1BXZA

Crystal structure of a thermophilic alcohol dehydrogenase substrate complex from thermoanaerobacter brockii
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
352
structure length
352
Chain Sequence
MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAELADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLVTHVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADP-DEPENDENT ALCOHOL DEHYDROGENASE
publication title Crystal structure of a thermophilic alcohol dehydrogenase substrate complex suggests determinants of substrate specificity and thermostability.
pubmed doi rcsb
source organism Thermoanaerobacter brockii
total genus 104
structure length 352
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 1998-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1bxzA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1bxzA01
3MJ4A 4B3HA 3B70A 3I9LA 2YHIB 4GWGA 1X13A 4E21A 2X0JA 3ITDA 2H63A 3IS3A 3QVSA 4B79A 4CR7A 5IFLA 1QYWA 2W8ZA 5G0SA 4EGFA 2RCYA 4QFCA 1OMOA 3RKUA 1A7KA 3BMNA 3K31A 3VZQA 1HDYA 4Z0PA 2YUTA 3LK7A 1LDEA 5EQDA 1ZIDA 4B7UA 2VZ8A 1F0YA 4KTVE 3V8BA 2O3UA 4GVXA 1RM0A 2WTBA 3HJAA 3V2GA 3WBBA 4QSMA 4A27A 1K6XA 1LSUA 3ZDFA 1EEHA 4UUNA 1U3VA 5IDXA 2Z1MA 2OP0A 3KV3O 4IIUA 1ULSA 4CM4B 5EQFA 3FPLA 5U9CA 3HG7A 1LQUA 4CLEA 2W4QA 2E6UX 4ILKA 4LMRA 1CERA 4N5LA 2VTDA 3HB4X 3BA1A 3UHAA 3NT5A 4R51A 3A06A 4BQPA 1RPNA 2PTGA 5JAMA 1I36A 4QEDA 2DTDA 3E82A 4CMIB 2Q1SA 2Z5LA 1MB4A 2I9PA 4K28A 1DSSG 2VWHA 1GEEA 5MGBA 4NFYA 2NQ8A 3ORFA 4XRGA 2BRUA 1R0LA 2H9IA 2JL1A 4YACA 5C7LO 2GZ2A 1Y1PA 4E5MA 3FN4A 5K6AA 4DGSA 3E9QA 4K26A 4DPMA 4J4TA 4BO5A 3G3EA 2EW8A 5I9NA 4EBFA 1HEUA 3KTDA 4XIJA 4DVJA 1PJQA 1F8GA 3DAPA 4R69A 2ZKLA 4TMFA 3SC6A 4YXFA 4BO3A 4LCJA 1ZW1A 1E3WA 2BGLA 4AJOA 4ZQBA 3WJ7A 1HDOA 1E92A 1M6HA 1WVGA 4P22A 4XB2A 1O8CA 3H5NA 1CYDA 3D64A 3QV1A 3S2IA 1LRLA 4LRSB 1RJWA 1IHXA 1RYDA 3MCVA 4Y98A 1WNTA 3L4BC 1KVQA 1PIWA 1UAGA 1NX6A 3H2SA 4PZDA 3DO5A 3S2FA 3T7CA 7ADHA 1Y9EA 1D1SA 3VZSA 4FOSA 2E37A 4AVYA 2GLXA 4A26A 2V6FA 4DQXA 2C5AA 3JYLA 4DPLA 1WMBA 4R01A 8LDHA 2YFHA 1LQTA 3BHMA 4IXWA 3RIHA 4DBZA 3PHHA 1BXGB 3WGQA 4L0QA 4HV4A 1LU9A 2OORA 2HAEA 1HL3A 4YQYA 4L73A 1YQGA 1EQUA 4F46A 1ZK1A 3WTBA 5JXWA 1WDMA 3P2OA 1YB5A 3JQ8A 4O63O 3MJVA 2PFGA 3PI7A 4WE3A 3GNQA 4R4JA 4AJEA 2W2KA 4GWKA 4FPXA 1P33A 3GLQA 2ZYAA 2P5YA 3ZV4A 3INTA 1B3RA 1HZZA 3NTRA 2C54A 2Q2VA 2WD7B 3EZYA 4WCFA 3K9QO 2ZB8A 2OL4A 3RCBA 4XQCA 2VUUA 4HX5A 4NJMB 2YQ5A 3PEFA 1NQOA 3U49A 1GL3A 5EERA 2JJYA 1FK8A 4TVBA 3RU9A 3F46A 2B5VA 3D5TA 5KVVA 1E7RA 1LDBA 3MJEA 1IB6A 4UUPA 2Y66A 4UUOA 4WLEA 4WLOA 3AUTA 3W4JA 1EFLA 1WMAA 2CVZA 1A7AA 3LC7O 2C5EA 3M2PA 4CMEA 3GN1A 4D0SA 4HY3A 5DBGA 4QECA 3O4RA 5DCWA 5L53A 1MXHA 1QR6A 3T7EA 2FSVA 1DC5A 3C85A 4M87A 4MVJH 3WWYA 1IHYA 4ALJA 3KSDO 4D41A 4N5NA 3ZU5A 2QW8A 4W9NC 1Y7TA 4J9UE 5DT9A 5TJ9A 1YJ8A 4UVGA 3KLMX 1RYEA 1I5RA 4IDEA 3ULKA 2I3AA 1EBUA 2Y93A 1G1AA 1ZK3A 3KYBA 4E5PA 2EJVA 4BNMA 4YAKA 1TXGA 3K73O 2VRCD 1QG6A 1YE3A 4FQ8A 3TPCA 3VPHA 3WICA 4MVJG 4E13A 2NSDA 4Y9DA 5T6BA 4AJ2A 3AWDA 1AHHA 1XA0A 1N92A 2DPHA 1KEWA 1KIFA 4U6SA 3ZWNA 2J3KA 3ZNPA 1YRLA 1TI7A 1T2AA 2VCYA 5JDIC 2O50A 2VNSA 1U8FO 4QQRA 5G4KA 1I30A 3SXPA 4IDGA 1U5CA 5JSFA 4UVHA 3ZN2A 2BFMA 5I8WA 4DYVA 1XQ6A 2PGLA 3JQFC 4YEDA 3INRA 4TRNA 3W8DA 1I3LA 3H6KA 1IZ9A 3PHLA 4GQAA 3TFOA 1GV0A 1VL8A 2Y0EA 2C2XA 1W6UA 5IN4A 1O9BA 4JX8A 5F1KA 1GQYA 4NU5A 3ZHBA 1WZIA 1IY8A 1W8DA 3IAHA 4J0FA 4P4NA 4E33A 3VH4A 1JVSA 3RASA 4CL8A 4R54A 4AJLA 5JC1A 3LT2A 3LF1A 2Q50A 4IQGA 4MDHA 3WX0A 1NPTO 3QLJA 3Q6IA 2AQHA 4B8ZA 4MVJD 3DAFA 4WLFA 2PKRA 4L74A 2IYOA 2HRZA 2QX7A 4CM9A 1E3JA 1PJ3A 2JCVA 2Y1EA 4IDBA 2W90A 5TLSA 1ADBA 3PWZA 3PWKA 1ENPA 4Y6RA 1DIAA 3ETEA 4EDFA 4FFRA 1V35A 1ZSVA 4BHTA 1DOHA 1ZO8A 3FPCA 4Z0HO 4MVJM 2XPCA 3VTFA 1HF3A 4JP3A 4IJVA 2I3GA 1BVRA 1E3SA 4NFSA 3C24A 3PHJA 2CFCA 3X2FA 3U4IA 3E5MA 3NGXA 4W99A 5FEUA 1E7YA 5JY1A 1U1IA 4YAIA 4A2CA 4BGIA 3WGGA 1PWXA 3CSDA 3GC6A 1I2ZA 1OOEA 3TZHA 4DLBA 3F5QA 4GGOA 3TSCA 4BGUA 3E8XA 3DHEA 3LT1A 1RM3A 1M75A 4BV8A 1KEPA 1FDUA 1VSVA 3STHA 2GO1A 3T4XA 3TL3A 1N9GB 4TSKA 1R4MB 1LXCA 4NJOA 1U3WA 1WDKA 1NNUA 2HMWA 3BHJA 1TA4A 3U9LA 2DTXA 1E3EA 2VUSA 1HLPA 1X7HA 4Z6KA 2LDBA 3GRKA 1PQPA 5TC4A 3S8MA 4BGEA 3QWBA 3W4IA 3PJEA 4GX0A 4D0RA 4DWVA 1C1XA 5I8ZA 5JAIA 1T2EA 3NRCA 1HDZA 2DKNA 3FWNA 5DOZA 3ITKA 5DBIA 3G0OA 1U28A 4XYBA 3L77A 2CMDA 1Y81A 4JCOA 4UULA 4YJGA 2CF5A 3OQ1A 4WNIA 4OXNA 3RFXA 3BMQA 3GN2A 2VYND 3Q2IA 1ZEJA 5EESA 3Q1LA 1CEQA 1DXYA 3K8ZA 1SOVA 4PZEA 3DMTA 5T5QA 4RVDA 3OECA 4DIFA 4YRDA 4NZ9A 2NVBA 1EUZA 3GQVA 5G0TA 1P0CA 2BFPA 3NDJA 4BNIA 5HS6A 2Q1TA 4LN1A 1QP8A 4FW8A 4R1NA 1PS9A 3RU7A 5CP8A 3I9OA 4QX6A 1C0KA 5C7OO 5JLAA 1OBFO 2HQ1A 4EI2A 3IUPA 2AQKA 3NEPX 3UICA 4PG5A 1X15A 3TDKA 1T26A 5GZ1A 2Q4BA 3GZNA 3SEFA 5KTKA 3S1LA 4TROA 1CRWG 4GMFA 4RPKA 1PGNA 1ZMTA 3GVCA 3F9IA 3QQPA 3WJAA 1OI7A 4I5FA 1U3TA 2UYYA 1ID1A 1P45A 2JHFA 2O7SA 1I32A 3D4PA 3BTVA 1NYTA 4E31A 5TGDA 3A14A 1KVRA 3GDGA 4A03A 4BNYA 3DBVO 1ZEMA 3W6UA 3PYXA 3ZGYA 5AQ1A 4HADA 3BMOB 2YYYA 3WGTA 4ITUA 5JCJA 4BNHA 4LVUA 2HK7A 2QZZA 4BNFA 3OIDA 3RFTA 4PG8A 1TT5A 1MP0A 4E5KA 1FJHA 2QHXA 4QO8A 4WECA 1KOLA 2Y68A 1DPGA 3A9WA 2YDXA 4EUHA 4RGBA 1H2BA 4W7HA 4R1TA 1ZBQA 4TRJA 5JPIA 2P2SA 2ZK7A 1VLLA 4XKJA 2H5LA 4OSOA 2VHZA 3RWBA 2HO5A 4IJUA 4BKRA 4AJPA 2OHXA 4UVIA 5CG1A 1E1NA 2A9FA 2J5QA 4NU6A 3ZWOA 2X0RA 5C5IA 1FMCA 3MTGA 1SC6A 3PFWO 4B8WA 4PLZA 3DTYA 3ZV6A 1F12A 3PDJA 3PXXA 1NPYA 2WMDA 5F1PA 5JW6A 1DLIA 1ULUA 1QV7A 3OJLA 5TX7A 3QWAA 4FSHA 1JLLA 2HMTA 3DZJA 3LLVA 4BNVA 3KYDA 4GGPA 4U0KA 4DREA 4XQ9A 4YBZA 5IDYA 1U3UA 3D0OA 3JQ8B 4K6CA 2JD2A 1YS4A 1L1FA 3ENKA 1N5DA 1E7MA 2GCGA 3PZRA 4RPHA 3IUSA 2I6TA 3KYCA 3HN2A 4I9UA 4AJKA 3VPFA 2EGHA 4AG3A 3JQFA 2QRKA 1UR5A 1DIRA 1DIHA 3AM4A 4PG7A 4WCFB 4WLVA 3SLGA 2VQ3A 3RI3A 3MWDB 5MDHA 3RD5A 1M2WA 2O4UX 2Y0DA 3JQ9A 3TZCA 4Y6PA 2FP4A 5F5LA 2QRLA 4CV2A 4WOKA 3PYMA 3RJ5A 1N1EA 1ZK2A 4S3MA 4E30A 1MA0A 4FD3A 1TT7A 2IZ1A 1NFQA 1K0UA 2J3JA 5AYVA 5K1SA 1DLJA 3PQFA 3ZW9A 5A9RA 1YBMA 1GUZA 5IG2A 3HSKA 3GY0A 2ZQYA 2NTJA 2R6JA 2UUOA 4D44A 5TT1A 1T2FA 1ZVMA 3UXYA 3P5SA 1F17A 3LZ6A 3VH1A 4DL9A 4YT8A 1Y9AA 2VYNA 4XB1A 4UUMA 3RJ9A 1DBVO 2FZWA 3EZLA 3M1AA 1ISMA 1LBEA 1FF9A 5GZ6A 1GCOA 2D8AA 2PZKA 5AXCA 5U1PA 3WMWA 1K89A 3DDNA 3VVBA 2YZ7A 3GUCA 1R4NB 3KZVA 3HDYA 2HMVA 2Y1FA 4ZRNA 3G79A 4E2YA 3TZ6A 4Z3DA 3KVOA 5KJFA 4AJJA 3JQAA 2DBQA 2X7HA 5TNXA 2A94A 2X6TA 5TJHA 3UCFA 3AOGA 2JCXA 3L4SO 4NI5A 1E1LA 4DA9A 1IPEA 1YKFA 1C0IA 2VZ0A 1B16A 1PL6A 1U7TA 3K2BA 1H2HA 3ZWXA 1I2BA 2E4AA 3C3XA 5G4KB 2I76A 3AOEC 4KWIA 4ZQHA 4IDDA 5BT9A 1UZNA 3AJRA 3F5SA 1EK5A 2PR2A 1Q0HA 2C29D 1UXIA 2VNAA 2GZ1A 4PIVA 2F1KA 4Q3CA 3QIVA 3ZZNA 5ICSA 3RFVA 1DRVA 1J0XO 4QXMA 4OXKA 4Z0TA 5JDCC 2Q2WA 3C7DB 3NJ8A 2R00A 4N18A 3MOIA 4BO2A 2NTNA 3I6IA 1H6BA 1KYQA 2V7PA 3JYNA 3V1YA 1LA2A 3C7CB 4B4UA 4M1QA 1SEPA 5L40A 4BV9A 1DC6A 4BOYA 1GEGA 2FMUA 2RHCA 5I9LA 1Q7BA 1K5HA 4Q3NA 1T1SA 2WM3A 1LDGA 1XGKA 3DFUA 1QYCA 5DULA 1ZK4A 5DZSA 4W4TA 2EGGA 3HHPA 1PJ2A 1B7GO 3DB2A 4DRYA 1IYZA 4E12A 2P9CA 2PGDA 3PQDA 3GPIA 1YQDA 3GOHA 2SCUA 4YRBA 2IRWA 2BF7A 1IPFA 4G81A 4JBIA 3U4HA 1N8KA 1Y5RA 5DBFA 1UXGA 1A71A 4BNTA 5A3JA 3WGYA 3TRIA 3CKYA 4HUJA 1YL5A 1MLDA 4CQMD 2BI8A 1LC3A 1U9JA 1ZMOA 2V6GA 2C7GA 1EZ4A 1SBYA 4KDFA 1H93A 1P1IA 1ZSNA 3BZUA 3OEYA 4QO7A 2I66A 5ILGA 1UXJA 1T2CA 3OSUA 2DLDA 2Y1CA 2DFDA 3C8MA 3E9NA 3GDOA 2NU9A 3CH6A 4WGGA 5I7SA 5CAEA 1W4ZA 1AUPA 1LLDA 2DPGA 1VJ0A 1EUDA 2HCTA 1XYGA 1UDBA 2O3RA 1E0DA 3S2EA 4GKBA 2B0JA 2J3IA 2W2LA 2EEZA 2ZTVA 4D79A 3OHSX 1R37A 4ZU3A 2FWMX 1DAPA 3R6DA 4RF3A 4YA6A 4I08A 4MVJP 2DBZA 1Z7BA 3OJOA 3RAJA 4CMJA 2DQ4A 1C1XB 1SPXA 3OP4A 3OJ0A 3U62A 3UVEA 1LSOA 3VKUA 4ZQFA 4KTTE 4E3ZA 5IXSA 1E5QA 3WIEA 3VZPA 5JE8A 2ZTMA 1O89A 1Q0LA 3PQEA 2JD0A 5TIIA 1C0LA 1H5QA 4NBTA 4AL4A 1VKOA 3CZMA 2EXXA 3JD1A 3WNVA 4E2WA 1X0XA 3BMQB 2E49A 1HXHA 1PGQA 3JTMA 3TFQA 5HWSA 3I52A 1YJQA 2P68A 3D4NA 4ZICA 5A5EA 4CM6A 5T8KA 5HM8A 1HYHA 2EHDA 3EGOA 4FFOA 1B14A 4MINA 4ZGWA 1HT0A 1J49A 4O5OA 5EN4A 1PJBA 1YDWA 9LDTA 1KEVA 3EY4A 1LC0A 1GPDG 3HFGA 4F6CA 1AXGA 3DTTA 4YJHB 5DCUA 3CMMA 1XSEA 1VRWA 1SB8A 3JQBC 3LC1O 4AJIA 4YWJA 3FNFA 2X22A 1XU9A 4FOOA 2XAAA 1H94A 3JD2A 2X5JO 2ZQZA 3GZNB 1D8AA 2EV9A 4O1MA 2FPPA 2FOIA 3PJGA 4GI2A 3WDSA 4AJ4A 1NQTA 1GZ4A 3ANLA 1EFKA 2G17A 1NHGA 3OA0A 4UEJA 4RF5A 5IZCC 4IDFA 1IZ0A 4J91A 2H1SA 4MKRA 3WGOA 1EVJA 4OYRA 1QRRA 4B7CA 1ZKMA 2EJWA 2GGSA 2ZYDA 2JFHA 1IE3A 1M67A 4TZTA 2B4RO 1B2LA 3O26A 3UAGA 2VTEA 1YBVA 1MFZA 3DOOA 4RQTA 1Y8RA 1QYDA 1JTVA 4BGVA 3RUHA 4BO4A 3DAGA 1ENZA 2Q46A 4CM9D 1KBZA 4IGFA 1ZFNA 3LF2A 4NR0A 1O94A 5L7TA 3GVIA 4FFLA 2IXAA 2YY7A 2GRAA 1ZSYA 1TT5B 4EEXA 2YQ4A 2EKQA 4HNGA 4XR9A 1PJCA 4FN4A 3BMCA 1V0JA 2X23A 2QYTA 4GLOA 3ZHZA 2EKLA 4ZQGA 4HWKA 1LX6A 3ZCXA 1XELA 3FRJA 1Q7GA 1Z73A 3NYWA 3O9ZA 1E3IA 5BNFA 4FS3A 3LT4A 3QWHA 2X5KO 2P91A 4BO6A 5CFZA 2VWPA 1GYQA 1UJMA 4XEHA 3TJRA 3ZNOA 5KVCA 1VE9A 4RORA 4MO2A 1C1DB 2JKVA 1RWBA 4N54A 3LC2O 1QYXA 4XWYA 4CQMA 2FPGA 2FR8A 1I3NA 4G2NA 3VDQA 1O6ZA 4DMLA 1A9ZA 4CQLA 2Y0CA 5FF9A 5G0UA 1PZGA 2PZJA 4PLHA 2I99A 3Q0EA 3KYDB 2Z1NA 3VH2A 2PWZA 4NNJA 1QLJA 3OQBA 5GY7A 4D3DA 3SX2A 4B4VA 4ZQEA 2PD6A 1B8PA 1HSZA 1O5IA 3OJEA 4CR6A 2I65A 2TMDA 4TKLA 3KYCB 2ZB4A 1E77A 1MXFA 4FC7A 2WYWA 4AJNA 5HTOA 1NWCA 2GF2A 1XKQA 2GUGA 4Q3DA 4K9DA 4OAQA 2JCYA 3JQ7A 1E5LA 2Q1WA 3N7UA 3H5RA 3TL2A 4LK3A 4XQGA 4MP8A 3GR6A 1UP7A 3WIDA 4UEOA 4IUYA 4CM1A 1I8TA 5KWEA 5H81A 1SCUA 1F14A 3RVDA 4JJIA 4PG6A 1J5PA 1BVUA 1FDWA 4WNCA 3RBXA 4M89A 3WGIA 3PFFA 1VL6A 3TF5A 5CDUA 5DN9A 5T57A 1I2CA 1LEHA 1DO8A 3QVXA 1CDOA 2PZLA 3GPDG 5H83A 4ZD6A 1PTJA 4LSMA 4L8VA 5KKAA 4JIGA 5A3VA 1ZH8A 3LU1A 4NQZA 3WFIA 5JC8A 3RKRA 5G0WA 4Q39A 5L4NA 3DFZA 3H9EO 4B4WA 5ILOA 2F00A 4HP8A 3ZWPA 4XRRA 1IULA 1VI2A 4PFJA 1GY8A 4YJFA 2BFOA 5AXDA 4BMNA 3ADPA 1H6CA 3R1IA 2GN6A 1P31A 3V2HA 2DFVA 4CUKA 2POQX 1P1JA 3DOJA 3JQAB 3LLSA 5BSGA 2O2SA 1PL8A 3NKLA 4R41A 1QSGA 2J5KA 1VPDA 3NGLA 4RL6A 4RF4A 1T4BA 3HUDA 4JGBA 3OFSA 3U0BA 4NIMA 3D3EA 3O03A 1Z75A 4RDHA 3SLKA 2VT3A 4CM3A 4GAEA 3Q3CA 4JNKA 4BKPA 2DAPA 1BTOA 1P3DA 4CV1A 1B0AA 1U2DA 2D2IA 4FCCA 1I3KA 4J49A 4WK6A 3ZHYA 2C20A 3FD8A 4JXKA 5HBRA 4S1VA 1XWFA 5JCJD 1PJTA 2B83A 4DTIA 2OOSA 4NG5A 3I9JA 5COBA 5KNLA 1DFGA 1PU2A 5LDGA 4BO7A 2FHSA 3K5PA 1I33A 4E2ZA 2AG8A 3JQGA 3W6ZA 3A28A 1LDMA 3DZHA 4H16A 2AG5A 3KO8A 1K2WA 4GX1A 3GFGA 2YV3A 2B4TO 3M1LA 1WWKA 1DJQA 3ANMA 3NTOA 4J4HA 1SMKA 2G1UA 2Y05A 3I4CA 2JFFA 2O3TA 4BNKA 2RH8A 4YTEA 3MZ0A 3RBZA 4Q3BA 1JKJA 3AUAA 4XIYA 2P5UA 1HYGA 1LDNA 1Y8QA 3ZU2A 4A5OA 2D3TA 1I3MA 4MOWA 1NVMB 4U8GA 1JDJA 1UAYA 1A5ZA 2OBNA 4J3FA 3WNQA 4PN3A 3RC9A 1TVEA 3VPGA 3PJFA 3GAZA 3RROA 1UP6A 5JY6A 4GX5A 4O6VA 2GN8A 4NBUA 1Q0QA 3WGZA 3BXXA 2QZ9A 2BFAA 4RLSA 4R5MA 4I5EA 1GZ3A 2NU8A 1BGVA 2G5CA 4CUZA 1U8XX 4R16A 2VN8A 2C07A 1I01A 3WOHA 1KC3A 3ENNA 4KOAA 4OO3A 1E1KA 3JD3A 1DHRA 2WJPA 5L4SA 3VH3A 4AJHA 4M8SA 2AEFA 4RO0A 4KUHA 1Q7CA 1ZUD1 1BSVA 4FJ0A 5ITWA 3AY6A 1DHTA 3HNPA 4JJGA 4UAGA 3SC4A 4BNNA 3I83A 2NACA 3RC2A 2Q2QA 4XYMA 4DUPA 1X7DA 4JQCA 1H0KA 2V65A 2Q4EA 5A05A 4YJDA 4CR8A 2AA3A 4R9RA 1C14A 4J7UA 4D45A 1ENOA 1GQQA 2IEDA 4GBJA 3BMNB 3PGXA 1EVIA 1EVYA 1HE2A 2CDCA 3FHLA 1U4OA 3QRWA 5F5NA 3L4BA 3CPSA 3ETGA 1UXHA 5A9SA 2WEKA 1NQAO 2DUUA 2W98A 4XYEA 3TNLA 3DBRA 5TQVA 3KHUA 4PRKA 3HZZA 2QRJA 5JCXA 3IC5A 5K9ZA 3W8EA 4FGSA 4J16A 3COSA 2Q3EA 3P7MA 4QT0A 2OBYA 1AXEA 3U09A 1EDOA 4LCEA 2CY0A 3JQAD 2NV6A 1LSJA 2FR0A 3D4OA 3NDIA 3VC7A 3VOSA 1LLUA 1N2SA 1XHLA 3KXDA 4ESOA 4B7XA 1EDZA 2VYVD 3ZU3A 3JSAA 4CM4A 1O95A 4CLOA 2Y1GA 3OMLA 1PJ4A 5TF4A 3SJUA 1E6EA 5CDGA 5CHEA 3IQDB 4YPOA 2XXJA 4CJXA 3PIDA 3U3XA 4J7XA 5IAAA 2X9GA 3GH3A 3UCXA 5LCXA 2VT2A 3OA2A 5L45A 1EVZA 1DC4A 4DIBA 3QVOA 1C0PA 3PHGA 4G5HA 3TZKA 1PJLA 3Q2KA 5IDWA 1PS0A 3E48A 3UH1A 2RBEA 3NJ4A 1H9BA 2UV8A 4UVDA 5CEFA 2OO5A 1PJSA 4I9HA 4F3YA 1Z6ZA 3QHAA 2O23A 3G1UA 4YT2A 2EP5A 1AE1A 1E3WB 4L4SA 3ZWBA 4Z9YA 1JQBA 5JS6A 4IS3A 5CEEA 1Y8RB 4ND1A 2PLAA 4RVFA 1R6DA 3OIFA 1S7CA 4PLCA 5CDSA 4XZ3A 4MIYA 4BS9A 4PVDA 1PQWA 3F47A 1M6WA 3QVTA 3PPIA 1KVTA 1YB4A 4BL5A 2CF6A 4CV3A 4D42A 4W9NA 1N7HA 1MC4A 4RJTA 3FBGA 4IGEA 2GN9A 4J7CA 3QWIA 2EF1A 2NWQA 4P8RA 4I5DA 3FTNA 3ZWAA 3R3JA 1EE2A 2EW2A 4XX0A 2GN4A 3BMCB 5B37A 3C7AA 3IL2A 4XCVA 4DIOA 4PLWA 4OL9A 1D4FA 2OUIA 3GGPA 1DC3A 1FDVA 2PKQO 3N58A 2X1HA 5HRUA 2PH3A 1VSUA 1ISGA 3I6QA 3PGJA 1YO6A 5AXBA 4P4GA 5I7VA 1A72A 3I9MA 1BXGA 3LQFA 3V5NA 3I9NA 2PNFA 4YCAA 4B3IA 2FR1A 4URFA 3SJ7A 1JW9B 2Q99A 1QKIA 5I7FA 3AM3A 3OJFA 5TT0A 4R1SA 4RCVA 1LJ8A 5JDIA 1BDMA 2WYVA 4KUGA 2W2KB 4CQMB 4FFPA 4CLRA 3B6ZA 4LMPA 5FYDA 2O3JA 4RPGA 4CQLB 4IQ8A 1KY5A 3WR5A 3ZWVA 4FFMA 4IDCA 3EHEA 2QQ5A 4DC0A 2C82A 2VUTA 2W2LD 5CPBA 5L3ZA 3C1AA 3DBLA 2WD7A 1EK6A 1ADGA 3KM0A 1NPDA 3WQRA 4BKOA 1V3TA 1T25A 3ZU4A 5CPFA 2PZMA 5G4LA 4BMSA 1OC2A 5K6AC 3FI9A 3JQ7B 2NVUA 3GVPA 3ZV3A 1OFGA 4ALIA 2YV1A 4YVFA 3EUWA 4BIIA 4CM5A 3A4VA 4CLXA 4WOJA 4Q9NA 3WTCA 1HWYA 1MG0A 5BSFA 4OQZA 4YT4A 2O3SA 1X7GA 4BO0A 5ENDA 3ICPA 4MVJI 2J3HA 4XGNA 3ONFA 1WPQA 5U4QA 1K6JA 2HKIA 3K92A 2XOXA 3WG9A 1NP3A 1T1RA 3QY9A 1L7EA 1PQUA 1MX3A 5A02A 4HFMA 3FSRA 2AEMA 2OP1A 5KOIA 4CM8A 2DBVO 1U7HA 1ORRA 3ROPA 4YYZA 1HE5A 2C7VA 3O8QA 1LTHR 1MUUA 2WDZA 4BNWA 3LSYA 4GVLA 4PLPA 5COQA 1YGYA 3I5MA 3DZIA 3JYPA 4XYGA 3WQSB 5IF3A 1XIVA 5ITVA 2VYVA 4XDZA 3KRTA 2D4AA 3E03A 2H6EA 3FTPA 4L75A 3X2EA 4E6PA 3GDFA 5KJCA 1Z74A 4NPCA 4F45A 3IJRA 4IDAA 3KB6A 1Z82A 2CVQA 3OEWA 2X8LA 3ZWWA 2VWQA 3B20A 4P4LA 3L9XA 3RC7A 1DIGA 1BHSA 2VOEA 3GNTA 1PEDA 5IDQA 3WYBA 2J6IA 2BH9A 3CINA 3PJDA 3GG9A 4ND5A 5L9AA 2PGJA 2YFQA 4PLFA 4PGFA 2B37A 4U7WA 3LT0A 4AICA 3HDHA 4Q3AA 5H82A 1KERA 3VAZA 1PSDA 3CXRA 3DHNA 4LGVA 3GT0A 1GDHA 4IQ0A 4BQRA 3P2YA 1UZLA 1MC5A 2O7QA 3OBBA 4WCFC 4RV9A 5JBIA 1VL0A 4OKNA 2B69A 3FWZA 1YL6A 4INAA 1I0ZA 2AQ8A 1ARZA 4MPDA 3RUEA 1GFSA 1T4DA 3SVTA 1WDLA 4R3WA 4IBOA 1U4SA 3KSUA 5FFFA 2X4GA 5T67A 3DOCA 2PD3A 2IODA 4ALMA 3ICCA 1P1FA 4BMVA 1GYRA 3NAQA 2RHRA 1V6AA 1P9LA 4OIMA 4O0LA 5ADHA 1HE3A 3JQGB 5B4UA 1CF2O 3MWEB 2FRDA 2CZCA 1YB1A 4CMEC 3DBHA 5HS4A 1NBOA 5GZ3A 4WPGA 3T4EA 3ANNA 4XR4A 2P4QA 2ZTUA 2A92A 4MVJF 1XLTA 2FZEA 2NQTA 2BI7A 1NFRA 3IIEA 1ONOA 3Q11A 5COAA 2ZCUA 3BTUA 1AGNA 1P1HA 1Y8QB 1HRDA 2NNLD 3H65A 5AXAA 4ALLA 2WYUA 3PK0A 2EIHA 2RIRA 3C1TA 3AUSA 1PL7A 2FPIA 4GPD1 5A06A 2DT5A 1GCUA 3BYZA 3GA0A 4EEZA 1VKNA 2NLOA 1LI4A 2I5PO 4J6FA 3RUDA 2B4QA 1J6UA 1UH5A 4CM7A 3UF0A 3VKVA 1GV1A 1HE4A 1ZNQO 2RH4A 2ZJ0A 4A10A 1GUFA 1X1TA 4HFRA 4E2XA 1QLHA 4CLHA 4W7IA 4DMMA 4MVJE 2JAHA 1O0SA 3K30A 5GMOA 4M55A 3H9UA 2OGUA 3RC1A 5B1YA 4HXYA 1UZMA 1RM5A 4FBGA 1XEAA 4ND3A 3AI3A 5JNLA 2DC1A 2VWGA 4WJZA 3ZWMA 5T64A 4TVOA 5IN5A 3H9GA 1Q2XA 5FWNA 4YB8A 3I1JA 4HNHA 4DLLA 2PA3A 1LNQA 2GR9A 3WGHA 3CUKA 2DM6A 1PWZA 4E0BA 4BKQA 4PVCA 1V9LA 2OMEA 6ADHA 1D1TA 4FC6A 3FCOA 3D5QA 5JYEA 3OH8A 3RUFA 1T2DA 3KETA 2YW9A 1VJ1A 4E32A 4YJGB 2VOJA 4IINA 3UW3A 1GR0A 1OZAA 4J1NA 3E9MA 4EJ0A 1B3BA 3EW7A 3DZGA 3Q9UA 1F06A 4ZN6A 4LSWA 5A9SB 3HN7A 3IOYA 4PRLA 2X0IA 3DBRB 1NWHA 3DEYX 3JD4A 4QTZA 1SOWA 4ZHSA 2BHLA 3CTMA 2WE7A 1ISJA 2C59A 1WAMA 3TQHA 2NVWA 1GZ6A 4OHUA 3CZRA 4AFNA 4BO9A 4J1SA 3GEGA 1YWGO 1X1EA 3JQEA 3L6DA 4D46A 1Y5MA 4IIVA 9LDBA 3FR8A 3I23A 3MTJA 1JWBB 3RUAA 4TZKA 1YH3A 3AK4A 4RVSA 3DR3A 4Z3KA 4RVGA 4EJMA 1N1GA 1WLYA 1SZJG 2PV7A 4CLOB 5JO9A 1W0CA 1U2GA 1ENYA 4ND4A 4K6FA 1QV6A 2VHXA 3HADA 4FIZA 5BQFA 2OXIA 5EPOA 4N7RA 4A0SA 1NAHA 4QUKA 1YL7A 3AU9A 1UDAA 3GGOA 1K3TA 4BO1A 3EC7A 3HWRA 3I4FA 4PLTA 3A1NA 2V6BA 3HFSA 2CVOA 1AN9A 5KKCA 1LLCA 1PGPA 4KWHA 1XQ1A 3NTQA 4GH5A 4PZCA 2QIOA 3WLEA 5AVOA 1EMDA 2GERA 6LDHA 3FF4A 4EW6A 3D3WA 1GU7A 3D7LA 4RDIA 2UDPA 1G0OA 4U0JA 4Q3EA 2EKPA 1MV8A 4HKTA 4LISA 2NU6A 2Z95A 3MJSA 2AXQA 2NM0A 5FI3A 1DDOA 3H5AA 4TQGA 1W73A 5I9MA 4BNJA 4XJTA 1JU9A 3BMOA 2V6MA 1F8FA 4D3FA 1OAAA 4KDEA 2Y1OA 2IEBA 3WXBA 2Q1UA 4ZRMA 3H3FA 5C7IO 4WCDA 1NVGA 3Q9NA 5L95A 1KEUA 1A27A 5JYDA 2HJSA 4Y8VA 2GSDA 4IMPA 5F21A 2VHWA 4MKXA 3QWFA 3OF2A 3L9WA 5LDHA 3GHHA 5CG2A 3DMTC 4KZPA 4J1TA 4L76A 3ZWCA 5F1OA 2ZJ1A 4UVEA 3QW2A 3FNHA 4LW8A 2B36A 5B4VA 5JAZA 2IXBA 4CV0A 3GMSA 1XG5A 2TMGA 3H7AA 1JA9A 2O4CA 1CIVA 2EG9A 4PG4A 1JAYA 4HBGA 1XCBA 5TS3A 4EUEA 2NTVA 3CMCO 4XDYA 5CDTA 5KJ6A 1E7QA 1ONPA 3R0IA 3ROMA 5A4DA 4RPJA 3ZHXA 1BDBA 3PLNA 1JN0A 4NK5A 3AOEA 4CLRB 3BIOA 3DWFA 4H15A 1GTMA 1X0VA 1ZJYA 1JKIA 3INGA 4FB5A 4OMUA 2VHVA 2PD4A 1BXKA 5ICMA 3CIFA 3ZV5A 3TN7A 3IMFA 2ZB3A 3DBLB 4IMRA 3RUIA 2YHUA 3H9JA 4J9VA 1ISFA 5BNTA 3PLRA 2IZ0A 5L51A 1T24A 1WP4A 5JDCA 3ZWYA 1HTBA 1SEVA 4D43A 4G65A 3JQ6A 3DONA 1ISHA 2NUAA 1PGJA 3EAGA 3GG2A 3M6IA 4GL4A 4QFDA 2NVUB 4EITA 2ZCVA 5CEJA 8ADHA 5JMPA 3U4CA 3W8FA 7MDHA 3F1LA 1M66A 3SBOA 1G6KA 3V1TC 1TB4A 3OICA 5L7WA 3VPXA 1HDGO 1J4AA 3OM9A 4C7JA 2E48A 3IDSA 1YOVA 4U5QA 3MOGA 3HDQA 3GHYA 4JBHA 1BMDA 4ID9A 4XGKA 5BSHA 2D5CA 2E82A 4YDRA 4F6LA 2XXBA 4DLAA 1AHIA 1MGOA 4YAEA 4EUFA 4CM8B 2FY8A 3DZBA 3O8QB 4BNGA 1U5AA 4FJ1A 1CWUA 5A9TA 1R4NA 1CQJA 1E3LA 4J2OA 3F4BA 4FJ2A 1WW8A 3QE3A 3JCZA 5C3MA 1DRUA 4BB5A 3UOGA 1LRKA 1BG6A 4J0EA 4YT5A 4FDAA 5EIOA 2AE2A 4ALNA 3UUWA 4IS2A 3MEQA 4E4YA 4RPLA 1DAOA 1NFFA 4CODB 4J2HA 5A1TA 4D3SA 2HU2A 2JD1A 5JAQA 4CMHA 5KJEA 4I9NA 3NX4A 1ZK0A 2WE8A 1KC1A 4Y67A 3F4LA 1KS9A 4WKGA 2X9NA 4IM7A 3S2GA 3GNSA 4DYDA 1JAXA 1NXQA 1HKUA 3UFXA 1VJTA 1D7OA 2GPTA 3ZI0A 2D59A 5AOVA 2CNBA 4BKUA 1Y6JA 3DMYA 3GAFA 4NDNE 3PRJA 4I1IA 4Y6SA 4YQZA 5DF1A 2X86A 2IDZA 4R3NA 5G2OA 1VM6A 3ST7A 3AI2A 2CSUA 1P0FA 1A4IA 3G17A 4OQYA 3JQ9C 2HDHA 2BGKA 3HB5X 1KETA 5JFOA 1R0KA 1ML3A 3GK3A 3NT2A 3C1OA 4WUVA 3IKTA 3KEQA 1VC2A 2ET6A 4P38A 1DIBA 4MP6A 2NU7A 3QA9A 4XYLA 3K2EA 3ETDA 3TWOA 4M54A 2AW5A 3BTOA 3G1TA 4BO8A 3GVXA 3DBHB 1GYPA 1SNYA 3CE6A 3PWSA 3FR7A 4RZHA 4I8XA 4YAGA 1H9AA 4KP7A 4RQUA 4RF2A 4JJFA 4I5GA 4NBWA 4RVUA 3AY3A 1SB9A 1Z45A 4GKVA 4WASA 2IE0A 3F6YA 1BW9A 2HMSA 4MP3A 4UEKA 4OKIA 2PKQP 5G0VA 3PZBA 3TOZA 1IOLA 3RSHA 1DEHA 4CL3A 3JQBA 4PCVA 4CMCA 1XDWA 4HFJA 3F3SA 5DP2A 3EMKA 3OETA 1XR3A 3I9KA 4OOEA 3HQ4O 1E1MA 3B1KA 1HDXA 4UREA 3NT4A 3VZRA 4ZVVA 2ZATA 5IZCA 3K96A 4CPDA 3EK2A 2G76A 3PP8A 2G0TA 4N5MA 2Q45A 3WMXA 3H9QA 1B8VA 1DJNA 1ISIA 3IKVA 2OZPA 3U4DA 1YBAA 1ONNA 4CUJA 1PZFA 3AI1A 3V2UA 2IYPA 3WSVA 4Z9FA 5EINA 2RAFA 3DZKA 2P4HX 3KSZO 3UCEA 2YHIA 4FFNA 4PLYA 3VTZA 3WSWA 4A73A 2XF8A 2ZTLA 3IJPA 2HMUA 3L6OO 1B26A 3PVZA 4WLUA 5CDYA 2AQIA 3PHIA 4XGIA 3QSGA 2R00C 4DPKA 2BLLA 3ZW8A 3VHRA 2ZYGA 5L4LA 1LSSA 1JVBA 2C0CA 1NTOA 3NUGA 5BNIA 1M76A 4YAJA 4BNZA 1HYEA 1P1RA 4JK3A 2DU8A 3PTZA 1UXKA 2WD8A 1DRWA 3H3JA 2AEJA 3IP1A 1FXSA 1PX0A 2DTEA 2HSDA 3WYEA 5BR7A 1C3VA 4L9RA 4IJWA 3ASUA 2Q49A 2HRBA 1A9YA 2OFPA 3TZQA 4A7PA 3L0DA 4R68A 2GNAA 1HLDA 4ND2A 3N74A 4XJSA 5J23A 3TOXA 2C2YA 3NDRA 4MJLA 1ZXBA 1JWAB 3PYLA 3R3SA 4RZIA 2O3QA 4OOFA 1LLQA 2GYYA 4XQEA 1H6AA 2VRCA 3IP3A 1LRJA 3JV7A 3DXFA 5EL0A 3RQSA 4YJHA 4CMIA 1NR1A 5HA5A 4R9SA 2Y1DA 3UGKA 2P9GA 4IJKA 3WYCA 4KQWA 3H8VA 2JHGA 4II2A 1P1KA 3GMDA 1CQIA 2IZZA 4JROA 5TRTA 2X5OA 1E7SA 2HLPA 1R66A 1NQ5A 3EVTA 1PR3A 1K6IA 5ER6A 2ZIZA 1V3VA 3NV9A 4J4BA 4GLLA 4OH1A 1G0NA 4BB6A 4ZA2A 5F3RA 1D3AA 1NR7A 2AMFA 1QMGA 4W6ZA 3ADOA 1DFHA 1YDEA 4J1QA 1NASA 3DHYA 3D3WB 1MFPA 3H4VA 3I3OA 1GQ2A 3GZ4A 1YVEI 1I10A 4IZHA 3OIGA 5DCYA 5A04A 4M49A 2J5RA 2BELA 4GSKA 1OC4A 1UUFA 3VVCA 2PH5A 3P19A 2HK9A 3GGGA 1HDCA 3PDUA 4R1UA 1B8UA 1ZXLA 3O38A 4DC1A 4WEQA 3ZNNA 2UVDA 3AUUA 4MVJA 5KVQA 3ZNQA 1EBFA 2JAPA 3OQ6A 4WLNA 2BKAA 2GDZA 4CMAA 1A4UA 3JQDA 2AE1A 1EQ2A 2X9VA 4YR9A 2ILTA 4C4OA 4NHEA 3ZH2A 3WQQA 4PLGA 3GUYA 5EMHA 4GSLA 1E6WA 1QYVA 2WSBA 5T8KC 4OXYA 5L7YA 1WXDA 1P74A 4JBGA 3AFNA 4JLWA 1PZEA 4TKMA 2FSSA 4J90A 1LDYA 3DQPA 3E1KA 2PY6A 4O59O 3VPSA 1C1DA 4JN6B 4ROSA 5ES3A 3RBVA 1V8BA 3BTSA 1FDTA 1XU7A 1UDCA 1NAIA 1L7DA 3QP9A 4ZJUA 5JMWA 1P77A 3EYWA 3KLPX 5IZ4A 3WWZA 5KVSA 4TRRA 2QYSA 3UKOA 2HUNA 1TEHA 1RM4A 3JYQA 3MJCA 2EERA 1E7WA 1EE9A 4BNLA 1CETA 2YJZA 3HE3A 4MKZA 1YONA 5JO0A 4NJMA 4E5YA 2Y67A 4NK4A 5KCZA 2EWMA 3PIIA 4NFHA 4BNUA 3VDRA 1CJCA 2X0NA 3E6AA 1DFIA 3GEDA 1KVSA 4EJ6A 3L6EA 4KUEA 1KY4A 1X14A 1GADO 3ABIA 4FGWA 2VRBA 5KJ1A 1PZHA 3BAZA 2EP7A 3AW9A 4II3A 2D0IA 3AM5A 3FNGA 2HJRA 1FDSA 1YQXA 4IXTA 3ROQA 5EJ2A 4LVCA 4OSPA 2JFGA 3WS7A 2YV2A 4ALKA 2CD9A 3WBFA 1IL0A 1BRMA 5A5FA 1R12A 5IXYA 5IJZA 2P9EA 3WFJA 4EZBA 1TLTA 4J43A 2UUPA 4BVAA 5K0ZA 1V3UA 2UAGA 3EDMA 2B35A 4X54A 1YOVB 3QVWA 4MIOA 1S6YA 4ONEA 4EYEA 4MIEA 5THKA 2CDBA 3ON5A 4CMBA 1BWSA 2GD1O 4BNXA 3B1JA 4YJFB 1YXMA 3W4KA 1NM5A 4XD2A 4IPTA 4OGWA 4E5NA 3JD0A 3JYOA 3GFBA 5DDIP 5ENVA 3H2ZA 1GD1O 4GMGA 3BHIA 2Y99A 4DBVO 1ADFA 3DC2A 5DP1A 2QG4A 3DZFA 3CEAA 1P44A 1QORA 2O2YA 2I67A 1SO8A 2A4KA 4GX2A 1DB3A 3V1UA 2FN7A 1GAEO 3JQCA 3L07A 2BD0A 3D1LA 2DVMA 1MG5A 4W82A 3U5TA 3EVNA 1GUYA 1B15A 2B5WA 4L4XA 4NBRA 4DXHA 3E18A 2LDXA 1Z7EA 2NADA 1HETA 3KUXA 4XA8A 1H6DA 4H7PA 3KBOA 5BSEA 4LRTB 4R5HA 3WLFA 4JP2A 3HDJA 4NBVA 3QJ5A 2GASA 4DQVA 2WWRA 2R2GA 1ZCJA 1BXZA 2DBRA 5FI5A 5TSDA 4L4RA 2G82A 3MJTA 3G49A 3M2TA 3ONDA 4AJ1A 4IY1A 4RVHA 4DQUA 5KIAA 4KQXA 4KMSA 4PLVA 5B12A 1R0SA 1R15A 1EUCA 1ZJZA 5DNAA 3WB9A 4B3JA 4FR5A 3S55A 5C37A 3GVHA 3K6JA 3GRPA 1Q1NA 1RKXA 2A35A 4U6QA 1NHWA 5THQA 1QXSA 2O48X 4NMHA 5ER9A 3GF4A 4B4OA 1R16A 3FBTA 2ZB7A 4OJNA 1ZZEA 3F1KA 3ASVA 3FNEA 4C7KA 1ADCA 5A03A 4H3VA 1PGOA 1KVUA 1GPJA 1HZJA 1PS8A 3AY7A 3AU8A 2HK8A 4YRAA 5B4TA 2CUKA 3ROKA 1BW9B 4HFNA 3ONEA 1NVTA 2GZ3A 4OM8A 1PR9A 2BMAA 3LVFO 5I7EA 2PK3A 1I24A 2VHYA 1HDRA 2CDAA 3UN1A 5LC1A 4NH4A 2D5AA 3DL2A 2DUWA 2YDYA 3AFMA 4WEOA 3GEMA 4CLDA 1WZEA 1N9GA 3LYLA 3RUCA 1IUKA 4D7AA 2BGMA 1R4MA 2AHRA 1N7GA 4TWRA 3LDHA 3W1VA 4M86A 3E5RA 3KEOA 1LUAA 5DOVA 3B1FA 2J8ZA 2X58A 2D1YA 1HSOA 1E6UA 4BUCA 3KOUA 1SAYA 4IZIA 4CMKA 1UP4A 1JKFA 4K1LA 4RLHA 4Z9XA 2VZ9A 4TRMA 4CMGA
chains in the Genus database with same CATH superfamily
2B4KA 3L5OA 4LKOA 3B70A 3R6TA 3DV0A 3TIIA 4YIKA 4N3AA 3NBYC 4MEJA 2H63A 4B79A 4BFLA 5LYJF 1QRUA 4L4ZA 3G8CA 5EVCA 3C0KA 4OYLA 5IJ0A 5G0SA 3RKUA 2GM9A 4HF7A 2BP7B 4IEFB 3RLIA 3N05A 1CDZA 2CB9A 1W76A 2QRVA 3TQOA 1XUOA 2ASEA 3UUEA 2GKOA 3LK7A 2P4EA 3IEKA 2AMJA 1SKYB 5EQDA 3P9NA 4KTVE 2QKYA 4ZV9A 4JI6B 3DE3X 4MI9A 4AUNA 1RM0A 2PUWA 2WTBA 3V2GA 4A27A 2XCSB 4UMVA 1GR1A 1AGXA 3MN1A 1Z7WA 1U3VA 3LUHA 4D8VA 2VDVE 2OP0A 1JHUA 4KPUA 3SMVA 5IJ9A 5EEHA 2QOEA 3LX5A 4MS4A 2F9LA 4CM4B 2QRGA 2C7PA 3N07A 2B2CA 5AK3A 4XFJA 3L7JA 4QRHA 5U9CA 3HG7A 1LQUA 5BURA 2R4UA 4GXRA 4Q7LA 1AO0A 4ILKA 1GM5A 1CERA 2V45A 1YASA 3G2PA 1EP3B 3SVLA 4R51A 1D9XA 4MRPA 1Z5PA 1FNNA 5NULA 1CQPA 4JP8A 4PF1A 4TV8F 1JF8A 2DTDA 4DAEA 1Q91A 4CMIB 3HNOA 2Z83A 2Q1SA 2Z5LA 3CUUA 3T7KA 3DC7A 1PNOA 2IEYA 1AV6A 1M10A 3HU2A 1VFPA 2OMKA 1MB2A 2YIDA 3BE6A 1J0AA 2Q7XA 2NQ8A 4DLRA 3WRXC 5EJMA 3TVDA 4D80A 3GT3A 3VJLA 3WIBA 3JAWB 4TYNA 3W3AA 3TGPA 1R0LA 2H9IA 1EGQA 1HQDA 2I4MA 4YACA 2GZ2A 3THXB 5EIWA 4FM9A 5JZ9A 4ICIA 5DYWA 1Y1PA 3DQZA 4C22A 2DGDA 4MQMA 4X8HA 5LDDC 2HH9A 1Q50A 2WU4A 4DGSA 2O8BA 4QYIB 4R2LA 2K6GA 4J4TA 4IIYA 1AUXA 5E8RA 4FYPA 4BO5A 3UB2A 1G8MA 2HW8A 5BWOA 1VZ2A 1HEUA 1UBUS 1N8SA 3IIMA 3VR5A 4DVJA 1F8GA 3JAKA 3M49A 3BWXA 3WLSA 3ZYCA 5LZ5A 1L5VA 4YXFA 5NLLA 5DBHX 1RBMA 1T43A 3D6AA 4YRMA 4AM8A 3ZJVA 2V98A 3TTTA 3ABRB 2XJ4A 1VGVA 1CYDA 1ORIA 2PL3A 2Z2ZA 1E0AA 1RBQA 4RS3A 5DYYA 1LRLA 4LRSB 4FYJA 1RJWA 5CT6A 5J4KA 4Y98A 3RKSA 5DNUA 2AFHA 3T5PA 4WACA 3ZD7A 4RK4A 4UXIA 3EXG2 4QJIA 2WWXA 4JVNA 4LHSA 3VZSA 5I47A 4TMVA 3UJPA 1D0VA 4L50A 2GLXA 3IBCA 3IDOA 1GSHA 2V6FA 4JDUA 5T8KC 2Q4OA 4BX8A 1R5OA 1T5SA 3JYLA 2VP6A 4X92A 1QVVA 4JLBA 1WMBA 4ZIRB 1R5JA 4J16C 8LDHA 1O77A 4IEIA 1MQAA 4IDOA 2HV8A 2BEKA 1R9NA 2HF8A 3WGQA 4EA6A 2OKCA 2WPDA 4L0QA 1J2UA 5H1YA 2OORA 1FNDA 3OLWA 2FW6A 1GQSA 1C80A 1CUBA 4YQYA 4E5VA 1OT3A 4OATA 4Y9SA 4MRVA 1YQGA 1O95C 2IUUA 2JFNA 2P69A 1FFDA 5JXWA 4C06A 1CZKA 1BJRE 1QVWA 1WE2A 2X2OA 2FE1A 3MJVA 4INJA 1QANA 4OGLA 3B2NA 4WE3A 3S1SA 3GNQA 3JQPA 3LVRE 3A6HA 3VQTA 1WB4A 5LU9A 2JBAB 2H29A 4MUKA 3B3JA 3HUUA 2J9FB 3FHJA 3KTOA 1XAIA 4M1EA 1IJEA 1B3RA 2WD7B 3EZYA 3G2OA 3IHLA 3FOWA 3W1EA 1TVKB 4FHEA 2WHPB 4WCFA 4FEAA 5DLPA 4RJIA 3K9QO 2ZB8A 4ZT5A 3GJSA 3O83A 3S68A 1TW2A 4WBXC 2MYUA 3C5HA 3AT1A 4LDNA 2NT4A 5CM9C 4IIFA 4KIGA 3PEFA 2WWTA 3HO6A 3U49A 4OBBA 4NRDA 2W48A 4A8JC 3DLPX 1RZRA 2JJYA 2ZJ5A 2BMEA 5E1DA 3SLRA 2ZDQA 5AW4A 1UPFA 3F46A 2H2IA 1LNSA 4HDMA 3VOBA 1A9XA 3D5TA 4I1PA 3AONB 1E7RA 2H8KA 2WWFA 3KYJB 4P5EA 2IW3A 1TCBA 4CFYA 5KVVA 2P6RA 3ZGLA 2QMEA 1XQ9A 1D6SA 1WMAA 2P6NA 4CMEA 5JRJA 1T5DX 5AVWA 2GZDA 4HGPA 4MH0R 5IVDA 1RYNA 1PFUA 3AF4A 5FBKA 5L53A 4PCAA 3VBCA 1IHYA 5FWDA 2L2QA 1F48A 4ZANA 4RFSB 5CCXA 2JHAA 3HB0A 3I1YA 1A9PA 2QW8A 3EGWA 4YMSA 4J9UE 1OLSB 3OLQA 4HUTA 5E0OA 4S1TA 3KLMX 2GEUA 4MV5A 1C4XA 3TD6A 1WNFA 2QQFA 1Q1EA 4PONA 5JXIA 3LUJA 3DCJA 3MCZA 5B3LA 1I1HA 4OLAA 1ZK3A 3KYBA 3NVDA 1ZHOA 3PC2A 3E1SA 3SC3A 2C3YA 2JATA 5HHTA 1TXGA 3LLUA 5EJ4A 3OCJA 1DX4A 1QG6A 1YE3A 3I58A 2AOXA 1N2ZA 2F43B 1HK7A 4O2BA 5EWMB 3SZLA 4JU8A 3TB4A 3VUEA 2NSDA 5AJTA 1FSPA 3LUBA 4Y9DA 3NJRA 3E3AA 5AIBA 3AWDA 3Q10A 2QTVA 1UMDA 3NR2A 3C6KA 3NTLA 1I3CA 3GFTA 2MDTA 3ELDA 3SZUA 3ZEIA 3T5DA 1EE1A 4ZU6X 1YRLA 4P32A 1T2AA 1FEZA 4GIBA 2VNSA 4H27A 5I9TA 3QX7A 4IIEA 5DBOA 1MH1A 1RYHA 4WZAB 1I30A 5G4KA 4X6LA 6CHYA 4A0QA 3G59A 5I8WA 1QZ3A 3L6BA 4YEDA 5LMUB 3K9NA 2O52A 1I3LA 1Z4PX 2J6HA 3HDGA 1C3XA 4WL0A 3B3QA 2DY1A 1L4YA 3IAAA 4GQAA 1GV0A 1ZOSA 1QHNA 4IIDA 2YL2A 3O8RA 3CW9A 3CX6A 2C2XA 3GELA 2A1IA 3TQCA 3AILA 4EG8A 2XUOA 5IN4A 1P60A 2EZ9A 4Y30A 5F1KA 1GQYA 1NDUA 4OFXA 1Z6XA 4P4NA 1U0SY 1U3GA 1IY8A 6ABPA 2Z08A 1OBHA 1Q22A 2XDWA 3CIOA 2RIPA 3H1PA 3H3XA 1V5WA 4J0FA 4M1KA 1XHFA 5JC1A 1QFSA 3LF1A 2Q50A 4IQGA 3NDBB 5KC8A 4L5AA 4NEHB 3IQZA 1I7QB 2V1UA 1RKVA 3NO4A 5H02A 4TYQA 4MVJD 2AR9A 4N0DA 4OQLA 4DKXA 3VYTB 3OTGA 2IYOA 2HRZA 1W87A 1PJ3A 4HZIA 4MLZA 4N48A 5EVJA 2QTMA 4NOMA 3KR0A 4JZKA 2W90A 4EKIA 4EY6A 4U2BA 3B9RA 3ETEA 4C2BA 2ACVA 4PC6A 1V35A 1ZSVA 2I7TA 4BIMA 2Z98A 4BHTA 3OQNA 3FPCA 4H0FA 2GAJA 1A9OA 2HSEA 2X14A 2XPCA 3LNTA 1HF3A 1IWPB 3PRHA 1F38A 1RWPA 4IJVA 3VTFA 1WTAA 4F93B 3QEMA 4OQMA 2I3GA 4R2HA 5LP6B 4FHDA 4NFSA 3GUHA 3HBJA 1SXJA 3T54A 4F85A 1XU4A 3T3PB 3F5DA 5F2KA 3SHTA 3QXXA 4YAUA 4CXMA 3EBOA 4MYUA 3TCNA 1FQOA 2H92A 4EHDA 3TUZC 1NMZA 2H4XA 3DZCA 3OTQA 4W99A 5JSYA 2A33A 3ANXA 1U1IA 4HB2A 4BGIA 3R6GA 4YAIA 2BYTA 1KZYC 3WZ2A 1I1OA 3K16A 3D7RA 1P2TA 3D7NA 4HDCA 4ZQIA 4XUEA 4RA6A 1X9IA 4UMFA 4C0QC 2HU7A 4ARIA 4IKEA 3F5QA 2PSEA 4GGOA 1L4UA 1NJ1A 2FV8A 5DCLA 3V42A 2KJQA 3DHEA 3OLCX 4QXQA 3AEXA 2HV9A 2C57A 2IYSA 5JS2A 4BV8A 1KEPA 2C31A 3CTPA 4X0EA 2GO1A 3QA3E 4UZFA 3KQNA 1N9GB 1XALA 3GRRA 3L0PA 7MHTA 3TLGA 3D6VA 4GMKA 2H4ZA 2FJUA 2OGTA 3KEMA 3T3MB 4NJOA 2RD2A 1SCIA 2XKJE 2HMWA 3BHJA 1Q1GA 4MQFB 3B60A 2HLNA 1K5DA 2DTXA 4CHGA 2GWRA 1PT9A 1HLPA 2IITA 4OK3A 2Y2VA 4HRXA 2XX3A 2WHRA 1XTKA 3EZ6A 1D03A 1V4VA 5FORA 1WOMA 2CXQA 1ZL0A 2A5GA 4WXPA 3W5UA 3DG9A 3QWBA 1XZLA 3ONNA 4JT4A 2ZGVA 1UL1X 3CZ5A 3H0CA 4K9PA 2M6RA 3M3DA 3WO1A 1Z39A 4UM7A 1HDZA 1VJDA 3AG6A 2YFYA 4FBMA 4IHAA 3QXGA 4JNCA 3U3RA 3ITKA 3AIOA 1UC8A 3G0OA 3D7KA 3L77A 4B32A 4AWAA 4JC5A 5JAUA 2VZEA 3JRXA 4PO8A 5HIAA 3O3MB 3VSEA 2C5GA 4UULA 4YJGA 4YCJA 4WNIA 4UU8A 2VP5A 1FYEA 5DI9A 3ZV7A 3UC9A 1T0IA 1ZM2A 2H2WA 3Q1LA 1SOVA 4PZEA 4WGFA 1NVAA 1OW3B 4RVDA 1JWLA 5HW0A 1FX1A 3P27A 3JTEA 1XQXA 5CVJA 4G9EA 1XLTC 2H07A 1CTQA 4NZ9A 4YRDA 5HEKA 1M33A 2D0OB 4KN5A 4BNIA 5HS6A 1HG0A 5TGTA 2F59A 2Q1TA 2VUHB 2WJ3A 1CR1A 1EWRA 3PCXA 1IU9A 1NG1A 1K88A 1WMEA 2D5IA 2HK6A 3NHPA 3FAKA 1P7CA 2QTTA 1ZOOA 5C7OO 1ESCA 1QO7A 2X4LA 1RFLA 1W85B 2HQ1A 1YK1A 2ZR9A 2QSYA 4HQNA 4EI2A 2AQKA 1JHMA 3LH5A 4MYDA 3HCBA 2YVKA 1Z5NA 2GK7A 1X15A 3QKSA 4IZ6A 4PG5A 1SBNE 1T26A 2VATA 3GZNA 3B5JA 3TRDA 2OFXA 3UT5B 4UNRA 3CZAA 1U9CA 3WNDA 1CRWG 3A36A 3A6EA 3NBUA 1T3SA 2H1FA 1X1SA 1X8LA 2CVHA 2P2NA 3GVCA 4G1UC 5T6MA 3RF6A 4DSOA 1A04A 2FEPA 2XUPA 3HPRA 2QVGA 4C05A 5BW4A 1CRPA 2VNKA 2CLOB 1HKHA 3PGA1 5DB4A 2V7UA 1TAHA 2WBLC 3D4PA 4IG4A 5AVSA 1OXMA 3BTVA 4JFRA 5B2FA 1DCKA 1NYTA 1XVTA 1ZGHA 2WVJA 3IDFA 1XMXA 3KJGA 5KX5F 5TGDA 1RXWA 3MMNA 4BKMA 4Q24A 5BSWA 3QZUA 2V03A 2X0FA 3VZBA 3OHMA 4R2KA 4RY0A 2HMYB 1ZEMA 4TLEA 1KQGA 3HZOA 4Q9JA 4C87A 1RTKA 2IC5A 4XSGA 4HN2A 2WF9A 1MO5A 2E18A 1HYQA 2LIPA 1CF9A 4N49A 4ZOBA 5BSKA 3BSFA 3VVLA 4P83A 2FWIA 3Q4GA 5FIUA 3WGTA 3VV2A 4YLGA 5GONF 4X65B 4ITUA 5JCJA 5SYNA 4BMXA 2QZZA 3FZQA 5C46F 2VSYA 5CA0A 2LKCA 3RFTA 1MP0A 4BTEA 1FJHA 3V8PA 2VJYA 4X60A 4XSVA 2Y68A 1TF5A 1GTL1 1NIJA 2CCKA 1DPGA 1X94A 1XVIA 2FN4A 4XLTA 3PUJA 1L5LA 3U7JA 4W7HA 4U9IS 4TRJA 1GUBA 1E3MA 3CUVA 4I0WB 4P0QB 2P2SA 2ZK7A 2ECPA 3MRXA 2EQ5A 3QKWA 4XKJA 2AH5A 1T9DA 2H5LA 2VHZA 1MQ8B 5KAMA 1QH1A 4IUCS 5CG1A 4NU6A 1R8JA 3UMVA 1M8GA 3RVSA 2O8DB 5C5IA 2B0CA 2HZBA 4OXXA 1SC6A 3ET4A 3QFSA 4GP7A 5E3HA 4PLZA 4EP1A 4R2IA 5D51S 2R8RA 4EHFA 1BRTA 1DQSA 5GADl 1L0BA 2P9TA 3S40A 3LRXA 1NPYA 3M4JA 5LN1A 3AETA 4YPVA 3U4QB 3AVXA 2F8TA 1KO7A 3K4HA 3FYUA 4J8PA 1H2AS 1QHHA 1ULUA 4QUBA 4RTPA 1WZ2A 1WSBA 2NV0A 2C3PA 4FSHA 1JEOA 1JLLA 1L7VC 1B0PA 5D3MB 3WL4A 2VDNB 4PGGA 4UNSA 4GGPA 2HT6A 4FN5A 1V9CA 4U0KA 3AHEA 1U2GC 5IDYA 4BVGA 3KQHA 1E0KA 3JQ8B 1ZRMA 3RTCA 1DTSA 4ENUA 5I01A 1OY1A 3V6MA 4LC0A 1L1FA 1N5DA 2FEMA 3V7FA 4GP9A 5JCOA 3L0IB 2I6TA 5DWQA 3W3AH 4JJ7A 4FLFA 1E18A 2Q9BA 1LS1A 2EGHA 3VPFA 1KQOA 4DLUA 2QRKA 4IV8A 5K8TA 2D4HA 3N39C 1DIRA 5HE9A 3T41A 4F7DA 1DIHA 4IIHA 4WLVA 1U3DA 1REQB 2WT8A 2H54A 3LE8A 2C4NA 1JLRA 3LKZA 4K6OA 3RRFA 2GM3A 3T4PA 3VYWA 2DXIA 4DCOA 3H9CA 3RI3A 3RD5A 1U9IA 3HI4A 3ASZA 3TZCA 2FP4A 3IUJA 5ALJA 1RAEA 4WOKA 3RJ5A 3NP9A 1N1EA 5FWXB 2XRFA 1VYUA 2GHTA 2ZDGA 3LQYA 1WY7A 3NATA 3KAQA 4MWZA 2GBGA 2AJCA 1KOGA 1NFQA 5CYOA 2WMOB 5CFQA 1W5TA 1Z56C 4MQ6A 1JNXX 5K1SA 4EQ6A 2XOEA 3PQFA 3KJHA 4LECA 1HC7A 3ZK8A 2ZQYA 2UUOA 5J9FA 2AF4C 3RTEA 5CK5A 4BP3A 1UKAA 5IHPA 3UXYA 4D25A 4NHOA 1F17A 4RMNA 5G40A 4MGYR 3GJ0A 4P54A 1Q15A 4XB1A 2LNDA 4UUMA 3CLTD 4JA2A 2O5VA 4WCVA 1IJBA 4U39A 3EZLA 3RJ9A 1JSRA 3M1AA 5FPPA 4YV7A 4BXOB 2D8AA 5F64A 2PZKA 2NZYA 1M5RA 3RDPA 5U1PA 4BX2A 1K89A 1USGA 5CIWA 3HM9A 2YZ7A 5L3SB 4EF4A 4KPEC 5FT9A 4WX2B 2HHLA 2F3TA 3G79A 3I04A 2NZXA 4Z3DA 4V1CI 1Y7HA 3G0IA 1AD2A 2PUTA 2IV2X 2TSYB 2J4CA 3JQAA 4DSNA 5BOSB 2DBQA 1AGPA 2X7HA 4Q1DA 5TNXA 2X6TA 4PC3A 4V0KA 4QOHA 3A05A 4Q82A 2E7ZA 3KCQA 3A6DA 1ZHHA 2JCXA 1E1RD 1H2ZA 3L4SO 4JEMA 4K9QA 4NI5A 4I14A 4X1OA 4X44A 1E2EA 5BV2P 5IKPA 2VZ0A 1B16A 4LFCB 5K4GA 1TUBB 4XVRA 2JLXA 2AZXA 1SCAA 3K2BA 1X70A 1Q57A 2ODNA 4OQ4A 4PO3X 3EVZA 3TTYA 4B45A 2AKYA 5HIKA 1U7ZA 1ATZA 2DHDA 4KWEA 2I76A 4GE3A 1KI8A 3AIIA 4E11A 1JHQA 2MSCB 4EMUA 1D5WA 4IDDA 4NDZA 5GV7A 1NLZA 2PYZA 3TXXA 4DB2A 5FQOA 4FI3F 1L4GA 1TIKA 1YS7A 3C3DA 3CNHA 1O0CA 1PNVA 1H4SA 2C29D 2CEAA 4YROA 1RWXA 3C3KA 1B6TA 3ML1A 4IIGA 5FA8A 4EVIA 3RFVA 1DRVA 1PV2A 3NC0C 5TQ2A 5CD1A 3GT4A 1WVIA 1N5MA 1EYZA 3NJ8A 4LPKA 4N18A 1NXOA 3DOEA 3LYUA 4FHZA 4WDQA 1XJWA 4RMHA 2C8VA 1CUGA 2VAWA 3NWBA 3JYNA 3V1YA 1NVFA 1LA2A 4B4UA 1LS6A 1QUEA 3ENZA 3LRTA 3A0RB 4X5OA 4CNQA 5JADA 3GLHB 5ED4A 2EF0A 4Q3NA 5K3DA 2HA5A 5BWNA 5ARDA 1FXWA 4DMFA 2ATEA 1XZFA 1KZ1A 1QK5A 1JKXA 4HJXA 1VCNA 3PQ8A 1QYCA 3KKQA 1ZK4A 4BJHB 1G5HA 5JBNA 2GF0A 3HHPA 1PJ2A 4I2VA 1DAIA 2XE7A 3C15C 4E12A 4Q1VA 2PGDA 3PQDA 4YCBA 3K1YA 1V5EA 4FQ5A 1DO2A 1NC1A 1YQDA 4KLAA 3EUAA 3P4XA 4NAVA 4QUEA 3T5GA 4YRBA 4C7OB 5K6TA 2GLUA 3PENA 4Y9TA 2MCFA 4GUDA 4YMHA 1Y5RA 4IIJA 2RGCA 4RSMA 5DBFA 3ZZ0A 1K7SN 4JC0A 5I7AA 2QUIA 4ER7A 3WGYA 4QQNA 4HUJA 3NTXA 3WGNA 2DWOA 3OURA 1YL5A 5CYPA 2EL9A 3ED1A 4JH0A 4CQMD 4KJXA 3W06A 2BFCB 4FCWA 4LS3A 4ZHQB 3D8RA 3AB3A 4U9HS 1LC3A 1U9JA 2I2FA 3OLXA 3IR7A 2F67A 1M2FA 3A9CA 1E4VA 1H93A 1P1IA 1ZSNA 3LX6A 3BH6A 5HSGA 2I66A 3MWLA 1UXJA 3LXUX 1T9GS 3OOYA 3OSUA 4C30A 3OCCA 4EX6A 3GDOA 4FHFA 3C8MA 1ZC4A 4OMFG 1IY0A 2IUSA 5CAEA 1AUPA 4MUMA 4A8TA 3LRPA 2Q0XA 3TBHA 2OOKA 4Q48A 5H8WA 1UWKA 4A2WA 1IWOA 2XF2A 2JARA 4WHMA 1XYGA 2ROQA 4DMUB 4KYVA 2O3RA 1E0DA 4PZ9A 1MPTA 4ND8A 5HCIA 5TF0A 2B0JA 2J3IA 2YHSA 1CEEA 1CZRA 2WSSD 1Z2CA 2NZWA 1R37A 1ABEA 3E58A 3KT8A 1LLFA 3R6DA 2R7MA 1GJRA 4JMPA 1JL3A 2V8OA 2C04A 1POXA 4ZYLA 3AFGA 4MVJP 1KA9H 5B2ZA 4DF3A 4PC2A 3W5HA 3K0CA 4HLCA 2YHBA 2PX5A 3REQB 4G9BA 5IKXA 4G0QA 2XUAA 2G80A 2PS1A 4EF6A 4HGRA 3ITNA 3WHKA 5K4HA 1C1XB 1SQSA 3OE4A 3OP4A 1HGXA 4N3GA 2VCHA 1K8YB 5JD3A 4P08A 3UVEA 4ZQFA 4H7FA 1T9BA 4MLCA 4AO7A 4KXVA 3WIEA 3VZPA 4RXUA 3ETCA 1VLQA 3VM6A 1VE6A 2ZRMA 3PC8C 1RRVA 2RFLA 1PT5A 3LSTA 5TIIA 4AZ3B 1H5QA 4TKVA 1VKOA 1QWOA 1KK2A 1L5OA 1IY9A 2EXXA 3CZMA 3JD1A 4YO8A 5F2EA 4DJFC 4L3VA 4FHCA 1H65A 3BFVA 4E2WA 3F78A 3JATA 4JC8A 4BLWA 2IELA 2BVNA 1PGQA 2GHRA 2IDKA 3FPGA 3JTMA 4KRGA 5HBGA 2P68A 5ALZA 5HM8A 4ILEA 4WXYB 3PD0A 2VF7A 3EGOA 1GKIA 2XTJA 4GRDA 1NF8A 5LL6P 4B2PA 1T6NA 4BY9E 1FFGA 1OGYA 1PJBA 4BYGA 2J07A 1BOOA 1CFZA 1CW2B 1L4BA 1V7CA 2HM7A 3EEQA 4CFSA 3KD3A 4Q7JB 3HFGA 1LPSA 3DTTA 3DH0A 4YJHB 1CVLA 1CLEA 1FUUA 2M98A 1AN0A 3JZAA 1XSEA 1W2HA 2B61A 3JQBC 4KPGA 2X8JA 5E38A 3VR2A 2G9VA 4Z8YA 3RARA 2IX3A 1YTLA 1H23A 4R9UC 1E1RA 4D6PA 1UKYA 4C21A 1ODSA 2ZQZA 3QLUC 1OB2A 4I1UA 4UOZA 4CKYA 2R68A 1D8AA 4O1MA 4Q7QA 1TM5E 3BKWA 4BFZA 4DR2B 1CUDA 2D5BA 5A7HA 2ASVA 4Q9AA 3BK7A 3D3NA 4RF5A 2PT5A 1H0RA 4FFDA 3ECAA 4MKRA 4K8RB 2GRJA 4OP2A 3TEFA 1EFUA 3VGJA 3S44A 4EATA 2P8SA 4M60A 3T52A 3DV2A 1VLVA 5KU1A 2G07A 1ZKMA 2EJWA 2GGSA 5E9WA 2MSDB 2JFHA 2QORA 3EXG1 4DTCA 1TD9A 1U2PA 5JV5A 3O26A 2C9MA 3F2VA 5AUNB 1AB5A 5JHHB 1HFKA 3DOOA 5TARA 1QYDA 4UBLA 1JTVA 3DAHA 3T3HA 3RUHA 1ENZA 4M83A 4RDCA 1E9VA 3OVMA 1MVNA 3H5TA 3WGVA 3L7IA 4AQ7A 4QYMA 4AK9A 2QX8A 2JGLA 1IIBA 1YR2A 3VR4A 4NR0A 2ECKA 4FFLA 4IF4A 3UYKA 5EE0A 3QNMA 2QQEA 121PA 4L9SA 5LUAA 3LA6A 1TT5B 4JEHA 4JXJA 5CJJA 3LOQA 4EEXA 2YQ4A 4WZBE 2EKQA 1QIJA 3B6MA 3ZE1B 3GLUA 2REOA 3CF4A 3JVUA 3EVFA 2JLWA 3PC4A 4WZ6A 1V0JA 1X7XB 1KYWA 2X23A 3ZYZA 1XZHA 2ZZKA 5ARBA 4PO9A 2EWVA 1PD0A 1FLNA 1GPAA 2D7JA 2R5WA 2RB5A 3EGEA 2HCRA 2JZNA 4HWKA 4NMXB 4H60A 1KJYA 4RK7A 2ZU0C 1LX6A 2AFIA 2AMLA 3ZCXA 1NDHA 2FHPA 2LW7A 2MJLA 3ISVA 4EA7A 1JH9A 4NECA 3OLZA 1Q7GA 1VE5A 4AYWA 1LQ2A 1LVGA 2HEGA 3RRYA 3DTVD 3UMJA 1EAYA 2PUDA 4KFUA 4KXLA 2R4TA 3KJXA 4I4TB 2CD7A 1UJMA 3ZNOA 4V0OA 3VC2A 5KVCA 1QG0A 3QHPA 1JEDA 4YDSA 1QHSA 3LC2O 1RXVA 1P9OA 4XWYA 2EX1A 4CQMA 1Q3KA 1ADJA 1ZN8A 2FR8A 2PJZA 3NHAA 3VDQA 4BCBA 5FF9A 1JTEA 3TSAA 4PLHA 3R3VA 3KYDB 1IBRA 4URWR 1TTPB 4TT3A 2PXAA 3AV0B 4JB0A 2PWZA 3KT0A 3WB2A 4MWCA 2DJ5A 4MA0A 2IHUA 3CEHA 3IOBA 1QTIA 2AT1A 2PD6A 2FEWB 1B8PA 1O5IA 3OJEA 5HR5A 3ETLA 3SYMA 3CNOA 4X41A 4IRUB 5D1NA 1MXFA 1W30A 1CZUA 2RHJA 4G1BA 4GOLD 2GF2A 2NZUG 3KDSE 3STVA 1XKQA 4Q3DA 4JS0A 4ZAYA 4D4GA 4HNAA 1O54A 4OAQA 3VC3A 1KU6A 1M3SA 3JQ7A 1V1RB 3E22B 3TL2A 4HB4A 1OYOA 3KD2A 1ZN7A 4HMOA 1XDBA 3GR6A 3ZTTA 1XNRB 4E22A 4UEOA 4E46A 3OOSA 1E98A 2VP2A 3EISA 3HYCA 1YRYE 2FRVA 5DYNA 5FUWA 1MO2A 4PBTA 4DM4A 5H81A 1JG2A 4I2NA 3SEQA 2IP1A 4A0RA 1CFJA 4NCJA 4Q1CA 2JLBA 2WIJA 3B3AA 3KXPA 1L7BA 4ARZB 4EGSA 3QOYA 1DBPA 4LAFA 1Z4QA 2D13A 4M46A 2H0RA 4P4SB 1OIXA 1SG0A 4JBNA 4Z4GA 2QI9C 3PFFA 2OXTA 1VJGA 1I6KA 4WQMA 3TF5A 5DN9A 3LIPA 3P1JA 3IQEA 3ZG6A 1C81A 3AMVA 5AIAA 5ALTA 3FXAA 1UC9A 5EEGA 1O9GA 2VQSA 1GXSB 4MCJA 1DKMA 3UWPA 2ZSKA 1YVUA 3GPDG 3T5MA 4LSMA 2DUNA 3AVUA 1OFVA 3PFBA 4NQZA 5JC8A 1NW6A 4X6XA 1DCTA 3RKRA 3UAXA 3G2QA 4OA8A 3S5UA 1PF7E 7REQA 3G2LA 2P3OA 3IVGA 5ILOA 4M1ZA 4HP8A 4P98A 3SI7A 4XRRA 1YQWA 1IULA 3ROEA 1O95D 2BFOA 5TS2A 2DECA 4BMNA 3SE0A 3V2HA 3ECCA 3R1IA 3KXIA 3LCJA 3MYYA 4HAZA 4CN8A 5AW1A 3PD7A 2WKSA 2QJTA 3D59A 2XXAB 2OT3B 2V3VA 2IYVA 2QTAA 1EJBA 1I7LA 2J5KA 3L02A 3MCUA 1VPDA 3D4IA 3R4CA 2BZGA 4RL6A 5T3YA 2MYNA 1M1YB 1T4BA 2P2ZA 2O0LA 5LXTA 3OFSA 3GJYA 4CTNA 4ROTA 3ZJ5A 1EJ0A 1Z75A 3D9QX 3LVQE 4UAJA 3GBSA 2BFWA 1KOFA 3NZEA 2RCNA 2P1DA 3KSBC 1WBDA 3RHTA 4K6KA 2I1QA 1KZGB 2XEXA 1G21A 1B0AA 1ECJA 3OQHA 2BMVA 1DAFA 1YVPA 4N9WA 1IHOA 3ZHYA 5IDVA 3A1UA 3FD8A 4TVSA 2SBTA 3OJXA 1PJTA 2P6MA 4RH1A 4DTIA 5KEIA 4MYTA 5COBA 1SHLA 2FK7A 1DFGA 1PU2A 3A9VA 5FA6A 5LDGA 2FHSA 3BWVA 1L7AA 3ES9A 4GRIA 4O8CA 1I33A 4E2ZA 2AG8A 1N77A 3W90A 2AG5A 3C3YA 1K2WA 3MWEA 5LZ7A 1XPOA 1Z33A 2QLJA 2YV3A 2JIDA 3BXPA 3DWIA 4QU8A 2OPHA 1KTVA 2Q4RA 3NTOA 1RC8A 4HQ6A 2CXOA 1DTWA 2O3TA 3MZ0A 4EWLA 2F1JA 3D7SA 3U17A 1V8DA 2EL7A 3BGVA 2ARKA 2BEJA 2X8AA 3TSZA 4LFBB 3I53A 4XIYA 5HUHA 1HYGA 1JQLB 2CFOA 1SY7A 1VKRA 2D3TA 4YLYA 5K03A 1G64A 2VLBA 2AG1A 3KWLA 4JR0A 4QSHA 1JDJA 4G0ZA 4M6WA 5AJWA 2H1LA 2PRJA 1G5TA 2Q3DA 2RHMA 1GGHA 2OBNA 4J3FA 4PNZA 4WKBA 2B9VA 3U80A 4PN3A 1DX9A 1TVEA 2PMCA 3DTVA 3IOMA 1VGQA 4HAYA 2G06A 3PFKA 4ZOLF 5D86A 5GJCA 4XJXA 3RROA 2JLZA 1AV7A 4O6VA 1EZZA 1NM5C 4LBYA 3WGZA 3ZCTA 2Q41A 3ORHA 1N0WA 3S5JA 4DLZA 3RYHB 2TMKA 2GLTA 1GZ3A 2NU8A 1SR8A 1XZNA 1BGVA 5JS8A 3QVGB 1BE1A 3PEVA 2FSFA 1Z5WA 4KAAA 2VN8A 3UW1A 2ZRLA 4DSAA 2YRFA 4WVLA 4MAFA 1Z5OA 1E4OA 1Z3CA 5K3BA 3WRXA 3ZI7A 1GL9B 3AVVA 1PD1A 5B3AA 1H3EA 1V39A 1D1QA 4IW3B 4X8MA 3WYDA 1KI7A 1L6RA 1YZLA 2WJPA 3LDAA 4IGKA 2JEOA 4LWQA 4NMLA 3TNDA 3M82A 3KZKA 4KUHA 4FJ0A 1RRFA 1MN6A 2AS0A 2XWBF 2WQZA 5E2BA 2RJ3A 3SC4A 2H52A 3C70A 5AM3A 2CV1A 2NACA 3RC2A 1EINA 2DZDA 3FKQA 4DUPA 4HVLA 2VDWB 4KXXA 4DUZB 1GPLA 1X7DA 2BFEA 4XUDA 3A1VA 1WEKA 3T3IA 4FWTA 3N2LA 3CQ9A 4EHNA 5FTKA 5HK8A 1Q84A 3ZXYA 4LJLA 3QFHA 2JZCA 3DV0B 3RT7A 4POOA 2GAOA 3EIOA 5C80A 5EUQB 5FHRA 5KYTA 3B1VA 3TKYA 1KTIA 1ENOA 1ESEA 4BB9A 1QQAA 1IZ7A 4FX2A 1VB3A 3GRFA 3AUYA 3FGPA 1WZNA 4HQLA 4YP5A 2CDCA 3VBEA 1U4OA 2QRVB 1KI1A 1Q16A 2HA0A 3B1WA 4MPPA 2HTEA 4C0AC 3MUOA 3BFXA 4G0YA 5IYZF 1N3IA 1UFVA 3DBRA 4FFBB 3UAVA 1V25A 3KHUA 3DDCA 2Q8PA 4PRKA 1UWCA 4QUIA 4MICA 3BBPA 4MHTA 5CGQB 4QBKA 2XOKA 4YX9A 3LUDA 5LM3A 3DE4X 2JIMA 3MB5A 3VPDA 1XV5A 1P62B 5K9ZA 1UJ5A 4OHPA 1WV0A 4J16A 4JOQA 1E2PA 4PQYA 5K3AA 1UPCA 1E2NA 2Q3EA 3COSA 3WNCA 4KPUB 1T4CA 3WGKA 3LPDA 1JGTA 4PX9A 2LTAA 4B80A 3SQWA 3C6YA 4YRCA 2EJBA 2QRNA 3DHVA 2QN9A 4Y2XA 5BRJA 3NDIA 3TUIC 2FR0A 1T6YA 5FA5A 2ZS7A 3VOSA 1N2SA 1XHLA 1UBTS 3CF2A 3KXDA 3LCVB 3D54D 3PDIB 1EDZA 4OF4A 3JSAA 1O95A 4CLOA 2Y1GA 4BLSA 1PJ4A 3R3HA 1E5TA 1V71A 3P0IA 3QU2A 2EAUA 4YPOA 3I04M 4Y2PA 2I33A 2E5WA 2YV5A 4JP5A 4MMYB 3U3XA 4J7XA 2VNIA 2X9GA 4V0NA 2DFPA 4B4KA 4GEGA 4B3SB 3CRW1 3L7DA 3OC6A 3MIZA 3FYHA 5LCXA 1TVMA 2VA9A 3BXOA 4S0XA 1GGJA 2ZIFA 5KTSA 4S35A 3I30X 5L45A 2H2AA 3WY9A 3EODA 1DC4A 1NIPA 2AHOA 3THWB 3DCYA 3WAGA 2OHHA 3OFJA 3T3OA 8OHMA 1K9SA 5WRFA 2RAPA 3PHGA 2W2QA 1QHIA 4JELA 2JFPA 4G63A 4ZJYA 5IDWA 5JCZA 3FVTA 1NMYA 2WWIA 3NJ4A 4L1KA 1H9BA 4CIXA 4DLSA 1WHTB 2O8BB 5CEFA 4W5NA 4IOKA 4F3YA 1RRKA 5B2EA 2DYKA 2O23A 4UBMA 1EA7A 1KJNA 1S2DA 2EP5A 3KG2A 4CWAA 2PX3A 3STUA 3DE2X 4U7PB 1KDVA 3FDZA 4UHCA 2HNKA 3IJ5A 4IWXA 1QJ4A 1U90A 4MW9A 3PNMA 5MN4A 4TKUA 2FLWA 1A9QA 4MRMA 1JI0A 1WSAA 1Y8RB 2BKVA 2YJNA 4J0IA 1RDFA 1T2VA 4JD5A 3N8KA 2VQFB 4XZ3A 2QYOA 3RYFB 1RADA 2W6IA 3DA8A 3PPIA 3VR6A 5LIRA 1OXSC 3FNQA 1RHQA 1YNSA 1ZONA 1W46A 1O3YA 2HD4A 3BXFA 3I42A 4TTPA 5IBQA 2GQ0A 1R6UA 3WXMA 4RY9A 1D2MA 3O92A 3QWIA 2OCKA 4TLBA 2MU1A 3KNZA 3DNMA 4INZA 1W7AA 4JI1B 4Y2HA 3ZWAA 3KAKA 5BSUA 4XX0A 1AKVA 3IGFA 2BZ1A 4TMKA 3IL2A 1TE2A 4OBEA 1VQ1A 4EK9A 6REQB 1D4FA 3EXAA 3HCWA 4BQNA 3I6QA 5C32A 1BQ4A 1RPAA 3AP2A 3OE5A 1RQLA 2WFZA 3K53A 2YMQA 4ITRC 4X8OA 1KDPA 5DGIA 4UOQA 5FOTA 5AXBA 1DG3A 2WFLA 4YMWA 4JGGA 1U8YA 3I9NA 2LVBA 5F3WB 3IXQA 4A23A 4N4AA 3SJ7A 4AZVA 2NUBA 5KKNB 3ZJUA 4GKKB 4J75A 3A4NA 4FW9A 3A11A 2M1ZA 4L3OA 2WNHA 4C08A 1TAUA 1OWMA 4L8FA 3F6RA 5L8VA 4A6PA 3MCWA 4EB0A 1OHHD 2FPGB 1J1ZA 1N5IA 2O3JA 2H18A 4K3VA 3BB1A 4IQ8A 2BV3A 4LZPA 2X40A 4RETA 4XDHA 3MTDA 4ZAVA 3R7SA 2QJOA 4IDCA 5HF6A 1WCIB 4ZVMA 1PFGA 1SUEA 2HSGA 1A5BB 3C5WP 3OPXA 3EH2A 1Y3DE 2W2LD 1YV9A 3A4TA 4OXQA 3DDOA 5A0VA 1G8YA 1AQJA 2BRUC 3WQRA 1EVEA 1DP4A 1I0LA 4M2LA 1JT9A 4RY8A 4G0UA 4X84A 3NEYA 1RRPA 1VLMA 1H8ED 2BY4A 4JI3B 3G2NA 3CEPB 4PZAA 3LX4A 5CPFA 4C2AA 1RHUA 2PZMA 4HX2A 4R31A 5G4LA 3ESAA 1E8DA 3CH7A 2D54A 3FI9A 4HDMB 4PHCA 3ZHQA 5KNDD 4BIIA 3FLEA 3A4VA 1CB7A 2XNCA 2J33A 4HZUB 4CLXA 1WBJB 2O8CA 1HH4A 4FVTA 1IFXA 1TKRA 5JSZB 3U7QA 4OQZA 3BHNA 2WSYB 4GZ6A 1HOXA 3HFJA 1J2TA 1X7GA 3R8FA 5EJEA 2VZLA 3ONFA 4YUVA 1I7SB 2VQEB 2VRNA 1XB2A 3A2MA 2I71A 3WKEA 4N41A 4XB6B 4UBOA 1K6JA 5KYYA 1JPUA 1WB6A 1L8OA 2CKMA 2XBMA 3WG9A 1NP3A 3TIVA 1Y98A 2AC7A 1NL3A 2ZUDA 3EGVA 2IBMA 4RQAA 2PR7A 1L7EA 5TPZA 3F7OA 4YMGA 5A02A 3FSRA 5EHGA 2PU5A 2C8LA 2FQWA 2LP4Y 3LDUA 4WV3A 3SF0A 5K01A 3AEZA 1I4WA 3PHBE 4YECA 3DLBA 1P6QA 5GOZA 2WDZA 3D0QA 1BFDA 1Y8ZA 1U3FA 5DE3A 4PYIA 2XBUA 4K1XA 4RE5A 3GRUA 5E3JA 1XIVA 5LFAA 1H66A 1GNSA 1X3LA 1Z13A 4M88A 2H6EA 3FTPA 3MERA 4L75A 3X2EA 1K2VN 2PLFA 3GDFA 2QTVB 1Z74A 3CF4G 2HO4A 4NPCA 4F45A 4HCJA 4IDAA 2QRZA 3VDNB 1Z82A 4DLYA 4F1WA 4ES6A 3FRHA 3V4VB 3ANSA 4R9VA 3ILHA 3HM2A 4RMGA 2FXIA 3RC7A 3L9XA 2C1XA 2NYUA 1DELA 2VOEA 3EVEA 1EDBA 5FPKA 5IDQA 4W5TA 5JMTA 4QM6A 1JR6A 4ZZ3A 3I5UA 1JR2A 3GG9A 4LHXA 5IJWA 5AO9A 2PGJA 3F3YA 2C00A 4PGFA 3AVYA 2JGDA 1GPBA 3QKTA 5FBWB 4AMGA 1N1DA 3V9PA 2OFOA 3VAZA 4Q1AA 3ZDEA 4LGVA 4DUGD 5KTPA 3H1EA 1HZZC 3M6UA 1M8KA 2O7QA 3OBBA 4RV9A 3CX4A 1NF2A 4K5QA 2B69A 1F8UA 2FDXA 2G5GX 3B53X 1DCFA 1JIIA 2WZBA 3OX1A 4HNRA 4NV3A 5H4HA 5SYMA 3RUEA