4UEKA

Galactitol-1-phosphate 5-dehydrogenase from e. coli with tris within the active site.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
346
structure length
346
Chain Sequence
b'MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHEFSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEYIVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCAVALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVPQTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWETASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTITOL-1-PHOSPHATE 5-DEHYDROGENASE
publication title Enantioselective Oxidation of Galactitol 1-Phosphate by Galactitol-1-Phosphate 5-Dehydrogenase from Escherichia Coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 110
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 1.1.1.251: Galactitol-1-phosphate 5-dehydrogenase.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4uekA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4uekA01
3EC7A 2Z1NA 4WKGA 4CJXA 4NFSA 4B4UA 5BQFA 4CMEC 4N5NA 1IY8A 1R6DA 2E82A 4MOWA 4WLUA 3OHSX 2PGJA 4ND3A 4OAQA 5JE8A 3V1TC 4DLBA 2O7SA 1T2DA 2VWGA 4UUNA 4B8ZA 1DC6A 1YB5A 4XKJA 2J5RA 4OSOA 2W2KA 1BDMA 4TRMA 3OIDA 1ZK2A 2Z95A 3H9JA 3UFXA 5JLAA 1EEHA 2NUAA 1NQAO 3AW9A 1ML3A 3ADPA 1ZXBA 5F1KA 4BNYA 2ILTA 1U5AA 1ZMOA 1A72A 3F1KA 1NQTA 1HT0A 3X2EA 2BHLA 1I3NA 3HDHA 2PFGA 1N1GA 2VTDA 3E18A 1VM6A 4XGNA 4J9VA 4CMBA 1A4UA 2GERA 3TOXA 1XKQA 1NM5A 4YJGB 1E0DA 5AYVA 3UCEA 2BMAA 2Q1WA 3JQ8A 5HTOA 3DDNA 1I36A 2EW2A 2FMUA 1TA4A 2NLOA 1C1DA 3L4BA 1LXCA 3ROKA 3S2FA 3OIFA 1GADO 1HE2A 4XX0A 1SNYA 1MLDA 1YQDA 2VZ0A 2W2KB 3N7UA 2VT2A 1SZJG 3LSYA 5TT0A 2O4CA 4OOFA 1N7GA 3KV3O 4GVLA 1Y8RA 1A27A 4FQ8A 1WMAA 3N58A 4FSHA 4L76A 2HMWA 5COAA 4BS9A 5ER6A 3FNGA 3M1AA 1BVRA 2EKPA 2Q2QA 3TOZA 1E3EA 3VZSA 4DREA 5I9MA 2X6TA 3DZHA 4K6FA 3W1VA 3L4BC 4A2CA 2FWMX 1QYWA 1T2CA 3JQ8B 1LC3A 1GYPA 1YVEI 2JD2A 2HK9A 4R4JA 4RZIA 2E48A 1C1DB 4EZBA 4LCEA 3NDIA 5EL0A 4D3SA 5T6BA 1W8DA 2YV1A 4PLVA 4U8GA 1PGQA 3EMKA 3NYWA 3PQDA 2VRBA 3IOYA 5FI5A 1Y8RB 1AHIA 2CFCA 4BGEA 5A5FA 4JIGA 1XEAA 3TZ6A 2F1KA 3G1TA 1LU9A 1MFZA 3GH3A 1BGVA 3GY0A 1DHRA 2JHFA 2DBVO 2Y99A 3FWZA 3UUWA 1DFIA 3DHEA 4CODB 1HETA 4CV1A 1LLCA 5C7OO 3L6OO 4W4TA 1PWXA 2QQ5A 1KIFA 1Z75A 1PGOA 3VPHA 1IHYA 3U0BA 4BMNA 1VLLA 3Q9NA 2ZTLA 3WDSA 4P4NA 4KDFA 5BR7A 2EGGA 3AI1A 3FNEA 4JK3A 4WLFA 3JV7A 4BKOA 2VHZA 1B15A 5JMPA 2R00A 3I4FA 4YEDA 2OMEA 3DQPA 4Q3EA 3JQCA 2ZCUA 3L6EA 1HL3A 4HBGA 2PGDA 1FDWA 3UOGA 5C5IA 2AEFA 4YT8A 4CM9D 4B7XA 4MKXA 3MJEA 3EZLA 3LVFO 2NACA 2I9PA 2Q1TA 3R3SA 5F21A 4E12A 5IZCC 2P4QA 4XB2A 3ZHYA 4BNLA 5HS4A 4JJIA 1MA0A 1A4IA 4R01A 5KWEA 3H6KA 5DBGA 1QYXA 2O50A 1YB4A 2R00C 2CDAA 2RIRA 1PZFA 5FWNA 5EIOA 2E37A 3OJLA 4BNZA 1E1LA 1WDKA 3ZN2A 3JYQA 3RBVA 2JCVA 3ETGA 3HQ4O 2C0CA 5DULA 5I7EA 1NPTO 1R4NA 2P9EA 1KEWA 1PL8A 1A71A 4RCVA 1P31A 4FFNA 1A9ZA 2CNBA 3VZRA 3ZW8A 4N5MA 1XQ1A 1PJ3A 2HKIA 2OUIA 3DXFA 1CIVA 1JU9A 4O0LA 2P68A 3ULKA 4II2A 3ZV5A 3AM3A 3CZRA 4DBZA 1C14A 3RFVA 1NFQA 3QWAA 2GZ2A 5HWSA 1Y6JA 2YW9A 4M54A 3DBLA 2IE0A 1F0YA 3DONA 1R4NB 4FGSA 3WQSB 3I9OA 1LEHA 4PG6A 4XQ9A 3C7AA 3QE3A 1ZXLA 2BFOA 2E49A 3WQQA 5K1SA 3RKUA 5DOZA 5LDHA 4R3NA 2R2GA 3F6YA 4MVJP 4FC7A 5LCXA 1EMDA 3B1KA 3OH8A 1E3WA 1IHXA 1H2BA 1FDUA 1YQGA 2BD0A 4R1TA 3UVEA 1SBYA 5KVQA 2CD9A 2H9IA 3D3EA 1ZEMA 3I6QA 2X5KO 3OJ0A 4EUEA 3INRA 3RI3A 3DBLB 3FBGA 3JQFA 4PZDA 3WOHA 3PTZA 3D4NA 2ZQYA 4O6VA 5B12A 4KQXA 4WLVA 3TDKA 3W4KA 2PLAA 3GOHA 1R16A 3RC9A 3D5TA 3QW2A 3ITDA 4RF2A 2W98A 3D1LA 3VDRA 4CQMD 4R1SA 1D8AA 3E9QA 5CDTA 1JAYA 1YONA 4A5OA 1I8TA 4PZCA 5L7YA 4M1QA 4RPKA 4WJZA 5JAMA 1AHHA 2B83A 1X0VA 3JQFC 1RM4A 3JQAD 3ENNA 2GRAA 3PWZA 1B7GO 2C7GA 3E82A 2J3IA 5A9TA 2EP5A 2GF2A 4KUEA 4JP3A 4IY1A 4WE3A 1ZSNA 3OJFA 4XCVA 3U4IA 1U2DA 2IDZA 4FOOA 4HY3A 2NQTA 4UREA 3KYDA 4FB5A 3OETA 1ISMA 5IDWA 5TGDA 4RVSA 5KCZA 4ESOA 1U3TA 4ALIA 5DDIP 4NFYA 2Z1MA 1DO8A 2PKRA 4J49A 3BYZA 4CMGA 2OO5A 3LU1A 4PRKA 4KTTE 5CFZA 3VPFA 3DHYA 4B3IA 5CEEA 1UH5A 2PD3A 2VUSA 5T57A 5JXWA 4F6LA 4HV4A 3PQFA 4J3FA 3TRIA 2EWMA 1SOVA 1Z45A 1LQUA 3DHNA 4W9NA 3H7AA 4G81A 1EE9A 3QWHA 4C7JA 1LLQA 4E4YA 3H3JA 3G17A 3KYDB 2W2LD 3ICPA 2GN9A 1SC6A 2I3GA 4BNFA 4LSMA 3O03A 2JFFA 5L4LA 3DOCA 3VZQA 1GV0A 1WXDA 3G49A 3ONDA 2X58A 3AJRA 4GGPA 1NBOA 3FHLA 1MFPA 5GZ6A 2NADA 3FF4A 1BXKA 1LX6A 2A94A 4F45A 4E5YA 3O9ZA 2IRWA 4JQCA 5BSFA 7MDHA 5I9LA 4W9NC 2POQX 3O38A 3BTUA 1UXJA 2YYYA 4A0SA 4HFJA 5G2OA 2NTNA 1AGNA 2OP1A 1PZEA 1GFSA 1VRWA 1RM0A 3GFBA 3BHIA 2IEBA 1BXZA 1TLTA 3BA1A 2HO5A 4D79A 1K2WA 3OA0A 3CINA 3PEFA 2BFMA 1PJQA 3TZKA 4XWYA 1ENYA 2CSUA 5EESA 1HE3A 1DEHA 4L73A 2B37A 4W7HA 1YBAA 3PJGA 3ZWVA 3I83A 4J2OA 5JO9A 1GU7A 1CYDA 1GUYA 1HDZA 4FFMA 4I5FA 4CM9A 2DTEA 2VZ8A 3JQEA 1N9GA 5JSFA 2UDPA 1E3SA 1Y5MA 3H9EO 1DIHA 1BVUA 1FJHA 1X7GA 4DIOA 2Y1OA 5HBRA 1T25A 4WECA 4XQGA 2YY7A 1RJWA 4BO4A 4C4OA 3ORFA 2DQ4A 2I5PO 1JLLA 3LT1A 1DRUA 4XYEA 3UN1A 3ZNQA 1PJTA 2WD7A 4Z0HO 1CQIA 1B8VA 3HWRA 3AI2A 1U4OA 2HSDA 2Q1SA 2XOXA 2HU2A 3GRPA 3WLFA 4AJIA 1DIRA 1ADCA 3H9QA 4Z0PA 4AJHA 4EYEA 1XWFA 3INTA 4XDYA 3TL2A 3GAFA 3ZWYA 1EUZA 4GX0A 1P1HA 4IIVA 2FOIA 1N9GB 4OGWA 2FP4A 2O3UA 1C0PA 2NTJA 5DF1A 4DC1A 1PIWA 5U9CA 5CPBA 3ZU2A 5IDQA 4MIEA 3C85A 4L0QA 4RVDA 2ET6A 3LZ6A 4D43A 3MWDB 3EGOA 2OBNA 4RLSA 2WD7B 2ZYAA 2VRCA 3COSA 3BMOA 4XGIA 3EZYA 2H5LA 4J91A 4BKQA 1X1TA 3WSVA 3WG9A 3OP4A 5JCXA 4Y67A 2D8AA 1YXMA 2Y1CA 4PLYA 1C1XB 1A7KA 1WVGA 2LDBA 3ANLA 4CV0A 5FF9A 1UXHA 3NJ8A 1XQ6A 2A4KA 5JY6A 1K5HA 1XLTA 2V6BA 3KRTA 4UVDA 2P4HX 4DQVA 4JROA 4BNWA 4NDNE 1U28A 3A06A 1EE2A 5TIIA 5G0TA 2FZEA 3G0OA 1BWSA 1UDAA 4QXMA 4XRGA 1QG6A 1LDGA 3BMOB 2V6GA 5DZSA 1AE1A 4Q3AA 3W8DA 2GSDA 4Q39A 4ALLA 2WTBA 3JQ9A 5TX7A 5IJZA 1M76A 4YJDA 5KJ1A 4CL8A 3HHPA 1HEUA 3ITKA 2O3SA 3C8MA 3FD8A 4PLGA 1E1MA 3QV1A 3KLPX 1DJNA 1WDLA 1HYHA 4RORA 1P9LA 2WEKA 1DC3A 3UAGA 2YV3A 2G76A 4TSKA 4TRNA 3DWFA 3BZUA 4WEOA 3WX0A 5A9SA 1DOHA 3D64A 4R9SA 1GPJA 3R6DA 7ADHA 1DFGA 1PR3A 2O48X 4H15A 4FW8A 1Q7BA 1MV8A 3JQ9C 3HFSA 3WB9A 1DRVA 3OECA 4CM5A 5C3MA 3RUAA 3E5RA 4YA6A 2PZMA 3FTPA 4NJMA 4D3DA 2CZCA 4AJOA 2DTXA 3NJ4A 1UJMA 2DTDA 3DMTA 4Q3DA 2NNLD 4WOKA 2GD1O 1E3JA 3HFGA 2GUGA 2Y0CA 1HLPA 4OM8A 4PLTA 4WLOA 4Z9FA 3MJSA 3TSCA 3FBTA 3RUDA 4BKUA 3CEAA 4L75A 4CUZA 2O23A 1JA9A 1RYEA 5A9SB 1GDHA 1ZIDA 1R66A 1P1RA 1S7CA 3GN1A 3JQAB 2VNAA 3H2ZA 4DGSA 5K9ZA 1LSUA 3QVTA 3PZBA 4ND2A 3DMTC 1H0KA 1NFFA 1OMOA 2O3JA 4NJMB 5ENDA 5GZ1A 4NHEA 4ILKA 4O63O 3U3XA 3OSUA 2VWPA 3RBXA 4GWKA 4J43A 5G4LA 3RD5A 1H6CA 5BNIA 4JJFA 3LT2A 3WGHA 4BNGA 4PLPA 3FTNA 4KMSA 3CMMA 1CDOA 2I66A 1ZK0A 2Z5LA 4CMKA 5KTKA 3WJ7A 1D1TA 3ZWBA 1OC4A 3DL2A 2WWRA 1T2EA 4YXFA 3DAGA 1O94A 1MUUA 2X86A 4XJSA 1EFKA 3HB5X 3LT0A 3PHGA 1TEHA 4CM4B 3STHA 2HRBA 2C29D 1ENPA 4B3JA 1A5ZA 2PK3A 1B8PA 1D4FA 3IIEA 4XR9A 4RVFA 4RGBA 1DJQA 1YDWA 3T7CA 4J0EA 1X7HA 3ASVA 1GUFA 3DAFA 4ZQFA 1PL7A 4J1TA 5HS6A 3HG7A 1NPYA 4H3VA 1J0XO 2DFVA 3GGGA 3HDYA 1LI4A 1XG5A 1P1KA 1ZK1A 3C1TA 4CMIB 5L53A 1YKFA 2DPGA 4MP8A 3PJFA 1XYGA 4CMCA 4DIBA 4E31A 3CSDA 2XXBA 3GDOA 3EAGA 1IPEA 1QMGA 4D44A 5LC1A 1Q0QA 3F4LA 3JSAA 4HKTA 5C37A 1R15A 1SAYA 1KEPA 1VL8A 3RCBA 3HZZA 1H9BA 1QLHA 2YV2A 1ISHA 4I8XA 4M49A 4YAIA 2ZJ1A 4URFA 3DC2A 3V5NA 1J4AA 5G4KA 4IDAA 1X14A 2QG4A 4XZ3A 1I2BA 2C82A 4OO3A 1ZSVA 4BNHA 3JQ7B 4FFOA 8LDHA 1IE3A 3S1LA 5KJCA 1GY8A 5KJ6A 1ARZA 3L6DA 3OFSA 3K8ZA 3DO5A 5CEJA 3WR5A 2GPTA 4R16A 2G1UA 4FJ1A 5KVVA 2DKNA 1PZHA 2Y68A 1KEUA 5KIAA 1TXGA 3OF2A 1BTOA 3GUYA 4J4BA 4U6QA 5EERA 1XR3A 3KYCA 3K6JA 3JQDA 5FI3A 4GGOA 2BI8A 1F12A 3UXYA 3BXXA 2GN4A 5G4KB 1QRRA 1YBVA 2D5CA 3ENKA 2PA3A 4IPTA 1JKIA 2HMSA 4INAA 3RC1A 4IDDA 5B1YA 1Y81A 3MOIA 3WGQA 2EV9A 2ZYGA 4K1LA 4FFPA 5I8ZA 1NQ5A 2PY6A 1EVIA 3K73O 3AFNA 3L77A 2A9FA 4M86A 3WIEA 5KKAA 2PV7A 3KYCB 1X13A 4BO9A 4QX6A 1RM3A 3NUGA 1Z73A 1DRWA 1GUZA 1N5DA 2NSDA 4Y6PA 4DVJA 1HYEA 2RHRA 3UCFA 1PQPA 1Y8QA 3IUSA 4LMPA 4O5OA 1YS4A 4J2HA 3TWOA 5BNFA 5IFLA 4IDGA 2W4QA 1FDTA 1SB8A 2HAEA 4UUMA 3GGPA 2A92A 3K31A 3PYXA 3X2FA 3GHHA 3ZHBA 4AJLA 2PKQO 1R12A 5K6AC 2B5VA 5DNAA 4JJGA 5B4VA 2PH5A 2D59A 3PIIA 1W6UA 4D41A 3A9WA 2FSSA 4BO0A 3TNLA 3W8EA 2VWQA 4BB5A 3C3XA 1Y8QB 3H65A 1V6AA 2X0IA 4J1NA 1WPQA 3SVTA 3HJAA 5KVSA 2JAHA 5CPFA 3ZCXA 4YPOA 3PYLA 1H93A 4LRSB 1GTMA 4R68A 4DRYA 4WK6A 4ZVVA 1BXGA 1XU7A 5L3ZA 1HZZA 2QZ9A 4WNCA 1C0IA 4ALNA 2O2YA 1RKXA 3H4VA 4AJ4A 3GT0A 4HWKA 2EERA 4RF3A 2IYPA 5AVOA 4YT2A 4BUCA 4GBJA 4Y98A 2GGSA 2RHCA 4BV8A 3OEWA 4J9UE 3EVTA 1KYQA 1Q7GA 3BTOA 3KEOA 5A05A 2AQHA 3MJVA 1R4MA 3CXRA 3E9MA 1ZK4A 5TF4A 4TRRA 3ZWAA 2G17A 3WXBA 4B4OA 1BXGB 2HK7A 3D4PA 4FIZA 2D0IA 4RF5A 4FC6A 3RC7A 3U49A 3TZHA 3EDMA 4MJLA 4XB1A 2JFHA 3IJRA 2XF8A 3NDJA 4E2ZA 1NHWA 3PHHA 5A4DA 4I5EA 1NNUA 3WYEA 2XAAA 4IJUA 1NAIA 3PHIA 4ZRMA 5IN5A 5CAEA 5FYDA 3AM4A 2ZQZA 1EUCA 1N8KA 1ZMTA 3CMCO 5JW6A 1PX0A 3ZNNA 1R4MB 4XA8A 2IODA 3CUKA 3OM9A 1FDVA 4DQXA 4J1QA 4E13A 3VH1A 1YJQA 1NR7A 1XCBA 1B3BA 2ZB7A 3RBZA 4E5MA 1D7OA 1L7EA 3L07A 3TPCA 1H6DA 4BIIA 4K6CA 2PH3A 2I65A 5IXSA 3LF2A 1AN9A 2AG5A 1UAYA 2PGLA 1YE3A 2GN6A 3PYMA 5JNLA 3ICCA 1GEEA 2Q45A 4O59O 3DZFA 4ZA2A 3OQ6A 5AOVA 1LLDA 4FFRA 3DFUA 1LJ8A 2YQ4A 3QIVA 1L1FA 2C2XA 1ISGA 2C5AA 3I9JA 4HNGA 4I9HA 2X0NA 3NGLA 1KERA 3JD4A 2CVZA 1G6KA 3NTRA 2UUOA 2OZPA 1B3RA 1Z82A 2HJRA 4FGWA 2P91A 3LC1O 5BT9A 3RWBA 3WFJA 3W8FA 3C7CB 4BNUA 1NPDA 2FR1A 1DIGA 3KOUA 2WJPA 5F5LA 1VJTA 2X5JO 4ZQBA 1UXKA 3I9MA 1UZMA 1MB4A 3MJ4A 4TMFA 1YJ8A 4NI5A 4MINA 1A7AA 1ZK3A 2BH9A 3Q2KA 3L9WA 1RPNA 4WEQA 1BRMA 1EQ2A 4HXYA 4RZHA 1DFHA 1DLIA 1E5QA 1PJBA 1JVSA 1V3VA 3RIHA 3RU7A 3S2IA 4UVHA 1QORA 3RUIA 2EG9A 5CDUA 4PG8A 4DC0A 2FR0A 2HMTA 3DBVO 2O2SA 4AL4A 3BTSA 3I23A 4QO7A 5A1TA 4YJFA 1ZBQA 2WYUA 3AFMA 3M2PA 2B4TO 5L7WA 5FFFA 4HNHA 3QJ5A 1SOWA 2GR9A 1N92A 1PQUA 1KS9A 1UP6A 4QFCA 1YDEA 1E1KA 1X7DA 1ZCJA 2VRCD 4YAKA 5L51A 4L4SA 3PJDA 3JD3A 3BMNA 5TT1A 1LSJA 1W4ZA 1NR1A 5THKA 4DA9A 2JKVA 4PLWA 4BGIA 2X1HA 4IQGA 3S55A 3DZBA 3NX4A 1QYCA 1SMKA 3PLRA 2YFHA 2I99A 3PLNA 4EEZA 5JC1A 1LDMA 1KVQA 1T1RA 3WBBA 4CPDA 5CG1A 3LLSA 4JBGA 2C7VA 4YJFB 2G82A 1NVMB 1O5IA 1LA2A 3OA2A 3OBBA 4IDBA 4OQYA 2OXIA 2VYVD 1HZJA 1P1JA 5HA5A 1MG5A 1SEVA 4EJ0A 2QX7A 5A5EA 3ZNOA 4CM3A 3VVCA 5I7FA 1LRLA 2C59A 1CERA 2Q2VA 1KC1A 2ZCVA 4YBZA 5DN9A 4OJNA 4TRJA 3BMNB 1E7SA 1FMCA 1ADBA 2BGLA 3P19A 4DXHA 1DIBA 3LK7A 1D1SA 2PWZA 3ZWNA 4KOAA 4W82A 1UXIA 1E7MA 2BFPA 1LRJA 4XIYA 4F6CA 5F3RA 1E6WA 1MGOA 3UF0A 3I9NA 2DVMA 5B37A 4JBHA 1E3WB 4FS3A 2IEDA 3DEYX 4RL6A 1NHGA 1WWKA 2CDCA 4TVOA 1VC2A 3DZGA 1I5RA 1GR0A 1VE9A 4NBWA 4KUGA 1PR9A 5AXCA 1S6YA 4XRRA 1QR6A 3QQPA 1ISFA 3GEMA 2DT5A 8ADHA 3HN2A 4IXWA 4EGFA 3DOOA 3ZV4A 4ZGWA 1PU2A 2GASA 3KTDA 4KWHA 4EBFA 5A9RA 1IPFA 1MXHA 1NFRA 5CDYA 2H1SA 4Z0TA 2P5UA 2QRKA 4KTVE 1YB1A 1YH3A 4NH4A 3LT4A 3WGTA 1WMBA 1C3VA 4ALMA 4GL4A 4YVFA 3ZH2A 2YQ5A 1XU9A 4R69A 1NAHA 3I4CA 2V7PA 4PLZA 4E3ZA 1E7RA 3WLEA 4P38A 3RU9A 3GK3A 3HB4X 1NVGA 3MJTA 3NT2A 4A27A 1H94A 4DMMA 1N2SA 1Q1NA 1OI7A 3AUAA 2VYND 2QZZA 2NTVA 4I5GA 3GUCA 2EKLA 1U2GA 3PI7A 1IOLA 4J6FA 3CKYA 1E3LA 1P77A 4YDRA 3R3JA 1L7DA 1DAPA 1LBEA 3KSZO 3CE6A 4DWVA 5IN4A 4ZQHA 1HE5A 1JWAB 5GMOA 3V8BA 3LDHA 3IKVA 2I3AA 1OC2A 2NVWA 3L9XA 4OXNA 1U5CA 4ZHSA 3B20A 4LMRA 2Y0DA 3ZHXA 5IF3A 4NQZA 1M66A 3QA9A 3S2EA 1EVYA 3DMYA 1XA0A 2QYTA 1GL3A 4YQYA 2TMDA 4J7UA 1WZIA 1IZ9A 2C20A 1HYGA 5L45A 3KLMX 4BGVA 4B4VA 2Y05A 3JTMA 4R3WA 2GZ1A 4GX1A 1BSVA 3C24A 4OOEA 3NRCA 2HMUA 3GNQA 2B36A 3DZIA 5CP8A 4AJ1A 3AOEA 3EUWA 1YWGO 4Q3NA 1EQUA 2P9GA 2NVBA 4JBIA 4MVJF 3Q6IA 1GQ2A 1MX3A 1T4DA 3PHLA 1HDXA 2V6FA 3QVOA 3R1IA 4WLEA 5G0VA 3Q1LA 4UVGA 1E77A 3GC6A 1OFGA 2B4QA 1ADFA 1U1IA 3ON5A 1HLDA 2I6TA 1P33A 2DBRA 3K92A 3EY4A 2OBYA 4JXKA 1ID1A 2Y1FA 4GKBA 3DFZA 3I9LA 3P7MA 4OXYA 5EPOA 1PS9A 4FJ0A 4P22A 3NGXA 1G0OA 5COQA 2DUUA 4J4TA 2FHSA 2BKAA 4RJTA 4IMRA 4L74A 1QV6A 3GEGA 1Q7CA 1VJ1A 4LW8A 2WE7A 3SJUA 1RYDA 1UP4A 3WIDA 1F14A 4EW6A 2JD0A 5MGBA 1B0AA 1GQQA 1ZFNA 4B3HA 4LISA 4ID9A 5A03A 4IM7A 1V3UA 5J23A 3MOGA 2NU9A 4B79A 4HFMA 4B7UA 2X0JA 2AG8A 4CLEA 2E4AA 3GHYA 4B8WA 3WSWA 3HSKA 4BNNA 3CH6A 1HDCA 4CM6A 3ZZNA 4PIVA 2VHWA 2YZ7A 3K9QO 1JN0A 3IP1A 2DC1A 1GYRA 4KWIA 4MVJM 4AICA 3WICA 5JO0A 5DCWA 3DTTA 4TROA 2O4UX 1GZ3A 2UAGA 3OQ1A 2YDXA 4GVXA 1EK6A 3GEDA 2QRJA 1K6XA 1O8CA 4S3MA 4Y6RA 1BG6A 4TQGA 4U6SA 4BOYA 3B70A 3BIOA 3BMQA 4BNVA 2CVQA 4MO2A 3SLKA 1PS8A 4CR8A 3PVZA 3GG2A 4JP2A 1U8XX 2P2SA 5ER9A 2VYVA 3GZNA 3PDJA 4PRLA 3M1LA 1E3IA 3ZU3A 5BSEA 1X1EA 5TS3A 5L40A 2Y93A 4GAEA 4NBVA 1F8FA 2ZK7A 4LRTB 4U0JA 3K30A 5TSDA 4DQUA 3FRJA 4MP6A 4WPGA 5JDCA 2PR2A 5EMHA 1VSUA 1J5PA 1KBZA 1IL0A 3WYBA 3WWZA 2WD8A 3BMQB 4TKMA 1CWUA 3M2TA 1GCUA 1TVEA 4YWJA 3SEFA 4KUHA 1IB6A 2WYWA 1WDMA 5L95A 4XJTA 1W73A 3GZNB 2DLDA 3WNQA 2VQ3A 4K9DA 1ZEJA 4L4XA 3TL3A 3PRJA 5DBFA 3WGYA 1UR5A 2CMDA 1DC5A 3GF4A 4YRDA 1PJ4A 4NR0A 3IL2A 3EYWA 5JDCC 1DB3A 4J0FA 3L0DA 4RPJA 4YRBA 1KVRA 1H6AA 2Q49A 1PGPA 1I30A 4GX2A 4D42A 3MTJA 4ZD6A 5KKCA 1BHSA 3I1JA 4Q3CA 3PP8A 1VSVA 3HDJA 1Z7EA 2JD1A 3PWKA 3E5MA 4I9NA 2NVUA 4J90A 1XIVA 4BQPA 2HMVA 2OORA 1EVZA 3NTQA 4XGKA 3AI3A 4PVDA 4LCJA 1JTVA 3ANMA 3QVXA 1VKOA 1SCUA 5JYDA 2FPIA 3H5RA 3OJOA 4LK3A 2VYNA 2DAPA 2AE2A 1N7HA 3KVOA 4WGGA 4W6ZA 1ZW1A 1D3AA 3A14A 3FNHA 5H83A 1M75A 3FPCA 4OHUA 4EI2A 3JQ6A 2ZYDA 4FDAA 2ZIZA 4ZQGA 3ANNA 4BQRA 5I8WA 4FR5A 4UUPA 1H2HA 5TNXA 4RQTA 5IXYA 2DU8A 5A3JA 2NVUB 4BKPA 1X15A 2GCGA 5AXAA 4FCCA 1Z7BA 3MZ0A 4MVJE 2PD6A 3T4EA 4PLFA 2J6IA 4CLDA 4NBRA 1G1AA 2J5KA 3TF5A 3CPSA 4A7PA 3L4SO 3WFIA 1Y9AA 1I24A 4DYDA 4J16A 2C5EA 3PFFA 4IJKA 4E2WA 1R0SA 1EDOA 1U7TA 2Y1DA 2D5AA 2YHUA 4RQUA 4CV3A 3GVCA 1ZUD1 4BNMA 2C07A 1I0ZA 4R54A 1KOLA 3E6AA 4JCOA 3MEQA 1PEDA 1MP0A 1KY5A 2Q1UA 3ABIA 4NNJA 4CQLA 1G0NA 1Q2XA 4UAGA 4L4RA 4OMUA 3KSDO 5IG2A 2AXQA 2SCUA 1GQYA 3OIGA 4HX5A 4B7CA 1IUKA 1PSDA 3JQGA 3OMLA 3GGOA 1ONNA 5HRUA 1JW9B 1VL0A 2V65A 5DP2A 1YO6A 2D1YA 3VKVA 3H9UA 3PZRA 1P44A 1T26A 2OL4A 2VTEA 4I08A 1PJSA 1P1FA 5DOVA 2Y0EA 4UVIA 5L9AA 3UKOA 4N18A 2J5QA 2Q99A 1VKNA 2NU7A 2AEMA 4PLCA 4CQLB 4YTEA 2AQIA 1QLJA 4WOJA 1KEVA 1NQOA 1A9YA 4FN4A 5ITVA 4H16A 2UYYA 2ZB4A 3ZWCA 2J3JA 2AHRA 2X5OA 2ZB8A 5L4SA 4BV9A 5CDGA 3V1YA 3JQGB 4QT0A 2BELA 2PTGA 1U3WA 3GVHA 3OEYA 4R5MA 3N74A 5GY7A 1MG0A 1CRWG 4GKVA 1T2FA 4R1NA 1PJCA 5DCYA 4CLOA 4NJOA 1FK8A 3A1NA 2UV8A 2AQKA 2HUNA 4I9UA 1M67A 1O0SA 3WQRA 3S2GA 1PTJA 4MVJH 4D0SA 1IZ0A 3FPLA 1HTBA 3SC4A 3QVWA 1JQBA 3FSRA 4E2YA 3VDQA 4OH1A 1QXSA 4B4WA 1I10A 1UAGA 1NWCA 2WMDA 2X4GA 1P45A 1Y9EA 3P2YA 5LDGA 4Z3DA 4BNTA 2WE8A 2GZ3A 3RUEA 3RKRA 3ETDA 4CLOB 1B26A 4M87A 3PGJA 4QO8A 3F5QA 3GMSA 5COBA 3C7DB 4QSMA 1NVTA 2NV6A 5IDXA 2X0RA 3ETEA 3IUPA 2W8ZA 4E33A 1YBMA 1XHLA 4AJPA 3A28A 3EW7A 3HNPA 4R41A 3BHJA 3U62A 3HE3A 1I33A 4FBGA 3D3WA 5T8KA 3GLQA 1EUDA 5CHEA 1DBVO 3EHEA 3AOGA 3QWIA 3IAHA 4OXKA 5F1PA 3Q3CA 3VVBA 4KZPA 5JFOA 1EDZA 2G5CA 4QFDA 4BNKA 2YFQA 3PWSA 4PGFA 4IDFA 2NWQA 4W99A 1T2AA 1JDJA 3H5NA 1O89A 4EDFA 1P74A 1Q0LA 3ONFA 2OP0A 2OGUA 1KETA 3RSHA 2X7HA 3D3WB 4GMFA 1ZJYA 1QP8A 4YJGA 4Y9DA 2RCYA 4BO1A 4CMAA 2YDYA 4Y6SA 3ZHZA 3KEQA 1LTHR 3JYNA 3I5MA 4IDEA 1R0KA 4YT4A 1LDYA 1LDBA 1R37A 3GA0A 1NXQA 3ZWWA 3B1FA 4D3FA 1DLJA 4IBOA 5MDHA 4E30A 4XYBA 2VUTA 1GPDG 1O9BA 2FY8A 4R9RA 3WMWA 4PCVA 4RPHA 5A06A 4ZRNA 3NEPX 2X9NA 2YUTA 4PG4A 3H8VA 2FRDA 4C7KA 2V6MA 1TI7A 1GV1A 2HJSA 3T4XA 3ZWXA 1ULUA 2VHXA 4FJ2A 4OSPA 4BNXA 4CM8A 1GD1O 3WYCA 4BL5A 1YOVA 3ASUA 2ZTMA 4A26A 4PFJA 1R0LA 2HK8A 3E03A 3H9GA 4IZIA 3F9IA 4LSWA 4BO5A 4CUJA 5JCJD 4ITUA 3AY6A 1K6IA 1CETA 4TKLA 1NWHA 2DUWA 4WCFA 2EJVA 5A04A 3F1LA 1CJCA 1DDOA 3MTGA 1ULSA 3GNSA 4MVJD 5C7LO 3Q0EA 1Q0HA 2JCXA 1C0LA 2FPPA 1E6EA 1EK5A 1T1SA 4D0RA 5H82A 3AU8A 3P5SA 4G65A 1E7WA 3WBFA 3QY9A 1HKUA 4IGEA 4EEXA 2D4AA 1SO8A 5JAZA 4CM8B 1KVUA 1YRLA 2VZ9A 4DL9A 4JN6B 1YOVB 3RUCA 3VAZA 2VOEA 1TT7A 4WCFC 4NK5A 3RFXA 2J8ZA 3Q11A 3U4CA 3UH1A 4QQRA 4Q9NA 4U0KA 4WCFB 1H6BA 1OOEA 2DBQA 4MIYA 3GVXA 1YL7A 2NU6A 1UZNA 5JDIA 3FR8A 4OL9A 2B5WA 2TMGA 2CF5A 3ZWMA 3SXPA 4ALKA 1AUPA 3WMXA 4GLLA 1I3LA 3KBOA 3VOSA 5U4QA 3T7EA 3GMDA 4U5QA 5TRTA 2Q3EA 2JJYA 4DMLA 1WZEA 4HFRA 4WLNA 3MWEB 1JKFA 3HADA 1ENZA 4NU5A 3OICA 2Q4BA 5I9NA 2VUUA 4M89A 5TC4A 4OQZA 4YT5A 1UUFA 5JC8A 3JYLA 2VWHA 4KDEA 5ICSA 3I9KA 4YQZA 2ZTUA 1OBFO 4RVUA 6LDHA 5IZCA 5JDIC 3AUUA 1TT5A 3JYPA 2A35A 4NK4A 2E6UX 2BFAA 1LDEA 2Y67A 1DHTA 3C1OA 5IZ4A 3WGIA 5I7SA 5JMWA 3RC2A 3DOJA 3V2UA 3W6UA 3WNVA 3VPSA 1UDBA 5IAAA 3VC7A 3W6ZA 3WJAA 1ZZEA 4ND4A 1Y7TA 1B8UA 4HADA 3GAZA 3UCXA 3H2SA 3IP3A 2DM6A 5KVCA 3BMCA 1ZNQO 1KY4A 4RDHA 1BDBA 1PJLA 3LF1A 3DAPA 4TWRA 1TT5B 3PDUA 1E7QA 1P0FA 4G5HA 4P4LA 1XDWA 4JLWA 4AFNA 4DLAA 1ZJZA 5ILGA 3VPGA 5JYEA 2Q46A 2Y66A 1HSOA 4AJJA 4RF4A 1XSEA 4Z9YA 3LC2O 4YRAA 3O26A 2EW8A 4WUVA 3RQSA 4ZU3A 3VH2A 4NPCA 2O3QA 3PQEA 2WSBA 1WNTA 3TZCA 2JAPA 4DIFA 4YYZA 3BMCB 3TFQA 3DR3A 1RM5A 3DB2A 2IYOA 2B0JA 3WGOA 4IGFA 5T67A 1DC4A 3FN4A 5EJ2A 4E5NA 4N54A 4NBTA 2RAFA 4MKZA 2BF7A 3GPDG 3PPIA 3ZW9A 6ADHA 4MPDA 2XXJA 2JL1A 4FPXA 5L4NA 1U3UA 2VOJA 3GDFA 9LDBA 2EJWA 4YAEA 1WP4A 2WM3A 3KSUA 4FOSA 3SX2A 1E5LA 3IS3A 1SPXA 4UEOA 2GYYA 3QWFA 4YCAA 4BNJA 3GZ4A 1MC4A 3RAJA 4KP7A 2JFGA 4UEKA 2DBZA 3V1UA 4IZHA 2I76A 5G0SA 1U8FO 3WWYA 4IS2A 3ZV3A 3OJEA 1Y5RA 4UVEA 4DYVA 3E8XA 4D46A 5G0UA 4NMHA 4J4HA 1LRKA 3A4VA 3QP9A 1I2ZA 3ST7A 3VH4A 1I3MA 3H3FA 1HDYA 2X9VA 3FCOA 1RWBA 2OHXA 2QRLA 3SBOA 1B16A 1MXFA 4WASA 4CMJA 1K0UA 4EUHA 2CF6A 3NDRA 1I01A 2B69A 5FEUA 2C2YA 3IQDB 1O6ZA 1LSSA 2IZZA 4BHTA 1KVTA 1PWZA 2HCTA 5KOIA 2ZKLA 2AQ8A 1LQTA 4DPKA 1K6JA 1BMDA 1HSZA 2X9GA 3KB6A 4YJHA 4IMPA 5DT9A 3ROPA 2EGHA 4IUYA 1ONOA 3IKTA 1GZ4A 4F46A 3K5PA 3G3EA 1H5QA 4BMSA 4BO6A 3RASA 2BI7A 3IJPA 4XIJA 5JCJA 2QIOA 4S1VA 2GNAA 1UZLA 3B1JA 4ND1A 4CV2A 4CUKA 2AA3A 3TN7A 4QTZA 1E6UA 2GN8A 3LLVA 3GRKA 2VNSA 4MVJA 4Z3KA 3AM5A 4AJNA 4KQWA 4RLHA 4ZICA 4YJHB 1CEQA 4RO0A 4NU6A 1ISIA 2BGKA 2WYVA 1YL6A 3QSGA 4AJKA 2D3TA 4R5HA 4Z9XA 4GSKA 3DZJA 4E2XA 2HDHA 4R1UA 3RJ5A 3PHJA 4QEDA 4IS3A 2OFPA 2PD4A 1DAOA 5EQFA 3PK0A 3KYBA 3QWBA 1DPGA 1PQWA 1OZAA 3S8MA 1B2LA 4JX8A 3KHUA 3NKLA 3QVSA 1E92A 4L9RA 5AXBA 2J3HA 2EIHA 3IC5A 4IINA 1ORRA 3GNTA 5TJHA 1LSOA 4CLXA 4LVUA 1EBUA 4J7CA 3AY7A 3B6ZA 1NYTA 1I3KA 1KVSA 3FNFA 2Q50A 2BGMA 4GMGA 4IDCA 4XYGA 3F4BA 2UUPA 4UEJA 5H81A 4N7RA 2F00A 4M55A 3ZDFA 1HDRA 3C1AA 1FF9A 1GEGA 4GI2A 3U5TA 3FI9A 4IXTA 5BNTA 1SB9A 3D7LA 2VT3A 2Y1EA 3TQHA 4L8VA 2EKQA 1LDNA 4NZ9A 2B4RO 3CZMA 2JHGA 1OAAA 3ROQA 1LLUA 3RUFA 3Q2IA 4MKRA 4BKRA 1P1IA 4AJ2A 5B4UA 9LDTA 3JCZA 4XR4A 1M2WA 1DSSG 2VCYA 3AOEC 4RVHA 5G0WA 5B4TA 4NFHA 4U7WA 2X8LA 4GH5A 4H7PA 2W90A 3FWNA 3HDQA 4BO2A 2FPGA 3ZGYA 1U3VA 3SJ7A 2NQ8A 5T64A 3JYOA 4CR6A 3VTFA 2FR8A 4XDZA 4CR7A 4YR9A 1PJ2A 1WAMA 4G2NA 3DTYA 3TFOA 1K89A 5ENVA 1ZVMA 1X0XA 4DBVO 3GG9A 4A03A 1UP7A 2H6EA 3DBRA 4QUKA 1V0JA 2ZATA 1T24A 1PGNA 4MP3A 2X22A 1CQJA 1QYDA 4GPD1 4XYMA 3K2EA 4E5KA 4PZEA 3RUHA 5JS6A 4E6PA 5ILOA 4XEHA 4PG5A 3VZPA 1JAXA 2ZB3A 4RV9A 1C1XA 3ROMA 1P3DA 4W7IA 4AVYA 5T5QA 1DIAA 4J1SA 2DPHA 4E21A 5A02A 4E32A 3I3OA 3E9NA 2PZJA 4IJWA 3DBRB 3D5QA 1QYVA 4ZJUA 4K26A 5THQA 4HFNA 5EQDA 4ROSA 5DBIA 5IDYA 4BB6A 1QKIA 3E1KA 5ITWA 3LC7O 2EXXA 1WW8A 3FR7A 3WS7A 2FN7A 1HDGO 1U9JA 4LGVA 4RPGA 1VPDA 3QRWA 4NBUA 3GVIA 2VHVA 3GR6A 3VKUA 3DBHA 4D7AA 4F3YA 3PGXA 1UDCA 3G79A 4WNIA 1PL6A 3WTBA 1JWBB 5K0ZA 2G0TA 4JNKA 4OYRA 3WGZA 3HUDA 3GFGA 4BMVA 3PXXA 4ND5A 4AJEA 1CF2O 1E1NA 1DXYA 2R6JA 4I1IA 5TQVA 3ZWPA 2HLPA 2EEZA 3O4RA 1QV7A 2EP7A 1I32A 1HRDA 5CG2A 3VH3A 3H5AA 3IDSA 1YQXA 3KO8A 5DP1A 5BSGA 1IYZA 3ZU4A 4CLHA 3TZQA 4O1MA 1LC0A 1O95A 4NIMA 2HRZA 3F47A 5U1PA 3KUXA 1ZO8A 3V2HA 3DBHB 3V2GA 4EJ6A 3QLJA 3IMFA 1M6HA 3UICA 3CIFA 4A73A 4EJMA 2PNFA 4CQMA 3JD1A 5JY1A 4D45A 4DLLA 5ES3A 5I7VA 2H63A 2IXBA 3GQVA 3R0IA 1LUAA 4P8RA 2VN8A 3NAQA 4BO7A 1K3TA 4GQAA 4CL3A 1E7YA 1P0CA 3JQAA 4BO8A 1YL5A 2PZKA 4OKNA 1GZ6A 4J7XA 5JAQA 4MIOA 3ZV6A 4IJVA 4WCDA 1HE4A 3O8QA 4PN3A 3GDGA 1AXEA 4K28A 3GVPA 3UHAA 2FZWA 4LVCA 2FSVA 4XQEA 3KM0A 3I6IA 2GLXA 4HP8A 4CQMB 4LN1A 4Q3BA 4YAJA 1NASA 1XGKA 2OOSA 4YB8A 1F8GA 4ZQEA 3G1UA 4I5DA 3K2BA 4NG5A 1NP3A 4YAGA 2P5YA 3PFWO 3OQBA 4RVGA 5EN4A 1IULA 4CMHA 4ZN6A 3P2OA 3WGGA 3DZKA 2AEJA 2DFDA 1HDOA 2I67A 4CM1A 5KJFA 1H9AA 1EBFA 2Q4EA 3AUTA 3MCVA 3K96A 4GX5A 4HUJA 1WLYA 3O8QB 3BHMA 1W0CA 4CM7A 3GN2A 2O3TA 3D4OA 5GZ3A 5ICMA 4JGBA 2W2LA 1TB4A 1ZH8A 4CM4A 1V35A 4FD3A 4FFLA 4PLHA 4DUPA 5CDSA 1LNQA 2AMFA 1ONPA 4DPMA 3BTVA 3NTOA 2IZ1A 3MJCA 4BGUA 2C54A 2QW8A 3JD0A 4XYLA 3ZU5A 2BRUA 3Q9UA 1J6UA 1UXGA 1V8BA 4ONEA 3F3SA 3BAZA 4PVCA 3ZI0A 4PG7A 1QSGA 5C7IO 1AXGA 3W4IA 5TLSA 3VPXA 2AW5A 3U4DA 5JBIA 4CMIA 4X54A 3RROA 1JVBA 4Y8VA 5F1OA 2XPCA 1EFLA 5F5NA 3NT4A 2CDBA 5L7TA 1F06A 3PIDA 1EZ4A 1PS0A 5CEFA 1T4BA 4IIUA 2J3KA 4BNIA 2X23A 5HM8A 1ZKMA 3RFTA 4TVBA 1BW9A 4ALJA 2BLLA 2YHIA 2Q2WA 1ADGA 1JKJA 1PGJA 5KJEA 1V9LA 2CUKA 4AG3A 2RBEA 3JD2A 4RDIA 1FXSA 3RVDA 4GSLA 4XQCA 3VTZA 4II3A 3U4HA 4OIMA 1ENOA 1PZGA 3JQ7A 2GO1A 2JCYA 2P9CA 3E48A 3AY3A 3WTCA 3TJRA 3M6IA 2PKQP 4BVAA 1SEPA 5TJ9A 1V3TA 2ZTVA 1ZSYA 3AUSA 1N1EA 3F46A 4GLOA 1BW9B 2QHXA 2YHIB 3D0OA 1U4SA 1NTOA 1GAEO 1VI2A 2EF1A 4MDHA 3ZWOA 3AU9A 1YGYA 4EITA 1Y1PA 3RJ9A 1F17A 2PZLA 2WDZA 3SLGA 1ISJA 5BSHA 1I2CA 4CLRA 3INGA 4UUOA 4XD2A 4EUFA 1GCOA 2AE1A 3AWDA 3I52A 4IQ8A 5A3VA 3UGKA 4MVJG 4DPLA 1EVJA 2EHDA 3QHAA 4YACA 2NU8A 3EK2A 1GYQA 1C0KA 1Z6ZA 2D2IA 1J49A 4TZKA 1M6WA 3LYLA 1B14A 3KZVA 4DTIA 3NT5A 2O3RA 4E5PA 4QECA 2O7QA 1U7HA 2YJZA 3JQBA 4Z6KA 4E0BA 3U9LA 3CTMA 4CLRB 2CVOA 4IQ0A 3KETA 1VJ0A 3GPIA 5DCUA 3W4JA 2LDXA 3ADOA 2IZ0A 3UW3A 4A10A 2RH4A 5AQ1A 2IXAA 1HWYA 2VHYA 5JAIA 5EINA 3EVNA 3ZNPA 4CMEA 3SC6A 3NV9A 4OKIA 3HN7A 4RPLA 2ZJ0A 3ONEA 4P4GA 4GWGA 1FDSA 2CY0A 4MVJI 3U09A 2GDZA 3VHRA 2NM0A 1XELA 2RH8A 3F5SA 3JQBC 2HQ1A 4M8SA 4TZTA 1KC3A 2UVDA 5K6AA 5KNLA 4R51A 1VL6A 3AK4A 1MC5A 5JPIA 1HXHA 4BO3A 4N5LA 1NX6A 5AXDA 2QYSA 3LQFA 1HF3A 3PJEA 2Y1GA 5T8KC 5ADHA 2B35A 3KXDA 1Z74A 4UULA
chains in the Genus database with same CATH superfamily
2LPMA 4CJXA 4KG7A 4PBSA 4B4UA 1IY8A 4KFSA 4L22A 3M5WA 4WLUA 1GDDA 1RNLA 1C29B 4ND3A 3SS8A 5ICEA 2C2MA 5IZCA 3RW9A 1X8JA 2FX2A 1UWLA 4BP8A 2ZI7A 5TGZA 2VNIA 1M6EX 2AV6A 2C00A 4RMGA 3F3KA 2O0LA 1HTTA 2MSDB 3MG9A 4PCLA 3QPWA 4B7ZA 4ZKDA 3V4RA 5K0JA 2PXXA 2DWPA 2VSFA 3G0CA 5GPBA 1NQAO 3AGQA 4O33A 2REQB 5YASA 4BNYA 4OHWA 1TC1A 1RVDA 5HIKA 5AHKA 4AN1A 1KA9H 1NQTA 2AXPA 1KDYA 3HDHA 1MOZA 1PG5A 1N1GA 2VTDA 5I4IA 2FPRA 5TQ2B 1A98A 3ZD9A 5JD4A 4J9VA 4CMBA 1GPBA 7MHTA 3D7KA 2QDXA 2GERA 4UCQA 3Q7EA 1ZISA 3TOXA 1QTRA 5AYVA 1IQUA 1MEOA 2AOWA 3PXAA 3UCEA 1R0YA 2BMAA 3JQ8A 2JJ8A 3OT4A 1UOPA 2HM7A 1TVCA 4QYIA 4MUNA 1TA4A 4RZSA 5TPZD 3OIFA 2DSNA 1H3NA 4IAOA 3SHTA 1HE2A 2MU1A 4IXMA 5LSAA 4TV9B 1DCKA 2IBTA 3A6PC 2NT3A 2W2KB 5IKMA 4ZVOA 2D74A 1IB0A 1N7GA 2YOFA 3GT3A 4XI9A 4ZT5A 2F17A 1Y8RA 3OWOA 1A27A 2B99A 4FQ8A 4KIWA 1WMAA 3CLRC 2E5WA 4TS4A 3HN6A 5LQSA 2FRDC 5EZ6B 3N7AA 4L76A 4BS9A 2QD4A 3FNGA 5D84A 1MT0A 2EKPA 2NGRA 3IQWA 1C3JA 1GFWA 4JSRA 1WM1A 3TLKA 3D3JA 2D06A 2ISQA 3RYIA 5E4TA 2A5DA 2X6TA 4K6FA 3FUWA 3W1VA 2QVLA 4MUXA 2BGRA 3TD2A 4E88A 4OKSA 1M8JA 4U7GA 4LGMA 4WV3A 5AHWA 5DI3B 1SQ5A 5JADA 1LC3A 3QKSA 4HT3B 5LXTB 2HK9A 1SM4A 1A8SA 2VSXA 3EXEA 3KL2A 1CC1S 3QYFA 4OGKA 3OEEA 4GI3A 3ELUA 3OQIA 2V6JA 1DARA 5K3CA 4XOIA 2CHVA 3PQDA 3VR2A 3EXFA 3IOYA 5JS7A 1O0BA 2JIRA 5FNVA 1XAIA 1PKXA 2PRYA 3OPQA 1P6UA 2PUEA 3UAYA 1X7ZA 1Y98A 2C7RA 1NQUA 2F1KA 1G3QA 1LU9A 1KP3A 1MFZA 3GH3A 3H99A 3RYCA 2PYIA 2O8BB 1A96A 3LHKA 2WU3A 3AVWA 3U37A 3W34A 2DYKA 3ZXXA 3UUWA 1DFIA 2QMYA 4NE9A 5HFNA 1BHQ1 1HETA 2SKDA 4KN9S 4Q4AA 5DO9A 2PU7A 2N1MA 3OX4A 3T9BA 1PWXA 2BCEA 3HM9A 1PHPA 3TGLA 3D4LA 3DWIA 4C08A 3V4PB 3FNIA 3OE1A 1H0RA 2QNBA 5SV2A 3L5OA 2Q5FA 2ZTLA 2Q5IA 3WDSA 3RVOA 4P4NA 4J03A 4JK3A 2PWYA 5F98A 1VLZA 2EZ8A 2EJUA 1NYLA 1KYTA 1JIVA 1KNXA 2WJYA 4Q7JB 2FFAA 4HBGA 4LZAA 3CH5A 2GN2A 4WDQA 5DV9A 1BHJA 4DB4A 3EOAI 1NN5A 1YZFA 2BMDA 3UOGA 3JTEA 2UZ3A 4Q1FA 4MKXA 1Y4DE 3AH8A 2AN1A 1COWD 3DLTA 4E12A 3ZHYA 4X9XA 2OWDA 5FH9A 1B6SA 5HS4A 1KARA 4JJIA 3SEQA 1MA0A 4I1SA 4KAJA 4D9IA 5I7AA 5DBGA 2XHZA 4G1BA 5EIXA 3AYZB 4YRIA 1DJPA 2R00C 1ESEA 3TSWA 2RIRA 5FWNA 3RIXA 1HUQA 2E37A 1DAFA 2OV3A 2EFYA 3E5HA 1RS0A 3RBAA 5I48A 1Z4NA 1WDKA 3GARA 4UU8A 5CLHA 2OQIA 3OESA 2W83A 5FEMA 4ZTUB 1C3XA 2Z83A 3OZVA 3RV4A 1NVWQ 4B3DA 3HQ4O 4ZHQA 1G20A 1Z8DA 2X5NA 5I7EA 1NPTO 1AQIA 1R4NA 1ZU4A 1KEWA 4AY5A 4JOBA 2MMCA 3NHYA 4QDZA 4QE3A 3TKLA 2IU4A 4WY5A 1P31A 2J09A 1JYSA 1OBCA 3REOA 2E4VA 1A9ZA 3VZRA 4M1ZA 1VKJA 1X9GA 2QN1A 1GUAA 2OUIA 3BS4A 2D7DA 1CIVA 1YRAA 4O0LA 1JEDA 4UNSA 3HFRA 2CHGA 2P2CA 4Y2YA 5CTJA 5CCBA 4DBZA 4L8YA 3IB3A 2A7XA 2XQKA 3ELBA 1XMOB 1JHOA 2ZIXA 3QWAA 1Y6JA 4YI3A 3MIIA 4EG0A 3Q5DA 1YJ5A 2NNWB 1F0YA 3DONA 1VXOA 4PZLA 1GA1A 3IVGA 3ENVA 4NEQA 4LTNA 1K63A 2JEOA 3E27A 5K8IA 1VRCA 4KXVA 3NHKA 1XNQB 1SKAA 4ARBA 4MV9A 3QVGB 4XQ9A 2X77A 1TEZA 2BFOA 4MS1B 3RKUA 4HRXA 5DOZA 2QPAA 1G3RA 4MVJP 2WTXA 3WGMA 3M6MD 3RQIA 1T8PA 1E0SA 1QHEA 4HVAA 1E3WA 1IHXA 4HWOA 4BVBA 3SP1A 4XVUA 4MH0R 4BP1A 3MJHA 1A8QA 1FDUA 2YNMA 3U3KA 2BD0A 3JATB 1SBYA 5KVQA 2H9IA 3D3EA 3OCYA 2JVIA 2X2OA 3WNCA 2QKYA 1H8ED 3OJ0A 2VQ6A 5D51S 2BONA 3H1AA 4H7IA 2CNWD 3JQFA 1VMKA 2QZJA 3JU3A 3O92A 3PTZA 4HGPA 1MO5A 1NVEA 2ZQYA 3RIEA 5B12A 5AVRA 4QBGB 1GRCA 4KQXA 4B9AA 1NXOA 2HADA 4RHEA 4XM0A 1CUSA 2B4AA 1KI4A 3MTQA 3AF1A 1ZCZA 3BMXA 4TUYF 5D5QA 4YMIA 4V02A 1CJVC 2NZYA 3RC9A 4D9KA 2JLXA 4B3SB 3L7MA 3NHLA 2W98A 1ODFA 4LMAA 4CQMD 2REBA 3F5DA 1GZUA 5EJ9A 1SHTX 3I6BA 3UUFA 2B2CA 2QR3A 5CDTA 3OQVA 4L85A 2FW0A 4BLUA 3DG9A 3R6GA 4NZNA 1XZNA 4M1QA 2WJHA 3N8HA 4RPKA 4YQEA 4AUEA 2QMEA 3JARB 2WIGA 2EQ5A 1Z3IX 1RM4A 4YRCA 1LJUA 3V7UA 3RT7A 2C7GA 1OLXB 1I4DD 2VAWA 4F2GA 3WGUA 3F90A 4C29A 5C32A 4BC1A 3EHDA 4KUEA 1EHIA 5D00A 1W85B 2X8AA 3I62A 4WE3A 5ADHA 4HDQB 3VU3A 1DXHA 1I3OA 2IDZA 2NQTA 5JFGA 1JH9A 4UREA 1BDHA 2DF8A 1ISMA 1CHNA 5IDWA 4P92A 1OH8A 1QKKA 2Z4SA 1MNQA 2QTLA 5TPWA 5KCZA 4ESOA 4ALIA 1L5ZA 4NFYA 2TRSB 4DSAA 1KJZA 4J49A 3BYZA 2P9TA 5EKXA 1R9NA 4Y2XA 5HFJA 1T9HA 4TV8A 4BFTA 1JR3A 3BQ9A 4BMOB 4C0BA 1OPRA 3R7BA 2DX7A 3D6JA 1L4LA 1IMJA 1ZJ4A 4LJ4A 4F5WA 1K66A 5B7NA 4F6LA 4F9GA 4HV4A 4EBBA 3TRIA 5TMEA 2EWMA 3UH0A 4CIDA 2H1CA 3BL5A 4IZ6A 3F8SA 3TTTA 5H9WA 2H9YA 1X9IA 2DWUA 3IA2A 1VE5A 4Q9AA 2YYAA 1SIOA 5DGHA 1F2UB 4E4YA 1PZXA 3H3JA 3T5PA 3KYDB 4FNOA 5EVJA 2HFKA 4GZ6A 1ONSA 2H0RA 4LSMA 3G7NA 4RV5A 5A4AA 2XKKA 1GV0A 1WXDA 2OO5C 4IFTA 2X58A 3CUTA 4J07A 3OZWA 2VNHA 4OYLA 5C7YA 3H04A 3P9CA 3NWOA 3ZDYB 4H4EA 4ARCA 1U0HC 1U4NA 2ORVA 5AKIA 2ILVA 3TLJA 4IGIA 4E5YA 2CV2A 4GLFA 1IN6A 4EHNA 3I0NA 3BSYA 3C6BA 3L1IA 4RYLA 1KJ8A 3KKEA 5BSFA 2YFYA 1RIFA 3K35A 5I9LA 3VDNB 3O38A 1WS6A 1UBUS 3UMGA 1MBZA 3BTUA 4BAUA 4A0SA 1SR8A 4IVQA 5KNBH 2CJYA 2ZM6B 1GFSA 3EUEA 5EWMB 3P4UA 3EWNA 3PKIA 3TX2A 2HY7A 1ZGGA 3WB2A 3OZTA 1YZYA 2WC1A 4ZI7A 3HVRA 2HO5A 4NABA 3VSBA 5SYNA 4GW3A 1FRQA 3TZKA 3RSLA 1ENYA 3LGXA 1WXQA 2CSUA 2PFKA 4NBKA 3HR8A 5C8VA 4J0JA 4RV4A 4H0NA 5TR9A 4H18A 5BUCA 4XD7D 3LBYA 5HGXA 4HQRA 1CDEA 1ZDMA 4RMNA 1XPRA 2EZUA 2VQSA 1GU7A 3HVJA 1CYDA 1GUYA 2WMNB 3EQ7A 1WUIS 4FFMA 4OQLA 1QF7A 3ZDDA 3CISA 3LX8A 5H7XA 2ZJAA 3PNKA 4RM3A 4ZO4A 4B6SA 1PFGA 3TGWA 2A9KA 3JQEA 3BXGA 1JAIA 1N9GA 1FNBA 1N2JA 1QPGA 1REQA 2P6UA 2UDPA 1DIHA 3CFYA 3FIUA 1BVUA 4XUCA 4DIOA 5JZVA 4GL2A 4HK4A 1J0EA 3KCQA 3S5UA 5AIBA 3BX1A 4BO4A 4QPZA 4A6XA 4C4OA 4Y2VA 1E9CA 1LJLA 2G3YA 3MWDA 1ZN2A 1JLLA 1JEJA 1EFHA 1DRUA 3ROEA 1ES9A 4K1XA 2DR0A 3UN1A 3ZNQA 5EMNA 4NEGA 1NW8A 2PXAA 4G01B 4LXYA 4Z0HO 2JJ2D 2AF4C 3V4VB 3SZMA 3HI4A 3AI2A 3LQ4A 4WN9A 2HU2A 2VXBA 3AR5A 3LY9A 1N5KA 1I7QB 2DUMA 1RP7A 3BB3A 4EYEA 1XWFA 1ZMBA 3INTA 3QX8A 4PR3A 1A82A 3R74A 4JKIA 3GAFA 1XAJA 4GX0A 2OT3B 4LNUB 2FOIA 2IYAA 2O3UA 2GBLC 1C0PA 1NJ5A 2FUNB 4MARA 3UHJA 4PYJA 4YAOA 1EWKA 4JFRA 4TWIA 2DT8A 3QG1A 1BGXT 5FI0B 1LY1A 4ZODA 3ZU2A 4FCWA 1AUVA 3C85A 2PUBA 2RC6A 3LZ6A 7REQA 1NKVA 2VXOA 3EGOA 4L0CA 2FV8A 5G53C 2ERYA 1TEVA 4M0KA 3HUFA 4XOUA 2OBNA 2WD7B 1JHYA 5ABPA 1AQUA 4DM7A 4WBNB 4EGCB 4LNHA 1DT3A 4B87A 2O6HA 4GXQA 4JLDA 1XC7A 4KQMA 1CD5A 3L8DA 4JXJA 1FQJA 1W5SA 3QLEA 2WWFA 1XZKA 1ODTC 3TR0A 2D8AA 3GLIB 2JLVA 1GRRA 1J20A 2WILA 1KJQA 1L4BA 3B3JA 1X2BA 4CV0A 2GHTA 1TK3A 5FF9A 1PLKA 1XQ6A 3WBKA 4CM7A 5BV0A 3WIBA 4MZDA 1K5HA 1QGYA 4NZYA 1XLTA 2N9UA 2V6BA 1BNCA 1LZKA 4DQVA 1LLFA 1JH8A 3G8BA 1APBA 4D9EA 5DBOA 1XTBA 4AZWA 2AMLA 3EGXB 1EB8A 5IRCD 4UBMA 3V42A 1KOGA 4J94A 2QPLA 3MT8A 1TYAE 3CB4A 2PS3A 4XRGA 1F0NA 4A82A 3HBJA 4KXMA 4MULA 4Q3AA 4RU1A 2GSDA 3OLZA 2FSFA 3ZDEA 1U2TA 2IIVA 3JQ9A 2IUYA 3C39A 5TX7A 1M76A 4YJDA 2ATEA 2BW0A 3DFKA 3MUNA 2R84A 2RHOA 4RAOA 1V6SA 4KGDA 5FBKA 4LYDA 1ZW6A 2WJ3A 1E1MA 1F6DA 3S2YA 2HLDA 1WDLA 1HYHA 4O2BF 2Z58A 1U28C 3OE7D 4XGQA 5J4VA 5BSKA 3PTAA 5LPNA 1KJWA 2G76A 4TSKA 2FW7A 1NLZA 1IEXA 2K2WA 1CNMA 3KKPA 3P9XA 4UU7A 4WEOA 4UZFA 5HIIA 3RVRA 3WX0A 1GPJA 3NU1A 1NJ1A 1QZ3A 1ZN9A 3NB0A 3R6DA 7ADHA 4IWYA 1L7OA 1DFGA 1PR3A 2O48X 3KAKA 3HKBB 2OB2A 1Q7BA 3N2EA 3JXEA 2YYZA 3PUHA 2YY6A 4NV3A 4JNCA 3SS7X 3WB9A 3AEUA 4MV4A 5C3MA 3E53A 5C18A 1AB6A 1PYDA 1HE8B 3FTPA 2PSSA 4KXUA 5FWDA 4D3DA 1ZOIA 2PQ0A 4GP9A 1Q14A 1U0NA 4H60A 3T3EA 1SUFA 2PMWB 4TS1A 1KFBB 3URMA 3R8FA 1YJAA 4XW2A 3ZCUA 3BGDA 3DDOA 1C1YA 4Z9FA 1F7UA 1LZLA 4KIJA 4G0UA 4QOGA 1G9XA 1RYYA 3OZCA 2VYFA 3V1NA 5MF6A 2GBGA 4FU0A 4FUTA 4PFKA 4Q6BA 3RUDA 4CUZA 2XKBA 4INJA 1NBAA 4M8NE 4BLPA 1JA9A 1RYEA 5I01A 1GDHA 4I55B 4PNHA 2LKDA 3VBEA 2ODTX 1S7CA 4FKBA 1FX1A 3R7DA 2P79A 3H2ZA 5EJEA 5GADl 2IUSA 5K9ZA 3K53A 6PFKA 5LZ4A 1NRIA 1PX2A 2CL6X 1XFDA 2FP3A 3EXIB 4ND2A 3VPBA 3UGJA 1BC5A 1NFFA 5GZ1A 2WF9A 1G4AE 2FVXA 1MQ8B 4NJMB 1A9RA 2NZWA 5JS2A 4ILKA 4U2FA 3WDKA 2WOOA 2Z8XA 1DTWA 3RBXA 1Y8ZA 4GWKA 1U0EA 1Y34E 1NXTA 2JGMA 1E9EA 2GD0A 4G1MB 4MI3A 5ALVA 1UADA 1WXIA 2HD4A 4BFUA 3KVRA 4C3UA 4Q6WA 4HQNA 1JMKC 2Z5GA 1RZUA 2OCXA 4WKBA 4BNGA 4PLPA 4YP1A 5K0BA 4G0YA 3K5WA 5CNKA 3CMMA 5ITZA 4KI0A 3TCKA 2IY9A 2I66A 2Z8YA 5KTKA 1FB5A 1E79A 1H0SA 2ZULA 5FA5A 4B31A 2W5UA 3WNDA 3A6ZA 4UZEA 1QIKA 2ZRDA 3DL2A 1BXRB 5A4JA 3X43A 1TVKB 3OJXA 1FFXB 2ZDGA 4KI7A 5ALUA 4HAIA 1R6XA 1SZDA 4MROA 4IXDA 1O94A 4EF4A 3FXAA 3QPVA 1MUUA 4C43A 3WFZA 1BN7A 3PHGA 4M0DA 3KQKA 2WU8A 3GRAA 4O4JA 5EHGA 4CM4B 4MGZR 2HRBA 1NBWB 1Z5UA 1ENPA 2C29D 1JHQA 1A88A 4QAJA 3SSAA 1ETUA 1D4FA 3B2NA 1A2QA 3NUZA 4E5UA 5HM6A 1DJQA 4AP5A 4J0EA 3KWFA 1X7HA 1VLQA 1NNSA 4CIBA 5AW6A 2OM2A 3DAFA 4ZQFA 2QTGA 2YZMA 1YZHA 3QTTA 3G2HA 1JAZA 3LDFA 1NPYA 2H2HA 4TMXA 4RXUA 2BGWA 1AKWA 4MUEA 5EZ5A 1MTZA 5A5VA 2FH5B 1Y48E 3GGGA 2D0DA 5DN6A 4ZAYA 3KC2A 1S3IA 4BMCA 1XG5A 1ZK1A 1J06A 5ECDA 1YKFA 4MP8A 3OQOA 1FSSA 4CMCA 3UKDA 5EPEA 4LZLA 1IG0A 2R60A 2XDQB 3UOWA 3HRHA 2CLFB 2ZWMA 4L8FA 1J8MF 1Z2DA 2G4CA 3D7NA 4FOLA 2B20A 4WI1A 2HXYA 3EAGA 1NR5A 1QMGA 4D44A 4GE3A 5LC1A 5B3KA 4MW0A 1I0LA 1TOAA 3OPYB 2WICA 2JC3A 1SIUA 4J1TC 4BBJA 3L92A 3RE1A 4C6TB 2PSFA 3PPYA 4CBVA 2I71A 1WABA 1QLHA 4DCPA 1VA5A 4MS4A 4QPPA 3Q7RA 4X6XA 1U7WA 1W7AA 2H4FA 4KBYA 1W25A 3IVMA 1FUEA 5H3LA 4HR7A 1B76A 4AKIA 2QG4A 4XZ3A 2CXHA 1DKRA 3REQA 1QF9A 2XI4A 1ZSVA 5F7OA 3OZBA 3JQ7B 4BNHA 3H11A 1CSEE 2BE7A 4MI6A 2I22A 2R6ZA 3C5HA 1P8AA 1E8MA 4IG4A 4HDNA 2WABA 2PRJA 1WMDA 5CH5A 3DO5A 2PZFA 5CIQA 5CEJA 4Q05A 1JHXA 2AJBA 3D1VA 3WR5A 2R4QA 1IOWA 2G1UA 3DOIA 3UJPA 3D5EA 1GUDA 2EATA 2DKNA 3OCJA 4WK4B 5A4KA 1KQ3A 5KIAA 2RE8A 1TXGA 4U6QA 2DUJA 2HQOA 1JE0A 2G1KA 4BVJA 4M88A 4ZEVA 4JQZA 4OGLA 4Y1GA 3U4QA 1CCWA 2GN4A 2ZRNA 3BXOA 1YBVA 4JUAA 2X2FA 4F3CA 2PA3A 4IPTA 2JFVA 4INAA 4BP3A 4ARAA 1ECGA 3A1TA 1EU1A 4IDDA 4RH1A 3RC1A 3NFRA 1PWHA 1XCLA 4WKNA 2EV9A 2ZYGA 5KX5A 4K1LA 2WJ4A 2YJ3A 3AF2A 3PF8A 3QUTA 3UK1A 4RHXA 2B1RA 2HYDA 3HVKA 3MLBA 4TKUB 4QTUB 4E22A 4E46A 1QTIA 2VJDA 2L17A 3HU1A 3PJRA 1USKA 1T43A 3CUWA 3PD7A 2GCPA 3NHZA 1DU4A 2PR7A 3F74A 3Q72A 4KQIA 4BVEA 3L77A 1VQ1A 3F3MA 4MUBA 4BO9A 4G67A 1MHTA 4QTYA 4BB9A 3HCEA 3FVVA 2RBKA 2BTOA 1GUZA 4DVJA 4ZT4A 4DDHA 5CLFA 2RHRA 1Z4PX 3JRWA 5AW4A 5FWXB 1KGDA 1JDSA 3N2IA 4LMPA 3L1VA 2GX6A 3HCAA 1Z6GA 3TWOA 3AFGA 1P72A 3IBTA 3UO8B 4CCYA 3JR3A 4JYMA 1VXRA 4Y6QA 2F55A 5DRTA 2NO9A 3DV0B 3U7GA 4NSNA 4IV5A 4C89A 3GGPA 2EYQA 4UMVA 3DOFA 3ZIUA 3GI1A 1QIDA 3GHHA 3WL6A 4OUKX 2WT8A 3GNLA 3X1YA 1YV9A 4BATA 1J9GA 3WP1B 2ZYTX 5K6AC 5LU9A 3WZMA 3I0ZA 1H8HA 1NNI1 4OM7A 4TTJA 2NOAA 5B3JA 3UWOA 1SK9A 4YJ2F 4PC7A 4Q4DA 4D41A 1MAWA 1TCAA 1ZI9A 1FMTA 5F9HA 2PNJA 3A2LA 4PSAA 4D4KA 1WU7A 1OY1A 1TCUA 4LK2A 3FG9A 1IRXA 2VNJA 4AS2A 1WPQA 2CLLB 4CFYA 2WJVA 4ERNA 3HJAA 3SVTA 5CPFA 2BDUA 4HYYA 3RTBA 3ZCXA 2YHAA 2AI3A 1YJBA 2AHOA 1YTLA 2WNHA 3P27A 4YPOA 2CDNA 3OTHA 1H93A 4DRYA 4WK6A 1O8BA 1IHPA 3RRXA 2QZ9A 4JITA 3K0CA 3V4ZA 4J0IA 4Q7MB 4ZCIA 5K3BA 4LWPA 4YP9A 4DILA 2QN3A 3GT0A 1MT3A 3RFCA 4HWKA 4QPJC 1DMSA 2A0UA 5ALZA 5DYTA 2D54A 4V1CA 5AVOA 3AB7A 3NM4A 4B6JA 4J7AA 1YZQA 3C4QA 5FTWA 4UHCA 4QM7A 4C2UA 4QQNA 2HGZA 2XUZA 3OEWA 1U90A 4J9UE 1TUBB 3EVTA 4G1CA 4LPKA 2A5LA 5DU2A 3QU5A 1L5RA 3E0XA 2ZM5A 2W4IA 3KEOA 3DZDA 2V5AA 3G9XA 2IWRA 2QTVB 1JDNA 3E9MA 1L7MA 1ZK4A 3C97A 2IHYA 3ZWAA 4LFAB 2G17A 2VHQA 3GO4A 5H68A 4X3CA 2B4KA 2HCFA 1XKLA 3TB6A 1T9CA 2FSUA 4DCNA 4DJEC 4QYIB 1LWOA 4RF5A 4DJTA 4I4IA 4MJ7A 1QG4A 4FT2A 3ZLTA 1PSWA 1N2CB 3EPLA 3EDMA 4ZANA 2ZG6A 2NO6A 2RJNA 2YZGA 2Y4OA 3WQBA 1XD9A 2JFHA 4BLOA 4E2ZA 4P31A 1NHWA 4YH1A 1IHOA 1TECE 1Z47A 2GZHA 3WYEA 2XAAA 3QEMB 1NAIA 2Z43A 3LKVA 5K45A 5AM2A 4X64B 1ODJA 1VPEA 2OGSA 3DV9A 2HWYA 4WRRA 8ABPA 5FL7A 1QGOA 3LUBA 3SE0A 3RYIB 1YRQA 2BFCB 4CTNA 1UL1X 2WTAA 4DA8A 2XJ4A 3EOZA 3IXQA 1UDWA 3FI0A 1PYOA 3VH1A 4ARIA 4KO4S 4MWOA 1HG0A 1W30A 1B3BA 3LUDA 3NETA 2EL7A 4OQMA 3TDMA 3TQIA 5HZMA 1FQOA 1A7JA 4JUFA 1KFJB 3KJEA 1H6DA 3TPCA 4A2PA 1XP5A 2PH3A 1ORIA 4N5IX 2I65A 3DMHA 3RF6A 2DJIA 1N1DA 3KZKA 3LF2A 4P54A 5THXA 4E6EA 4F3TA 5A4MS 1R6VA 1JIXA 3PYMA 1GGNA 2CHEA 1A0OA 2Q45A 1RWOA 3FROA 4O59O 4FMBB 4JA0A 1G7SA 3JQPA 4C0KA 4AS1A 2ERCA 4FFRA 3DFUA 4F12A 5HE9A 2AZDA 3EEBA 4K81B 1HNWB 1ISGA 3GGCA 2VR1A 3I9JA 4TQAA 5E6UA 5B6IA 1MPTA 3TQTA 1X8LA 1NMSA 1SBTA 3E7XA 3U7EB 3K0SA 3QW4B 3F9RA 2DR2A 1B3RA 1L4YA 2C2WA 3OT1B 3R5FA 2QTAA 5AKZA 2NPFA 1KRXA 3HDTA 1QCDA 1ZIYA 2NO0A 1B8OA 3UMFA 1KAEA 3H2YA 3I09A 3VYRB 4C5CA 4EA8A 2WHYA 4X8LA 2Q1XA 5J58A 2XCUA 2FR1A 3CGGA 4A6EA 1ZA2A 5E95A 3IAS1 2Z6QA 4W5TA 1VLJA 1WF6A 2X5JO 2YJ5A 3I1YA 3VR3D 4F4FA 5HNKA 1OX4A 2B1QA 1QG2A 3DDHA 3IEIA 3UMJA 5A3QA 1F0KA 1TF5A 3FY4A 1MB4A 1ODLA 1CJBA 3LQYA 3UT5A 4X71A 4BE4A 5BW8A 1SC3A 2BH9A 3B9PA 1CNEA 3P9SA 3Q2KA 3UPDA 1TKRA 3SAJA 1YR7A 4WZ6A 3W3AD 1RPNA 3SICE 1GQFA 16PKA 2DPXA 4WEQA 3UC9A 3DAYA 4D0LB 4M1TA 4RZHA 1P7PA 2RAPA 3AL3A 3FOCA 3RIHA 3W5IA 4ZOAA 4MLPA 4EABA 2FEMA 4JSTA 1C4XA 4PG8A 1HQYE 3X1WA 1FJ2A 1Y1SA 1DBRA 2HMTA 3O31A 4GP6A 5IT5A 3O6VA 3W7BA 3BFXA 2AKEA 2O8EB 1V8DA 3LUCA 4BRZA 1CR4A 1PKEA 4TYMA 4YJFA 5DM60 3GFPA 3M2PA 2FWIA 2AFIB 1A8HA 2R1VA 3WAJA 1U7PA 5JARA 5F4ZA 4UATA 1SOWA 4JZYA 2PCJA 1T9DA 1YDEA 1X7DA 2FW1A 2VRCD 2BBOA 2IF0A 5C4MA 1CE8B 4L4SA 4EUKA 1V4VA 2YIMA 1T36B 1G8GA 3VSAA 3CVUA 4ZOLA 1SXJA 5L3RA 2P0EA 2JKVA 2YVUA 3H83A 2PUFA 3ZH9B 1GKLA 2AN4A 2C7OA 2PIDA 3S55A 1GSIA 2WHPB 1NZDA 1O5OA 5EZYF 1P91A 3ZJUA 1KVQA 1RTKA 1T1RA 2FJ0A 3LW8A 5CG1A 3LLSA 1Z5NA 4HDRA 2C7VA 821PA 1TAUA 4ZYWA 1NVMB 2EFGA 1OGIA 1Q1AA 3HR7A 1QHNA 1KAOA 3BK1A 3OBBA 3QVLA 2VYVD 2QRNA 1P1JA 4LQ4A 1MG5A 1ML4A 2CDRA 2H2GA 3O1HB 1ZWLA 3B1YA 4EJ0A 5A5EA 4EB6A 4GXRA 3A37A 5I7FA 1CERA 1NXXA 1QM5A 2LIPA 4IFEA 1YA6A 5E7IA 3KL4A 4BJHB 2P30A 1DBQA 4TRJA 3BMNB 3E4DA 3IAAA 2VCEA 1L4FA 3FWHA 3RSSA 2F9LA 3PE4A 1Y6ZA 3EXHB 1RLUA 4GHWA 1F38A 4PGGA 1QRDA 4ZOCA 4EL0A 1FU8A 1UXIA 1ZRHA 2WIDA 3NHBA 5DH9A 5ERYA 2BZSA 3SIWA 3KUCA 3QFSA 3K9WA 5F3RA 4F6CA 5J2UF 2F3PA 1KP2A 1MGOA 4LDZA 4UJ5A 5ALTA 4QAQA 1NKSA 5DW0A 5BYBA 3FZGA 2EG5A 2XR1A 1E3WB 3N75A 2J9FB 4JELA 3ZEIA 1FSFA 4QPNA 2CDCA 1M2NA 2GVDC 3BRQA 1I5RA 2XUFA 3WL8A 1GG9A 3WK5A 2IBMA 1VE9A 3PQ2A 4I1YA 3A25A 2J87A 3SXJA 1QR6A 2X6RA 3DOEA 3KQPA 5KQLA 2J46A 1Y3CE 5IBRA 5CM8B 2CJXA 4AKTA 3GEMA 2DT5A 3L7OA 3HN2A 2JGJA 4IXWA 2XGOA 4L4YA 4M1EA 1JJBA 4EGFA 4IDOA 2GASA 3PNOA 4HCJA 2PYDA 4EBFA 2WF7A 5A9RA 2I7CA 1IPFA 3U44A 1NFRA 5KTRA 3V6MA 4Z0TA 4DXAA 4HQKA 4MIKA 2ZU0C 3P8ZA 4LYFA 3S5JA 2P0AA 1GGEA 3PUWA 2HRCA 5EXTA 2Z1DA 4GL4A 4I50A 4BZZA 1IDN1 2YQ5A 1XU9A 4GLBA 4ZK2A 4R69A 1NAHA 2V7PA 3LWBA 4BEJA 4E3ZA 2GYWA 2IZOA 1E7RA 4JP8A 1C50A 1BO6A 1NQXA 1EWVA 4U2GA 2FG6C 3P9RA 1KDOA 1TK2A 1U1GA 3HB4X 5GONA 1H2WA 1IXSB 1X74A 2P27A 3BBLA 4R7TA 1N2SA 2B8JA 3AUAA 1OI7A 3C48A 3OURA 2DULA 5CURA 2JGAA 4BFLA 4PTLA 4J6FA 1VHLA 4PO3X 2GFHA 3EBOA 2NQ2C 3NBQA 1P77A 3IKLA 3OVMA 3QMWA 4YDRA 4YS6A 1AGPA 3VR4D 4YRNA 1Z13A 1UINA 5CA1A 4DWVA 3KR2A 3EFEA 4H27A 4MQFA 1A69A 4OFZA 1IOVA 4ZQHA 1CZRA 1TYBE 3FCSB 1N5MA 5LZ7A 5D85A 4KU4A 1OC2A 3ORRA 1UBFA 2NVWA 1GN8A 4DMGA 4IFBA 1U02A 3I76A 3PNSA 5TPWB 4BRSA 4MS3B 3FOAA 2FYTA 3B20A 5GIPE 4NRDA 5B7QA 1YQ9A 4IWNA 3CNQS 4MW6A 5ESXA 3WLSA 621PA 1SVOA 2BFDA 4BJ3A 3GEHA 3U1VA 1YS1X 3GIWA 1FLDA 3S2EA 1V7ZA 3OQNA 1FA9A 4RD6A 1GL3A 1LF0A 4F38A 3PEYA 4RGQA 2OR3A 4X20A 4ZYTA 2PKCA 1IZ9A 2NZXA 2PO5A 3DMRA 3BXPA 1U2SA 4I9GA 3O75A 2GZ1A 1RRMA 1W46A 5CXUA 1BSVA 3AIIA 4PYLA 3C24A 4YMTA 4YRZA 3VOAA 4E14A 5CBPA 3QTBA 4CFSA 1T0BA 1WVMA 2HMUA 4IEEA 2QM8A 2CJWA 1R8QA 3P2KA 4PE5B 3H0KA 3CVVA 1R5JA 4DV1B 1W5BA 3NAZA 3EUWA 3Q15C 1YWGO 4Q3NA 2P9GA 2CMFA 2NVBA 4ZO8A 4I8DA 4DRXA 1VMIA 2WSLA 1OYVA 3SZRA 1GQ2A 2PZGA 1JFFB 2QRQA 4QEKA 1R3UA 3C5EA 1E1YA 3DA8A 5HX7A 5LQKA 3UT6A 1IY9A 3PFNA 2P3QA 1N8NA 2B4QA 4RL4A 1ADFA 2R1UA 4HGZA 3ORQA 1TMKA 3COPA 2JLAA 3RT1A 1J0CA 1ZVKA 1NT4A 1KQGA 4FM9A 4JXKA 3EY4A 2OBYA 2P1ZA 1CX9B 3MM4A 4GKBA 3OE5A 4K88A 1PQYA 2OYCA 3JAWA 2B4YA 1WHTB 4Z51A 2G1PA 3HABA 4CL0A 5EPOA 2ANCA 2CD7A 2P2DA 4FJ0A 4EOGA 521PA 1JJAA 2MYTA 3C8ZA 5CJJA 3WKAA 3NGXA 3TLZA 4U63A 5FR1A 1OWLA 3FE2A 3WIDA 1J7KA 2IP4A 4QHSA 3KKQA 4EECA 1KYIA 1G0OA 1QDUA 1RYZA 1SQ0A 4P3KA 2Y2VA 3C6MA 1NYRA 1OLSB 1I7SB 2QK4A 1SU8A 3N5KA 3MT0A 4Q18A 5BW6B 4K0KB 4NZOA 3D8SA 2KI5A 2V7EA 2YZNA 2G4VA 1WZUA 1GSHA 1F14A 1VP3A 2JD0A 1B0AA 3SS9X 1ZFNA 1YBHA 4K2HA 4ID9A 2PS9A 5K4GA 1RBMA 2XMZA 3RODA 3U7IA 2XT0A 4L9SA 5AW9A 1RPAA 2X0JA 1JGTA 1Y6GA 3GHYA 1AZSC 1C9NA 4HLDA 3BD9A 1I7NA 3LX6A 2LV8A 4MQUA 4P5DA 1E9FA 3U81A 1TFRA 1K9SA 1ZRSA 2I2XB 1HDCA 3CH6A 4CM6A 1H4VB 2BCGY 3ONWA 2ZS9A 4HSEA 5TRTA 2VHWA 4DIEA 1W88B 1ZM3A 2YY5A 5GGYA 3IP1A 5AD1A 2O9JA 1GYRA 2C7QA 4MVJM 2X9QA 1OFUA 4OX9Y 4TROA 4XPIA 2YDXA 3HKEA 2VXCA 4MRMB 1O8CA 4BAGA 2JNWA 3ISTA 3UK2A 4X0EA 5DSTA 1DX4A 2OD2A 4MGKR 1EEXB 3A1DA 4HDKA 2I6XA 3FAZA 2K7ZA 3DPSA 1NSTA 1TD1A 3K32A 3N2KB 4MTCA 4BNVA 4IQ4A 2NU9B 1GNPA 4MO2A 4MVCA 5HE8A 3D4IA 3PVZA 3GG2A 3FLMA 4MV0A 2P2SA 2XWSA 4WBXC 3AERB 4Y9RA 2WHEA 3A36A 3ME5A 5EJ6A 4LYEA 2X3FA 1UBNA 3M1LA 3MN1A 5T4HA 2EFDB 3V8VA 3WKCA 1KYZA 1W4LA 3T99A 2I55A 1JTEA 4R2XA 3TQFA 1GQRA 2PGIA 5AQEA 5TS3A 3VUFA 4K5QA 1KDTA 4Z2YA 3MGKA 3FDFA 3N6XA 5LIRA 4DQUA 1P1CA 3QMPA 4MP6A 3QPUA 4Q7KA 4DC9A 4KO3S 5HKLA 1J5PA 1KBZA 2YASA 1DDIA 3WYBA 1Q0PA 2A86A 4TTVA 5FBLB 4PZPA 3DGFC 3BMQB 2AYXA 2LKCA 5DM2A 5FD8A 1NW7A 3WWZA 3C43A 3THSA 4CKEB 2F3QA 3AKEA 1SCAA 2QJWA 3M2TA 1E59A 1G4HA 4YWJA 2Z2XA 3SEFA 1HNXB 1GAQA 3KQWA 1UKBA 1WDMA 2HA3A 2VPYA 1W73A 3LXXA 3GZNB 1SCQA 1US8B 2VQ3A 4JWKA 5A0FA 1LB1B 3HVUA 4MYHA 2IT1A 1ULZA 5CLIA 4Q9JA 5DBFA 2XB8A 3WGYA 1JFSA 1NBMA 1RI3A 3GJ5A 4YRDA 4BLSA 4ZAVA 3EYWA 5JDCC 1M34E 4UNPA 1H1LA 4NJEA 4E1AA 4YRBA 1HBJA 1M1YB 5HUHA 1YTUA 1I30A 1R2QA 1IMOA 2C9BA 4NXMB 4QGFA 3I1JA 4FBMA 5KTYA 2C88A 5CB6A 1UFRA 4UM8B 3WB0A 3R9IA 2FMKA 1X39A 3FPFA 3WIUA 3E35A 4MLDA 4J29A 3M5PA 2FSPA 4PS1A 2IBSA 2NVUA 3N87A 1QLWA 4PZZA 1FSGA 2FZGA 3TW0A 2RG1A 2OORA 5BV7A 4QVIA 1EVZA 4XGKA 1OU4A 1LX7A 1R5NA 3F6CA 3QENA 1JSXA 4LCJA 3HRIA 5BN4B 5CB4B 1M1NA 1SCUA 3GPBA 4FHEA 4IICA 1V8FA 2FPIA 2BCJQ 2QSZA 1BD4A 3H5RA 4I2NA 2VYNA 2VJKA 2BEUA 1DC7A 2IA5A 4NQRA 3KVOA 3HP1A 3IP6A 4W6ZA 4B48A 1ZW1A 2QU7A 3A04A 3A14A 5H83A 1M75A 5BR4A 3ZY6A 4OHUA 4Z4IA 1GTSA 2AG0A 2BTQA 4P4UA 4ZQGA 1XTQA 1C80A 1ZCBA 4UAJA 2WWVD 3R7LA 3N8DA 1XJCA 3O4FA 4PBRA 2HWWA 1QF6A 2IS4A 4G4SO 3ZDZB 4PZAA 1T6BY 1RQ7A 5AXAA 4KYVA 2E1PA 3REGA 2PD6A 3GYBA 4U9HS 3T4EA 3WKDA 3R24A 3OIVA 4CLDA 1J56A 3G23A 1MR3F 2VK2A 3NC4A 3TZBA 3QNUA 1NOJA 5TV2A 2WYIA 1L5HA 2QTRA 3L4SO 3PSAA 4BTLA 3R3ZA 4MEAA 4RIGA 4IQFA 4J16A 2VSOA 3DBIA 4HYTA 1CB0A 1MN6A 1FFCA 3AVVA 2AJLI 1NOIA 2KLBA 1S2DA 1AV7A 2OV8A 4H1TA 4UOZA 1UBKS 4YRJA 3E7FA 1CUAA 5DFAA 3E8SA 3T3IA 1KPHA 2Y9PB 4CV3A 1XN4A 2E89A 2ZPUA 3OHMA 5KC9A 2ZREA 1L5FA 2DJ5A 3T54A 1KOLA 1JP7A 1RI5A 2IYTA 2JRLA 3ICVA 4FVTA 1Q16A 1DDGA 1J1ZA 2DPYA 7ABPA 3T3HA 4D96A 1I4TD 4FFBA 4IH4A 3RO7A 4CF4A 4L8LA 2PKWA 5AOAA 2AYZA 4OJTA 4WCVA 3WGKA 2AWNA 2PX5A 3BXZA 2G63A 2WWGA 3PB3A 4Z86A 3OIGA 4IOJA 5CU7A 1XZBA 5ALPA 3NBAA 1IUKA 1PSDA 4XDHA 1RKUA 1ZH6A 2R751 4JC8A 5AVWA 2P6MA 1EK2A 1MVLA 1DKUA 1YO6A 1XL0A 2D1YA 3H9UA 3KOMA 3PZRA 1CQWA 1P44A 1YR8A 1FUYB 1Z4MA 1ORHA 2ONKA 1XAGA 4IIEA 1PJSA 5M04A 1QTQA 1C8VB 1OVGA 1P1FA 4FYKA 3SZLA 3AR4A 4O4JB 4UVIA 1WULS 4QG7A 1MQAA 4N18A 4GM0A 3GLFA 2J5QA 2WZQA 3TJZA 4ZQIA 1R7RA 2QX8A 1BH6A 4FEYA 1HT2E 2MINA 3TNDA 4EVIA 2AQIA 4QBIA 4EK9A 1HT1E 1KEVA 3W6PA 1NQOA 4KWEA 1ZGCA 2ZB4A 3EAQA 4DW8A 1QBGA 2SCUB 1QHGA 1EFRA 2ZB8A 3ETNA 4NHOA 1R0XA 5L4SA 1Y8CA 1S4MA 2VSNA 4UTOA 1DQNA