1BXZA

Crystal structure of a thermophilic alcohol dehydrogenase substrate complex from thermoanaerobacter brockii
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
352
structure length
352
Chain Sequence
MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAELADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLVTHVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a thermophilic alcohol dehydrogenase substrate complex suggests determinants of substrate specificity and thermostability.
pubmed doi rcsb
source organism Thermoanaerobacter brockii
molecule tags Oxidoreductase
molecule keywords NADP-DEPENDENT ALCOHOL DEHYDROGENASE
total genus 104
structure length 352
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 1998-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1bxzA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1bxzA01
4MVJE 1QG6A 3E9MA 1E5QA 2OGUA 1PJ2A 4BS9A 1B26A 4B4OA 4BNZA 4CLXA 3WYBA 1LJ8A 4UVDA 4J2HA 4YAKA 1JU9A 1F17A 3MZ0A 1LC0A 4OAQA 2PY6A 3C8MA 2AW5A 1T24A 5F1OA 3RBVA 3ZCXA 2PZKA 1LSUA 4RLHA 3VVCA 3WWZA 1WPQA 3KTDA 2PFGA 5TSDA 4OH1A 4BNTA 4BMVA 5JC1A 1IUKA 4K28A 4YDRA 3UVEA 3ZNOA 1LEHA 1NNUA 4D42A 5TIIA 2NM0A 3DONA 4GX1A 3RU7A 3QE3A 4RJTA 4MKZA 3H3FA 5IJZA 5COQA 1XCBA 3T4XA 3DXFA 1O5IA 3A1NA 3D5QA 4IGEA 3CE6A 3DWFA 3I5MA 1QYDA 4NIMA 1W8DA 2XOXA 4YJGA 3GMSA 4QX6A 2NQ8A 1TA4A 4F3YA 1NPYA 1KOLA 5I7FA 3N74A 4KWIA 1KVUA 4UEKA 1ZK0A 2J5RA 4ZQGA 5EPOA 4DUPA 1DO8A 3ZWBA 3JD4A 1ADFA 1O95A 3BMQA 1EK5A 4YJFA 1YQXA 3OFSA 1B14A 3QWBA 2Y0DA 1PJ3A 3V5NA 1CIVA 1V8BA 2A92A 4CMEC 2ZYAA 5U4QA 2X6TA 2D4AA 4OOFA 1NPTO 1ZZEA 1NWCA 4D45A 1F06A 3K92A 2O3JA 3D4NA 3LZ6A 4GWGA 2C82A 2EEZA 3GA0A 5K0ZA 4JBHA 2ZB3A 2SCUA 3GOHA 3AM4A 1PJTA 3HDHA 5G4KB 4LCJA 4XR4A 1LLUA 5JAQA 2Y1FA 5DCYA 4A5OA 4BKUA 4BUCA 1HXHA 1DJQA 1QSGA 5CDSA 1X1TA 4J1QA 4ZRNA 3E5MA 3VZQA 4BO3A 5GY7A 2G17A 3LT0A 1ZEMA 1IE3A 4Q3NA 1BTOA 4QQRA 5DT9A 5A9RA 4EYEA 1KVRA 4IY1A 3ZDFA 1IZ0A 3ST7A 1GZ4A 2FZWA 4WE3A 4XIYA 4CV1A 3PIDA 3QY9A 4ROSA 3FI9A 5ER6A 5ER9A 3ETGA 2I9PA 1XGKA 4DWVA 3R3JA 3G1UA 3O26A 4KWHA 5LDHA 5TGDA 1YDWA 3B1JA 4IMPA 3DZKA 4Y6RA 3ZHXA 1Q0HA 4Q3EA 1ZNQO 2UUPA 3ZWCA 4FFLA 4PCVA 2ILTA 5BT9A 2GYYA 1VL6A 2DTDA 4YQYA 1HL3A 3VHRA 3PJGA 2VT3A 3PPIA 3CH6A 2EGGA 4MVJI 3QV1A 2HQ1A 2JHFA 4RF2A 1N7GA 1ZMOA 4GQAA 4D46A 1MFPA 3EW7A 3GH3A 3GNQA 1E3WA 1ZBQA 1Y8RB 4MVJH 5EN4A 1QKIA 3LC2O 3BHMA 5K9ZA 5ENVA 3WDSA 1C0PA 2NLOA 3HADA 4J7CA 1H9AA 4RDIA 2AE1A 5A9SB 5F3RA 3Q1LA 3G0OA 1ORRA 5I9MA 1NP3A 5JDCA 4RVGA 1F0YA 4CLOA 5CG2A 4NPCA 4XCVA 1JAXA 3HDQA 5K6AC 3FPLA 4URFA 4BKPA 2HUNA 4DGSA 3WFJA 1E3JA 3W8EA 1XHLA 3LF2A 1KEWA 1X15A 3K30A 2CD9A 1MX3A 1VE9A 2AXQA 3HNPA 3N7UA 5H83A 2CY0A 1NVMB 1SNYA 2AA3A 3STHA 1XU9A 3V1YA 3VAZA 4PVCA 4I1IA 5T57A 2Q4BA 1SBYA 4LSMA 5L9AA 1NPDA 1C0IA 1Q1NA 3DHNA 3JD2A 4FFMA 4Z9FA 3JQEA 2GDZA 4BB6A 4PG4A 4NFYA 1ONNA 1KY5A 1MXHA 5FFFA 3WS7A 3ANMA 1DRUA 5T67A 4B7UA 1EE9A 2FR8A 2HO5A 3AUUA 5EIOA 3E5RA 4J91A 1XSEA 4RL6A 2C59A 3JYNA 3ZV5A 1NHWA 1YO6A 2DFDA 4QFDA 1ZMTA 4EITA 3PHLA 4HFJA 4BV8A 3G79A 1MG5A 2YV1A 4TRRA 2VHZA 4J1TA 3VDRA 3WX0A 1HE4A 2HRBA 4HFNA 2EKQA 4ZQFA 3PDUA 4DVJA 1FDWA 4E2YA 5TRTA 3JYLA 1H6CA 2WYUA 3IS3A 3C3XA 3MTJA 2W2LA 2J5QA 4ILKA 4CL8A 3FNGA 3JQ6A 2FP4A 4JNKA 1JWBB 2Q99A 1TXGA 2RH4A 1PR9A 1S7CA 4UVIA 4BQPA 1LSSA 1UDBA 3VPXA 1ZIDA 1PJSA 1HE3A 2D5AA 4K9DA 3H5AA 2Y99A 4GGOA 1GZ6A 3DZHA 1EEHA 3FF4A 3DFZA 5G4LA 3K5PA 1I2BA 4OKNA 4C4OA 4DPLA 3TQHA 2X9NA 1T25A 2VT2A 1N1EA 4YT5A 4WOKA 6ADHA 2JD0A 4TKLA 2B4RO 5TJHA 1U3UA 3TZQA 1CJCA 3WGYA 3UAGA 3ON5A 3JQ9C 2Q3EA 3UKOA 3ZU3A 1ZUD1 4AJOA 5TS3A 4L75A 3TPCA 4CMBA 2CVQA 1LTHR 2Q46A 3PGJA 4IM7A 3HUDA 3NEPX 4RVHA 5CP8A 1I2CA 3AUSA 4XD2A 3RKRA 4E0BA 2ZQZA 3Q11A 2NU7A 1I2ZA 3HQ4O 1A4IA 2VOJA 2Q1UA 4MVJA 3S55A 4WUVA 3OEYA 4EJMA 2FPIA 5IFLA 2H5LA 2EKPA 2IEBA 2Q45A 2WE7A 1P0FA 3AJRA 4KZPA 1ZO8A 3HG7A 4DREA 3AM5A 1LX6A 5TX7A 1RYDA 4PZCA 4E3ZA 3H5NA 4ALKA 3C7CB 4BIIA 5HS6A 3C1TA 3VVBA 2JKVA 4YEDA 1JVBA 1NR1A 3A9WA 3PK0A 3U49A 1U4SA 3KETA 4WLFA 1ZJYA 3HWRA 1UXIA 4FD3A 4BNXA 1ARZA 1LBEA 3K2EA 3CINA 4WNCA 1HSOA 4H16A 3JQ7A 3PWSA 1SCUA 3BIOA 4YRBA 1CETA 2J3IA 4WASA 1W6UA 3CXRA 3D7LA 3NYWA 3GGOA 5JNLA 1U5CA 4XYBA 4FGSA 1ENZA 1E3IA 5CAEA 1MV8A 4GPD1 1ISGA 3KV3O 1EVYA 4II2A 3F4BA 3VKVA 2Y1DA 5HA5A 4CLRB 3UCEA 4P22A 5BSGA 4UVHA 3DMTC 1YJ8A 1NASA 3IUPA 4IGFA 1XQ6A 3D3WA 3JQFC 3KSUA 1UH5A 4AJIA 4ZA2A 3S1LA 4BKRA 3HN2A 2AG5A 2YV2A 1UZNA 3TZ6A 4FFRA 2FPGA 1EBUA 3ZNPA 1DFGA 4D44A 2IRWA 5EMHA 4P4GA 1R66A 4NQZA 5IN4A 5ES3A 1XG5A 3NGLA 1M6HA 3ZH2A 2NVUA 3E1KA 1IY8A 4TRNA 4RQUA 1K6JA 5CPFA 4YT4A 4DLAA 4XDZA 1T2EA 4WECA 3ZW8A 1I10A 1U5AA 3OJ0A 4I9NA 3SEFA 4BNUA 1IPFA 4YT8A 1LRLA 5K6AA 5A4DA 5DDIP 3F1LA 3I52A 1DIGA 2AEJA 5LC1A 4B4UA 1EK6A 1K0UA 3AI3A 3NAQA 4WGGA 3RC7A 1EVJA 5FWNA 5HS4A 3AY7A 5GZ1A 2GUGA 3QVOA 2EWMA 2X5JO 1R15A 4B7XA 1IL0A 3M2TA 3AOEA 1LA2A 4R1NA 1U3VA 3RU9A 3D4PA 1UXKA 1LU9A 4MP8A 3F3SA 4E2ZA 4I08A 1DJNA 3L07A 4Q39A 3SLGA 1EUZA 1H93A 1AHHA 3KVOA 1JKFA 4ND1A 5I7VA 5AXAA 4DMLA 5DP2A 2O4UX 1E7SA 2WYWA 1Y6JA 4L9RA 1JTVA 2NV6A 4JN6B 4P38A 1J5PA 3S2IA 1O94A 1R4MA 4HBGA 4NBRA 5IZCA 2DKNA 3KYDA 3QW2A 1JKJA 4XGNA 2Y68A 1VL0A 4A7PA 1IZ9A 1PGPA 5KKAA 1B16A 1DBVO 1MG0A 2QX7A 3E8XA 3GLQA 1BVUA 4J43A 3WMXA 3NT5A 3PHGA 4PRLA 1NQTA 1PJLA 3AI2A 3HHPA 2CVOA 3GVHA 1ULSA 4BO8A 3IUSA 4PLGA 1VRWA 1I24A 3PHJA 4OM8A 4Z3DA 1Y1PA 4ZN6A 4CR6A 5EERA 3DAFA 3JQAB 1HKUA 1P77A 1MUUA 4XKJA 1H2HA 3I9OA 1MLDA 2I76A 2JAHA 4GVXA 1ADCA 3H3JA 3B1FA 3TL3A 5JXWA 2YV3A 4ND5A 2B69A 3QHAA 4YT2A 4XR9A 5BSEA 1JN0A 4KTTE 1T2AA 3PP8A 5A5EA 5F1PA 1R4MB 2W90A 4J1NA 4INAA 3PLNA 4G5HA 5F5NA 5G2OA 1TI7A 4BNHA 2UAGA 4KQWA 3ENNA 4AFNA 4BNMA 3JYPA 3WG9A 4YTEA 4DBVO 5CEJA 5HWSA 1HYGA 1ML3A 3ZU5A 3GEGA 1WZIA 1XDWA 1IULA 3K8ZA 1XA0A 3KZVA 3NX4A 4NK5A 1PZEA 1DC3A 2POQX 3ORFA 4HKTA 1WDLA 1LUAA 3U4CA 3WNQA 4LRSB 2GN9A 1F14A 2BKAA 3AUTA 3H7AA 4D3FA 5JAMA 2ZJ0A 4RPGA 1IHXA 2BD0A 2NU6A 4NFSA 1QXSA 2DUUA 4Q3DA 1E3WB 3DC2A 4ALMA 2P9GA 4AJ1A 3QVWA 3WFIA 1XKQA 4J9VA 4N5LA 4CMCA 2OORA 5TJ9A 4BGIA 3QVXA 4CLEA 2OL4A 2BLLA 3ENKA 1TT5B 1KVQA 1X7DA 2NNLD 2YJZA 3CUKA 3FHLA 4JCOA 4WCFB 2ZATA 5AXCA 2HU2A 3VH1A 3ZW9A 3NTQA 1IHYA 3DBVO 3I6QA 4E31A 4Y98A 1BG6A 3KSDO 3M1LA 3DR3A 4NU6A 3RC9A 4J7XA 4BNVA 2Y1GA 3C1OA 1PTJA 1HLDA 2WD8A 4I9HA 1GTMA 4GVLA 1P0CA 2O3UA 4KUGA 3K73O 3O03A 1XYGA 3H2ZA 5FI3A 1C0KA 1Q0QA 4BO5A 3H6KA 1TLTA 1CRWG 2OZPA 3O4RA 4PLCA 3FTNA 3V2UA 1UAYA 1C14A 4TQGA 2FY8A 4K1LA 4TMFA 4GGPA 2OFPA 1AXEA 4MIEA 3ZHYA 4J0EA 1GV0A 3JQ8A 4S3MA 3SJ7A 3NJ4A 2HK9A 3QA9A 4NU5A 1N1GA 2C7VA 4AJKA 5A5FA 2Q1TA 1TB4A 2EJVA 2FPPA 5IDWA 5T8KA 2I6TA 1NR7A 3BTSA 2LDBA 1YDEA 5GZ6A 4B3JA 3WTBA 3VOSA 2R6JA 1HTBA 4CM6A 5JYDA 1N7HA 3DHEA 1GY8A 4OJNA 5I7EA 2QYTA 2FHSA 5T8KC 4E2WA 4NH4A 3OM9A 4XEHA 1YGYA 4BNKA 1P31A 3UICA 1WAMA 2EG9A 3OH8A 2RCYA 4FOSA 1CERA 3BMNA 3NRCA 1HT0A 1KETA 5DCWA 5JCXA 1H9BA 5FI5A 4L4XA 2VUTA 1RPNA 2X0RA 1P1KA 1LSJA 2F00A 3U3XA 1VM6A 5L4NA 1DPGA 1V3VA 1KEPA 1XR3A 1P44A 4J4TA 4DLLA 2G82A 1DLIA 1ZK3A 1GQYA 2NTVA 4I5EA 1EDZA 2BH9A 4G65A 4RDHA 5EJ2A 2CDCA 3FNHA 1ONOA 4WLNA 2UVDA 4YJGB 2GD1O 3RUDA 1JA9A 1V3UA 1CQJA 1UZLA 2OHXA 4BO4A 1SO8A 4FJ0A 1B8PA 2J3HA 4DTIA 1E3SA 3ROKA 1JKIA 1C1DB 2JAPA 5EINA 4J49A 4OHUA 4PG5A 1H6AA 2AQKA 2VWPA 2X1HA 1MC5A 3ANNA 1R0SA 4L4SA 2YDYA 2A9FA 1LLDA 2EW2A 2E4AA 1OC2A 3WWYA 1YL6A 1MB4A 4FSHA 3RSHA 5A02A 2A35A 2J3KA 3RUIA 3WGIA 4M86A 3TFQA 3AFMA 3IL2A 4M8SA 1SC6A 3R0IA 3D4OA 3PJDA 2WYVA 5CDTA 2DBVO 4CQMD 4PLTA 3GR6A 1OOEA 1YB1A 3ASVA 4QEDA 3PXXA 3DBLA 4FQ8A 3ULKA 5T5QA 4I9UA 4TRMA 3WR5A 1KVSA 3L6OO 1N2SA 2PD6A 2QRLA 4XQGA 1LQTA 4M54A 1D8AA 3E9QA 1DRWA 4UEJA 2VYNA 1VLLA 2WMDA 3P19A 4W9NC 1SEPA 3EZYA 3VPHA 5JDIC 1BXZA 1DC4A 4YJDA 1J49A 6LDHA 1T1SA 1ZSVA 3E6AA 4CLHA 1ZK1A 4BMNA 2VWQA 4NHEA 1N8KA 1HWYA 4XYMA 1UR5A 3VZRA 2DT5A 4CMEA 4MPDA 5G0VA 3WYCA 3H9GA 4J1SA 4A73A 3VZSA 1R16A 1NFRA 2GSDA 4CMAA 5GZ3A 4R1TA 4YPOA 4YA6A 1PEDA 3U62A 4NI5A 3I1JA 4WJZA 1M2WA 3LQFA 4RF3A 5JMPA 2FN7A 1EUCA 5JAZA 3RBZA 3R6DA 4MKXA 1I30A 3H9QA 3AWDA 2FSVA 1I3MA 3V8BA 2IYPA 5JW6A 4CV2A 3PQFA 4QECA 4FC6A 3ZNQA 1FK8A 1DAOA 2RAFA 1MA0A 1I33A 2OO5A 1BHSA 4UVGA 4DXHA 4K6FA 1HEUA 1K5HA 3B20A 1ZSYA 2VWGA 4HFMA 3INTA 3RUHA 1YBVA 4HX5A 3PIIA 5ILGA 3H5RA 3C1AA 1WZEA 4RQTA 1PGQA 3IQDB 4MVJP 1W73A 4WCFC 4JP3A 1DAPA 1U7HA 2QIOA 3FSRA 2V6FA 5AOVA 3ZWAA 4BKQA 2DPGA 4E21A 1B2LA 4XB2A 1G0OA 2FR1A 2BI7A 2ET6A 4NJOA 1BGVA 1Z6ZA 1RYEA 1MP0A 3TZCA 1VJ1A 4K6CA 4NBVA 4O6VA 3MTGA 1FDVA 1H0KA 2NU9A 3I9MA 3PTZA 4RPKA 2IODA 3DBLB 4Y6SA 4XGKA 3JQBA 4GX2A 1E3EA 3VC7A 1HZZA 3ADOA 1UXHA 3OSUA 3ZN2A 5ILOA 4UAGA 3IDSA 5TNXA 2H9IA 2Y1OA 5JE8A 3ROMA 4N5NA 4J6FA 2X23A 2NTJA 4I5GA 2Z95A 3AU9A 1QV7A 4EJ0A 5TF4A 1PS0A 3WBFA 5TLSA 2PH3A 1K3TA 1NM5A 1ZH8A 2UUOA 3WGZA 4E30A 1ISFA 1PSDA 3GZNA 1TVEA 2O4CA 1V3TA 4GMGA 7MDHA 3LSYA 2WM3A 4MVJD 3LT2A 3Q9NA 4CQMA 3WIEA 2WD7B 3K96A 2D59A 4DQUA 3JQ9A 4W7IA 4Q3CA 1KIFA 1FDUA 4HNHA 3I9LA 5BSHA 3EVTA 3PGXA 4KDEA 4QSMA 2AQ8A 4C7JA 2PKQO 2QRJA 2BMAA 2PA3A 3UGKA 1VI2A 2YDXA 2ZQYA 3OETA 3DB2A 2GERA 3LLSA 1WMBA 4ZGWA 2PH5A 5EQDA 2UYYA 3WGQA 3HDYA 5ITVA 4CM4A 1NYTA 1LRJA 3OIDA 3TDKA 1PZFA 3MWDB 4J7UA 4KTVE 3HJAA 4DQVA 1NAIA 2EP7A 4PLWA 4BO9A 3IMFA 1EBFA 1Z73A 3ONFA 2P4HX 3G1TA 4E5NA 2I99A 3NDJA 4DLBA 2E48A 2JJYA 2XXBA 3RFVA 4RLSA 1PU2A 2ZYDA 4BNGA 2VRCA 2X0JA 3JD0A 1DXYA 5IZCC 3GHYA 3E82A 4WEQA 4A27A 2G1UA 1GZ3A 2OXIA 3WGGA 3I4CA 2FRDA 3DBHA 4NMHA 3RAJA 4NBTA 3GDOA 3RCBA 1M76A 1NQAO 2WSBA 4R9SA 4XQCA 3SXPA 2V6GA 4WLEA 4QUKA 1KY4A 3VH2A 2CZCA 4I8XA 5CHEA 3AOGA 4PVDA 5BNFA 3WYEA 5DULA 5JYEA 4Z6KA 4JGBA 4CMGA 3RBXA 3CTMA 4HP8A 2GR9A 2EF1A 1P74A 4NG5A 4ESOA 1UXJA 4DIBA 5COAA 1V6AA 4J2OA 3DFUA 1W4ZA 3HDJA 4BNYA 3W4IA 1EFLA 3OA0A 3WGOA 3LVFO 4GKBA 2GZ3A 4R68A 2ZCUA 1I3LA 3IIEA 4IINA 1OAAA 5L7YA 2D8AA 3R3SA 2QZ9A 1I01A 1A7AA 1LQUA 3PRJA 1DHTA 2DUWA 4TZTA 4R54A 1ADGA 4EDFA 1KYQA 1UUFA 2VNSA 3A06A 1Q7BA 5I8WA 4ZJUA 4AJEA 1R0LA 1T2DA 3ICCA 4Q9NA 4ZHSA 3GFGA 1GL3A 2HLPA 4R3NA 2VZ8A 2WD7A 1ZEJA 4XRGA 1E6WA 3OJLA 2PV7A 1PQPA 5B4TA 1EE2A 4FOOA 2Z5LA 2Q1WA 3IJPA 2GO1A 1AUPA 1EVZA 4J16A 3I6IA 1GD1O 2BELA 1IPEA 5CDYA 1XQ1A 4E32A 3RUAA 5ICMA 1GCOA 2ZTLA 3I3OA 5CG1A 1T2CA 1I8TA 4JLWA 5EL0A 3HFSA 3ZHZA 4YAGA 4FS3A 1CDOA 3LT1A 5DCUA 4N54A 3W4JA 5A06A 1T1RA 4S1VA 3VH3A 3SVTA 2EJWA 4WNIA 3RFXA 1U7TA 4KUEA 4W99A 1WDMA 2PGJA 5L3ZA 4AJHA 4IDEA 1YBAA 3AY3A 1HDRA 3QLJA 2IXBA 1NXQA 2ZTUA 4I5DA 4AJJA 4LRTB 4UUOA 1RM0A 4FCCA 3S2FA 4CM9A 4D43A 1DRVA 1TT7A 2X9GA 3F6YA 5AXBA 3WB9A 3DZBA 1H2BA 3TOZA 1T4DA 4J4BA 4NBWA 3D1LA 2ZCVA 4N7RA 3KSZO 5DBIA 1E7QA 3RC1A 1SOWA 3DZFA 1FDTA 1LRKA 1UJMA 3DQPA 4IS2A 2WTBA 2ZJ1A 5DOZA 1VSVA 3RQSA 1ZW1A 2GNAA 3KYBA 1ISJA 4BO1A 1YONA 4O63O 4Q3BA 3INRA 2VYND 3UN1A 1NFFA 2O3TA 4H15A 3RJ9A 2X58A 1WDKA 2NVWA 1ZXLA 1D3AA 2YYYA 4M55A 2GPTA 3RI3A 4QO8A 5U1PA 3INGA 1DSSG 2QYSA 3TRIA 4OXNA 3AOEC 3PYXA 3UHAA 3HB5X 2ZB4A 4W9NA 5ICSA 1U4OA 2C2YA 5BSFA 3LT4A 3V2GA 5I7SA 1ISIA 4IBOA 4TVOA 1O9BA 1JW9B 1NVTA 5I8ZA 4IXTA 3NDIA 3KYDB 1A72A 1OI7A 3BTVA 5LCXA 4L0QA 1E6UA 2XF8A 1EMDA 1T26A 2YY7A 3G17A 3VZPA 9LDBA 2DFVA 5L7TA 2NADA 3PQEA 1YKFA 2QRKA 4PG6A 3QVSA 1C0LA 1BW9A 4J4HA 3GG2A 2H6EA 1ZXBA 4FFPA 4RVUA 5JCJA 4DQXA 5HM8A 4W4TA 1LDGA 1JDJA 2B5WA 4Z9YA 3C7AA 4LMPA 3SBOA 4CQMB 1UAGA 4BO6A 2LDXA 5T64A 5L7WA 4RCVA 1P33A 1X1EA 4FFNA 5TT0A 3UH1A 3RFTA 1U9JA 3JQCA 1PS9A 3PFFA 3CZRA 1E7RA 3U5TA 4DYVA 1HDXA 1Q0LA 2XXJA 3CEAA 3U4IA 1PGNA 3GY0A 1XELA 4P8RA 4B4WA 4TVBA 3PFWO 3GZ4A 4FJ2A 2VRBA 3JV7A 1R0KA 4R1UA 1WNTA 3N58A 2EW8A 4CM4B 1A9YA 1M6WA 5B4VA 1FMCA 1B0AA 3KYCA 4QTZA 1X0XA 2GN8A 4J0FA 4C7KA 5KJFA 1HE2A 2A4KA 4P4LA 4XZ3A 1HDGO 1Y5RA 4U6QA 3U9LA 4R5MA 1QORA 3DMYA 3KLMX 4HWKA 1E7MA 2R00A 3GGPA 5IDYA 5TQVA 4NDNE 5A05A 2X22A 2O3QA 1LSOA 3B6ZA 3MJCA 1U3WA 4UVEA 4LK3A 4E5KA 4GWKA 1PZGA 4A2CA 2VYVD 1WLYA 3B70A 1J6UA 3OMLA 2VUSA 1ZK4A 3BZUA 3IP1A 3MJVA 3ASUA 2HJSA 2RHCA 3PI7A 4GLOA 4PLHA 3S2GA 1IB6A 4HUJA 1LXCA 2GN4A 4NZ9A 3TN7A 4E6PA 3SX2A 1A27A 1YQDA 4BV9A 2NACA 2JD1A 1YQGA 1A4UA 3RUEA 4BNJA 3JQ7B 5IDXA 3L6EA 3FWZA 2HMVA 3DAGA 5I9NA 5G0SA 1LNQA 4LISA 3H65A 4FIZA 4A10A 3MOIA 1OFGA 1LDBA 5KJCA 2WDZA 3W6UA 1RJWA 1K6XA 1UP7A 3DOOA 4CPDA 2YZ7A 1GEGA 4BNLA 4PFJA 4TRJA 1I36A 2GCGA 4PG8A 4O59O 3BHJA 3K9QO 3DZJA 4MIOA 5BNTA 1RWBA 1K89A 1BDBA 5COBA 2CDAA 3QWHA 2B4TO 1XU7A 3E18A 1RKXA 2B37A 2QQ5A 4WKGA 1Y9AA 3VKUA 2WE8A 4Z0PA 1P1IA 3WJAA 3W6ZA 5AYVA 2PD4A 2X9VA 2ZB7A 3F1KA 2VZ9A 1U28A 1YB5A 2OP0A 2NSDA 3OECA 4XX0A 4BO7A 3TOXA 4ZVVA 1EVIA 1M67A 3U09A 3PZBA 5L4SA 3A14A 5A3JA 2VUUA 1UDCA 2DQ4A 3FNEA 2YQ4A 5JO0A 1ZCJA 2WWRA 2I66A 4DRYA 5A04A 5B12A 5AVOA 2BHLA 1BWSA 1WXDA 1BMDA 2QG4A 1GU7A 1VKNA 1ZK2A 5G4KA 1E1NA 3GC6A 4YAIA 3GDGA 2CNBA 4BQRA 3QWAA 3V2HA 1Y8QA 2C5EA 5KJEA 1GYPA 2XAAA 4D79A 2D2IA 4IDFA 2PGDA 4U8GA 3H9JA 2HK8A 1HDOA 3JTMA 1E0DA 1SB8A 3MCVA 4GX0A 4CL3A 1GQQA 4NK4A 4YRDA 1PQUA 4FC7A 1Y7TA 2D1YA 4IPTA 1I3KA 2VCYA 1NTOA 3PYLA 3RIHA 1H6BA 3CZMA 2AG8A 1EZ4A 1XLTA 4LCEA 4U6SA 2IE0A 4CODB 4WCDA 4YVFA 3JCZA 4AICA 5C7IO 3LC7O 4DMMA 2Z1NA 1EDOA 1U3TA 2PZLA 4RZIA 5CFZA 1S6YA 3WQRA 2PKRA 1FDSA 3EAGA 4CLOB 5AQ1A 3O8QB 4DPMA 1DHRA 2C2XA 3ITKA 5A03A 1DIAA 1SB9A 2JCXA 4Z0HO 2VTEA 4E13A 3ZV3A 4DL9A 4YXFA 1DB3A 5DN9A 4XDYA 1YJQA 4CMIA 2X5OA 2PTGA 1P1HA 2FSSA 2VHXA 1BRMA 1L7DA 3RC2A 1GADO 3WOHA 2CUKA 3G3EA 1SOVA 5C5IA 1U1IA 4KQXA 3WIDA 4IZIA 4RO0A 4L74A 1U2GA 2CF5A 4OMUA 4UUNA 4LSWA 2BFAA 4L8VA 3FPCA 1KEUA 1QP8A 2FZEA 2OBNA 4EEZA 2DU8A 4E33A 3ONEA 5T6BA 4RF4A 1YRLA 5DOVA 2VRCD 4RPHA 2I67A 5KIAA 2VHVA 3ZU2A 1J4AA 4EI2A 3SC6A 4NJMB 4AVYA 4ZICA 3K31A 3A4VA 3U4HA 2ZTMA 4RV9A 2Q2WA 2UDPA 4CUKA 2HCTA 3A28A 2VNAA 3HB4X 1X14A 1HZJA 2JFGA 3NTOA 4BGUA 3UOGA 1DIRA 3M2PA 2I3AA 2CF6A 3BXXA 3JQ8B 5AXDA 1TEHA 4F46A 1V9LA 2RBEA 3RD5A 2PGLA 3UXYA 3H9UA 3VPGA 2C07A 2W2KA 4BMSA 5IF3A 4AJ2A 3PQDA 4RVSA 4KUHA 2YFHA 2EKLA 1ULUA 2IYOA 3JSAA 3F47A 5H81A 1N9GB 5IZ4A 3DEYX 1ONPA 1QMGA 1GPDG 1H5QA 3DBRB 1HRDA 4OXKA 4Y67A 5EESA 2YHIB 1LC3A 1PX0A 5JFOA 3E9NA 2Q1SA 3R1IA 4TSKA 2BI8A 2HMUA 3U0BA 4IUYA 4CM9D 2DBRA 4ZRMA 1UZMA 3PLRA 4PLYA 5EQFA 4ITUA 3KRTA 1ID1A 1W0CA 4ND4A 3OQBA 2BGKA 2OUIA 2P68A 3JYOA 3SLKA 1Y9EA 1C1XB 2NVBA 4G2NA 4XJSA 2O7SA 1D1SA 2ZTVA 2FMUA 5JSFA 4R01A 1I5RA 2O23A 4J90A 1MFZA 4NNJA 3W8DA 3E48A 3OJOA 4GLLA 4CM8B 1F8FA 4AJPA 5A3VA 5H82A 1MXFA 2YHUA 3C85A 3IC5A 1LDEA 2E6UX 4JROA 4CM3A 4FN4A 1JAYA 1E1LA 1OC4A 3MJEA 1P1FA 3EVNA 3QJ5A 4JXKA 2ZKLA 2ZYGA 3F9IA 5JPIA 2Y0CA 1QYWA 4X54A 2NVUB 3TFOA 5CEEA 4OO3A 3GVXA 2Y0EA 1F12A 3AI1A 3F5SA 3OBBA 3WGTA 2PWZA 2ZK7A 3EZLA 1EQ2A 4OXYA 3FR7A 3VTFA 2TMDA 5ITWA 2PKQP 2X86A 1AE1A 1E1MA 4AJLA 5IAAA 3GVCA 3OIFA 5DZSA 2B83A 2R00C 2ZIZA 1Z45A 1DFHA 2D0IA 1HE5A 5JBIA 4K26A 4NR0A 4PLFA 3TWOA 2P9EA 4EUHA 2VQ3A 3UFXA 2E49A 3NJ8A 4ID9A 5JMWA 1OMOA 1I32A 4EUEA 4IS3A 4R5HA 1ZJZA 1JVSA 1GYQA 1YBMA 4XRRA 4CMKA 5I9LA 3GG9A 2P4QA 4B3IA 3DZGA 3LF1A 3CKYA 1I0ZA 2CVZA 3FCOA 4R41A 3ANLA 1DIBA 2GGSA 1RM5A 1KBZA 3SC4A 2G5CA 5JO9A 5IG2A 4G81A 1Z74A 1HF3A 4D0RA 3JYQA 4QT0A 3VTZA 3S2EA 4E5YA 1SPXA 3MWEB 4HXYA 2VTDA 2X8LA 3IOYA 4IDCA 4A03A 4RPLA 3DHYA 4RF5A 4R9RA 5L4LA 1Q2XA 3EC7A 1I3NA 1C1DA 3JD3A 4JBIA 3WXBA 4CM1A 1PJQA 4XGIA 2BFMA 5DNAA 4BGVA 4YJHA 2IZZA 3BA1A 3L4BA 3JQGA 4LN1A 1V35A 2PNFA 5BR7A 4IJUA 1DEHA 1J0XO 1XEAA 2O3SA 3VPSA 3EYWA 1E6EA 2H1SA 4N5MA 4MINA 5F5LA 3Q2KA 3GEDA 4NJMA 7ADHA 3GUCA 2Q50A 2HDHA 4FBGA 1GUYA 2NTNA 3D64A 3H2SA 3PYMA 1PJCA 3ZV6A 2AQIA 2DTXA 1ISHA 4BGEA 1E1KA 3E03A 1N9GA 1QYXA 5KTKA 4EJ6A 3CMMA 3LU1A 4IQGA 4MOWA 5G0UA 2Z1MA 2JFFA 3AUAA 3L6DA 2EP5A 4KDFA 1WVGA 2EXXA 3O38A 5B37A 3IKVA 2C7GA 4YR9A 4M1QA 3GT0A 2PZMA 2PLAA 3GNTA 3KXDA 4UUMA 1Z7BA 3S8MA 4DC0A 5C37A 4QO7A 1YH3A 4IDGA 4R16A 4GMFA 4CLRA 5ADHA 4MIYA 1R4NB 3BMCB 1G0NA 1WMAA 1BSVA 3P7MA 5KVVA 4MVJM 4ZQBA 3Q0EA 1O89A 1WWKA 2AHRA 1KC1A 2WEKA 4LW8A 4E5MA 4OGWA 2W8ZA 4PGFA 2I5PO 5JLAA 1A71A 3WLFA 4J9UE 3ZWYA 1KC3A 4OOEA 5KJ6A 1RM3A 4B7CA 3QRWA 4XA8A 4YACA 9LDTA 1SZJG 1IYZA 5KJ1A 3X2EA 4R3WA 1PQWA 4IZHA 1X13A 3ZWOA 1AHIA 1HLPA 5FF9A 1SAYA 4DIFA 3MOGA 4ZD6A 3RVDA 2VZ0A 2V7PA 3ROPA 1PGOA 1ZKMA 1M75A 1VC2A 1TT5A 4B8WA 1R6DA 4M89A 3GVPA 4JJGA 4FPXA 2GN6A 2Y93A 3PJFA 3Q6IA 1P3DA 2J3JA 3WQQA 3Q3CA 3SJUA 3FBGA 4CV3A 2NWQA 3PJEA 4R51A 8LDHA 1NQ5A 3DBRA 3LC1O 3V1UA 2P5YA 4JQCA 4XYEA 3ZU4A 3QQPA 2PD3A 2X0NA 5HTOA 5IDQA 3NT2A 2QW8A 3JD1A 2CFCA 3KEQA 5JS6A 4CR7A 4DBZA 5A9SA 1GCUA 1UP4A 2GZ2A 3CPSA 4DYDA 3RJ5A 1IOLA 1HYEA 3GAZA 3RUCA 3GPIA 3L4BC 4R1SA 3GHHA 2HKIA 1NWHA 3RASA 3AFNA 3TNLA 2WJPA 1PL6A 4BNIA 4WK6A 5MDHA 3B1KA 3GN2A 4ALNA 4OYRA 3NT4A 4IJVA 2EERA 3DOJA 4MO2A 4JJFA 3GGGA 3WLEA 3KEOA 1XIVA 1L1FA 4IDAA 4DIOA 1EUDA 1NBOA 4IDDA 5LDGA 3T7EA 1KERA 3C7DB 3KOUA 4WCFA 3OIGA 1NX6A 3H8VA 1QYVA 4QXMA 1Z82A 2F1KA 3EDMA 1B3BA 3H4VA 4CR8A 2O48X 4B8ZA 1LDMA 1G1AA 2HMSA 2P91A 3AY6A 3RROA 3ZV4A 3L9WA 4PZEA 4WOJA 5DBFA 2EGHA 3GF4A 3P5SA 1VJ0A 4W82A 1BDMA 4IJKA 4TWRA 4EZBA 4L76A 1MC4A 4CV0A 5KVSA 4UREA 5DP1A 3KB6A 4FFOA 3F46A 4F6CA 2FOIA 2IZ0A 2NQTA 1G6KA 3WSVA 4L4RA 1FJHA 5DF1A 3JQGB 4NBUA 1ZSNA 2BGMA 4OL9A 4PZDA 4RPJA 4EBFA 4CMJA 4PIVA 2X7HA 3KBOA 3MJ4A 4TKMA 2Q2QA 2V6MA 4DC1A 4XQEA 3W4KA 1YL7A 4IJWA 3PWZA 1CYDA 1LLCA 3Q2IA 4TZKA 4XYLA 3QIVA 1GV1A 1SMKA 3DTTA 1JWAB 4IDBA 4LVCA 2CMDA 2Y1EA 4JJIA 2C54A 5HBRA 3NKLA 2W2LD 3CIFA 3ETEA 3FTPA 4N18A 4BOYA 1VL8A 3JQAA 3ICPA 1EFKA 5JCJD 3DZIA 2J5KA 1GUFA 2Q4EA 5K1SA 1Z75A 4E2XA 4O5OA 3DBHB 3ZHBA 1VPDA 3KLPX 3GUYA 1HDCA 3I83A 2O3RA 3COSA 1XWFA 4Z3KA 3JQFA 4MP6A 3UCFA 3LK7A 3BYZA 4GBJA 3O9ZA 4GL4A 1PZHA 1ZFNA 3GPDG 5A9TA 4D0SA 4CM7A 1GAEO 5KKCA 1BVRA 4U5QA 2B4QA 1GR0A 1Q7CA 3AW9A 4CUJA 1D4FA 2NUAA 4ND3A 2E82A 3H9EO 4U0KA 1MGOA 3I23A 2BFPA 3OJEA 2X5KO 1QR6A 3NDRA 1O6ZA 4BB5A 1PJBA 1QRRA 2RHRA 4JX8A 2Q2VA 3C24A 4XIJA 3CSDA 4PLPA 3ZZNA 4WPGA 2J6IA 1E7YA 5JAIA 1WW8A 3BMOB 4EGFA 5F21A 2I65A 4WLUA 3QWIA 4II3A 3D0OA 3BAZA 1C3VA 4JIGA 2VHWA 4LMRA 3EY4A 1PL8A 5KNLA 2PR2A 3DL2A 3ZWXA 1GPJA 2Y67A 4F45A 3BHIA 3FN4A 4WEOA 4ZQHA 4GH5A 4PG7A 3Q9UA 3UF0A 2B35A 1E7WA 5THKA 3AK4A 2AQHA 2JCVA 4R69A 3FD8A 4UULA 3GEMA 2ZB8A 3UUWA 4TROA 3KM0A 2CDBA 4RORA 2FWMX 3OHSX 5GMOA 4PRKA 2YHIA 3F5QA 1LDNA 3CMCO 3QVTA 4U7WA 4Z9XA 3IJRA 2IXAA 1CF2O 2AMFA 3KHUA 4I5FA 4BVAA 2Y05A 1CEQA 3BMOA 4UUPA 1D7OA 2H63A 1U8XX 4IIUA 3V1TC 1ADBA 3GRKA 5MGBA 1FF9A 1U2DA 2YW9A 4FB5A 2OBYA 5IXSA 2IDZA 4E5PA 1PS8A 1Y8RA 1YOVA 1PJ4A 4BNWA 1LDYA 3FBTA 2PZJA 3GNSA 2GLXA 3DTYA 3OF2A 3D3WB 4PLVA 2P9CA 3ONDA 1ZVMA 1GFSA 1QLJA 1V0JA 4JBGA 4XQ9A 3TSCA 1R12A 4CQLA 3WGHA 3EK2A 1X7GA 5G0WA 4YWJA 1OBFO 2BGLA 1ISMA 4OIMA 5JDCC 3KUXA 3GZNB 4R4JA 2GASA 1GQ2A 3ZI0A 4HNGA 5JY1A 4KP7A 3IKTA 3OICA 4AG3A 4JK3A 3GAFA 4XWYA 4BO0A 1JLLA 2EHDA 2RIRA 1E5LA 5B4UA 1Z7EA 3HZZA 3EUWA 3L4SO 3W1VA 1BW9B 2FR0A 4BNNA 1GEEA 2AEMA 4D3DA 1KEVA 1UXGA 2JCYA 1P1JA 1B7GO 1A5ZA 2HRZA 3P2YA 4Z0TA 2HAEA 3DAPA 1HETA 3QWFA 2E37A 2YFQA 2JD2A 2QHXA 4ZQEA 1H94A 4YCAA 3NV9A 3OP4A 1PR3A 2P5UA 4Y6PA 4YAEA 3T7CA 4AL4A 5C7LO 2B5VA 3LYLA 4BL5A 2Y66A 4YRAA 4ONEA 3ROQA 1PL7A 3OA2A 3ZWPA 4GSLA 2D3TA 4D3SA 1HDYA 5L40A 3GQVA 3UCXA 5HRUA 4HY3A 3RUFA 2W4QA 5FYDA 5F1KA 1BXGA 4QFCA 4IIVA 3BTOA 3WBBA 1WP4A 2HJRA 4CM8A 1RM4A 2HMTA 4A26A 1Y81A 4HV4A 4JP2A 5TC4A 1Y8QB 4YQZA 3WTCA 3TZKA 4IQ8A 3HSKA 4WLOA 4F6LA 4FGWA 4HADA 3I9KA 3AM3A 3LLVA 2DAPA 3ITDA 4RVFA 2C20A 3U4DA 3WJ7A 1BXKA 1E77A 4XYGA 1YWGO 2VWHA 1U8FO 4D7AA 5CEFA 3OQ6A 3EMKA 3NGXA 1YS4A 1YXMA 4BO2A 3ABIA 5DBGA 4J3FA 4CQLB 3I4FA 2V65A 4ALLA 4YJFB 3VH4A 3D3EA 2DTEA 1YVEI 3GVIA 3ZWVA 2Q49A 4RZHA 3ZWWA 4PN3A 2B36A 4DPKA 5G0TA 3TF5A 1DLJA 1UP6A 3OJFA 4LVUA 5KOIA 1E3LA 1GDHA 4O0LA 3RWBA 2DVMA 2XPCA 4H7PA 3TL2A 5U9CA 2O2SA 3JQAD 2PK3A 2R2GA 1NVGA 1X7HA 3GRPA 3HN7A 4E4YA 2O7QA 4MVJG 1T4BA 4DA9A 3AU8A 1O0SA 4PLZA 5BQFA 1AXGA 3PDJA 2AEFA 2BFOA 2TMGA 1Y5MA 3QP9A 4MDHA 3PHIA 3KO8A 4H3VA 4L73A 5CDGA 2C29D 1M66A 3EGOA 4ALIA 1NAHA 2VYVA 4BNFA 1OZAA 4CUZA 2C5AA 3UW3A 3ETDA 1GYRA 1O8CA 2BRUA 4Y9DA 1YL5A 5KVQA 3DOCA 4IMRA 5TT1A 1X0VA 4D41A 1B15A 4XJTA 4M87A 3FNFA 2X0IA 1ENYA 4GAEA 3ZWMA 4W7HA 4CLDA 1L7EA 5L45A 2O50A 4YJHB 4FR5A 5JC8A 3PZRA 1EQUA 3PEFA 4B79A 4B4VA 1PWZA 3OEWA 4OSOA 3I9JA 1PWXA 1F8GA 3PWKA 4IQ0A 4GI2A 3M1AA 2DPHA 1R4NA 3BMCA 2DBQA 2GZ1A 4B3HA 1R37A 3HFGA 2A94A 4GKVA 1P1RA 3DO5A 3LDHA 1DOHA 2C0CA 2DLDA 3VPFA 2EIHA 5J23A 1N92A 2HMWA 3I9NA 2GF2A 3GFBA 4CM5A 4FDAA 2G0TA 3F4LA 3GK3A 4KMSA 2J8ZA 4W6ZA 4EW6A 5A1TA 4MVJF 2OMEA 4O1MA 4OQYA 2X4GA 1DC6A 1YE3A 3ZNNA 4ZU3A 5ENDA 4CMHA 2AE2A 3M6IA 1PIWA 2GRAA 1E92A 2HSDA 2HK7A 3T4EA 1CWUA 2DC1A 1VKOA 4FJ1A 2V6BA 5C3MA 4A0SA 3K2BA 3PHHA 1DDOA 3RKUA 3DMTA 5KCZA 1ENOA 3WSWA 3FWNA 2OOSA 4NFHA 2VN8A 1T2FA 2OP1A 3G49A 4MJLA 2YUTA 1B8UA 4WLVA 4IXWA 1CQIA 2Y1CA 3MJSA 3TJRA 1HSZA 4OSPA 1P9LA 2BF7A 3BMNB 3BTUA 3FRJA 4GSKA 1AGNA 4U0JA 2IEDA 4FW8A 1H6DA 3ZGYA 3W8FA 3NUGA 3WNVA 1HDZA 3P2OA 1K6IA 1UDAA 1KVTA 3BMQB 3MJTA 4CMIB 4EEXA 4M49A 3IAHA 4OKIA 3WICA 1DFIA 4LGVA 2P2SA 3O8QA 2W2KB 3QSGA 3L77A 1NQOA 3L9XA 1AN9A 1D1TA 1SEVA 3EHEA 4GX5A 1PGJA 1N5DA 5L53A 3X2FA 1K2WA 3OQ1A 2G76A 1JQBA 4YYZA 1VSUA 3VDQA 4UEOA 1QLHA 2JFHA 4RVDA 1B3RA 2O2YA 5L51A 4Y8VA 4MP3A 4BKOA 1QYCA 2I3GA 1VJTA 2DM6A 2W98A 4MKRA 4AJNA 3DDNA 5IN5A 2NU8A 5KWEA 5THQA 1NHGA 2RH8A 1KS9A 4BHTA 4YB8A 5CPBA 4AJ4A 2EV9A 3ZWNA 4OQZA 2VOEA 2YQ5A 4RGBA 5CDUA 4KOAA 4Q3AA 3NTRA 2DBZA 3JQDA 1B8VA 3WMWA 4YBZA 3IP3A 4E12A 5JDIA 4ND2A 1YB4A 4CJXA 5L95A 4EUFA 2CSUA 1BXGB 3K6JA 5C7OO 1DC5A 5BNIA 1P45A 3HE3A 2IZ1A 1QV6A 1LI4A 5KVCA 1YOVB 2JL1A 2VHYA 1DIHA 3GMDA 1NFQA 3FR8A 3WQSB 5IXYA 1Q7GA 3KYCB 2D5CA 2QZZA 5B1YA 3JQBC 1FXSA 1LLQA 4ALJA 4P4NA 3MEQA 1HYHA 4HFRA 5JY6A 3TZHA 5FEUA 3ADPA 4XB1A 1A7KA 4YAJA 3PVZA 8ADHA 1GUZA 3L0DA 3D5TA 1A9ZA 1ENPA 2UV8A 3GDFA 2B0JA 2JHGA 3GN1A 1C1XA
chains in the Genus database with same CATH superfamily
1KO8A 2OHOA 3ZE7A 4DAEA 2FJ0A 1KL7A 3QI7A 4DQKA 1PK8A 2EQBA 1UJ6A 4BFLA 1Z47A 4B4OA 2XGOA 2QN6A 2VJBA 1LJ8A 1W0JD 5HIAA 1XL0A 4GVPA 4YAKA 2QN3A 3FM9A 3VR4D 1HOTA 3BX1A 3MZ0A 2PY6A 2RHGB 4WX2B 3R5SA 3D8TA 4I4NA 5FLEX 3RFCA 1V8DA 4ZOEA 2BKLA 3ZCXA 4UU8A 4EW2A 5BN1A 2EQ5A 2PZKA 5KYWA 2Z1DA 2QMYA 4RLHA 5FWXA 4D0LB 3M5DA 3ORQA 3KTDA 4P4UA 4R98A 1SVNA 5TSDA 2ZREA 3SX4A 3VO1A 5B3KA 3IX7A 5KOJB 4K6KA 2ISCA 3UVEA 2QG9A 3ZNOA 4TTTS 3MELA 1VPEA 4HNAA 2GDJA 4PSAA 2JLAA 4O2BF 1C3LA 1G2OA 1YR1A 3H3FA 5F5XA 2IQ5A 4RTKA 2A88A 4IWYA 1V7PC 3F9RA 5DFAA 3CVJA 1O5IA 1ZL2A 1PV4A 1JDTA 2A2ZA 2Q41A 3PI6A 5EFOA 1GM5A 1CULC 3CE6A 1XV5A 2PJRA 4IVPA 1W8DA 4YJGA 1NMZA 1FQJA 2VHTA 1TA4A 4X9XA 2IEGA 5I7FA 4KWIA 5G1OA 4XVUA 3W8NA 5B7QA 1GIAA 3TH5A 2H2IA 1W48A 1T2NA 2V4MA 2VNHA 2WIAA 3E9RA 3SQOA 1PR5A 4ABYA 4CF3A 1GZSA 3WHPA 5GQSA 3OQJA 4LY0A 1XTPA 3C70A 3H2JA 2EG5A 4FXPA 1YQXA 3OFSA 3QWBA 4O2BA 2Y0DA 2QX6A 1J99A 2JFQA 2A92A 3OQPA 1XDGA 3M3PA 1WXQA 3SG0A 5HKLA 4CMEC 3NTVA 1JQ5A 4J0QA 2A6PA 2ZSKA 1QP0A 4FTWA 4OOFA 1NPTO 3I05A 2Y1XA 5EWMA 4IGIA 3CRVA 3ZGLA 4U39A 5BSKA 2G9ZA 2EEZA 2ZRFA 3C3AA 3GA0A 3OFNA 3KZXA 3U3JA 5K0ZA 3FVQA 2HLNA 4EK9A 1D2GA 2WQ7A 5E6UA 3CZQA 3ZE0B 1ML4A 1PJTA 1NYLA 5G4KB 4EG1A 4XR4A 1VYUA 1UBOS 5HK9A 3EZGA 4GI1A 4LC9A 4RPIA 5JAQA 3RADC 4K6HA 4S05A 1Z6YA 4TSRA 1RXCA 1G5IA 2GFIA 3B1XA 1QSGA 5CDSA 4C2BA 1KBOA 1X1TA 5EVJA 4XJVA 4D56A 3A9UA 2FEAA 2WUDA 4ZVNA 3TQIA 3I28A 4BRZA 1PW7A 1XD8A 4RZQA 2AF4C 4RSGA 3TLCA 3LT0A 4AWBA 1T1JA 3DT9A 1K8ZB 1OCEA 4KREA 2CXUA 1GSIA 4FYWA 4ZIRB 1WHTA 1FEZA 1AZLA 1YZYA 2LNDA 4Y1RA 1DX9A 4EYEA 2L0XA 3CUVA 2BGUA 3IEPA 2RGDA 3K2QA 3B1WA 2FMHA 3FJOA 5L45A 1E8DA 1NBIA 1P0MA 2FZWA 3GLTA 4ILEA 1UOQA 4XIYA 4ZOLA 3AUKA 3FI9A 1SG9A 4E4TA 2I9PA 2YZMA 4HDRA 4DWVA 3R3JA 3O26A 3CEHA 2VJOA 3DFIA 1QH8B 2F3PA 1KE1A 1SRQA 3LUPA 3R9XB 4FX2A 1C9MA 1MIOA 4YUWA 4Y6RA 5BR1A 5AK5A 3ZHXA 3N3AC 5KEIA 2PU7A 4FCTA 4P4SA 5DX0A 1PR2A 2VQDA 3KSBC 2J5BA 4PCVA 1XRSB 1MORA 3IQXA 4ADSG 2V4ZA 1SBNE 3FMIA 4M1EA 3WISA 3GLIA 5DV9A 3SDSA 4KPYA 1P3Y1 3JWEA 2QK4A 1OLXA 1YASA 3ILYA 1N9KA 5ITZB 3VHRA 4LOJA 4D4JA 4HZUB 2VT3A 1WMEA 5EEGA 3IR6A 2EGGA 5T4BA 2XQFA 4DARA 2HQ1A 2JHFA 2YOHA 4RF2A 4WKBA 3RSLA 3BFJA 1MFPA 5D3QA 2IYRA 4V0ME 1J20A 2HCJB 4K9MA 5EFZA 1UKCA 4URHA 1L7MA 1XA4A 4L4YA 1QKIA 3MBKA 4GXQA 2XXAA 2ONYA 5KYNA 3EZ7A 1UANA 1ZM2A 4X94A 1JG2A 1C0PA 3HADA 2HH9A 4PBRA 1H9AA 4YAUA 2H2AA 3ME5A 1G9XA 3JR3A 5TMDA 5AO9A 4JVLA 8ATCA 1YHZA 5KQGA 3G0OA 5JDCA 4RHCA 1HFWA 3BCUA 4I36A 4NC9A 5FBQB 4HH4A 4LPSA 4ME6A 2RG7A 4KLNA 4XCVA 1NXWA 4C5AA 4B44A 5I51A 5KNDA 4XVRA 2QMZA 3DE0X 3ZDAA 4C0QC 4V2IA 4URFA 4BXOB 2IEIA 3UK7A 1ABFA 4WJKB 3W8EA 4BVJA 1RVV1 4JYAB 4P1ZA 2XMQA 2DERA 1KEWA 1EFTA 4V38A 1HRKA 3NI2A 1CNFA 5EUBA 4OI1A 3HNPA 3LVRE 4FU0A 3I01M 3N7UA 4MPTA 5P8WA 3TTXA 3VU3A 2ZRNA 1SNYA 1W88A 4NY1A 1XU9A 5IU6A 1OGIA 1RHJA 2C97A 2CHGA 4X44A 3V1YA 3PQ5A 4M38A 1TEXA 4C21A 1O6GA 3G9XA 1PNQA 2CV1A 3P9NA 3QNUA 2I87A 1J7KA 1Q91A 4FBLA 1U0GA 1SBYA 4W1QA 5EZYA 3SHVA 3EHDA 4DUGD 2GYVA 2ZRPA 5AHWA 5J43A 4GO1A 4Z9FA 2V9PA 1Z4QA 3JY6A 3R6GA 4KYVA 1UBNA 1SD5A 2G40A 4NFYA 3WB0A 2R8YA 1FFCA 2O8NA 2JPDA 1MXHA 1RZRA 3IBCA 1L8AA 5FFFA 3FUXA 1P2BA 4P34A 4C06A 1WB6A 2F1JA 5EIOA 3PVSA 3WLPA 4PZZA 5LP6B 1QVAA 1XSEA 2HJGA 3BXPA 4MEBA 4RL6A 2C59A 5AW3A 2J4DA 1YO6A 1SVMA 3FY4A 1GOTA 2E4WA 2WKRA 3C8DA 4QFDA 5FD8A 2YZGA 4B33A 4L95C 3IPCA 4BFXA 1ODKA 4ZGGA 4HFJA 1BIFA 1THGA 1MG5A 4EG3A 3OKPA 4TX1A 5HHTA 4PM4A 4TRRA 2ABWA 2FN4A 3BRSA 3ZV7A 3DLHA 3BWVA 5BVGB 3PRYA 1K88A 1HE4A 2HRBA 3LQ4A 1M2NA 4C20A 3IQEA 1VPTA 4HFNA 5HQ3B 4WESB 1CDZA 2XDAA 3PDUA 3PUZA 4JITA 1FDWA 1WD5A 4DVJA 4LWPA 3OHPA 2IKQA 1PR0A 1H6CA 4YASA 3IS3A 2C7RA 1FFBA 4DCTA 1XCJA 5JQGF 2R4TA 3UK0A 2VP3A 2OAP1 3FNGA 3G0DA 4CL8A 1FFYA 2J31A 3H86A 1H66A 2FP4A 3JQ6A 3WLTA 2RH4A 4BQPA 1S7CA 1O08A 2ID4A 3KVYA 2WF5A 1H2EA 3Q0IA 1UDBA 3VPXA 4BMZA 1G8MA 1DAGA 4AI6A 2M98A 4I55B 1ZIDA 5E9WA 1PJSA 1CHNA 1HE3A 5K45A 2QGFA 3ZWKA 1KPIA 3UK6A 1YACA 4MO9A 4G1BA 4U9IS 3ANSA 3H5AA 4GGOA 1TAQA 4PSKA 3ICOA 1SCAA 4NESA 1JR6A 3D6VA 1NSYA 1JX6A 1T25A 2PVPA 1I7SB 1OGJA 2UZ4A 1I3OA 1OBCA 1P7WA 3WMEA 4GI3A 4ER6A 4Q4DA 4WOKA 4ZI3A 3D8UA 1Z2OX 2QTAA 4TKLA 5K1ZA 5TJHA 2VVTA 3M6WA 4YDQA 4YFYA 1QBKC 1CJCA 1Y3CE 2LZ0A 2HCBA 3KJIA 4I8IA 3OX3A 4LTDA 2PV0A 2JIOA 4YROA 4MQLA 3QKRA 3ZU3A 3F49S 3HRHA 3KAPA 1ZUD1 3P2EA 2B9VA 4ZVRA 3LQ2A 4D97A 4YV1A 4H60A 1LTHR 2QUJA 5CDFE 3PGJA 4IM7A 4LOKA 1UT5A 4TWAA 4RVHA 3TIXB 4OHFA 2I4IA 2ZJFA 4XD2A 1DTWA 1QTNA 1R9JA 1WDTA 2NU7A 2W2VA 1KQGA 1I2ZA 3TGWA 1A4IA 4GPTA 2DSNA 4B3XA 3FPHA 5DYTA 1S3GA 2VDMB 5FL7A 1W5SA 3VDXA 3OEYA 4EJMA 3CU5A 1NI5A 3TW0A 4RDXA 3THXA 4OQPA 1FIUA 3UV6A 1VXRA 4R0MA 3LQKA 1ZI6A 3NVKI 1GN8A 5TB5A 2WE7A 4IL5A 1R27A 3ORHA 2P9YA 4YV7A 2AMVA 4JCCA 4PZCA 3SJBA 1UXOA 1RYBA 3HJUA 5EA2A 1PT7A 4NICA 5K0FA 3VVBA 2XNHA 4KACA 4MCIA 1J8MF 4YEDA 5C52B 4KFCA 4JODA 4FCWA 3P9QA 3A9WA 1AKYA 4H18A 2ZYIA 4QJ5A 3U49A 4PTLA 3TR5A 3ZLVA 1ZJYA 3HWRA 4FD3A 1AGPA 3KOMA 1DKQA 1ETHA 2XCOA 1BJTA 3FMVA 1ARZA 1LBEA 3K2EA 5CU7A 4B4DA 1MAWA 4DE5A 2WZQA 1I7QB 4WNCA 3H97A 5LBUA 3JQ7A 1ZUWA 3PWSA 4EPTA 2TS1A 2EAUA 5AW7A 4HPWA 2C4MA 5K3EA 3A1DA 3CRQA 3DDOA 4IVRA 2E21A 2XKKA 1ENZA 4IEIA 3KHKA 1MV8A 3GBPA 1G6OA 1PO7A 4EGSA 4ED9A 4BQOA 4JA0A 4ZOLB 3F4BA 3K1AA 2RHTA 5HA5A 5I7AA 1RYNA 3EZ2A 4UVHA 4K88A 2AMLA 1RTTA 1NASA 3HYLA 4HAOA 5D86A 3A2NA 4RMNA 1JHYA 4EF5A 4X1KB 5HZGA 2QZSA 1THZA 4JKIA 1X87A 2AG5A 3D8HA 4QASA 4BKRA 3GFFA 3QH4A 1N6OA 4PTZA 2IYZA 4LOIA 1ZIXA 2OQRA 4AP9A 3ZCUA 3B48A 1Y33E 2IRWA 4UDYX 3GJZA 1OB5A 2JFVA 4NQZA 5IN4A 2MYPA 2JJ2A 1Y98A 2ZSAA 4MMYB 4XUGB 3WL8A 3WGUA 1XVUA 3D31A 4BAUA 3ZH2A 4JUFA 2A5LA 2AUNA 2XMDA 1K6JA 1LLFA 2H8GA 3QLVC 3N6VA 1WB4A 2W0MA 3TL6A 4KIFA 1FY2A 4DLAA 4XDZA 3NBAA 3EGCA 4R8RA 1YS2X 1U5AA 3L0OA 4V0QA 3OJ0A 5IVIA 3SEFA 2CJFA 4R71A 1OX4A 1Z9BA 2HRDA 2A8YA 3CN7A 4MB0A 5TF0A 3QLVA 3JR7A 5K6AA 5DDIP 3OZCA 3F1LA 2AFIE 1K08A 1DIGA 2GHIA 5ALMA 4ZEOA 2P2LA 3JAWA 2ROQA 2ZW9A 1K0UA 2J3QA 2V96A 3FDFA 2ZZMA 3IBGA 1E3TA 3RC7A 1FVHA 1EVJA 3MPUA 2OPBA 2Z2IA 5GZ1A 3D2LA 3QKWA 1ZGAA 1XJWA 2VXCA 2GUGA 1V7CA 2AZ4A 2H1WA 3WV4A 3QVOA 3OQIA 4K86A 1YVUA 4BVGA 3ZXIA 3RRMA 1R15A 5FTLA 3L0BA 1LA2A 3RIEA 4C5CA 1U3VA 4OHVA 3K0KA 1P8JA 3OCWA 4NSNA 4H2DA 2HWXA 1VMAA 2WUEA 4RA9A 1FP2A 4R9UC 2NU6B 1OX4B 1ULAA 4MP8A 2GK4A 3V4RA 2ALJA 2ANBA 2V5UA 3L07A 4Q39A 4A2QA 4QA9A 3M83A 3FKSA 2RB4A 5DI3B 2DFKB 1LGYA 1AHHA 3TIVA 1BA3A 2WHEA 3KUUA 4V39A 4QLBA 4Y2YA 1WETA 3SHWA 4XUCA 1JZTA 4RWZA 5I7VA 1KJNA 3B7GA 4TXNA 4UDNA 4EA8A 3QXGA 1WKCA 4FNOA 2NV6A 4KDRA 4YALA 2PRIA 1VPWA 4I5IA 1CNEA 2JGRA 4HBGA 4NBRA 3S8EA 1QZZA 3QX7A 1JKJA 2BKVA 1W85A 1U11A 1IZ9A 1JIUA 1VL0A 4O4HA 2DUNA 1LY1A 5E1DA 5LB4A 1ZAKA 2QX7A 3T8YA 1MG0A 2W8BB 3R3ZA 4CCWA 1KZGB 4FYYA 4FEGA 2ON6A 1OT5A 3WMXA 2XCRB 3G2NA 5FHRA 3HHPA 2DE0X 2V59A 2CVOA 2PXAA 4IIGA 5UKDA 4BO8A 3E3MA 3IUSA 4PLGA 4BLUA 3BWEA 5ALYA 3PHJA 4Z3DA 4QGBA 6YASA 4YLYA 1Y1PA 4EA6A 4ZN6A 4CR6A 3UO8B 3SVZA 2QVGA 3SXUA 4CM6A 4F9FA 3JQAB 1QK4A 1B6TA 3OTHA 4U2BA 4O4IA 4ERNA 1QRSA 2BFBA 1REQB 2A1TS 4UU7A 3WYGA 1MUUA 3PNSA 5JXGA 2D13A 1VG0B 3ZY3A 4XKJA 5AK3A 4X1IA 1X70A 2GJ8A 4W6QA 3L7JA 3Q7TA 1ATIA 3K0CA 5EE5B 3OX1A 5CFNA 1ADCA 5JEDA 1LPMA 2XHEA 3B1FA 3H18A 1W88B 1MO2A 4Q1AA 1X80B 3H6HA 4ND5A 3N59A 5AKJA 4DDTA 8OHMA 1NKTA 3O2NA 5BSEA 3F71A 1SULA 2WTAA 1JN0A 2VJMB 3DM9B 4KTTE 4XR9A 3PT9A 3HUTA 5AJUA 3I5XA 2CEAA 4X6LA 5EJ9A 1J9GA 4UBMA 5IABA 3GLFE 2ASEA 4DUYB 5G2OA 2C7BA 3B2NA 2P6OA 1PKEA 2DXIA 3E70C 4YUZA 1J22A 2JIRA 3B2EA 2G9VA 3WG9A 1VZ2A 3ZY6A 3EYAA 5HWSA 2HXYA 3HPQA 3ZU5A 5EHNA 1XHEA 1WZNA 2D1TA 1WZIA 2Z08A 3KZVA 3K8ZA 3DVQX 3TVYA 3REQA 1PZEA 3UMJA 3NBKA 4EBBA 2POQX 3DMFA 1FMJA 4M1SA 1LUAA 1POXA 3HI6A 4LHZA 3TDNA 2EZTA 2BE7A 1WSDA 4HNRA 1I7NA 2NZJA 2UXCB 2F9MA 2EATA 2MSEB 2BKAA 3IAFA 2HSZA 3H7AA 5AJWA 4BFVA 2ZJ0A 4N6OA 2AJTA 2Q9AA 4CT4B 2BD0A 4EG0A 4NFSA 4F21A 1EHCA 4L9SA 3SHOA 4B7ZA 4F4HA 4XTCS 5LBIA 2ZWMA 3SSNA 3EIHA 3DULA 5LNK1 2OD7A 1K75A 4C6RA 1Y1LA 3GZTB 2EZ9A 2I6UA 1E0JA 3MSXA 1EX9A 4R2LA 1F8XA 1Q22A 1Z0SA 2CBGA 3AVPA 3FHLA 4L07A 4RY0A 1EUDB 1W6RA 2ZATA 2GHTA 4QOSA 3IRUA 3VH1A 3HLKA 1OFUA 2H9AA 3LZCA 2AFVA 3B9RA 3VPCA 3RB8A 2HU8A 4NU6A 4DQDA 2IX3A 3RYCA 2P5TB 3OPNA 4J7XA 1NW3A 2QPTA 4Z1OA 4O4HB 1F1BA 1X8XA 2ZP1A 1JG3A 1JIXA 3LV8A 4M9QA 2IU3A 4Q5IA 4WY8A 2PHZA 1OPXA 3AF3A 4A91A 3K73O 2HYIC 2AH5A 3T94A 5F23A 1A9XB 3H2ZA 1C0KA 5FI3A 2R65A 4BO5A 1FSZA 4D8WA 3WL4A 4JNCA 1CRWG 1NG9A 4GZ3A 3O4RA 2BUAA 4F2DA 3P26A 2EKZA 4BFYA 1D09A 4DJFC 3GPCA 5IJ0A 1M8PA 4X63A 1Q6ZA 1TLLA 2CLSA 2IF2A 1JEQB 3MUFA 4IILA 4K1LA 2OFPA 3LBIA 1VCNA 5A6SB 4MIEA 1KFKB 4B34A 1JFLA 1GV0A 1XZBA 3EUFA 3JQ8A 4GPZA 3F6EX 4S3MA 4BCCA 4QQ8A 2JEYA 2GF9A 4AJKA 4B32A 5A5FA 2VTBA 3KT8A 4BECA 1TB4A 2XDWA 3IALA 4LC0A 4Y9RA 2X4LA 3HXTA 5FTMA 3C6MA 4UDXX 1NR7A 2Q3LA 4B71A 1W581 2AC7A 1YDEA 3BFKA 4A15A 2QPAA 2Q9UA 5FUWA 3S29A 5JVDB 1MR3F 1L4LA 1ZCAA 3DHEA 4O4LA 1GY8A 4OJNA 5I7EA 5PGMA 1VRVA 2N46A 5FI0B 4BNKA 1KY2A 3I2JA 1NVFA 2MSWA 1GCAA 3I76A 3DMHA 4FOSA 4LVNA 4FHCA 1HK7A 1CERA 3BMNA 4YPVA 1KETA 3HU3A 2FPLA 3KJNA 4G84A 3LY7A 1WUYA 2ZI6A 4G24A 4TKUA 5FI5A 4J3NA 3V8VA 2CE7A 3EGVA 2JHPA 1RPNA 2ECQA 4AP5A 3KXKA 3U3XA 1VM6A 4YQFA 1QFXA 3HH8A 1DCFA 5FUBA 2ZIXA 5AI0A 4DLLA 3WL7A 2G82A 2BLNA 3DEKA 4RS4A 2MU1A 2QM8A 3D3QA 5H4GA 2HV9A 1W44A 2CDCA 1DG3A 1L9XA 2QMQA 3T54A 5H3CA 1RQNA 3NOXA 1T43A 4ND6A 2ZVQX 1MW8X 1SO8A 3CQ9A 1B8PA 1GCIA 2FSGA 2J3HA 1E3SA 2OWDA 3DDSA 4HDSB 4QOEA 2PRJA 4QRDA 2E89A 5CGZA 3BGDA 5EINA 4OXQA 2F3UA 2IH4A 3RVPA 3NHZA 3WAJA 4LYFA 4RXUA 2AQKA 1X1DA 2D1RA 2LTAA 2VWPA 4GEKA 1X7ZB 2HWKA 2JFUA 3EW9A 4KR7A 5GP1A 1DKUA 4BRSA 1XAHA 4EGCB 1VP3A 4L4SA 5M5BA 3NP7A 3O90A 4DADA 2G83A 1AQJA 2EW2A 2W43A 2CV2A 2BEWB 1OC2A 2Q6VA 2V8OA 3KE9A 4HMOA 1IEVA 3QTLA 4J0KA 3OQOA 4MH0R 4ZI7B 1QHIA 1FYXA 2BUCA 5A02A 1W36D 2QRQA 1OX5A 4IP0A 1EX7A 3EQZA 3WBKA 3OSZA 1ZJ4A 2VEOA 4I1RA 3ZD8A 5FWXB 4UMEA 3AFMA 4CCYA 3IL2A 5IKEA 4MTLA 2F2TA 3R0IA 1JR2A 3UGJA 3BXZA 2WYVA 4LV6A 3VR5A 1F4PA 1AX9A 1XLUA 5CFMA 4CQMD 4GLFA 3BFPA 4ZANA 1V48A 1OOEA 3HCBA 4C2UA 3W90A 3ASVA 1GLNA 2B9EA 4BBZA 5C32A 1NVVR 5KNCH 4F56A 3PQ2A 3OPQA 4FYHA 1C9JA 1G3IA 3DBLA 2WFAA 1SXGA 4FWIB 3X1MA 5EWJA 4TRMA 1YZKA 3L6OO 3S8YA 1E99A 4TWJA 5L3QB 2W6PA 2O8DA 4MUHA 4XQGA 1CUXA 1FNSA 1LQTA 1W2WB 1NBMD 4M54A 4AQYB 1D8AA 5EJ4A 3E9QA 4JJ8A 1NU6A 1MN6A 2DUJA 1VLLA 1Z2PX 4NCNA 1YNOA 4IIDA 4TQ9A 2JJQA 1BXZA 2GBPA 3LYUA 4LQCA 1DC4A 1FX0A 1QCZA 1P2TA 4L28A 3KT6A 5DHAA 3WKDA 4C9BA 5MN4A 4MV0A 3E6AA 1ZK1A 2HLDD 4BMNA 2PSSA 2OFFA 1GGKA 4EY8A 3C48A 5JI3E 2DQZA 2DT5A 2JA1A 4AULA 3BH0A 5G0VA 2GRJA 2XUDA 1KFCB 3RF6A 3CR7A 4KOEC 1C80A 2O5EA 1UJCA 2GSDA 1JH8A 3TUZC 2HEIA 2Z2JA 2G63A 4YPOA 3SM9A 1XD9A 4YJ3B 2QPOA 3LGSA 4RF3A 5AJYA 3KQVA 1AV7A 2FN7A 2VHEA 3RBZA 5F78A 5AVUA 3GPLA 4MB6A 3A32A 1D6MA 5K3BA 1CJKC 1U1FA 4L6AA 5JSYA 2JCSA 2NT3A 2IYPA 3ABRB 2VO1A 4CV2A 4KBYA 3GIWA 5HUQA 4QECA 5BV8A 3KVRA 5DEOA 1J2RA 1IEWA 1MB3A 1P9NA 3N8DA 1MEEA 2OZKA 1GG8A 1PG0A 2B34A 3IERA 1FK8A 1TDJA 3KUDA 3U7QA 2X5NA 2CUZA 1MA0A 1NLUA 2XUGA 4N5HX 1BHSA 1ZC4A 1WVMA 3EG9A 3F0TA 4LZZA 3OLWA 2JFZA 5E4JA 1K5HA 1CV2A 2GESA 1DMRA 4KITB 1E6LA 5CCBA 4LHXA 3DOHA 3HMKA 3FLBA 1PF7E 2A9JA 5LNK6 4TYYA 3ZS8A 2QMHA 1BOOA 5IBCA 3QITA 4INZA 1S2MA 3B1ZA 1FB5A 4C3ZA 4Y2RA 1WZEA 4OUDA 1Z4NA 1PGQA 2NPIA 4RQTA 3WYNA 4MVJP 1CKEA 2W22A 1W73A 4IO1A 2JZNA 1EAMA 5AI9A 4W8HA 5A0TA 5AOVA 4Z3OA 2QTFA 3ZGZA 1DJLA 2VF8A 1B2LA 1M6EX 1G0OA 2W37A 3CG0A 4JEIA 1P2GA 1P4SA 2ET6A 3NHAA 4L16A 3V8NA 2QUZA 1MP0A 2XITA 2VZLA 2YN2A 3TZCA 5IF9A 1QVRA 1IN5A 4MYDA 5BRAA 3ZD7A 1IBCA 4EDHA 4B09A 4ZMBA 1JSCA 3N1UA 1QYRA 3ZOZA 1WU7A 1NVUQ 2R6AA 1LKZA 2VRNA 2NU9A 2ECKA 3VOBA 4MROA 1SKUA 1TPYA 1H9CA 1DT3A 5G1PA 2FMIA 4URUR 5D5PA 2UYCA 1E3EA 2JAQA 3PL1A 1BWPA 1HPLA 4KQJA 2G6TA 2HQRA 2BFFA 3JVUA 4OK6A 1A4XA 2HF8A 2F3RA 2SECE 2UUCB 2XI4A 2Y1OA 4M99A 1IZ8A 5CVTA 5K0CA 4UCXA 4KNYA 4OQQA 2NTJA 4FYVA 4TS1A 1VHQA 2Z95A 4YS6A 4EJ0A 5EI5A 2ZJ2A 5TF4A 2CBXA 3ZKWA 4HVCA 1PS0A 4C6HA 1T5OA 2XMBA 3F8TA 1F8YA 3VR6H 1ZH8A 3BVPA 2UUOA 1H05A 3NKVA 1PSDA 3K8YA 3PQ7A 4HYEA 3ESCA 7MDHA 2J4FA 2JAXA 3BJIC 3LSYA 4KH1A 4EVRA 2WUFA 2EVWX 2WD7B 4Q1FA 2D59A 4DQUA 2YNMA 4BXOA 1KIFA 4JGGA 5CBPB 1JTEA 2NV2B 1JAHA 3TD2A 1ZNYA 3TOSA 1NM5C 1J5XA 1ZYUA 3L0PA 5EYPA 5K0NA 1TQ2A 4WT7A 3V48A 1XMIA 4MW9A 4JVSB 4ZYLA 4AF8A 2Q3BA 4C7JA 4W9MC 2PKQO 1BH6A 3IB6A 4GNKA 2BMAA 2Z4TA 2ZAYA 4ZZ3A 5AICA 4CIBA 3NH6A 5IVPA 2ZQYA 5FORA 4W5WA 3DB2A 2LPMA 3UC5A 4ZGWA 3CX7A 4RMGA 2WA2A 1TA0A 1YBHA 3WGQA 5C1BA 4MLCA 3A6KA 4AWAA 5ARCA 1FL9A 5FQOA 3EXHC 2NUAB 3OIDA 2X5XA 3NWEA 1K7YA 5TMBA 1B1AA 1ECCA 4UHEA 2QI9C 3CCFA 3TXYA 4EY4A 2EP7A 1TZCA 1KJWA 2FE4A 1V3QE 2ZJYA 3IMFA 4PLWA 4EPYA 4INOA 4LYAA 3NIFB 1TCVA 4TLCA 3G1TA 4AECA 3NDJA 1JWLA 2VT7A 1JU4A 4HEA1 4DLBA 3AR6A 4ZOBA 1XTIA 2JJYA 2OHIA 1GKLA 3AONB 1R9NA 2X0JA 1G3MA 2GVZC 4G67A 1DXYA 1LQ2A 1XTVA 2IZ6A 4WEQA 4OI4A 5L3RA 4BLOA 4HSEA 3G1WA 5IZCC 1KWKA 2H7XA 4N3AA 2FZ5A 1NUSA 1SUIA 1Q20A 2QZ4A 4FE7A 3RPEA 3IBYA 4MA0A 2XGMA 3TQRA 4NBTA 2CL5A 3GDOA 4HB3A 5JJKA 3KYIB 4EA9A 2IOYA 3SXPA 1U5BA 4XQCA 2RB5A 4EI7A 5C31A 3QU9A 2YRWA 4OU5A 2XB9A 3W06A 3GCXA 4KVGA 1GG9A 3BA6A 1RJGA 3VH2A 4XE5A 4PVDA 5BNFA 1Z5VA 3NCTA 2YWCA 3PUKA 4Y0NA 4JGBA 1U0TA 3UJHA 3GJYA 3RBXA 2C7PA 2JH9A 3NS7A 3KZOA 2GR9A 1PFUA 4NG5A 4BZWA 2BVNA 5IJWA 1UXJA 3IV6A 3DWEX 3L05A 4OA5A 1SHTX 3LX8A 4UOQA 1T3HA 1GN9A 2QUBA 1C30A 3IR7A 3UJ6A 2EFHB 3HDJA 3R5FA 2WYHA 4YJKA 3OA0A 1VSQA 3DDZX 1JHRA 3LVFO 4FD2A 2AG0A 4M7OA 3OWHA 2PWAA 5I01A 4BRWA 1WEKA 1OAAA 4K9PA 5YASA 3DFFA 5JI2E 4FIDA 5CK5A 3I2HA 2H16A 4R54A 4CQJA 1M1XB 4LQDA 1NN1A 3RYFA 1Q7BA 2ZITA 4MRMB 3VR4A 3WGVA 1L3CA 5BW5A 3ZK9A 3TBFA 1X6VA 4DG8A 1SD2A 3S1AB 3D8NA 2DR3A 4Q9NA 2IVFA 1DOZA 1WCV1 2C3UA 3TIFA 1GL3A 5LQDA 1C8VB 4G9GA 1VSTA 1SXHA 3TO5A 2NN3C 5AMXA 5H7XA 3U7EB 5K6TA 4MR9A 1FQWA 5D2CA 1WZ2A 1WSAA 2XMCA 3E7WA 3PQ4A 1MAHA 1BXRB 4FOOA 4RZUA 4A16A 1QDEA 2Z5LA 4PC1A 3RRBA 5KTTA 3N75A 4DUZB 2YOFA 4GZ5A 4Y2HA 1AUPA 3RSZA 5AQEA 2W2MA 3HXLA 1PYOA 3A7DA 1J7JA 1RKUA 3UK1A 4B3BA 1IPEA 3VMFA 2HT6A 1QZUA 3PX2A 2ZM5A 3RUAA 1C8LA 1EVEA 1GCOA 4Q7JB 1J1IA 1KZYC 3KHSA 2WU3A 4HNQA 1KDPA 1TM2A 1ZMBA 2CEKA 1Q77A 2RG1A 3ZHZA 3U16A 4YAGA 2XTMA 5JVDA 3LT1A 4QOJA 5DCUA 2R8EA 4HD8A 4HVAA 5L6LB 3ZIUA 3I9FA 2ZSJA 3VH3A 4OFZA 1JU3A 4I9FA 4WNIA 2IUUA 4ZZ1A 1U7TA 4F9EA 3ETLA 3HLYA 2A33A 5GJWC 3UMFA 4RD2A 1QFSA 1RWKA 4IDEA 2F3SA 1CVLA 4UJ5A 2AS0A 4E14A 3BBLA 3C6KA 2G07A 3C15C 2FGKA 1UINA 4L3WA 4LRTB 1RM0A 4UUOA 5JWHA 4FCCA 3S2FA 4XJXA 4REMA 4XD7A 1TT7A 4D43A 5AW2A 2C5LA 2I6SA 5EE0A 4MRAA 5ELMA 1K4MA 1E62A 1M2FA 3MINA 3A11A 2QN2A 3GV0A 2O2DA 2PGIA 3LBNA 2IIPA 3MSCA 3WA7A 2AD5A 2VDLB 1YE5A 2P30A 3IVGA 3DZFA 3AP2A 1FDTA 4DGQA 1ES9A 4OV6B 1QTRA 3T3DA 5ECYA 2ZJ1A 2VP5A 2HR1A 2AJDA 4NL4H 1OJLA 5E6RA 4TVKA 1TK3A 4O63O 5C8YB 4NBKA 1BWQA 4Z8XA 2ZEJA 3AEQA 5IHXA 2OHVA 3HMQA 4QTTB 3OX4A 3RJ9A 4ZK6A 2PM8A 1WDKA 3V42A 1ZXLA 2VLIA 1UOPA 2A5GA 2ID7A 3GP3A 4X61A 1DSSG 1ZWLA 2J9ZB 2C1EA 5EJ8A 1GPNA 3QVKA 3QPCA 1GZ5A 4NKRA 4OXNA 4S1WA 3HB5X 5EXTA 3UHAA 4CIVA 4UD2A 5I7HA 2IP4A 5JCZA 2G4VA 4BP9A 5ICSA 2C2YA 5BSFA 5KQPA 5C51B 1NVVQ 2ZYTX 4DZZA 7YASA 2IPXA 3LVQE 1NBHA 1O9BA 4HDOB 4B3TB 4J3JA 2HA0A 2H54A 4YGXB 2ZVPX 5I8ZA 4EI8A 4F96A 1DAFA 1JHVA 3CX8A 1LV7A 1Z06A 2EFEB 1QC5A 1A72A 3NHKA 2XYHA 1TCCA 3RVMA 1Z63A 1PEKE 2AOTB 4YP6A 2RGNC 4L6IA 2C5GA 1G7CA 2XCUA 3FCAA 4DRZA 1U80A 4BFUA 1BDJA 3SHTA 5GVSA 1BW9A 2ECPA 3GG2A 2Q3JA 1E9DA 1YS6A 4X6YA 1II8A 2OOKA 4G5YA 4RVUA 3WDLA 3EH2A 4AD8A 2NQ2C 2HPAA 4NCXA 4X7MA 4W4TA 1KAEA 1LDGA 3VPDA 1O96A 2QSYA 1PSWA 1JSXA 2AI1A 2HFJA 3C7AA 3IUEA 3VYSB 4CQMB 4MYSA 1UAGA 3STVA 1NNLA 1XKXA 4PAMA 5L7WA 4RCVA 5BMOA 2B2NA 3UH1A 4QG7A 1GGMA 1S8NA 4ETNA 2ZSEA 1VYHA 4MUXA 4BIMA 2AZMA 3PFFA 4OPMA 3PR1A 4YMUA 2X2OA 3DMDA 1O94C 1E7RA 3U5TA 1W36B 2XXJA 2SICE 3CVXA 3U4IA 2L18A 4I6GA 4LDZA 1OREA 5DGDA 4A0QA 3HK2A 4B4WA 3TLAA 2I7DA 3PC2A 3GZ4A 4BV3A 2LP4Y 3B38A 4R1UA 3BERA 3N58A 2EW8A 3FA2A 1PNOA 1BE1A 4RC9A 4N0MA 1D5WA 2P67A 3PENA 1B0AA 4ESEA 1KSJA 3A1UA 1E9AA 4F4UA 5LQKA 2FFQA 3SDBA 2W8BA 2J7KA 5CCEA 1JDPA 2WJ6A 3L06A 4M60A 1ZGJA 3G0CA 4R5MA 5E3HA 2V7TA 3SYTA 1QHGA 3SM3A 3CG4A 5IDYA 2RDMA 4WUTA 3LUBA 1WXFA 2NP6A 2X22A 1WR8A 5DBEX 1CY7A 4RMIA 1FZQA 4C3UA 4DV6B 1T4GA 2B25A 4V2UA 3B6ZA 4NS4A 4UVEA 5E2IA 1NRWA 2B2CA 2AYXA 2OLKA 3LCMA 3PPYA 4YRZA 4LFAB 3ZU6A 4QYMA 1I4DD 1K06A 2HYDA 4A2CA 1MVLA 4PHTA 1JH9A 1ND6A 1WLYA 3ZDDA 3CEMA 1G7TA 3OMLA 1FMTA 2HWUA 3RVLA 2VUSA 4IV8A 3PI7A 3HRKA 5F9HA 3ASUA 2HJSA 2RHCA 3BXHA 1XEWX 2IDKA 3F5MA 3SSAA 4HVLA 5KTMA 1A95A 2MSDB 3NBUA 3SR4A 5FA8A 2W71A 3TN7A 5HKKD 1V1MA 4YLEA 1YQDA 1P62B 1EWVA 1WULS 3HS3A 4Z4GA 2CUTA 1YQGA 2BH2A 2JI4A 1L2TA 3L6EA 3FWZA 3LLMA 4KDCA 4OSEA 1SIWA 2EU8A 2HPVA 1EG2A 4GDFA 1EVKA 1ZKDA 2WJWA 4LISA 4CN8A 1PV1A 1D0SA 1SKBA 4AXXA 3ELBA 3WLMA 4ZAYA 5IVKA 2AMYA 1OFGA 5KJCA 3NEYA 3KAJA 1K6XA 4ISCA 2PRYA 4QODA 4CPDA 3HVRA 1BN7A 4L5IA 3EIXA 1XCMA 2JGEA 1VHDA 4PFJA 1QAOA 2PMCA 4HRXA 1SU6A 1P7ZA 4Y2JA 1ZVVA 5D1NA 1Z4KA 3AMVA 4L8WB 5EZQA 4KIGA 4JMLA 4E03A 4WNAA 3LBFA 3O83A 4Y9UA 1BDBA 5LL6P 1SKMA 1FBTA 1NVWQ 3AHGA 4G85A 1GUBA 4IRMA 1GSAA 2X2PA 3FPKA 2WE8A 3DEAA 4Z0PA 2BGWA 2Z5VA 2B20A 5SYMA 1QF6A 1KGDA 5AYVA 2V7QD 3KWLA 2HDNB 4KL8S 2I4RA 4OF4A 4BEJA 4IHJA 1U28A 4ZO8A 1DXHA 5BN4A 2VQEB 1CZOA 4P6VF 2RKOA 5KINB 4XEUA 1RXUA 2GPWA 1EVIA 1SXPA 3U09A 2GNOA 5L4SA 5IUNC 1N2JA 1YE8A 2VUUA 4ZJZA 4BCDA 3HYCA 3FNEA 5JQWA 1GZVA 5AHXA 5I4IA 3LE8A 2P5SA 1Q14A 5I7UA 3H1BA 3H2IA 3QEMA 5B12A 2JATA 3ZQJA 1M7BA 5EIAA 1ZK2A 3K0FB 3NQ41 1E1NA 1L5GB 2GLTA 4TXHA 3GDGA 121PA 2CNBA 5IASA 1PVDA 2WY2D 3AP1A 3W1WA 4LCBA 2XT0A 1X8KA 5FJIA 2XUOA 2C3PA 1Q7RA 1U9ZA 3HCOA 5KJEA 1R8XA 4ECEA 2BR5A 1M1YB 4IDFA 1E6KA 2HK8A 1VCMA 2YY5A 3VJMA 1E0DA 1H1TA 3FHOA 2H0AA 1SHZA 2IBTA 3QE0A 3TLKA 1Z5UA 4G6ZA 1D03A 4CL3A 2W5UA 3ZX5A 2J3DA 3PPXA 4M2LA 2UZ0A 2C9YA 3BB1A 4C03A 4CCSA 1MMFB 5I9TA 2D1YA 3R5XA 3DTVB 3GLGE 5BSVA 4IPTA 5ECDA 2YL2A 1LWOA 3U1TA 1NTOA 2BR4A 5FPPA 3R3VA 1U0NA 4F12A 5G3YA 1PR1A 2AG8A 4EABA 3IAS1 4LWZA 3JCZA 1Q7TA 3O4FA 3N07A 1C4OA 5D6NA 5FULA 3SC2A 4DMMA 1F2TA 2PZLA 2Z1NA 3IJEB 4LYYA 5TR9A 4DJAA 3WQRA 4F9TA 2PKRA 2Z2ZA 3BHNA 5CD9A 1GPBA 3O8QB 4RIIA 4DPMA 2C2XA 4N39A 4RTRA 4E46A 4Q1CA 1TJ4A 3ND9A 1G8PA 1DIAA 1SB9A 2DH6A 1FYEA 1FBNA 1T4CB 3O9VA 4F3NA 4MQUA 2X5OA 1JEOA 4OIFA 3QFSA 4O2RA 1DQSA 4CKBB 2FSSA 2VHXA 4NECA 2PH7A 1IH8A 1L7DA 2DSTA 3FUUA 2EP8A 3MK31 4QJ4A 1N77A 4DHWA 5KTSA 1OWNA 2B94A 3PXGA 5A7HA 3V1KA 4MZDA 4LY3A 5GONB 3RYCB 5U4XA 2M1XA 2Q0XA 3VYRB 5DTMA 3WIDA 3FWYA 4MQEB 2Q5LA 2VPQA 4PNHA 4GOLD 3GLVA 4KPUA 2CCJA 1QTIA 1SVSA 2WDPA 3AZQA 5EJMA 3F6SA 4GD3Q 4NP6A 3AR4A 4GDMA 3K4QA 2QAGC 2QD5A 1IOZA 2GJ4A 3ENQA 4NBLA 5JUWA 5LYJB 4K2HA 2P0YA 1NMSA 3B5EA 1ZRSA 2OSVA 3GDHA 1J4AA 3ND6A 4EI2A 3D2AA 4RIEA 5B2ZA 3ZGXA 1XC7A 2VTVA 4RTMA 4LJ4A 5C5CA 2ZDHA 3N6RA 3L92A 2JKZA 1GXSA 1VGVA 3A28A 4RJ2A 2VNAA 2C42A 4MJ7A 4MGKR 3QUTA 2C8JA 3KQHA 2L17A 1A96A 5B53A 1US8B 3SLRA 3TQSA 4BGUA 2E3JA 1KP3A 1DIRA 1NC1A 1ZQ9A 3OT5A 2GFQA 2GTPA 3BXXA 5DI9A 4ZAVA 5AXDA 5IAKA 3U4GA 2X42A 4U6NA 4BTVA 4E6EA 1V9LA 1XJQA 2RBEA 2VAXA 4C6TA 4ZK2A 3ELWA 4DCMA 2C99A 4V0MA 1S2DA 2C58A 3MGBA