4UEKA

Galactitol-1-phosphate 5-dehydrogenase from e. coli with tris within the active site.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
346
structure length
346
Chain Sequence
b'MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHEFSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEYIVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCAVALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVPQTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWETASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTITOL-1-PHOSPHATE 5-DEHYDROGENASE
publication title Enantioselective Oxidation of Galactitol 1-Phosphate by Galactitol-1-Phosphate 5-Dehydrogenase from Escherichia Coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 110
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 1.1.1.251: Galactitol-1-phosphate 5-dehydrogenase.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4uekA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4uekA01
3DB2A 2O7SA 2YUTA 2EXXA 3FTPA 3NYWA 3PXXA 4XEHA 1B3RA 1E1LA 1ZUD1 3ITDA 4CL3A 1M6HA 2CVZA 1SAYA 2J3IA 3DAFA 4YT8A 2X8LA 2Q45A 3BTSA 2YHIA 3SJ7A 2AQIA 2Q1UA 1YB5A 1GQ2A 1XR3A 2PZLA 1YH3A 3OJEA 3FN4A 2OP1A 1LJ8A 3F5SA 4FFOA 1LQUA 3GAZA 3OHSX 1PJBA 1ZW1A 1V9LA 1OBFO 1Y5MA 3GGPA 3GMDA 3JCZA 4ZRNA 2I65A 1KVQA 4CUZA 2C07A 4FIZA 3R1IA 1W4ZA 4MINA 1Z7BA 4BO7A 1DDOA 3ZU5A 1QLJA 3CTMA 3V1UA 1C1XB 4ZHSA 3LSYA 1PQWA 2F1KA 4K6CA 2E6UX 4PLHA 2I9PA 4A2CA 3CZRA 5A9TA 1NTOA 2Z95A 1ENYA 4KOAA 5JLAA 3ZWMA 2BI7A 3TZHA 4RPJA 4DBZA 1EVYA 3PRJA 4PRKA 1LRLA 4NU5A 3MEQA 4A03A 4HXYA 1EUCA 2UV8A 3KB6A 2NQTA 3DWFA 2HMSA 1UXHA 1IY8A 2AEFA 3A14A 4D0RA 4OAQA 1I2BA 4FFPA 2I5PO 3FNHA 1P1FA 4FOOA 1Y8QA 1GR0A 1ULUA 1T24A 4I5EA 2ZYDA 2PA3A 3S2EA 3DZKA 2YZ7A 4EDFA 2DC1A 1B26A 4R69A 1JN0A 1A5ZA 1MXFA 2PD3A 1O0SA 4BUCA 4RCVA 4JBGA 3VHRA 1PZEA 3V2UA 5KJFA 1E92A 3PK0A 3JQAA 1E3LA 1LRKA 4FS3A 4BV8A 3WB9A 2DT5A 1LDGA 1OC4A 4B4WA 4J6FA 2FPPA 1SBYA 1WP4A 2UUOA 2EKPA 4J4TA 2VT3A 1P1KA 3VAZA 4NG5A 1P31A 3GLQA 1V3UA 4YJGA 3AU8A 4R68A 3ON5A 1EE9A 1HYGA 2X5KO 4BO1A 3V8BA 4BO3A 4OIMA 5T5QA 4EUEA 2C29D 4CM9A 1HLDA 1RM0A 4XQCA 2YDXA 2DPHA 1Z82A 1JDJA 3L4BA 1ZKMA 3CINA 1GEGA 2UAGA 4LCEA 3IKTA 2EV9A 4IZHA 3RFTA 4ZN6A 5ILGA 3G49A 1EDZA 1R4MB 4IUYA 4PZDA 5IJZA 2CMDA 1B8VA 3DO5A 4YQYA 2O3TA 2IODA 1A7KA 4CUKA 4CMHA 3GVPA 1ISFA 4PG8A 5ITWA 1YONA 1E1MA 2CNBA 1PWZA 4XB1A 3SX2A 3T7EA 1MUUA 3ZHXA 3ONDA 1B16A 2ILTA 2VTEA 1I3MA 1OZAA 1QR6A 3CZMA 4I5DA 4P22A 4Z0TA 4ONEA 3QV1A 1UZLA 1U8FO 2EW2A 2IYPA 3RROA 5K0ZA 4O6VA 4WLOA 5C3MA 3KHUA 4JJGA 5GZ6A 4K26A 4JIGA 3I1JA 1YO6A 2AQ8A 2NU9A 1KIFA 4EJ6A 3G3EA 1D3AA 1BXZA 2EJVA 2E37A 2R00A 4MVJD 4DTIA 4PG6A 2VUSA 2Q46A 1LDMA 2EERA 3N74A 3AM3A 4RLHA 2WEKA 4ITUA 2D2IA 1M6WA 5LCXA 3TPCA 2R6JA 2X86A 1NR7A 1X0VA 1G6KA 4GL4A 4YB8A 5JCJD 1A9YA 3DL2A 4J4HA 4RVDA 1KVUA 3LVFO 3PWSA 3KYDB 3RBXA 4J7XA 5K1SA 1VJ0A 3I6QA 5F3RA 3PYLA 3VDQA 1GL3A 4OXKA 4CLHA 2JL1A 1EVJA 4XQGA 2B0JA 2W2LD 3S1LA 1CRWG 4RZHA 4P4GA 1EE2A 1FDWA 5DCWA 1T2FA 3DFZA 3GN1A 2AXQA 2PNFA 1E7YA 1WLYA 3PYXA 2VHXA 1Y8QB 5TS3A 4J49A 1K6IA 4PRLA 2B37A 1M2WA 4G81A 4PFJA 5F1KA 1AXGA 1MC5A 3U4HA 5BNFA 3KOUA 3JYQA 3L9XA 3KM0A 4DIOA 1PEDA 3WGTA 1DEHA 1WMBA 3C1OA 4B3JA 4CV0A 4AVYA 2AQHA 1E6UA 3L4BC 4EZBA 3DTYA 3M1AA 5H81A 4DIBA 3JQAB 4AJJA 1X14A 2X9NA 4IJKA 2PGLA 1MP0A 4UUMA 3WYCA 4E2ZA 4IM7A 3OJOA 3KSUA 4GPD1 4WLNA 5TC4A 1LBEA 2I3AA 3ZHBA 1PGQA 4TRMA 5EIOA 4W4TA 3TZCA 3VZSA 3PLNA 3RC9A 4RF5A 4BNHA 1I36A 3PJGA 4YJGB 2C2XA 2IZZA 4FFLA 3LU1A 1VC2A 1MG0A 1PL6A 1LLDA 3I9NA 1KERA 1NNUA 2EHDA 3QVWA 4Y8VA 4BL5A 4OXNA 4P4LA 3GZNB 1XQ1A 4EJ0A 1YXMA 4CM8A 3B1FA 2NWQA 1GD1O 3V1TC 4CQLB 2X5JO 3DC2A 4KWHA 3ZDFA 1NHWA 3TRIA 4ALIA 4Q3BA 3NKLA 2R00C 2G5CA 4RF4A 2CDAA 3BZUA 1OOEA 4UVEA 3OQ6A 3EVNA 4R5MA 1KOLA 3RD5A 5A02A 4J7UA 3RUCA 2FR8A 1P1IA 4CLRA 3K6JA 5JPIA 1S7CA 3W8DA 1W6UA 2O4CA 4J0EA 5T8KA 3U4IA 1GUZA 1U2GA 3RFVA 1WXDA 4Q9NA 1UDAA 4M87A 3L4SO 1QXSA 1RM4A 2YJZA 4E2XA 2DM6A 1A4IA 3DBRA 3DAPA 3F9IA 4Q3DA 4DC0A 3I5MA 1FMCA 4N5NA 5BSFA 1WDMA 2JAHA 2OFPA 4NU6A 4R4JA 1LUAA 4DRYA 3UOGA 4E5MA 1N1EA 4HNHA 5I9LA 2WYUA 2QQ5A 3GPDG 2Q4BA 1D8AA 1PGPA 1BSVA 3OIFA 1VPDA 4IJVA 5G0WA 3ZWXA 4XRRA 1F8GA 1DOHA 1PZHA 3KSZO 4YBZA 5G0SA 4TVOA 4BKUA 4AJPA 1NHGA 2Y1OA 3IOYA 5F5NA 2HO5A 3VC7A 4BNGA 1WDKA 2YFQA 3Q9UA 2B83A 3QSGA 5COAA 3BHJA 3OIDA 4GAEA 4BO0A 4UVDA 3JQBA 3CPSA 1C0KA 3KEOA 4GKVA 1O94A 4UEKA 3WGHA 3UCXA 2D3TA 4R1SA 4QUKA 2D8AA 4MPDA 3Q1LA 4E31A 1PJ2A 4D0SA 4BNKA 5KJ6A 4YRAA 2P9CA 5JMWA 3PGXA 5AQ1A 4EGFA 1Y6JA 4L9RA 4HKTA 1WVGA 5A9SA 4GBJA 1YKFA 2BI8A 1Z75A 1GDHA 3EVTA 3FBGA 4O63O 3K31A 3W4IA 1R16A 2B4RO 4BV9A 3ST7A 3IMFA 4MIOA 1YWGO 4BKRA 3DZJA 2VYVA 1UDCA 1GQQA 3TFQA 1N7GA 3GR6A 4NI5A 2PLAA 5K9ZA 2C20A 1A4UA 1RKXA 2O3SA 3JQEA 4BNLA 4A7PA 1LSJA 1NQ5A 3H2ZA 3V5NA 5JNLA 2I67A 5BR7A 3PHHA 4ZICA 2DPGA 3UAGA 2OBNA 1E3JA 2J5QA 2NLOA 2UVDA 5JY1A 3IAHA 4DPKA 4UVGA 1ZH8A 3MCVA 5T8KC 1LXCA 2FWMX 1O89A 1FDUA 3VZQA 4CM8B 1G1AA 1LA2A 1Z73A 3VKUA 5DNAA 4PZCA 1ZFNA 4A10A 4AJNA 2BELA 1BVUA 2RIRA 2I99A 1TT5A 2C82A 1UP4A 4RL6A 1LDNA 2RH8A 3NTOA 4OYRA 4TSKA 2W90A 4L4SA 5K6AA 4Y6PA 3GA0A 2EP5A 2R2GA 4LSWA 4R16A 3FTNA 3SXPA 4R3WA 2D1YA 4CM7A 2I3GA 1VE9A 1ISGA 3INTA 1GCOA 3BMNA 2W4QA 4J9VA 3AY3A 4TQGA 3H5AA 4GGOA 2CY0A 1CEQA 3SLGA 3WDSA 3ZWCA 3M2TA 3ZH2A 2GSDA 3U3XA 5MGBA 1KEPA 4B79A 1Y5RA 3DBRB 3P2OA 5HRUA 4E3ZA 3TN7A 4Q39A 5DCYA 2Q2QA 4DBVO 4NBWA 4K28A 3MJVA 3R3JA 2POQX 3JQBC 4RVGA 5TX7A 5U4QA 2AMFA 1R66A 3K2BA 1RYEA 3GGGA 3NEPX 1HF3A 5L3ZA 5L7YA 3WGIA 1HSZA 4MVJF 4QEDA 3O38A 4G2NA 4GVXA 4Q3EA 3QHAA 4HADA 1O95A 3O26A 4TRJA 5FI3A 1DIGA 1PL8A 1WW8A 5IFLA 2QRJA 4WLFA 1Y81A 4BNZA 5L53A 1PL7A 4JLWA 4IDGA 4DREA 3OA2A 3EDMA 1YL6A 1ZK1A 4BOYA 1FF9A 5CFZA 3JQ7A 4JROA 3AW9A 3SEFA 1YBAA 4L76A 4WCFA 5ICSA 3COSA 4W6ZA 2JD0A 4LW8A 4UVHA 1ZCJA 2D5CA 1UAYA 3RBVA 5IDQA 4GSLA 2ZTUA 3DXFA 3ICPA 1Y9EA 3WX0A 3E9NA 1U5AA 5GZ1A 3PJEA 4MVJA 3ROPA 5A5EA 3TOZA 2H5LA 1PS9A 1Q0HA 3UFXA 1P77A 1NPYA 1EZ4A 1OI7A 2HK9A 3E6AA 2CF5A 4E30A 3BHMA 5A9SB 2Q1SA 3ONEA 2J3HA 5ICMA 1QYXA 5L7TA 5A03A 3FPLA 4QECA 1MLDA 4RORA 1AUPA 5CDGA 5JC1A 5G2OA 4YWJA 5F21A 1KVSA 3GT0A 1X0XA 4GQAA 4R9RA 2YYYA 3K92A 2F00A 3BIOA 3HDJA 3NUGA 4HV4A 5CDUA 2YV1A 5TQVA 3CH6A 3Q3CA 3MZ0A 3KSDO 1YQDA 1DAPA 5K6AC 1N92A 5KWEA 4ND2A 4GX1A 2WM3A 4HUJA 2ZKLA 4K6FA 5BSHA 2VCYA 2Y1GA 3Q2IA 1SEPA 2P4HX 1E3SA 2DBRA 4GSKA 5EMHA 4YXFA 1H6CA 2C59A 3LT4A 2PTGA 3RWBA 1MFPA 3HZZA 2IYOA 2DUUA 3PGJA 5KTKA 5TLSA 3BMQA 4KMSA 3EYWA 3KV3O 4JJIA 1SEVA 3WOHA 1ISHA 3GK3A 4JN6B 3D3WB 4JK3A 3AUUA 3KEQA 4PZEA 1A27A 1TT5B 2Y67A 3IP1A 4XQ9A 3RC7A 5FEUA 2GNAA 4LCJA 1GQYA 2Z1NA 3ZI0A 4WK6A 4BMSA 3ORFA 4CQMB 1XYGA 4J1TA 1D1SA 2Q2VA 3GVIA 4Y6RA 4BO4A 4YJFA 1HDCA 4HBGA 1PJQA 4BO2A 5G0TA 1CWUA 1EVIA 8LDHA 4I1IA 3GRPA 1C14A 2DUWA 1NX6A 2H1SA 5F1PA 5LDHA 3QWFA 3EUWA 3E5RA 4DPLA 1IOLA 1HDRA 4BO5A 1NASA 4Z3KA 4BQRA 3WQRA 1YDEA 1JVBA 1OC2A 1ZNQO 3ETEA 3KBOA 3PP8A 4DC1A 1ENOA 2GN6A 4MVJG 2NVUA 3B20A 3UKOA 1M66A 3HUDA 4WCFC 4XWYA 5KJ1A 1DIRA 5DBIA 2GN9A 5G4LA 2J5KA 4OKIA 2ZB8A 4OO3A 4EBFA 3EK2A 1AHHA 2DBVO 4ZQGA 1WAMA 2RHCA 2A35A 5GZ3A 1NAIA 4O1MA 3OJFA 4J90A 1U5CA 4M86A 3W4JA 5HM8A 1CF2O 3AFNA 2IRWA 5DULA 3F1KA 1ZIDA 3QLJA 4A5OA 4QO7A 4U8GA 7MDHA 3JYPA 4XDZA 1XSEA 2B4TO 1N8KA 1ZBQA 1PJ4A 4Z9YA 3JQ7B 3PHJA 1YDWA 3A28A 3OMLA 4WCFB 3UVEA 3LC2O 3WR5A 2E49A 2H6EA 4L8VA 1E3WA 3L6EA 3VPFA 3DHNA 4XCVA 4JNKA 1L7DA 3FD8A 4RVSA 2DQ4A 4RDIA 1NM5A 2X22A 3ETGA 5B4TA 3R0IA 2V6FA 2D5AA 4IXTA 3C8MA 3G17A 3WBBA 2VQ3A 4NBVA 4PLWA 5L4SA 4IS2A 4CMEA 4NDNE 1B2LA 2NU8A 1NFFA 1V0JA 3NDJA 3K5PA 4CMBA 1WNTA 4IQ0A 4DYDA 4RO0A 3PIIA 4WOKA 2YV2A 2OXIA 2EGHA 2P9GA 3KRTA 4CJXA 4CV3A 1HDZA 2V6BA 1Z7EA 2O3RA 2VOJA 3QA9A 5HTOA 3S2IA 3AI1A 5KVQA 2YDYA 1VSUA 3BMCA 2QX7A 4ID9A 5IN4A 3WMWA 3DZHA 5DP1A 4XR9A 3TSCA 2JKVA 3HSKA 1PJCA 4J2OA 3S2FA 4R5HA 1GADO 3PZBA 2IZ1A 1B8PA 4YPOA 1ADBA 1WPQA 2C5AA 1F17A 3HN2A 4UUNA 5EQFA 1N7HA 4XKJA 1KY5A 3I3OA 5TNXA 4BKQA 4JGBA 2GD1O 3NJ4A 3DBLB 2W2KA 1U1IA 4OHUA 1RM5A 4J9UE 4DQVA 4N54A 4BMVA 3TOXA 1Z45A 1P3DA 3SJUA 4FFRA 3UCEA 2B4QA 2WWRA 4BGEA 4K1LA 4BNNA 2NV6A 2PKQP 3QVOA 3I9JA 4MP6A 4PLPA 5FF9A 4RDHA 1WZIA 2ZCVA 5A5FA 3JQGA 4LISA 4FD3A 3DDNA 4NJOA 3UICA 4DXHA 2BMAA 1U3WA 3JQFA 4E5NA 3P7MA 3LQFA 3LDHA 5LDGA 2ZJ1A 3DR3A 5BT9A 3OA0A 1LDBA 1I3LA 3AK4A 4NQZA 4YJFB 4LK3A 2ZK7A 2X58A 5JFOA 3JQDA 4PG5A 3PWZA 4B7XA 3I9MA 1MGOA 1NFRA 2PR2A 1TVEA 1HKUA 4MVJH 3WGQA 2HRBA 4UREA 1SO8A 1V8BA 1VJTA 1XCBA 3AUTA 3ENNA 3GVHA 3KYCA 1LEHA 5EPOA 5IZCA 1YGYA 4ZD6A 3IKVA 2O3QA 3ZCXA 2NVUB 3IL2A 2VZ9A 4YYZA 3AY6A 1U4SA 3JTMA 4OXYA 3JSAA 3LK7A 1RJWA 1E3EA 4J1NA 4B7UA 2VNAA 1PIWA 2WSBA 4FGWA 4ZVVA 4AJHA 3BTOA 3W6UA 1PJLA 3PYMA 4R41A 1GEEA 1H2HA 3PJFA 5B4VA 2GZ3A 3BTVA 1I30A 4CMEC 1N5DA 4AJ1A 5C7IO 1P45A 5A1TA 1YOVA 5C37A 2QYTA 5A9RA 2O23A 4JQCA 3JYNA 2QZZA 5JCXA 2FSSA 1FK8A 1U8XX 4FJ0A 1XU7A 2HAEA 3NDRA 4KUGA 1QYDA 3RC1A 3ASUA 2JFHA 1E3WB 4J43A 3MJCA 4D42A 3CUKA 3SC6A 3TZQA 1TEHA 1C0IA 4B8ZA 2BFOA 2GCGA 3VVCA 2BFMA 4I9HA 4OSOA 2RAFA 2FZEA 4W99A 1KC1A 3PQEA 4H3VA 1Y9AA 1PQPA 5I9MA 4JJFA 3C24A 3DBHA 3W1VA 4XD2A 4N5MA 1HLPA 2H9IA 7ADHA 1MV8A 3MJSA 3H9JA 4GX2A 2FMUA 5JMPA 4ZQFA 3E1KA 1P9LA 3R6DA 5KJEA 1CQJA 5COQA 1EEHA 1UDBA 5AXDA 3WLFA 1I2ZA 1LLCA 3JQFC 1L1FA 1XLTA 1ZVMA 5CHEA 4M54A 1J49A 2DVMA 2FSVA 1U2DA 3JD1A 1JA9A 1N2SA 3PPIA 2O3UA 2J8ZA 4RVFA 3RI3A 4CM4A 4E5YA 2V7PA 2YHIB 4WKGA 1E7RA 5EL0A 3ZNNA 3AOGA 1QSGA 3DZIA 2W2KB 3QWIA 4NBRA 3W4KA 1AN9A 3ROKA 1CERA 1EBUA 3WGYA 3LF1A 3NT2A 4OMUA 1VRWA 4HNGA 2EKQA 3C7AA 4BKPA 5IZCC 4LVUA 3JQGB 1O6ZA 1P1HA 3AFMA 4ALKA 4MOWA 2XXBA 4F6LA 3GHHA 3PHIA 1DPGA 2G76A 4EYEA 2OOSA 1G0NA 1YVEI 4AJLA 1R12A 1Y7TA 4A26A 2HCTA 1LTHR 1LDYA 1V3VA 1R4NA 2IZ0A 1M76A 1EUDA 1LI4A 2O2SA 1EFKA 4IQGA 4WEQA 4TKLA 5JDIA 5AXAA 3KYCB 1V35A 2GYYA 1Y8RA 1ADCA 4FPXA 1UXIA 2V65A 5JXWA 4EW6A 5L7WA 1DHTA 2QW8A 2VWGA 4PVCA 4E21A 3WYEA 2NSDA 3H5NA 3WBFA 1SOWA 5DP2A 3E18A 4A73A 1RM3A 1WDLA 4BO8A 3BMOA 4NIMA 5HA5A 3S55A 1QYVA 3ENKA 1BXKA 3GN2A 1GYRA 4ESOA 4GX5A 5TT0A 4I08A 3AJRA 1JU9A 4XYMA 4CL8A 1H0KA 4BKOA 3TQHA 1DLJA 4CMIA 1M75A 3GUYA 3EZLA 3RUEA 4R1UA 1E5QA 1EUZA 3O9ZA 1YOVB 2VN8A 1GZ4A 1B0AA 4CLDA 3K8ZA 1QYCA 5JYEA 4IDCA 2EEZA 1LC3A 4FC6A 3OQBA 1VM6A 5DBGA 4GWGA 4E4YA 1DO8A 1BTOA 3OECA 1HTBA 1I32A 3DZBA 1VL6A 3ZZNA 4J16A 2TMGA 3F4LA 3VPHA 3GFGA 4IDFA 2G17A 3WIEA 2BGMA 2E82A 1NVMB 1R6DA 2VRCD 4IIUA 3D7LA 4QT0A 4R3NA 4GMGA 2VUUA 1IULA 5L4LA 1NWHA 1DRWA 2IEBA 4YAIA 3DBHB 1J4AA 3C3XA 1GZ3A 1ZMOA 5TGDA 9LDBA 3ZNOA 2JCYA 5JSFA 3LYLA 3RVDA 4OOEA 2CF6A 4JP2A 4BQPA 2AHRA 4DVJA 1H6DA 1A71A 3GVCA 4S1VA 1GAEO 3WMXA 3GRKA 1UUFA 2VRBA 1VL0A 5JO9A 3I4CA 3WGZA 5L45A 1LRJA 3UUWA 2OHXA 4WNIA 3AWDA 3ZWAA 3KETA 4CV2A 3LT2A 4TRNA 2PK3A 4WE3A 1D7OA 2PZMA 4CM4B 1T25A 1DHRA 1F14A 2AA3A 3S8MA 3HQ4O 4ILKA 1JKIA 2HLPA 3PZRA 2A4KA 3RSHA 4OH1A 2C7VA 3ZV3A 3OBBA 2BD0A 3WWYA 4KQWA 3ZHYA 1F0YA 4WLUA 5JDIC 2FY8A 5HS6A 2X0RA 3HB4X 1X15A 4Y67A 2PH5A 4PLTA 4MVJP 2HUNA 4D3FA 4X54A 1HDXA 4B4VA 2PH3A 4RGBA 3GNSA 3RUDA 1PTJA 2UYYA 3P19A 4UVIA 1OAAA 4PN3A 1SPXA 1SB9A 3FR7A 2JD1A 5AYVA 2A92A 4XX0A 2V6MA 1MB4A 1R4NB 2GN4A 1O9BA 1LQTA 2EWMA 4XYGA 3JV7A 3M6IA 4ND4A 2VWQA 4BNMA 1ZSYA 1Y8RB 3VZPA 3FPCA 2NACA 3U49A 1B7GO 2QZ9A 5CEFA 2YQ5A 4HP8A 4WOJA 5CP8A 4BB6A 3M2PA 3GF4A 2XAAA 1PJSA 1X1EA 3LT1A 2Y1EA 4BGUA 1P0FA 4TZKA 1GYQA 1NP3A 2GUGA 3H9GA 1K3TA 1VKNA 5ES3A 1Q1NA 4MIEA 3OFSA 3BMOB 1GYPA 1T1RA 4GGPA 4LMPA 4UULA 5BNIA 3OQ1A 3Q11A 4D3DA 3ZV5A 3Q6IA 4RV9A 5CEEA 4JP3A 4JBIA 5EQDA 4J2HA 1P74A 4NHEA 2Z1MA 1LNQA 4NR0A 4CMIB 5L51A 3RCBA 4IJWA 1KEWA 4E5KA 1QV6A 5COBA 4CLOA 4R54A 4YAGA 4JCOA 3UHAA 2IEDA 1NFQA 3KXDA 2ZQYA 4ALLA 1PS0A 2J3KA 3AU9A 3OM9A 4CM6A 5I9NA 2X0NA 3QWBA 4DYVA 1NAHA 2WMDA 3NT5A 1ADGA 5I7VA 2DTDA 5AXBA 4EITA 4YT5A 2X5OA 1T2DA 5A05A 1PGJA 3F6YA 3U4CA 2TMDA 4YEDA 4WCDA 5G0UA 1QKIA 4Z9FA 3D0OA 2O2YA 1JVSA 1ONNA 4IGEA 2VZ8A 1UP6A 3OETA 3FNFA 3VH3A 4WUVA 4ALMA 1XG5A 4B7CA 4ZRMA 4LRTB 5T6BA 2G0TA 4XYLA 2VTDA 4ZGWA 2BF7A 2OORA 4D46A 4OM8A 2HDHA 4QFCA 4PLFA 3WYBA 2GDZA 3DTTA 3AM5A 1O8CA 4CLRB 4IPTA 3ZWYA 3NT4A 1Y1PA 3DZFA 4CLXA 4FC7A 3WNVA 5B1YA 1IHXA 3NTQA 1XKQA 4HFMA 2VHZA 3RUAA 3WGOA 5DCUA 4YJDA 4DIFA 3JD0A 4YTEA 3GQVA 3WIDA 2Y66A 2NTJA 3G79A 3NGXA 2FRDA 1E6WA 2GLXA 2I6TA 3GAFA 5EJ2A 4Q3AA 1H6BA 4NFYA 5C7LO 3JQ9A 5I7FA 1VJ1A 4UUOA 5DDIP 1DC6A 5DN9A 5KOIA 2IE0A 1I33A 5B37A 5U9CA 1I3KA 3H7AA 1EK5A 5GY7A 5DOVA 1ZJYA 4DQXA 1H93A 4O5OA 3KO8A 4M55A 4CUJA 1DFIA 4RF2A 4E13A 1E6EA 1XU9A 4JXKA 4CM9D 1ZEMA 1B8UA 3QP9A 2IDZA 4RF3A 1F06A 5CAEA 4DL9A 4HY3A 4L73A 1AE1A 3K30A 3ZNQA 1J0XO 1GPJA 2C2YA 3N7UA 3WSWA 4J1QA 5JYDA 1Z74A 4XB2A 3UGKA 2NM0A 3WTCA 3AOEA 4CM3A 4MKZA 2HK7A 4XYBA 5KKAA 2NUAA 4KZPA 3U09A 3ROQA 1DRVA 4CR8A 3HFSA 2CDCA 1UR5A 2LDXA 5ENVA 1M67A 4ROSA 3CSDA 3EMKA 4QX6A 2DTEA 1ZSVA 4J4BA 1HWYA 4IBOA 1G0OA 1EFLA 3RC2A 2Q1TA 4J7CA 5TRTA 4PG7A 3MWEB 3F47A 4AJEA 3H3JA 1K2WA 2ZB3A 2C5EA 3VH1A 1DAOA 2P5YA 4OQZA 1Z6ZA 3GHYA 5EESA 3GNTA 4B3HA 4HX5A 4IQ8A 4QFDA 2EP7A 1I0ZA 3HFGA 5JCJA 2GPTA 1T2AA 3FCOA 2QHXA 2FN7A 3B70A 3HDYA 3PHGA 4PLYA 2VHVA 4CMCA 2ZIZA 4FDAA 3PWKA 3PQDA 1HYHA 3ZV6A 3OEWA 5FI5A 3MOIA 4XGKA 3ZU3A 2PZJA 1U9JA 3D1LA 2Y1CA 2W2LA 1ZO8A 3E03A 3FSRA 1ONPA 5JW6A 1P0CA 1KBZA 2NVBA 2X0IA 2WD8A 3ASVA 3DFUA 4JX8A 4TZTA 4BNTA 1U3UA 3NX4A 3KYBA 1GUFA 2AG8A 2XOXA 1PR9A 3L9WA 5A06A 1R37A 2VHYA 4E2WA 2HRZA 3VPSA 3PFWO 4ZJUA 1NQAO 1S6YA 3U5TA 4I5GA 3F3SA 1GTMA 4LN1A 3ZWVA 2RBEA 5A3JA 1BRMA 1I24A 2GO1A 2EW8A 4FFNA 4NPCA 4CODB 1YJQA 5ADHA 3JQCA 1KS9A 4H7PA 4N5LA 5TJ9A 4URFA 3RKRA 5ER9A 1U28A 1C3VA 3TL3A 3I83A 2EF1A 1GV1A 2AQKA 3I9KA 4DQUA 4Q3CA 3HWRA 4E6PA 5CPBA 1ULSA 1X7GA 4HWKA 3JQ9C 4IGFA 1EDOA 2PY6A 2D59A 4IDDA 4BB5A 1ZXBA 4I9UA 1WWKA 3IQDB 4G65A 5JC8A 1JWAB 3KUXA 3BMNB 3EY4A 3EGOA 3HN7A 3NTRA 4KTTE 4CMGA 5JO0A 2X4GA 4BNYA 3PLRA 1U3TA 1C0LA 4MVJM 3VPXA 1DIBA 4R51A 3T4EA 1C1XA 4J3FA 4OQYA 2LDBA 1P1JA 3B1JA 3VTZA 5T67A 5IXSA 1KYQA 3U0BA 3HE3A 1H94A 4YJHA 3TWOA 2BGLA 3OEYA 2CUKA 3EAGA 3EW7A 3V2GA 1T4DA 2VRCA 1ZK3A 4HFJA 3AOEC 2GR9A 3ZWWA 3BHIA 4Z0PA 4E5PA 4GX0A 4BNWA 5IZ4A 2W8ZA 4XJSA 1MXHA 4KQXA 2JHGA 3H9EO 3Q0EA 1J5PA 5H83A 2O4UX 3C7DB 1SZJG 4MKXA 3P5SA 5EN4A 2PV7A 3RU9A 3D5TA 2WE7A 4CPDA 4N7RA 5HS4A 1GCUA 2GERA 3L6OO 1OMOA 3MJEA 2PKQO 4HFRA 4RPKA 6LDHA 3ZWPA 3HNPA 4FSHA 2Y68A 2B69A 4DUPA 2GRAA 4BS9A 3WXBA 5L40A 1U3VA 3ZNPA 4L4XA 3MJTA 2RHRA 4Z3DA 4PLGA 4HFNA 1SCUA 3PHLA 1HDOA 2VUTA 4AG3A 4D44A 3B6ZA 3QIVA 5L4NA 1NWCA 4BMNA 8ADHA 1SNYA 1GPDG 1NPDA 3UW3A 2CVOA 4IS3A 2NTNA 4FOSA 4ZU3A 4OJNA 5G0VA 5KCZA 1I3NA 2ZTLA 3SBOA 5KIAA 3TFOA 1P1RA 1ISIA 3JD4A 2OP0A 3JYOA 1IL0A 3QWAA 2JCXA 3I52A 1XGKA 4EUFA 2Q99A 3RUFA 4INAA 3WG9A 4ZQEA 4EI2A 4IINA 4D43A 3E48A 1IPEA 4H15A 4NBUA 3WQSB 3D64A 2EG9A 2JFFA 4E0BA 1PX0A 3D4OA 4BHTA 1X1TA 1CDOA 2BRUA 2PZKA 3C1AA 1X7DA 1NVGA 1H5QA 4OKNA 4CM5A 3FHLA 1B15A 1LLUA 1LDEA 3T7CA 3FWNA 4KP7A 2WTBA 4RPLA 3RU7A 3QE3A 3TZ6A 3OICA 3RUHA 2Q1WA 2XXJA 1R0LA 4NZ9A 2ZB7A 2VNSA 1JKFA 1FXSA 2HU2A 4AFNA 4YQZA 1VI2A 3QWHA 2GN8A 4IZIA 1T2EA 3RFXA 2C54A 4Y9DA 1A9ZA 2Y05A 4GWKA 4XR4A 3W8FA 1ARZA 1T1SA 1UZNA 1P44A 2Y99A 2WYWA 3BMQB 4CR6A 1ID1A 1H2BA 1ZMTA 3PVZA 4KWIA 1ENPA 4II2A 1ZK2A 3CE6A 2X23A 3AI3A 3P2YA 3C85A 3CMMA 4R9SA 1U4OA 1I2CA 1W8DA 5LC1A 3GZ4A 1PZGA 2X0JA 2HMTA 3HJAA 4TKMA 4H16A 4D45A 3HG7A 3SLKA 2B35A 3DQPA 5HWSA 2OL4A 1NBOA 1NVTA 2HMVA 2PFGA 2Q2WA 5H82A 2FPGA 4NMHA 4PGFA 4W9NA 5JAIA 3FI9A 4ND5A 4MJLA 3K2EA 1UXJA 1YE3A 2BHLA 1DLIA 1SC6A 2P91A 2GZ2A 3GEDA 5FFFA 3FNGA 2PD4A 2OBYA 3GDOA 3GG2A 2HMWA 3PI7A 4YJHB 1YRLA 4GLOA 2YFHA 5HBRA 2VYVD 2HMUA 2Q50A 1RYDA 3ADOA 4GI2A 1YQXA 3G0OA 4FGSA 3GDFA 1C1DA 1KY4A 1UXGA 3KYDA 5A3VA 3PJDA 3PQFA 3VKVA 4BNXA 5ENDA 2HSDA 1QV7A 3RQSA 4B3IA 4W7IA 3IDSA 3RIHA 1UP7A 3M1LA 5DOZA 1HE4A 1T4BA 5CPFA 2X1HA 4W82A 3ICCA 3U9LA 2AEMA 1X7HA 1BDMA 1XWFA 4IDEA 4LSMA 4MO2A 3ADPA 4RVUA 3GPIA 3HDHA 2ZTMA 3H8VA 4WECA 5AVOA 2QIOA 1F8FA 1EBFA 3AUAA 3DHEA 4QQRA 4Q3NA 4GMFA 3GEGA 3E8XA 3FRJA 3H2SA 4CQMD 5TJHA 4B4UA 2DBZA 1I10A 1LC0A 3V1YA 1E77A 4M89A 3DOCA 3O4RA 3CXRA 3WJ7A 1C0PA 1UAGA 4PLZA 1PZFA 4RQUA 4XRGA 3UH1A 3K96A 5KKCA 1JLLA 3I9LA 1Q0QA 2V6GA 1FDTA 2JJYA 1ZJZA 2DBQA 2IXBA 4W7HA 4Y98A 2X9VA 3DZGA 4F45A 4FJ2A 4P38A 1HL3A 3GZNA 2BGKA 5FYDA 4MKRA 2XPCA 3BMCB 1ISJA 1UXKA 5BSEA 4FFMA 1JTVA 1HZJA 3DMYA 1XELA 1UH5A 5KJCA 1LSOA 3TF5A 1JAXA 2Y0CA 4XGIA 4CMAA 4KUEA 4CQLA 3DEYX 4DWVA 4GKBA 3ZV4A 2WDZA 4YR9A 1IUKA 1F12A 1UJMA 2E48A 4W9NC 3ANMA 3WTBA 2H63A 2QG4A 2YV3A 1WZEA 3JD3A 3ZU2A 1BMDA 2D0IA 3GDGA 4LMRA 5L9AA 1KEUA 1W73A 4RPGA 2O48X 4BNIA 1PS8A 3A1NA 4F46A 4G5HA 3LLVA 3QVSA 4DLBA 1BXGA 3VVBA 1XDWA 1B14A 1I01A 4EEXA 4UEJA 3AY7A 3EHEA 4B8WA 1JW9B 1ORRA 3A4VA 1BW9A 4YAJA 4GLLA 4FR5A 4KUHA 1NXQA 1SOVA 1XIVA 1MFZA 4IIVA 1GFSA 3JQ8A 1YB1A 2CZCA 4UAGA 2DU8A 4NK4A 4YDRA 3ZHZA 4IMPA 5DBFA 2ZCUA 4CMJA 1DFHA 1ZXLA 4BIIA 3L6DA 3BXXA 5JAQA 2BLLA 5F5LA 3KLMX 3G1TA 1TI7A 2WD7A 1K89A 2Y93A 1NYTA 3MTJA 3RAJA 3WS7A 1HDYA 5ITVA 4NFSA 2AG5A 3INRA 3G1UA 3DBVO 3PDUA 2PKRA 5T57A 1C1DB 1PU2A 4U6QA 5FWNA 2DFVA 3F5QA 3RJ9A 5JDCA 1B3BA 3ZU4A 3H6KA 3ONFA 4L0QA 1GUYA 2BFPA 4IY1A 1KEVA 4U7WA 3FF4A 1XEAA 1PJTA 3E82A 5CG1A 4L75A 3D5QA 4AICA 2A94A 2B36A 2HJRA 4GH5A 1IE3A 2VYND 1NQOA 3QY9A 3X2FA 4WPGA 3E9MA 4F3YA 6ADHA 2P4QA 1ADFA 1FDVA 1KC3A 1E0DA 2OUIA 2P9EA 3ZW9A 2VWHA 3O8QA 2A9FA 3Q9NA 1I5RA 1E7SA 3HDQA 3RBZA 3VH4A 2W98A 1DC5A 2XF8A 3LZ6A 4S3MA 3ZWBA 1E1NA 2QRKA 1ML3A 2WYVA 4RLSA 1W0CA 2SCUA 1QORA 3OIGA 2X9GA 4AJIA 1R15A 1HETA 2ZTVA 1DSSG 4N18A 4OSPA 5KVVA 2FP4A 4DMLA 4XA8A 1HE2A 1T26A 3W8EA 4YACA 1DC4A 4BO6A 3DOOA 3C7CB 4FN4A 4RJTA 3GVXA 2J6IA 4DLAA 1YBVA 4EEZA 2BFAA 3H9QA 4WGGA 4F6CA 3MOGA 1CJCA 3H4VA 4KTVE 3F46A 2HQ1A 3H5RA 4ZA2A 5AXCA 1DRUA 3I23A 4QO8A 2CSUA 2G1UA 3LC7O 4A27A 3VTFA 4XJTA 3TJRA 2Y0DA 4R1TA 1NR1A 1QYWA 1HE3A 5KVCA 1XA0A 3NDIA 3U62A 4AJOA 2NU6A 5L95A 3WSVA 1BDBA 1IZ0A 1QRRA 4KDEA 1CIVA 1AXEA 3GFBA 2PGDA 3D4PA 2VWPA 3AM4A 3X2EA 2ZB4A 3HHPA 3JD2A 3HADA 3JYLA 4OGWA 1XHLA 2I66A 1YBMA 4BVAA 1YJ8A 2QRLA 4YT4A 1QLHA 4O59O 4PIVA 3A06A 3A9WA 4I8XA 4BNJA 3GY0A 1BXGB 3ANNA 3IUSA 1E7QA 2O50A 1ISMA 3AUSA 4C4OA 4ND3A 1IZ9A 1Q7GA 1EK6A 3L07A 9LDTA 2VZ0A 1DC3A 3BYZA 1A7AA 2HK8A 4BGIA 2I76A 3GH3A 1BW9B 1VSVA 5JDCC 2O3JA 4E32A 3PEFA 5IF3A 4RVHA 4TMFA 3JQ8B 4Z6KA 3RUIA 1DJQA 2O7QA 3LLSA 4TROA 2VHWA 4IMRA 3E9QA 1DIHA 1YQGA 2DKNA 3ROMA 5CG2A 4QXMA 1JKJA 4XIYA 1P33A 1BHSA 2NVWA 1BWSA 2FPIA 2YW9A 4J0FA 4R1NA 5ILOA 2GASA 1HXHA 3R3SA 3BA1A 3I6IA 4U0JA 2B5WA 5GMOA 4CLEA 2WD7B 4QSMA 4YAEA 3FBTA 1CQIA 3HB5X 2BKAA 1CYDA 4WLEA 1J6UA 4ALJA 4D79A 4M8SA 4PG4A 2Y1DA 3FNEA 1DJNA 5IG2A 3RKUA 3MWDB 2JHFA 4BO9A 4BNVA 3F4BA 4LGVA 1LX6A 3K73O 5C7OO 2OGUA 2FR1A 1N1GA 4U6SA 1VKOA 3IJRA 1PQUA 4P8RA 4EJMA 1MA0A 1DBVO 3PFFA 4XZ3A 5JBIA 5J23A 2E4AA 4NK5A 2GGSA 1Q7BA 2JCVA 2P2SA 4TWRA 4UUPA 4CM1A 3O8QB 3EZYA 3VZRA 5CEJA 3OSUA 1IPFA 4CV1A 2BH9A 1QG6A 5EERA 3STHA 2X7HA 3BAZA 1TXGA 2YHUA 3TDKA 2J3JA 5CDYA 5G4KA 2UDPA 2VOEA 1H9AA 3L77A 2AW5A 4I9NA 4ND1A 5DT9A 4FQ8A 3RJ5A 3WQQA 2Z5LA 4MP8A 3WNQA 1R0SA 3KVOA 2RH4A 5THKA 1Q7CA 2WE8A 4YA6A 1ZSNA 1E3IA 3CKYA 3IP3A 4PCVA 5BSGA 1OFGA 3IIEA 1AHIA 2WJPA 3OJLA 4U0KA 3IUPA 4JBHA 1TLTA 5TIIA 4C7KA 3ZN2A 3OJ0A 1SMKA 1LU9A 1LSSA 3NV9A 5AOVA 2CVQA 3O03A 3D3WA 4M49A 1VLLA 1MG5A 3LT0A 4AJ2A 1HDGO 4O0LA 1YB4A 5I8WA 1ONOA 5CDTA 2RCYA 4DLLA 4XGNA 4ALNA 5IAAA 1EQUA 3AI2A 2DTXA 2AE2A 5JE8A 2EGGA 3L0DA 4LVCA 4CQMA 3JQAD 3UN1A 3FWZA 3QJ5A 1BVRA 3JQ6A 1PR3A 2P5UA 4NFHA 4BGVA 5B12A 3LC1O 3QW2A 3NRCA 2FOIA 4ZQBA 2G82A 3GGOA 5TT1A 1A72A 1HT0A 2YQ4A 4NBTA 4YVFA 2ZYGA 1H9BA 3EC7A 4AL4A 2Q49A 3GEMA 1ZEJA 1K6XA 5I8ZA 1EQ2A 3GMSA 1BGVA 1T2CA 4MIYA 4RPHA 5IDYA 3RASA 1HEUA 2Y0EA 3NAQA 3UF0A 5JS6A 3DMTA 5BNTA 2ZATA 2CD9A 4TRRA 2HKIA 3INGA 4LRSB 2D4AA 4PLCA 3LF2A 3WLEA 3VOSA 1TA4A 1D4FA 1ZK4A 2OO5A 4FB5A 1PSDA 3VPGA 1N9GA 3ULKA 2AEJA 1YS4A 2ET6A 3PIDA 4IJUA 3WFJA 3OP4A 3PDJA 2GF2A 4MDHA 1GY8A 4WNCA 2P68A 1YL7A 4IDAA 3WWZA 4D3SA 2JFGA 5EINA 3V2HA 4FBGA 4DMMA 1LSUA 2ZJ0A 1DXYA 3N58A 5BQFA 1V3TA 3GNQA 4NJMA 4WLVA 4A0SA 1PGNA 3SVTA 4CLOB 3DONA 3TZKA 4WASA 3MTGA 5IN5A 1BG6A 4AJ4A 4WEOA 3ANLA 5B4UA 2GZ1A 3B1KA 1FDSA 3S2GA 3GOHA 4UEOA 4YCAA 2DLDA 5C5IA 5TSDA 1IB6A 3NJ8A 1E7MA 1E7WA 1DB3A 3DHYA 1V6AA 3OF2A 1PGOA 3QVXA 4FJ1A 5G4KB 4D7AA 2Q4EA 4II3A 5DZSA 3I9OA 1VL8A 4L74A 3UCFA 4YRBA 5JAMA 1HYEA 5A04A 3DAGA 4WJZA 3CIFA 1K0UA 2FHSA 1D1TA 3VDRA 1HSOA 3GG9A 3DOJA 5JY6A 1GU7A 3BTUA 1DIAA 3IC5A 1FJHA 2FR0A 5I7EA 1EMDA 3U4DA 2PWZA 2ZQZA 3W6ZA 1IHYA 4CMKA 2PGJA 2PD6A 2Q3EA 4E12A 3DBLA 4QTZA 3ZWNA 1WMAA 2VYNA 2CDBA 2DFDA 2QYSA 2UUPA 3E5MA 5IDWA 3ZW8A 2OZPA 3QRWA 3SC4A 2JAPA 2C0CA 1HE5A 2FZWA 2JD2A 5F1OA 5CDSA 1TT7A 4M1QA 1TB4A 1U7TA 1R0KA 4XIJA 3WGGA 1NQTA 3ABIA 1ZZEA 2B5VA 1ENZA 3NGLA 4J91A 5KNLA 3D3EA 3GC6A 3H9UA 4PLVA 1MC4A 2X6TA 3H3FA 2J5RA 1LLQA 4YAKA 4XQEA 2IXAA 3I4FA 3DMTC 3MJ4A 4P4NA 1AGNA 2VT2A 3PTZA 4DPMA 4R01A 1UZMA 1KVTA 5T64A 4E2YA 3IS3A 4Z9XA 4I5FA 1GV0A 3WICA 1NPTO 5KVSA 4J1SA 1KVRA 3D4NA 2EJWA 4DA9A 4E33A 4KDFA 4D41A 1XQ6A 3TNLA 3CEAA 1PJ3A 1QMGA 4BNUA 4XYEA 3TL2A 3QQPA 4MP3A 3GUCA 3KTDA 3Q2KA 2NTVA 5IXYA 3ZGYA 3OH8A 2AE1A 1X13A 1GZ6A 2HJSA 4NNJA 1JAYA 1IYZA 3C1TA 2NQ8A 5U1PA 1DFGA 1HRDA 1CETA 3VH2A 2NNLD 2YY7A 1E1KA 1K6JA 3ZWOA 3WJAA 4DGSA 1K5HA 3FR8A 1MX3A 5DF1A 5THQA 2C7GA 3ETDA 3KZVA 3UXYA 1HZZA 2DAPA 1N9GB 3H65A 3T4XA 1EVZA 4RQTA 1KETA 1E5LA 2NU7A 4IDBA 4Y6SA 3QVTA 4FCCA 2Y1FA 2EIHA 4IXWA 4Z0HO 5A4DA 4PVDA 4EUHA 1H6AA 3IJPA 3KLPX 4MVJI 4XDYA 3CMCO 4FW8A 4NJMB 4CR7A 1JWBB 1L7EA 1O5IA 4YT2A 4C7JA 1ZK0A 1SB8A 2EKLA 1Q0LA 3K9QO 4B4OA 5IDXA 4GVLA 3F1LA 4L4RA 4RZIA 4K9DA 4TVBA 1Q2XA 5I7SA 4OL9A 4U5QA 1R4MA 5JAZA 1JQBA 4YRDA 5ER6A 4NH4A 2CFCA 2NADA 1RWBA 1PWXA 2OMEA 1YL5A 1RPNA 3ITKA 4BNFA 5MDHA 4ZQHA 1U7HA 3WFIA 4OOFA 1QP8A 2ZYAA 5TF4A 4MVJE 1I8TA 4AJKA
chains in the Genus database with same CATH superfamily
2PSHA 1HE8B 3VAAA 1JEYA 4AS1A 4LQLA 1IN1A 3BXFA 2YUTA 1V1RB 4CL3A 4Y7DA 1WD5A 3AEUA 1SAYA 1I2MA 1T5IA 4YT8A 2H2DA 2H9AA 1N6NA 3AZQA 3BTSA 3A4TA 2VSFA 3MT9A 1PSWA 2VXBA 1CZRA 2ZRGA 5FQNA 4FBLA 1ISSA 3KFLA 3LIPA 3QE9Y 3EDRA 5J2UA 2AKEA 5BSKA 1XR3A 1G6HA 1YJXA 1YH3A 3WLMA 3FN4A 1YZKA 1Z37A 2OHOA 2WF5A 4GM0A 5CLGA 3TUIC 3R0JA 3W5IA 1I2AA 5JNRA 1LQUA 2V5VA 4LJ4A 4KLNA 1NDHA 4X1IA 1Y5MA 1OBFO 3GMDA 3HXTA 3JCZA 4TMYA 1BZYA 3LO8A 4JBWA 1Z34A 3SSOA 3ZI4A 5BN5A 5T3UA 4KE8A 2I65A 3TEMA 1L7NA 2XA2A 4NV1A 1ZI6A 3OJWA 3AETA 2NO7A 4GE0A 3SD7A 1W4RA 2P5TB 2IYTA 4E3WA 2VZLA 1ZQ1A 5CFNA 4X94A 3ZU5A 1QLJA 1VLQA 4KI0A 2D54A 3T5BA 4RAOA 1J2JA 5DNDA 4X62B 1Y8ZA 1I3CA 3A2MA 3DEIA 1HO3A 3LPCA 4X7PA 4MQMA 1S8AA 4Z5XA 3QV2A 5DFAA 3DVAB 3Q1KA 3O3MB 1EGHA 4TS1A 4ZZ3A 2ZBVA 2UXCB 5L8VA 2GCIA 4HZUA 4D8YA 1ENYA 1XCOA 4KOAA 5JLAA 2BI7A 2RGAA 3ZWMA 3HJRA 1ZC4A 4LBZA 4PRKA 1VIAA 3ZE7A 2GN1A 4HZIA 2SHKA 4G8JA 4DJDC 4J3NA 1UFQA 3DE5X 4HXYA 4JT9A 3ZVLA 2R86A 5C32A 2Z3ZA 4I4CA 4L0DA 3DEHA 4AYXA 1UXHA 1PWEA 1C41A 2IHYA 3A14A 2XMRA 4UDNA 3E9RA 3HR8A 5IULC 1KQOA 4JDUA 5J2TA 3IODA 5DRYA 2OENG 4RULA 4J2TA 1LQ2A 3EXHC 1EHIA 1DE0A 2XNSA 1HT2E 1BWPA 1O57A 2H51A 3OQIA 5KQSA 2ZYDA 5M34A 4YUZA 5CGQB 1MOQA 2UYQA 3ESYA 3UPDA 1CJBA 10MHA 1M6VA 4NJEB 3UUGA 4AMYA 3ZQUA 3BK7A 2WFAA 1V8DA 2IYEA 3G8DA 2QRGA 3WLKX 5GADl 2PD3A 1O0SA 1ECPA 2QVGA 3IBCA 3LXXA 4RCVA 1PZEA 4H2DA 3UNXA 5KJFA 3EIHA 1YBHA 3N5KA 3OPYI 1B8OA 3JQAA 3FYTA 2ZJ8A 1LRKA 2HHHB 1GKLA 4PYOA 4RZQA 3BBPA 2VSNA 4B4WA 2O5RA 2W0SA 4BWGA 2YWCA 3ZY4A 1WOMA 2FPRA 4PHHA 1V7ZA 3K3PA 2QUHA 3ACBA 1A9XB 4K03A 1P31A 2C5HA 2Q3FA 3LP5A 3EXHB 4BU0A 2JEZA 1F3OA 1YR7A 5BW6B 2WM9B 1M6NA 4FHFA 2AUTA 1EE9A 2X5KO 4O4JB 3OX4A 4FT2A 2XEDA 2VS1A 1ZZGA 3NJRA 4F4UA 1QHGA 2GXUA 3B36A 3EOZA 4QATA 4IIYA 5TB5A 3A1CA 3L4BA 2QU7A 4OUDA 4HLUA 3UJ3X 1U7XA 2OE2A 4IF4A 5J5CA 4DZRA 4IZHA 4FEAA 1ZIYA 1NATA 2ORED 5IJZA 4L5BA 4TV8A 2CMDA 1B8VA 2RG7A 3VPDA 1JKMA 2IX9A 1E4EA 2O3TA 2XCQA 1NUSA 3IXQA 4X95A 2DQSA 2HHAA 5KYUA 3FCAA 1PR2A 2H5JA 2WYOA 1YRAA 4EHKA 3P9CA 1NSYA 3HKEB 3ZHQA 4BMDA 4LF9B 5JJLA 2Y0PA 3D7KA 2Z58A 1VGVA 3QK7A 5EMKA 5F1YA 3STVA 4DA0A 1B23P 5BWMA 1SBCA 1KA9H 4HWSA 5CTJA 1OZAA 1KRHA 1QR6A 1Y9JA 4AJEA 4B40A 4YAFA 4CU5A 4I5DA 5AJVB 5EP4A 3P9RA 4Z0TA 3EJ6A 4US0R 2I78A 1VYHA 2IYPA 3CX6A 3PKIA 4B83A 1Z0SA 4ZOCA 5K0ZA 3AF1A 1UMBA 3R7NA 4P84A 3D6VA 1CS4C 4AWBA 5GZ6A 3VI4B 3QGMA 4FEYA 3UATA 4BMOB 1P61B 4DJAA 2A5LA 3SHQA 1QIDA 3F9RA 1CNMA 5F33A 3SQOA 4Z4CA 1RXUA 3PUKA 1ISPA 3DV0A 1EJ2A 4JZYA 2B4KA 4RY2A 2XR1A 3R0XA 1A2QA 2FPGB 2QU8A 4DTIA 1M2KA 2B30A 2VF2A 2PM8A 3LVQE 4M9CA 4PG6A 3BMXA 2VUSA 4PQEA 1JQ3A 3I1IA 5EFOA 1SU8A 3DEZA 4KXNA 3PL1A 3A3KA 2HU8A 5NLLA 2ONKA 2X0EA 1XZLA 2G9RA 2WEKA 4RLHA 5GPBA 1T0HB 4I1RA 1M6WA 3FRIA 2H4ZA 3EY9A 4C7MA 2W22A 5EHXA 3U44B 1CUDA 5GJBA 3DE1X 2ZIVB 2XV1A 2EJUA 5K3OA 4GL4A 1SHLA 1UBTS 1XB2A 2QSJA 3DL2A 4XWTA 3KHSA 4D5EA 1IM2A 3IHTA 4WERA 3GLFE 1O6FA 4I7EA 1PL0A 5I7AA 1RAIA 3SYKA 3EIFA 5IHPA 3I6QA 4K0KB 4EI9A 1NRJB 1U04A 5K0EA 1NYRA 2E89A 1IRXA 4OXKA 1BJRE 2LUOA 4X1KB 2XUPA 1ZM3A 3R3VA 3WB2A 4RABA 3WAGA 4EG7A 1NI4B 3ACDA 1XZIA 4RZHA 3IA7A 5FI1B 1EE2A 1ZP6A 2VBIA 5DCWA 2YIVX 3N2GA 3C3CA 3DFZA 4MJXA 4MGYR 3GN1A 2IYNA 2HA5A 1F4VA 1HUQA 5H3LA 4FZVA 1O97C 1E7YA 4HDNA 3RRJA 1ODIA 2OUKA 2VHXA 3EZ6A 3NXKA 4MUHA 1FQOA 4M76B 5TS3A 4A9AA 4OX9Y 1IZYA 1JHVA 1F8XA 4PRLA 3FVVA 4R8RA 2JFNA 3FCYA 3P97A 4PFJA 2OVBA 2WM2A 3BL8A 2LXNA 4BZZA 1MC5A 4UM7A 4EG8A 2C04A 5DW3A 5BNFA 3K70C 1QNFA 3JYQA 4HWOA 4A5SA 4DIOA 1XZ8A 4M38A 1U5BA 1DEHA 5EQJB 3WGTA 4B3JA 4EB8A 2RGXA 5CD1A 2XA1A 1VDMA 3L7NA 1X14A 3AG6A 1Q1QA 2W6OA 3PUZA 3EXFB 3KDPA 4H35A 4LVOA 4AXXA 5KVAA 1ZYUA 2R8OA 4LRQA 1FSGA 1N32B 3L8ZA 1N9KA 3LCUA 4R84A 4TXMA 3B6JA 4IQ4A 4MW9A 1PGQA 4TRMA 3ZHBA 4K9SA 4BCBA 2HPVA 4LKOA 1P2TA 1UWKA 1P4GA 2AYXA 3QG5A 1JG6A 3VZSA 3DPUA 2AN5A 1XLWA 2H1HA 2J30A 2QLJA 3PJGA 4N5IX 5E6SB 1GTRA 2CXUA 2XYGA 2FUG6 1RABA 2RDMA 4BRWA 2J3DA 2VP2A 3K70B 3T5AA 2V3CC 2POCA 1TJ4A 3I9NA 3G2JA 1KKMA 4QFBA 4Y8VA 4BL5A 2BGUA 1H85A 3MGAA 4P4LA 2HQRA 3BDAA 1VZ2A 4J0GA 3I05A 4EJ0A 1CJSA 3HRKA 5K2OA 3B1FA 2NWQA 1GD1O 4MTCA 1Z83A 2B61A 2A0FA 4E1BA 3BB4A 1XK7A 5FL7A 3P9ZA 4Q48A 4GOOD 4LWZA 2X5JO 4CQLB 1RRCA 4KR0A 3QUCA 5IUKC 4YV1A 2H1FA 4B31A 4EG4A 1EZZA 5CW1A 3MTIA 4H59A 3TG8A 2ECPA 2ZBDA 3B78A 1GGHA 3R3XA 4DCCA 3BICA 2ZS8A 4JI3B 2GEVA 3BZUA 4X45A 1C0EA 2QSYA 4R5MA 4RE6A 2H2IA 1IXRC 1W4AA 3G85A 5DX0A 1YU9A 2QL9A 1O5TA 1X8XA 3RUCA 2YYSA 4P9NA 3BQ9A 4U7PB 1X7ZB 1N5KA 2KQUA 3WWPA 4XFJA 4DE5A 521PA 3RVOA 4TYYA 2Y27A 4H7DA 5E9QA 2V98A 3AMVA 2JI7A 3BWEA 3DD5A 4PYIA 1Y7HA 4K87A 3URMA 5EHNA 4CN8A 1YFLA 1U2GA 1ZXXA 3TW8B 1L4LA 1WXDA 2C95A 3FROA 4PAGA 4Q7MB 4Q9NA 5KNCA 1UDAA 2VDWA 4M87A 3RG8A 5DTQA 5KDOA 2GZSA 3KQLA 3T3GA 4U2FA 1QZTA 3FDZA 3H5WA 2ECKA 1KPHA 2O8NA 1B74A 1M2VA 1GARA 4DIKA 4U00A 4RXMA 4OGGA 2Z08A 4NXNB 3ZIDA 1UKVY 1YT5A 1FU8A 4KU4A 5GV7A 3U48A 1WBBA 2WQ6A 4DJJA 4DRYA 5F5XA 1N1EA 3JU3A 4HNHA 1NVAA 1ICEA 1TO1E 4IOJA 5I9LA 2Q4BA 3OIFA 2PUTA 1Z2NX 3ELDA 4IJVA 2BUBA 3UB4A 5AI4A 1KMQA 2WHQA 1NW7A 2H29A 2W8BA 3H11B 3BIJA 3QEAZ 1TLLA 4J0QA 1YB2A 4UHJA 4C01A 3IO3A 5CB0A 1T6XA 1I94B 3H0CA 2PVSA 2YXEA 3V46A 4BNGA 1E62A 2O8CA 2K4MA 1IHDA 2IK8A 1MB3A 3AINA 3UXEA 4MYCA 2YFQA 3CCCA 3GT3A 3HM2A 5JARA 1L5QA 2V97A 1ABBA 5JZMA 1FMLA 4ZAWA 3KUDA 1J24A 4J94A 2H9YA 4Y2TA 4IIJA 4BO0A 1KL7A 4HDOB 2XVXA 3IH5A 3JQBA 3CPSA 3Q9SA 1Z4QA 5IH7A 4UEKA 2JDID 1A8QA 1PV2A 3NH6A 4LXIA 1GXSA 3JPWA 3TMYA 3B5IA 1P5JA 4EPRA 3Q1LA 5CVDA 3GPBA 2I6QA 5KJ6A 3O75A 2P9CA 4Y6LA 4COKA 1VCIA 3PGXA 3GJ6A 4G5QA 1ZONA 4LYDA 4G36A 5DPMA 3EXG1 3RV3A 1AX9A 2C3OA 2EU8A 3MUEA 2JIZD 4L9RA 1WVGA 3OD5A 1G21B 3CPHA 4KXVA 4U6NA 5DE3A 3FBGA 1Z75A 1Z2AA 3EVTA 4H7EA 1A96A 4O63O 4C4RA 3V4LA 3HU3A 3K31A 1VB5A 1R16A 3W4IA 4BV9A 1B76A 4MWOA 5HSGA 1Q95A 4BKRA 1NQVA 2WSSA 1PG5A 1OWPA 1M8GA 3PFBA 4HCJA 4YP9A 3TZLA 5HM6A 4GVPA 3AUKA 3RVLA 4GMXA 4C4XA 1LNSA 4D9KA 1BFDA 1N7GA 4KR2A 1YSCA 2PLAA 3A1EA 5K9ZA 2GPWA 4BWVA 2M1ZA 2Q8NA 1G9XA 4BFUA 3ZU6A 3JQEA 2DH5A 2KBFA 2VQEB 4A7PA 1TKAA 3WK8A 4IDOA 1LSJA 3AR7A 4MUXA 5F9HA 4P32A 5JNLA 3VUEA 3OUZA 4KREA 4D74A 4ZICA 2DPGA 2FR8C 5TE9A 2NLOA 4YJKA 4ED9A 1EIZA 3MTDA 4G5SA 4UM8B 4G9GA 2QTRA 4S24A 5HVNA 3RABA 5JU6A 3B3AA 3QBTA 2D5IA 1L8AA 1FDUA 4CWAA 1G1AA 1Z73A 4N03A 2JASA 1QANA 2PL1A 2G9QA 3KR1A 5EA2A 3X1KA 4B81A 4WZAE 2CWWA 1TT5A 1GKIA 2C82A 2WSLA 4JIMA 1YKSA 3TZEA 2R7NA 4ATNA 3LV8A 1XQVA 1LDNA 2RH8A 3EOBI 4RTPA 3CJTA 2W90A 5GM1A 5K6AA 2BT4A 3O2SB 3T35A 4CQNA 4IHJF 2BW0A 1QK4A 4URUR 4UZFA 1W88B 2ZWMA 4CM7A 1RS0A 4K6MA 2QLBA 1A9TA 1GCOA 3BMNA 3MMZA 4UHHA 1W5SA 4RIGA 3AY3A 2I29A 1NZFA 3CLTC 2PMEA 2Q6IA 4JT2A 3WYNA 3ZDZB 4EAAA 3H4MA 1X2EA 4Q03A 4ZT6A 1UC9A 2Z83A 1DKLA 4NNOA 3WDSA 4B3DA 1QH9A 1K7XB 1Z39A 4EY5A 2WJ3A 3PGVA 1PLKA 1Y5RA 1PJZA 5G3YA 4TV9A 1WXXA 3MWGA 4IJQA 4UAJA 1MIHA 2JA2A 1I80A 1Z28A 4P34A 2KW5A 1KJQA 1MRSA 2J4DA 2Q5FA 3LBFA 4NENA 5EIFA 4P4TA 4K28A 3DXYA 3UXMA 3A3PA 5TX7A 1H8HD 3WRWA 1E4YA 2XA9A 4H6WA 2UVPA 3K2BA 1RYEA 1J20A 1V3QE 2WZBA 3NOQA 5L3ZA 4KOEC 4F6RB 5LJIA 4DY4A 1Q0RA 1EE1A 3N8GA 5LSAA 2Q3BA 4QEDA 4G2NA 2YCLA 1ORWA 2XJ4A 3AC0A 2DKFA 4GVXA 4Q3EA 4MRNA 5F4BA 3O26A 3O8LA 4TRJA 5C51B 3NWBA 2RK3A 1Z2PX 3WNCA 3EGWA 4DM4A 4CETA 4FP9A 2NYUA 4D9BA 1WW8A 4FHCA 3ZCTA 2QRJA 4QGAA 4WLFA 4ZYUA 1G55A 5L53A 1ZD8A 2GVZC 4LNAA 3RVSA 4QG7A 3ANXA 3AERB 1BO6A 1WXGA 2PJRA 1V11B 1IC6A 3TTTA 4HT3B 4KR3A 1FF9A 3RH0A 2I1VB 4RSRA 5CFZA 1OX4B 1V8FA 1X9HA 2XYPA 1FP4B 1ZHOA 3ZDQA 5K4HA 2R6AA 1QFZA 1LPSA 3IEUA 1NDQA 1ZCJA 2D5CA 4CKEB 1PHPA 1UAYA 3KKQA 3P2IA 4I0WB 3U6KA 4XSHA 3JPYA 1YR6A 3CLSD 4ZYXA 1TK3A 2C97A 1U5AA 3D8TA 4IJ6A 4H27A 8AT1A 4I55F 4MVJA 2R1TB 1P81A 1NLUA 1OIXA 3NTXA 3ROPA 5A5EA 4P36A 3V4PB 2E4UA 2XITA 4B6RA 4O2RA 3DO8A 2BCGY 3ZGOA 2EWWA 2L82A 4M36A 4EA8A 3BHMA 1QYXA 4B3CA 2GPSA 3BS4A 2ZSEA 1NKSA 5B6JA 3ZG6A 2Q9CA 4DOMA 1SXJE 5A03A 1J9ZA 4QBGB 4Y2PA 1AUPA 4OB8A 3SF0A 2Q1XA 4OQQA 4QEZA 1M5TA 4YWJA 2FW8A 3ECAA 1PNQA 4GQAA 1EWTA 2AJDA 4HUQA 3NO4A 1FYXA 3FFXA 4HV4A 3BIOA 4YP0A 1G16A 3I9V6 2JJMA 2DHCA 3Q3CA 1WQ4A 2CNKA 2C7BA 4V1CB 4KG7A 2ZKLA 1S01A 4K6FA 1GCGA 5BSHA 1RI5A 1Q7EA 1SHUX 2RK4A 3TSWA 4UQOA 4BQNA 2MSDB 3Q2IA 2GB4A 4LWPA 3W2EA 1U94A 2DBRA 3O0TA 1ESDA 1QHXA 4EHHA 4HOYA 2PTGA 1GFWA 3RWBA 4G8DA 3OWHA 2XMSA 3CKLA 1YI8A 3CW8X 1XO1A 3EDOA 3HZZA 2DUUA 4RUKA 4TUYA 4PW0A 3BMQA 3MAJA 4FUQA 3GLHB 4KMSA 3KV3O 3T7DA 3DLHA 2L42A 1SEVA 4DEVA 2OCAA 3O95A 1OH7A 3A25A 1EFRD 3WK5A 1DBSA 3AP3A 2R8BA 4PZEA 2WB2A 4UQLA 1RT9A 4WBNA 1A27A 4U2EA 4XQ9A 2G8LA 3EPKA 2BTQA 4AS3A 1W5FA 3CVXA 4WK6A 1POXA 4IX1A 1T29A 1W5EA 3FVQA 1IZ8A 3LD9A 4D8XA 1ZNXA 1HNNA 2LWIA 3HVHA 3Q3HA 4CQMB 2HLDA 4J1TA 1GPAA 1OVMA 2Q0XA 1D1SA 3BSFA 3L7LA 3A27A 4RL4A 3TIXB 3IQIX 1XXHE 3ZTYA 4PYMA 1HDCA 5EWMA 4BO4A 3ZDAA 4MV5A 4AWAA 1E60A 5H59A 4YRKA 5KNBH 3N2ZB 4FWIB 4RACA 4HRAA 1CWUA 1KMIY 3D8UA 4DZTA 8LDHA 3BH6A 1C14A 3HBLA 1O95C 5F1PA 3CLHA 3EF0A 3EUWA 3RKSA 2NZ8A 1XRSB 2WF6A 3E5RA 3F7NA 2ZKIA 2H2WA 1BGXT 1O08A 3Q3GE 4BO5A 2AFIA 4ENTA 1ZNQO 3ETEA 3PP8A 4N8EA 4RA9A 3ROGA 5EZQA 3SMVA 3TUJC 3IT2A 4BN4A 4DC1A 4UZEA 2ADOA 1F6BA 2BFBA 3M0EA 3T1TA 3TOSA 4GNKA 4WDQA 3FUCA 3HUDA 4YROA 1VBFA 5B1SA 5KJ1A 3GLIE 3ZE0B 4GYWA 2GN9A 2X2OA 4QDTA 1K8YB 1P2FA 1QGUA 4X8HA 5G4LA 2ZB8A 2J0VA 2ATCA 3O4GA 3PHCA 1MJGM 3W90A 3L6RA 1F0KA 4LA4A 5H7XA 2UZ1B 4E5DA 2GAIA 4V0OA 2BEUA 1Y5NA 4GC5A 4XPIA 1HC7A 4EG3A 5AM3A 4O1MA 3OJFA 2GA9A 1S2IA 1YAJA 3DEAA 1XN1A 3C3DA 4OHCA 5EMMA 5EYPB 1P72A 2HQOA 3MFQA 4I6EA 3VM6A 1CF2O 5HM8A 2Z8XA 5K8TA 5K09A 1KTIA 1MO5A 2P9JA 1KEEB 4BJHB 4U8GA 5CITA 4DT1A 2EW1A 2I7XA 4OQEA 1SCKA 1ZRHA 3OFKA 4G9EA 1PJ4A 3FPFA 4Z9YA 4RZ3A 1Y6ZA 3PHJA 1YDWA 1M8FA 3A28A 3H2JA 4MS3B 5AJYA 2VF7A 4HB3A 3NWJA 3UVEA 4ER5A 3GYBA 3LC2O 3QUTA 4OP1A 3TW4A 2Z6AA 2WJYA 1NMYA 4QBTA 4RIFA 1IBRA 3DHNA 3WBKA 5AI6A 1Q0TA 3R7SA 2CFOA 4RVSA 3I1YA 1ZM2A 3PDWA 1QZZA 2FXIA 2C96A 2XIQA 1BVYF 3E2IA 4IGIA 5B4TA 2XH8A 4HL6A 3OF3A 1T2NA 3G17A 4JJ7A 1D6JA 3WBBA 2VQ3A 1MQ8B 2HA7A 2XMDA 4PLWA 3D4IA 4IS2A 5L4SA 4QGFA 4YQEA 4NRDA 1FX0A 3MFYA 2NU8A 4U7JA 5J4YA 1JGTA 2B98A 2ZAIA 4HDKB 1GR1A 2QLFA 4DYDA 1I9GA 2MSLA 4ZDIA 4RO0A 5HKOA 1OASA 3MG9A 2YV2A 2OXIA 2EGHA 2QP3A 3KRTA 3PNKA 2D06A 4GECA 1IWPB 5BVGA 1G64A 4FS8A 5KYYB 1SY7A 2FUKA 1Z7EA 2J0UA 2O1EA 2V3VA 4QLAA 3T1HB 1L0BA 2B8EA 2DFKB 2IUYA 2P3QA 1U0GA 2Q41A 3AI1A 3P26A 1VPLA 4MSUA 1Z22A 3S2IA 5J1TB 3OC0A 3NVKI 5HHTA 1XMVA 5DP1A 3W5AA 3HSKA 1EM8B 5HCIA 4MJ7A 4JQSA 1FLDA 1OLUA 4FYIA 4R5HA 5TARA 3UJ8A 3BD9A 1O87A 1ZKDA 1WPQA 2V9CA 4FXPA 5EQFA 4MLDA 4I55B 4A6XA 4K9RA 3QTBA 4HB4A 2I62A 4A8HA 2W2KA 1SXPA 2Q2NA 4DG8A 1BQ3A 3BH0A 3F7MA 2JJ2D 5KOJB 2JLUA 1G8HA 1RM5A 3V6MA 4N54A 1SBIA 4BMVA 5FFMA 3ICQB 3OPXA 4FFRA 3UCEA 1W87A 2WWRA 3B2EA 2PBFA 3FZEA 4MR9A 4Q01A 4BNNA 4N0DA 5AR1A 3WV5A 5K3EA 3GGCA 5FLXA 3PEEA 2B7LA 4HLDA 1VCMA 2IEGA 4KH1A 3JQGA 4LISA 1XC7A 1ZG3A 5FORA 2EFGA 3UICA 1U3WA 1UKAA 4MPJA 2LGJA 3LQFA 5LDGA 4FZ3A 1M34B 5FT9A 5BT9A 1KI4A 3IALA 3MRXA 3QA3E 1LDBA 2GARA 1Q44A 2Q62A 3V4FA 3W05A 3M6UA 5JD4A 2G1AA 5EKSA 1AMOA 2ZK7A 3P9NA 1BU8A 3JQDA 1XEWX 4B7XA 5CLFA 1Z8HA 2PR2A 3FCEA 1SHZA 1HKUA 2FP3A 4C6RA 1IIRA 1JDTA 1WO8A 1QVVA 3EWNA 2HRBA 3TBHA 4RC9A 5JANA 1EB9A 3N7AA 4FEGA 1SO8A 1JT2A 3AUTA 4RKRA 3DM5A 4WNAA 4RH3A 3KYCA 1GIAA 1SXQA 4AC9A 5AQEA 3MT8A 5EPOA 1RXYA 1M1NB 5K4AA 5H5JA 1YGYA 2FSUA 4EB3A 1C29B 2VEDA 1TTTA 1W36D 4QQNA 1T9HA 4OHRA 3IL2A 4YYZA 2ZUFA 2G9ZA 3FOEC 1QIHA 1RI2A 4DG5A 1VFPA 4TKUB 1D03A 1JI3A 1UFKA 1XZPA 2NUTB 1GSOA 2HLNA 2IYWA 3S1AA 3IB3A 3UV6A 4X66B 4QVIA 2P2ZA 4C7BA 3N2LA 4PZUA 1KE1A 4ZVVA 1MX1A 3CWCA 3AR6A 1A7JA 3GFFA 1XN4A 3DF7A 4LRXA 5IAGA 3FHOA 4LOHA 3RG2A 1Y4SA 2GZAA 4S05A 4R41A 1RIIA 3BRQA 3PJFA 3TRIA 2WR8A 5JQGF 3HM9A 1N5DA 2WHEA 1GTL1 3PXEA 3UKJA 5D3MB 1P45A 1ZX1A 5A1TA 5FNZA 3QPDA 5C37A 3L49A 5A9RA 2BEJA 5IC4A 2BBWA 2FSSA 1FK8A 2NU7B 3DDHA 1AHNA 1Z6AA 4JLJA 2Y4NA 4C07A 2HAEA 4KUGA 1QYDA 1IUPA 2FSPA 2V7QD 2CLCX 4RTJA 1RWQA 1SQGA 2VJKA 2MOKA 4QOSA 2X14A 4XAQA 4GZ5A 3BVPA 3VTAA 4R1QA 5B58C 2A59A 1M0EA 1CE8B 1UPCA 1UZAA 2JI8A 3SC6A 3V8VA 3DE3X 3AT1A 1WKVA 3G5AA 1TFUA 1IN7A 1H2RS 2BFMA 4I9HA 1Z8FA 2CLHB 4EF6A 1RQLA 2ZSDA 4OSOA 2P65A 4M83A 2HWWA 4G56A 3T4UA 2AUMA 2J6HA 2AZ4A 4DABA 1K9SA 3BJZA 2NO1A 2BFWA 1U0EA 1YFKA 2PKEA 3DBHA 4BLQA 4LIPD 5BV8A 4XD2A 1PK9A 2O1SA 4LYJA 1A8IA 1MV8A 3B8EA 1D04A 3FPEA 4IGAA 4GX2A 4DA6A 4U7DA 2FMUA 4ZQFA 4EVIA 3R6DA 3V1NA 2O0HA 4GXRA 1OTYA 5COQA 3EA5A 4AS2A 4DMCA 3TQIA 4QTYA 2F62A 2EFCB 3ZZUA 5LMZA 3U7GA 5KC8A 3HB0A 4B6OA 4UTXA 4PEVA 3QBVA 3KOYA 1ZVMA 2FF5A 1CBUA 5LB2A 4W5TA 3B82A 3AF4A 3A7EA 4P33A 1JA9A 3ZQJA 3AFOA 4G23A 2HBQA 5HYVA 3OIYA 4WKGA 5GIPE 1E7RA 3A4YA 3ZNNA 3MIZA 3X44A 1W52X 2W2XA 1GFIA 5EJ4A 4Q4LA 3LLCA 2P3SA 4LZAA 5LBUA 1AN9A 2XNKA 1R9GA 3ROKA 4HNUA 2H7YA 5CLIA 2EAUA 1XHEA 3LF1A 1VL2A 4OMUA 1GCIA 4KXQA 2A6PA 5IZCC 4UD6A 3NONA 5JSQA 2IJGX 3QNMA 4LFCB 4TM8A 1O6ZA 1UT5A 4BGDA 3N2KA 3ZGNA 4MOWA 2PUFA 2XXBA 4F6LA 1DPGA 3JQPA 3NHRA 1XD9A 1NA5A 3M6FA 4BB0A 1SUCA 3SHWA 1A2OA 4EYEA 4CQJA 1HKHA 1YVEI 4DHWA 2W6IA 1R12A 1VSBA 2JAXA 1Y7TA 2XDQA 3RU2A 1J1IA 3KCQA 1LTHR 4MI6A 1LDYA 2VPYA 3PQ3A 4WQMA 4YALA 1FS4A 1EWQA 3KKKA 1M76A 3A1FA 2I2XB 2O2SA 4G09A 5IJ0A 4KQJA 3LZDA 3OTOB 5D00A 1HM5A 1VYVA 1WXEA 3A32A 3I0ZA 3KKLA 5AXAA 2GYYA 1Y8RA 5I4KA 8GPBA 4FPXA 2FOXA 4S04A 4Y2RA 4MEBA 4N8DA 1RAEA 2AJLI 3FZQA 3I2HA 3SIWA 2EYUA 2QW8A 2VQDA 3SZLA 4OJQA 2ZWPA 2R3SA 2VDNB 3WA7A 3L8DA 4QUJA 2NSDA 3P45A 4F04A 3WBFA 3VSCA 1UKZA 2DPYA 3K09C 1RM3A 1WDLA 1OQAA 5BUZA 3BMOA 3NC4A 4NIMA 5EWJA 2BJHA 2WICA 1PBTA 1YA8A 1RC0A 1BXKA 1W19A 5DHRA 5DNCA 3WGMA 1DKUA 1E6KA 4OK5A 1C7RA 1U0BB 4X1OA 5M5BA 4IH9A 2O20A 1H0KA 1SVNA 4FYHA 2JKYA 3EG9A 4CMIA 3U56A 1M75A 2BFCA 3AFGA 3EZLA 1YULA 4DZZA 1PKEA 4L3VA 1IN5A 1YOVB 2VN8A 1GZ4A 1DELA 2XVZA 2OCKA 4BU1A 3K8ZA 1P5ZB 1RWWA 2IBMA 4LZNA 3O4FA 1W2GA 4QUIA 2B92A 3RDPA 4D3YA 4IDCA 4LNHA 2QG9A 4B7AA 5K45A 4CKCB 1F9AA 1FC0A 1XALA 2XOKD 2XTMA 2WABA 1DO8A 3OECA 3TCNA 3A4MA 1HTBA 1IDOA 1I32A 1TZKA 2GI4A 2BM0A 2OBFA 3KZCA 2TMGA 4J16A 1AKTA 3RT9A 5HIAA 2CFRA 3LY7A 5I7OA 3GRVA 2I4TA 1JX6A 2OXFA 2F67A 1CY6A 2ISQA 3ROEA 5JHGB 1XRNA 1NVMB 2E82A 4QT0A 4NCJA 3HVRA 2QT9A 3ZCUA 5L4LA 1NWHA 3LDUA 2Q4RA 3BK1A 3C3XA 3VR2D 3URKA 3QEMB 3L8GA 4BFCA 1U2SA 1GNPA 3SQDA 5AI9A 2JCYA 3CLSC 4EIWA 9LDBA 5JSFA 2D1TA 3GD7A 4IO1A 1DUSA 4WN9B 4OOEA 5ALZA 4JP2A 1L3CA 4HVTA 1Y80A 2AHRA 1CQJB 1MV5A 4HDSA 4MV6A 1NW5A 2HDOA 1A71A 1PR1A 1LCIA 2ISSD 2N1BA 3GVCA 3O6VA 4JLDA 3WMXA 5CLJA 1L5YA 2DXIA 2G1PA 3L0YA 3I4CA 4EEKA 2QJFA 4U2KA 3V00A 2AVDA 3AWDA 4CIDA 1R5OA 4JI2B 3TYXA 3GEHA 2UXDB 2CK3A 2I3BA 3KIPA 2GHQA 1YC2A 4X6XA 4WE3A 4DV5B 1U63A 1SULA 1USGA 5JS8A 1T25A 4DQDA 2YIJA 3AHIA 1XJ5A 3LUKA 1FQWA 3RVKA 2DEUA 2JH8A 4BBZA 4QICA 4U7FA 1FYWA 2A4KA 3HGQA 1OA1A 2C7VA 3EPPA 2MMGA 3D3KA 4HGYA 1MAVA 1JE1A 4FXOA 3WWYA 3ZHYA 4PTLA 4H4CA 3VBCA 4CEJB 1SZPA 2E5WA 1G8AA 1L7XA 2W2QA 2X0RA 4K6GA 1KZ1A 4Y67A 1HPLA 1FVHA 1T6ZA 5K4GA 3O4VA 4PLTA 3EGCA 5B5SA 2H1OA 1U2PA 2R5WA 2XE7A 2BONA 1HDXA 1G6OA 4B4VA 3SQXA 4HAVA 3L1JA 3I2IA 1PTJA 3EFHA 5FIUA 2I0FA 3DVRX 4HXGA 4WHMA 4KHPB 2I03A 2PQ6A 4PN3A 1SPXA 4MS4B 3FR7A 1D6MA 4G63A 4Y2GA 2QVZX 4Z1MD 3UJ7A 3S81A 3RPEA 3X3HA 5D01A 1KZGB 2A92A 2BEWA 4P3YA 4IO0A 1XK6A 1R4NB 4UHKA 5KAPA 4YCLA 5EUCA 3JV7A 4MICA 4GBED 1HFJA 4P1ZA 2PZGA 1UK6A 1XF9A 3F5MA 3MCZA 1RAFA 1ZSYA 1SIWA 3MQ2A 4M1SA 3GJ7A 3B9BA 1P4RA 1C1HA 2JH3A 3VZPA 3JY6A 1E6CA 2E21A 3CR8A 3DNMA 2QZ9A 1ZJ5A 5CEFA 1E61A 4LFBB 3II6X 2G06A 1JILA 1X1EA 3ADBA 1P0FA 1GYQA 1P3JA 1WV1A 3H9GA 4M8KA 3VISA 2RGNC 1W25A 5ES3A 2ACEA 1F4LA 4TYNA 4Q9DA 2DHRA 2W7TA 2GUWA 3KV1A 1NLMA 3OQ1A 5B7NA 3QUAA 3ZV5A 4A0HA 2ODNA 4DWJA 5E0OA 3OCVA 5CEEA 1VPWA 1SZDA 4URVR 3QLVA 5B7GA 2VPXA 4UMFA 4J2HA 1P74A 4RIIA 2D0PB 5HCNA 3UJ9A 4RHCA 4B80A 3STWA 2O57A 2F4NA 4IJWA 2ACKA 3HO1A 5AKYA 1K1EA 4ZOLB 2PMKA 4KXMA 3UHAA 4DB2A 1NFQA 1SJ9A 2YFYA 3KJQA 3KUCA 1PS0A 1NUUA 2J3KA 4KIWA 2JAWA 5AJHA 3N76A 4FX5A 3MS7A 4W5OA 3DE6X 4DRXA 2W83A 1QH8B 3OM9A 2XF2A 2X0NA 1AB6A 1AV6A 1TYCA 3ZHSA 2W11A 4AZ0A 2DTDA 5AXBA 5C8XA 5ESDA 5DU2A 1X1CA 3K0AA 5JBNA 1OWLA 2W6JA 1XNRB 2NMVA 2CW5A 3BGVA 3U4CA 5CVUA 4HNAA 4WCDA 4MKGA 2RD2A 2BVNA 3OM8A 3X1ZA 3EEYA 1JVSA 1LJLA 2ZAYA 2ZI9A 2VZ8A 3U26A 1I7PA 3IILA 4GKAA 1JBEA 5BQOA 1XG5A 3SS9X 3AY0A 3RS4A 3JZMA 1C3JA 3GAAA 4P86A 1C3OA 1Q7RA 3IVXA 4L50A 4XOUA 4ZGWA 2BTOA 1JR4A 2OORA 3GPCA 2YOHA 2ZETA 4D46A 3E8SA 3EVEA 3Q7PA 4QFCA 4QYSA 5CK5A 5JFTA 4BX8A 4PX5A 1J9GA 2CUTA 5CK4A 2QTVB 2WA2A 4CLRB 3T5GA 1X7WA 2CHGA 3NT4A 3ECCA 1B1CA 2DJIA 1JDSA 5E9WA 1IHXA 3M4JA 3REQB 4KNVA 4S1WA 2XBUA 3RUAA 3WGOA 3C14C 1TUEA 2WG1A 3JD0A 4YTEA 3WIDA 5ICCA 3I37X 3CH4B 1Z13A 1EBBA 4BQSA 2NTJA 4GOKA 3F8WA 2JIBA 3R5KA 1TCVA 2R1ZA 3ZI7A 4LDJA 4C21A 4UDYX 3K32A 4DCJA 5I7UA 3LRPA 5CYGA 2GLXA 3GAFA 3CUEF 3NQ41 2H4HA 4LC9A 5FP0A 3HL4A 3Q3IA 1HH4A 4IRMA 4CKBA 4JI1B 5EZYA 1UBSB 5DDIP 4W1SA 1XZDA 3W6NA 3ER8A 1I33A 4KGZA 3HI6A 1XYVA 3H7AA 3PVCA 1RZRA 1E18A 1EK5A 5A71A 4G3XA 4MQ5A 5CCBA 4EGCB 4QJ3A 4C7OB 1YDHA 3E3OA 3ZE2B 2D74A 4LOIA 1NBAA 3L3BA 5EVCA 2XCTB 1XU9A 1Y34E 3SS7X 5E8JA 1ZEMA 2LZ0A 3I61A 3GCWA 3FW1A 3WMRA 4MK4A 3LBNA 4RF3A 1JYFA 1VP3A 4JXZA 4U2DA 5KYXB 4MDEA 3IP6A 3DHVA 1AE1A 3K30A 3ZNQA 1J0XO 3EE6A 1KR2A 4OFBA 3BWMA 1PYOA 2HEIA 4U7GA 2IPLA 2HO4A 4X60A 4BXOB 2AN1A 2IXDA 3JRNA 1GA6A 3Q7IA 2CLFB 3WTCA 1COWD 1DO0A 2XMBA 4I5IA 1IPHA 1NI5A 3T4PA 1W75A 2HK7A 2Z09A 3OLZA 4AMBA 1ZIPA 2HGZA 2VA9A 4ZC8A 4YRIA 3NVAA 2QN2A 3MGCA 3ROQA 4F9TA 4L85A 2E5LB 2QNIA 2IBTA 3L0ZA 4B0OA 2LDXA 3VYRB 3LRTA 1CQPA 4HEQA 5EAIA 3EMKA 3TMAA 2QX8A 2QRZA 1ZSVA 2CLDX 4OF4A 1EFLA 1ACLA 1JLMA 4CIWA 1QHHA 4PG7A 3F47A 4ISBA 3SE7A 4NOJA 3FETA 5MN5A 3FOBA 3R75A 1ZW6A 2WU0A 1BCRA 5DXAA 3QELB 4OQZA 5M2QA 1W36C 5CA0F 5EESA 4M8IA 5LA6B 3RRYA 4IIBA 3TW0A 4B3HA 1DUIA 2PT9A 3TVDA 4IQ8A 3T1QA 2OYSA 5MN6A 4FFWA 2FWJA 4F71A 2V59A 5LYJF 1I0ZA 2QR2A 3HFGA 5JCJA 3Q7RA 2GPTA 4MUAA 4OQDA 1WZ2A 3FCOA 2I3ZA 3B70A 4BCCA 2VT6A 2X9LA 2VHVA 2ZUUA 3LBIA 3WA6A 5DHFA 3SEZA 1MA3A 5LQKA 3BIXA 3UV7A 4AIIA 1R8XA 2OFOA 1RE0A 3CO5A 2OZKA 5JVDF 4XGKA 3IDFA 3D1LA 3UQZA 3KR2A 3GJQA 5JW6A 4FMCF 3WE7A 3THWB 4JX8A 1U3UA 1UBOS 1E0KA 2PWAA 3UEOA 3IELA 1W36B 2XOXA 4ND8A 3THXA 4E2WA 1V37A 1ORTA 4MB0A 1JLSA 3U5TA 2R6R1 1XROA 2P9QA 3O9MA 4G5OA 2RBEA 4YPVA 3IR7A 1BRMA 5CMLA 3VX3A 1I24A 1T36B 2ZSIA 3C98A 1J8DA 2ICAA 1J0BA 3OE5A 4ZVTA 3MW8A 1U2TA 3OT5A 2MYTA 5FNVF 4BZXA 1BX0A 1EPUA 4NPCA 3BULA 4YUYA 1RHJA 5ADHA 3JQCA 4H7PA 4N5LA 2FRDC 1CHDA 4REOA 2PL5A 3L0CA 4URFA 2I2FA 5A7FA 5ER9A 1U28A 1C3VA 2OV3A 1PVOA 4C7VA 3Q10A 5C4IA 3UMJA 2ZBUA 1WUYA 2V0CA 4HSEA 4KZKA 3ZK9A 3UIEA 3LS2A 1H65A 1YQWA 4I9UA 5JC8A 2FK8A 2VNJA 1YJCA 2WVAA 1SM4A 2QT0A 4GZ6A 5FDFA 3IULA 5K0FA 5JO0A 3O1JC 3LYHA 3FOWA 3CG0A 3ZVMA 4OA8A 3TDKA 2O2DA 1U3TA 4IOLA 4DV3B 2H2GA 5L3RA 1DIBA 3NIBA 2HLHA 2BH2A 1XVVA 1C1XA 5GP1A 1NX9A 2LDBA 1P1JA 2V96A 4OQYA 5KHLB 3DULA 4MAMA 3BA6A 4YGXB 3BE8A 3OEYA 2CUKA 1TMOA 3V2GA 3JWHA 3VNSA 1BN7A 2JPDA 4AKTA 5FCDA 2GR9A 2VAMA 4F1WA 3GJXC 4E5PA 3H9EO 3Q0EA 1J5PA 4LYFA 3AVQA 2JNWA 3C7DB 1Y3CE 5TPZD 1SZJG 5L3SA 3HCCA 4RY8A 3U4QA 1FFXB 1E64A 2Z2ZA 5BO5A 5FYQA 5I48A 5SZJA 4HD8A 2YNMD 1RR6A 4NZOA 4DF3A 2QVXX 3HZRA 2GERA