4UEKA

Galactitol-1-phosphate 5-dehydrogenase from e. coli with tris within the active site.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
346
structure length
346
Chain Sequence
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHEFSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEYIVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCAVALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVPQTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWETASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GALACTITOL-1-PHOSPHATE 5-DEHYDROGENASE
publication title Enantioselective Oxidation of Galactitol 1-Phosphate by Galactitol-1-Phosphate 5-Dehydrogenase from Escherichia Coli
pubmed doi rcsb
source organism Escherichia coli
total genus 110
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 1.1.1.251: Galactitol-1-phosphate 5-dehydrogenase.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4uekA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4uekA01
3OEYA 2NVUB 1JTVA 3HADA 6LDHA 1N7GA 3HDJA 1NNUA 1X14A 2PV7A 3HHPA 2BFPA 4AJ1A 4YWJA 1UDAA 4XKJA 2WJPA 3H5NA 4AG3A 4ZVVA 1R4MB 2VWPA 3D5QA 4XEHA 5EPOA 1IZ0A 5JCXA 5A9SA 4LVCA 4QT0A 4JLWA 2WE8A 2OBNA 3JQ9A 2GGSA 3VPGA 2CSUA 3PQDA 4E32A 1EQ2A 2UVDA 2GERA 4WASA 4NQZA 1CQJA 1ZO8A 3KLPX 1D1SA 4YRAA 1JAYA 4ZN6A 2AMFA 4IM7A 4MIOA 3WGHA 2WEKA 3HN7A 2NV6A 4GX1A 2I76A 4I9HA 1ZCJA 4Y6SA 3RFTA 5DF1A 3ROQA 4BGIA 4DPLA 4EW6A 1KBZA 2X0RA 3CIFA 2BI8A 2Y1CA 5G2OA 1Y5MA 2FPGA 3ABIA 5DDIP 4U6SA 1M66A 4AICA 2Y67A 3UCFA 3UXYA 3JQCA 1ZFNA 1O6ZA 1LDGA 1P0FA 5T8KC 3V2HA 2PLAA 4BQPA 1B0AA 5TF4A 1AE1A 2G0TA 2W2LA 3NJ8A 4FPXA 3BMQB 4RVGA 1D3AA 3BMOA 4GSLA 5FF9A 1VSUA 3ZU4A 4G5HA 4K26A 3WOHA 4NU6A 1PZHA 1O94A 5A05A 3GQVA 1YQXA 4GBJA 2ZTVA 3E48A 3RUCA 2E37A 1E3IA 1KS9A 3VHRA 2RHRA 4AVYA 3C8MA 5C7IO 3ASVA 3DFZA 2PZJA 1A4IA 2WM3A 2B0JA 4IDDA 5CAEA 1BSVA 1VSVA 4H16A 1YB1A 1EE9A 4A10A 2Y1DA 5MDHA 2HMTA 4G81A 2O3RA 4BKOA 1EK6A 2BFMA 3HDHA 2DFVA 2E4AA 4ZA2A 2OGUA 1WAMA 3KSZO 4ZQEA 1VKOA 2FR0A 1DRWA 4M86A 1X7DA 3B1FA 2NVBA 3E1KA 1YKFA 1FDVA 3DZHA 4IS2A 1BVUA 3PYMA 4L4XA 4JJGA 1FK8A 4A26A 5IN4A 5JCJD 3FF4A 1WNTA 4KUEA 1Z74A 3JQ6A 1KVQA 3DR3A 4J4HA 4QO7A 1ULUA 2X6TA 4JXKA 2AHRA 3GEDA 3U4HA 3U49A 2DBVO 1I2ZA 5KWEA 1T25A 4WGGA 1UR5A 1T1SA 1R12A 1GR0A 3PJFA 4CQLA 1ZK2A 2QG4A 4R1UA 3RVDA 5ICSA 2GN8A 4XQ9A 3BA1A 1MGOA 4TMFA 3TWOA 5DCWA 2HMSA 2O4UX 2QYTA 3DZFA 3FWNA 4HNGA 3WSWA 1A27A 3GG2A 1MV8A 1NBOA 5L45A 4H3VA 2Y0DA 5JDIA 4Z3DA 4E31A 3DQPA 4GKBA 4RPKA 1JVBA 4N54A 4CR7A 5J23A 3LSYA 4FGWA 4IZIA 4DRYA 2O23A 1Y9EA 2XOXA 4J90A 5AXCA 5KVQA 5CG2A 1LDYA 3B1JA 1PJBA 3W8DA 5TSDA 3ZWBA 1HDYA 3RBZA 2C29D 3L0DA 3O8QB 4L0QA 3RFVA 5F3RA 3ONFA 2YHIA 3VPSA 4HXYA 3W6UA 3O26A 1MFZA 4ZQGA 1I33A 2J5KA 3NT5A 4OYRA 4TRRA 4ZJUA 1C0PA 2F00A 3PP8A 1ID1A 3HB5X 2VZ9A 1MG0A 3D4PA 3H9EO 4JN6B 5HS6A 3EVNA 2JCYA 4NJMB 4CMJA 1A71A 4EZBA 4BNHA 3TFOA 4J9VA 1UXJA 5T8KA 4HBGA 3TOXA 3ZWPA 2BFAA 2A92A 1GPDG 1KEWA 2ZATA 4Q3AA 5I8WA 4OXKA 1J49A 3H4VA 1WPQA 4N5MA 3LZ6A 4E3ZA 1I3KA 2VZ8A 4NI5A 1PR3A 1NQAO 1MG5A 4BVAA 2J6IA 1PJ4A 4NIMA 3BMNA 3KBOA 2ZB8A 2O3TA 4BGVA 4CMIA 1N7HA 4CM8A 3H6KA 4JP3A 4HP8A 3WQRA 3VZRA 2HK8A 3FNEA 3BTOA 5AQ1A 5BQFA 4HUJA 3UN1A 4IDEA 5KJFA 1TT7A 3RBVA 1MC4A 2JAPA 4RPLA 4AJOA 1YQDA 5LDGA 4IDCA 1HL3A 4ALJA 2X58A 4CM4B 2Y1FA 4OXYA 2D59A 3AJRA 5CDTA 1ENZA 1DPGA 3MJTA 4TRNA 5A3VA 1VJ0A 2DTDA 3PEFA 4CMEC 1DO8A 2AA3A 2QHXA 2VYND 3U4IA 1E3WB 2P4QA 3L4SO 5FI5A 3PRJA 5G4KB 1DRVA 1JDJA 3SEFA 3D4NA 5HWSA 2D5CA 4IINA 3QWAA 1WMBA 2QX7A 2ZQZA 1T2FA 2J3IA 4IPTA 5CDYA 2BELA 2BD0A 2PGDA 3ETEA 2HRBA 5L7YA 2WD7A 5DCUA 4ALMA 5HS4A 3RASA 4PLTA 2VZ0A 1NFQA 4PIVA 3ZWAA 1JA9A 3TZKA 5ILGA 4E2WA 3WQSB 1XIVA 1D1TA 3KB6A 3PHIA 4W7IA 3ULKA 3KZVA 4YT2A 5TS3A 1GV0A 4YT8A 2NTJA 3NRCA 1KOLA 1BRMA 3F5SA 4R51A 3W4JA 3RC2A 4MJLA 4ND1A 5A9TA 4PLWA 3RJ9A 4BO4A 3CMMA 4TSKA 3GVIA 1P3DA 3SBOA 5T64A 3HN2A 1HEUA 4YDRA 4CLXA 4DC1A 4E33A 4RPHA 1MFPA 4RF4A 1H6DA 1N1EA 1ZK3A 2EWMA 3B1KA 3ZU2A 4R01A 1HTBA 3HE3A 3ST7A 2AEFA 2EG9A 4W82A 2AEJA 2J5RA 4J16A 1VC2A 3DOJA 4DMMA 2O2SA 8ADHA 2VYVA 3NGXA 9LDTA 2LDXA 1CIVA 1A9YA 1UZMA 3N58A 3OBBA 4O1MA 2E49A 1GQ2A 1YBVA 4R9SA 1GAEO 3VZQA 4WCFB 1V3VA 4CQMB 3GRKA 1DHRA 2FN7A 4XDZA 5TRTA 1Z75A 1LRJA 4DLLA 1ZUD1 2EW2A 4WE3A 4CMBA 4XGKA 4YQZA 4MDHA 4R1NA 5ITVA 1LLUA 1U3UA 4BV8A 2JFFA 2CD9A 3UHAA 3VC7A 3E9MA 4RVFA 5F1PA 1P0CA 2PZKA 5JYEA 3P2YA 4AJIA 4BHTA 2YV2A 3I4CA 2NUAA 1LLDA 2QRLA 3HQ4O 3DZIA 1OC2A 1XGKA 3LYLA 3OQBA 2V7PA 4ZICA 4A5OA 2P68A 1GV1A 1YE3A 2O50A 4WCDA 3WYBA 4PRLA 2CMDA 1QYVA 2ZYAA 5CEEA 1PJ2A 4DC0A 3X2EA 1C1DA 5HM8A 1E1NA 2DFDA 3MWDB 1I32A 3GMDA 1EUDA 2IEBA 3ANNA 5L7WA 5ILOA 3GLQA 1C3VA 4CMEA 1F12A 4BO5A 4J43A 4J3FA 3RC7A 2C5EA 1PL6A 2HMUA 2J8ZA 3KVOA 3LLSA 5BNFA 3PJGA 4D0RA 4FFOA 1XA0A 2VOJA 2J5QA 1E6EA 3ZI0A 5JXWA 3AK4A 3ZU5A 5HTOA 1BXKA 1T26A 1ZK4A 4I5DA 4IJUA 4K28A 3KYDA 2FR8A 4KOAA 1DLJA 4MP6A 2GCGA 1DJQA 1N9GA 4R41A 1G0OA 2CDCA 2FWMX 2ZQYA 3EYWA 5DP1A 5LC1A 4GI2A 3QE3A 5JO9A 1B8PA 3I9JA 3FNHA 5FWNA 4TZTA 1TLTA 1HE5A 3D3EA 5G0VA 5CDGA 1NX6A 4IY1A 3Q3CA 1WDLA 2TMDA 1I3LA 3OQ1A 3IL2A 1ISJA 3DBVO 1CDOA 4AJKA 1U28A 2CNBA 2EP7A 4YYZA 2C59A 1YVEI 4BOYA 2D0IA 3EW7A 3AUAA 5DBIA 2DBRA 4QEDA 4AJPA 4CM7A 3GVCA 3RJ5A 4Z9FA 4QQRA 4FDAA 5L95A 3SVTA 3ZWCA 5JNLA 3JD2A 3EVTA 4XWYA 5KOIA 2UYYA 3M2PA 4BQRA 4CUZA 2C07A 1CEQA 5CEFA 1VL0A 3PIIA 1ZW1A 4UUPA 1HYHA 1U2GA 3GEGA 4FR5A 1J0XO 1RM5A 2EJVA 2NVWA 4NMHA 3MTGA 1XG5A 2CUKA 3PYLA 4CM6A 2GRAA 2HKIA 3I83A 1DHTA 4WEQA 4ALNA 5LDHA 3GC6A 1U7TA 1Z7BA 1X13A 4RVHA 4R68A 4MVJE 3D3WA 5ER6A 1UUFA 3AM5A 4LGVA 1K89A 5EQDA 4WUVA 3RC9A 2BGKA 2XF8A 2EJWA 2JD2A 3A28A 1NFFA 1YONA 1M6HA 3GVHA 3NX4A 4CUJA 3I52A 4CR6A 3FPLA 3OA0A 3GF4A 2VTEA 3EDMA 5AXBA 1AXGA 5C5IA 5L4SA 2AXQA 4JNKA 4Y9DA 4QECA 3DL2A 4AJHA 3F47A 5COBA 3I6QA 4YJFB 5A02A 1JKFA 4DA9A 5JAIA 1BXGA 3SLKA 3AUSA 3RBXA 3WWZA 4BNNA 4TQGA 3AI2A 4BNXA 2PKQP 5COAA 3U09A 1XKQA 1PGJA 1HSOA 3GN2A 4OQYA 4BNTA 1E7RA 4XZ3A 1D4FA 1JVSA 1T4BA 4ALIA 1LLQA 3K9QO 3WGZA 3F4BA 3AW9A 4CR8A 1A72A 2JFHA 1Z7EA 5A1TA 1NVMB 4TRMA 4YEDA 4E5YA 1D7OA 3S8MA 3I5MA 4FFMA 1SB9A 2YDYA 3UW3A 3R3SA 4AJNA 3NKLA 2VUTA 2OOSA 3N7UA 1FDUA 3EK2A 3QVSA 1MC5A 3JD4A 2WYUA 4Y67A 3ZN2A 5TJHA 4GX0A 2I66A 3BHIA 5G4LA 2FSSA 4XR9A 4Y8VA 2GZ2A 4ND2A 1SCUA 2AG5A 4CM1A 1EDOA 4YJDA 4B3IA 2AG8A 3PQFA 2I99A 4ZRNA 1P1IA 1N2SA 4IBOA 5A4DA 1WLYA 2Q1WA 4PG8A 5EL0A 1O0SA 2EGGA 1A4UA 1V9LA 1GZ6A 1ISFA 1PTJA 2Y66A 1XELA 3HG7A 1EBFA 4HADA 4H7PA 4HY3A 4I9UA 4D46A 3JQ7B 2EW8A 2X23A 3H7AA 4NBRA 5C7LO 1E3EA 1GUFA 4YAIA 2NU6A 4MVJG 2AQKA 1E6WA 3C7AA 1DIHA 3PHLA 4GQAA 4CM9D 3FR8A 3H9JA 2IXAA 4MVJH 4QO8A 3BMCB 3UICA 1E1MA 3H9GA 1QKIA 1NR7A 1Y8QA 4OXNA 5G0TA 1WZIA 2V6FA 3JQAB 3H8VA 1I0ZA 4TROA 1OOEA 2G1UA 2GF2A 3OA2A 5KKCA 1ADFA 4J2OA 4A2CA 4QFDA 1V8BA 5DULA 1JW9B 3QWHA 3UCXA 3P2OA 4CMKA 1W6UA 4UUNA 2GD1O 4DXHA 1WMAA 5EINA 1BWSA 5HRUA 1EQUA 3H65A 4OQZA 4DIOA 2VHWA 2FZWA 3W6ZA 5FEUA 1HE3A 1YDWA 2J3HA 3DBLB 3NDIA 3PHGA 4B4VA 1R4NB 4D43A 3ICPA 1IULA 3VTZA 1ISHA 2X5JO 4AJ2A 5B1YA 2Q4BA 3DAGA 3HB4X 2DT5A 4PLGA 3H3JA 4GVXA 1NAHA 4NFYA 3ZWOA 1HF3A 1RWBA 3GDOA 3AOEC 1CJCA 4LRSB 4DYDA 4YT5A 1SAYA 1H6CA 1NM5A 1C1XB 3L6DA 4IQGA 4B7UA 3JQAD 1LTHR 2Q2WA 2ZIZA 3WS7A 3DBHB 3K31A 4IQ0A 4CLOA 3P7MA 1HKUA 1DJNA 1I5RA 2Y93A 2BF7A 4JJIA 4II2A 1C0KA 4DQVA 1GY8A 2C82A 5COQA 1MX3A 5JC1A 2BH9A 1ORRA 4FOSA 5IXSA 3EHEA 2WDZA 4IS3A 4YJGB 3RU7A 1NVGA 3O9ZA 4FN4A 4PGFA 1QR6A 1QMGA 2EV9A 4F6LA 3GZ4A 5U9CA 2W2LD 1WW8A 1K6XA 3PZRA 1LBEA 2WSBA 3OP4A 1YBMA 4TRJA 3SJUA 2WWRA 3GAFA 2IZ1A 3BTSA 3PFWO 4I5FA 1PEDA 1UH5A 3O38A 1Q7CA 1W8DA 1JWAB 2WD8A 4J4TA 2Z1MA 4J4BA 2GZ1A 5L53A 1ZSVA 3GAZA 3UFXA 1F14A 3IJPA 3IOYA 5BT9A 9LDBA 1GADO 3UCEA 2NTNA 3WGGA 2E82A 4KWHA 4MO2A 1B2LA 4BUCA 1K6IA 4JX8A 5I7FA 4D0SA 3JTMA 4XYBA 1PGNA 3EMKA 4BL5A 4BNFA 1I8TA 2VTDA 3DXFA 2JFGA 4J7XA 2PZMA 4MVJI 1VL6A 1IHYA 1MXHA 5IDXA 2GASA 2VUSA 2VUUA 1LDNA 3WICA 1HLDA 5U1PA 3AU8A 1F8FA 4WK6A 3DBRB 1G6KA 5IF3A 5CEJA 3JYLA 5JDIC 3PWKA 3MEQA 3S2GA 3CH6A 4OOFA 4WLEA 4LVUA 3BHJA 4K1LA 4BMSA 3FRJA 1HDXA 5DNAA 3ETGA 4D44A 3HSKA 4DTIA 5TGDA 2FR1A 1U1IA 3QWBA 4TKMA 2BMAA 5CFZA 4HFMA 3LLVA 4IIUA 2OMEA 5EQFA 2POQX 1PJLA 4JCOA 3SC4A 1I3MA 1FDTA 1UDBA 2ZTMA 3JQDA 3LC7O 4CMHA 3CINA 4N5LA 3WXBA 3KETA 5G0WA 1M75A 1M2WA 2QIOA 4GVLA 3FBTA 5I7VA 2PNFA 4BNKA 4UEJA 3HDQA 2A94A 1E6UA 3WNQA 5KVVA 3I23A 1A7KA 1I3NA 4CV0A 2GNAA 1ULSA 1LU9A 3P5SA 3AOEA 4Z0PA 1PGPA 5CDSA 1K2WA 1F0YA 1A7AA 4J1QA 2QRJA 1LC3A 4OH1A 3GH3A 4PFJA 3DZJA 3ICCA 3LT0A 4XQCA 4Z0TA 4ZGWA 1T2CA 4TKLA 3QRWA 4Y6RA 5DBFA 4CLDA 4EBFA 3AUUA 4EITA 4XYGA 4HV4A 3NTRA 1NHWA 5BSHA 4DQUA 3GMSA 3GZNB 2ZKLA 3GVPA 1GDHA 4O59O 2W2KB 3F9IA 3OH8A 4RO0A 4A0SA 4LMPA 5L7TA 4WOKA 2NACA 2HRZA 2P2SA 3ASUA 1TB4A 4PLFA 4Q39A 5DBGA 3W1VA 3WFJA 3SJ7A 1Y9AA 1E7QA 3DFUA 1M6WA 4YJHA 3SC6A 4B8ZA 2C5AA 1KY5A 3KOUA 4YBZA 4KQWA 4PN3A 2PFGA 4UVDA 4E2XA 2IE0A 5T5QA 5KJCA 5JLAA 1YBAA 1TT5B 3K8ZA 4M89A 2NQTA 1VRWA 1QV6A 1PS9A 3K5PA 3NV9A 3L4BA 4E5MA 4XGIA 2YW9A 3AI3A 3F1KA 2AEMA 3WMXA 4D79A 5JBIA 3WGQA 3WIDA 5BNIA 1BMDA 3E8XA 4IGFA 3AM3A 2B5WA 4S3MA 3W4IA 4L74A 2WMDA 3RFXA 3OICA 2UUPA 2BRUA 1X0VA 2C7VA 3Q6IA 1SC6A 3ROPA 3UKOA 3WB9A 3AOGA 2C2YA 2X4GA 5F21A 4XYLA 5ADHA 6ADHA 4PLVA 5B4TA 5K6AA 4I08A 2R2GA 4N7RA 1U3VA 1H94A 3ANMA 1BW9B 2V65A 1PQUA 3G79A 1ML3A 1AHHA 3A9WA 5JMWA 3IKVA 5KCZA 4OIMA 2ZB3A 1H2BA 2PGJA 1QLHA 4WLFA 1PZFA 1P33A 3OECA 2FMUA 4GSKA 4W99A 3GNQA 4PZCA 3I9KA 3BIOA 4JIGA 5A9RA 3OETA 2V6MA 3W8EA 2EP5A 1Y8RB 1RJWA 2W98A 2Q99A 2GN4A 4RVDA 3FBGA 2GN6A 1PU2A 4XB2A 4BNGA 5EMHA 5JE8A 1ONPA 4LRTB 2I3GA 1V35A 3KSUA 1GZ4A 5DN9A 4XJSA 5G0UA 2ILTA 4ZQFA 3LU1A 1JKIA 2D4AA 4RF5A 4KP7A 4XA8A 2NSDA 2PD6A 5C37A 1NAIA 2DBZA 2C54A 2YYYA 2NVUA 3DB2A 4JBGA 1SEPA 4RDIA 4F45A 1RM4A 1WDMA 1M76A 2DKNA 2FPIA 5EJ2A 3V2GA 5B4UA 3RUIA 2O3SA 3ZGYA 4NH4A 1ISMA 4MVJA 3H2SA 1XLTA 4IIVA 4A27A 1R4MA 3S1LA 3JD1A 4L73A 3JCZA 4IDGA 1LRLA 5BSEA 3AWDA 3IUSA 4G2NA 5I8ZA 1DFIA 3C1TA 2YHUA 4PZDA 3P19A 1U5CA 5H83A 4CLRB 2CF6A 2YDXA 4WJZA 4XQGA 3D5TA 1ADBA 3WDSA 4D3DA 1ZMTA 2X86A 5IN5A 4GX5A 4BNLA 3FNFA 1IL0A 1ONOA 2CVOA 2UDPA 4G65A 4IUYA 5L51A 1TEHA 4BIIA 1NTOA 3DDNA 5AYVA 1P74A 5EN4A 3RUHA 1YWGO 1X1EA 2NNLD 5B12A 1L7EA 3IS3A 4K9DA 5JAZA 2B69A 1QP8A 4OJNA 2Z1NA 1PZGA 1PX0A 3UVEA 1E92A 5JCJA 4RDHA 1V6AA 3BHMA 4IZHA 1WZEA 4IQ8A 5JW6A 3DAFA 4XB1A 4ZQBA 5C7OO 3GNSA 4CODB 3FHLA 3BMQA 4RORA 2X5OA 1BDBA 1O9BA 4RF3A 3QIVA 1VE9A 3RC1A 3MJCA 3TQHA 5IDQA 1B7GO 4W7HA 4ONEA 3WGYA 1KETA 2CVZA 2QYSA 2PR2A 5IDWA 2DM6A 4GAEA 4D3FA 3ZDFA 1ZK1A 2D5AA 1DIGA 2PKQO 3ENKA 5L3ZA 3GDGA 1PWZA 2BGLA 4E2YA 3GHYA 1SOWA 1B8VA 1BG6A 1MLDA 1UXHA 5BNTA 2BLLA 1I30A 3MJ4A 2HUNA 1GPJA 1P31A 4I8XA 3L6EA 3HJAA 3WSVA 4RPJA 3INTA 3M6IA 2HMVA 3F6YA 1UP7A 3G1UA 4NZ9A 3QQPA 5GZ1A 3SLGA 1D8AA 4Q3NA 4OO3A 1ZEMA 1DC6A 4XD2A 3OJLA 5A5FA 3JQGB 3C1AA 4EJ0A 4FSHA 2JJYA 1U4OA 1AHIA 4GGOA 4AL4A 2V6BA 4CMAA 2EXXA 1PZEA 1E7WA 3AI1A 3ANLA 1FXSA 2Y0CA 4NPCA 4XIYA 3ZCXA 3K96A 3L9XA 4DYVA 2I9PA 3I9LA 3AY7A 4MKRA 4TZKA 2ZB4A 3LDHA 5DP2A 3U4DA 3PI7A 4ALLA 4W9NC 3Q0EA 1PGQA 4XX0A 2DU8A 2BGMA 3GVXA 3IJRA 5JO0A 1KEUA 3WBBA 4GL4A 2VHZA 5IAAA 1Z73A 3ZHXA 1X7GA 1P1JA 3BAZA 4I1IA 3LQFA 2PWZA 3UF0A 4FCCA 1HXHA 3O8QA 2DLDA 5TC4A 3H5AA 1LJ8A 4L8VA 2OFPA 5MGBA 1PS8A 1IY8A 3NT2A 3E18A 2DQ4A 4WCFC 3NDRA 1K5HA 4R69A 3JV7A 3FTPA 5B37A 2R6JA 3JQ8B 4PLYA 1XU7A 3KTDA 1FMCA 1SZJG 3KHUA 2H5LA 4IDAA 1VLLA 2QRKA 1GU7A 4BO9A 3WGIA 4WNCA 1XSEA 4UVIA 3X2FA 1LQTA 1SMKA 1Q0LA 4WLVA 4EEZA 4NJMA 5LCXA 3FPCA 1IPFA 3RIHA 4LK3A 1MA0A 1M67A 2IDZA 4URFA 4D42A 5L4NA 4PLHA 4U0JA 4BNYA 2E6UX 1PJQA 1GCOA 3CE6A 4EYEA 1XR3A 3KYBA 4LN1A 4GWKA 2PTGA 3OIDA 3RI3A 1J4AA 3HNPA 3QY9A 3QV1A 3VVBA 1DRUA 2DC1A 5KJ6A 5JAQA 4CUKA 3ZWXA 1I24A 2FOIA 2FRDA 3KYCB 3QA9A 3KXDA 3OM9A 1DC5A 1U9JA 2YQ4A 2RBEA 1KC3A 3ZNPA 1FJHA 1ZIDA 5JSFA 3UAGA 2RAFA 4FS3A 4RCVA 3QWIA 1LXCA 2I65A 4CM4A 1BHSA 4UVGA 4O0LA 4YAJA 4ND4A 1HDOA 3C7CB 3TF5A 1YS4A 2IYPA 1O89A 1KC1A 2H9IA 5JAMA 3PQEA 3WLEA 5IZCA 4L76A 3JQEA 1KVRA 3KO8A 1E3WA 3GGOA 5G4KA 1ARZA 1CF2O 2Z5LA 3S2IA 3IC5A 4J1SA 1B3RA 3KEOA 4CMGA 2HU2A 4YPOA 3G3EA 1DDOA 2GR9A 1R15A 2RIRA 3UOGA 2CDAA 1NPTO 4IJKA 1N8KA 1ONNA 3DONA 2C2XA 1X1TA 4EJMA 5CP8A 1ZBQA 1H0KA 3PWSA 1LLCA 5U4QA 3GUCA 5EIOA 2HLPA 3KM0A 1QXSA 2C0CA 2EIHA 1HDRA 1SO8A 1PQWA 4MINA 1R0LA 3OQ6A 1EVZA 1GZ3A 3VVCA 2VRCA 3R3JA 3QHAA 1SEVA 2GDZA 3VH4A 1JWBB 3W8FA 1CQIA 4NDNE 1P1RA 3COSA 4YAKA 4W9NA 1T24A 2VT2A 3GGPA 5FI3A 1NPDA 4J1NA 2DTEA 1GQYA 5AOVA 4BNIA 8LDHA 1YJ8A 4KWIA 2P9CA 1I2BA 1LSJA 2A35A 2XXBA 4RZHA 3CPSA 4NFHA 4E5KA 1DEHA 1CWUA 1GCUA 1HZZA 3FN4A 5CG1A 1ZEJA 4BO0A 3D64A 4LW8A 5CDUA 1PWXA 1RKXA 2H63A 4P8RA 2HCTA 4WCFA 4CQMA 1FF9A 1U8XX 4R9RA 5I7SA 2G5CA 2RH4A 3IQDB 2DPHA 2EERA 4MIYA 3R6DA 4YA6A 3ZHYA 2NLOA 4WPGA 3AY6A 2JL1A 4GMFA 3RWBA 5H81A 1HLPA 2QQ5A 3AU9A 3M1AA 2QZZA 4CLEA 1VM6A 3Q11A 5IJZA 3G0OA 1LEHA 1ZSNA 2PH3A 4D3SA 2VNSA 4P38A 2P91A 1OAAA 2P5UA 3TL3A 4EDFA 4RV9A 4MP8A 4HWKA 3EUWA 5CHEA 1DLIA 3CZRA 3ZW8A 4YXFA 4WLOA 2LDBA 3VZPA 3Q9UA 3N74A 1P1FA 4KUGA 4CL8A 5AVOA 4IMPA 3DZBA 4BKRA 3K2BA 3ZU3A 4HFNA 3OIFA 4NNJA 3DOOA 3QVTA 3IDSA 3QVWA 3HFGA 4BS9A 5I9MA 2IRWA 2B4RO 3CZMA 4QSMA 3VDRA 1Z45A 1ZSYA 4PZEA 4BB6A 3UH1A 1F17A 4YRDA 3Q9NA 5A9SB 1YXMA 4J2HA 4R3WA 3GFGA 1H93A 2ZCUA 3DEYX 1O5IA 3R1IA 1NFRA 1JU9A 3U3XA 3QW2A 3ZV4A 2WYWA 3ZWVA 1DC4A 4E5NA 5F1OA 3BTUA 1ZJZA 3U62A 4I9NA 3RKRA 1U2DA 4L4RA 1Y1PA 5JY1A 4RL6A 3PLRA 1EEHA 4MKZA 1YGYA 4JBHA 2X0NA 5KKAA 3TZCA 4UUMA 1GD1O 2VHXA 3H9QA 3B20A 3WYCA 3EZLA 3ZNOA 3ENNA 4OL9A 2AE1A 3WTBA 3WTCA 2WE7A 3V2UA 4DLBA 5A03A 1B8UA 4KDFA 4BNUA 2OP1A 1W73A 3O03A 1BTOA 4GLOA 3RUAA 1I2CA 2AQ8A 3U9LA 1DOHA 4KMSA 1HETA 4ZU3A 4GGPA 3S2FA 4FBGA 3BMOB 4Q3DA 4E6PA 5B4VA 5I9LA 4AJ4A 4DWVA 3BXXA 2HAEA 4GKVA 3RQSA 1Q7BA 3DTYA 3E82A 1DB3A 3PJEA 1PJSA 2F1KA 3PHHA 1NXQA 5IG2A 2EF1A 1XEAA 4PVCA 3JD3A 5HA5A 5JDCC 1IZ9A 5IXYA 3ITKA 4Z9YA 5KNLA 3CTMA 4XIJA 4KDEA 2X0JA 4OHUA 3NUGA 1P9LA 2FP4A 3MCVA 2YV3A 4JROA 1WWKA 1ZH8A 2RHCA 1JLLA 5IDYA 4A73A 2HK7A 3LT1A 1L1FA 5TT1A 4Q3CA 3INRA 2B36A 2G76A 1DBVO 1UZNA 1QG6A 1CYDA 3CEAA 3JYOA 4B3HA 4LSWA 3MOIA 3JQFC 1I10A 5F5NA 1H2HA 1LDBA 1B14A 4II3A 1ENPA 2HSDA 4KTTE 4B8WA 4XR4A 4K6CA 1XYGA 1SNYA 2G82A 1YQGA 1H5QA 5K9ZA 4RQUA 3B6ZA 1MXFA 1YL6A 7MDHA 4FB5A 3RUFA 4MOWA 1YB4A 3FR7A 1JQBA 2O48X 4OKIA 1HDGO 4YJFA 4CQLB 1A5ZA 4Z9XA 1X0XA 3ZWWA 3F5QA 2VQ3A 3DMTA 2YFQA 4E30A 4DUPA 4BMVA 4UEOA 1LUAA 1RYDA 1VJTA 1A9ZA 1NASA 1ZXBA 4J7UA 3U5TA 1HDZA 4PLCA 4ND3A 4PCVA 3L4BC 3GRPA 3MJEA 4PLZA 3LT4A 4XDYA 5EESA 1MB4A 1PSDA 3AFNA 1PGOA 2GSDA 3G49A 3IP1A 1GYQA 3ADOA 4MP3A 4A03A 3E6AA 1UAYA 2X9NA 1R66A 3S55A 4R16A 1ZMOA 2JD0A 2Z95A 1U3TA 1PR9A 1DSSG 4C7KA 4PRKA 2P5YA 1T2AA 3LC2O 1QYWA 4JBIA 1J5PA 2YHIB 2IXBA 1EVJA 3NEPX 4MIEA 4OOEA 4XGNA 3V8BA 1S6YA 3TSCA 5K6AC 1GQQA 3GFBA 3ZZNA 1YJQA 1EZ4A 1Y5RA 2UV8A 4XQEA 4CM5A 1PL7A 2HDHA 2VWGA 4FFPA 4IJWA 4L75A 5DOZA 2YY7A 2O7SA 3JYPA 1TA4A 3AY3A 4INAA 3ZWNA 4YAGA 4CV3A 3TN7A 3DOCA 4NHEA 3GUYA 3TL2A 2VHVA 3ZNQA 4NK4A 1U5AA 1ZNQO 3TDKA 4EI2A 2PH5A 1AUPA 5F1KA 4PLPA 4BO1A 1UP4A 3BMNB 3PK0A 4QTZA 5DT9A 3JQ7A 5HBRA 4ZD6A 3T7EA 4CMIB 4CM8B 4DIFA 2Q1UA 4K6FA 1WDKA 2AE2A 3C85A 3K73O 5KJ1A 5JDCA 2B83A 3NT4A 4UULA 1E7MA 1EE2A 3DWFA 3GT0A 4R3NA 1XQ1A 3MJSA 4YT4A 1V0JA 3RD5A 3BMCA 1G0NA 2C7GA 5ENDA 2IODA 3JQAA 3IUPA 2ZJ0A 1LSUA 1R37A 4F3YA 3VPHA 4BMNA 1KY4A 3H9UA 3TNLA 1P77A 4CL3A 3PFFA 4GLLA 3JQFA 2JHFA 1DIRA 1EFLA 2O3JA 2O3UA 3VZSA 3I9NA 2YJZA 4BB5A 3E5RA 2HQ1A 4LCJA 1VL8A 3FSRA 1BXZA 2B35A 3L77A 3RUDA 2Y1OA 1Y7TA 3TZHA 2OHXA 2WD7B 4BNVA 1TI7A 4MVJD 1WVGA 2CFCA 3DBLA 2NADA 4WECA 1LQUA 1QLJA 5CPFA 3ITDA 1ADCA 1R4NA 4XYEA 3PIDA 1UJMA 4BO2A 2VHYA 5KTKA 2BKAA 3VAZA 2Y1EA 1I36A 2ZK7A 1E3SA 1CETA 1GYRA 4O6VA 3VTFA 4ALKA 4B3JA 1RM3A 2W4QA 2OP0A 3WJAA 4P4LA 2GN9A 4DBZA 4I5GA 4B4WA 4ZQHA 4N18A 4DQXA 4O63O 1C1XA 2DVMA 3GN1A 3VDQA 3MWEB 3QP9A 3OJ0A 3DBHA 2H6EA 2CY0A 2IEDA 3LT2A 3OFSA 3C3XA 4FW8A 1FDSA 3I4FA 1HYEA 1I01A 2A9FA 1EBUA 2XPCA 1JN0A 2IYOA 2B4QA 4GH5A 4NBUA 2B37A 2OUIA 1W0CA 2NWQA 1EFKA 4R54A 3OIGA 2E48A 4YJGA 4NG5A 1TVEA 5THKA 3V1TC 4CM3A 2HJRA 3T4EA 3B70A 4NBWA 1G1AA 3E03A 4PVDA 2VWHA 1LDEA 3ONDA 4E12A 5L40A 1IYZA 1X15A 2ZTUA 5G0SA 3I1JA 3ZW9A 1UZLA 3F3SA 5A3JA 2YZ7A 4WOJA 2GO1A 3V5NA 2BHLA 4JQCA 1R6DA 4RJTA 1AGNA 2Q45A 1PQPA 1UXGA 4FJ2A 3ZV6A 4BO6A 1GL3A 1YO6A 4R4JA 5DCYA 2HK9A 1E5QA 5I7EA 5K0ZA 2R00C 4D41A 3CXRA 4JP2A 3GA0A 4JK3A 2HMWA 2OORA 4E0BA 2EHDA 1HE4A 3DAPA 2EKPA 1N5DA 4BO7A 2VYVD 3OJFA 1J6UA 1ENOA 3DHYA 1C1DB 3I9MA 2FY8A 4J49A 1HYGA 4N5NA 2CVQA 1OC4A 1GTMA 2C20A 3DBRA 1HDCA 3Q2KA 2D8AA 1QYDA 1N1GA 4NU5A 3GNTA 1QORA 4YAEA 3WBFA 1QSGA 3FTNA 4M8SA 3RUEA 3PXXA 4B4UA 4CPDA 1R0KA 1E3JA 3A1NA 2WTBA 5JFOA 1NPYA 2X7HA 1OMOA 3C7DB 3KYDB 3CMCO 4ITUA 3VH1A 1NP3A 1N9GB 1SB8A 3EC7A 3VH2A 1DIBA 1DFHA 1UAGA 3PYXA 1YDEA 1ZKMA 1T2EA 2CDBA 3D4OA 4BNJA 3TRIA 4UREA 4EGFA 5AXAA 3RROA 3RU9A 1UXKA 2RCYA 1U8FO 4I5EA 4ZHSA 3ZWYA 2O2YA 1LNQA 2GZ3A 1B16A 1NQ5A 3K30A 1JKJA 4L9RA 2ZYDA 1GUYA 3ROKA 1K0UA 1PJ3A 4CLHA 2GPTA 2JD1A 4FC7A 4R1SA 3W4KA 1T4DA 3DHEA 4WEOA 3AM4A 5ITWA 3AUTA 2X0IA 3UUWA 3TPCA 3GPDG 3O4RA 4AJJA 1NQOA 4QXMA 4J0FA 4BO8A 2AQHA 3QWFA 4Q9NA 5AXDA 4A7PA 3VPFA 3GZNA 4ESOA 2D3TA 4DMLA 3OMLA 2W2KA 4PG6A 4RQTA 4UVEA 4YCAA 4EUFA 1DAOA 1OI7A 2W90A 3JYNA 1V3UA 2W8ZA 1AN9A 2NTVA 2X9VA 4S1VA 1CERA 1XWFA 1OBFO 1IOLA 1NVTA 5A5EA 5JC8A 2QZ9A 3WQQA 4C4OA 4FQ8A 3D3WB 3WMWA 3T7CA 4EJ6A 1P45A 2VOEA 4HNHA 1B15A 4RZIA 5IZCC 1ZJYA 1E1KA 1DXYA 4KUHA 1LX6A 3NTOA 1H6AA 1H9AA 1TT5A 4DGSA 3DZKA 3R0IA 3ZH2A 3WG9A 1H6BA 4YR9A 1C0IA 2JCVA 4HKTA 4YQYA 1E1LA 4W6ZA 4B7CA 4RGBA 3CUKA 2R00A 4UEKA 3LK7A 1LI4A 5DZSA 3OJEA 2PA3A 1SBYA 4BKUA 1K3TA 1QYCA 1OZAA 4MPDA 1KEPA 4LSMA 4J6FA 3WX0A 4D45A 1IPEA 2VRBA 4BO3A 1BXGB 3PVZA 1HSZA 5FYDA 1E3LA 2Q46A 4YVFA 3WJ7A 4C7JA 2OL4A 2GUGA 3IP3A 4E4YA 3DZGA 1OFGA 4GX2A 1QYXA 2IZ0A 5ER9A 3PDJA 2VNAA 2NQ8A 3HUDA 3ONEA 3C24A 1KEVA 3ETDA 1BW9A 2X22A 1VI2A 3WYEA 3WR5A 1EUZA 1PL8A 4UUOA 4BGEA 1EUCA 4J91A 3SXPA 4ZRMA 2UUOA 4NR0A 1RM0A 1ENYA 2DPGA 1NQTA 2GYYA 4KZPA 4Y98A 4CV1A 2EKQA 2O4CA 3MOGA 3RCBA 2X8LA 2VRCD 3GDFA 2NM0A 3QVXA 3Q1LA 1ISIA 1Y8RA 4J1TA 4NFSA 1HRDA 4R5HA 4BNZA 2YQ5A 3HWRA 3NDJA 5BR7A 2VYNA 3TJRA 2X5KO 3WFIA 1AXEA 2DAPA 3E5MA 4GPD1 4UVHA 1F8GA 1XHLA 3OJOA 5EERA 3VPXA 2JAHA 5L4LA 5A06A 3EZYA 1H9BA 4FOOA 1IHXA 2Y1GA 1Z6ZA 4O5OA 4QFCA 2EEZA 3GY0A 2OO5A 2YFHA 1B26A 4MVJF 1YOVB 2RH8A 2EGHA 1LRKA 4BKPA 3G1TA 2TMGA 4CQMD 4IXTA 1B3BA 2HO5A 3IMFA 3Q2IA 4ND5A 4M87A 1IB6A 3GEMA 4CMCA 3M2TA 1NWCA 1Q1NA 3OF2A 1VKNA 1VPDA 2H1SA 3D7LA 4R1TA 3WWYA 3G17A 4GMGA 1Q2XA 5TQVA 4BGUA 3F1LA 1GYPA 2O3QA 5CPBA 1Y8QB 1LA2A 4CLRA 4F6CA 1EVYA 1U7HA 3QJ5A 4IDBA 3MTJA 1U3WA 1LDMA 4JJFA 3VKUA 1P44A 3I9OA 4LMRA 4WKGA 2PK3A 3ZV5A 4OAQA 3HDYA 3ZHBA 5H82A 4FJ1A 1Q0HA 3GG9A 1O8CA 4IXWA 2Q2QA 4OSOA 1DFGA 1UXIA 5L9AA 1ISGA 1UP6A 1ZK0A 1GEEA 1NR1A 4WLNA 3VKVA 4J0EA 1DIAA 1U4SA 1E0DA 3WLFA 4D7AA 4DL9A 4U5QA 2Q2VA 3TFQA 1YH3A 4FFNA 4RF2A 4TVBA 4U8GA 4QX6A 3H5RA 3TZQA 3WIEA 4ID9A 3ZV3A 3U0BA 1RYEA 2NU7A 1VJ1A 3NGLA 3ZWMA 1W4ZA 1C0LA 4FGSA 4H15A 4AJLA 3RKUA 1KYQA 4IGEA 3PJDA 4CV2A 3PHJA 1XU9A 2J3KA 1KERA 2P9GA 4UAGA 1F06A 3FNGA 5BSFA 1KVSA 2FPPA 3FI9A 2I6TA 1YRLA 2Y99A 1T2DA 4MVJM 2PKRA 4NJOA 4XRRA 5GMOA 5TJ9A 4Q3BA 2D2IA 5ENVA 1YL7A 2VN8A 3INGA 2Q4EA 1HWYA 1EVIA 2OZPA 2ZB7A 3ADPA 4CLOB 4EUEA 1Q0QA 3CKYA 3K6JA 3DHNA 2I5PO 4J9UE 4GWGA 3IKTA 5BSGA 1SPXA 7ADHA 1PIWA 4U7WA 4L4SA 1NHGA 1XDWA 5I9NA 3OHSX 4DBVO 5TNXA 1Y81A 5FFFA 2AQIA 2JCXA 4RLSA 2PZLA 3KSDO 1E7YA 3A14A 4U6QA 3DMYA 3ON5A 3WGOA 2DBQA 3JQGA 4Q3EA 5ICMA 1T1RA 3JQBC 1GEGA 2X9GA 1HT0A 4J7CA 1NWHA 2Q1SA 3RAJA 1LSSA 3I6IA 2D1YA 1FDWA 3PGJA 5GY7A 3LF1A 1K6JA 3D0OA 1QRRA 1R16A 5KIAA 2PD4A 4ILKA 2G17A 3EAGA 4BNWA 2Y68A 3D1LA 4E5PA 1ZXLA 2AW5A 3ZHZA 2YUTA 4XJTA 1C14A 1SOVA 2Y0EA 4HX5A 1DC3A 2CF5A 2NU9A 3OEWA 3NYWA 2B5VA 2WYVA 4FJ0A 4PG4A 2I67A 2O7QA 4RVUA 1BGVA 2DUWA 1EK5A 3E9NA 3NJ4A 5JMPA 3LF2A 4B4OA 4ROSA 3HZZA 1XCBA 3PLNA 4OGWA 4YTEA 5JY6A 3BTVA 4TVOA 1EMDA 3V1UA 1R0SA 3STHA 4FC6A 3HFSA 5KJEA 4QUKA 3NAQA 3L6OO 4U0KA 1HZJA 5T57A 1GUZA 3AFMA 2I3AA 3QVOA 3DMTC 4OSPA 3S2EA 5TIIA 2PY6A 3WNVA 3KV3O 5IZ4A 5T67A 5KVCA 2VT3A 2SCUA 1S7CA 2VWQA 3GHHA 3JQ8A 4B79A 2X1HA 1YB5A 3KUXA 5JS6A 1V3TA 4M55A 4NBTA 4YRBA 1EDZA 2V6GA 1P1KA 4IJVA 4DPMA 2VCYA 5JPIA 4E2ZA 1KVTA 4YACA 3MZ0A 4NBVA 2JKVA 3E9QA 5TX7A 5GZ3A 2Y05A 2DUUA 2XAAA 1LC0A 4FIZA 3ZNNA 3FWZA 4FD3A 1JAXA 2PGLA 1YOVA 3BYZA 3DO5A 3NTQA 3KEQA 1KIFA 4EUHA 1Y6JA 1MUUA 2DTXA 2IZZA 3PDUA 3L07A 1X7HA 1E7SA 2B4TO 3A4VA 5THQA 4DIBA 1Z82A 3WGTA 2Q49A 3JYQA 3H3FA 4JGBA 1RPNA 1IUKA 4YB8A 4MVJP 2P9EA 4OMUA 3M1LA 5T6BA 2XXJA 4RLHA 3KYCA 4IMRA 5A04A 3IIEA 3GK3A 3OSUA 1NYTA 5IFLA 3PPIA 3LC1O 4E13A 2EKLA 2GLXA 3BZUA 4FFLA 4IDFA 4P22A 1E5LA 1TXGA 2PD3A 2J3JA 4LCEA 2BFOA 4W4TA 1LSOA 4M49A 4F46A 1XQ6A 1ZZEA 4HFRA 3TZ6A 4B7XA 3GGGA 2BI7A 3U4CA 3K2EA 5KVSA 1Q7GA 2A4KA 3I3OA 3JQ9C 4X54A 3T4XA 2JHGA 3C1OA 4Y6PA 1GFSA 1BVRA 3ORFA 3F4LA 5K1SA 1N92A 3F46A 4DLAA 4P4GA 1BDMA 3JQBA 4WNIA 3VH3A 1QV7A 3GOHA 2FZEA 3A06A 4BNMA 4AJEA 1E77A 4YJHB 2OBYA 4RPGA 4MKXA 2FHSA 1ADGA 1YL5A 3EGOA 3QSGA 2HJSA 3KLMX 4LISA 4M54A 4M1QA 3RSHA 2Q1TA 3QLJA 4TWRA 1ZVMA 4XCVA 3JD0A 3VOSA 4EEXA 2CZCA 3H2ZA 3FCOA 4FFRA 4DPKA 4XYMA 3PZBA 3IAHA 5F5LA 4XRGA 3DTTA 5DOVA 4PG7A 3V1YA 5GZ6A 2Q3EA 3CSDA 1WXDA 5TT0A 3PWZA 3LVFO 3SX2A 1PS0A 4DREA 3JSAA 2UAGA 1HE2A 2P4HX 2YV1A 1MP0A 4BV9A 4KTVE 4WLUA 2FSVA 5ES3A 5JYDA 2ZTLA 3EY4A 1DAPA 3GPIA 2NU8A 2QW8A 4HFJA 5C3MA 3PTZA 4CM9A 1P1HA 2OXIA 3GR6A 1L7DA 4KQXA 2ZYGA 1CRWG 1PJTA 3K92A 4OKNA 4AFNA 1IE3A 2ZJ1A 3ROMA 1KVUA 3DC2A 2ZCVA 4CJXA 4BKQA 1PJCA 4DVJA 4PG5A 4R5MA 3FD8A 1WP4A 4RVSA 4OM8A 3TOZA 5TLSA 4E21A 3L9WA 2Q50A 2ET6A 1UDCA 4Z0HO 3PGXA 3KRTA 1O95A 4NK5A 3MJVA 4Z6KA 3UGKA 4P4NA 4Z3KA
chains in the Genus database with same CATH superfamily
2NVUB 3OPVA 3HADA 2G0AA 1DJOA 2G1AA 3HDJA 3O94A 1HE1C 2C2HA 4ZVSA 4KQ9A 1VB3A 2D5IA 2PKCA 1E8DA 3HJRA 1OU4A 3HHPA 5DWQA 3VX3A 1U1EA 3HP1A 1JB1A 4XKJA 1CNFA 3M6VA 4FZVA 3H5NA 4R8RA 2FPKA 1NXXA 2O2JA 4GR5A 1R4MB 1Q17A 2VWPA 2WKSA 4PBSA 4C01A 4XEHA 5AKIA 4DEYA 1MZPA 4J0HA 1IN6A 1SUBA 5KX5B 1BGXT 2FE1A 1EFDN 4INPA 2WINI 3RYCB 2CSUA 3PQDA 1H8EA 5IH3A 4EQZA 4MPPA 5BXYA 1V8DA 4NQZA 2ZYHA 3L1JA 4HUQB 2IGTA 3KLPX 3ROEA 5K6RA 3AJEA 1D1SA 4YFYA 3U81A 5C8YF 1K63A 4MCJA 1YFZA 4XWGA 3OQIB 2WEKA 3HN7A 4CW7A 3OCZA 3CO0S 4URUR 2HJHA 3ROQA 1ZCJA 3RFTA 3TD2A 1XVTA 3V6MA 1SHTX 3I5YA 4AZ3A 2X0RA 4QRDA 3WZLA 4EJFA 2KJQA 1XC7A 3DKKA 2Y1CA 4ZAGA 2FPGA 5G2OA 1YZGA 2HLHA 3NHFA 4J29A 2CV0A 4U6SA 3QBEA 1V16A 1TK2A 2ZBDA 2O7NA 4Q05A 4TSRA 4HVLA 5B64A 3T8YA 2HPZA 2Y67A 3TMKA 1XAGA 3UXYA 1JT9A 1V4NA 5DSZA 1VL2A 4F2PA 2GBFA 2IPLA 3JQCA 4WNAB 1ETUA 2QRUA 1LDGA 1P0FA 3C87A 3F3KA 2PLAA 3K16A 1B0AA 1IXSB 1ITZA 3NJRA 1TGYA 2F3UA 1SPBS 4G26A 1M3SA 5DK4A 2W2LA 4DG8A 3BMQB 3PVSA 4AO7A 1GZSA 5IUJC 4ZALA 4FOPA 1YR3A 3ESYA 3RU3A 3WGUA 4FDUA 4PSCA 4X1YA 4RKWA 5KNBD 4PS0A 2OG2A 3ZU4A 3I8XA 1BFDA 1W581 2EFEB 2RI6A 3ACDA 4K26A 3GFSA 4M8LA 4OK6A 3WOHA 1O94A 4EHAA 2ZTVA 3E48A 1SXJC 3QEJA 4JOQA 1RD4A 3EJ6A 3RUCA 3VU9A 1IQPA 2NXJA 5AH0A 3UHFA 4BVKA 3HYLA 5B3KA 5C7IO 1QGED 2EQAA 3ASVA 3KVRA 1ZJ5A 4RUKA 3DFZA 1DQRA 1R6XA 1Y4SA 2B0JA 2WM3A 3BRQA 4GG1A 1S3GA 1R8SA 2IYRA 1ML4A 2IVFA 2A7QA 2BTOA 4G81A 2ZAIA 3QVJA 2WUEA 4ZJPA 3EIHA 2P9JA 1R50A 1B1AA 1TIPA 3JALB 4G86A 2WTNA 3S0JA 4LI3X 3MGCA 2E9SA 4GXQA 3I5UA 3OZFA 1JHXA 1DRWA 1MX1A 1X7DA 3UGJA 4QM6A 1MAVA 2PKXA 4DDTA 2E4YA 4A2PA 3S81A 2FEXA 4MLDA 1FDVA 1JBQA 1QG0A 3DZHA 1KJWA 1XZKA 3N8NA 4L4XA 4EY4A 5IN4A 4LE0A 4U2CA 2XQGA 3KQMA 4LV6A 4O4HB 1J2JA 2XMQA 1RMQA 2XXAA 3JQ6A 4RGVA 3S2YA 3DR3A 4J4HA 5ECGC 4EUNA 3EISA 4QO7A 4ZFNA 4Y2HA 2E1RA 3U49A 2YRWA 3FDZB 5KWEA 4KFRA 1T25A 1UR5A 2H2IA 4XM2A 1ZK2A 2QG4A 4O02B 4R1UA 5IC5A 4EB8A 1L3IA 3R9XA 3T1QA 4DJ5X 2OM2A 4XQ9A 4KE7A 1WXXA 2Z3ZA 4FZRA 1MGOA 1MR3F 2PAFA 3KELA 4KSYA 3M81A 1TEVA 2QYTA 3MQFA 3TD9A 1QFMA 3DZFA 3O31A 4ZOLA 4G5GA 3WA7A 1X8XA 2Y0DA 2WWTA 5JDIA 3VOTA 5BYBA 3IPRA 4GKBA 1NJGA 2JIOA 3LSYA 1XL1A 4FGWA 4XX0B 3LKDA 3Q8LA 3ILXA 4DJEC 1JDUA 1Y9EA 3O1IC 1MRSA 1L7VC 4CCYB 4EFKA 4YRZA 5KVQA 3HM9A 1EAMA 2X3YA 3BF8A 2GN1A 1J56A 1XD2A 4J16C 2WJWA 4NWIA 3FG9A 3E15A 3ZHQA 1CUEA 3I2GA 4DV3B 1SD5A 1P7CA 3O8QB 2G9QA 4HAUA 3HVIA 2CL6X 4OHFA 5F3RA 3CUYA 2Q07A 2WM2A 3NP7A 3PCXA 2BE9A 1MQ8B 2CHFA 2I8CA 2UZ1A 1L5ZA 3JR3A 1GG8A 1YDHA 3O91A 4UATA 4MWOA 1JE1A 4RXTA 4Z1MA 5AW1A 5FWXB 1S9DA 2IUSA 5AESA 1RQNA 3EPJA 4KE8A 1I33A 4OYRA 3AHDA 3VR2A 4G0MA 4TRRA 5EIBC 2YWFA 3UGQA 1ID1A 4WY5A 3WRVA 2MSWA 1MG0A 2O2CA 4ZT3A 5IKMA 2UYHA 5HS6A 2R65A 3VQTA 1G5TA 1KJ9A 2PUWA 4EZBA 3OLCX 1B8OA 2VAVA 3TFOA 2EBUA 1TRHA 1XQWA 2AKYA 4J9VA 4KPUB 4WKBA 5T8KA 3TOXA 2IX3A 2HRRA 1L4KA 3ZX5A 3Q7PA 2A92A 3IE0A 1KEWA 4OYLA 5I8WA 4OXKA 2A5LA 3H4VA 5JATA 3YASA 4TLBA 4N5MA 3LZ6A 2R47A 3H87A 2IITA 4FLMA 4Q4AB 4DGQA 1MG5A 3ONNA 3EVBA 1VFPA 3SZLA 3M9WA 2GNOA 3KBOA 2ZB8A 3NFRA 4D9NA 3CRZA 3B9QA 1ZR4A 3UBMA 3IFSA 2C9YA 4JFAA 4JP3A 4LDZA 2HK8A 2ONYA 1C7ZA 2G6BA 2WAYA 5DEOA 4BZZA 4LZOA 4URXR 3UN1A 1TT7A 3AKEA 3L1VA 2VK4A 3DLTA 3TK1A 3DDHA 4RPLA 1X38A 4YP5A 5JD5A 4AJOA 1OVGA 1YQDA 2FN4A 2JFUA 4NCJA 1R8QA 5IAGA 5LDGA 4AD8A 5LNK1 2ORVA 1JDBC 3H1BA 3WRYA 3CNOA 1ULTA 3MJTA 2A1UB 2CV1A 4DSAA 1E66A 1DO8A 1EGHA 1FP4A 1ZIXA 2AA3A 2Q3FA 5CB4F 1ZWLA 4RHXA 4AUNA 5BW5A 1C8LA 1PJAA 1CG6A 4CF4A 1E3WB 3L4SO 1I4WA 1E8NA 4UU8A 5B1HA 1MA3A 3EZNA 1V3QE 3NBAA 1E2BA 2OLEA 4INZA 4G24A 3E4CA 4IXNA 4WJLA 5K0JA 1AHPA 5HWSA 4IINA 3QWAA 2R8YA 3QOWA 4ZKEA 4BASA 2QX7A 2ZQZA 4IPTA 5I9IA 5B30A 2R84A 1Z29A 2GK6A 2HX1A 1G8FA 1P9WA 2ZYWX 3IJ5A 3ZHVA 4ZI7F 4WKOA 1EWYA 3KWMA 2O7RA 3R9WA 5L7YA 2GHQA 2FZKA 3RSZA 2VZ0A 5C80A 3CUWA 1NC3A 1JA9A 1OQAA 3W78A 4LY3A 4MKIA 3Q1KA 3HWWA 3L6UA 4Q4CA 4LBVA 1XIVA 2WMNB 3KB6A 1LI7A 4W7IA 4WD3A 4E03A 4YT2A 4WY2A 2B1RA 2C9OA 4X65B 1L5VA 4F96A 4NULA 3W4JA 1EFVB 4P32A 4MJLA 4G63A 1N6RA 2ODAA 2NPFA 4PLWA 1YB6A 4BO4A 2HEGA 2QXUA 1SH7A 3LZCA 4TSKA 1YZ3A 4MR9A 1OJ7A 3KZXA 3SBOA 1NJ8A 1HEUA 4DC1A 1KMMA 3DFIA 4E33A 3Q3IA 2VF2A 1FLDA 2VDWB 1UWCA 1Y7HA 3AHIA 1WSWA 3GJQA 4BWYA 4XM1A 4LSZA 2CB0A 1UKBA 4R01A 3GBSA 5BRJA 2XH8A 1FP1D 2AEJA 3EQ7A 1NN5A 1LGYA 1VC2A 1A4RA 3DOJA 3S1AB 3ORYA 4L50A 2UYQA 2VYVA 4YREA 2LDXA 4DMMA 2AWOA 4UDYX 2NZWA 4O2LA 3E5HA 1GSOA 4B5LA 1DJLA 2G40A 2IQ5A 4O1MA 1Y33E 3G0GA 2WQ7A 3ADBA 1RFLA 2PV0A 4DJTA 2W6NA 4XGQA 1JJIA 4LHXA 4Z4QA 3JRNA 2FN7A 4KRYA 3LY9A 1LRJA 3NG1A 5MF6A 2F43B 4U7DA 1FZTA 5FOXA 2IU0A 4QFBA 4XGKA 1P6QA 2IDJA 3H2JA 3Q72A 1M2VB 4G9BA 4MDHA 3RWOA 2C83A 4D2IA 1QK5A 5M5BA 2JFFA 3CRNA 3ZE7A 7YASA 5JZSA 2XOEA 1SWWA 3UHAA 3P9CA 3RFCA 1G98A 2IEIA 2X5NA 2PM8A 2PGAA 3LJKA 4Q7LA 5JYEA 3P2YA 3PFIA 3H1GA 4HD8A 5F7JA 4KWEA 1XTRA 1KSFX 4IVPA 1C50A 3D9QX 3WB1A 3NORA 2NUAA 3QSYA 2P5SA 3SF8B 1UBEA 4U39A 1XHEA 1U0FA 3L6CA 3ND6A 3IIKA 2PH7A 3ZR4B 3TRFA 3K70B 3R7NA 4H6XA 1Q50A 2PKYX 2VHUA 3EIEA 4A5OA 4TXHA 2HHCA 4L02A 5AKZA 3DV0A 4L6CA 3I92A 1GKYA 2X76A 2WYOA 1F2TB 3PJRA 3UUGA 1HNWB 4GPTA 4PRLA 2PAAA 1YJ5A 2A0FA 4PYKA 4TV8F 1E0KA 3OO0A 1E9RA 2ZRGA 3RSLA 1C1DA 2X77A 3G0BA 4COKA 3O1LA 3ROXA 1AF4A 2HC9A 2DFDA 4LX8A 3DVQX 2IEBA 1JHPA 4WXMA 3GLQA 1XCJA 2XQJA 2ZW9A 3GT4A 3EOAI 3FTQA 1F12A 4H3HB 4QTUB 3ELBA 4O5AA 4BO5A 3KS9A 4J3FA 1ZKDA 2ZAGA 3TUIC 3MCAA 1PVVA 2C5EA 2Z5VA 3QFTA 3LCRA 3SCZA 4F2GA 1Z5ZA 3QBJA 4C3VA 4DAOA 3JRXA 2CYCA 3PJGA 4XEUA 2J7PD 5EJMA 1KMHA 3RS0A 3RAEC 1RZ3A 2JDID 5F77A 3I73A 3RYFA 1BXKA 1UWLA 2RHTA 4K28A 2FR8A 4F4CA 3OOWA 1C8BA 1DLJA 2GCGA 1KAGA 1N9GA 4EQ6A 4EHNA 1SVIA 2E55A 2CDCA 2FWMX 2JLQA 3BRWD 3R8CA 3NHKA 3EYWA 4S1OA 1AK9A 2O54A 5CB0A 1L5LA 1B8PA 1GGKA 4MA0A 4P6VF 3C5CA 4ERNA 4DSZA 3FNHA 1VB5A 2CUTA 3FB4A 4HRXA 2X7JA 4DMHA 1ODJA 5G0VA 4DF3A 2AXNA 2H08A 5EMMA 5CDGA 4IY1A 3K70D 3Q3CA 1E2IA 2G28A 4GNKA 4DA7A 4FHGA 1QDUA 4C5BA 3IL2A 2QEQA 1CDOA 3DBVO 4O2AB 4TTVA 4AJKA 5KOYA 4ZPJA 3IDAA 5CUQA 3FLBA 2BSAA 1F5SA 1LK7A 3FFBA 2D0IA 2HRDA 2NTYC 5KTRA 3AUAA 2QZ4A 3O1HB 4RTMA 5K0CA 4M8NE 3HC7A 3D81A 4FDAA 3ZQ4A 1PV2A 2HPVA 3ZI4A 3ZWCA 1H8HD 3SY8A 1QYIA 5CNJA 4TL8A 2QYHA 2HGSA 5EJFA 2JCSA 3RSCA 2I2WA 1RKUA 4CUZA 2C07A 4FYHA 1CEQA 3WWPA 1VL0A 5ALMA 4O08A 2FE4A 3C3CA 4YK7A 5LD2B 3EBOA 2CMHA 1J0XO 1JSXA 1BHO1 2PO5A 3L0BA 1JZQA 5IDVA 5A2QA 2YVQA 4TS1A 4ZYWA 2HKIA 3CHYA 2JGRA 4KXUA 2EZTA 3T3GA 4HVTA 1U7TA 1Z7BA 1X13A 1D0VA 4RVHA 1Z62A 3DFMA 4R68A 4KQIA 5DM60 4Z7NB 1CJTC 4IIFA 4IIBA 1FFSA 2AC7A 1RQPA 3DVRX 1FTQA 3UJNA 3R0JA 3VGJA 1M2JA 2JD2A 5CX4A 4A4DA 1NFFA 2O1EA 1A8HA 3PS9A 1YONA 5SV2A 7AT1A 4M3NA 5DH9A 3IR7A 3B9PA 3D0RA 1VLQA 3HBLA 3FPLA 5AUQA 4DNPA 4HH0A 3KTFA 3G68A 1KSJA 3EDMA 4LQCA 5LP1A 3UT5B 1D2MA 5HW0A 2H16A 4O8CA 4I4TF 4KITB 3OLWA 3IELA 4LC0A 2B78A 4US0R 2BC9A 2AXQA 1R0XA 1P5FA 1V1MA 1XU4A 1TM1E 3DL2A 3JWHA 5COBA 3RYHA 4C1BA 3I2IA 3E3OA 1MQAA 3MA0A 2SKCA 3I6QA 2WIAA 3BUSA 3MS2A 2GHRA 2PMBA 4Q82A 5JAIA 1NN1A 5I5GA 3ZYZA 2X0FA 3WWZA 2EKBA 3KPWA 4TQGA 3AI2A 4UM5A 4UHKA 2V0NA 10MHA 4CEJA 1HQCA 3U09A 2E4VA 4XPIB 1RPAA 1AKNA 2ZBVA 4BRSA 1XKQA 4Q4JA 1NW3A 1OGYA 4FHFA 5EWLB 3P4XA 1OKKA 3O3NB 2WUWE 4UM9B 3AWIA 1NMSA 3OCCA 3ZIUA 1NJ6A 1L4HA 4BTEA 3QXCA 1D4FA 4XZ3A 1TYEB 2PQ2A 2ZDGA 3PX7A 1N6IA 1NV9A 2ZVPX 3AW9A 4CR8A 2DEUA 4NCHA 2CHUA 1L5QA 4TRMA 1V47A 2R6ZA 1VHQA 1A82A 4EHFA 3UJ9A 3GUVA 1SB9A 2YDYA 4ZT4A 3VKWA 5HJ7A 1EDDA 2IL1A 2QROA 3EDQA 4EAQA 5BYJA 1D5WA 1NRWA 3P8ZA 2FK7A 4BFZA 5L3SA 4ECAA 4P4SA 1L5RA 1GDDA 2GPBA 3C0KA 4V2IA 1NUHA 3D7RA 2FSVC 1YTUA 1C3JA 3N7UA 4TQAA 1B0ZA 2A88A 3QVSA 5CIQA 4HBZA 4RK5A 4CIYA 3ZN2A 2V1UA 2QN7A 3DHVA 4KO3S 4GU5A 3ECAA 1XTPA 1OJLA 2XLCA 1X19A 3C74A 1V1JA 3G2LA 5G4LA 1WD5A 2RHMA 4D9GA 5KQMA 5NULA 1SCUA 2AG5A 3Q4GA 4JLDA 5TQ0A 3OPXA 3PQFA 1UPCA 1R64A 3OZAA 5D6OA 1PUIA 5ARBA 2XT6A 3ZDYB 1JLRA 3DOUA 4HGRA 5A4DA 1WLYA 1RJFA 3Q2OA 2JJ2D 2I03A 2OOKA 3BXEA 5CLIA 4PG8A 1Y3CE 5BNWA 2V3CC 2ZRMA 4RS3A 3KEFA 1A4UA 4HTFB 5EJ4A 2JLRA 1ISFA 4HADA 3HG7A 3NC4A 4UE3S 5BMOA 3QI7A 1Y4DE 2LKDA 4H7EA 4UM9D 3LLUA 1R4ZA 2E6KA 2RG1A 4RTRA 3JQ7B 2M1ZA 2X0EA 2X23A 4NBRA 1WF3A 3N2GB 1SURA 4N03A 4OUKX 3P9PA 1YAHA 3TB4A 1W76A 1DIHA 3UB2A 3QMWA 1U63A 4KRGA 3FR8A 5IHPA 1RC0A 4U5XA 3V80A 3BMCB 3UICA 4PNHA 4ZO6A 1Y8QA 1NR7A 2D2FA 4WX2B 5G0TA 3M1IA 3ZVLA 3A9UA 1G42A 2I7VA 2XCIA 1C1YA 3RBAA 3H8VA 3SF0A 4KQFA 4L07A 4B4DA 3OP1A 4LMAA 3N5KA 4JITA 1FMJA 3W6PA 1BN7A 2UYGA 3FHCB 2G1UA 2GF2A 2OAQ1 3O8DA 4BVBA 4P2GA 4ER6A 5CXQA 4EGSA 4NLLA 3QNMA 3KPUA 3CKKA 3UCXA 3WYAA 2WZQA 3VV2A 4BX2A 1U0EA 5DLYA 3GXBA 2GD1O 4DXHA 4UDNA 1JZSA 2WW8A 1WMAA 4BP3A 3KJQA 1ZR2A 5EINA 3QPWA 3B38A 2FH5B 3DE2X 3LUBA 4IR7A 4QOEA 5ELXA 3EXHA 1NXTA 3LFUA 5B3JA 4I6JA 5DO9A 3PXGA 3KDSE 1J2YA 1MW9X 1CCWA 3W7AA 3GLHA 2PJZA 4N0DA 3VH2A 4OH7A 1CR1A 2W4IA 3FVQA 3MRVA 3PHGA 3UMSA 2PZEA 2GPAA 3ICPA 1IULA 1RACA 3REOA 3WGVA 1KQFA 3HKEB 3DFFA 2G07A 3KDPA 4FR2A 1RXVA 3V3TA 4TMVA 3KV1A 4NBLA 4Q7KA 2WJGA 3U4AA 2YMLA 1YNSA 5DYWA 1Z68A 3ADCA 1RWBA 4GT1A 4YY3B 3ABOB 1UMDA 1CJCA 3AOEC 3LYUA 4C7VA 3ZY2A 2FYTA 2H1FA 3CLUD 4YT5A 4MWTA 3SDSA 5DMXA 1T5OA 1YZUA 3L6DA 3QK7A 4ICIA 5TQ2B 4G9GA 3WIUA 5AKKA 2Q2WA 4BLSA 2ORYA 3DBHB 4CLOA 1CVLA 2XWQA 3IHTA 5D3ZA 4X62B 1ZIOA 3RYTC 1CRLA 1Y48E 2XQFA 1ABEA 4MDYA 3DDCA 2Q5JA 5JNVA 2HA6A 4OG2A 4DFDA 3O4JA 2VUHB 4B6EA 4JKOA 5DX1A 3GLIA 4KG7A 3TTYA 1TJ5A 1VBMA 4KX3A 2GEBA 4HEJA 4V03A 4ZGWA 1NVGA 4HS4A 3H5VA 1N8NA 5DHTA 1QMGA 1UBMS 2PIAA 5AI4A 3VKFA 1KJZA 1XRJA 3BJIC 1Z0KA 3GZ4A 5U9CA 4YO8A 3K9NA 4H7FA 4X90A 5C5DA 2VDRB 3NHLA 1WW8A 4TRJA 1A8UA 3SQWA 1TU3A 2P6UA 3SJUA 2WWRA 1PT7A 3O90A 3TLJA 4BGDA 1G20B 2QUAA 4L3VA 1JDVA 1PEDA 2PKWA 2Y2VA 3ANTA 3UHOA 2XKBA 5KINB 2ID4A 3L92A 3QF4A 3TM4A 3L79A 1JWAB 3AXSA 2Z1MA 2Z0MA 5L53A 4DSNA 3UFXA 1YVPA 4ZANA 2Y4OA 5BMVB 3Q5GA 3ZDAA 1OAKA 3PUHA 5J59A 3WK6A 2MSKA 1N6OA 2FW7A 3ZXYA 5CDFA 2WKQA 4JJ8A 4QOJA 3UCEA 2O9JA 4CKXA 3N6RA 5HSGA 5JBNA 4CDNA 3NVMB 3QLVA 2YIVX 1CVIA 4D0SA 2F59A 3A2NA 4XYBA 3CVXA 3SZMA 3RLIA 5IULC 1YS1X 4F71A 2P11A 2DSNA 2GHIA 2NZYA 2VTDA 2JFGA 4J7XA 4CKEB 4FMBB 2INGX 2A1TR 1CUSA 2JRCA 2QR3A 4FWBA 5KAMA 1RC8A 4B2IA 5HKAA 1P3JA 5GIOE 1MXHA 5IDXA 2B25A 4PPYA 1JEQB 1HLDA 3CVJA 3SAJA 4P53A 4NSNA 5KMGA 3HK2A 1G6KA 3PDCA 4UMEA 1M9NA 4XSHA 3W34A 5IF3A 4RE6A 5KBYA 2X9LA 3CLTC 3EW9A 1T5IA 3CH6A 2ONKA 1ST3A 3ZIAD 5EQJB 1AKEA 3E05A 2JRLA 3BGIA 1QH1B 2XUJA 1BAPA 1VE7A 3L1KA 4HH1A 4BV2A 1Q1BA 2JFXA 2H17A 3S29A 3ETGA 4XWOA 1OB2A 1PFGA 5JBQA 1BDIA 4DQKA 3UATA 4EMTA 2Q5EA 1E8MA 1IY0A 4B3GA 2BMAA 5CFZA 3BWVA 2C96A 1XJCA 4HFMA 1NQXA 2DKFA 4XPZA 4Y6QA 2QOEA 3MG9A 5FWYB 3SC4A 4CKWB 4EHLA 1FDTA 4G25A 4AN4A 2MINA 3LC7O 2HIMA 3IVMA 2AB0A 2VKTA 4OHCA 1VOTA 3WXBA 3KETA 3QX7A 1VI5A 4CRWB 3FBTA 3ZUGA 3ONVA 1JB9A 3NDPA 4RZUA 3USCS 3VR6H 6REQA 1J33A 2LBPA 3CZ5A 1JKJB 1OA0A 3TSWA 3I23A 3Q98A 1OX5A 2QT0A 3WQBA 4LFAB 5HF8A 2GNAA 4JYZA 4Y2SA 4F0JA 2EARA 3UYKA 4MULA 1LU9A 1TDJA 3WJ2A 1S4MA 2UUCB 3A9TA 1YULA 3NIBA 5H3HA 1K2WA 3V4VB 4J1QA 3TKLA 4FYJA 4PFJA 2RGNA 3I28A 2Q5QA 3MW8A 4IF6A 1D2EA 1IHDA 4U02A 5DKFA 5LQSA 3REQA 5HPYB 5DNWA 4CBVA 5CFQA 2A14A 2WIDA 3WOVA 1KF0A 4CLDA 1Z0JA 5EJ9A 4IEIA 2Z04A 3NTRA 2Y71A 5FYQA 4Z7OB 3GZNB 1TKRA 3GVPA 5KYGA 5JH7B 3FROA 2VIIA 2C84A 1QKKA 2XB8A 2YXPX 2HLDD 2XDWA 4WOKA 2P8JA 2BWJA 1FFYA 2P2SA 5IRCD 4GZ6A 3GT7A 3U0VA 3SJ7A 1AU9A 2IYAA 4KH1A 3D6AA 1VCHA 4A6EA 1MEOA 1X1DA 2HSGA 3Q3HA 4YJHA 2GCNA 2O59A 1NU8A 4IHJB 2VPIA 3KOUA 3SHTA 1XDZA 3GIWA 5EIEA 4HAZA 1BQEA 4P84A 3CX8A 1T8YA 2ZUBA 3KL4A 4Q9IA 3AUFA 2VBGA 1H2EA 3NBUA 4UVDA 2WF9A 1JL3A 3AIIA 5HIAA 5KJCA 2QL6A 1YBAA 1TT5B 2C00A 2A8YA 5K3CA 1KEZA 5I8PA 1RI2A 1XT6A 5CITA 1PS9A 1E2DA 3IUEA 3MTIA 3NV9A 3UOAB 5AW6A 1E3DA 4E5MA 2CD7A 2YW9A 3IYLW 5K6TA 1KPGA 3C5VA 4D79A 4UZEA 1RNLA 3BSFA 1GTZA 4DMCA 4EFNA 1N3BA 4JL5A 1E6KA 1TTQB 1SU7A 4DS3A 4UFPA 1N5IA 4S3MA 1VGQA 1WHTA 2WMDA 4L74A 2GCOA 3OICA 4EY5A 5TB5A 5BN3B 1N34B 2ISSD 1HM5A 2L2QA 3Q6IA 1SC6A 3UKOA 1VIAA 3A1WA 1T5SA 3EA5A 2QKYA 4F91B 4NU8X 4XYLA 1Z83A 4HB2A 1DBSA 1AKRA 3WL7A 2GETA 3OURA 5K6AA 5FNVF 1K27A 1Z0ZA 1H4VB 2ODTX 2DX7A 1FLAA 3A4TA 4LI0A 3S3TA 2GESA 1JDZA 1L6RA 4JNCA 4M88A 4ND8B 1K8ZB 4UBIA 3IKVA 3GLHE 3MSXA 4XOIA 4A8HA 3ECSA 3SXUB 4JI1B 1L7QA 1RBQA 2PGJA 3VBCA 3VR4A 1L4MA 3AZQA 3OECA 1UBTS 4PX2A 5E4FA 1NT4A 4AF8A 3NBYC 3ESZA 3UNXA 5A9RA 4N8DA 2V6MA 4HDNA 2XCSB 1WMFA 1E98A 2DH5A 3R3HA 4GOLD 2Q99A 3U31A 1NVEA 2IYEA 3KKEA 4DILA 2GN4A 1RWWA 1H0SA 1CEXA 2GN6A 3FBGA 3HI4A 3ZJYA 4YCSA 5CBPB 5KOHA 4O4LF 5EMHA 2I3GA 2D2XA 1LX7A 4M9XA 5G0UA 4LF6B 1DKRA 2W93A 4ZQFA 1DOAA 4RF5A 1UFRA 3LBIA 1ZD8A 5DHFA 1H1DA 5J5CA 4F5EA 3VSBA 2DBZA 1NVDA 2PDAA 2J0UA 3DB2A 4JBGA 4AYTA 3L04A 1AMNA 1SEPA 5IEBA 1XZQA 3PA8A 5A3QA 4FKMA 5KNCD 3VA7A 2DKNA 1M76A 2FPIA 2QBYA 1Z8NA 3HRKA 4FYIA 5B4UA 3RUIA 3DE4X 2C9CA 4DDWA 1IH8A 1ISMA 5E7JA 1E61A 4BV3A 2BUBA 1QGDA 4KBYA 1RWPA 4A27A 1NUSA 1ZWKA 2VT7A 4B48A 1PUXA 1CUHA 2IYNA 4D6YA 1K5GA 3HXMA 3C6BA 2B7LA 2W00A 3CCCA 3JD1A 4NEGA 3T99A 4F3KA 1B0PA 4L73A 4G8CA 5GTDA 1S2MA 3K8YA 4IUBS 1QRTA 2G9NA 3VR1A 1LRLA 3DD5A 3KJIA 5BSEA 1SCDA 3SOPA 1SUSA 1P2BA 1R8XA 2C2OA 2LXNA 3FPJA 4G2NA 4LSGA 3C1TA 2YHUA 4PZDA 4PTZA 4XARA 1U5CA 1GGFA 3GFPA 2FSGA 3JASB 3DMRA 1EXWA 1GJRA 3I01A 4LNUB 3BJRA 3VYTB 1FQWA 3SC3A 3RKSA 1P7PA 3E7FA 2RG7A 1O4WA 2FSUA 1DUSA 4X9XA 3FNFA 1IL0A 1ONOA 3INNA 5BQXA 3OD5A 3EY9A 3TNYA 3LYAA 3FNBA 4HRAA 3RIGA 1YIAA 3FWHA 1P74A 1U7XA 4K9PA 3KKKA 3ZE0B 2R8XA 4QICA 3PI6A 3C3JA 2R7NA 3P9XA 2CEKA 4Q1VA 1QP8A 4OJNA 1PZGA 2ZSUA 4MUAA 4AN0A 4GMXA 1ZH4A 1MO2A 3BHMA 4UJ5A 4V3BA 4DZRA 2QQ0A 2IFTA 3EZ2A 3H5WA 3EFEA 2E89A 4ZQBA 2CLOB 4FE4A 4JWTA 2JC3A 2G3YA 3A2LA 3RTEA 5B2FA 2BM9A 1Z6XA 3QIVA 1T9ZA 3RC1A 3TGWA 3H5LA 4EIWA 5SZJA 1PF7E 1P2VA 3CGGA 4Q1BA 4X92A 1GU0A 3FKQA 4GBGA 4AG6A 4C0BA 1V1RA 4ONEA 4KMRA 1JQJC 4X1KB 5K3AA 3IA2A 5DW0A 2QYSA 4KN5A 3URKA 4BFSA 2WA2A 5IDWA 5BW6B 2JCGA 3A9SA 1CB0A 2FPPB 2D5AA 5L3ZA 2ZRIA 1J00A 2WJ6A 3IIMA 5CU7A 1US8B 4KWCA 1PSWA 3EVCA 3C5WP 2G83A 2HUNA 1GPJA 3EVFA 3OF5A 5NLLA 4CTNA 1RYZA 2BFEA 2NGRA 1R6VA 3FAKA 1NULA 3L6EA 5EYPA 3WSVA 1GARA 3DT8A 2HMVA 2JLBA 1OXXK 2KS6A 2ETVA 4DA4A 1G60A 1D6JA 3FFAA 2F3RA 2X42A 3F6YA 4B0PA 4ZHQB 5HGXA 1EX7A 1USVA 3MK31 3QQPA 4FIDA 4K88A 3BSWA 2QM7A 4JEMA 4XD2A 3GMIA 1P7WA 5L3QA 1U2GC 1CJKC 2XNHA 3C1AA 4HMQA 3THWB 4DLRA 2JJYA 1VHLA 1GPWB 2P2GA 2BCEA 3OFND 3DLAA 2EL7A 3STUA 2CHVA 2IDMA 4CMAA 3ZS8A 1KE1A 2O2IA 4Y9UA 5JZBA 5LVAA 4TN1A 1E7WA 4UMDA 3THOA 3VC3A 3QBDA 2GQ0A 4CF6A 3AI1A 3ANLA 4BPRA 2IS2A 4RA6B 1WHSB 2D54A 2Y0CA 5FA6A 1CD5A 4PZ9A 3UJBA 3NXKA 3HXOA 3EXAA 2P6PA 4MGHA 3EMBA 4MS3A 4U2BA 2Q21A 1YQEA 4D0LB 3I9LA 4EB0A 1E4EA 5I45A 2YNMD 1MDFA 4FGUA 5AVYA 5E4JA 4TZKA 2ZB4A 2MR5A 3LDHA 5EUBA 3JAKA 3ID6C 3PI7A 1Y3HA 2O19A 1R0WA 3GDHA 3Q0EA 3S8YA 1AS3A 3BCUA 4Q7JB 3AEQB 2WV7A 5IVKA 3ZKAA 3GVXA 4LG1A 1KEUA 3WBBA 3HL0A 2RGWA 5K3DA 1Q83A 2IYSA 4BY9E 1FX0B 2VHZA 2OV2A 1RYNA 3AP1A 3MELA 4HYEA 2ZR0A 5KYWB 1JPNA 2QD3A 1JHRA 1PWEA 3VHXA 1DARA 1JV2B 1CR2A 1EE1A 3LQFA 1HXHA 2LWIA 4D9HA 3H5AA 2QRZA 3BWEA 1I7QB 3VU1A 4HDOB 4WCFC 2YN2A 3ZCTA 2YVLA 3CH7A 4R69A 4JJZA 4BX9A 5CFOA 1KH3A 2ZE6A 3BIWA 4FFWA 1Q16A 2A58A 4IDAA 1VLLA 2ACEA 4UVIA 3X2FA 1ISPA 4EEZA 5CIWA 1OZGA 4NJMA 3D7NA 1C7JA 2WMYA 1IPFA 1Q74A 2I1LA 1EVLA 1Z6QA 4C7OA 1P80A 4LK3A 4E1VA 4G1EB 4QPJC 5L4NA 1ULZA 4PLHA 1EINA 1BIFA 4U0JA 4LFBB 1MJNA 4ENWA 3GEHA 1AH2A 1L4BA 4UM8B 4JUAA 4PBTA 1XR3A 3KYBA 4TQUS 1XRPA 1BOOA 3ODGA 3HGMA 1XJ5A 3K7EA 1J4AA 2YL2A 3ZC3A 3VVBA 1DRUA 2DC1A 5KJ6A 5JAQA 4JVNA 4M37A 4MKHA 4UASA 4OHYA 2QUKA 2FRDA 4XAQA 5C53B 1QRUA 4F3NA 4HWPA 5KVAA 5KYKA 2VJDA 1DC5A 2H1RA 2VJAA 1N2EA 2RBEA 3R6WA 4JLOA 3TBKA 1KC3A 1TM4E 4ZP1A 5DYGA 4M1KA 1YVDA 2ZWOA 4U9UA 3WMEA 1M6VB 2JGFA 4RCVA 1GIAA 3A27A 5G02A 2OQVA 1N33B 4E5VA 1SK9A 4N49A 3TF5A 3LS2A 1JEEA 1DWPA 1HT2E 3C7CB 3H13A 2CHQA 2D1QA 5JAMA 3DE5X 1DXQA 2J0SA 5IZCA 1ADJA 4Y2VA 2ZIVB 3B6JA 3JQEA 2RB4A 2WU0A 1IXKA 3KO8A 1GPAA 4KCGA 5KHOC 1HO3A 5KTPA 2CLMB 3EXEA 1XZCA 4UD6A 2Z5LA 3FWPA 4ASUD 1BMTA 4RTPA 1FQKA 3I0NA 3KEOA 4CMGA 5HYVA 2GR9A 4MAMA 2FRXA 4KLZA 2QX9A 1R15A 3CO5A 1NPTO 1OBCA 3LI2A 2GBLA 4QWWA 1IUPA 1Y3FE 1FBNA 2R79A 3OFVA 2CDRA 3HNOA 1RWOA 3GUCA 3DP9A 3OTQA 3CEPB 1QXSA 2EIHA 2RI1A 3FYDA 3D3NA 1T9BA 4MQFB 1NUPA 1PQWA 1QCDA 1ZAKA 2H57A 3TZEA 3V4SA 1KJIA 3QEMA 4WZBB 4BQQA 2OCYC 5EIHA 2QR5A 3PLAE 2VRCA 2I2BA 3I2YX 3SSOA 2NUPB 3R3JA 4H3KB 1Q0PA 3PGA1 1QO7A 3KJZA 3RRXA 1QV9A 4EP1A 5TPWB 1ZLYA 2RGDA 1P1RA 3CZAA 1F3OA 2FWNA 4W9NA 1T24A 2VT2A 3F5MA 3GGPA 4YAKA 3Q88A 5JJKA 1WCXA 3KQWA 4PY2A 1HK7A 3OX2A 2ZVDA 4NZNA 1Q95A 4BNIA 4PHTA 1L4UA 4C87A 3WB2A 1I2BA 2A35A 1WXEA 3CPSA 4QREA 3DUFA 1KOJA 7GPBA 5KSOA 1GPMA 1GCUA 3R75A 1ANKA 3CJQA 5ALZA 2R6R1 4LW8A 4EG6A 4CG3A 5FO0A 5DGCA 3EIOA 1JSLA 2EWVA 1OUMA 2CLFB 4DNQA 4F97A 2H63A 4BQIA 3R9IA 3BIFA 4C08A 2QD4A 4L85A 2OV1A 2R7MA 4TTQA 2BHNA 1EX1A 3SMVA 2G5CA 2RH4A 3HVRA 2QSZA 1DUIA 2WJAA 2DPHA 4DXDA 2EERA 3BE8A 3DF7A 4A6DA 2B2XA 2X3FA 2ZJZA 3ZHYA 2NLOA 2REXB 2WNSA 4C4TA 2IBMA 1L6IA 2ANCA 4MQ6A 2O06A 4YP7A 4GMFA 1KI9A 3GJ4A 4ZCMA 2KLBA 3CRVA 5EWMA 1KOGA 5CT4A 5DX0A 3W5BA 4G0ZA 3D2LA 3G0OA 5IJZA 5E6UA 4YRGA 1ZSNA 2IHKA 3UAXA 3S44A 1YQ9A 4D3SA 4DM4A 1WB4A 3IBGA 1OAAA 2P5UA 5CK5A 4YH1A 4EDFA 2N42A 3FIJA 3GCGA 4MP8A 1T6NA 4XSGA 3CZRA 1JYFA 4PZUA 1NF9A 5D3QA 3GRUA 1RWMA 1T1JA 3PGLA 2PRKA 2C8KA 3VZPA 3Q9UA 1G8YA 1EQAA 1CF9A 1TUBB 1XEXA 3N74A 4M22A 1OX4B 3JAMA 1MZVA 3AB8A 3IGFA 4GR9A 4W1PA 3EE6A 4PAWA 5DLQC 3JARB 3I76A 3PENA 3WLSA 3ZU3A 1PEAA 1WUYA 3OIFA 4NNJA 1O97C 3DOOA 3QVTA 5IK2A 2QXTA 4G4SO 3HPQA 5I9MA 1QCZA 2IRWA 2X3UA 2XCRB 3ZXUB 1W5TA 1Z45A 1DEKA 4AY2A 4BB6A 1MOZA 4BVLA 1NW7A 1CUZA 2VAPA 3KKMA 3OUUA 1OH7A 4R3WA 3AYXB 1H93A 1NLYA 3DEYX 3KQNA 4MMYB 3RV4A 3QW2A 4KXVA 1CQJB 2J3EA 5FB3A 3FNIA 1OBVA 4E5NA 3R0VA 1SBNE 5KPDA 4ZT7A 1ZNWA 1CFJA 1N7JA 3LUJA 5TF0A 4MW2A 3U62A 3HWSA 3O8OA 3N2EA 3RKRA 2P6RA 4L4RA 1H65A 1Y1PA 4RL6A 4LWQA 3T1OA 4AX4A 5JY1A 2D00A 2EFCB 3LH5A 1ZGCA 1ZOPA 5BNZA 4EY8A 1WMEA 5AUNB 1GD1O 3BRSA 1ZRSA 4EB6A 2Z9BA 2X4IA 3TMAA 4AURA 5INTA 3WTBA 2E0IA 3OX3A 4GFDA 1YA4A 1O95D 4DLBA 4ANFA 1KOFA 4KE6A 2M6RA 4TV9F 3O7MA 1MAUA 3AF0A 5A03A 3A1SA 2WHQA 3ZZUA 1RRKA 2YV4A 2XCOA 2QJFA 3P2IA 3U9LA 4HSGA 1DOHA 4YCBA 4KMSA 1HETA 1OU0A 4ZU3A 3E4DA 3HP4A 1UWKA 3UG7A 3BMOB 2AW3A 1V11A 3T34A 2YN4A 1E2NA 1Z2NX 3CJRA 2QGZA 4DWVA 4QM7A 2DJIA 4ZCLA 2WNHA 3BXXA 2OKCA 3NM6B 1T5LA 2FWRA 3DTYA 2ZI9A 1DB3A 1QGUB 3PJEA 2GXSA 4B85A 3ZPXA 4R2XA 1Y98A 1FFWA 2R7LA 1W30A 3CXUA 2C1ZA 5AK5A 1IC6A 2WTEA 2RC6A 4HDSB 5DGIA 2EF1A 5IG2A 5TMEA 1FDOA 2QQEA 1CUFA 3A6JA 2WJVA 2WV9A 4IRUB 5ENZA 2BGUA 1XTJA 5IXYA 2GD2A 3ITKA 1KY3A 3VO8A 3K8OE 3KEMA 3OEHA 1SHUX 3CTMA 4XIJA 1NW9B 1TAQA 2X0JA 4D92A 3NUGA 3U7EB 1P9LA 2V8BA 2PS0A 5AKJA 1XAHA 4U2GA 4C0KA 1W4LA 1ZH8A 2RHCA 3QOFA 4F2DA 2ZB2A 2HK7A 1BGWA 1T34A 2NO9A 4PONA 3COJA 1QQ6A 4Q3CA 4B71A 3EQ2A 3INRA 2XWBF 2B36A 4PCLA 1MEEA 4MQFA 1CYDA 3UUFA 4B3HA 4UNPA 4DRXB 2BMFA 5B36A 4XUCA 5CR9A 2PQMA 3CPEA 2CHGA 5H4HA 4D4HA 3EJWA 3RAGA 2ERCA 3FOEC 4OQ4A 1MTOA 3ZCSA 4L9SA 2QTWB 1R18A 4K6CA 5KAPA 1G2IA 5A4AA 4Q93A 1NY6A 4TMKA 2OYRA 5BP7A 2ZRQA 2G82A 4LJSA 1U0HC 1YQGA 2P2CA 3CF4G 3M6MD 1MXFA 2A67A 4HNSA 3SNHA 2MCFA 3RHFA 4FB5A<