4UEKA

Galactitol-1-phosphate 5-dehydrogenase from e. coli with tris within the active site.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
346
structure length
346
Chain Sequence
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHEFSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEYIVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCAVALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVPQTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWETASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTITOL-1-PHOSPHATE 5-DEHYDROGENASE
publication title Enantioselective Oxidation of Galactitol 1-Phosphate by Galactitol-1-Phosphate 5-Dehydrogenase from Escherichia Coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 110
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 1.1.1.251: Galactitol-1-phosphate 5-dehydrogenase.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4uekA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4uekA01
5FI5A 3JD2A 1KVSA 1U3UA 3QWHA 3GGPA 1T24A 1HKUA 3JD1A 5A06A 2AEFA 2ILTA 5H82A 4GX2A 3W6ZA 1C0KA 3JV7A 2YV3A 2ZB8A 2HSDA 2EIHA 3B1FA 3IIEA 5CDGA 1UXJA 4CODB 3MTJA 1JA9A 1EBUA 3C7DB 4GSLA 1HYHA 4J1QA 3RBVA 1OBFO 1HLDA 1P9LA 1B3BA 5GZ6A 2CF6A 3AUTA 1A4IA 1DC3A 3PVZA 4YJHB 3RQSA 4CLRB 3M2PA 4YQYA 3U0BA 2J3IA 2B83A 2BHLA 8ADHA 4YJGA 2HU2A 4RCVA 4CM8A 2X23A 5T8KC 4AJEA 4LSWA 1DIGA 4B4VA 3LF1A 1E3EA 1BSVA 3K5PA 4O63O 4UVDA 4YB8A 1E1NA 2C82A 1AHHA 3F6YA 3G0OA 1LLUA 4XGIA 1I8TA 1P44A 5JYDA 3WFJA 2RH8A 3NDIA 4BO6A 1DIRA 3H3FA 3DBVO 3JQFC 5TJ9A 4FFPA 3D7LA 3QJ5A 1GUFA 4TSKA 3IC5A 1LDMA 2W2KB 1PL8A 4EGFA 3T4EA 5G4KA 4DPKA 4J1TA 2IE0A 3AK4A 1HDXA 2QRLA 3BMCA 2PZMA 2VWHA 3KUXA 3ZW8A 3DR3A 2Y99A 5G0WA 2GZ3A 4DLBA 1E3JA 3JQAD 2WJPA 1D1TA 3JQ9A 1ZXLA 1PS0A 1DAPA 3IAHA 3NUGA 2PGJA 3KRTA 4OXYA 4MVJH 1H0KA 1KVQA 4UUOA 3GHYA 5L3ZA 3B6ZA 1B8VA 3B20A 4DBZA 4Z9FA 1L7DA 3ENKA 1ARZA 4BO1A 3A06A 4MVJA 3GF4A 4BO7A 3GEDA 3DZFA 3B70A 4O1MA 2DBQA 2Q2WA 5CHEA 1VL8A 4L9RA 3UVEA 2GR9A 2UUPA 3BMNB 3WFIA 1FDVA 2Q1SA 4E2XA 4E2WA 3HB4X 3QWIA 4YRBA 4ITUA 5IDWA 1HDZA 2WD7B 3HG7A 1NVMB 1P33A 1YJQA 1AE1A 1BHSA 1R37A 4JXKA 4X54A 4XYEA 1L7EA 3GPIA 3GZNB 4LCJA 3WMXA 4EITA 1MP0A 5T64A 5KJCA 1B7GO 1DC6A 3DZBA 3IMFA 3IQDB 2X5JO 4XJSA 3F1KA 2EHDA 4FD3A 1IB6A 2OO5A 3BMQB 3E5MA 3I3OA 3OBBA 4RQUA 3VH3A 4ZQGA 1T25A 2Y05A 2PFGA 3VTZA 5JC8A 4CM9D 4ZRMA 2Q2QA 3GRPA 2CVOA 2YZ7A 1GAEO 3UUWA 3CZMA 4U7WA 3RBZA 3ZCXA 3OFSA 3PQDA 2CZCA 2ZTMA 1EMDA 1SB8A 1VRWA 1PQUA 2WD8A 1GD1O 3EVNA 4A7PA 4IMRA 1Q1NA 3DC2A 1MFPA 4MVJP 2PZJA 3ZU4A 3H8VA 1WW8A 1VKOA 3K30A 3GAZA 3VKUA 1I3MA 2E49A 4P8RA 1TI7A 3KEQA 4B8WA 1X13A 5KKCA 2ZB4A 2D5CA 1I3NA 3CINA 5KWEA 5KJEA 3UKOA 4KUEA 2NQ8A 2ZQZA 1CQJA 3ZNPA 4YDRA 2PK3A 1KEVA 1PS9A 5TT0A 4PLZA 4YR9A 1B8UA 5A05A 3KSUA 3AW9A 5ILOA 3S55A 3UAGA 3X2EA 1Y8QA 3COSA 4Y6SA 2BFOA 2YV2A 2NVUA 1ADFA 4CM4A 3GVPA 3GVIA 4JIGA 5IDQA 4PVDA 4B79A 3LVFO 4RGBA 2DC1A 3ASUA 4J6FA 1R0LA 1GL3A 1HE4A 4L76A 3WGGA 4YAKA 2C54A 4RF5A 1DFHA 5JDCC 2ZCUA 1K2WA 4II3A 4UUNA 5COAA 1H94A 4PRKA 2X8LA 5L95A 4FGSA 4XD2A 4BKRA 5CFZA 5CDTA 3ORFA 1R16A 1QYWA 3JD4A 3EW7A 1BXGB 1NAHA 1ENPA 1HDCA 1W0CA 4CLEA 3BHIA 2HRBA 3DZIA 3FI9A 2C5AA 3RI3A 4CMGA 4ZQHA 2B0JA 4II2A 3AJRA 3QA9A 3GA0A 3GEMA 5EINA 5ER6A 3DQPA 3FR7A 1QLHA 1NR7A 3GVCA 5IDXA 4MKZA 3TF5A 3WSWA 2VUUA 1C1DB 1LQTA 3JQ8A 4HNHA 1JVSA 3I23A 4E5PA 1WMBA 1NPYA 4CM1A 3VVBA 1HF3A 1VJ0A 2Q1TA 1KEPA 3U09A 3RJ5A 4FGWA 4EEXA 1SB9A 3GMDA 4WKGA 4Q3BA 1NQOA 4W7IA 4MJLA 4XRRA 5T8KA 3RUHA 5I7SA 3IKTA 4OSOA 1EE9A 1SC6A 2B4TO 2PZKA 1X1EA 1MX3A 1PQWA 5A3VA 4M49A 1E3WA 2R00C 3ROPA 1O95A 3ANLA 1QV6A 2X9VA 1JQBA 3ZNQA 3WQQA 4CQMA 1I3KA 3KSZO 4XB2A 4CUJA 2DT5A 4ZICA 3A1NA 5CEFA 4IBOA 4EJ6A 2NVBA 1YO6A 1ZO8A 2IZ1A 3ABIA 3E82A 4RLSA 5KIAA 1NHGA 1LX6A 3PJDA 1SEPA 2YQ4A 4OKNA 4FOSA 4IIVA 1VM6A 4R5HA 1IYZA 4B7XA 5U9CA 2OHXA 3HSKA 5DP2A 1ORRA 4BNUA 1YQDA 2DTEA 2Q1WA 3Q2KA 1K3TA 1CQIA 1LJ8A 1MC5A 2GSDA 3AOGA 1TB4A 1NFFA 3PP8A 3NT2A 3TL2A 4YAJA 3K73O 5A03A 1VJTA 1GU7A 3AU8A 1OC2A 1I30A 1PJLA 4BVAA 5LC1A 4DIBA 1YH3A 3RUCA 1DIAA 2QQ5A 1JWBB 1VI2A 2VHVA 4HX5A 4EJMA 1DFGA 1GQ2A 2IXAA 4XRGA 5HTOA 2PGDA 1OMOA 1UZNA 3VKVA 3WICA 3RROA 3T4XA 1PJCA 2O2SA 5I9MA 4AJLA 1R12A 4J1NA 2GPTA 2VNSA 3WX0A 4NJMA 1SBYA 4TZKA 1BMDA 4DC1A 3WTBA 2F1KA 2ZQYA 5L7WA 4OYRA 4PRLA 1QR6A 1YBVA 4ESOA 3K31A 1GQQA 1Y1PA 4D0RA 1CJCA 1O8CA 4JLWA 1GV1A 2CDBA 1O94A 1B0AA 1KIFA 1ONPA 4I9NA 2BGMA 1EUDA 2BF7A 3LLSA 3RC7A 4NIMA 2EKPA 3C85A 2RHRA 4JK3A 4KWHA 4AL4A 2QZZA 3EZLA 1ZIDA 3MEQA 2WDZA 2JD1A 5T57A 5IAAA 4BNGA 4GX5A 4QUKA 1R6DA 3GOHA 2UYYA 4UEOA 1DPGA 4NU5A 1GPDG 2NM0A 4F46A 1I33A 5A5FA 3I1JA 3QE3A 2D59A 4XYBA 3CXRA 3DEYX 5DNAA 2OORA 4CM5A 4J1SA 3JTMA 4DGSA 3KYDA 1PJ4A 1T4DA 1P0FA 5C7OO 2VCYA 1Z45A 1GZ4A 5L40A 1PGNA 1ULUA 2RBEA 3N7UA 1CERA 1JKJA 1PR9A 3ZHBA 1YVEI 2O7QA 4BNNA 4B7CA 4NFYA 1PU2A 3WJAA 2ZJ1A 1IOLA 1G0OA 2BFAA 4Q3DA 4AJJA 1ADCA 4CR8A 3VVCA 1HETA 1Y8RB 5DBGA 4WEOA 1UDBA 1V9LA 2HDHA 3PJGA 3L9XA 1SAYA 4AJKA 5CG2A 2H9IA 3LT2A 4UUMA 1XQ1A 3L4SO 1A5ZA 4OAQA 4MIYA 2OP0A 3H5NA 5AXAA 1LSUA 1VPDA 4GL4A 4XGNA 5JAZA 3LZ6A 2J3JA 2G1UA 2IXBA 2J3HA 2E37A 2X22A 4MPDA 4FCCA 1V35A 2CUKA 1Z7EA 2D8AA 2VT2A 4WLOA 1FDTA 3W4JA 1IPEA 3DBHB 1B2LA 3ZH2A 4ZQFA 4CMJA 1EFKA 3DOOA 4GMGA 2AEMA 1KYQA 3BHMA 4XB1A 4L4SA 4Q3NA 4H15A 5CEJA 3CMMA 4DA9A 1KVTA 4WCDA 4FBGA 4HUJA 3FWNA 3O4RA 2PKRA 2Q1UA 1CEQA 1TT7A 2X5OA 2FWMX 1QYVA 3H5RA 2AQKA 3WYCA 4XYLA 1YS4A 4M54A 1F0YA 3PDJA 4IS3A 4TWRA 3UFXA 3ZWMA 4ALMA 4TZTA 1DLIA 3JQDA 3AI3A 2HK8A 3BZUA 4NJOA 1ID1A 4PVCA 2OBYA 4YJGB 1CWUA 4LVCA 2DM6A 4CM8B 1PGJA 3U4DA 2DQ4A 3KETA 3GY0A 1T2AA 2D5AA 3PWZA 3WSVA 2O2YA 1QG6A 2IEDA 3D0OA 2GCGA 1ZK3A 2GDZA 5IG2A 3LT1A 4K1LA 3ITKA 2R00A 2B37A 5IJZA 2EKLA 3TDKA 5DBIA 4BV8A 4MO2A 1QYCA 4JP2A 5JSFA 1V6AA 1Y5MA 3H9QA 4KTTE 1Y7TA 4IPTA 2AE1A 4FC7A 4NPCA 2AEJA 5G4KB 3JQ6A 3RBXA 1TA4A 3MCVA 1R15A 1VE9A 3BMCB 3L4BC 4DPLA 2DLDA 1Y5RA 4FOOA 3Q9NA 3U9LA 1PWXA 2E4AA 2BGKA 3OP4A 2BD0A 3PXXA 3BTSA 4G81A 4PIVA 5EQFA 2VHZA 4URFA 4RF3A 4E21A 3U49A 1BTOA 3G49A 3BA1A 4Z3KA 1NVTA 1QYDA 4HP8A 1LLDA 2O3QA 4AFNA 4QFCA 1LNQA 4MP8A 4H16A 4CQLA 1EVZA 3AI1A 1OI7A 5EIOA 3GUYA 5DCYA 4O0LA 3LT0A 3PHLA 4LMRA 3ZV3A 1YB4A 2WEKA 4PLWA 4YACA 3RFVA 1ZCJA 4PCVA 4J7CA 4ZRNA 5CDYA 1AGNA 1NX6A 1LQUA 2NACA 1YJ8A 2VYNA 3C1AA 3PZRA 4AG3A 2OOSA 4BNJA 4N5NA 2G82A 2VRCA 1ZSYA 1GQYA 1PJBA 1DB3A 3OEYA 4NFHA 2QX7A 5C5IA 5IFLA 4NZ9A 2E6UX 1R66A 3K2BA 5DN9A 5K9ZA 2VTDA 4UVGA 1ULSA 4IY1A 1X7HA 3INGA 2VTEA 5HS4A 4MKXA 3UCXA 1EVIA 4IDBA 1GCUA 1I0ZA 3AFNA 4PG7A 3RUEA 3ASVA 1DLJA 1J4AA 1JU9A 1A9ZA 2NSDA 3RU9A 1KEUA 5JFOA 4I1IA 3OMLA 2EJWA 5DCWA 5ILGA 4CL8A 3O26A 3AI2A 1H6AA 3NRCA 1GEGA 1ML3A 1NVGA 2EP5A 4B4UA 1LDBA 4HFNA 3ZNNA 1GADO 1V3UA 4JX8A 1H93A 3GDFA 3I9JA 3GQVA 3ICPA 1ZK0A 5ICSA 2VZ0A 3O03A 3KSDO 3UN1A 1H2BA 1YQGA 3WBBA 3SXPA 3B1KA 2VWPA 2PH5A 5I8ZA 1EK6A 3WGYA 2DUUA 4WOJA 2Y1FA 2GASA 1ZK4A 3JQBC 4N5LA 5TSDA 1FJHA 2DVMA 1GV0A 1SO8A 3ANMA 3BMOA 4OOFA 5L4NA 1I2ZA 4IXTA 1VLLA 2IZ0A 4UEKA 4BNHA 4BUCA 3OECA 1WXDA 5EESA 3JQGA 2D1YA 5FEUA 1OOEA 1Y8QB 1ENZA 4AJ4A 4YJFA 1UJMA 2VWGA 2NVUB 4CM4B 4E4YA 2IODA 5TLSA 2OMEA 3ZU2A 4PLVA 1GYQA 3NDRA 3WGIA 4WCFC 3NX4A 4W9NC 3P7MA 3RSHA 2WSBA 3ZW9A 3OJOA 2YDXA 4R1TA 5EPOA 4CMIA 2NU9A 2V6MA 1EUZA 1VSUA 1GZ6A 3GVXA 2GUGA 3BTVA 3DBLA 2OGUA 1NQAO 2VYVA 3EY4A 4ND4A 4XIYA 3SLGA 1PJ3A 3UGKA 2ZK7A 3LC2O 4UVHA 2PV7A 3K92A 4ZU3A 4K6CA 4C7JA 4EBFA 1TXGA 1RM4A 2EW2A 5JE8A 2TMGA 1Q7GA 3CPSA 3RCBA 3MZ0A 2HAEA 3BTUA 5KCZA 2GNAA 1BDMA 2I9PA 3RVDA 3W4KA 1T26A 3LC1O 3WQRA 4UUPA 1IUKA 1PSDA 3GDGA 3LF2A 5JO9A 3VPHA 2BGLA 4CMAA 3RFXA 1UUFA 5MDHA 3G79A 4IIUA 3NT5A 3MOIA 4UVIA 1GY8A 3ZV5A 1XU9A 3DZHA 1NWHA 4A5OA 3EGOA 4B3IA 5BSFA 1J6UA 4RDIA 1D4FA 3I83A 3EUWA 5DF1A 5F1OA 5ITWA 4HNGA 5ES3A 3V5NA 4ZGWA 3JQ8B 5TJHA 4DC0A 2YFQA 4HFMA 2Q46A 4DPMA 1X7DA 3PHJA 3AUAA 1U28A 1UXHA 1VC2A 2FN7A 2PKQO 4Z9XA 4OIMA 4Q3CA 4YT2A 3KV3O 4JNKA 2C29D 2GD1O 3QSGA 1E7YA 4LMPA 4MVJG 3ULKA 4PLTA 3VZSA 3K2EA 3F46A 1PZGA 3TWOA 3NAQA 4R9RA 4WLUA 1E3WB 2EG9A 3GN1A 1OC4A 3ONEA 4IDFA 1BRMA 1F17A 3M1AA 3GNQA 4NU6A 3FNHA 1QSGA 4BGIA 3PHGA 2D2IA 3TSCA 2P5UA 4FB5A 1P1HA 4CMKA 1K6IA 4CQMB 1O6ZA 3GHHA 2BLLA 4OHUA 3GUCA 3RWBA 4ALNA 4CLOA 3AM4A 4MDHA 3F3SA 1M66A 3JD0A 3S2FA 4BKUA 2Y0EA 1ZSVA 3D4OA 1SNYA 2O3TA 3AY3A 3PGJA 4U5QA 2HMVA 5DOVA 5TX7A 3HUDA 1M76A 3NTQA 1NQ5A 3UF0A 1RJWA 3L4BA 2EGHA 4RPJA 3U4HA 3KLPX 3W8DA 4OH1A 4E5NA 3QWAA 4Q39A 1I2CA 3DXFA 4RO0A 1OFGA 5BT9A 2ZB3A 4J49A 4AJNA 4XX0A 5A04A 4L4XA 4J0EA 2NTVA 4J91A 1ZVMA 4DQXA 2Q50A 1HEUA 2EXXA 3UCEA 3H4VA 4CV0A 4YWJA 4BQPA 1IPFA 1HSOA 2VHYA 4Z9YA 1KOLA 1H9BA 1N92A 3LU1A 4IDEA 1YE3A 5AVOA 4BNYA 1PR3A 3KYBA 4NBWA 2RIRA 3VH2A 3ZNOA 2WE8A 4G65A 3EZYA 3NV9A 3NGXA 1VL6A 9LDBA 3C3XA 3KB6A 3MJCA 3ZHXA 3L6EA 4RVDA 4TVBA 4O59O 4BO9A 1BWSA 2EF1A 2ZTVA 1C0PA 1MG0A 5KVVA 3NT4A 4NJMB 1MXHA 4RPGA 1Y9AA 4N18A 4QO8A 1UP4A 3ZDFA 4DQVA 1XGKA 2Z1MA 4BGVA 5BQFA 1C0LA 1XCBA 2PD4A 4IGFA 2VQ3A 4LCEA 3R0IA 4GX0A 1BVUA 1LXCA 2XXJA 5K6AA 5L4SA 1Z73A 1GUZA 2GGSA 3V2HA 4CMHA 5COQA 1Q0HA 4CM7A 1AHIA 3S2EA 1PX0A 5TNXA 2GZ1A 1UP7A 1E6WA 4YYZA 3O9ZA 3GG9A 3I9KA 5FYDA 2O4CA 1R4MA 1WPQA 2PD3A 4B3JA 2C5EA 4RZHA 3GDOA 2NNLD 1HZJA 2I76A 2V6BA 2X58A 4TVOA 2R6JA 5DZSA 2P9GA 4FJ0A 3CE6A 3ICCA 4YA6A 1FXSA 1DJNA 3KYDB 4YAGA 1KETA 5KVQA 5FWNA 1EZ4A 1J0XO 4TROA 2XOXA 4PLFA 1BDBA 4A73A 3I4FA 2H63A 1XU7A 4ONEA 1U9JA 4A2CA 3PWSA 1DRVA 2YV1A 4ALLA 5FF9A 3MJVA 2HK7A 3ZU5A 7MDHA 3OSUA 1I10A 2D0IA 2I67A 4B4WA 1NXQA 3OETA 4S1VA 4ZHSA 5JCXA 4RJTA 1KC3A 1IULA 4GVLA 3ROQA 3PHHA 2BFPA 4XQCA 4DXHA 3UH1A 2HKIA 3KXDA 3QVTA 2W8ZA 1JKFA 4HBGA 3OM9A 2XXBA 1PJSA 4BNZA 1NM5A 2C2XA 1PEDA 1SZJG 3KTDA 5G0TA 4UVEA 1IE3A 2VRBA 3HN2A 5DBFA 4XKJA 3ONFA 4W9NA 4WCFA 3UW3A 5IZCC 1U4SA 4M8SA 2D4AA 1E77A 2H1SA 2D3TA 1DBVO 3Q6IA 1YB1A 4ND1A 5GMOA 1O0SA 1LTHR 3PYLA 4BO3A 2X0RA 1HE3A 3H2SA 3VPXA 1V0JA 3GGGA 2R2GA 4R68A 2HMUA 1W6UA 5AXCA 3OJFA 3WTCA 1HE2A 4YPOA 3K8ZA 4BO2A 2JJYA 3V1TC 4FFLA 1PL7A 5DULA 3DZKA 1GDHA 2V7PA 2J5KA 2Y1OA 4E0BA 4XA8A 1XR3A 3C8MA 2UAGA 3WNQA 4IQ8A 4NBVA 5BR7A 3L07A 3QVSA 4D0SA 5HM8A 1E0DA 4GLLA 5KTKA 2O23A 3WDSA 4PZDA 2YHUA 2I5PO 1QRRA 1AN9A 4J0FA 3RUAA 1DIBA 1PIWA 2AXQA 2X6TA 1XDWA 5LDGA 4ZD6A 4GQAA 4XGKA 2NU6A 1LRKA 3EVTA 4K28A 3AWDA 1X1TA 2IRWA 3W4IA 2PNFA 3OIFA 1L1FA 4N7RA 4GLOA 1K0UA 3HDJA 3QWBA 5L7TA 3NDJA 1O5IA 3PYXA 4N5MA 4MINA 3SX2A 3FR8A 4IMPA 4J4BA 4P4GA 3SJUA 5ITVA 1HSZA 4Y98A 3IKVA 4TMFA 4F6LA 4YXFA 4G5HA 3S8MA 2FR0A 5T6BA 2RCYA 3P19A 3PPIA 1ZK2A 3VOSA 2BMAA 3EC7A 4R16A 1E7WA 1C0IA 1O89A 4GPD1 4U6SA 1DO8A 5L4LA 3JQAA 2NVWA 3H2ZA 3H9UA 4CMCA 2PH3A 1ZNQO 1H2HA 5AQ1A 3D5QA 1LLCA 2FPGA 4BOYA 3HDHA 2PA3A 3EMKA 2JCYA 3H6KA 3JQFA 4TRRA 4A10A 3FPCA 1HDYA 3HJAA 3WG9A 4DQUA 2GRAA 5TT1A 1ZH8A 1LRJA 3G1TA 1QP8A 4KOAA 4CV3A 2GN9A 2O3RA 4CQLB 1X14A 2NU7A 1WLYA 3KBOA 2AG8A 3ZWPA 2CY0A 3VPGA 5J23A 5EERA 1A7AA 3WOHA 2J8ZA 3IUSA 5TIIA 1G6KA 5GZ1A 3EDMA 3IS3A 2YHIA 2O3SA 3C7CB 3OHSX 3VHRA 1LDNA 1I5RA 3SBOA 2ZTLA 3ZWNA 3RC1A 1LLQA 4MP6A 2P68A 1PZFA 4R1NA 4W4TA 3ETGA 4OO3A 3LC7O 2B5VA 2I66A 5CP8A 3V1YA 1JTVA 4XIJA 4B7UA 4LN1A 4IDDA 4OSPA 2WE7A 3RC2A 4R3NA 3PQFA 4GGPA 5HBRA 4FSHA 4LW8A 3VTFA 3FTNA 1RKXA 5B37A 4R51A 1Q2XA 1PL6A 2X0NA 3HB5X 2JFHA 1NTOA 4JJIA 3GR6A 4ALIA 3PYMA 4CM9A 3V2GA 4BMVA 1BGVA 1PWZA 3DOCA 1M6HA 1A7KA 3DMYA 2AQ8A 3WWZA 1FDWA 1N2SA 2DFDA 3WNVA 1I24A 4R5MA 3QHAA 4ZQEA 1LDGA 3PIIA 4HY3A 1ZMOA 1HWYA 4BO4A 2W2LD 4PLPA 3S2IA 5TRTA 3QY9A 1S7CA 1QMGA 5JCJD 4HWKA 3VAZA 1N5DA 4JBGA 2DTDA 4RZIA 2RH4A 3ZWXA 1MUUA 5B4TA 1UXIA 1T1RA 3ZZNA 2CFCA 4MVJF 5LDHA 4WLVA 4KWIA 2BFMA 5DOZA 2AQHA 4P22A 1ADBA 3RASA 3QP9A 2B35A 1E1KA 5EMHA 3F5QA 2WTBA 4W82A 3BMOB 4GGOA 2BI8A 2J5RA 5AOVA 1E1LA 4CMEC 4HFJA 5AXDA 1JDJA 4QT0A 1XELA 3JQGB 1Z75A 1QXSA 3OF2A 4D3SA 4YJFB 2NV6A 2NWQA 4C7KA 4EDFA 3NGLA 2EW8A 1O9BA 5KVCA 1JW9B 2AHRA 4YT4A 5IZCA 1PGOA 3TPCA 2Y1DA 3AM5A 5IN4A 2HMTA 3CKYA 2NUAA 4CMIB 4LISA 3JYNA 4LGVA 1G1AA 1LSJA 4GI2A 3DBLB 3OJEA 2YW9A 3ZGYA 1PGQA 4P38A 4PG8A 1LDEA 3OEWA 4E12A 2J3KA 3ADOA 4DYDA 2B5WA 4KUGA 3E9MA 2G5CA 5T67A 1NNUA 4WLFA 1R4NA 3ZWAA 5JDCA 4J2OA 3CZRA 1I01A 3UCFA 1XA0A 1E6UA 1YRLA 3BAZA 3UXYA 5AXBA 2J6IA 3OA2A 4W6ZA 1N9GA 2B69A 5ICMA 4Y8VA 4I08A 4IDAA 4KZPA 1HTBA 3C1OA 1WZIA 4LK3A 3GC6A 4KDEA 5CEEA 1NFQA 4BNWA 2C59A 4PN3A 4J4TA 3GT0A 3JQCA 4WUVA 1NPDA 4YEDA 1Z82A 4BNXA 5I8WA 5I7FA 3DDNA 1C3VA 2P5YA 3RUDA 4BO0A 2I6TA 4BMNA 2C2YA 5JS6A 3PWKA 4H7PA 2X7HA 5IZ4A 1AXGA 3D3WA 4WGGA 4BNFA 1P1KA 1WDLA 4LRTB 4ZVVA 1KVUA 1UDCA 1Z6ZA 2VOEA 2VOJA 3FTPA 2DUWA 4NI5A 3AM3A 4FJ2A 3OICA 5EN4A 1U3TA 3TN7A 1CDOA 3V8BA 4WJZA 3RUIA 4DBVO 2O3JA 5THKA 2VUSA 4IXWA 4N54A 4BKOA 1HE5A 1ISJA 2DFVA 4NDNE 4EUHA 1TEHA 4RF4A 2B36A 4IUYA 2JCVA 2EWMA 4FFMA 4QEDA 2IDZA 1DFIA 4GBJA 1AXEA 4CLOB 4D3FA 1KC1A 1U7TA 2JD2A 1HYEA 1UP6A 2AA3A 1NP3A 5EJ2A 5G0SA 2AE2A 4E13A 2CDAA 2QW8A 3ZWVA 1F12A 3H65A 3AU9A 1E7MA 3JCZA 2CDCA 2LDXA 2ZCVA 3PLNA 4NBUA 4UAGA 4ALJA 1VL0A 2HMSA 3K6JA 3U3XA 4WLEA 1UH5A 1E3IA 4K26A 3PDUA 1H6BA 3DL2A 4NHEA 5CPBA 2QIOA 2CVZA 2FSVA 2FR1A 4A26A 2OXIA 1BXZA 1N1GA 1HDOA 1U5AA 2G17A 1LSOA 3FN4A 3GNSA 4JJFA 4U8GA 4D43A 4L0QA 3TZQA 3W1VA 4FQ8A 3FHLA 2EV9A 3AOEC 4BMSA 3R3JA 3UHAA 4PZEA 3E18A 4NFSA 4E6PA 4IINA 3AY6A 4E3ZA 3WXBA 4E2YA 3LLVA 5I7VA 3GLQA 2P4QA 3U4IA 3PTZA 3FD8A 4NMHA 4RVUA 1CETA 5A9SA 3R1IA 4L75A 2EP7A 5LCXA 2CF5A 3DTYA 3ZHZA 3E48A 1DHRA 4QO7A 1TT5A 2UVDA 4TRJA 5JCJA 1LC0A 2DBRA 1YBMA 1QKIA 1GTMA 3GVHA 1HL3A 3QV1A 4IJUA 4GH5A 4OKIA 1NQTA 2Y1CA 1T2DA 4D46A 4E5KA 3PI7A 5K1SA 4PLHA 2ZKLA 2NADA 1T2FA 3EYWA 3JQ9C 1P77A 4NR0A 5TS3A 1D7OA 1P45A 3SLKA 4WEQA 2Y0CA 3FSRA 1KS9A 3VPSA 3BIOA 3PGXA 1YDWA 3FPLA 1NR1A 2BRUA 4YTEA 1XLTA 3VC7A 3KLMX 3I6QA 4DMLA 2WWRA 4KTVE 4CJXA 3N58A 3MJTA 3V1UA 3DOJA 1R4MB 5G2OA 3M1LA 1ENOA 2HQ1A 1KY5A 2C7GA 2EKQA 4HKTA 1H9AA 3S1LA 4M55A 4R41A 5F1PA 5HRUA 2FOIA 3KEOA 3F47A 4TQGA 4CLHA 3G3EA 4ZJUA 5G4LA 1Q0QA 2V6FA 4U0JA 3RKRA 4EI2A 5DP1A 3VZQA 1WMAA 4DIOA 5BNIA 1X0VA 1KBZA 4BV9A 1BXKA 4PG5A 1NHWA 1QLJA 2RAFA 1VSVA 3ENNA 3P2OA 3OQ1A 3QRWA 5C3MA 3F9IA 4R1SA 4EW6A 1GFSA 2HCTA 3D4PA 3FWZA 4EJ0A 2GN8A 2DBZA 2DPHA 4CMEA 2Q45A 2IYOA 4CLDA 3VH1A 3A28A 4NK5A 4MVJD 2P9EA 1MFZA 1V3VA 4IZHA 3QVXA 1U2GA 3ZWOA 2HUNA 2I99A 4J3FA 5BNTA 1YBAA 3H5AA 4ILKA 4LRSB 1K6JA 2FRDA 2PWZA 4WCFB 1A4UA 5CPFA 2HO5A 4D3DA 2YFHA 1LI4A 4J9UE 4XWYA 4BNMA 4Y67A 4XYMA 3ZWYA 3TZ6A 1I36A 2PKQP 4D44A 1ISGA 2CD9A 3W8FA 4RVGA 1JN0A 5TF4A 1E5QA 2TMDA 4YBZA 1F8FA 3UOGA 1MA0A 4GWGA 1BW9A 4I5EA 2A92A 1P1IA 3Q9UA 1FK8A 1P1JA 3B1JA 4D41A 3FBGA 1FF9A 2CSUA 3H9JA 5KJ6A 5L51A 1GYRA 1P1FA 5EQDA 2X1HA 4BKPA 1DOHA 3DTTA 4PG4A 1A72A 2BELA 1DAOA 3ETDA 4NBTA 3GAFA 3I9MA 1MV8A 1XEAA 4R3WA 1YXMA 1XYGA 5JY1A 1U3VA 5HA5A 2Y66A 1UZMA 5KOIA 2H5LA 5B4VA 5BSEA 1ZEMA 5H81A 3STHA 1WNTA 2CMDA 3PK0A 3IJRA 4EYEA 3HFSA 4D7AA 1V8BA 4RPKA 1D8AA 5JAIA 2C20A 3HDQA 3L77A 1XQ6A 4OQZA 5JDIC 1D1SA 3CUKA 4KQXA 3R6DA 1RM3A 1ADGA 3LQFA 1GEEA 4BNVA 3GFGA 3G17A 4WOKA 4J7XA 4MOWA 1X7GA 4BNKA 4BKQA 4EEZA 5U1PA 3RFTA 5JC1A 4QSMA 3BHJA 2I3AA 1YQXA 5L53A 4YRDA 4MKRA 2GO1A 2HRZA 5IN5A 3F4BA 4OL9A 2ZYGA 3L6DA 3CH6A 4M89A 4CM6A 1F06A 1ONNA 1GR0A 3TQHA 3JQAB 3D4NA 3LDHA 4J16A 3TRIA 4WNIA 3U5TA 2XAAA 2QYTA 1U8FO 4QECA 3IDSA 5JAMA 1DC5A 4M1QA 1RM5A 3DBRA 4BS9A 1N7HA 4OJNA 1B16A 3DFUA 3FNFA 3HN7A 1LEHA 4Z3DA 4ALKA 3INRA 5A1TA 4YRAA 3ETEA 1NWCA 4IJKA 1PS8A 3DWFA 4ROSA 2C07A 3HWRA 3M2TA 1H6DA 5FI3A 1YL7A 2X9GA 5K0ZA 4R69A 3AOEA 2NTNA 4PFJA 1LUAA 4RORA 3NJ4A 4J4HA 1UZLA 1Z7BA 2C7VA 5L45A 2BI7A 2YHIB 1EEHA 3I9NA 1N7GA 5MGBA 2HLPA 3MOGA 4TRMA 4WNCA 3WMWA 1RM0A 1RYEA 1EVYA 2EERA 3A4VA 4PGFA 4DVJA 2ZTUA 2Q3EA 4A0SA 2DAPA 2JAPA 4RQTA 3VZRA 3SVTA 4PLGA 1TVEA 4QX6A 4ZN6A 3GH3A 3DAPA 5C7LO 4TKMA 4CM3A 4I8XA 4FC6A 2YYYA 1KERA 3NKLA 3MWEB 4I5GA 4JBIA 1A9YA 1A27A 3AUSA 4LVUA 2BKAA 3D3EA 2Y1EA 1LA2A 3PZBA 5JYEA 3MJEA 4CQMD 4CV2A 3NTOA 2O50A 2P2SA 1SPXA 1KVRA 3DAGA 5EL0A 1R0KA 2QZ9A 1SCUA 3I52A 2VZ8A 3DAFA 1EUCA 2QHXA 1HZZA 4J9VA 1EDOA 3TZCA 3QIVA 4Q9NA 4B3HA 3I5MA 2YJZA 2UV8A 4C4OA 1E1MA 1NASA 1XKQA 4R01A 3R3SA 4XR9A 1YONA 1Y9EA 3GG2A 3OA0A 5KKAA 1BG6A 4IJWA 4MIOA 2YQ5A 8LDHA 1VKNA 5CDUA 2WYUA 4JJGA 4AICA 2IEBA 5TQVA 2ZIZA 4EUEA 2QG4A 3CIFA 1T1SA 1NAIA 5JPIA 4CL3A 1QORA 1RWBA 3JQBA 3KZVA 4GWKA 2GYYA 3GFBA 4BO8A 1ZW1A 3GNTA 2GN6A 1YWGO 2Z95A 3LSYA 3KYCA 3JQ7A 1YDEA 4HV4A 4FR5A 1M67A 1YOVA 3MTGA 3DB2A 4NK4A 4QXMA 1R0SA 3QW2A 4D45A 1CRWG 1UR5A 4FJ1A 3UICA 1WVGA 3C24A 1T4BA 1F14A 3QLJA 1G0NA 2NQTA 1XIVA 4RF2A 4XQGA 3TL3A 3W6UA 2B4RO 1B15A 1R4NB 4W99A 4GMFA 4E33A 1I2BA 1SOVA 2OZPA 4J90A 1UXGA 3WWYA 5A3JA 5IDYA 3WIDA 3ADPA 1JWAB 1W4ZA 1C1XA 1DSSG 4Y9DA 3PIDA 3ROMA 4IDGA 5JBIA 5F3RA 3Q3CA 1N9GB 3VDQA 1LDYA 4YT8A 4DMMA 1E7RA 3GEGA 1OZAA 4E30A 4F45A 5TGDA 3H9EO 4YQZA 5L7YA 1EE2A 4GSKA 2WM3A 5JY6A 3QWFA 2H6EA 4RLHA 1Z74A 5F1KA 3E6AA 1J5PA 3PEFA 3TZHA 1S6YA 2ZJ0A 1ZJYA 5JXWA 3AUUA 3D3WB 5JMPA 4CUZA 1LSSA 2FP4A 2X5KO 3OQBA 4A03A 4YAEA 3H7AA 5JDIA 1PGPA 1EBFA 5ENVA 4UREA 4O5OA 3FNEA 4XEHA 3I9LA 2Z5LA 5KJFA 3T7EA 2V65A 3O8QA 1WDMA 3RAJA 1SMKA 3VDRA 1E92A 1T2EA 2YDYA 4NNJA 2VZ9A 4DIFA 2X0IA 1RYDA 1JLLA 3HADA 3CEAA 3IP3A 4JROA 2HK9A 1RPNA 4R1UA 2Z1NA 1X15A 2J5QA 4ID9A 4K9DA 3WGOA 1ZUD1 4CR7A 4KDFA 4Z0PA 4LSMA 1E3LA 3CTMA 1QV7A 1GCOA 3G1UA 2JFGA 3P2YA 4XQ9A 4BL5A 3HZZA 3KVOA 4GX1A 1KY4A 3KM0A 3HDYA 3GRKA 3WGHA 4NH4A 5ADHA 1UXKA 1PJTA 1DJQA 3BXXA 4IDCA 5JAQA 2I65A 4CLXA 2DU8A 3MJ4A 3DZJA 2ZATA 4H3VA 1GUYA 4JP3A 3FBTA 1EFLA 4DLAA 1N8KA 5C7IO 3INTA 1E5LA 3NYWA 4GKVA 2AW5A 2FY8A 2YY7A 3SC6A 5I9NA 2LDBA 1JAXA 1I32A 3T7CA 2P9CA 1NPTO 2VUTA 4AJPA 2ZYDA 4WE3A 3GN2A 5TC4A 5THQA 3TFOA 4BO5A 1Q7CA 5HS6A 1YL5A 4Q3EA 3WJ7A 5I7EA 2EGGA 2X0JA 3TZKA 2SCUA 1EVJA 3S2GA 3HE3A 2QRJA 3RC9A 4YJHA 4HFRA 1IL0A 2UDPA 4CLRA 3GMSA 3PFFA 3C7AA 1HRDA 1ZZEA 1VJ1A 4JN6B 3I4CA 3WYEA 1FDSA 1F8GA 1IZ0A 2DTXA 5A9SB 4TRNA 5IXYA 2CVQA 3JYQA 2QRKA 1HLPA 4BB6A 2AMFA 4MVJM 3PFWO 4KQWA 4IS2A 1ZBQA 2W90A 4DUPA 2IYPA 3DO5A 1TT5B 7ADHA 5HWSA 4E2ZA 4RPLA 4XQEA 1U5CA 1U1IA 1WWKA 1JKIA 2WMDA 3E1KA 2DKNA 4B4OA 4DTIA 3ZHYA 4DREA 2OP1A 1PQPA 3ZWWA 2W2KA 3KHUA 2Q4EA 4O6VA 2CNBA 4U0KA 4AVYA 3QVOA 1XG5A 2PLAA 5BNFA 1U2DA 4E5MA 3JYPA 4D79A 3LK7A 4XYGA 4FFOA 4RV9A 1U3WA 5F5LA 4BB5A 2YUTA 4K6FA 3OIDA 2FZEA 3H3JA 1PTJA 4IJVA 1PZHA 4NG5A 4A27A 4FN4A 4E31A 1SOWA 2GERA 3LYLA 4I5FA 4XDYA 4EZBA 5BSGA 2FHSA 1ZKMA 2OL4A 2VNAA 1Q7BA 1P1RA 5B1YA 6LDHA 4J2HA 3DZGA 4MVJI 1K6XA 3VPFA 5F21A 2JCXA 3BMNA 3C1TA 1E3SA 1A71A 4MP3A 2F00A 2OFPA 1BVRA 3DMTC 3ZN2A 5A4DA 4J43A 4Z0HO 4KP7A 4WPGA 1ISFA 2WD7A 3WIEA 3ITDA 2VYND 2JHGA 3JD3A 3AFMA 3GPDG 2Q99A 1EQUA 2VRCD 3HFGA 3FNGA 3GZNA 3K9QO 4J7UA 5DCUA 4AJOA 2AQIA 2AG5A 3VH4A 3OIGA 4JBHA 1B3RA 3U4CA 3X2FA 2X9NA 3WS7A 4FDAA 2FMUA 3D64A 3BMQA 3IOYA 4PLYA 4S3MA 1PJQA 2X4GA 4L74A 2A4KA 4AJHA 2OUIA 1BW9B 2O3UA 1KEWA 4HXYA 4YJDA 2Y93A 2NLOA 4I5DA 1JVBA 4ND5A 1J49A 3L6OO 2JKVA 2HMWA 4RPHA 1XHLA 2JHFA 4FFNA 5BSHA 2FSSA 1E6EA 2Y67A 3FCOA 1K5HA 3TOXA 4IQ0A 3ZI0A 4CUKA 4YAIA 4Y6PA 1CYDA 1ENYA 4BGUA 3KOUA 3Q2IA 4F6CA 1M6WA 2PGLA 1ISIA 3DONA 1NYTA 5G0UA 1OAAA 4ND3A 4RVSA 4WECA 2UUOA 1H6CA 5KJ1A 4INAA 1XWFA 4BGEA 2VN8A 3PHIA 2BH9A 4JCOA 4OM8A 2JFFA 4ZA2A 4Y6RA 1P3DA 3ROKA 3OQ6A 5JO0A 2Y0DA 3M6IA 2JD0A 2Q49A 3LT4A 3JYLA 4IQGA 5DT9A 5A9TA 2I3GA 3ZV4A 1M75A 4E5YA 2RHCA 4UEJA 3RIHA 4GVXA 3RUFA 5GZ3A 4GAEA 3TFQA 3PJEA 1GYPA 4BNTA 5ENDA 5DDIP 4WASA 5F5NA 2ZB7A 4JQCA 5C37A 2VT3A 2IZZA 1YB5A 3DHYA 1HYGA 1ZFNA 4R4JA 2HJRA 5B4UA 1X0XA 1LC3A 1Y81A 1PZEA 4I9UA 3GZ4A 3I6IA 4FS3A 4AJ1A 2FPPA 1BXGA 1DRWA 3ONDA 2VYVD 3DBRB 1B26A 1T2CA 1ZK1A 1MB4A 1GPJA 3QVWA 5IXSA 5I9LA 4ZQBA 3CSDA 3WQSB 3BYZA 5A9RA 3L0DA 5JMWA 3A14A 4P4NA 3VZPA 3P5SA 1DC4A 2P4HX 3WBFA 4BHTA 1SEVA 1MGOA 2ET6A 2X86A 4NBRA 3E9QA 3IJPA 1YKFA 9LDTA 2Y1GA 3WGQA 2JAHA 1MLDA 3SJ7A 5CDSA 1C1DA 2ZYAA 2GLXA 3NEPX 3ON5A 4OGWA 1YGYA 3PJFA 3RJ9A 2WYVA 3MJSA 3F1LA 4Z6KA 4XZ3A 1IY8A 1JAYA 3HQ4O 3ANNA 5A5EA 5B12A 1EK5A 3SC4A 3TNLA 3SEFA 2DBVO 3GGOA 4DRYA 1HDGO 2A94A 3PLRA 1U7HA 4TKLA 2NU8A 2VWQA 5GY7A 3WLFA 4FIZA 1NFRA 4PLCA 1LU9A 4JGBA 5CG1A 3F4LA 1FDUA 4PZCA 4QFDA 4M86A 3Q0EA 3TJRA 4BNIA 4AJ2A 3FRJA 3EAGA 2W2LA 3ZWCA 3GK3A 1Y6JA 1ONOA 2QYSA 3WYBA 1DHTA 3RKUA 5IF3A 4ND2A 3E5RA 1ZSNA 1HT0A 3OJLA 2NTJA 4M87A 4YVFA 3N74A 1DRUA 3ST7A 5KNLA 4CV1A 1DIHA 6ADHA 5ER9A 5T5QA 1I3LA 1IHYA 2Q2VA 2GZ2A 4BQRA 3EK2A 3CMCO 1MG5A 2Q4BA 3ZV6A 3A9WA 2FPIA 4DL9A 1WDKA 3W8EA 4BNLA 2W98A 3EHEA 4DLLA 3U62A 3OJ0A 2POQX 3IP1A 4L73A 4IZIA 3ZU3A 3E8XA 4OOEA 4QQRA 4OMUA 3ZWBA 2E48A 1QYXA 2FZWA 1N1EA 2PTGA 1H5QA 3NTRA 1EDZA 3MWDB 4U6QA 4B8ZA 1XSEA 4FPXA 3PQEA 1UDAA 4CPDA 4DYVA 5JW6A 1CIVA 4FW8A 3DHNA 4W7HA 4HADA 2XF8A 1DDOA 4KMSA 1LBEA 4QTZA 4I9HA 1FMCA 4CMBA 4XCVA 3WB9A 3HHPA 5K6AC 3WR5A 3DMTA 1MC4A 1TLTA 5AYVA 4F3YA 2P91A 1U8XX 3E03A 1P31A 1DXYA 1CF2O 3HNPA 1D3AA 3K96A 5A02A 1IZ9A 1AUPA 1P74A 1V3TA 5FFFA 1WP4A 3KYCB 3JQ7B 3H9GA 2A9FA 3KO8A 4P4LA 4R9SA 3WGTA 1YOVB 1P0CA 4YT5A 1IHXA 3FF4A 1WAMA 2FR8A 1ISHA 4IM7A 4OQYA 3IL2A 3TOZA 2HJSA 4MVJE 1HDRA 2VHXA 2OBNA 3DFZA 1MXFA 2PR2A 2XPCA 1K89A 2PZLA 4OXNA 1B8PA 3QQPA 4XDZA 2G0TA 1ISMA 3O38A 3L9WA 3Q11A 3OH8A 1LRLA 2Y68A 3RD5A 5JNLA 3BTOA 1M2WA 2EEZA 1ZXBA 4G2NA 1C1XB 4E32A 5CAEA 5L9AA 1E7SA 3I9OA 5U4QA 3F5SA 1UAYA 4L8VA 4OXKA 4UULA 4RDHA 1PJ2A 5COBA 1EQ2A 4MIEA 4Z0TA 3D1LA 2GF2A 1C14A 2C0CA 2W4QA 1E7QA 3JSAA 4IGEA 4FFRA 4RL6A 4XJTA 4WK6A 4XR4A 2DPGA 2O48X 2EJVA 4KUHA 1ZEJA 3V2UA 3PRJA 1DEHA 1ZJZA 4DWVA 2A35A 4WLNA 1Y8RA 1YL6A 2V6GA 1W8DA 1GZ3A 2E82A 4R54A 3RU7A 1U4OA 2B4QA 3NJ8A 3Q1LA 3AY7A 2WYWA 4CR6A 1W73A 2JL1A 4YCAA 4Q3AA 2PD6A 2VHWA 3WLEA 2PY6A 3DHEA 3O8QB 3WGZA 1NBOA 4PG6A 4RVHA 4AJIA 4EUFA 3JQEA 4L4RA 2G76A 4RVFA 1ZMTA 2O7SA 4BIIA 5KVSA 1HXHA 1Q0LA 3JYOA 4NQZA 1WZEA 3DBHA 1B14A 2GN4A 5H83A 5JLAA 2O4UX 3E9NA 5G0VA 1UAGA 3IUPA 4D42A 3D5TA 4GKBA
chains in the Genus database with same CATH superfamily
2C92A 1NT2A 2AUNA 2MHCA 2UVPA 2WA2A 1XLUA 3IQZA 3GGPA 3JD2A 4JH0A 1HKUA 2OCPA 4LUCA 1NX9A 4M83A 4XJXA 3AJDA 4BRSA 2AEFA 2V7XA 2RGWA 2WD9A 3JVUA 2IYVA 5H82A 4YYEA 1R5OA 3MCTA 1C0KA 5DN6D 2P9HA 3HS3A 4NYIR 2FN4A 4FINA 1NMZA 4I1SA 4NXNB 3KEGA 4NBKA 3O4JA 1DGQA 4QU8A 1G8KA 2XNHA 4ZAGA 2C5LA 4YPFA 3KQLA 4C6TB 4PAOA 4NMMA 3RBVA 2JKZA 2Q8NA 2SCUB 3NHBA 1M2OA 1XP8A 3IVGA 1RS0A 1GAJA 1X7YB 3O9MA 3PFNA 3PVZA 2ZT7A 2R6FA 3BQNB 3I1FA 3RQSA 3UZUA 5EIEA 4KFCA 5K8JB 3LUDA 3M2PA 4TUYA 3U0BA 2KYRA 1H2RS 5KWIA 5LOVA 3WJ2A 2B83A 1Q5PA 2BHLA 3D6VA 1CD5A 2VAWA 2REXB 2XRYA 2Y1KA 221PA 1GR1A 4CM8A 2X23A 5ICFA 5T8KC 1UJ5A 2Z2IA 3KWLA 4LSWA 1RYHA 1RAEA 4GM1A 4JI3B 4F21A 2CUTA 4Q02A 4UCFA 3NIDB 4LZJA 4O63O 5BR1A 4LOLA 1O95C 1AHHA 5IEBA 2CHUA 3F6YA 1LLUA 4MDFA 1P7WA 1Q1EA 4JHLA 3AW8A 1EM8B 3D2AA 2PUHA 2B2XA 2JGNA 4TZ6A 4XWGA 3SR4A 2JGKA 1BOOA 1GUFA 4US2R 4D8UA 4RDXA 2W71A 4WJKB 5G53C 1ZJWA 3V4FA 4OHMA 5H0IA 1PF7E 1Y3HA 5ECGC 1Z37A 1VHJA 2YNMC 1O6CA 4R05A 1GQSA 1EFUA 1OZFA 1NJ2A 1QTNA 2DECA 2H7CA 2QMEA 3EVGA 4J1TA 3T06B 1PNRA 3BMCA 3HJCA 5E6UB 3T3GA 2P9ZA 3X1DA 4B6EA 5AW2A 1T8SA 5G0WA 1TJNA 4DLBA 3GEIA 4AW9A 3LRPA 4PNHA 4KXXA 1PS0A 2W7TA 5D2CA 2ORWA 1DAPA 2A6PA 2I1QA 3IAHA 2H06A 3REGA 3ZUPA 1VLJA 3G2MA 3DYIA 1YKSA 3JWJA 4RIFA 4Z7JA 4NBLA 1G7SA 3HP1A 3W5HA 1KVQA 4RD2A 5FOUA 4CEHA 4BO1A 2NUPB 3A06A 1SXQA 4HN9A 5DI3B 4EHHA 4G8BA 5B2EA 2OBLA 2BGTA 4PZUA 3B70A 4G0XA 4O1MA 1C7QA 1II9A 2CL5A 3EXEB 2DBQA 4AKIA 1KJYA 5FRDA 1YMVA 3A0UA 5IWAB 3UVEA 4D9IA 2V1UA 3ZY5A 5HJ7A 3GJ0A 1G8PA 5LUBA 2ZYWX 3QE0A 1NVDA 4E2WA 1JFTA 4Y6GB 3W2EA 1IBCA 5HOQA 4ITUA 5IDWA 2PMDA 2VCHA 2WD7B 2XWJI 3GPCA 4O4HA 3VR6A 3L0ZA 3HR4A 4C4ZA 3VQTA 1YJQA 1BHSA 2KS6A 4X54A 2G83A 1CUWA 3GZNB 4LCJA 3DNFA 1IN5A 5TPWA 2W58A 1YQEA 2O1SA 1JG7A 1MP0A 2EBWA 2X2OA 3EC2A 3H11B 4DR5B 2ID8A 3OJWA 2NG1A 1K97A 1JIJA 3BWXA 3MCWA 1J00A 1XAJA 2HQSA 2KSQA 3G5MA 4NWIA 5IZCC 3IAM6 4XJSA 1EXVA 1DG9A 1D2NA 4WXEA 3NAMA 4UHKA 3EXG1 2PYZA 4OB6A 1EGAA 1V16A 5AW1A 3CPJB 4YFYA 3B48A 2WTXA 3NDPA 4B3DA 1A9XB 1J8YF 1RLIA 2IYTA 1RI4A 2ZYSA 4ZRMA 4N7JA 4Q16A 3OOWA 1JDBC 2CVOA 2BEVB 4U7WA 3BA6A 1JWLA 1DRKA 3IILA 4DWWA 3LCJA 1SB8A 3EVNA 3MSXA 4NONA 3DJYA 1VCNA 3WMGA 3PC6A 2KI5A 4MVJP 1VKOA 2LBPA 1QIGA 3GAZA 1J2JA 1I3MA 3QVUA 3NHKA 4GP7A 4LZWA 1J2UA 1TI7A 3C15C 4TTAA 4QOJA 1E5DA 2I62A 4OUDB 3QEMB 3WRYA 4HUQA 1I3NA 3CWCA 1GLNA 3CINA 1SIBE 4TSRA 4QTXA 3N3BC 5C18A 4FM9A 5KWEA 5TMBA 1QGZA 1L4EA 4KUEA 4QRHA 2O05A 4AN4A 3KYJB 2X13A 1GHTA 1XC7A 3DM9B 4YDRA 2XYVA 2PK3A 2YZMA 3AHFA 1KEVA 4HGZA 4PLZA 4YR9A 3O9VA 1WHSA 3OO1A 1E8NA 1Y8QA 3G8CA 3PICA 4LC0A 3U7RA 4MYCA 5J1SB 2JS7A 4TLEA 2C4NA 3K1YA 1ADFA 3GVIA 4CI0B 1X6VA 3P9XA 3CR7A 4D82A 1I5EA 1HR0B 4KNYA 3ASUA 3G0GA 4KKVA 5LQKA 4CG2A 1UBJS 1RKVA 1JHRA 2X15A 4AJNA 3IDOA 3GA7A 4MS1B 4L76A 4QVKA 4RQAA 1SKUA 1D1PA 1XN4A 4FHFA 4RF5A 5JVDB 2ZIVB 2DUJA 4OJMX 3UT6A 3R7AA 3AEQA 3EX7C 1FP7A 2W2QA 4XIIA 2JKYA 2IYZA 2NO7A 2E0IA 2WU1A 3EWNA 4WGFA 2HO4A 4PRKA 4C0WA 4HRYA 5CX1A 2MSDB 1V5GA 3CZ5A 5KTTA 2I91A 5K4GA 1KNQA 2C04A 2HV8A 4QXRA 1UEXC 2ZJ3A 3F3MA 3U2QA 1YZVA 1G55A 1XDUA 1KIMA 4FFBB 1W4AA 1JYEA 1KJ8A 2AMYA 2VT7A 4FZVA 2RHGB 3S2GA 1EXNA 4LDNA 2QTTA 3SSAA 2JFNA 2XADA 2XRFA 4Y2VA 4GRAA 1O96A 3AESB 4ZCIA 4UBOA 3DZIA 3FI9A 1N0UA 4HGOA 3SJBA 2JH3A 1MOQA 1AX9A 4L4YA 3JQRA 4UCXA 3E2PA 3E7DA 4P92A 3WV4A 1QE0A 1XJCA 1ABBA 3WE7A 4M4SA 3FR7A 4A92A 1T10A 4C29A 1ZP6A 1AZLA 3GVCA 1M1NA 2XB2A 4Z4QA 3IE0A 4YJ2F 3JY6A 4WBXC 3UJ6A 2Q3CA 2VUUA 2HJVA 1C1DB 4PX2A 3WSWA 1NF3A 4HNHA 1DO2A 3OPYA 2HIMA 3COYA 1FRVA 1NPYA 4FD2A 4XVHA 1VJ0A 2CLSA 2IUUA 4D5EA 1LK7A 3RSFA 4RPIA 4M1YA 1GKLA 2BV3A 2WJYA 3BBLA 4FGWA 3GMDA 1Y4UA 5DASA 3RJ5A 3K05A 1V3QE 4GKAA 4IKOA 4Q3BA 3LBHA 4DUGA 4MJLA 4XRRA 3SKXA 2NTYC 1VMIA 4AG5A 3A2LA 1L4GA 1EE9A 1NI3A 3EEBA 4HEA6 5H8WA 5EIXA 1D8TA 2PZKA 2XH8A 1MX3A 1PQWA 1W75A 3DLCA 4QREA 4RHCA 5HUQA 3D7SA 3ROPA 1IAQA 3BL6A 1YHNA 2JGEA 1NLYA 3UWPA 4OX9B 1JG6A 1JQBA 3ZNQA 1RLJA 4IKPA 3TSOA 3UXMA 1OLUA 1YE8A 2JRLA 2ZBRA 3JRXA 3X1YA 2P9QA 1I3KA 5K3FA 3TRDA 1UQRA 4A1FA 2GA8A 1N0WA 2ZSBA 3QX9A 1KAHA 1FTNA 4ZVNA 2W42A 1YO6A 1XQ9A 2FSVC 2GEFA 1NQVA 3M33A 3WA7A 5F1YA 1PR5A 3I62A 3ABIA 5JWRA 4WN9A 4HXGA 1EX9A 1J70A 1H8HA 1K7FB 5K4AA 1QAMA 4OKNA 3PJDA 4B6OA 3MA0A 5JZBA 2COEA 2FW0A 5DP2A 1ORRA 3TLEA 1OYOA 5HRAA 5F98A 3N59A 3UWDA 3OT1A 2ZTHA 2Q5QA 1KR2A 1PLKA 4KAAA 1YQDA 4J0KA 5BV0A 1H2EA 1UEIA 1K3TA 4G07A 2GSDA 1PFUA 1WB4A 1TB4A 3GZTB 5E6UA 3DLHA 2I1LA 3NWOA 4I6JA 1MJNA 3E3NA 3QJGA 3NT2A 1RLTA 4Q01A 2A5JA 2FZLA 1T13A 1OW3B 5A03A 2QB5A 3AU8A 3AF1A 2EQAA 5CLGA 1PJLA 2O7NA 4DM4A 1W5SA 3DP7A 2OM6A 3VI3B 5ALTA 1DX6A 1PD1A 2IP1A 1PYOA 4B80A 3JWHA 3RUCA 2JLAA 2QQ5A 2Q6OA 2P30A 1KEEB 1AZTA 3W7BA 4JKYA 3VKVA 2V5AA 4L6IA 1H4TA 2DH5A 3TNFA 3N8HA 1TQHA 1JNXX 4G1FA 5I9MA 4FT2A 3LYUA 2CXUA 1VG1A 2WSYB 4NLLA 1KAOA 3B6JA 2VNSA 4AECA 4E03A 3HM2A 4BPBA 2IEYA 1BMDA 2AZTA 3URKA 1KDZA 3KXKA 2ZQYA 1L5SA 1BE6A 3EIHA 4ENWA 4PGGA 2YBEA 1R0RE 5F77A 1XFAA 3KQUA 3KZOA 1Y1PA 1NBMA 3TUZC 1JQAA 1IXRC 3TSZA 2CDBA 3IXLA 2VDOB 1L8QA 3A9VA 4Q9KA 1EFPB 3W5IA 2BGMA 2C78A 4Y2RA 2BZGA 4GYJA 2JLVA 3C85A 4JK3A 2CL6X 3RHSA 3EZLA 3UH0A 5INTA 2O1WA 1I14A 3TJMA 2JD1A 3SYKA 5IAAA 3ZPXA 5KTNA 1Z16A 2ONKA 1ORHA 4BNGA 2DLCX 2WKQA 1JEYB 2FPMA 3LC0A 5LMCA 2UYYA 2AC4A 1DPGA 4DCVA 3KFVA 3ZIUA 4QQKA 5KOYA 2V9ZA 1I33A 2FU5C 2HD4A 2J85A 2DG2A 3GUVA 3I1JA 4HN2A 3NALA 2GRUA 4JY7A 3H0CA 4I46A 3CXRA 5A71A 3TCXB 1SUWA 3AERA 4F71A 3ABRB 4I4LA 3GLKA 3ID6C 1PJ4A 4H31A 3ZQ6A 4G67A 4JLAA 2H59A 2JFVA 2KQUA 1DOAA 1TCBA 1ULUA 4J75A 5EGNA 3THWA 4DS3A 3TD6A 1CERA 1JKJA 1KZGB 1PR9A 2A9OA 3MGKA 1FNNA 2IHKA 1TAGA 2WF6A 1D4OA 2A3NA 4LF6B 1MENA 4NFYA 4MUMA 5LMZA 2ZJ1A 3IUQA 3OIYA 2DJIA 3SR3A 1FL9A 4XW2A 3CT6A 2BJWA 3DL4A 4MR7B 2P7IA 1HETA 1T35A 3EEFA 3FX2A 4MUIA 4QBTA 5C34B 1UDBA 2Z3VA 1AUQA 3L8HA 4KXLA 4Z3OA 1T1EA 1AV6A 4HATA 1SAYA 1JEJA 3KJHA 2QRMA 2VFAA 1KAEA 4EW2A 5B36A 3VU1A 1CDDA 2IU3A 2CLOB 3NHSA 3THRA 4EX6A 4NV1A 4MIYA 5AXAA 1LSUA 3QQ5A 3TUIC 3E22B 3WGLA 5JAZA 4DTCA 4U2GA 4H9GA 2G40A 2IXBA 2J3HA 2X22A 1QE5A 4LZLA 1V35A 1MDFA 1Z2PX 1Q95A 1Z7EA 2Q62A 3RSGA 2VT2A 2WA1A 3OZAA 3TQFA 4BLSA 4RQBA 4KE6A 4WZ6A 3W4JA 4M37A 3DBHB 1FX1A 4JU8A 1G9XA 2VSXA 5F5XA 1JIUA 3BKXA 1GP2A 3FCCA 1FZTA 1EFKA 2BFBA 3NJRA 4L8LA 4WY2A 1W94A 4KR3A 1ZHOA 7YASA 1UAAA 1YR7A 2WTMA 3QBEA 5IJ0B 2B20A 3KUKA 3QY0A 2XAUA 4ZYXA 3T41A 5CLIA 3QLUA 3DOUA 4H15A 1XMIA 3K6RA 1YJXA 4QGAA 2EJBA 2BH2A 1Q2UA 3IODA 4WL0A 5KCMA 4J0DA 1H2AS 4R2HA 2QRPA 1P6QA 1EB9A 1OI2A 1OTHA 1DTSA 2IQ5A 3LPNA 1FMJA 5DBHX 3WYCA 1KJJA 3OBIA 4QOIA 3UWOA 1GQFA 1YS2X 4XYLA 4LRWA 4RTKA 5HP4A 2PWYA 1P18A 1YR2A 3UJ8A 1SKYB 4IS3A 2F1RA 2X77A 3ZWMA 4NMWA 1XRJA 5BMVF 3UA3A 1A77A 3KPWA 1XF1A 2QAGC 3VSDA 2EP8A 1U2ZA 2B4AA 3OF3A 2FVXA 4ZEOA 4NJOA 1ID1A 3Q3IA 1RIFA 4XWKA 4G9EA 4YJGB 1Q6ZA 1PEYA 3FYHA 3RAGA 2HBRA 3H2YA 2RK3A 1T5TA 3O4GA 5I4IA 1RADA 2PWAA 4J7AA 2IDJA 1JE0A 1U11A 1ZK3A 4TLMB 2RGXA 4K1LA 4O4IA 2R00A 1DDGA 2P1DA 5FIUA 1TTHA 2A5YB 5D3MB 1HLFA 4PYQA 5UKDA 3QBTA 3TDKA 1MW9X 2OEPA 5DBIA 2HA5A 1NVAA 3U7HB 1KR5A 2HWYA 3KPJA 4MO2A 5JSFA 1PT8A 1YFZA 1V6AA 3GT3A 3R3UA 4O4JB 3GFSA 1L5YA 1GZSA 1Y7TA 3QOXA 4FGJA 4JQOA 4V39A 4NPCA 4FC7A 1VQ1A 2XBUA 3P1JA 4LJAA 2AEJA 2FW6A 1Z6AA 4XUGB 1QO0A 1UBUS 4NL4H 5EPUA 4B8WA 2YHAA 1TA4A 5DNEA 1VE9A 1II8B 2G1JA 2WVHA 3LWBA 4REQB 2HX1A 3RYIB 4FOOA 2RKWA 3FGZA 4D97A 3V2HA 2ZBUA 4MI1A 1L4HA 4RF3A 2IPAB 4RNDB 1D6NA 4E21A 3P9KA 1E9AA 4Z3KA 2G04A 1FSGA 1KQFA 4EPXA 1NVVQ 1E9SA 3EMDA 4DA0A 1GU0A 2DQYA 4DM7A 3CUTA 1WUYA 1AC5A 2PBFA 1PO7A 4MP8A 2I7TA 3AI1A 1WXIA 3KDPA 3SZRA 3RKSA 5MHTA 3A4TA 4POOA 2OV1A 1VLZA 3KLNA 3KEFA 3L02A 3QSYA 3L5OA 4OLFA 5DCYA 4BVJA 5CGQB 5GGXA 3LT0A 3ZV3A 1QZZA 4ZJYA 2UYQA 2O19A 4P53A 5EPEA 4EM6A 1TC2A 3BCHA 1R8QA 3PFHA 2OKCA 4ID3A 1SVLA 1ZU4A 2GF0A 4IIYA 4ZRNA 5CDYA 3IE2A 4Z86A 3WGVA 3IVXA 3OM1A 4DLWA 1Q7EA 1E6CA 2AHOA 2I4OA 2NACA 1SQSA 2PMWB 2QY6A 4ZAFA 2C9OA 3KK0A 3OCZA 1YJAA 2V0CA 5CJPA 3RV4A 9ABPA 1TIPA 1ZM2A 3OEYA 2NZ2A 1E4YA 2QX7A 3ZWDA 4NZNA 4PHHA 1Z4KA 2ZIUB 2E6UX 3JATB 3U13A 5KOHA 5FTWA 3VJRA 5DE3A 3ODPA 3RODA 5MN6A 3LDUA 1PUXA 1LJLA 1JQLB 4UVGA 1N2IA 1RJGA 5EZYB 3QKSA 4IY1A 3V4OA 4AKHA 3UPUA 2O8EA 2I6GA 1VE6A 1ODIA 5IH3A 4MKXA 1AKTA 1UCFA 3BF8A 2A57A 5E4JA 2XQKA 5K3DA 4ZZ1A 1GCUA 3RUEA 5AUOB 5CXQA 3ASVA 2WABA 1YAHA 2PVCA 4NDAA 1N6HA 4B4DA 4BLQA 1AV7A 1L4UA 1G20A 1VCOA 1R5BA 4OSEA 1AQUA 3UY4A 3WYGA 5KBYA 3I3SR 1VE5A 1STOA 3CA8A 4NNPA 4UBNA 4KZKA 3B36A 2V5UA 2AB0A 2OR3A 1UBCA 4CL8A 2EEPA 3AR7A 2DUNA 3AI2A 3E4DA 1H6AA 3MHPA 1MJHA 3M6WA 4R9NA 2CNWA 4CF4A 1U8AA 5EKDA 1LDBA 4KFRA 3EZ2A 4RK4A 4M38A 5F73A 3ZNNA 1NXVA 4JLVA 3U1VA 1V3UA 1T5LA 1PR4A 3U3ZA 1HM5A 2HR1A 3WWDA 4HR7A 3GQVA 3UN1A 4H4EA 3I5UA 1BGXT 1YSCA 1APBA 1H2BA 3HXMA 1FYXA 2RC5A 4K6MA 2VIIA 4S24A 3K5HA 1PHPA 1M7HA 4NVRA 4B44A 1DWUA 1YZFA 2VWPA 3GIWA 5E1MA 3ED1A 2N0SA 2B2CA 1EK6A 4FQ5A 4URWR 2IBSA 1RHKA 2IUEA 4KW7A 2ICAA 2P2DA 4LJLA 3VNRA 4IO1A 1T91A 5FUVA 3D3QA 1FJHA 3LXRA 3R0QA 3GLVA 3BMOA 5L4NA 3DV9A 4OOFA 4FX2A 2PUWA 2RAUA 4UEKA 2F8MA 5ICGA 1KTVA 1Y5IA 3GRUA 3GLHA 5C8VA 3JQGA 2D1YA 4MLCA 1MF7A 2ORVA 2WPDA 4DJEC 4YJFA 1JFSA 1V48A 2AMLA 2H3HA 3DPIA 3I9FA 3CUYA 2OMEA 3QPDA 3W3AA 1ZM3A 3DWGA 4LHZA 2QUJA 4P31A 5SZHB 2P9TA 2HYDA 2ODWA 4YPVA 4O0MA 3MD9A 3RSHA 4E4RA 1CS0A 5CA1A 3TLZA 1M2VB 2ZRIA 5HTKA 4OYYA 3GVXA 1OBOA 2WJJA 3DBLA 3MMZA 4G1BA 2AGVA 1OLSA 1Z4LA 2R97A 2OD7A 1JIVA 1L8OA 1PJ3A 1C9DB 1RKUA 1QIKA 3LQ2A 4JWKA 3K2QA 1JG4A 1QOZA 2CC2A 3R7LA 1H0RA 1ZPDA 2VKTA 4UVHA 3C6MA 3K92A 4M0CA 4ZT7A 3WZ2A 3GO4A 3RYFA 2GAAA 2QRZA 5KNDH 3OX1A 1TGVA 2Y4OA 4XD7D 4EBFA 4RVCA 1M6NA 6PFKA 5DGCA 3JZDA 1RM4A 2VHTA 4KVGA 2BHTA 4P54A 4JLPA 4AAYA 4UNNA 4Q4CA 1YS7A 3DR5A 4PAQA 1GVNB 1QIJA 3RVDA 1OXMA 1T26A 4P7FA 4R9VA 5I3CA 1IUKA 1PLJA 2DR0A 1ADYA 4P3YA 5JO9A 3VVMA 4IH9A 1FJXA 3GJXC 5DXJA 4MRMA 3DW3X 4IIUA 1HBJA 3MOIA 5IK2A 1GY8A 3L8MA 1XMPA 3I6MA 3RFFA 3GLGA 3TW6A 1AO3A 2MSNA 1J6UA 2EQBA 3KKKA 3QKRA 4RDIA 4BYMA 5DF1A 1G7TA 5F1OA 4ZGWA 1YA6A 3FCAA 3JQ8B 3OVMA 4PHGA 4P2BA 4YAUA 3KKQA 4HFMA 1C8VB 3LE8A 4EX7A 2VP4A 3PHJA 1R6VA 4D8WA 3IMCA 2ECFA 1UXHA 3OU6A 3R8FA 1A2QA 3DA8A 4Q3CA 1DJOA 1HDIA 1RACA 2F3RA 2PSDA 2XKBA 5D5PA 5AW8A 5ES4B 1YHZA 1ECLA 2C29D 3QSGA 4JNKA 3ZHQA 5BR8B 4U7DA 1L0BA 3P45A 4LMPA 4PHTA 5FQNA 3TGWA 2RG1A 4HWTA 3WXMA 1I7PA 4BLUA 4TPKA 4CXMA 1PZGA 2Y2VA 1AT1A 3NAQA 1SQFA 4BCBA 2GBCA 4QOFA 5JVDF 1CY6A 3JASA 4WHMA 1F17A 2BFDA 1RAGA 3M1AA 5AM0A 3BWVA 3RJ9A 3TTTA 2AMJA 3FNHA 3PEYA 3PHGA 1TO1E 2P5UA 4BNDA 2QD4A 2W6OA 5KU7A 5ARBA 4ALNA 3Q3VA 4KRYA 5NLLA 3AM4A 2ENUA 4HLUC 1FMTA 1RQ7A 4N0QA 1TECE 3TAXA 3JD0A 4BKUA 1DBWA 2GPWA 3MFQA 3D4OA 3O1LA 4MICA 3TK1A 2XA1A 3AY3A 2YWFA 3CXUA 4G4IA 4DHWA 2CK3A 3LRTA 1PQ4A 2QYHA 3HUDA 3UF0A 1NQ5A 1UJ2A 3C8HA 3WK4A 3UWSA 4MJ7A 3EXIA 4RPJA 1J9ZA 3KLPX 1DG3A 3U4HA 3W8DA 3QWAA 4C14A 4BX9A 3KUCA 1HFWA 1Z3IX 2N3ZA 2SKCA 3MD0A 4PICA 4WNYA 4J49A 5EMLA 3S68A 4MUXA 4EGSA 4MX8A 1Z39A 5K3SA 4DV0B 1CQIB 2NTVA 2DCUA 2CXXA 2QD1A 1FVXA 4P3KA 4ZOEA 2E5LB 3T8YA 1YV9A 2V7UA 1CUGA 4PYMA 2BJHA 4BQPA 2O5RA 5EFZA 4Z9YA 1KOLA 4RTQA 2UYHA 1TLFA 4Q1DA 4EPVA 3HKBB 2P9BA 2AG1A 4TWJA 5LQUA 3HN6A 1FFAA 5AJXA 1YUBA 2DY0A 2FVYA 3BD9A 3ZR4B 4S0ZA 4BNYA 3N2KA 5E6RB 1M6EX 2XNDA 1KU6A 3ZNOA 3EZYA 4PCAA 1X77A 3NGMA 5KX5B 3C8UA 3NV9A 4FONA 4L50A 5C4MA 1PNOA 3NGXA 1TCVA 2YWHA 2XI4A 2IPLA 3FPGA 1NN0A 3I30X 4QDKA 4TVBA 1BS1A 4HJRA 3UYLA 4BO9A 1E0AA 3NBFA 3I45A 3TXAA 2HLHA 1C0PA 3N86A 4KYVA 4H17A 4NJMB 4RPGA 4CKBB 1BA3A 2OKGA 1S1CA 1ODJA 1QIDA 2J45A 4GYYA 1SKAA 1QIHA 1UMKA 1ECPA 2YOGA 2Z1MA 2ZLBA 2PKYX 3BJMA 3C3JA 3D9QX 3FDXA 3H9CA 3O73A 3ZX5A 5BQFA 3IX7A 3NNSA 2ATXA 1AA9A 4GX0A 2ZETA 3U16A 1PYGA 1BVUA 1F6BA 2IQIA 3OFND 4UXHA 5L4SA 1H1LA 1EUDB 4OJQA 4HAIA 5BN4B 3CVVA 2GGSA 2JB9A 4ENTA 2C3OA 4WMLA 4CM7A 4YRPA 4Q4JA 2A0FA 1RBZA 2YJNA 2I80A 1XTIA 2NZ8A 2ZBDA 1ZH6A 3QELB 1Y6FA 1KO1A 4DQLA 2Q5FA 4BLVA 2PUAA 3PXAA 2PD3A 3K0AA 2P6PA 4G1CA 2WFLA 4QUHA 5JQWA 2I76A 2V6BA 1L4FA 3IH5A 4FDUA 1RYYA 4X3CA 2O5EA 2R6JA 3L1JA 2P9GA 1PHRA 2A0KA 2FAXA 1CZRA 4M9ZA 5DZSA 4Q7KA 2I4TA 1FXSA 4J07A 3M4XA 1DJNA 3KYDB 4BQIA 4YAGA 1JR2A 4Q4HB 2WIDA 4KE9A 1J0XO 5E2BA 4LF9B 2XOXA 2ZSJA 5BW4A 1G66A 1BDBA 3C3PA 3KE8A 3MXOA 3TYXA 2JGMA 4ONEA 4A2CA 1XU7A 1XDDA 5GADl 1ODTC 5KWSA 5JBNA 4MA5A 4K3UA 2AKEA 2BFFB 3VGJA 3SOPA 4UNPA 4CKYA 1KS2A 1YZNA 1K4MA 1ZNZA 2QW1A 5D3QA 3ZU5A 3OSUA 4ESEA 7MDHA 3LNTA 3K0SA 3UQZA 1NXQA 3QVGA 1NBME 1KC3A 4L8YA 1ZIOA 1AS2A 4MGHA 4YX9A 4I3HA 2PTHA 4I1PA 1DQYA 3MQ2A 4XQCA 4A8JC 1E2JA 1KWGA 2JBHA 4GPTA 4DKXA 3S2ZA 1JB1A 3OM9A 4KR9A 1KMCA 2VS1A 1PEDA 2FG7C 3I12A 1SZJG 4I8IA 4JOCA 4NYJQ 3ZDCA 3ETHA 4PYJA 4XKJA 5CVCA 1BN7A 1SHZA 2XTAA 3FTEA 1U4SA 4M8SA 3HZHA 1E77A 4ND1A 2B7BA 2GKGA 3HXTA 4INOA 3A7DA 2FUG1 5I6DA 3AQ4A 3AV3A 4BO3A 3QU2A 1TM1E 4XWWA 2X0RA 3WIBA 2I03A 3H2SA 3H1BA 2F17A 4PO8A 3LKDA 3GEHA 3W7AA 4R68A 3ZY3A 2BHRA 3IMKA 4BUJA 2OYSA 4MYSA 4D6XA 4J8PA 4TVKA 3OJFA 4ETIA 5JROA 2NZJA 3V80A 5K0TA 3SZOA 3WO1A 4BO2A 4I0WB 3OP1A 3V1TC 1RHMA 2QT9A 5DULA 1GDHA 1OSNA 2V7PA 3AINA 1JDPA 1RFGE 3FDFA 2HQOA 3C14C 4B33A 3CBQA 3EXHC 5BR4A 1X2EA 3C8MA 3CG4A 4TSFA 5BR7A 4Y2XA 2Q8QA 3NHFA 2AX3A 1O6FA 3IGFA 3Q6NA 4QHSA 1IHDA 4Z4CA 1AGYA 6AT1A 4MV0A 4D8YA 5KTKA 1INLA 3MUEA 5DI9A 3K9GA 2H0QA 5NULA 2I5PO 1KI8A 4BQNA 1KP3A 1AN9A 3ORYA 1SU7A 2JLUA 2JGDB 1PIWA 1SXJD 4ZD6A 1DCMA 3GGSA 5JS2A 3H2IA 1KO7A 3M3HA 2JFWA 4C4RA 5AHOA 4TV9B 5FLXA 1CUDA 1GT6A 4DLXA 1RR6A 3W4IA 1FQOA 1RXCA 3Q41A 3D6TB 3AJEA 4E6EA 3NDJA 2SHKA 5J5VA 4CF3A 3NBZC 4EW1A 4Z4IA 4HZIA 2YWBA 1CUVA 1Q0UA 3L0SA 4QOHA 1I13A 3SJUA 4CETA 1HSZA 2YXPX 5E7JA 4YXFA 2FR0A 2OCDA 3HDTA 4OQQA 3HCWA 3PPIA 5T6BA 1V95A 2XHZA 5EWMA 3VOSA 4QM6A 2BMAA 3AUKA 3V1NA 4AP9A 1KZ1A 1M0EA 4R16A 3U3KA 1TAQA 1E7WA 3MOSA 4RTJA 1I6LA 1ZITA 3TR5A 1U9ZA 1QTQA 2WJIA 1XHFA 5K8TA 4B9AA 3H2ZA 3B9BA 3H9UA 4W1PA 2ADMA 6REQB 1T5IA 1U3DA 1WZUA 4QULA 2OPBA 2WK1A 2WT9A 3RAEC 2NXWA 1LLCA 4L5YA 1XZEA 2RJ3A 1MH1A 2PGAA 1TQ4A 3A37A 3CF2A 4IIEA 3IEMA 3H6KA 4A10A 3HJAA 2P6RA 1OWOA 3RC3A 4CIVA 3BSWA 4QAQA 3HBFA 4YQEA 2FFQA 3SLRA 1R50A 5B58C 4LSGA 3KB2A 1WB9A 1IB0A 1QP8A 2E4UA 4A0FA 3N5CA 2C1EA 1K8ZB 2XEXA 1SD2A 5T4HA 1WNFA 2O3RA 2RKOA 4HZGA 1PSZA 3O1IC 1Y1RA 2GPBA 3OOYA 1QQ6A 3GLUA 5JNSA 1FUUA 1AMOA 2UU9B 3PXCX 3R7NA 4H7EA 3V00A 1V8PA 1WLYA 2AG8A 4YP6A 1T6NA 1U8TA 1ADJA 5F2KA 1N6KA 2XLCA 4MKIA 4JB8A 4WBNA 3EFOA 2V7TA 3HYTA 2J8ZA 4DLRA 1ZBDA 4RWEA 1CE8A 2J3MA 2ZUEA 3VHRA 2UZ1B 2QMUA 2PE5A 5LQAA 4EYSA 4CRWB 2OZEA 3ETGA 2WMYA 4EKDA 5DIZA 4XIJA 3L7NA 2NSYA 2B34A 4O3FA 1ZOPA 1TZBA 3TDNA 4IDDA 3MPOA 2B3DA 4OFWA 3T3MB 3WGGA 4DDUA 4YIHA 4R3NA 3OPNA 3PQFA 3VTFA 4FSHA 1F6DA 4LZAA 1T9DA 4QUJA 1PL6A 2GVZC 2X0NA 3IVCA 1NTOA 1XZJA 3HVJA 3P9SA 1ZIPA 4O4JF 4ZWNA 3PYMA 1SUSA 4D4IA 2P3OA 1F51E 5KI6A 3OEHA 4UTOA 3DOCA 1Q14A 5A5DA 1YB2A 4INJA 1OWMA 2C94A 3EODA 4W5WA 4YHBA 3WWZA 2G8NA 4OP3A 1UT6A 1X87A 1EDBA 1Y42X 3EXG2 4DGQA 5KQMA 1JHUA 2AXNA 2B4YA 3PXUA 5CBKA 3W1EA 2IH4A 3SBEA 1JQ3A 5CLLA 4ZQEA 4DDMA 1QNFA 1G5PA 1PV4A 1DL5A 4DLPA 5I4CA 2DMRA 2W2LD 4GC9A 4CDRA 1XROA 5AVVA 5TRTA 3HV0A 1S7CA 2V0NA 3JARB 5F4ZA 5BN4A 4EENA 1FFHA 5FTJA 1N6PA 1XJWA 3MTIA 3VU9A 1Z34A 5B7GA 1L7AA 1UFQA 1ND5A 1XCLA 4QPNA 4LJSA 2F9LA 1FU8A 4Y2JA 4XI9A 4CHTA 2ZZKA 4G1VA 1T0IA 3CB2A 3ZWXA 1P3JA 2FSUA 5AKGA 3ZCVA 1L4YA 1J06A 1SQ0A 2FSHA 5B4TA 1T1RA 1U0RA 5LDHA 4TXHA 2QSUA 1PBTA 3VR3D 3HA2A 4ER3A 3O8CA 3VOAA 1FUKA 4B3CA 3SSOA 1M8FA 2B1IA 4NAUA 1T0UA 3EEIA 1D6SA 4MQ6A 4OBBA 3CSUA 3SR0A 3ZTYA 2WTBA 4H6PA 5KB3A 5KYTA 5TF0A 1U6JA 3KR1A 4EK9A 1I2DA 1Y3FE 4GGOA 2QTVB 3LHDA 4BWYA 1E1QD 1MVLA 1VHDA 1XD8A 2FLWA 1ELOA 1WDTA 3IP7A 4QDJA 4QT0A 1XELA 5AXDA 1Z75A 1C4XA 1EK0A 2XCRB 2BTQB 3OF2A 2ZWVA 4LBVA 1QLWA 2ZE7A 2IUSA 4M7OA 5ECYA 1BKYA 2HSGA 5DW0A 4Z51A 1RWKA 5KTOA 4C7KA 2GHIA 5EZYF 5FQOA 1ULBA 1O9BA 3MS2A 4FI3C 5CHYA 2O52A 5K05A 2FSIA 2IZ5A 5KVCA 1W4BA 4IFTA 5JH7B 2Q1XA 4Q37A 5IN4A 2YWEA 1G3QA 3AFOA 3CUWA 4CMIB 2BYTA 2BONA 2NU9B 3CVXA 3AEYA 4V0NA 1U94A 4F5EA 1U3FA 4S2EA 1P2GA 4IG4A 4CL0A 1U90A 1ORIA 2IBTA 1IHOA 2YW9A 3TOSA 3RRJA 3SC2B 1A4RA 1LDEA 4LDPA 2BOVA 1RHRA 2W6JD 4DC9A 2OZLA 3KWMA 3ADOA 2P2YA 3TTVA 4DYDA 2TMKA 4HAXA 1N5JA 1OT5A 1QS0A 4KUGA 4C4YA 3N28A 2AG6A 2QEQA 1J8VA 1BN6A 1I01A 2QM7A 5F9FA 4BVFA 4B40A 2Y9PB 1YRLA 2NSLA 4BJHB 1KZ7B 4KOEC 1V1RA 1NVWQ 1ACJA 1M0WA 3W2IA 4UNSA 5ICMA 4AROA 3GW8A 4KZPA 1HTBA 3F6CA 1AUVA 4PHFA 4PSCA 3KVVA 4LK3A 3RK1A 3GLHE 4ZVQA 1FS4A 3FFWA 4BNWA 1HG1A 4J4TA 1A8PA 2DT8A 4BN0A 2YRXA 1G7CA 3SFVA 2EZ9A 4D3XA 1SIOA 3MIZA 3CZ4A 4DV2B 4BO0A 2I1WA 3KTAB 3E3LA 1D6JA 5B7PA 1IZYA 2X6RA 4GQIA 4H7PA 1AXGA 2XT9A 5FUYA 4PONA 1EWKA 2WF8A 4BNFA 4B2YA 1Z2AA 2QAGB 1P1KA 5TEWA 3ZW7A 5JAOA 2GESA 5LNK6 3CUVA 1XA4A 2ZJYA 2RJOA 1Z6ZA 2HA3A 3R5JA 1LFDB 3SEZA 3FLAA 3IDZA 1U3TA 1CDOA 1AOXA 1R8SA 1V11A 2VAVA 2ZRJA 1GCIA 4JQZA 2B1RA 3BDAA 3D2CA 2O3JA 5THKA 4ANFA 5FBLB 4JL5A 3EPLA 1NDUA 4K9RA 2R8XA 4KIWA 2ODTX 2BWJA 1SUEA 4RSRA 1B0PA 3HU1A 4ZT4A 3R9XA 1CF4A 1YI1A 2CHQA 1YFKA 4ZKEA 5EC8A 1I94B 3F98A 1W6RA 2B36A 2JCVA 2EWMA 3BULA 1D2GA 4FFMA 2IDZA 4GBJA 4IUYA 4KXVA 4WUTA 4D9CA 1KC1A 3DTVB 4J16C 2JD2A 1HYEA 1OBVA 1WCWA 2I87A 3WL5A 5CXUA 2VA9A 1XD2A 3VXKA 4E13A 1M5RA 3IAFA 5CH8A 1YTUA 3VKHA 2O57A 1O97D 5JR3A 4LFBB 3ZWVA 3AU9A 1YVRA 5DH9A 2YCBA 3V4ZA 4NBUA 3PLNA 4CU2A 4UAGA 4JUCA 4AKEA 3K6JA 2IA5A 3A6FA 2FZCA 4JL8A 2CBXA 1MABA 4K26A 1J0BA 1XOIA 1H6BA 5CPBA 3SYLA 3T3EA 1G3MA 3WK5A 2KMLA 2QIOA 5HMLA 2FSVA 5I8PA 1X1RA 2JI7A 2X8JB 4NZMA 2ZIFA 1X1DA 3FN4A 1FC0A 3FDIA 5K6RA 2ZIXA 2O8FA 1Y3IA 2O8CA 4ZCRA 5LMNB 1PV1A 2OM2A 4IJMA 2GZHA 3FMGA 1T36A 4BVLA 5CFMA 2EV9A 3AOEC 3OCYA 4YREA 4BMSA 4PZEA 2Q7OE 1RRKA 1XMXA 3E18A 4NFSA 2Q28A 4XSVA 2WHPA 3AY6A 1L4KA 4E3ZA 1YF3A 4LMAA 1MZVA 4EHNA 4HJXA 1VIDA 3LQRA 4E2YA 3WDKA 4AZ0B 1EHYA 2F1IA 2OCIA 3B3AA 3GLQA 3U4IA 4HGYA 5A9SA 5AW3A 5ERYA 1TF7A 3R1IA 3TLCA 3HYLA 2XGSA 4OK3A 4H0FA 2VT6A 5CNJA 3S7TA 3TJZA 2LUOA 2HI0A 5LXTB 5H02A 5BY2A 5JCJA 2M1XA 1LC0A 3KZMA 2B21A 2WWWA 4FNAA 1QKIA 1T5OA 3A9UA 3GVHA 3K4HA 1WCYA 1T2DA 4AM8A 2GOYA 2B78A 2Q21A 1JQDA 4PLHA 1JH9A 3MF4A 5B53A 5K1SA 2OLEA 2Q5IA 2ROQA 2XDYA 2Z4SA 3E0XA 4GR5A 3QU9A 3JQ9C 2GBPA 1EX1A 1CJKC 4RK0A 1VKJA 2EZ8A 3NBQA 4NBNA 4X1YB 3A1CA 2O0LA 1PG0A 1M8JA 1NKVA 2Y0CA 3BJEA 3FSRA 4HQKA 4C9BA 1USVA 3VPSA 4QVGA 3PGXA 2C4HA 4HDRA 1YJCA 3K3PA 1MNAA 1WV1A 3L7YA 4LYJA 3K1TA 3I6QA 4PRYA 2IP4A 4EZIA 3GFOA 4BBZA 5KYXA 2EBUA 1ZA1A 2D1TA 3BJRA 4JELA 1EESA 1UKVY 2WUFA 3E81A 3MJTA 1KYIA 2BEWA 3OSZA 3I9V1 3SDSA 1QPGA 2HC9A 4Q7EA 1ZX1A 2C7GA 1PZMA 3CT4A 3Q6MA 1QZTA 4HKTA 1NZJA 2GNOA 4BV3A 1I6KA 1LVUA 2Z6AA 1CRPA 4HAYA 4R41A 5F1PA 4CIYA 3KEOA 1E1DA 4PBTA 5BUCA 3Q8KA 3G3EA 1H42A 2A3RA 5G4LA 3IYLW 3W6OA 1L9KA 2XYQA 3VX3A 5AKYA 5EE5B 4XTCS 2GI4A 2YC2C 1TFUA 1L7VC 1X0VA 3GCZA 4Y2HA 5TQ0A 4ZVSA 2A67A 4HGPA 4DF3A 4W5QA 1NHWA 3SQDA 4TN5A 3RIMA 1NW6A 1ONSA 5BN3B 1XVLA 3ENNA 1P75A 2ODEA 2ZWPA 1N3BA 3K5WA 5KX5F 3QG1A 4G25A 1E0JA 3UJ7A 2HCTA 1PFWA 4CF5A 5K5EA 1SQ5A 3FWZA 4JJKA 2IPOA 5KREA 3TLJA 2DPHA 1IIRA 3V4RA 2HA2A 3A28A 5IP5A 1A7UA 4E14A 2P9EA 4IZHA 1T0JB 2ZKIA 1G2OA 4PX9A 4FSXA 1K7XB 2HF8A 1NVEA 2HUNA 1HC7A 3EQ9A 5ALSA 5SYNA 3CNLA 4MQEB 3EDCA 4WZAE 2EFYA 2ERYA 1K6JA 3KKMA 4GZMA 1T8WA 2FRDA 3IHTA 4ILKA