZBDA 2Q5CA 4GLOA 1X92A 3QKRB 3G0CA 2FLWA 2ZT7A 4BO1A 5JAIA 1WV0A 1O97C 4BNNA 2AZ4A 1NI3A 2J1LA 2FDCA 2AUMA 2O8EB 1U04A 2J4FA 1R9GA 3DF7A 4LZJA 5H3HA 3H8VA 1M1UA 3RJTA 3RPEA 1LWOA 1QX3A 2D0DA 1OBHA 2P5YA 2CUZA 1FTNA 2RB4A 1UC8A 3A4YA 2DQZA 3IPLA 3O4VA 4TTVA 4BDTA 1G8GA 1JG3A 4OHUA 3K1ZA 2WSLA 5TPWA 1I3KA 5JAHA 4OQFA 5JISA 1HT2E 3OH8A 2R8YA 1WKVA 3DFIA 3OQHA 3PU6A 4G84A 4EHLA 1QH1A 1NHGA 4R0VA 3U49A 1K66A 1T2FA 4PONA 2CT8A 3G9UA 4G0UA 4I5FA 4WEQA 4FW9A 3LC2O 1WDLA 1FDUA 2K2WA 2WHYA 4Q7JB 3WMEA 3WLNA 2IYPA 5AQEA 1TXGA 1EX7A 3MYRA 1ZDMA 1ATZA 2P4HX 4IY1A 5AKLA 2GILA 1T2NA 2JFZA 2R7KA 1H1LA 3VSCA 4G1MB 3WX0A 5CVTA 4JI4B 3UAZA 1OFUX 1FJHA 4MYCA 4NP6A 1GZ4A 1ZSYA 3O4FA 1NVAA 3OZFA 5AUOB 5BMVF 1KFEB 2VJPA 2XWQA 1PR2A 4QLOA 3FPKA 3UK1A 4MGHA 5IKPA 1KC1A 2YWGA 2JI4A 4KLRA 5JAQA 1NLUA 3K72B 2VF7A 4B17A 1YBFA 1I32A 2H9AA 3LJKA 5EKSA 3ZIAA 4CL8A 1RLTA 4KYUA 2H3HA 3SBDA 3U48A 5JQGF 4D9EA 4MVJD 1MEJA 1EFPB 4H0NA 1A9OA 1EP2B 4UE6A 5EKDA 1IM2A 1M34B 1RP7A 2NSHA 3Q15C 2RH9B 3WLKX 4F85A 1U9JA 4KJXA 3USCS 3RLFA 3CH4B 5IH7A 3D1JA 4CQLA 1NFRA 3VHXB 1W36C 2MSCB 3VZDA 2PJZA 1CJSA 1A27A 3CTPA 3SC4A 4HNGA 2EX0A 5KEIA 5IYZB 3HG7A 1E2GA 1Y6ZA 2GESA 2ZSJA 3NT2A 4K8RB 4DEXA 1FTGA 2JFOA 3ML1A 3S2EA 2QF7A 5COBA 5FFMA 1D8AA 1K6MA 1XTUA 3O3OB 3ET4A 2AKEA 3TQIA 5JS2A 2P6NA 2X4DA 2YZMA 5AUQA 2BE7A 4JCCA 3H6GA 1N0WA 4LBZA 4NYJR 1XNJA 1UKZA 5FTNA 2MMGA 2O8DB 1FFGA 1ZJ4A 3HDTA 3LOQA 4QHSA 3R9IA 5F2KA 1XMVA 4DA6A 4E5YA 5KPDA 1UQRA 4WASA 3LGAA 1GU0A 4DNPA 4UDYX 3F5SA 4EA6A 2QTFA 2O8CB 3ROFA 3PQ5A 2Y0DA 5CB4F 2CHVA 3V3KA 3MUFA 1B6TA 1W8DA 3VVLA 3RIEA 4CM3A 4JJFA 5BO5A 4PC2A 2A30A 1VLMA 5JY1A 2YQ4A 3RVPA 2B98A 3PIIA 1YSCA 3I5XA 1VBNA 3I39X 1VBKA 3MWJA 5ALDA 4K5QA 5E0OA 4M53A 1YMUA 3UICA 2CXPA 3D5EA 4KTVE 2GEDA 2M2IA 4C4OA 1I36A 3GHYA 3TM4A 1RQGA 1OU0A 4NAUA 1L5SA 4M0LA 4JLNA 4NZPA 1WKCA 1N2BA 2Q2NA 1T5OA 3CU5A 4Q6BA 4BASA 1XALA 2PV0A 3GNLA 2FSHA 4GPZA 5K3EA 3H1PA 2Y1GA 2JLZA 1SXJA 2V5VA 3GJQA 3Q3GE 1GYRA 5BSUA 2WAOA 3WNVA 3AR7A 3U6KA 4YQFA 4MULA 3GJRA 4M76B 3UHOA 4AY2A 3O4IA 4RVCA 3Q6NA 3DPUA 1KAOA 2HZ7A 4BV3A 4QGSA 3RM3A 3A31A 3S1SA 3SZLA 1K9SA 2PR7A 4KFSA 4Z9AA 1FFDA 3D2CA 3BIWA 4QECA 4I4NA 4EPWA 5L53A 3LKZA 1JDSA 5TR9A 3IEUA 2VTBB 3UAXA 2BYTA 4C9BA 3WP0A 5LUBA 4DCSA 1S3IA 1OW3B 4FGUA 3UHJA 5A4IS 2XMBA 2HMUA 2VDMB 4OBBA 4UEKA 1IY9A 2GK6A 3KSUA 1KI9A 4LHWA 3QSYA 2IXDA 1J00A 2HFJA 5H1YA 3TGLA 2GWRA 3EQ8A 1YQGA 3N7UA 4YXFA 4LJRA 2WP8J 4AX4A 1E5DA 2F3SA 4UNIA 4DCMA 1YRQA 1ZM4A 2FF5A 4HDOB 2OL4A 4NABA 4UTXA 4RENA 2QQ5A 4BBAA 1JMKC 2O2IA 3E05A 2QZPA 4O8CA 2X4GA 2BSQA 3EWSA 1I51A 4EO7A 1ZUD1 1WW2A 4ZO6A 3H99A 5T4HA 1S3GA 3ODGA 2I55A 3E7FA 3AI1A 3TI9A 1E94E 1OIXA 3AJAA 4UBIA 3TLZA 1MUUA 2L19A 2BEUA 3HM2A 3I5UA 3GQVA 5SV2A 3K0SA 1N7HA 3BB3A 4LC0A 5KJCA 1A50B 3I2FA 4IRXA 3UG6A 2VPIA 1H8ED 3GVPA 5ABPA 4DDTA 2N3ZA 1ZZEA 4Z0HO 1NX6A 2JBAB 3PGLA 1H9AA 1ST3A 3JWIA 2B8WA 4YJ2A 4RZHA 2CMHA 2XNKA 1UP7A 2SCUA 3NOVA 4KR0A 4US1R 2BBTA 2H4YA 3C8MA 4ITRC 4BVLA 1QV7A 2ZAOA 3EAGA 1U1EA 4HX5A 2R1VA 3B3AA 1C14A 4TSRA 3RYIA 4DLBA 3OX3A 2CLDX 4UUOA 2OE2A 2QD4A 4EJSB 1AM4D 1PGJA 2CFTA 2E4VA 2JFPA 1JXMA 2X4LA 3GELA 4FONA 3SLKA 4QDTA 3ZQUA 4BMOB 1TZCA 1A88A 4FDVA 1W93A 3KXLA 3II6X 1SC1A 3TLBA 1NXVA 4W4TA 3PHIA 2I1WA 2PZLA 4QBHA 5JDIC 2LCQA 1DAMA 2CXQA 1YMVA 4IV0A 5D7BA 5KNBD 3H75A 5AO9A 3G1TA 1LBSA 1Y7TA 2DECA 2O2SA 4QOFA 4X8HA 4PAOA 5HX7A 2AOTB 4IRUB 1GNSA 1Z5WA 1FBNA 3C45A 5L3SA 2BEVA 5FPYA 2DT5A 4DV3B 3I6IA 3RYHB 3LX4A 1F2TB 2CF6A 4ZOBA 5LCXA 4P7KA 3WYDA 1BH2A 4HWOA 2QE6A 3E9EA 3RIHA 4FMBB 3K0BA 4PC3A 1L7NA 1TJPB 1L5KA 4CG0A 1IN4A 1IJEA 1WKBA 5ALPA 3L40A 3K9CA 1X1RA 1T4GA 1GG2A 2WD7A 4Q18A 2XOXA 2R44A 1RXUA 4TQ9A 5A6SB 4OAQA 4X3PA 2RBKA 5CFRA 1J56A 1TCUA 3GLTA 3CLUC 2CVOA 3GGDA 1JI3A 3FMGA 3WK9A 4NATA 4DA0A 2HIHA 2QYSA 2WP0A 2WJWA 5BQFA 1ENYA 3HU5A 1EG2A 4ZQEA 4GHWA 1XZAA 4G0QA 4Y2GA 1ABEA 2WU3A 2FK8A 1CERA 2KHZA 2P9ZA 5DZSA 3UGTA 3VBEA 1ZJWA 1KL7A 1J8VA 1YS7A 1NOJA 1YFKA 1RM4A 1EA5A 3ZW8A 3IE0A 1O5TA 2CL6X 2OXTA 3ILHA 4ZXFA 3SYKA 1UBRS 1C3LA 2Q0XA 1PQWA 4CLXA 4DKXA 4ENTA 1SA0B 2I3GA 2DPGA 1BHJA 1X7XB 3AIOA 1ZD1A 1YMQA 2FE1A 3KEQA 4NZOA 1CJKC 1J0BA 2Q5IA 2XD4A 4Q02A 2PKQO 2EXXA 3L4KA 5CXSA 2NU9A 3TD2A 3UWDA 1YCDA 2FN9A 5IM4A 2IPNA 4KL8S 3WLMA 3ANNA 5IVPA 4MKHA 1F1JA 4BNVA 3UKOA 4A2WA 3WBKA 4IG4A 1F8FA 4IMPA 5G1PA 4UW9A 4MR9B 2H0QA 2PO7A 1MXHA 1WLYA 3PQ8A 3K2EA 2BM1A 1EK6A 1U2GA 1GT6A 4QPNA 4BXOA 4PSDA 4QAQA 4D2IA 1RFGE 1JAIA 2AMYA 1MOPA 2HF9A 4OREX 1FTWA 4JQCA 4MUNA 4OK5A 1CNMA 4ZQCB 2V6JA 3RSGA 3AHHA 3CVXA 3LA8A 4NEQA 1F2UB 1IEWA 4B0OA 5JNRA 2GB4A 3JW8A 5FHRA 3TNLA 3ON5A 5ECYA 5JALA 1KZYC 2DBQA 4Q9DA 3WWEA 3DMYA 3QSGA 4J3JA 5T4FA 3OWXA 5CVJA 3G2QA 5C9ZA 5H9VA 2CFIA 1GILA 2IUFA 4L4SA 2H4JA 4RVGA 1TZ2A 3COYA 4WAUA 1YR9A 4N3NA 1PSDA 3EVDA 3SBEA 3PPVA 1PI3A 3V34A 3HPQA 3AIKA 2J9YB 1EJ6A 5EI5A 1NAHA 3RU2A 3EZ2A 1U7ZA 3O75A 1DAIA 4QU9A 1N8NA 1H2HA 3BGDA 4HO1X 4K9QA 2CK3D 3AG6A 4O08A 3AHIA 1JECA 3LS2A 3LMKA 5FWYA 1E4YA 5AJHA 3O4GA 4TUYA 2QE7A 3LGSA 3PEWA 2Z8YA 3BK1A 3MCWA 3Q6MA 2P1DA 4DGQA 3D1LA 4RD0A 3PDCA 1MW9X 2DCMA 2H3EA 4R7ZA 3KUUA 1SCIA 4RLQA 1FX0B 4BB0A 3BFKA 4LE2A 4Q3EA 1A77A 5GGXA 4DV5B 1QTQA 1ZMXA 4YRLA 4E51A 1PUJA 3OLXA 5KC9A 3N0TA 3FVRA 3MD9A 5AKHA 4DA8A 3QNMA 4NOLA 2EKZA 3C6XA 1G42A 1OI2A 1WMEA 3GGSA 3IP8A 4LG1A 2PL1A 2ZQZA 3A9CA 3FLBA 3IYLW 2FJ0A 4AKHA 1PSWA 4H4CA 1KMHA 1F0PA 3UJNA 2VP2A 3OCWA 4L4YA 4RDHA 3R7NA 1S2NA 4V1CI 2P27A 4DB2A 1HDZA 3AEKB 5CDTA 2AI3A 2BHTA 1NBWB 3X0DA 3UV3A 4EPXA 5GIPE 2X0EA 1XRPA 3BH0A 1UMCB 3I8OA 5EP1A 1A95A 1CZUA 1Z0JA 1RD4A 1XZQA 3EGVA 3OD1A 1T3GA 5FPTA 1PYDA 1T1EA 4WKBA 5DXJA 1QE5A 4C5BA 5E7QA 2LGJA 4NLLA 1YS4A 4NONA 2CVFA 5E2AA 2UYYA 1XCPA 2XDQB 4CM9D 1KMNA 4W9NC 2O19A 4GR5A 1ZN9A 5BW6B 4JNCA 2WSIA 2FWRA 3A6LA 3VVCA 3B13B 5JBNA 3HMKA 4IXNA 4IHJB 1UZUA 2C8KA 1XIVA 4LZWA 3RYFA 1X13A 2HBRA 3KD3A 5D84A 3R9WA 3HXOA 1P0QA 3AR9A 1DV1A 1LQ2A 2GBLC 2BM8A 1ZEMA 3FFTA 2AF4C 2ERCA 1Y9JA 4UASA 5TB5A 1HYQA 4RKQA 2JLWA 2KS6A 4NAHA 1CFZA 5IJ9B 2BZ0A 3AV0B 3FYUA 1JILA 4EYSA 5BRJA 1RTTA 1ZM9A 2JA1A 4LYDA 4MI1A 4R9RA 3DYIA 3DO8A 1KR5A 3W6NA 1V25A 4BMYA 2XUDA 2NO9A 1JDPA 3N2NA 1IZ0A 5MFPA 3AHFA 1NUTA 4RXTA 3UXHA 4IOLA 1ZH6A 2IUYA 4AY5A 4XM0A 4ZV9A 2VAMA 2ZB4A 4PFJA 4ZMSA 3TOXA 3ZE0B 5E1BA 1RLMA 2LDXA 2DM6A 4GYWA 2I4MA 3WDMA 3PE4A 1CUHA 3PNBA 5DHFA 3FSRA 5J2UF 1GV1A 1OZFA 2BFDB 2AFVA 1XMXA 2F6RA 2WMOB 1E6LA 1R88A 2FZCA 2AF3C 1IAVA 2HD4A 3N59A 3PICA 3RSSA 5B5SA 4II2A 3RWBA 1I9GA 1KBQA 2EFYA 1DC7A 3QJYA 3RRFA 1C2YA 4MS1A