1Q1NA

Apo and holo structures of an nadp(h)-dependent cinnamyl alcohol dehydrogenase from saccharomyces cerevisiae
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
360
structure length
360
Chain Sequence
MSYPEKFEGIAIQSHEDWKNPKKTKYDPKPFYDHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQRVGVGAQVFSCLECDRCKNDNEPYCTKFVTTYSQPYEDGYVSQGGYANYVRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSMGTLISKAMGAETYVISRSSRKREDAMKMGADHYIATLEEGDWGEKYFDTFDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLSLKPYGLKAVSISYSALGSIKELNQLLKLVSEKDIKIWVETLPVGEAGVHEAFERMEKGDVRYRFTLVGYDKEFSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Apo and Holo Structures of an NADP(H)-dependent Cinnamyl Alcohol Dehydrogenase from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords Hypothetical zinc-type alcohol dehydrogenase-like protein in
total genus 107
structure length 360
sequence length 360
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2003-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1q1nA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1q1nA01
2PR2A 3FCOA 4LMRA 4I8XA 2GD1O 3JV7A 1VM6A 4IDAA 1LI4A 4NHEA 4EDFA 2B4TO 3ADOA 1YH3A 4EUFA 5BSFA 5JY6A 3HJAA 3FHLA 1N92A 1GCUA 2ZB8A 3EZLA 1LC3A 3FN4A 3JQ7B 1DRWA 4QO8A 3WBBA 2BFPA 2ZKLA 3AM5A 2VHXA 3KZVA 3V5NA 3ORFA 4NFHA 3DZJA 3V1YA 3ANLA 4YJDA 4WLUA 1AXEA 2Q1UA 1E3WA 4BNFA 1NVTA 3TZHA 2PGJA 5KVVA 3IIEA 5DN9A 4PVCA 1DXYA 3RVDA 2CDCA 2DBVO 4A26A 4AJLA 4L0QA 1ISMA 2DBZA 4CM9A 3V8BA 4OAQA 4JBGA 4IIUA 3DBHB 2AQIA 1JWBB 4FN4A 5JAIA 4U7WA 4MVJP 3IL2A 3ZH2A 4YDRA 4RJTA 1QYCA 2JFHA 2E82A 2W2KB 3GEDA 2ZYGA 2O3TA 3MZ0A 1PZHA 2WMDA 5JCJA 1WZIA 4J9VA 3DFZA 4L73A 3PWZA 4NQZA 4E30A 4NMHA 2J5RA 2ZTUA 2CDBA 1PL7A 2G76A 1MG5A 3GK3A 3QVWA 4DIBA 1P31A 1I33A 4O59O 4J16A 4PLHA 5IDXA 2R00C 4FGSA 3WTCA 3GVCA 4TZTA 4JP2A 2WSBA 3VAZA 3GDGA 3L6EA 4I9NA 1HLPA 1YQGA 4YT5A 4GPD1 1EQ2A 4MP6A 3QWFA 4CQMB 2P5YA 2AE1A 2VUUA 5COAA 2WEKA 4KWHA 4CM7A 2H1SA 4WOJA 1QKIA 3CEAA 2FZEA 2O7SA 3PIDA 5G0VA 2OXIA 1NQAO 3KYCB 3TN7A 1E3IA 2XXJA 1DHTA 4GSKA 2C5EA 4CMIA 3IP3A 3H9QA 4CV1A 5IF3A 1Z73A 1B15A 4OGWA 3PZRA 3JQ9A 1IHXA 4D0SA 3L4BC 4KOAA 1I3NA 1E6UA 4XYMA 3ROQA 4RV9A 1BXGA 3PLNA 4IMRA 1RYEA 1X15A 4BNYA 3PQEA 4M49A 2QRKA 1PJQA 4XJSA 1DAPA 4FFRA 1KEPA 1U3TA 5TSDA 4H16A 1VJ1A 4ZRMA 4S3MA 4FDAA 2X23A 3GVPA 1NPTO 1ONOA 2Y1CA 5AXCA 3ROMA 3DC2A 1NVMB 2NQTA 4YAJA 3RUHA 4YAKA 2O2YA 3KYCA 4RF5A 4BQPA 1KEWA 2Q4EA 4RLHA 3ANMA 4WEOA 4CMAA 4MP8A 3ZNNA 1U3VA 3GAZA 1WAMA 4HXYA 2V6BA 3JYPA 4I5GA 4XB1A 4EJ6A 4PLYA 2ZB3A 1LU9A 1IPFA 1GYRA 2GO1A 2HMUA 3COSA 1JKIA 2YJZA 4J91A 1KEVA 1JW9B 2I5PO 3E48A 4PLFA 5C7LO 1JAYA 4WGGA 1UXGA 2E4AA 4K6CA 4RPJA 4CM9D 4Q3AA 4DYVA 5A9RA 1E7SA 1GPJA 1XU7A 4Z0PA 1LEHA 3K2BA 4OYRA 3T4XA 2YHIB 4FW8A 4OJNA 1LTHR 2B36A 3QVSA 4LCJA 5L9AA 1LBEA 3PJGA 3JD2A 4CMCA 1G0NA 3I3OA 5I9LA 1BG6A 3WSWA 1D4FA 4Y6PA 4MJLA 3PJFA 4O0LA 1NQOA 3DZHA 1N9GB 1VL8A 1ZCJA 1JVBA 1EEHA 1YBVA 1PWZA 5C7OO 3TSCA 5ADHA 1O5IA 3AJRA 2IEBA 2W4QA 3UICA 5ICMA 3ZV6A 4BNZA 1IULA 4B4OA 2H9IA 3RD5A 2FOIA 4D3DA 3KLMX 3AY7A 5GY7A 3H7AA 1JA9A 1TI7A 2VWGA 4QXMA 3RUEA 1A7KA 1P1HA 1Q0LA 3D5TA 2TMGA 1UDCA 5K1SA 4JBHA 2VYND 4MVJM 2Q3EA 4P4NA 4BNJA 4YT4A 4ZQBA 3NUGA 3NTRA 4IDGA 5L3ZA 3U62A 3A4VA 1P45A 3AI1A 4Y6RA 2QYSA 4BNVA 4MKRA 5KVCA 4CPDA 1JKFA 1BXZA 3HDQA 4ZJUA 1VC2A 4K1LA 4LCEA 4XQ9A 2X0NA 1U4OA 1EFKA 1YDWA 4L74A 4F46A 3BIOA 2DPGA 4E5KA 3QWIA 1ML3A 1DFGA 4YB8A 2AW5A 1K3TA 1JN0A 2HUNA 3VC7A 3ITDA 2OGUA 4XEHA 1T4DA 4XR4A 2Q99A 4YCAA 4DQVA 3F9IA 3GN2A 3EK2A 1PSDA 1LDYA 3NDRA 3QA9A 4TMFA 1KIFA 1DJNA 5JLAA 5IXSA 3FR8A 4PG4A 3E8XA 4CV2A 2CMDA 5BSEA 3HG7A 3VOSA 5DZSA 2Y99A 3NV9A 5JSFA 1PGQA 1U3WA 1K6XA 2UV8A 3RSHA 1TLTA 4R1TA 3IS3A 2AG5A 3DZIA 5EL0A 2HO5A 3ZDFA 2VN8A 4MVJA 1EFLA 1PJTA 4U0KA 2BFMA 1ZBQA 3JQ9C 4YRDA 3JQDA 5TS3A 1ENZA 4A7PA 2HDHA 4B7XA 3WNVA 2YHUA 1KEUA 3JD0A 4AJ2A 5ITWA 1ISFA 4DLAA 1Y81A 3TNLA 4NBUA 4BHTA 3KYDB 5B4TA 1UP6A 3V2UA 3ZHYA 2HK7A 4FIZA 1BW9A 4LRSB 2VRBA 3WGZA 4YBZA 3QIVA 1KERA 1EK5A 3EZYA 3H4VA 3GG9A 3RWBA 1J6UA 3AW9A 3LLSA 3OSUA 4OXKA 1F12A 4PG5A 4DWVA 3FNFA 4QO7A 5LC1A 2FHSA 3RUFA 1P1KA 2CVOA 1B2LA 1PX0A 5I9NA 1O89A 2IRWA 2SCUA 1CIVA 4NH4A 4XJTA 5ENDA 5IG2A 1HE4A 4O1MA 4KUEA 2VZ8A 4I9UA 1NWHA 2NU9A 4YACA 2G0TA 4RVHA 3TQHA 1A9ZA 3D1LA 4PZEA 2JD0A 3VVCA 4BO2A 3AU9A 4GGPA 4F6CA 1TVEA 3LU1A 5K9ZA 2AXQA 3ZWOA 5TLSA 4ALKA 3E9NA 2EHDA 3WGTA 2FP4A 4IIVA 1QSGA 4YTEA 1MFPA 2QG4A 3OJFA 3Q9UA 3H5RA 4M87A 3GPDG 4CLOA 3BHIA 1U3UA 1PIWA 4JNKA 4RVSA 3W4KA 3W6UA 2O2SA 1XEAA 4N54A 3V2GA 4IS2A 1U5AA 4CQLB 2LDXA 2GN6A 3I4CA 2GF2A 3OFSA 4B7UA 5LCXA 3I83A 5I7FA 3QVXA 1HDXA 1EBFA 4E3ZA 3WYBA 4B3JA 2YV3A 1ONPA 4ALIA 5IDYA 2GASA 4XRRA 4L75A 2D4AA 1YL6A 4PG6A 4CM4A 5C3MA 4MVJD 3DTTA 1ZK2A 4EZBA 1C0IA 1GQQA 5A9SA 3DR3A 5CFZA 3STHA 4AJ1A 5TGDA 4D3SA 3HN7A 4BNWA 3CIFA 3INGA 4BOYA 1T2AA 1I30A 2VZ9A 3DAGA 2J6IA 1M6HA 3PHIA 3MCVA 4ZGWA 4PLZA 3L0DA 2BFAA 4IJVA 1SB8A 3IP1A 4LSWA 4J0FA 1Z82A 3NGLA 1XSEA 3BTOA 3DHYA 2Q45A 3ENKA 4D3FA 1I01A 3KVOA 4HFNA 3K30A 4YR9A 4RQUA 3PYXA 4JJIA 1I2ZA 5F1KA 3D4NA 3ZW9A 3I9MA 3ZHZA 3PTZA 3ASVA 4C7JA 1C1DB 2P9GA 2LDBA 4CMKA 4CR8A 1Q7GA 4YAIA 2BLLA 2Q46A 1IE3A 1DEHA 1YGYA 3FBGA 4J2OA 1HTBA 3HFSA 3W6ZA 3WR5A 1H6BA 1HSOA 1AE1A 2DBRA 5FF9A 3D0OA 1YB5A 3FNEA 1VL6A 2ZTMA 4YT8A 1ZK0A 1LSJA 2GN4A 1QYVA 3A9WA 3EGOA 4NR0A 1B7GO 1Y9AA 3QW2A 4BO0A 1QR6A 3ANNA 3GHHA 3LSYA 3ZU5A 5CAEA 3JQBC 4BNTA 3KHUA 4O5OA 1OOEA 3TF5A 3GT0A 4AICA 2X5JO 4PLGA 5HTOA 3M2PA 4EEXA 4WLEA 8ADHA 2YFQA 4NK4A 4DC0A 3PEFA 4NU6A 3DTYA 1I24A 4B4WA 1H2BA 4FR5A 1RM0A 1B14A 2PKQO 3F4LA 4LRTB 5U9CA 3PGXA 4CM8B 4JK3A 2NSDA 5AYVA 2IEDA 3HUDA 1CETA 5KIAA 3OETA 1JTVA 2VT3A 3RU9A 1NFRA 3PFFA 5TC4A 3NRCA 1YOVB 1SOVA 3O26A 2XXBA 3WGIA 3Q2IA 4CJXA 4XGKA 4IXWA 1RPNA 1QG6A 3RFVA 1LSOA 1C14A 2B5VA 1PZGA 4HWKA 4IQ8A 2D0IA 3O8QA 2C2YA 1YDEA 1IHYA 3BMOB 4FC7A 1XHLA 4MVJH 2NVWA 4OL9A 2JCYA 1K6IA 1PTJA 1U7TA 1U2GA 2B69A 3H6KA 2JD2A 3Q2KA 4BKPA 3VH3A 5CPBA 1WWKA 1SOWA 3GQVA 4WEQA 5JPIA 2HSDA 1R4MA 2P9EA 2VRCD 4BL5A 1YBMA 4WOKA 3G49A 1GFSA 2X0JA 5GZ6A 4YAGA 3UN1A 3VHRA 4Z9YA 3RCBA 1U9JA 3WX0A 4PIVA 4YRAA 1CDOA 4BUCA 3SBOA 1LUAA 5IDWA 4WJZA 4YAEA 4OO3A 4ZA2A 3OECA 1SMKA 2IYPA 5GZ3A 3ETGA 1H6DA 2UUOA 2Q49A 2ZCVA 4DMLA 2PV7A 3CH6A 1VI2A 4BVAA 2EP7A 2YYYA 1IUKA 1UDBA 4G81A 4GL4A 4UUPA 4HFRA 3VZQA 3JYLA 4GVLA 4AJNA 1RM4A 3AY3A 3ENNA 4Z9FA 3PJEA 4BS9A 3RC7A 4Q39A 3WGYA 4A0SA 4D45A 5C37A 4R4JA 2QQ5A 3OBBA 1XR3A 5CPFA 3S2EA 3VPFA 3UH1A 2PK3A 1FK8A 3DL2A 5TT1A 2AA3A 4JCOA 1E77A 4DLLA 1P1JA 4XZ3A 4Y8VA 9LDTA 4BGVA 1HDOA 4FPXA 1EDZA 2VZ0A 1U1IA 2GNAA 5JFOA 3MJCA 4DXHA 3PI7A 3UUWA 3JQ6A 4RF4A 5I8ZA 2VYVA 3JYOA 2NWQA 4KTVE 5JAQA 1HKUA 4C4OA 5JC1A 1C1DA 3JQGA 2CD9A 1K89A 5JAZA 4HFMA 4X54A 3E9MA 4URFA 4UVGA 4NU5A 5L7YA 4AJOA 3VVBA 1P9LA 3PIIA 4ALLA 4E2WA 4TROA 4ITUA 3OM9A 3EYWA 1H94A 1ZH8A 1YQDA 2JAHA 2JAPA 3QY9A 3JQBA 1NM5A 2GUGA 5A1TA 1EVJA 3AUAA 1DJQA 3VZSA 1QV7A 4XGIA 3LQFA 4YEDA 3UKOA 5FWNA 3WXBA 1XGKA 1V0JA 3GFBA 2NQ8A 5CDUA 1B26A 2AEJA 2V65A 3LC7O 1O6ZA 3QJ5A 4LISA 3QRWA 5DBGA 2XOXA 1C1XB 3K92A 2OUIA 1NR1A 1SC6A 3JD1A 1BTOA 1P77A 3GA0A 1LDGA 1X0XA 1HDGO 1ADFA 1OAAA 1AN9A 2Y1OA 2NACA 4BO1A 3ZU2A 4YXFA 3E03A 2E48A 2VQ3A 1F14A 2EW8A 4IGFA 1NASA 2I6TA 3LT4A 4KZPA 4BNLA 3ICCA 1NNUA 3ZI0A 1ISJA 1CF2O 1MG0A 2VOJA 5CG2A 3OQBA 3JTMA 2UVDA 1FDUA 3IAHA 3RFXA 1AXGA 1NPDA 3MEQA 5JO9A 3P5SA 3MTGA 3K31A 2Z1NA 4ZN6A 1O0SA 2C54A 2AQHA 5U4QA 4CLXA 1I0ZA 5KKAA 3OF2A 3GR6A 1PR3A 1GZ4A 1WXDA 3P19A 3WSVA 1GPDG 4BNNA 2O3UA 4DTIA 4RPGA 2BELA 1ADBA 3WYCA 3I5MA 4LW8A 1YJQA 4CLEA 3SVTA 4MIEA 4M86A 3MTJA 5EESA 2OZPA 1ULUA 2QRJA 2GGSA 2Y93A 1GUFA 3FSRA 3DZGA 3W8DA 2GSDA 3PJDA 4B4VA 4OSPA 3WGHA 3DOOA 2JJYA 4YA6A 5EPOA 6LDHA 2BGKA 2J5QA 2EGGA 2HK8A 4OXYA 3WWYA 1IZ0A 2PKQP 2VNAA 5DDIP 1GV1A 4IDBA 4CM1A 3KETA 3RKRA 3TFOA 5A06A 5I7SA 5KTKA 3LC2O 3HSKA 4CMEC 3TJRA 2EWMA 3IJPA 1DIBA 4A73A 1V3VA 3PZBA 1DHRA 4BB5A 3L6DA 4O63O 3GOHA 1LC0A 4GKVA 3DOJA 1N7GA 3F4BA 1DDOA 3SC4A 1G6KA 4FFPA 1OC2A 1PS0A 1PS9A 4MP3A 1NHGA 5AXDA 1HDCA 2PGDA 3UVEA 2WYVA 4AJIA 4EBFA 3ZWBA 4RORA 2C82A 3IUSA 1E3JA 1R12A 3EMKA 5HA5A 1Y1PA 3G3EA 3DMTA 2RAFA 1A7AA 1E7RA 3DAFA 4G65A 4IJKA 3PFWO 4IINA 4MDHA 3ZHXA 4XIJA 4H7PA 1SEPA 1WW8A 3SXPA 4OHUA 1NR7A 1J49A 4FFMA 1ZO8A 4BO9A 4RO0A 1XQ6A 1PQWA 1UAYA 2OO5A 4I5DA 3WNQA 3G17A 2PNFA 4TQGA 3QQPA 1P1IA 5C7IO 2CF5A 3OEWA 3BTSA 1U8FO 3GDOA 2YHIA 4HFJA 1GD1O 3RUDA 2HMWA 5JDCA 3UHAA 1HETA 3INTA 3U3XA 3S8MA 1Z6ZA 4PLPA 5JC8A 4N5NA 3GUCA 5C5IA 3VPSA 2GN9A 2XAAA 4DBVO 2D2IA 4XYBA 2HU2A 4WASA 2P9CA 1LJ8A 4J1SA 3ASUA 4C7KA 4R3NA 3ZZNA 4R54A 4IMPA 1DC3A 1E3LA 1XYGA 3PYMA 2Y0DA 1EUCA 5ENVA 4KQXA 2DTDA 4J0EA 4I5EA 4R1UA 1UR5A 3CSDA 3DZKA 2NU8A 2NM0A 2HJRA 3H9GA 2POQX 4GI2A 2PLAA 2XPCA 3VPXA 2O50A 3C7AA 3C24A 2YV1A 4ND5A 5EJ2A 4R16A 4FFOA 3JYQA 3KTDA 3WMXA 5KWEA 4XGNA 4GLLA 2DFVA 4XYEA 3I9KA 4FD3A 4JBIA 4WLVA 4Z3DA 2IXBA 4FOOA 4BO3A 4FOSA 3WFJA 2NNLD 4CMHA 2PGLA 1VSUA 3Q0EA 1Y6JA 2YDXA 1T26A 4XYGA 1TT7A 4IY1A 1ZZEA 4A5OA 1OMOA 1ZXLA 3ZWPA 1EE2A 3ABIA 1KC3A 3GVIA 2EG9A 1ZSYA 1AHIA 4WCFA 2IODA 3R3JA 5IFLA 4BMVA 2HKIA 3DHEA 4UUOA 1RJWA 3GNQA 2Y67A 1DSSG 4NIMA 4FQ8A 5G0UA 1Q2XA 4B8WA 3CZRA 4P4LA 2OOSA 3H2SA 3RJ5A 1ISIA 4B3HA 2J3IA 3P2OA 1C0LA 4LK3A 5G0TA 3U9LA 3QVTA 1SZJG 4Q3EA 4D42A 4QUKA 2PZMA 3IMFA 2JD1A 1JDJA 3KO8A 1B16A 3RBVA 2E49A 2V7PA 4AJJA 2IZZA 1HE2A 4TKLA 4ALJA 5KJCA 1ZNQO 2J3KA 1E6WA 4HBGA 2J5KA 3ZWXA 3DB2A 3OP4A 4II3A 2A9FA 1GQYA 5DNAA 1E0DA 3JCZA 1PJBA 1PGJA 3DWFA 4L76A 4EUEA 2GDZA 4DVJA 4PZDA 4EUHA 2O23A 1D1TA 3GAFA 2X4GA 1LQUA 2ZB4A 4B79A 4NBRA 4JX8A 4NFYA 1M6WA 4Q3NA 3NJ8A 1MV8A 5DCUA 2FWMX 1ZEMA 1UZNA 2A35A 3C3XA 4MKZA 2JCVA 2WYWA 2FSVA 3H9JA 3MWDB 2EERA 4MKXA 2GRAA 4QFCA 4ND3A 2X9GA 3S2FA 5A02A 5CDYA 3HDYA 4Q9NA 4IJWA 4E0BA 1B0AA 1NVGA 2VHZA 2YDYA 2PY6A 5G0WA 3WQSB 2IZ1A 1GR0A 1LLQA 1HSZA 5DF1A 4ND4A 4R41A 2RH4A 1UZLA 2DTXA 4KTTE 3ETDA 4W7HA 3GLQA 3UAGA 2AEMA 2RHRA 4M1QA 2I65A 3H3FA 4XWYA 5JMWA 4XDZA 4WK6A 5DULA 4DBZA 1Y8RA 3OA0A 2AEFA 3BA1A 4HX5A 1KVQA 2J3JA 4XQEA 4OXNA 1WLYA 3DONA 3FBTA 4BNIA 5KJ1A 3Q6IA 1UDAA 2O3SA 2HMTA 3LLVA 4CL8A 1S6YA 3DHNA 1ENYA 1HL3A 3X2FA 1DLIA 4QEDA 1NAIA 1IPEA 4RDIA 2FR8A 4IDFA 2D5CA 1LDBA 2FR1A 3L9XA 3QWAA 1DLJA 2EKLA 3PWSA 4CM4B 1U8XX 2G17A 3T7CA 3LF2A 4IBOA 4IDDA 1EK6A 4B4UA 4GSLA 3F1KA 1E3SA 4I08A 4RZHA 3GUYA 2B0JA 4J2HA 1ISHA 1VKOA 1Y8RB 2C29D 1BSVA 4HP8A 2FMUA 2JL1A 4J4TA 1P0CA 3HDJA 1MC4A 3OJEA 1U7HA 1O8CA 3NT5A 2QW8A 5L53A 3EUWA 3E82A 5ER9A 3O8QB 4CV3A 3K8ZA 4IDCA 5KCZA 5JDIC 4P4GA 3BMOA 4PRKA 2J3HA 1D7OA 3JYNA 1PJ4A 3RUCA 1JKJA 3U4CA 3AM4A 1ARZA 1KVUA 2B83A 3HADA 6ADHA 2NLOA 3FTNA 4INAA 2GZ1A 5T67A 3WQQA 3BXXA 3GNSA 1GZ3A 5I8WA 3GPIA 4QQRA 4F3YA 1MXFA 3RBZA 1L7DA 4KDFA 1U2DA 3RFTA 4NBTA 1MLDA 2I9PA 2DFDA 4NPCA 4I9HA 1EMDA 3FF4A 3WLEA 1GZ6A 1LNQA 1AGNA 2H63A 3BMNB 3OJLA 3PDJA 4CLHA 5U1PA 4BB6A 1X7GA 2JCXA 3AUUA 3U5TA 2GPTA 3BZUA 1W6UA 4IZHA 5JBIA 3K73O 7MDHA 3EVNA 2Q2VA 3DZBA 1ZMTA 3AOEC 2Y66A 4CLRA 1C0PA 2UYYA 4RDHA 3BMQA 2RBEA 1R0KA 3O4RA 1YONA 3B1KA 1V3UA 3CE6A 3KEQA 4OOFA 4YJGA 1MC5A 3D3EA 3VZRA 3E6AA 1Z45A 3I9NA 2YQ5A 2FPIA 1BHSA 1DRUA 1BWSA 1NHWA 1PJSA 1NFFA 3V2HA 5HRUA 5CEEA 1P33A 3WDSA 4JXKA 3RC9A 1T2CA 4E13A 3RC1A 1R15A 2QZ9A 1UP4A 4Y9DA 1ZSNA 4PFJA 5A5FA 5T6BA 1YB1A 2PWZA 2WE8A 3OMLA 4GLOA 4YQYA 1EVYA 1YWGO 5BNFA 1B3RA 3GVXA 4EJ0A 1JU9A 2ZATA 2QX7A 4RPKA 1YB4A 5T8KA 4AJ4A 4D46A 1DC6A 1N2SA 3IDSA 3ZWMA 2CUKA 2BMAA 1FDTA 3Q11A 3D3WA 3D64A 3UW3A 3L07A 1LSUA 4R9SA 3DZFA 2GZ2A 5J23A 1T1SA 2Q1SA 3P7MA 1Z7BA 3KYDA 1TEHA 2X0RA 1U28A 4E5MA 4G2NA 5AXBA 2GLXA 2Y0EA 5G4KA 5F1OA 4HUJA 4FGWA 5LDGA 2VHYA 4CL3A 3LT0A 4MVJG 5KVQA 5IZCA 4BGIA 4U6SA 1LRLA 2BRUA 1ISGA 2I66A 3ZWCA 1V8BA 4LVCA 3HNPA 1C1XA 3SJ7A 4BGUA 2WD7A 3ZV4A 1GV0A 3GDFA 4BNGA 4GX5A 4E2YA 3ZV3A 2EKPA 2NTJA 5L95A 2C59A 4WCFB 1T2EA 3PLRA 3F5QA 2HJSA 3JQEA 3UCEA 4D43A 3L4BA 2EGHA 1SAYA 3GEGA 2EXXA 5BNIA 2DAPA 3Q3CA 1K6JA 4YT2A 5L7TA 2HMSA 1D1SA 1Q7BA 2P91A 1RM5A 1T2DA 3S55A 1MB4A 1A4IA 2I3AA 3DBVO 4Z6KA 3NDIA 3BHMA 2IYOA 4OKIA 3B1JA 2I99A 2YUTA 3GZNB 3NTQA 3NYWA 2FN7A 5JE8A 3HQ4O 2NU6A 4CLOB 4CMIB 4PN3A 1NPYA 4FC6A 1A9YA 2YW9A 3EY4A 2GERA 3LK7A 1LSSA 1K2WA 4YQZA 1EVZA 3U4DA 3ZV5A 4CQLA 5L7WA 5JNLA 1UUFA 5JMPA 4DGSA 1VJTA 2D1YA 2H6EA 5JXWA 5FI5A 4BKRA 1MXHA 1WDMA 1QLJA 5TX7A 3TPCA 3LT1A 5H82A 1BDBA 3BAZA 2C07A 1O94A 1F17A 3FR7A 4XD2A 4R1NA 3R6DA 1J5PA 1XG5A 3TZCA 4NBVA 3R1IA 4TVOA 2DKNA 5DCWA 1BMDA 1MFZA 5THQA 3PQDA 2HAEA 1IY8A 4CMBA 3GMDA 1PQUA 1Y7TA 3IC5A 4PLTA 3NEPX 5A4DA 3H8VA 3ZWNA 3L9WA 5B4UA 3BMCA 4ESOA 2D3TA 1MGOA 2BHLA 2EF1A 4CLRB 2AQKA 3PQFA 4CMEA 3ULKA 1T4BA 3WIEA 1R4NA 1CJCA 1IB6A 1PEDA 4FJ0A 1RKXA 2ZTVA 4W9NA 4WLFA 3HZZA 2ET6A 4ZQEA 2BF7A 2C20A 2RH8A 3ST7A 5JAMA 4IM7A 4FFNA 1LXCA 3ZWWA 1DC5A 1OBFO 3WG9A 4DL9A 1F0YA 4GMGA 5BSHA 4HKTA 3Q9NA 3WGQA 1ADCA 1GUYA 3D5QA 4HNHA 1E5QA 3A1NA 1E1LA 5CDTA 2YQ4A 1PJLA 3NDJA 4L4RA 3V1TC 3TRIA 2A92A 4JJGA 2HLPA 4ONEA 3GMSA 5T57A 2VHWA 5BNTA 3MJTA 4FJ1A 2NVUB 1F06A 3E5MA 2CSUA 1WMBA 1GAEO 4JIGA 4JJFA 4RVFA 3WJ7A 3OICA 2ZCUA 1I3LA 4B8ZA 3LT2A 3NAQA 4J43A 4EI2A 4RPHA 4DMMA 4ID9A 4BIIA 4A03A 4U5QA 4OKNA 1V3TA 1VE9A 4UEJA 3D7LA 4FJ2A 5FFFA 5JYDA 3PDUA 2Q2WA 1P1FA 4J49A 1YRLA 1KS9A 4CMGA 1EUZA 3RIHA 3C7CB 4JN6B 1M66A 3A06A 1H5QA 1P74A 4AJEA 2O7QA 4OIMA 3MJEA 2GYYA 3E18A 4ZQHA 3OQ6A 3VH4A 4EYEA 2X6TA 5IN4A 1ZFNA 4B3IA 4IQGA 2BFOA 2FRDA 4ZU3A 2BGLA 4MVJF 5B12A 1KOLA 4K9DA 1E1NA 5DCYA 4BKOA 1EUDA 3AM3A 3EHEA 4LGVA 5BR7A 3GEMA 2RCYA 3SC6A 4E5PA 2OBNA 1H6CA 4TRRA 1SEVA 1ZUD1 4UVIA 1YE3A 1GYQA 3K96A 2E37A 3CXRA 3DFUA 3H65A 3AY6A 3OA2A 4L8VA 1ADGA 5CDGA 1G1AA 3TZQA 3A14A 2B35A 3WTBA 3RQSA 4IXTA 1PQPA 1W4ZA 5HBRA 1ENOA 1I2BA 2VWQA 4OSOA 4GH5A 1PGOA 3DO5A 4WNIA 5B37A 3MOGA 3PHHA 5IDQA 1JWAB 2PTGA 4XRGA 3JQFA 3AOEA 1NQ5A 2WWRA 4CQMA 5IZ4A 1UXJA 3TOZA 1G0OA 3R0IA 4R5MA 3DBLA 1DC4A 2A94A 2GZ3A 1SCUA 2NU7A 4UUMA 3TFQA 1HE5A 1R66A 5G0SA 1GUZA 5JW6A 3KSUA 4MIOA 4BO8A 1B8VA 3MJ4A 2QZZA 3W4JA 1JAXA 1PGPA 1X7HA 1MA0A 3HWRA 5F5LA 2EJVA 3WWZA 2DTEA 3UCXA 5BSGA 2AG8A 2X9VA 1K0UA 3DBRA 1IL0A 3JQAD 3BMCB 3MJSA 4A10A 5G2OA 3ZU4A 3KOUA 1ZK4A 2RHCA 1BXGB 1NBOA 4MIYA 1Q0HA 4PVDA 1F8GA 3L4SO 4EEZA 3AK4A 1P44A 5JCJD 1GTMA 4XYLA 5JDIA 1BGVA 1LA2A 1HDYA 1ZKMA 1DIGA 2R6JA 3QSGA 3IKTA 1UXHA 2PFGA 3F6YA 2VTDA 1YXMA 8LDHA 1W73A 3ON5A 1B8PA 4R1SA 1XLTA 2BD0A 5G4KB 3A28A 2FPGA 2O48X 2EIHA 4W7IA 3ZCXA 3CKYA 1HZZA 1TT5B 4WE3A 5JYEA 2ZJ0A 3IOYA 4MVJE 2B5WA 3WBFA 4BO5A 4TRNA 4GBJA 4RL6A 4UVEA 3B6ZA 1ORRA 1U4SA 3JQFC 3WMWA 4RF2A 3IJRA 1R0LA 3B1FA 4TKMA 4J1QA 1ZSVA 4KDEA 3TZ6A 1E3WB 4PG8A 3W4IA 4RCVA 3H2ZA 3MJVA 3KXDA 5CG1A 4FS3A 2PD6A 4EW6A 2C2XA 2O4UX 1FMCA 1X14A 4A2CA 4YPOA 5DP2A 1PZFA 2VYVD 4OM8A 1BVUA 3BTUA 5EQDA 2DUWA 5GZ1A 5IZCC 3L77A 4M54A 5DOVA 3EVTA 1DIRA 3RAJA 1VJ0A 2ILTA 3GVHA 1SPXA 1QYDA 4WLOA 3TOXA 3GZNA 4GMFA 5B4VA 4L4SA 3JD3A 3PHLA 4BGEA 4Q3CA 2W2KA 1O9BA 4BQRA 3AFMA 3H5AA 2DQ4A 3RI3A 2WTBA 3S2IA 5FYDA 4MPDA 4D41A 3IKVA 4CUZA 4M8SA 4NJOA 1GEGA 1NAHA 4BV8A 1UAGA 1X7DA 3ZW8A 1M75A 1RYDA 3EAGA 3RJ9A 3C85A 2JFGA 2EW2A 1UH5A 2DBQA 4BO4A 5CHEA 4J3FA 1BRMA 4II2A 3OJ0A 4GX2A 1V6AA 2UAGA 3OIGA 4E5NA 1S7CA 1ZXBA 1KVRA 3O38A 4W4TA 1Y8QA 1DB3A 4UAGA 2W2LA 1J4AA 4NDNE 1I3KA 2H5LA 2UDPA 2ZQZA 1A4UA 4Z9XA 2C7GA 4BNHA 1KETA 1D3AA 4R9RA 4RPLA 1UZMA 5KVSA 2VWHA 2EP5A 3FI9A 4N5LA 1A27A 2BI8A 4GVXA 2P2SA 3OIDA 4CQMD 3DXFA 5KJEA 3I4FA 4K26A 1VLLA 1UXKA 3PHJA 1YVEI 2YZ7A 4UEOA 1ONNA 2P68A 3SLKA 4R69A 2ZQYA 3DQPA 3ZWVA 3AI3A 3AFNA 1B3BA 1Q7CA 1UP7A 3FNGA 2JHGA 4RLSA 4HV4A 5CDSA 2O3RA 3KYBA 4EGFA 5L4LA 3ZWAA 5G4LA 3FD8A 3NKLA 4NG5A 3VKVA 1MUUA 3O03A 1DIAA 4WCDA 2HMVA 4CR7A 5AQ1A 2P4HX 5IN5A 2FZWA 5TIIA 3I9OA 5L4SA 2PA3A 1HXHA 3ITKA 4WPGA 4N7RA 5COQA 1HT0A 4CMJA 5EERA 5CP8A 1TA4A 1E7QA 2CY0A 3TDKA 2DU8A 2ZB7A 4UEKA 4J7UA 4DLBA 4U8GA 2X5KO 3HN2A 1FF9A 3RKUA 2X7HA 2CVZA 2DPHA 1ZW1A 2NVUA 2OORA 5A5EA 4CM3A 2BI7A 1C0KA 5THKA 1GADO 3M2TA 3V1UA 2Q1WA 2DUUA 3PPIA 2R2GA 1SO8A 3DMYA 1DFHA 1NP3A 4YWJA 5H83A 3SX2A 5A03A 2WE7A 1HE3A 5DBIA 5JO0A 2F1KA 4AG3A 5HS4A 4RZIA 4ND1A 3KSZO 1CYDA 1TT5A 3LC1O 1XKQA 4DIFA 3ZWYA 3AU8A 4S1VA 4CM5A 3KRTA 3KM0A 3UXYA 2WYUA 3ZHBA 2EEZA 3GN1A 4E5YA 1E7WA 1LDMA 3I1JA 3GGPA 4UREA 3WOHA 1M76A 1XDWA 4DUPA 2J8ZA 2G82A 4AFNA 4IGEA 4NJMA 4AL4A 1YO6A 4UUNA 3DOCA 3NT2A 2PH3A 4JLWA 1E1KA 1GY8A 1WZEA 2QHXA 4ALMA 2PZKA 4DQXA 3GGGA 4TVBA 3W8EA 2CFCA 1UXIA 1W0CA 3FWZA 3JQ7A 4ND2A 1L7EA 2VT2A 3F5SA 1YQXA 4E6PA 2IDZA 2WD7B 4QTZA 3CZMA 4MO2A 4NZ9A 1HLDA 1X13A 4P38A 4ALNA 2OP1A 3GG2A 4IZIA 4O6VA 1Q0QA 2ZIZA 1D8AA 2R00A 2WDZA 3M6IA 1XWFA 5H81A 4KMSA 4GWKA 3PK0A 1VL0A 1EQUA 1QMGA 4J9UE 1N1GA 1LLDA 3M1LA 1PWXA 1X1TA 3DMTC 1ZEJA 5EMHA 1R4MB 1X0VA 3WFIA 3DBLB 1H9AA 4XCVA 4YVFA 3FPCA 3KSDO 4R51A 3RROA 1Y5MA 3OH8A 5TJHA 3ZNQA 3NGXA 2B4RO 3OEYA 1KVTA 3KB6A 4I1IA 3LYLA 1HDZA 1PS8A 2VTEA 3N7UA 1T2FA 2QRLA 1E7MA 1I36A 1Z74A 3BYZA 4BNMA 4WUVA 4YJHB 1YBAA 1N8KA 3RU7A 1LQTA 3GRPA 3PRJA 2IE0A 1NYTA 3QWHA 1DBVO 1KVSA 1Y5RA 3UGKA 3FPLA 4TWRA 5JCXA 2AQ8A 3QV1A 1GU7A 4AJKA 5A04A 3NTOA 3UCFA 4DPLA 3U09A 1CERA 2PZLA 2P4QA 4F6LA 3E1KA 4NK5A 3VTZA 3EC7A 5B1YA 2VYNA 3NX4A 4KQWA 1BW9B 4BNUA 3SJUA 4E4YA 2JHFA 3QLJA 1GQ2A 1ENPA 3UF0A 2V6GA 2VRCA 2YV2A 4ZQFA 1SB9A 1H9BA 2I3GA 5MGBA 4YJHA 1A72A 2EJWA 3K2EA 3QP9A 3HE3A 4TSKA 1NXQA 5AXAA 4KP7A 2D59A 4JGBA 2WJPA 7ADHA 1GL3A 2EV9A 3SLGA 1E7YA 4OQZA 1LLCA 3I6IA 1M2WA 1ZJYA 1Q1NA 1OFGA 3N58A 3PWKA 4UULA 4OQYA 4WKGA 1SNYA 3NJ4A 1PL8A 4E2ZA 4ZVVA 2Q1TA 5FI3A 1JVSA 3M1AA 3KUXA 2JKVA 4HY3A 4U0JA 4F45A 2X22A 3K6JA 4PLCA 4IUYA 1ZJZA 4QSMA 4GAEA 3NT4A 2Y1FA 3I9JA 4PZCA 1OZAA 1E92A 3RBXA 2YY7A 4ILKA 5ES3A 2I67A 1HEUA 5F21A 2NTNA 1HDRA 9LDBA 4K6FA 2Z5LA 2Z1MA 3UFXA 1AUPA 1WP4A 3SEFA 3GFGA 4ZRNA 4NFSA 4XQCA 2AHRA 3QE3A 3ZGYA 4BKQA 1DO8A 4JROA 1BXKA 4FFLA 3FRJA 3VZPA 1ZIDA 5A9SB 2X5OA 4HADA 1PZEA 4BO6A 1ZK3A 3FNHA 1A5ZA 3BTVA 3LZ6A 2CDAA 4E32A 4J1NA 4LVUA 2FSSA 1Y8QB 2BKAA 1QXSA 3HFGA 1R0SA 3K5PA 3JSAA 4H15A 5IAAA 1XQ1A 1YL5A 2X1HA 4DREA 2RIRA 5IJZA 4R68A 1NWCA 4HNGA 3ICPA 4E12A 2B4QA 2PH5A 5ICSA 1GDHA 1PL6A 2E6UX 4G5HA 1W8DA 4L4XA 5TRTA 3ROKA 3B70A 4ZQGA 1EE9A 2G1UA 2GN8A 4R5HA 1R4NB 3G1TA 4RQTA 3HHPA 2X8LA 3AUTA 4BNKA 3WS7A 5TF4A 1I2CA 2Y0CA 3OJOA 4WECA 2F00A 3KEOA 1PJ2A 1L1FA 3RUIA 5F1PA 4CUJA 3U0BA 1DRVA 2CNBA 4GQAA 3BMNA 4Q3DA 4XQGA 4XR9A 4DC1A 1Z75A 2DM6A 1JLLA 2UUPA 2V6FA 4PLWA 3ETEA 3OIFA 4W99A 1HF3A 5JDCC 1P3DA 1FDWA 5EIOA 3U4IA 2QIOA 1P1RA 4R01A 5AOVA 4CR6A 3DDNA 3LDHA 2CVQA 4M89A 1I8TA 4WNCA 2W98A 3JQGB 4GWGA 1JQBA 4OH1A 5A3JA 4BMSA 3VPGA 2Y68A 1T1RA 1NFQA 4YJGB 4Y67A 4NNJA 5F3RA 1CWUA 1V35A 2PKRA 3F3SA 3TZKA 4BO7A 2NV6A 3RASA 5L51A 1YL7A 3JQ8B 1ZMOA 3B20A 1ID1A 1OI7A 1WDKA 3GZ4A 5DT9A 1LDNA 4QT0A 2Q50A 3E9QA 3JQAB 4P22A 2XF8A 2Z95A 1WVGA 4E31A 3DBRB 3E5RA 5KJ6A 4J6FA 1B8UA 3ONDA 4FSHA 4UVHA 2IXAA 2JFFA 4W6ZA 3FTPA 3AUSA 3U4HA 1HYHA 5EQFA 4N18A 4EJMA 1CQJA 1R16A 1V9LA 2C7VA 2X0IA 3OHSX 1R6DA 2D5AA 2HQ1A 4NBWA 1HYEA 4IJUA 4AJPA 1EBUA 1KY4A 5TT0A 1PR9A 1VSVA 3I9LA 4FB5A 1Z7EA 2G5CA 3KLPX 1P0FA 1QV6A 2OMEA 3R3SA 3G1UA 5BQFA 3TL2A 2NTVA 1IYZA 1PJ3A 3ZU3A 5F5NA 4ROSA 3F46A 4ZD6A 4IS3A 3IUPA 1FJHA 1GCOA 5JS6A 1O95A 4B7CA 1XELA 1WMAA 4AJHA 5ILOA 1IZ9A 3H9EO 3LF1A 1WPQA 4RVGA 3ZN2A 2Q4BA 3INRA 1XU9A 4J7CA 5GMOA 4XA8A 5HM8A 1SBYA 2D8AA 4BKUA 5I7EA 4BNXA 1KYQA 2X86A 1DIHA 4WCFC 4LN1A 4YRBA 3AWDA 4N5MA 1WDLA 2PD4A 4CV0A 2FY8A 2HK9A 2HRBA 3GF4A 5A9TA 4I5FA 1HWYA 2EKQA 5T64A 2DC1A 3WGGA 2W2LD 5L40A 5LDHA 1H93A 4ZICA 3DBHA 1DFIA 3ONEA 5TNXA 3VPHA 1GEEA 3WLFA 4CLDA 1A71A 1H2HA 1QORA 2ZYDA 2VUSA 4IQ0A 4Y98A 2NUAA 3T7EA 1FDSA 4RVUA 1H0KA 1EVIA 1PJCA 4DRYA 4Q3BA 2ZJ1A 5DOZA 3CMMA 2W90A 3GC6A 1LRKA 1Y9EA 2WD8A 1YS4A 2DVMA 2HRZA 3OQ1A 3I6QA 1M67A 1FDVA 2AE2A 4H3VA 4U6QA 5I7VA 1TXGA 5HS6A 2Y1GA 4ZHSA 3VKUA 1I5RA 4W82A 2VUTA 1CRWG 2VOEA 1AHHA 2O3QA 3IQDB 3QHAA 3C1OA 1E3EA 3WGOA 4GGOA 1PU2A 2ZK7A 4PGFA 2OL4A 2GCGA 2NVBA 4UVDA 4J4HA 5L45A 2NADA 3S1LA 5ITVA 2Y05A 5KNLA 2C5AA 2OHXA 3MWEB 4CODB 1C3VA 3K9QO 4P8RA 1ULSA 4PCVA 5FEUA 4TRMA 4CUKA 5BT9A 4DPKA 1NX6A 3PP8A 4MVJI 4RF3A 3C7DB 3WJAA 3GHYA 3EW7A 3HB5X 2O3JA 4W9NC 4CM6A 1KY5A 3C1AA 5ER6A 3PGJA 1VKNA 3H3JA 1LLUA 2FPPA 2GR9A 3UOGA 2AMFA 2X58A 3GRKA 4J7XA 1XIVA 3W1VA 3F47A 4D44A 1QYWA 3RUAA 3RC2A 4J90A 1IOLA 3JQ8A 4IPTA 5K6AA 3WQRA 4NI5A 3MOIA 3VH2A 1N1EA 1QLHA 3DAPA 4PRLA 5COBA 1I10A 1MP0A 1TB4A 3L6OO 3KBOA 2V6MA 2CZCA 1HRDA 4PG7A 2PZJA 2QYTA 3O9ZA 1NQTA 4J4BA 5EINA 3VTFA 4E33A 5KJFA 2WM3A 1UJMA 2IZ0A 1RM3A 5L4NA 1I3MA 4D79A 4XX0A 3GY0A 5DBFA 2PD3A 3D4PA 5ILGA 2YFHA 1CQIA 3D4OA 2P5UA 4FCCA 2Y1DA 4A27A 3T4EA 1N5DA 3AI2A 3TWOA 1OC4A 2A4KA 5A3VA 4TRJA 1VPDA 1ZVMA 3CMCO 4AVYA 1LRJA 3EDMA 2BGMA 1J0XO 4OMUA 1U5CA 1DOHA 4BMNA 2VWPA 4D0RA 1QYXA 3WIDA 4EITA 2VCYA 2Y1EA 5KOIA 4YJFA 1N9GA 1HYGA 1EZ4A 4DA9A 5KKCA 4DYDA 3I52A 5K6AC 3KV3O 4TZKA 5EN4A 1QP8A 1DAOA 4JP3A 2DLDA 3BHJA 3DEYX 3VDQA 4D7AA 4QFDA 1X1EA 3PHGA 4LMPA 4IDEA 2W8ZA 3PYLA 4QECA 2HCTA 3C1TA 4FBGA 1KBZA 1NTOA 4GX0A 1E6EA 3GGOA 1XCBA 1YJ8A 3VDRA 3I23A 1DPGA 1XA0A 2B37A 3JQCA 4MOWA 1H6AA 4DPMA 3G79A 3CUKA 5CEJA 5MDHA 5K0ZA 3C8MA 3JD4A 1F8FA 4Z3KA 5CEFA 4YJFB 1VRWA 3FWNA 3W8FA 3LVFO 2TMDA 3H5NA 4M55A 5HWSA 4E21A 1LX6A 1YKFA 3QWBA 5TJ9A 3X2EA 5AVOA 4RVDA 2FR0A 5IXYA 2ZTLA 4XKJA 2O4CA 4XDYA 1BVRA 4DQUA 2OBYA 3PVZA 4OOEA 4KUHA 1PGNA 1K5HA 4QX6A 3CINA 5T5QA 3P2YA 2OFPA 2OP0A 4LSMA 3CTMA 1RWBA 5T8KC 3F1LA 4MINA 3D3WB 1CEQA 1BDMA 4YYZA 1GYPA 3HB4X 1N7HA 2X9NA 4CM8A 1T24A 5JY1A 2Q2QA 1FXSA 5I9MA 4JQCA 2DT5A 3AOGA 1ZK1A 4PLVA 4GKBA 3TL3A 4Z0HO 3JQAA 1YOVA 1HZJA 3GH3A 4KUGA 3S2GA 3WYEA 4R3WA 1R37A 3G0OA 4XIYA 3VH1A 2VHVA 3H9UA 2I76A 4BV9A 1E5LA 5DP1A 3WB9A 2ZYAA 3GNTA 4XB2A 5TQVA 3CPSA 3BMQB 4Z0TA 1KC1A 1T25A 3ROPA 1EDOA 3Q1LA 4K28A 3PXXA 1QRRA 2VNSA 3ONFA 3HDHA 2BH9A 4RGBA 4Y6SA 3N74A 1LDEA 3QVOA 4WLNA 1WNTA 3ZNOA 4KWIA 4L9RA 4J1TA 3ADPA 2C0CA 1E1MA 4NJMB 4E2XA 3ZNPA 5A05A 3U49A 3WICA 4DIOA 4GX1A 1MX3A 2CF6A 1I32A
chains in the Genus database with same CATH superfamily
2BDUA 3HYLA 3FCOA 2FMFA 3UJ9A 1WUTA 2GD1O 3MFQA 1NW4A 1W9HA 4PWZA 4F3CA 1LI4A 4KI7A 3WJ2A 3ADOA 5BSFA 4Q4JB 5JY6A 3CT6A 3FHLA 1NNI1 1S3SA 1Q1QA 3CSUA 1RLOA 3EZLA 2P75A 1U0RA 1UM8A 2GYVA 2XR1A 1DRWA 2ZJ7A 3O4GA 4V0LA 4DN6A 3SZLA 5F2NA 1IBSA 2BFPA 3P1JA 3R9XA 4YP1A 3VTKA 3MRXA 3VSEA 5JJBA 4AZWA 3LQ4A 1IBKB 3UAVA 3ANLA 3P0IA 2QQ0A 3N0WA 2V59A 5KNDD 3T3OA 5DGTA 3CSSA 5DHUA 3E3AA 5ALTA 5KS2A 4PYKA 1E8DA 1NXXA 4KMRA 2DBVO 4N7BA 4WKNA 4A26A 3VFDA 2W6JD 4EVIA 2PUAA 3ER8A 4OAQA 4JBGA 4IIUA 2PGXA 3DBHB 4D8XA 3F4KA 4TTJA 4FN4A 1YI8A 2ZBGA 3U3JA 2H51A 3IBCA 3EGIA 4U7WA 2HCFA 1OFVA 4IGAA 4AKEA 4CJXA 3OQVA 3ZH2A 4D82A 4EW1A 1EJBA 2NTYC 2PSEA 1QYCA 2ZYSA 5CCDA 3RU2A 4RJTA 3V4SA 5B3KA 3ICEA 1JLHA 3T12A 2GRUA 5JCJA 3FUCA 1THGA 3DFZA 3K09C 2VQSA 3L8ZA 2J5RA 3AR8A 2PS0A 4QPCA 1QU2A 3JY6A 2M6RA 2IBMA 2NPFA 2QN7A 3QVWA 4FYVA 3HACA 2C9BA 4WADA 3CJRA 1Q7EA 3X1KA 2BGGA 1VLZA 1QJ4A 3GVCA 1I4TD 4TZTA 5EEGA 5LA6F 4JP2A 4B4DA 4EA8A 3U1TA 2WSBA 4Y1FA 5FJJA 4I9NA 1N7JA 1C9JA 1GLVA 1ZUNA 2R60A 1A9PA 3PVCA 4MP6A 4NZOA 4PW0A 3SZ3A 4C7VA 5B3JC 5COAA 4I1RA 1PYOA 1S01A 3QXCA 1MQ8B 2OHHA 3EF0A 1E58A 2ZIGA 4X1IA 2W0SA 1QKIA 2DSNA 3CEAA 521PA 1RRFA 2DQSA 3UXEA 2RK3A 2YL2A 1OXKB 3IEPA 1DT5A 4C3VA 1D2NA 1KGDA 3C3DA 4RFSA 3WL5A 1E3IA 1RABA 1J0EA 2V8BA 1DHTA 2XXJA 4CMIA 4Z86A 1T9HA 1U11A 1ZWKA 3H9QA 4CN9A 1OFUX 1Z73A 4IFIA 5JATA 1NKTA 3PZRA 1IHXA 1WZUA 5IYZF 4F2PA 1KEEB 1V8PA 2WQ7A 3L4BC 4TKVB 5DSTA 4AMUA 3VO1A 2ZJYA 4XYMA 3ROQA 3IR7A 2EQBA 3V80A 1G1MA 5DM60 4EHNA 3TO5A 3KALA 1X15A 4IMRA 3HWWA 3WLJA 4AP5A 3IMCA 2WIGA 2QRKA 4F6RB 4XJSA 3PGA1 1IN4A 2BYTA 4PHFA 5DNCA 1DAPA 1U0BB 4BGDA 1DI0A 3PCTA 1U3TA 4H16A 2O0HA 3F5FA 3UK1A 4FDAA 1Z4IA 4O2RA 3GVPA 4HDRB 1LPPA 4YAKA 2NQTA 2H4XA 4BYMA 3HSSA 5FIUA 3HU1A 2ZPAA 4MQFA 4RF5A 1KEWA 4WEOA 3SZRA 2IP1A 1J99A 1JV2B 4TQUS 3ZNNA 1I0LA 1U3VA 1PAUA 1WAMA 2R62A 4PSCA 4A8PA 4TKUA 5KQSA 3ABQB 3PX3A 3ZGLA 2OR3A 4I5GA 3IKMB 5ECWA 4EJ6A 2JBAB 4PLYA 4EQZA 8ATCA 1CJSA 1SPBS 1LU9A 1GYRA 3WLNA 1XZAA 3MRSA 1RTTA 2OCIA 1JKIA 2YJZA 4J91A 1UZUA 4MW9A 4CL0A 4RM3A 3QHQA 3DMPA 5C7LO 1IG0A 1FVXA 1HBJA 2CFSA 2OORC 4RZ3A 1YFZA 2E4AA 2HSJA 4Q3AA 4DYVA 5A9RA 3GX1A 3QU2A 1XU7A 1QGUA 1ANKA 2REXB 1GLNA 4RDCA 5ICCA 3OZDA 2WUVA 1NQXA 4OYRA 4Y9SA 1B76A 2XA2A 3T4XA 2AEEA 3KT0A 1I7QB 4CT0A 2B0CA 3JD2A 2XGGA 3BRSA 3STXA 2V9CA 1KOGA 3AEUA 3G2HA 4DLVA 5I9LA 2P9FA 2AVNA 3QVVA 1PUJA 4LI0A 2OPHA 2CJPA 4Y6PA 1RACA 2Q6IA 4D74A 1R8XA 3V8RA 5GONF 3ZXIA 4UQPA 2E5FA 3PJFA 2ZRDA 1X1BA 3HJNA 4O0LA 2QLTA 4MQLA 5LZ5A 5AW8A 5IKPA 4ZOCA 3WLIA 1JVBA 2QD1A 1RI4A 5ADHA 3EXAA 3V42A 1YZYA 1E2KA 4UHDA 3UICA 1QGOA 3GUHA 1MTZA 3FF1A 4NFLA 4Z9BA 4C0XA 5J58A 5KOYA 3RSGA 1UOOA 1REQA 5K20A 2WWXA 1W6RA 3H7AA 1R9MA 1NLYA 2XTMA 3LVBA 3QOYA 2VQDA 3QQ5A 3PUIA 1NY6A 3AF3A 1JKXA 3CG4A 1Q0LA 3D5TA 3FKSD 5EJEA 3NO4A 4UAUA 3RS7A 2VYND 4HYEA 4MVJM 5KYUA 4YONB 3H83A 4NATA 1T9CA 1LBHA 4P4NA 5EUMA 4BNJA 1RQ7A 3OUUA 1Y4UA 3KSRA 3NTRA 4ZQBA 3ORHA 4FYPA 4TUYA 5EZYB 2VP3A 4GI7A 3SBDA 1ZN7A 3U62A 1N1MA 4EB8A 4EG8A 1U0GA 3V2IA 1UWKA 4ARUA 2QYSA 3GEHA 4JB2A 3TZEA 3D4LA 4NY1A 4FFBB 3NTXA 3DCYA 3ZZ0A 2C96A 3O82A 1OWOA 1YJCA 2PLRA 2VVTA 2ZRCA 5BN5B 4LCEA 5JD5A 4IH1A 1SCAA 2X0NA 4H6WA 4XQ9A 5HKLA 2OAEA 3VAYA 4R8MA 2H5JA 2FMXA 1EFKA 4HWRA 4V0KA 3VOAA 1TNDA 2CBXA 3BIOA 2BUCA 4CV0A 5JANA 4W8OA 4E5KA 3NHZA 5JNVA 3QWIA 3B7WA 2X0EA 1G98A 1ML3A 2FUNB 2HUNA 4CKBB 4XEHA 1ULBA 4TYMA 3HCFA 3WQHA 2O2HA 2R8BA 1Z3CA 2JFNA 2WDPA 3K8OE 4YCAA 4DQVA 3M49A 3N0XA 3ICQB 1RRMA 2ZVDA 1LDYA 10MHA 1T8WA 4JI4B 2PGAA 1FTGA 4Q9JA 4E70A 1O0CA 1GO2A 3IDQA 3LBAA 1PTKA 1KIFA 1DJNA 2FWBA 3L7CA 3P9YA 2XCUA 4AY4A 1N36B 4KXFB 5L3SB 1ZNZA 4CV2A 1NMEA 2I78A 4BVBA 2ID8A 1W4BA 2J9GA 3NS7A 1VMKA 3CRZA 5BSEA 3QFFA 1WHTA 5DZSA 3WL4A 4D8VA 1A8HA 2BTQB 1E2PA 1KBQA 1N0IA 3F5MA 3KL2A 1XKXA 4HBZA 1E4VA 1DJPA 4PBRA 3UG6A 4R1TA 5IARA 2XKAA 2A1TS 1VMAA 3UYLA 1D4ZA 2BPOA 2VN8A 1Q6YA 5LA6A 4U0KA 2BFMA 5IFKA 2J3LA 1ZBQA 3JQ9C 5FUXA 1ENZA 2Q3FA 3AB8A 4A7PA 2YHUA 3C97A 1KEUA 1NVKA 3JD0A 2G04A 3NI2A 1K86A 4BTEA 4Q9LA 5TDHA 1ISFA 4DLAA 3KYDB 1UP6A 4FIZA 4B76A 4LRSB 3U44A 4O4LF 2VRBA 1KBOA 3OZBA 2MIIA 4YBZA 1VCMA 2EFYA 3BAFA 1QK5A 2CVFA 2ZZKA 5AVSA 1EK5A 3H4VA 2BH2A 1JFFB 1E4YA 1IUNA 2PWAA 2QQGA 3HUEA 3LLSA 4N8EA 2A9QA 5D6OA 3VZBA 1DV1A 2JF0A 2D1QA 2PRYA 2FHSA 5BR4A 2P4EA 1P1KA 4KYIB 2CVOA 1ODIA 4A8JA 2BAGA 3QTTA 1W46A 4S1WA 4D9NA 5BWBA 1U1EA 1UINA 4NH4A 4XJTA 2AZMA 3L8YA 1HE4A 3KR2A 3T35A 4BQSA 3ZY5A 1DAGA 3LECA 3SLRA 5CFNA 3R76A 1WXIA 4YACA 1BWQA 1PO7A 1W2WB 2BZ0A 2G0TA 2L17A 4IO1A 3TQHA 2HNBA 3D1LA 2HREA 3V1KA 4OVKA 4D3YA 5BWOA 2G08A 1JHAA 1TVEA 2OZLB 4LMBA 5FFMA 2X6RA 3JALB 4G0NA 2Z3ZA 2RCNA 1QDEA 2OZEA 2FRXA 2ICAA 1CNEA 2FVYA 3IPCA 2WD9A 2O8BB 2OBXA 1ICIA 4DCJA 2WIJA 1XWWA 3WGTA 1OYWA 4MV0A 2HWWA 1A9QA 4B6PA 4CI9A 4EHJA 1NMZA 2DR3A 4ZVUA 1Y6QA 2NU6B 4RVSA 1PIWA 3W6UA 3U3MA 4ZCRA 1JEQA 2BL4A 1E1QD 4C7MA 4YWHA 2GWHA 2GYWA 1XV5A 1X8LA 2GN6A 2HRCA 1JFLA 2PZEA 3AUFA 3DA8A 4GPTA 4V3CA 1SN7A 1YR6A 2FUEA 2ZULA 3QVXA 4JJKA 4Z1MA 4BJ3A 1Y8ZA 2Q6KA 2WNIA 2ZYHA 3KB1A 4LF8B 1GKUB 1NVUQ 4BLRA 2XITA 5C8ZA 4L75A 5DPMA 1XMIA 2CC2A 1W29A 4LOLA 3E84A 1ZK2A 2XUHA 1QWSA 4G8DA 4AJ1A 5TGDA 5G3ZA 4N48A 4KC0A 4JSRA 4BOYA 1SXIA 1I30A 1E61A 1T2AA 3K0CA 4KFTA 3W78A 4LPSA 3A37A 3L0DA 3W5VA 4OIFA 2BOVA 2Y9PB 1XU4A 3EG9B 4RHTA 1E2DA 5LQSA 1SCNE 1U9IC 4MRPA 1NU8A 3DHYA 2Q45A 3ENKA 1YD7A 3IDOA 2OLEA 3ZZ1A 3ABOB 4MUIA 4MHOA 2I7VA 1MABA 2J6HA 1XXHA 2HWUA 2VA8A 4RE5A 4C0QC 4HATA 2AS0A 4EATA 2JH9A 3ZW9A 2BUAA 3I9MA 1Q91A 1WZ2A 1J9ZA 1GPH1 1QHHB 3MILA 4EFNA 3U6BA 4HRYA 4NBSA 5JSUA 1PKXA 1LPBB 2CLHB 2LDBA 2P9GA 4HYTA 4UDXX 2H52A 1Q7GA 1VQ1A 3HJGA 1RVV1 1IE3A 2YJ5A 3EUAA 3OM0A 1KMQA 2C4MA 2OOKA 3SHTA 3A3KA 5JRJA 2PXAA 3WR5A 1H6BA 1XNRB 2EG5A 4JLOA 5FF9A 3D0OA 4M60A 1NW5A 1VL6A 3TTVA 4DWWA 4X93A 1ZUWA 3OD1A 1QZXA 1EVKA 4EARA 5IM4A 3A9WA 5FAXA 5I5GA 3EGOA 2POCA 1C3OB 5D5PA 4DWJA 4HNVA 1QQ5A 1TADA 1L7AA 1RLTA 3KT8A 3ETNA 1V5FA 1R64A 3ANNA 2I1LA 1Q77A 3V46A 3Q85A 1FSFA 1HG0A 2CJXA 3AEKA 2G63A 2WG0A 2I7CA 3F6CA 5TQ0B 4EVQA 2W0MA 1MZPA 3ZW7A 1WA5A 5CRIA 3R5HA 3MAGA 4GOND 1H3NA 5CX1B 1ZX1A 4EY6A 1CFZA 2PKCA 2X0KA 3WP1B 1V16B 2C2MA 3EIOA 4KXQA 3FKSA 4YIHA 5FAKA 1JMYA 1VL5A 2XT6A 4Y2XA 1KQ3A 1G3MA 1UEJA 3ADKA 4NU6A 8ADHA 5EIWA 1H2BA 4J07A 2J9RA 4NYJQ 4YJKA 3LTNC 1OY1A 1TW3A 3PGXA 4AY3A 2PE5A 3LPCA 2PX0A 4E03A 3EXIA 2FJ0A 2NSDA 4BBJA 3K5IA 2JFUA 2IEDA 2QRPA 2O8DA 3PCRB 1ZM2A 3ZK9A 3CZ4A 3S7ZA 2ECKA 1JTVA 4EI9A 1WXEA 4OJMX 3Q1KA 2GZHA 4ABYA 1Y8CA 5BXQC 5TC4A 3NRCA 2ORED 1WETA 1XMSA 5EY5B 3C8DA 5LP6B 3O26A 3WGIA 3NFRA 1ORWA 2ON6A 4IXWA 1RPNA 2IOQA 2H9AA 4P08A 5GONA 1XQ9A 1ELOA 1LSOA 3PNYA 1UBNA 4W5JA 4ENSA 2P90A 3O4IA 4ER5A 1KOFA 5C9ZA 4XWOA 3O94A 1L8OA 3GT4A 3C4QA 4WKBA 1UBUS 4EMSA 1P6UA 2OKGA 2E9SA 1R6AA 3BMOB 3BORA 3G2MA 4FC7A 2I4IA 3HC7A 1C4WA 3HDGA 4QQ8A 1NF2A 5EUBA 2JCYA 1U7TA 1Z3IX 2QGZA 2AI3A 3QKSB 1CY2A 1X1QA 2OCPA 2DETA 2R6DA 3JAKB 4G1BA 1ZPDA 4QIHA 1FFDA 4BKPA 1Z2DA 1A5BB 1QDUA 4G25A 5SZIA 1Z07A 3GQVA 2A3NA 2Z9CA 3H1GA 1Q57A 3NKVA 3TQSA 3TW4A 4BWVA 1R4MA 3I58A 1HYBA 3VO8A 4KCGA 1JQ3A 1OW3B 4Q4JA 1UBRS 4BLTA 3G49A 4NQRA 3A1UA 2DZDA 5A71A 3AWIA 3RU3A 1Z56C 2EFDB 3VR6D 4D81A 1CDOA 2C8LA 3ZDEA 4F2WA 3EGCA 1LUAA 3U7EB 1MO5A 1RLIA 4WJZA 1R5JA 3ACBA 4YP0A 1OFTA 4YAEA 3OECA 4JJ7A 1SMKA 2DUNA 1FNMA 1PSWA 1EWKA 2HMYB 2QU7A 3GRUA 3L0PA 2QAJA 4XVHA 3WZMA 2Y6VA 4W5RA 2V7GA 2R7NA 2Q49A 3GRYA 4OHPA 4F9EA 1H2FA 3PUVA 3CH6A 3TR5A 4NNPA 4DMLA 5JADA 3U3ZA 1R5NA 1ZHFA 3EIWA 3WKEA 2YYYA 1IUKA 4G81A 1N4AA 4BVAA 4DLUA 3JYLA 2HNKA 3T9DA 3KV1A 3PJEA 4XGRA 1U2EA 1ZDMA 4L2IB 4NV1A 1SXGA 3RC7A 2WHEA 5KPJA 2CHUA 5C37A 3RG8A 1XZJA 4R4JA 3CB2A 3ZU6A 3DOIA 4ZJZA 3S2EA 3TUIC 1M3SA 3UH1A 1Q0PA 1WNFA 1CJBA 3RRBA 2QVZX 2PK3A 2X8AA 1M8KA 3K4QA 1FK8A 4HH1A 5TT1A 5L3QB 3IAM1 4JCOA 1E77A 4DLLA 3O21A 4EFLA 3EA4A 4UTOA 3V9PA 2JLZA 1DPFA 4I14A 2JVKA 2VZ0A 1U1IA 5JFOA 3EEBA 5TPWA 4GNKA 3TTYA 3K6KA 1D7AA 1JHDA 3JYOA 5D2CA 2VTKA 1HKUA 3IAS1 3O6VA 2B4YA 2IYLD 3SNHA 4C4OA 5K3EA 1E9VA 1C1DA 1G2IA 1N9KA 1V5IA 3C3MA 4ZU1X 1N6HA 4URFA 4UVGA 5C51B 2A9OA 1P9LA 2PL3A 2CXQA 3DXXA 1J8MF 4WZAE 1Y5IA 2IY8A 2CKDA 4I0WB 4R2HA 4TROA 4CETA 1THMA 1JHRA 3SXJA 1ZH8A 1YQDA 4FMCF 4HDKA 2X4LA 3DL0A 3JZMA 3H04A 4ZIRA 3H11B 3JQBA 4H3KB 1TJ5A 1YTUA 3G0CA 2ZRFA 4K9OA 4FFVA 1NM5A 2HV9A 1P7ZA 1YKGA 1YRHA 2R86A 4B81A 1SU6A 1DJQA 1ESNA 4RAOA 1J2UA 1OIXA 1QV7A 3VZSA 2B3TA 1A95A 1FRQA 2O2ZA 3CV3A 4UUAA 5JJKA 4D9HA 4HQ6A 1B26A 2RB4A 1VLVA 1KZYC 4UHHA 1ZD3A 3BXEA 3R0XA 1PFQA 4X60A 1O6ZA 2XKJE 3W1EA 4QBKA 1E0KA 1I1OA 2YTZA 2VJOA 3GU3A 2PKWA 1C1XB 3GYGA 3LQRA 2TMYA 5K0EA 1N6KA 3TOSA 4ZEMA 3AINA 1M33A 1M73E 2LXNA 1SC6A 2AN3A 3SC2A 3HCRA 1Z5ZA 2F90A 3B13B 1ZAYA 1LDGA 1ZLXA 2LP4Y 3PPVA 4D8YA 1XNJA 1XA3A 1OAAA 1RC0A 4M7WA 4QGGA 2BEWB 1GCGA 1EJ6A 1S7GA 5CB4F 5LP6C 3E03A 3E8MA 2O57A 4IGFA 1NN1A 2EW8A 2X19A 4UDYX 4DNPA 4K9LA 4W7SA 2EP8A 1NNUA 1M0WA 3IXLA 1E79D 4MW2A 4Q9AA 5IAEA 4KMMA 2UVDA 2OBBA 4B9AA 1XJ0A 3SWWA 1NBAA 1FUYB 3IAHA 3LRPA 4L5JA 4X7RA 3P5SA 3MTGA 2IEAA 2Z1NA 5K3AA 1O0SA 2ONJA 2C54A 4UE2A 1SVMA 2PSDA 4L6AA 3WLKX 4CLXA 3L04A 1FP4A 3OTWA 4NYIQ 5KKAA 4DM4A 3GUVA 5HZHA 5KX5F 3IEIA 4MW0A 4TWAA 3ZS8A 5KNBD 3EPKA 4OH7A 2IV3A 4FYWA 2VJCA 4FT4A 1CUIA 3BRQA 1FUEA 3SVTA 1TKBA 2YN2A 4MIEA 4M86A 3MTJA 2OZPA 1KYIA 4I6EA 5KWSA 1P19A 2IYQA 2QRJA 2GGSA 2ISSD 3DZGA 1YK1A 3LQYA 2PYZA 2L19A 3LPMA 4RM2A 3E0XA 5DWVA 4RFSB 5ESWA 4AY5A 2G72A 4EHIA 4F91B 3FYTA 3N2LA 5EPOA 4G9GA 3NVKI 2BGKA 2J08A 2J5QA 5JASA 2EGGA 2VI5A 4BE4A 1E1CA 1SVWA 3EIUA 1CUHA 2VNAA 1EWTA 1YJ5A 2B1QA 1G21E 2OD9A 3B60A 3LDFA 1UKBA 2IKSA 3NIDB 5HUHA 5FQOA 1GV1A 4CF6A 3PKZA 2RC6A 3KETA 1R6UA 1VYVA 4F93B 4IDPA 4YFVA 4YRRA 5A06A 3FMVA 1QH9A 3HU2A 2WYIA 3PUJA 5KTKA 3LC2O 3TJRA 2EWMA 1OWPA 3I1YA 2ECPA 3A6JA 1I7LA 2I1VB 5ALGA 1RZRD 3IHWA 1V3VA 4PC2A 3PZBA 5JXHA 3MGKA 4BB5A 2O5RA 1D2AA 3L6DA 2PJUA 3G13A 5DTEA 3F4BA 1DDOA 1E1QA 1EVQA 1GQOA 4IJ5A 1Q3HA 3IAUA 4M8IA 4EECA 2DJIA 2ZSHA 1HDCA 1Q92A 5FBQB 4ETWA 3VMMA 3HU5A 2F2TA 4AJIA 2C82A 4IFEA 4OUKX 5BN5A 3HP4A 3TVTA 2PRZA 3V7FA 2VPYA 4G65A 1E7RA 4MDHA 1MIOB 3U5ZB 2A0WA 1WW8A 3SXPA 3LOUA 4GHWA 5A7GA 3OIUA 2HXSA 3ESXA 1B1AA 1MN6A 1MAWA 3NOQA 4NXNB 4GRIA 5JHGB 1XQ6A 1PQWA 3NPMA 1G21B 1UAYA 3WK8A 4X20B 3EOZA 1QDLB 2WF6A 2YY6A 3CLRC 3HJFA 2XVXA 3CRW1 4OY3A 2O1WA 1U81A 1XFAA 2QZ4A 3OEWA 3PD0A 3ESAA 3LNCA 2Q3BA 1GD1O 4KR9A 5JDCA 1T1GA 5CA0A 1Z6ZA 4CCWA 4JT9A 4PLPA 4DMHA 3OZVA 4XDGA 1P3JA 1CK4A 1U8TA 1AD2A 5DGCA 3VPSA 2GN9A 4CHTA 2X3UA 1H1DA 2WW8A 4FWIB 1QG4A 2JH3A 1H2ZA 1RPTA 1Z13A 3FWHA 1EGHA 1EJ2A 1WHTB 4EYKA 3NH6A 4KO2S 4MDFA 4OSEA 4G4JA 4J1SA 1LJ8A 4RSHA 4LQDA 2VP4A 4JDUA 1Z5GA 3TYXA 2QF7A 5J5VA 3DEZA 1OX4A 3EIXA 4TKZA 4DG9A 4ENTA 1X39A 2OB2A 1DC3A 1E3LA 1XYGA 4IOMA 5FUMA 1UC9A 2I2FA 1Y0BA 2VHQA 2Y0DA 1CEXA 1WG8A 4M9ZA 1GPLA 1VHWA 2XRFA 3O9MA 3MIZA 1DIOB 5ENVA 4L8WB 4KQXA 3TLGB 5AJHA 4WXRA 4N76A 3I6ZA 4FI3C 1I4WA 2V7WA 2W2MA 2ZBUA 3CPJB 3CSDA 3OMWA 4HQKA 1W59A 1XROA 5EA2A 2HJRA 5DGHA 2Y2VA 5HJ7A 4WN9B 2PLAA 2XPCA 3VPXA 1GDTA 1UBHS 3C24A 3FB4A 4KDRA 4X6XA 1Z6XA 4ND5A 1RZ3A 1KJ8A 3BREA 1O57A 4WA7A 1NVEA 2C7BA 4X7PA 3HUFA 1JYEA 2VXYA 1K98A 2Q3CA 2X42A 3KTDA 3LPNA 4H6VA 2H92A 4R3UC 5C8YB 4FD3A 4JBIA 4Z3DA 2GA9A 2IXBA 2OXRA 2R3SA 1WX1A 4FOSA 3WFJA 3SIXA 2PGLA 2EATA 2VA9A 2C9CA 3FAKA 1EM8A 1ZZEA 4A5OA 3H5WA 1OMOA 3ZWPA 4Q1VA 1EE2A 4D4GA 1MOQA 3GLGE 3SC3A 1ZJ5A 1IB0A 1T0UA 3EGDB 5FEMA 5IFLA 3TLCA 4EG3A 3WXMA 1D4AA 1B93A 3AVOA 4UUOA 1GNLA 4DABA 2AZDA 3MS4A 2GFHA 2RGCA 1OR8A 3BCSA 2P1ZA 4NIMA 4NMWA 3T5BA 4EX7A 1Q2XA 2GYUA 1P9RA 3VJKA 4B8WA 2JEZA 2BR3A 2CUZA 2CN1A 1JR3D 1L5QA 3LY8A 4B3HA 1ODFA 2EX0A 4XVCA 1WUJS 1C0LA 1YDGA 3DQQA 3K0CC 5J40A 4D42A 1QUFA 4BFCA 2JLSA 3QUAA 4ZCSA 3RS4A 3UMRA 3MOSA 2HIMA 4HQOA 4DNXA 5MFZA 4D26A 2AUNA 3C6ZA 2KX7A 5D87A 5HF5A 2JIMA 4BX2A 3RAFC 2VKQA 2ZJZA 3FPAA 4G1UC 3RBVA 1HM5A 5A2GA 4TKLA 4ZO7A 3I2GA 3F8WA 3HEMA 1JJBA 4RLQA 5KOHA 1ZHOA 1ZXXA 4R98A 1E6WA 4RHFA 2ONCA 3TSZA 4F8EA 1PFVA 3ZZUA 4JYCA 2QUAA 4II3A 1IIRA 3HBNA 2A9FA 3UMFA 2GRJA 1E0DA 3JCZA 1T5HX 4TZ6A 4DV0B 1E2GA 2FGKA 2M9MA 3CISA 2IHVA 3DWFA 4I81A 3K6RA 4QYIA 1XCPA 3HH8A 4RD3A 2GDZA 5KVAA 3F6SA 3VYTB 2NYUA 2NUPA 2RGEA 1YE5A 3LY5A 2O23A 3V7NA 3DMRA 3DL7A 1LQUA 3GPBA 4B79A 3EG9A 4PQFA 2F3SA 1EP9A 1JXMA 3Q7PA 4RPCA 1U98A 1FLDA 3C3YA 3OQJA 5DCUA 2FWMX 2ZI5A 2C4VA 2YUIA 4M0PA 1UZNA 1CBUA 4OB7A 3WBJA 1RAEA 1ZJ4A 2LKCA 1Z38A 4KWEA 2WYWA 3OI7A 2FSVA 2KHZA 3A4IA 3MT8A 5H68A 4AD8A 1W0KA 4QFCA 4BMZA 4CIDA 3HVUA 3LXRA 1XZGA 4FKZA 3W77A 4ND3A 3ZGVA 4CIVA 5KEIA 4JNCA 1QGZA 2JGAA 3LP5A 2IYFA 4LY9A 2YBDA 4E0BA 2E4VA 4O2BF 5GJBA 2PY6A 3CNBA 3P9IA 1E2HA 4LWPA 1MB9A 3ESQA 1HSZA 1EDBA 4R41A 2D1SA 5DNWA 1S0UA 2DTXA 2FJUA 1Y1QA 2XGSA 2VJMA 4MRSA 4NHOA 3JPWA 1HI9A 2RHRA 4M1QA 1C3OA 5E8JA 2LGJA 5AESA 2YXLA 4XDZA 5D85A 3ZZTA 4IDHA 4EHKA 4F5ZA 2G28A 2VHUA 4DBZA 5B6PA 1IZYA 1NL3A 2AEFA 2CXNA 4KR6A 4EEKA 3MK31 4XQEA 2PTHA 3HGTA 5K03A 1K2VN 5NULA 3SP1A 3NHSA 4JI3B 3HA2A 1NKVA 3ROXA 3UK6A 3CB4A 1OLSB 1S6YA 2OILA 2WPDA 3NHKA 1OPXA 3Q3IA 4IXNA 4QFMA 4OB8A 5ALXA 3X2FA 3NVMB 4QEDA 1IPEA 5G40A 1UBEA 4WBNB 1EUCB 3GCXA 3BUSA 4IDFA 1WMDA 3PXAA 5C46F 2FR1A 1NIJA 3U26A 5JOQA 4CM4B 3DDCA 4M1SA 1HZZC 1MOZA 3T7CA 4I3FA 3D7MA 3BF8A 3KR0A 3LHKA 5B7PA 4UMFA 1E3SA 1YB6A 4L9WA 4I08A 2XV1A 4K0RA 2H7YA 2W6IA 1VKOA 4NCHA 2C29D 4JXZA 1TDJA 5D8DA 5GONB 1K06A 1O9HA 1U7HA 5FQNA 5HKOA 3I1FA 1VG1A 3PCXA 3B7GA 1L7NA 4TQAA 4MYUA 1O96B 2F3RA 4UJ5A 4JB3A 2BBWA 3HB1A 4IDCA 1RMYA 1J23A 4P4GA 4ZJPA 3BMOA 5JDIC 1KAOA 5LLDA 5ELXA 2DR2A 4DQDA 1S2IA 1D7OA 2SKCA 1YU6A 1Z8NA 3FTNA 5HDBB 4ENPA 2IIPA 2XX3A 4Q3LA 5I8WA 4GZLA 3TLBA 2G25A 2F43B 3GPIA 4MGHA 5ALNA 4QQRA 3M5DA 4QXMA 4E08A 3TG8A 4AYXA 4OB6A 1HQCA 3E3OA 3P9XA 1F8YA 4KDFA 5THXA 3NRJA 2JZNA 1WV1A 2VXBA 2TS1A 4BLSA 5AVJA 4ATNA 1EMDA 4CKZA 5JPDA 3V97A 1GZ6A 4IMJB 2SBTA 3LGXA 1E2FA 3A1DA 3PDJA 3ABZA 3AIIA 5EUQB 4RWEA 3TSAA 4A0GA 4RTLA 1C81A 3S2SA 4YV7A 5K4HA 2VUHB 1AVTA 1A9TA 3UV6A 4KLZA 2H17A 4L51A 1WDWB 4B43A 2UZIR 3DZBA 3AOEC 2PT6A 2Y66A 5FI1B 2FH5B 3DPIA 3AFGA 4CLRA 2E5WA 2IW1A 1QRSA 3D2BA 1MDBA 3SQWA 1Q3TA 1R0KA 2R84A 4L8YA 2QL6A 1ESCA 4JKYA 3PDIB 2YMQA 3CRRA 4LTMA 3B5IA 1SVLA 4CU2A 1B41A 2IYVA 1A9OA 2UYCA 2JFBA 5DHAA 1N33B 3OFND 4MAMA 2FPIA 4MJXA 5KI6A 1DRUA 1P4AA 1NHWA 3KEMA 5EZQA 2XSZD 4B4KA 1ZIPA 3V2HA 3BE5A 1XO1A 2ZITA 1P33A 1R4ZA 4Z7OB 3REQA 3TVYA 3KUKA 1KU0A 2AUMA 1N78A 1GT91 4JXKA 5AK4A 1PW7A 2Z04A 3FHJA 2OZKA 2CLOB 2VAXA 2ZAYA 1R15A 2ZI4A 4RX1A 2QZ9A 4BTLA 3UHPA 4BB0A 5DSZA 1ZSNA 3I04M 1KGSA 3BL5A 3V4RA 1II8A 3OTQA 4V03A 4C03A 1EVYA 1YWGO 1S1MA 4OXIA 3GVXA 4ZI7F 2IYRA 2WJWA 2ZIXB 4EHHA 4X91A 5LZ2A 3OPYB 2NVOA 1F5SA 1CR0A 3RRYA 3P2MA 4AJ4A 3WK9A 1N8SA 4HDQB 2GEBA 3CUEF 1XZHA 4C3UA 3MGBA 3PDIA 2A9JA 3JWHA 4Y2HA 3U31A 4V39A 3IB6A 4CKWA 3NFYA 1LSUA 2D1RA 3LCVB 2ACWA 6REQA 4OBEA 1K7EB 3LHSA 3PUWA 2BF4A 4KPGA 5B1HA 1T1SA 2NUBA 4FEGA 2AFHA 5FI0B 3P7MA 3TAUA 1TEHA 4QUHA 2X0RA 2W2NA 5IBPA 2ZBEA 5GOZA 5IHPA 1J8QA 3FCSB 2BKUA 2OVBA 2WAXA 3HB0A 3C48A 4D97A 2ZRBA 3ETCA 2JJMA 4HUJA 2RJ3A 4FGWA 2NZ8A 2Q0HA 2Z3VA 5CM9C 2VP2A 3G5MA 2I1WA 5IZCA 3GRCA 4S05A 2WFLA 3T5DA 4JLUA 1VBFA 1ZC4A 1V8BA 3OOYA 1XMJA 3R23A 4ML3A 3WL3A 2WD7A 1K1EA 1PZMA 5JSQA 4GX5A 1ZC3A 3NBQA 4WK0B 4WRRA 3QW4B 3FVTA 4JV5B 4CG1A 2C59A 4WCFB 1AA9A 2QD4A 2Z6QA 1EX6A 3PLRA 1NJFA 4ZHQA 3QTBA 3UCEA 4FUTA 1J1ZA 2H06A 4ZAYA 3L7OA 3GEGA 2PN1A 4I5IA 5JD3A 3RYCA 1DCKA 3P0HA 3Q3CA 1K6JA 3BE4A 3TVDA 3IPXA 4YT2A 5BUZA 1XP5A 1I4OA 1RM5A 2PLWA 1BXRA 4I50B 1MB4A 1A4IA 4AUMA 5JV5A 5AVKA 1FEZA 4GM1A 2FEKA 2FN7A 2X1MA 1RJDA 4GNRA 1VTKA 5JE8A 3K5WA 2Y4OA 1OI3A 1ZESA 3VDMA 1DKUA 3WWOA 2YVKA 3K1AA 1ZA2A 1A9YA 2YW9A 3EY4A 1HNZB 4D1YA 1VYTA 2ZI7A 5CMLA 4YQZA 3U4DA 4QUBA 4CQLA 5L7WA 5HQTA 2J7PD 2V98A 1UUFA 2XNHA 2ODQA 5JMPA 1UFRA 5AM4A 3TX2A 2V9ZA 3JQQA 3RVJA 1OT3A 1F0KA 5JZVA 5K0LA 4AYWA 1T8UA 3HPRA 2HQRA 1ZVQA 2VJLA 1T3ZA 3IP5A 2X7JA 2HLNA 1AQ6A 5ALJA 5TX7A 3H0KA 1NJ5A 1T9BA 3GCZA 4P3OA 3MMPA 3NTLA 2CKMA 5D84A 3FR7A 5AHOA 4HTFA 1U2ZA 2OHVA 2A0YA 1E9BA 1Y5LA 1GCAA 3H75A 2DG2A 4KG7A 1GL7A 5DCWA 3V8NA 1MFZA 1M7BA 1JHQA 2HAEA 1WCV1 3FMOB 3LL7A 3O3OB 1IY8A 3QMVA 1FFCA 1SELA 4FX2A 5GJWC 1O4VA 4F3KA 3FDIA 1PQUA 1X7YA 1MB3A 3IC5A 2IFTA 2VDNB 1SQ5A 1PT6A 2CBZA 3RYFA 3ZWNA 4AZ0A 2BM0A 5TMDA 4ESOA 2JRLA 5HFAA 1L6RA 4UU8A 1XNHA 2EF1A 2OGZA 2HSGA 3DP9A 3T3MB 3TR6A 2I3DA 3WIEA 3BMXA 1EP1B 3ASYA 3PFIA 4FGZA 1VKZA 1Z12A 4YCDA 9GPBA 1PEDA 2F3TA 3E58A 2MINA 1FXWA 1J09A 1TEZA 5CA1F 4U7TB 4W5TA 4WLFA 3ECAA 3AGQA 4ND6A 1DG3A 4WFIA 1WQ4A 1GJRA 2WKPA 1TGVA 4L8LA 4YCCA 1EDDA 2OZVA 4LWZA 3HZOA 4ZPJA 4LV8B 5TXGA 1TQ8A 1DC5A 1T5IA 4MIKA 4RXMA 3Q8WA 3BIFA 4RJKA 4EB6A 1FIUA 5K0CA 2IH4A 1F0YA 1USIA 4L02A 2ZYVX 5KTYA 1GL9B 3LPLA 3RVPA 4GMGA 2AN9A 2O2DA 3KKQA 1ZN2A 1V9CA 3FFBA 4I4IA 5FR2A 2JNWA 2YQ4A 5JNUA 1EIWA 3V1TC 3TRIA 1YR2A 3G9QA 3QUBA 4HGQA 3M6MD 3HI6A 3E9YA 1X7WA 3IEVA 4ONEA 4MYHA 1JYSA 5AFSA 2PBFA 4HAVA 5AHXA 3AUKA 2NVUB 3E5MA 2Y0BA 1BA2A 2QAGC 4RVFA 4M36A 1L5LA 3RSFA 3UK2A 4BFSA 1COWD 4F4CA 3NBYC 1VPWA 2UYOA 4B8ZA 3X0DA 2FK8A 3T4PA 4U3JA 2HBYA 4LQ4A 4UD2A 4DMMA 4LEIA 3CX3A 4BIIA 4QA9A 1VI6A 4U5QA 4PX2A 1DCTA 3S2UA 2RGDA 3OWXA 4F1KA 1E6KA 2CL6X 3WIBA 4M0UA 4IHJB 1NW9B 3K0HA 5FP0A 4ZCIA 2HJGA 4P0TA 5K4AA 5FTWA 1Y9JA 1FVOA 2ANCA 5C52B 4ZAGA 1S5PA 4UNNA 1GOTA 3C7CB 5TV2A 1M66A 4QL3A 3FOZA 3T5TA 1M6VA 1JILA 2YWGA 3IVMA 5IUKC 2WUWE 3LBHA 3MJEA 1NN0A 2GYYA 4OFBA 3OQ6A 1H42A 3RV4A 3VH4A 3UOAB 1RYBA 4COKA 5IN4A 4GYWA 1F5NA 2B7BA 1KJNA 4B3IA 2RK4A 1G55A 2FRDA 4IQGA 3WC4A 3IQDB 1LK0A 2IF0A 1Z28A 5B12A 3DJYA 4RK1A 1E1NA 2QORA 3ZQ4A 2V3CC 3ZCUA 4BKOA 4ERNA 4F86A 3KK0A 1EUDA 4LGVA 5ARDA 2PMBA 2QS9A 1IQUA 4NCXA 1BFUA 1BNCA 2RCYA 2A0KA 3SC6A 5C1OA 1H6CA 2GKGA 2HK6A 1N2IA 1SEVA 1X8XA 2LCIA 2FNAA 2WIDA 5DTIA 3STWA 5C8YA 1GYQA 2HJWA 3K96A 5IM5A 4DWOA 4IHJA 5KQPA 1C30A 5E9AA 2JKYA 4UU7A 2NZWA 3H19A 3OA2A 5EJMA 4Y2TA 1G1AA 1B2RA 3U9TA 2IIQA 2CLDX 2IKQA 4PZZA 2B35A 3RQSA 1U5BA 2NPOA 3U7FB 3IE1A 1BDIA 4G6ZA 4RH3A 3L05A 5K3DA 2C8JA 1NYRA 1PGOA 3ZE0B 5JRZA 4S12A 3DO5A 4JFAA 1I4DD 1KXJA 1NXTA 1AZTA 4AX4A 1HX7A 9ATCA 3MOGA 2PL9A 3Q8XB 3AOEA 3BK1A 1QZTA 1JHYA 1NQ5A 2WWRA 3OKPA 2ZW9A 3QPDA 2W6QA 5IZ4A 1UXJA 1XA4A 2GMWA 3KC2A 4HDOB 3AKCA 1YCHA 1XTZA 3R0IA 3N5CA 1G66A 2A94A 2GBPA 5LU8A 2GZ3A 2XCOA 3K8QA 4QHYA 3EX7C 1BS9A 3VPDA 4OJYA 2MWMA 1SZDA 3MJ4A 1UFKA 3W4JA 1GFWA 4MYTA 1X7HA 5F5LA 3EDRA 3DBOB 2DTEA 5LOVB 3MS7A 5LMZA 2FZVA 3DDZX 3B36A 2Y1KA 1FFWA 3JQAD 3V1LA 2H0QA 3ZU4A 1CVIA 1SD1A 2ZTHA 1RHKA 1RZVA 2RHCA 1BXGB 4DIMA 1TMYA 1IXSB 1TAHA 5ADUS 3K6SA 4MUBA 4PVDA 5AKEA 3HCAA 4URZR 1UEIA 5J2TA 1F2DA 3L4SO 4EEZA 5TPZA 4DJ5X 2BGRA 2W83A 4D6YA 3K35A 1ZW6A 1OU4A 2HXYA 4OKSA 5JCOA 5CLHA 1HURA 1YS2X 1SCKA 1VPTA 4A3SA 2HHHB 3VNBA 1DIGA 4HEQA 5CT8A 3KQUA 1ZGGA 2BUBA 2H08A 3R0JA 3QSGA 3HCDA 1JIJA 2W42A 2HSZA 3AJ9A 4KLNA 1KI6B 2IYNA 5CLLA 1W73A 2IPNA 2YWDA 2DUMA 3BULA 3PFBA 3R40A 1XLTA 4QPDA 1FU7A 3BSSA 4UNQA 3A28A 5G4KB 4FWTA 4DIDA 1WCIB 2EIHA 2XUKA 5EKXA 4E5DA 2Q27A 3NALA 5IJ0A 5F3WB 4URHA 3CRVA 4JGGA 1WZNA 3IOYA 2B5WA 4RYLA 4QBGB 3D8HA 3S1SA 1Z7GA 3ZK7A 4TRNA 4GBJA 4RL6A 4UVEA 3WMWA 3JQFC 2XE8A 4FNMA 4D5EA 4YR7A 4LV6A 5BOSA 2KSQA 4NENA 2ZCJA 2DLCX 5GINE 3HYSA 1L1RA 5FOSA 4J1QA