1Q1NA

Apo and holo structures of an nadp(h)-dependent cinnamyl alcohol dehydrogenase from saccharomyces cerevisiae
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
360
structure length
360
Chain Sequence
MSYPEKFEGIAIQSHEDWKNPKKTKYDPKPFYDHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQRVGVGAQVFSCLECDRCKNDNEPYCTKFVTTYSQPYEDGYVSQGGYANYVRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSMGTLISKAMGAETYVISRSSRKREDAMKMGADHYIATLEEGDWGEKYFDTFDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLSLKPYGLKAVSISYSALGSIKELNQLLKLVSEKDIKIWVETLPVGEAGVHEAFERMEKGDVRYRFTLVGYDKEFSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical zinc-type alcohol dehydrogenase-like protein in
publication title Apo and Holo Structures of an NADP(H)-dependent Cinnamyl Alcohol Dehydrogenase from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 107
structure length 360
sequence length 360
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2003-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1q1nA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1q1nA01
3TZHA 2NU6A 3O8QB 2DTEA 5AVOA 1JA9A 1GZ4A 3RFXA 1Y9EA 1Y8RB 2CZCA 4CLDA 3E82A 4LRTB 1ENZA 4QEDA 4H15A 4HBGA 1B8UA 3WSVA 1M67A 5ER9A 4DQVA 4FC7A 4PG6A 3CMMA 1NAHA 3Q9NA 2D8AA 3TL2A 3GT0A 5DP2A 1B0AA 3JQ8A 2Q1TA 2Q4EA 4NI5A 1PQPA 3ZHYA 5KJCA 3ONFA 2D2IA 1YGYA 4A7PA 2YJZA 1EDZA 4DA9A 2E82A 1GZ6A 2P2SA 1CRWG 1SC6A 1R15A 3LT0A 1DC5A 4HADA 5ILGA 3KETA 4WEQA 1DJNA 2AA3A 3O26A 4NJMA 3VTZA 4KDEA 2HMWA 1L7DA 4ZICA 2AQKA 4IGFA 3H5NA 2OXIA 1VM6A 1ZSYA 1KERA 1QV7A 4FFMA 3S2GA 1C0KA 4L75A 4JCOA 3ROQA 4BGVA 4JBGA 1A4UA 4ZVVA 4RVHA 2B69A 2UDPA 1VL8A 4I9NA 3DDNA 3D4PA 3MJ4A 1WP4A 1XSEA 3VAZA 1PEDA 3S55A 4AJIA 3LQFA 4JQCA 4J1SA 4YJHB 1P1HA 2C59A 3E18A 3GVHA 2YY7A 4HKTA 4CM6A 5JBIA 1ZJZA 2YDYA 5CPFA 2J5QA 4XQCA 3UAGA 3HFGA 1Y5RA 4AFNA 1ZXLA 3O38A 2AE1A 5IZCC 4AG3A 4IDDA 1WWKA 1P1RA 1SO8A 4U6QA 2H1SA 5TGDA 2WE7A 4XDZA 1TI7A 4OSOA 1QR6A 2GZ3A 2Q1SA 3OECA 3SC4A 1DAPA 1HDOA 3NEPX 3RC7A 3BMCA 3NYWA 4UULA 5DBGA 3D3EA 1C14A 2O2SA 2YV3A 1BTOA 4GBJA 4XQEA 3FBGA 4Z0PA 1LA2A 4E13A 3PJGA 3P19A 3ZWPA 5DNAA 1IPFA 5JE8A 3DO5A 5TNXA 4IM7A 4J7CA 4BL5A 4CV3A 4EZBA 2VYND 3COSA 2NNLD 3GNSA 3X2EA 3CINA 2R00A 1VPDA 4G65A 3PFFA 3SXPA 3LF2A 1H9AA 4NQZA 3W6UA 1EEHA 2OORA 3FR7A 3ROKA 3AI1A 4CUZA 2P9EA 3AI3A 5JAZA 2EJWA 1J0XO 5H81A 4J9UE 1ENOA 4J7UA 5U4QA 5I9MA 2O3TA 4XYGA 3U3XA 1TVEA 3PDUA 4XJTA 1HZZA 2CDCA 5G0WA 1H9BA 1NQTA 4I5EA 3QWFA 4FJ0A 3JV7A 2E48A 3OP4A 2XAAA 4RVSA 1DHRA 5LC1A 1DC4A 2FZEA 3ONEA 3UHAA 3O4RA 4BO9A 4MVJD 2Y0DA 3HWRA 4GVXA 4HXYA 1NQOA 1GYQA 4QTZA 1R4MB 1PSDA 1TT5A 4K6FA 2FSVA 1GV0A 2X0IA 3WTBA 3VTFA 1SEVA 5JDCC 1LBEA 4AJNA 3F5QA 4TZTA 3Q2IA 4R41A 3GNTA 1B16A 1LRLA 4FOOA 3SJ7A 1YKFA 3OJ0A 1IY8A 3KM0A 4OYRA 4U7WA 4EITA 2NQ8A 1FMCA 1MFZA 7ADHA 1E7QA 2BRUA 4BNMA 1N7HA 3D5TA 3PRJA 2WYWA 4R16A 1PX0A 3GK3A 3MCVA 2ZB4A 3RUFA 3BZUA 4ALIA 4N5LA 1I36A 1DLIA 3GFGA 3BHMA 4K28A 1SZJG 1NVGA 3JCZA 4MOWA 4MKRA 4F6LA 2C0CA 3ORFA 3DQPA 1FDWA 3D0OA 4LSMA 1GTMA 3RUDA 4ZD6A 1GADO 3NT5A 3C7DB 3V1UA 1UXKA 5F5LA 3IP1A 3GNQA 3DZHA 4BB6A 1BG6A 4PIVA 1R66A 4Z9FA 3B1JA 1YH3A 5BQFA 4B8WA 3NX4A 1ZMOA 4AJLA 4IIVA 3C1OA 3I9MA 1LNQA 3TZCA 3RASA 4Q3DA 5A04A 5L4SA 1F14A 4ZQHA 3SC6A 4CM9D 1ISMA 3GEGA 4P8RA 2XOXA 1GEEA 4XR4A 5A9RA 3DOOA 4AJ1A 2YFHA 1EDOA 1DC3A 2VUUA 4UUNA 3K96A 3PHLA 3IKTA 2H63A 3CPSA 3CIFA 2PKQO 1MFPA 4Q39A 3SVTA 1Q7CA 1ONOA 4YJDA 1E3WB 3PTZA 4QUKA 5CDYA 5L4LA 1B14A 1H6CA 4J7XA 5T8KA 4E6PA 1U2GA 1B3RA 2Q50A 4BKQA 4BO8A 4BVAA 1U9JA 2GASA 2ZTMA 3HJAA 3WS7A 1UDBA 1O5IA 5IN4A 5L7YA 5IDYA 3WLFA 4Y6PA 4IS2A 1E3LA 4E21A 3AUSA 3ZWVA 3R0IA 6LDHA 4R54A 1M2WA 2NV6A 3BTUA 1O9BA 1IOLA 3H9QA 4NBRA 2YUTA 1CETA 5IXSA 3RD5A 4BO1A 3WJ7A 1A72A 2Z1NA 5GZ6A 4L4XA 5CDGA 4FFPA 5BNTA 4RPJA 1TB4A 4R01A 1F06A 4YWJA 2JHGA 4YT4A 1JU9A 1RM5A 4PG5A 2WM3A 3H2ZA 4BNTA 4RVUA 3E8XA 4XYLA 4DTIA 2G82A 1G1AA 1KC3A 1NM5A 1W6UA 3AY3A 2GYYA 4B8ZA 5IF3A 5L7TA 1ZSNA 4DQXA 1KY5A 4XA8A 2R00C 2VRCD 1DJQA 3WOHA 4GSKA 5B12A 4GX0A 4GPD1 1U3WA 2RH8A 2B5WA 3Q9UA 4GMFA 4K26A 1DIRA 3QP9A 1HL3A 4CV2A 4QSMA 4PVDA 4E31A 1MUUA 1H6BA 2DAPA 3K30A 2AEJA 4QT0A 3OJEA 3WFIA 5A1TA 1YOVA 4DQUA 3OQ6A 3WIEA 3RFTA 4TKLA 5DCWA 1MX3A 1NWCA 4ZJUA 3H9EO 3IOYA 5FFFA 1GU7A 1OC4A 2CNBA 2YQ4A 3JQ8B 3DZJA 4MIEA 2VHYA 3PHIA 1Q0HA 4WCFA 3HDQA 1BVUA 1E1NA 5KVSA 4IIUA 1ZIDA 1Z7BA 2FPIA 3MTJA 3G1TA 3K9QO 1BW9B 3PGXA 4JGBA 3KEQA 1LDEA 4N5MA 4XGNA 1VJ0A 3GPDG 3OEWA 4BKRA 2EERA 2J3HA 4KMSA 4NJMB 4W9NA 5F3RA 1ISJA 3I4CA 2OO5A 3PDJA 4FFOA 1HDRA 4OGWA 4UVGA 3PYXA 4NG5A 3NKLA 2P4HX 1PJCA 2JAHA 3GVCA 4YT8A 5CAEA 3PJDA 3KTDA 3H4VA 1MB4A 3PHHA 3GOHA 3DOJA 2PV7A 3L4BA 4XKJA 5TJ9A 4PLHA 4DVJA 3JQAB 4OKNA 1PZGA 3NV9A 4J1QA 1NTOA 5EPOA 4OOFA 2EHDA 3ADOA 4FBGA 3ULKA 2B83A 2HK9A 4FGWA 4D44A 1KBZA 1XR3A 5FYDA 3F46A 3H5AA 2W4QA 1VI2A 3E9MA 1JVSA 1PS8A 3U0BA 5CFZA 2O50A 3DHNA 1I01A 4IJWA 5L45A 3R1IA 3MJTA 2WMDA 2GSDA 5IZ4A 5EN4A 2X5JO 1YQDA 5BNFA 3RC9A 2C2XA 3DEYX 4E5KA 1T4BA 2EIHA 1JTVA 2Y05A 3BMCB 2WTBA 4JBIA 4RZHA 3PJFA 4YJFA 4MP6A 1DIGA 1ISFA 5T5QA 3TPCA 3Q3CA 1A5ZA 1GFSA 5JAMA 1QYVA 1MV8A 3GMSA 4AJPA 1G0NA 4L76A 4AJ2A 5JO0A 2D3TA 1XA0A 4I5GA 3ZWYA 4J4HA 1GY8A 2E6UX 4BKOA 3KYCB 1T25A 5KIAA 3QA9A 4NK4A 1SOWA 2EW2A 4GMGA 2QW8A 4ZA2A 1YE3A 5I8WA 2QYTA 4P4LA 4MVJG 4PLCA 3Q2KA 3ETGA 4QFDA 4XR9A 2Q4BA 4E3ZA 1VL6A 3W4KA 3BTOA 2EGGA 4KZPA 3UCFA 1PR3A 2PWZA 1QLHA 1X7HA 2OHXA 4TRNA 1YBAA 3ADPA 4BO0A 4CLRA 4I9UA 4LCJA 1W73A 2AG5A 2Y67A 1ML3A 3QWIA 3C7CB 1DSSG 1E7RA 2DC1A 4OXKA 5I7EA 1CJCA 3K73O 3NDJA 1ISHA 1JN0A 1OAAA 1Y5MA 1I32A 1NFFA 1TT5B 3DMTA 1NVTA 4PFJA 1H5QA 3F3SA 1PQUA 2WYVA 5EQFA 4HFRA 3KSUA 3ICPA 1A7KA 2X9GA 4H16A 4BGIA 1YQGA 2JCYA 1WW8A 2OP1A 4EJ0A 2JFHA 2YW9A 3P2YA 1K0UA 5GZ1A 4YR9A 1PS9A 2CD9A 2Y93A 3V2UA 3I9LA 3OIDA 3FCOA 1LEHA 4YQYA 4JROA 3W6ZA 5FWNA 4D0RA 2IZ1A 2Y1FA 2X6TA 4ZHSA 1ENPA 2JL1A 4N18A 3W8FA 2C82A 5AXAA 3GVPA 1V8BA 4KTVE 1V6AA 3H2SA 4WLVA 1VJTA 4ZGWA 3AFNA 2VCYA 4WCFC 5DULA 1IZ0A 2HDHA 4NU6A 2FP4A 3PGJA 4XWYA 4XYMA 3WMXA 3E48A 2QRJA 4WLNA 5AXDA 3FTPA 1EUZA 2GD1O 4FPXA 2GUGA 4W9NC 5GY7A 1DPGA 2BHLA 1VRWA 1R0SA 1J4AA 3G3EA 2AQ8A 1HEUA 1WZEA 2R2GA 2VWGA 4E2XA 4ND1A 5JAIA 2C7GA 2GLXA 4BO3A 1B2LA 4CM3A 5U9CA 2NVBA 5J23A 3LC1O 4HFMA 1U8FO 4E5MA 1DEHA 1D8AA 3L4BC 1C1XB 3AU9A 2VYVA 3VPXA 5KWEA 3EUWA 3KYDA 3GVIA 3JQCA 3V2GA 3GN1A 2PGJA 3PHGA 3AUAA 1X13A 1E0DA 1HDCA 2WSBA 4LK3A 1B15A 2IEDA 2VOEA 5F1OA 4R69A 1FJHA 1ULUA 5A9SA 4NK5A 4CMAA 1IHXA 3I9KA 3AU8A 2J3IA 3PVZA 4INAA 1NR7A 3GAFA 3H9GA 2BI7A 1Y8QB 4JJIA 3KV3O 3UW3A 5BSHA 1H6AA 4GAEA 2RBEA 3K2BA 2SCUA 5FI5A 3OA2A 2VHXA 4A0SA 2AQHA 4BMSA 3GPIA 1MLDA 4CUKA 1E6EA 5DBIA 3ON5A 4BNVA 1LLQA 1WAMA 3E9NA 4BKPA 2I3AA 4ND3A 2EG9A 1PS0A 3AY7A 2JFGA 3UXYA 5CG2A 2P9GA 4NNJA 4Z9XA 1KVTA 3I9JA 1BHSA 1R12A 1F0YA 3JQFA 4WASA 3S8MA 4IBOA 4JJFA 2Q45A 5C3MA 4ID9A 2Y99A 1EVJA 1ZW1A 3DBRA 3PWZA 1UJMA 1N1EA 4FJ1A 4M86A 1WMBA 4H7PA 2A4KA 5ICMA 3RUAA 4MVJM 3U5TA 3GY0A 1AXEA 4HNHA 3STHA 4P4NA 4WJZA 3GG2A 2V7PA 2HMUA 3HB5X 3VPFA 4BO7A 2NU9A 1LC0A 2NTNA 4DC0A 5AYVA 2DBQA 5EINA 4CLEA 2P5UA 4E32A 4MINA 2VT3A 3ONDA 4B7XA 3I1JA 4NIMA 2IRWA 2X86A 2IXBA 3DMTC 3JSAA 1X7GA 3HB4X 5G4KB 2WYUA 1PGPA 5U1PA 2DPHA 5K1SA 4YRDA 2X0RA 4BGUA 1Z6ZA 1QSGA 1BMDA 4BO5A 2DTDA 3I4FA 4NFYA 5EESA 1SCUA 4B4OA 5IDWA 1HKUA 4QECA 4RV9A 3OJLA 3BA1A 3JD4A 4BUCA 4M49A 5F5NA 4KUEA 2AW5A 4BNNA 2EJVA 1EVZA 2VHVA 3ZWBA 3CKYA 2ET6A 5ICSA 5BNIA 1ADCA 4HNGA 3GFBA 3VZQA 5ILOA 4XRRA 1HE3A 2OP0A 3OHSX 4EUEA 1GUZA 4Y67A 3AUUA 5TLSA 3VPHA 1AN9A 3RUHA 3F1KA 2JKVA 1FK8A 3V2HA 5DOVA 1UZMA 2RCYA 2RHRA 2Y0EA 1NFQA 1DBVO 3JQEA 2I65A 4IXTA 4RZIA 5COAA 1Q7BA 1Z74A 3IIEA 5LDGA 5B1YA 3PZRA 3TZ6A 4IY1A 1A71A 3QQPA 2E49A 1GQQA 4YJFB 3IS3A 2VUTA 1ZH8A 2FHSA 2YYYA 3ZWMA 1ID1A 4QFCA 1JLLA 4E4YA 2G17A 3BTSA 2BFOA 4RF4A 4CPDA 5CEFA 2QRKA 1ENYA 4XQGA 4MKZA 1ZEJA 2D5AA 5B37A 3SEFA 4DRYA 2B0JA 1LSUA 2DTXA 1HE2A 3RU7A 4YACA 1ZK0A 3M6IA 1IYZA 4R51A 4IDAA 2R6JA 5T67A 3E1KA 3BYZA 5CEJA 1LDBA 4E2ZA 3DBHA 3EK2A 2V6FA 3GHHA 3UF0A 3JYNA 2W2KB 2DUWA 3EY4A 4XYEA 4A10A 4ALLA 4EJMA 4UREA 1E1MA 3B70A 3HUDA 3AM3A 4II3A 3TOZA 1UAYA 2VYNA 1GYPA 3GVXA 1XWFA 5JO9A 5CHEA 4CMBA 3LT4A 1I2BA 4BS9A 1QRRA 4OQYA 1UXJA 4BOYA 5HBRA 3PP8A 4U5QA 2PLAA 3VVBA 3GR6A 2EEZA 4A27A 3VKVA 1DAOA 1NWHA 1KETA 3EW7A 3P7MA 2C7VA 5IG2A 2YV2A 3IQDB 3DBVO 1ZCJA 3JQFC 4YVFA 4KQXA 4MVJF 3KLPX 2NTVA 4LGVA 4UEKA 4H3VA 4OAQA 4CLOB 1E92A 3M1AA 2HSDA 4MVJA 3LK7A 4K9DA 1PWZA 5IDQA 4D45A 3FTNA 4TRJA 4MJLA 2HMTA 3RU9A 2CUKA 1GDHA 3GG9A 4DLAA 1XQ6A 2A94A 5L95A 1LLDA 3AY6A 4Y6SA 5THKA 1TLTA 1I2ZA 3U4IA 4KDFA 1HDZA 4R3NA 5EIOA 1P74A 3WX0A 4DXHA 1LRKA 1YWGO 4RVDA 3FI9A 3LYLA 4LRSB 4IXWA 1PGOA 3GRPA 5F1KA 2VN8A 3I9OA 2X4GA 3K5PA 2IDZA 4YT5A 2BGKA 3ZW8A 2BI8A 2OBYA 2ZQZA 2GO1A 3E6AA 4OH1A 4TZKA 3X2FA 3PYLA 1HTBA 1LLCA 1X15A 3WICA 4WNIA 3LU1A 1E5LA 1YDWA 2FR8A 1YDEA 2F00A 3L9WA 4YA6A 1EE2A 4L74A 2EKQA 4ND5A 1KEWA 4W82A 2D0IA 4JP3A 3F4BA 4WCDA 5IN5A 1C1DA 5CP8A 4D42A 4WLEA 4CM9A 5A03A 5IJZA 4EEXA 1PR9A 2Q1WA 1NPTO 3K6JA 5JPIA 1LSSA 1UDCA 4BNYA 2GZ2A 4IPTA 4NFHA 1M76A 1U5CA 3ENNA 4KUGA 1MGOA 3CMCO 3RCBA 4CR8A 1SB8A 2YHIA 3CEAA 3S1LA 4AL4A 4I5DA 3FPLA 2C2YA 3B20A 2Q2QA 1ZKMA 3QVTA 4C7KA 3ETEA 4D3FA 4RJTA 1P0FA 1HRDA 1CYDA 2CSUA 4BV9A 1M66A 1JAXA 1V3TA 4BQPA 4CM1A 3RJ5A 5A02A 4UUOA 3QWBA 4CMCA 5JCJD 4GSLA 1GUFA 3LLVA 3WGOA 2O3SA 2IYPA 4O63O 2VQ3A 2CVOA 3DOCA 4M54A 4CQMB 2V6GA 2PD4A 1AE1A 1MA0A 5BSGA 5JSFA 4IINA 3TFOA 2FMUA 3C7AA 4RVGA 3FHLA 3K31A 1PJTA 4NHEA 5A4DA 3UVEA 5BSFA 2X0JA 1LTHR 1B8PA 1D7OA 1DOHA 1HLDA 1UXIA 3AW9A 3KSZO 4M8SA 4R1NA 2PH3A 3CH6A 3G79A 1KOLA 4CV0A 4DGSA 4WPGA 1PJLA 1BXGA 4KOAA 4Z3DA 1D1SA 3DBRB 1H2BA 3L07A 3QVXA 1P45A 4QQRA 2C07A 1BXZA 4XGIA 1NVMB 3JQAD 2JCXA 1R6DA 5DBFA 1PL7A 1QYXA 2IZZA 2LDXA 5C37A 4B79A 3F5SA 3HZZA 4IDEA 4E5YA 1FXSA 4IMRA 1E77A 3KHUA 2GN9A 1IULA 3ICCA 5L9AA 3TZQA 5G0VA 2DFVA 2AMFA 3S2FA 1E7WA 2Y0CA 4DYVA 2PD6A 3TSCA 9LDTA 1Q2XA 3GA0A 2WDZA 4A5OA 1UR5A 5A5EA 3OEYA 3QW2A 1DRUA 3IUSA 1MG0A 5CPBA 3I83A 1PZEA 2HJSA 2NU7A 2UUOA 2AQIA 3HDYA 3NJ8A 3GGPA 3RROA 3CZRA 2DBRA 3R3JA 4M87A 1U5AA 1Q0QA 4Q3CA 5JCXA 3B1KA 2B4TO 4FR5A 4IJKA 2GN6A 4TVBA 3U09A 3RBVA 2PZMA 1Y9AA 4BNFA 2XXJA 4D3DA 4W7HA 1GZ3A 1P3DA 3Q6IA 1OBFO 1QXSA 4RORA 1BRMA 5TX7A 3JYLA 1P1KA 2PK3A 2J5RA 1BSVA 1C0IA 2EF1A 1JAYA 1LX6A 4FSHA 3TJRA 3AI2A 3NTRA 4JLWA 3VVCA 4PLWA 2CDBA 1H94A 4Q3EA 1VKOA 2HKIA 2E37A 1ISGA 2PTGA 2NSDA 1DRWA 1I30A 2D59A 3H6KA 1QKIA 1I3NA 3AFMA 3RUCA 2RIRA 1OZAA 3AOGA 1B7GO 4GKBA 4JJGA 1RM4A 3G17A 3WGIA 3H3JA 1DFGA 4IDCA 1R4NA 1E3EA 3DZFA 3NAQA 3RJ9A 3LC7O 4OM8A 3ZNPA 1CDOA 4BNGA 3Q0EA 1ZO8A 1Z73A 1ZK1A 2AEFA 4CR6A 4K6CA 4UVEA 3DAPA 4DC1A 4YAGA 3ZU2A 3H8VA 2HQ1A 1NX6A 1OI7A 1RM3A 3DAGA 4BNJA 1F12A 4X54A 2J6IA 3PK0A 5A05A 1P1IA 4EJ6A 2J8ZA 5LDHA 5DP1A 4YTEA 2TMGA 3BMNA 5TQVA 4FIZA 1EBFA 4CM5A 1H6DA 1WVGA 3JD3A 5JC8A 5L40A 5G0SA 2NVWA 4J9VA 1GPDG 3DBLA 3IL2A 2G76A 2O4CA 3TL3A 4JN6B 3PQFA 4BHTA 1XDWA 3L6EA 3HN2A 1QORA 2X8LA 3BAZA 4PCVA 1U2DA 4ZRMA 3U4CA 5G0UA 3JQGA 4ZQBA 2EKLA 5BR7A 2QZ9A 3U49A 2WEKA 1HDXA 1NP3A 3ZCXA 1HE5A 2DBVO 3ZWCA 1XEAA 4DBVO 2YZ7A 3DZBA 1T24A 3KZVA 4LSWA 1PL6A 1WPQA 4IDGA 3KSDO 3FBTA 5B4VA 3G49A 3JTMA 2I66A 2ZTVA 4KUHA 1P44A 4I08A 1N9GA 2ZTUA 4W7IA 4B4VA 2J3JA 4UAGA 1E7SA 3FR8A 3OMLA 4LMPA 3WFJA 1VE9A 5B4TA 4HP8A 3M2TA 2I6TA 3NT4A 1M6WA 1W0CA 4EUHA 3ZHZA 2FR0A 4TSKA 1F8GA 4CV1A 3M1LA 3WYBA 3JQDA 4XRGA 2EGHA 1XU9A 2JHFA 4K1LA 3INTA 3U4DA 1WDMA 2O48X 4RQTA 5C7IO 1E7MA 2X0NA 1CERA 1XGKA 3WGTA 3DHEA 5TT0A 1ZMTA 1SNYA 1EUDA 1T2EA 4NH4A 4MVJP 1AGNA 1EUCA 2VWHA 4BMVA 5LCXA 3DFZA 1FDSA 3OF2A 5ENDA 2Y1GA 8LDHA 1FDUA 3GEDA 4YPOA 1CEQA 4OKIA 4RLHA 5CEEA 2FPPA 3MWDB 4XB1A 5HM8A 3LT1A 1JDJA 4YAEA 4HWKA 2WD7A 3FNEA 3WXBA 1F17A 1EVYA 1P31A 1LSOA 5KVCA 1X1TA 4YYZA 2G0TA 3TOXA 4AJOA 2NWQA 3ITDA 4HUJA 2VT2A 4AJEA 3NRCA 3KRTA 1ULSA 3PWSA 5MGBA 2YFQA 5DN9A 2NQTA 1ZK3A 4W99A 4HY3A 5T57A 3JQ7A 4PG8A 4YJGA 2W2LA 4MVJH 2VZ9A 2W8ZA 4DL9A 2FPGA 1N2SA 4ROSA 2AG8A 4TKMA 4GGOA 5DCYA 5EMHA 4XDYA 5IAAA 4U8GA 3O8QA 3RWBA 3WQRA 1N92A 1ZUD1 1D1TA 1RPNA 1U7HA 3QSGA 1MXHA 4B4UA 3KYBA 1X0XA 1Y8RA 3GDOA 5CG1A 5JY6A 4CMJA 2C54A 3BTVA 1E3JA 1R0LA 1HT0A 4ND4A 3F4LA 2GF2A 4KTTE 3W4IA 1IE3A 3LVFO 3N58A 2W98A 3FNHA 2X1HA 2HJRA 3ZWWA 1GQ2A 2OUIA 2VUSA 5I8ZA 3I52A 1N8KA 1SOVA 4PLGA 3INGA 1K5HA 3O9ZA 4CMEC 1JWAB 3NUGA 4N7RA 3GGGA 1GL3A 4G5HA 3RC1A 4YAKA 4XIYA 4XX0A 4DIFA 1F8FA 4L4RA 1GEGA 1SB9A 2DVMA 4Q3NA 1P0CA 2Y1EA 4RO0A 4CL8A 3ENKA 1E6UA 4FD3A 3DAFA 3OICA 4YB8A 2X5OA 3DZGA 4FQ8A 4DLBA 1EFKA 1A9ZA 4FW8A 5ES3A 4BO2A 2FWMX 1BGVA 2HLPA 3TN7A 1B3BA 5ER6A 3BMOA 4J1TA 2X9NA 5KJ6A 1O89A 1Y7TA 3PZBA 2GGSA 1L7EA 1X1EA 2EP7A 1KVQA 3TDKA 2AE2A 4RPHA 3JYPA 2QYSA 4YJHA 1V3UA 2HK8A 1U3VA 3D3WA 4UEJA 2ZJ1A 4NFSA 3W8DA 2BH9A 3WIDA 1C3VA 3VH2A 4R1TA 4BNHA 3AOEA 5HRUA 1SEPA 3A14A 3DL2A 4MDHA 1UH5A 3GUYA 4HFNA 5HTOA 4J2HA 1LUAA 5L53A 2IEBA 5C7LO 4CMGA 1GQYA 1KS9A 3PIIA 5F1PA 1A7AA 5KCZA 1U8XX 1YQXA 2VWPA 3WYCA 4BNZA 3I6QA 1JWBB 3ASUA 3PXXA 3ROMA 3SX2A 4IJVA 3RBXA 5KJ1A 3OETA 5DZSA 2Z95A 1BDBA 3L9XA 3UGKA 4TRMA 4HX5A 2B4QA 5JS6A 1DFHA 3EAGA 3ZWAA 5K6AA 5JC1A 4PRKA 1TEHA 1T4DA 3DFUA 3PHJA 1HF3A 2VWQA 3NJ4A 3DZIA 3ZNNA 1C0PA 2ZATA 3BMQA 3FWZA 4DMLA 2P91A 3HE3A 3MJSA 3QVOA 1WMAA 2FOIA 1YL6A 3WG9A 2X22A 2FRDA 4WOJA 1KYQA 3ITKA 5GZ3A 2Q99A 4J2OA 2C29D 3GF4A 3H9UA 3HNPA 3VZRA 4XD2A 3HQ4O 4ALJA 4YAIA 4MP3A 3WGHA 1SBYA 4A2CA 2D4AA 4GH5A 5K9ZA 2EXXA 3ROPA 2Q1UA 1RM0A 4D46A 3JD1A 1YS4A 2UV8A 3BMNB 2PH5A 4TVOA 1R4MA 2G5CA 4R5HA 7MDHA 1XU7A 3RQSA 2PA3A 2DPGA 1WDKA 3RKRA 3IC5A 4L4SA 5I9NA 1ZJYA 3VH4A 1PJSA 4GLOA 3L77A 3OIGA 2H5LA 2I3GA 4IQ0A 1HXHA 4AICA 2VRBA 1L1FA 1DC6A 4YXFA 1ZEMA 2UYYA 1YOVB 4FFLA 4HV4A 1E1KA 1VSVA 3JQGB 2NM0A 3A1NA 5TIIA 3RUEA 4J43A 4L9RA 4JP2A 5JY1A 2NUAA 1KC1A 1O6ZA 4P38A 4UUMA 5AXBA 3ZN2A 2ZTLA 4CM7A 3RI3A 2VHWA 4WCFB 4WEOA 3MOIA 3EC7A 1Q0LA 4DREA 3D4NA 2ZKLA 3C85A 1RYEA 3QRWA 1X14A 1X7DA 2BD0A 4MIYA 3WNVA 2BMAA 1YXMA 4RGBA 3WGZA 1B8VA 4M89A 4Y6RA 1DIBA 2NACA 2EW8A 3ZZNA 2RH4A 2OL4A 1XQ1A 2ZQYA 2B37A 4BMNA 1T2AA 1XCBA 1U4SA 2QHXA 3GMDA 1CWUA 3QVSA 3GUCA 1GCOA 3KUXA 1ADGA 4CMIA 1V3VA 4CM4A 1NFRA 3L6DA 1PIWA 5AOVA 3IMFA 3H3FA 4D0SA 4E12A 4J4BA 1PZHA 1NAIA 1IUKA 3Q1LA 4WLFA 4DBZA 2Q2WA 1YBVA 4J6FA 5KKAA 1BXKA 3IJPA 3OFSA 1Q7GA 3WBBA 2IZ0A 1N7GA 1E3WA 4LMRA 3D4OA 2ZYGA 4BNIA 3ANLA 1NHGA 4FN4A 1IL0A 1P1JA 4MIOA 2EP5A 5F21A 1SMKA 3AOEC 1A27A 1GYRA 4LW8A 2DKNA 5EJ2A 5BT9A 4PGFA 1ZFNA 4BO4A 4EYEA 3K2EA 4Z6KA 5IFLA 2ZB8A 4CQMD 1DLJA 2V6BA 3NT2A 4DMMA 1PQWA 2HRZA 4XB2A 5KKCA 1U3UA 2B4RO 3GN2A 4J49A 4C7JA 5FI3A 3WB9A 1ISIA 1JW9B 1HSOA 5I9LA 2BLLA 3SBOA 3VPSA 2WD7B 1H0KA 4N5NA 3F9IA 4DYDA 1O0SA 1DIAA 1DFIA 1AHIA 1T1RA 1Z75A 1Z45A 4IQGA 4XIJA 5COBA 3UH1A 1ZNQO 4IQ8A 4RQUA 1W4ZA 1OOEA 1WNTA 3DMYA 2ZB7A 3CSDA 3H9JA 2HRBA 4P4GA 2OGUA 4J91A 2AEMA 5K6AC 3I3OA 4YJGB 1UUFA 1HLPA 1K6IA 2PZKA 4JX8A 3OQBA 1KY4A 1GUYA 1GD1O 2V6MA 2FZWA 2HUNA 2WE8A 4BIIA 5JMWA 4CLRB 3U9LA 4RL6A 3ZV6A 4RPKA 3GC6A 3PJEA 4TMFA 3ZHBA 4Y9DA 5JFOA 1I24A 4QXMA 5JYDA 1S6YA 1U1IA 1VC2A 4TRRA 1LLUA 3QY9A 3AM4A 3LLSA 3ZH2A 4OXNA 4AJJA 1H93A 4BNWA 1ZVMA 1DB3A 3T4EA 4Y98A 4ZQFA 4NR0A 3FN4A 5JCJA 2X23A 5FEUA 3JYOA 4YEDA 2HAEA 5IXYA 2PY6A 3PYMA 4G81A 4MPDA 1P33A 4R68A 1BW9A 2Q2VA 4GQAA 4B7CA 3PWKA 4D79A 2OBNA 4GL4A 4YCAA 1T2DA 4O5OA 4DPMA 3DWFA 1S7CA 3JD2A 1LSJA 2GZ1A 2BFMA 3RVDA 3G0OA 1OMOA 2V65A 2DFDA 4D3SA 4ND2A 1I2CA 2Y1OA 4II2A 2ILTA 3NTQA 4PLPA 1KIFA 3FPCA 1I3LA 3RAJA 3GHYA 2QIOA 1RKXA 3BMOB 1R0KA 3MJCA 3ZU4A 1UXGA 3IUPA 3PLRA 5C7OO 3A4VA 1PJ4A 1Y6JA 4WE3A 3JQAA 3KVOA 4LN1A 3WSWA 3WNQA 3LSYA 2NVUA 3D3WB 4EGFA 4NZ9A 4URFA 2X7HA 2JAPA 2VZ0A 2BGLA 3HHPA 5HS6A 5JAQA 2CVZA 3W4JA 4CODB 1HYHA 4ALMA 2I67A 4O0LA 4OOEA 5HWSA 4OL9A 1EFLA 3EDMA 5ITWA 4EDFA 4P22A 4NJOA 4QX6A 3RUIA 3WTCA 1O94A 3FD8A 3PFWO 2PKRA 3WQQA 2E4AA 5T6BA 4KWIA 1JKJA 4CMHA 1MG5A 1ADFA 3KYDB 4IDBA 4I1IA 3OBBA 1D3AA 2CVQA 1UP6A 1Y1PA 2I76A 4FFRA 4RDIA 5JW6A 3JQ6A 4KP7A 3EVNA 2D1YA 3DHYA 2VNSA 4WLOA 3ST7A 1EZ4A 4IS3A 2OFPA 1WDLA 4Z0HO 3B6ZA 3GGOA 2AHRA 5A9SB 1W8DA 3WR5A 4S1VA 3QHAA 2CF6A 4CLHA 3ANMA 3KYCA 5G4LA 4F3YA 2GN8A 1Z82A 1LQUA 3T4XA 1YB5A 2F1KA 1HDGO 4I5FA 1BDMA 1YRLA 4XEHA 4EUFA 4OXYA 4WLUA 3BMQB 4J3FA 4XZ3A 1YB4A 2WWRA 3HSKA 3TZKA 1MC5A 2C20A 2IYOA 1FDVA 3HDJA 4PLZA 2OOSA 3F6YA 3OQ1A 3IAHA 1SPXA 4WNCA 3E5MA 5I7SA 2HMSA 1OFGA 1LDMA 2FR1A 2PD3A 3GDGA 3ZV3A 4NBWA 1LDGA 3WGGA 4BB5A 2YDXA 4TROA 4PRLA 4WOKA 3FNFA 2O2YA 1EQUA 4E30A 1MC4A 2DBZA 4ZU3A 4ITUA 4W4TA 2Z5LA 3U4HA 2BFAA 3HADA 3DC2A 1HWYA 2P4QA 5I7VA 3BHIA 4YRAA 2RHCA 1I0ZA 4R9RA 2HO5A 5H83A 3VC7A 3ZNOA 4XQ9A 4ALNA 4I9HA 3TF5A 3ZWNA 4CM8A 2OMEA 3AJRA 3PQDA 1TT7A 1R37A 3IP3A 1EMDA 4J0FA 3CXRA 1JVBA 3M2PA 2VRCA 3TFQA 4NMHA 1YVEI 4BNXA 4YT2A 2O7QA 3KOUA 4O59O 4Q3AA 3MEQA 1Z7EA 3FNGA 1V9LA 3IJRA 1CF2O 2A92A 5JDIA 2CDAA 3AUTA 3MJVA 4RVFA 1E3SA 2CMDA 3WLEA 1E1LA 3K8ZA 1LQTA 4ZN6A 5L51A 3U62A 3KB6A 1IPEA 2G1UA 3P5SA 3PLNA 4IUYA 4MO2A 4FC6A 1HYEA 2DM6A 3N74A 3UKOA 3Q11A 5DOZA 2J5KA 2JCVA 5ENVA 3VKUA 3B1FA 4CMIB 1B26A 1QYWA 5JXWA 4CM4B 3A9WA 1QYDA 1V35A 1GAEO 1UP7A 2P9CA 2Q3EA 4QO8A 4WKGA 1U28A 3ANNA 2LDBA 2PNFA 2UVDA 1MP0A 4FCCA 1U3TA 3VZPA 2X5KO 3DB2A 1C1XA 1I5RA 3MWEB 4IJUA 1XYGA 2QZZA 3FF4A 3S2EA 4E5PA 4NPCA 4XGKA 2O3JA 4UEOA 4IMPA 2UAGA 3JQ9A 3LT2A 4GX2A 3KLMX 3JYQA 5DDIP 5JMPA 2FSSA 2PFGA 3UFXA 4U0JA 5TC4A 3RSHA 1Y8QA 2J3KA 2ZIZA 4GX1A 3UCXA 2HK7A 3NDRA 3HFSA 5EERA 1R16A 1I3KA 1NBOA 1T1SA 1ZK4A 2CFCA 3CE6A 1J6UA 5DT9A 4E33A 4R1SA 3T7EA 1T2FA 5ADHA 2GCGA 3H7AA 5FF9A 1HSZA 4U6SA 2HCTA 4CMEA 2Y66A 2BF7A 4LISA 2ZCVA 3GZNA 1ZZEA 1P1FA 4J4TA 4OQZA 3ZHXA 5I7FA 2NTJA 3DBHB 3SLGA 4EEZA 5EL0A 2PZJA 1ZBQA 1X0VA 4GI2A 3KBOA 4FOSA 3VZSA 1ONPA 5GMOA 4CR7A 4RDHA 3E5RA 3I23A 1EE9A 4DWVA 2ZK7A 4NBVA 4NDNE 4NU5A 4DIBA 2BKAA 4KWHA 4OIMA 3A28A 2P5YA 3V5NA 2D5CA 4E2WA 3C1TA 1K3TA 3I9NA 1M75A 1YO6A 2EKPA 3D5QA 5KTKA 4AJHA 4DPKA 3PIDA 1KEUA 3QVWA 4MP8A 3LC2O 3T7CA 4A03A 3V8BA 4CQLA 4FJ2A 3WYEA 2O4UX 2PGDA 3OJFA 1GR0A 1P77A 2DU8A 3ZGYA 3P2OA 2WJPA 3R3SA 2X9VA 3TRIA 4DPLA 3GDFA 1XKQA 5CDUA 4B4WA 2W90A 1HETA 1YBMA 5G4KA 4BNLA 3UICA 3TWOA 4PLVA 4O1MA 1T2CA 5L3ZA 1PJ2A 4W6ZA 3I5MA 5TF4A 2QQ5A 2UUPA 3RIHA 2Y68A 3HN7A 3FSRA 3DTTA 2EWMA 1ONNA 5B4UA 5AQ1A 3I6IA 5IDXA 1IZ9A 5KNLA 1UXHA 3OM9A 3RC2A 1E7YA 4HFJA 4JK3A 5KJFA 1U4OA 1OC2A 1I33A 1M6HA 5JDIC 3GZ4A 3BXXA 3EVTA 4BQRA 1PJ3A 1UDAA 2WD8A 3DONA 3WQSB 4J16A 4R5MA 4R3WA 1K89A 3LDHA 1ADBA 1JQBA 4GLLA 4R1UA 2NVUB 1HYGA 5A3VA 5JYEA 1LU9A 4I8XA 4RPLA 2H9IA 3LZ6A 1DDOA 1NXQA 3DTYA 3VPGA 3BHJA 1KVUA 3F47A 2A9FA 4MVJI 5CDTA 4ONEA 3OIFA 4B3IA 2O3UA 2A35A 1JKIA 3UCEA 4IDFA 1PGJA 4EW6A 4DUPA 1C1DB 1ORRA 2YHUA 1T26A 3JQBA 1RJWA 2ZCUA 3VH1A 1NHWA 3AM5A 4GX5A 3WWYA 3D1LA 2GNAA 3PI7A 4F46A 3L4SO 1AHHA 4C4OA 1A9YA 4OSPA 4ZRNA 4OJNA 1DHTA 1FDTA 5KOIA 3ZNQA 4Z9YA 1K6XA 4Z0TA 1YL7A 3EZYA 4PZEA 2YHIB 4S3MA 3ZI0A 1Q1NA 3CUKA 5T8KC 4FB5A 4RF2A 3RFVA 5A06A 2HU2A 2GRAA 1LC3A 4R4JA 4PVCA 1CIVA 3JQ9C 2C5EA 4M55A 4AJ4A 2VTEA 1J49A 3WGQA 2EV9A 2ZYDA 2B36A 3ABIA 5THQA 4FS3A 4JXKA 1LDYA 2W2KA 2YQ5A 4E0BA 3PQEA 4OHUA 1N1GA 3PPIA 4UUPA 1LJ8A 5L4NA 3ZV5A 4ILKA 5TT1A 5DF1A 1XLTA 4LVCA 4BKUA 4DIOA 1K2WA 4XCVA 2P68A 5COQA 1WZIA 3MOGA 4AVYA 5C5IA 1PZFA 2XPCA 3EHEA 3GH3A 5TJHA 4YQZA 4BNUA 2GN4A 4L8VA 4PZCA 1PJBA 3BIOA 4MVJE 1YB1A 4PLYA 3NDIA 6ADHA 4CUJA 2I99A 1BXGB 1BWSA 1DRVA 3UN1A 4A26A 4GWGA 2VZ8A 3GRKA 3VDQA 1DO8A 3ZDFA 2Z1MA 1PGQA 4O6VA 1K6JA 1XG5A 2JD2A 4WUVA 3W1VA 1VJ1A 4CM8B 2JD0A 2PR2A 4CJXA 1IB6A 4EI2A 3FRJA 1WLYA 3OSUA 4CLOA 5KVVA 4BGEA 2PGLA 1QG6A 4LCEA 1DIHA 1PGNA 2DT5A 4YBZA 1LXCA 3AK4A 2VOJA 4ZQEA 4BV8A 4YRBA 1XELA 3QJ5A 4R9SA 1E3IA 4G2NA 1AUPA 4J1NA 4Q9NA 4D43A 3UUWA 1NPYA 1HZJA 4N54A 1N5DA 2DLDA 2DUUA 2Q46A 3WMWA 1D4FA 2O23A 4OMUA 4ESOA 3EMKA 1EQ2A 2O3RA 2CY0A 3C3XA 4M1QA 1P9LA 3ZU3A 1U7TA 3W8EA 2ZB3A 4GVLA 1YL5A 1XHLA 4QO7A 1I8TA 2I9PA 4Z3KA 1NQ5A 2IODA 5G2OA 1NQAO 3VOSA 3L0DA 5G0TA 2C5AA 4PG4A 5K0ZA 1G0OA 3CZMA 3RBZA 2JJYA 1UP4A 3FWNA 4EBFA 4BNKA 4PLTA 1GPJA 2B35A 3A06A 1HE4A 2DQ4A 2FN7A 3C8MA 3DR3A 3ZW9A 4NBUA 3MTGA 1PJQA 4XYBA 2W2LD 3C24A 3KXDA 2X58A 5T64A 1CQJA 4FDAA 3QIVA 4A73A 3GAZA 1NR1A 2POQX 4D41A 2Y1DA 1SAYA 4BO6A 1QP8A 3QWAA 2GPTA 2PKQP 4XJSA 3OJOA 4RLSA 4F6CA 1E6WA 4KQWA 1XIVA 5ITVA 1LRJA 2RAFA 2HMVA 1J5PA 4LVUA 2VTDA 1R4NB 3IKVA 3IDSA 3V1YA 4DLLA 4MKXA 4UVHA 3DZKA 1PWXA 1ZXBA 3OH8A 1ZK2A 4PLFA 4RF5A 4CL3A 4PN3A 5A5FA 2CF5A 3KO8A 5L7WA 1UZNA 4JIGA 2Q49A 3EZLA 3JQBC 1LI4A 1EVIA 1VL0A 3L6OO 3SJUA 3WDSA 4CQMA 5HS4A 5AXCA 1BVRA 1GCUA 3E9QA 4WECA 3DBLB 3GZNB 4ZQGA 2H6EA 2QRLA 2QG4A 5DCUA 2IE0A 2QX7A 1NNUA 3O03A 1PL8A 3VH3A 3GLQA 3LF1A 4PG7A 3HG7A 2NADA 3OA0A 1RWBA 3QE3A 4D7AA 4E2YA 3WBFA 4WGGA 1I3MA 1CQIA 4GWKA 1QYCA 5KVQA 4YAJA 2O3QA 1YJQA 1TA4A 3INRA 5HA5A 1PU2A 1KVSA 3F1LA 4F45A 4Y8VA 1QV6A 4IGEA 5JNLA 3ZWXA 1G6KA 3NTOA 4L73A 4CQLB 4J0EA 1N9GB 1UZLA 3TNLA 1E5QA 2BGMA 4WK6A 5CDSA 1MXFA 4IZHA 5IZCA 1NASA 2Y1CA 4CMKA 4AJKA 3GQVA 3D64A 4L0QA 3V1TC 5BSEA 9LDBA 3G1UA 4Q3BA 1WXDA 5MDHA 4CLXA 3PEFA 2GDZA 1YONA 4U0KA 4YDRA 3WGYA 2GERA 5A3JA 1VKNA 2PZLA 2VYVD 3NGLA 4UVDA 1O95A 5EQDA 3UOGA 1NPDA 3K92A 1V0JA 2BFPA 2GR9A 3MJEA 1RYDA 2ZYAA 4FFNA 4OO3A 5TS3A 4B3JA 4J90A 3EGOA 3SLKA 3ZV4A 4RPGA 1KEPA 1A4IA 2NU8A 3HDHA 2XXBA 1YJ8A 4B3HA 1QMGA 3QWHA 1AXGA 3N7UA 3C1AA 3MZ0A 3S2IA 2JFFA 4NBTA 1DXYA 4RF3A 1EBUA 2VHZA 3WWZA 4B7UA 1TXGA 2FY8A 5JLAA 3D7LA 3ZWOA 2NLOA 1IHYA 1QLJA 3QLJA 2XF8A 1ARZA 4FGSA 4RCVA 1UAGA 2OZPA 1PTJA 1O8CA 2YV1A 2O7SA 1H2HA 1LDNA 3QV1A 3H65A 1GV1A 3GEMA 3JD0A 2VNAA 3DXFA 2TMDA 4GGPA 3H5RA 5KJEA 4PZDA 3R6DA 3KEOA 1VSUA 4ALKA 4UVIA 3E03A 1C0LA 3EYWA 5TSDA 2IXAA 1FF9A 2B5VA 4JNKA 4GKVA 8ADHA 1I10A 2ZJ0A 5A9TA 4E5NA 4TQGA 1ZSVA 3VDRA 1HDYA 3CTMA 5TRTA 2JD1A 4TWRA 1EK5A 3ETDA 3VHRA 3ZU5A 3NGXA 3WJAA 3JQ7B 3TQHA 1JKFA 1Y81A 2BELA 3ASVA 5H82A 4JBHA 1VLLA 5JDCA 1NYTA 3AWDA 4IZIA 2AXQA 3RKUA 1KVRA 1KEVA 1EK6A 2I5PO
chains in the Genus database with same CATH superfamily
4CIXA 4FGJA 4QXRA 4YDQA 3BXFA 3W2FA 4ZHQA 4G09A 3B53X 3BICA 1Y9EA 4JI7B 1H3EA 1Y8RB 2D7CA 4HN9A 4XCXA 4HHEA 4IO1A 4B3BA 3DV0B 2GEUA 3X1KA 3E82A 3OP1A 5DM2A 3KL4A 4LRTB 3DPUA 4ZDIA 4HBGA 2Q5LA 4AP5A 2R62A 3IHKA 3R09A 1B8UA 4EY5A 1QRDA 2OENG 4YRSA 4DQVA 2YXDA 1E3DA 5I51A 5BSTA 4N47A 1QP4A 3JW8A 3NC1C 3TL2A 1W75A 5HIJA 2VHUA 3EAQA 1ZBDA 3GT0A 4FHDA 5AO9A 3RPEA 1G5HA 1T5LA 5A0VA 2D2IA 1YGYA 3QKRB 2B1GA 3QU4A 4MA5A 3N0XA 3X44A 3P0IA 4A7PA 1QOZA 1RR6A 2P2SA 5JROA 4RTJA 3AL3A 1JEYB 4GXRA 3SQLA 1SC6A 3UFBA 4PQGA 3SS7X 4I1RA 8OHMA 4C0AC 4LYDA 1IMOA 2PA0A 1N7JA 2ZJZA 4TUYA 4GMXA 3HEMA 1OZHA 2AA3A 2IA5A 1ZUNA 2CDRA 2JIMA 3N2YA 4NCXA 5D8DA 3VTZA 2F4NA 2HMWA 4OI0A 3TZEA 4TWBA 1YD7A 4ZANA 3H5NA 2X6RA 1ZSYA 4UMFA 2WJ4A 1IXKA 4K87A 1XA4A 1JDUA 3FKQA 3KEGA 4L75A 2KJQA 3BIXA 4UDOA 3X3HA 3DCIA 3VBCA 2VP4A 1A4UA 1W0JA 2VPZA 1GZSA 2B69A 2UDPA 1VL8A 4D1YA 3NTVA 3KEFA 2BMWA 2DPMA 2E4XA 2QE7A 2YIVX 3VU1A 1Z6QA 2H9AA 3LDFA 1XSEA 5HKKA 3BE8A 3TIGA 5CFRA 4WZBB 2QBYB 3LQFA 1UBGA 1JR6A 1OYOA 121PA 5KSPA 3RREA 4MV8A 5JBIA 2YY7A 1JHMA 2YDYA 4PAGA 3V3TA 5BRAA 4KLNA 5LJIA 3TD6A 2O1EA 3SM9A 2XTJA 4OXQA 4LG1A 2PM8A 4EB3A 4AFNA 4I55B 5JAHA 1ZXLA 4M1SA 1KRXA 2O0LA 4BFUA 2V7UA 1W88B 4AG3A 5AIAA 4LFAB 1ZI8A 4IDDA 2BTOA 2QV7A 4U6QA 1RQXA 3N6VA 6GPBA 1Z29A 4R0VA 5MFZA 1EXDA 3R9WA 2HSWA 2Q1SA 1YB6A 3OECA 1RKBA 3P0EA 4GYYA 2ZT7A 4P58A 1DAPA 4X91A 3I5AA 5DX0A 3ILVA 1XAHA 4G23A 4KRYA 1SA0A 1TPZA 3NYWA 4E22A 1PKEA 1JLHA 3B9BA 4CKXA 5CIQA 3MWDA 1N36B 4E13A 2Q3JA 3FBGA 2FTKE 1LA2A 3GBPA 3IJEB 3OE7D 4HDRB 4JUAA 4Y9TA 4DZRA 2FVYA 3DAOA 1FRZA 4RA9B 4B75A 5DI9A 4IRUB 1JFVA 4W1RA 1RD4A 3C8HA 4F5DA 1QGAA 3HI4A 4EZBA 2OVBA 2WJ3A 1L5GB 2NNLD 2IW3A 4HQNA 1OYWA 4LUCA 2C7QA 1NI4B 1V8DA 3N0VA 3CHYA 3Q88A 1NBIA 4WXEA 1KZ1A 2JC3A 2ZJ5A 1VPDA 2CXPA 3ZYCA 4D8XA 3HFJA 5BXYA 3DKVA 1H9AA 3QNMA 4PBRA 1NF9A 1PTJC 5DBOA 3MW8A 3AI3A 1C29B 4E4RA 1J0XO 1YBHA 4J9UE 4XIGS 1SKQA 5I9MA 2PMDA 4AN1A 1PVOA 2O3TA 2FWAA 4Q6WA 1QVZA 4MRAA 1TVEA 2OHGA 2P62A 2CDCA 3PDUA 3H1TA 4KC0A 1PQYA 2VDPB 4UTOA 1IHOA 1NQTA 2RB4A 4BP9A 5I4CA 2CKDA 9MHTA 2E48A 3OP4A 2XAAA 2COKA 3FSEA 3PNVA 4P2GA 1E61A 1KKUA 3LHSA 3ABSB 4D4MA 2XQKA 5JRDS 4R9UC 4DDKA 2II6A 3WGMA 7MHTA 2Q21A 3DWEX 4GE3A 4MVJD 1RJ9B 2AFVA 5G1NA 5LXTF 1QF6A 2P2LA 2XLBA 5CGZA 1R4MB 4TZ6A 1PSDA 1TT5A 1Y33E 2FSVA 4K6FA 3MBIA 4KLCA 1UQRA 1Y1KE 1WJGA 2PXXA 2JFXA 4PXAA 4ZI7F 1E8DA 4HGYA 2BBTA 1Q17A 3CE9A 3FMFA 3WFZA 4DOMA 4TZTA 1FPQA 2Y9MB 2NQ2C 4ARUA 4FOOA 4C88A 4B17A 3C3EA 3KM0A 4BMXA 4BDSA 1F1JA 2OLJA 4UNSA 3ZGOA 4EITA 3LAWA 3W06A 7ADHA 3L8MA 1E7QA 3OD5A 3MCTA 1E62A 1C9MA 1RIFA 2NOAA 1L7XA 1WUTA 2XMBA 3PRJA 2VCEA 4OL0A 1ISPA 2I7CA 3GK3A 3MCVA 4D97A 1Z8FA 2PGXA 3PDHA 4PHFA 2QQFA 4CHTA 3SIPA 1JZQA 1SZJG 2JGDA 1Q0RA 4BXOA 4MKRA 4TGLA 2JVJA 2Q0HA 4IOLA 5I9NA 2QMOA 1FDWA 3RUDA 4BWVA 5MDHA 1GADO 2C42A 1WCIB 1MIOB 3H1PA 1T5HX 3K1YA 3IKLA 5F5LA 4IHJA 1Z06A 1QBGA 3PA6A 3C15C 4R8VA 2WJWA 3DZHA 2DUNA 3TW8B 2OQVA 1Z0ZA 1OWPA 4IV8A 1SQ0A 5DEOA 1YH3A 5BQFA 4MYUA 1L8XA 1J21A 1ZMOA 4IIVA 3FNBA 5I4KA 1LNQA 4Q1DA 4RAOA 1B74A 1UADA 2GHIA 3RASA 1ODIA 1WPXA 2XYGA 3UK2A 5A04A 2WWFA 3KFVA 2LUOA 4CM9D 2QW0X 1FBNA 3GEGA 3K9LA 4P8RA 2XOXA 4XR4A 3V42A 2C2MA 2CJWA 5EZYA 4KPEC 4O4IB 3UMJA 4MROA 2VUUA 3SXUB 4UUNA 4UNIA 1N0WA 1IRXA 3G7UA 3PHLA 1AMNA 4IICA 3B13B 3BQMB 2H4WA 4RKWA 3WRVA 2AOUB 2ASVA 5K03A 3U19A 4QNMA 4B3FX 3K9HA 2PKQO 4KSCA 1MFPA 1H1LB 4GFDA 4TL8A 1ONOA 4YJDA 5K0FA 2JCBA 5CDYA 1AUVA 2E4YA 2YN2A 3RSSA 4Q01A 3U9SA 4DJEC 5JATA 1T8YA 3LX6A 2VA9A 5F73A 3KNZA 4K6OA 3RC3A 1P2VA 3NWJA 2GASA 2Z1DA 1ZIXA 3HJAA 2VF8A 3QLTA 3O3OB 4LX8A 5DIFA 5A7HA 3K0FA 3GGCA 4IFBA 4C01A 4C4PA 1X1QA 5IDYA 4Y6PA 1ZM3A 5JZVA 4QQKA 1E3LA 3AUSA 2XA9A 3ME5A 2UKDA 2GQ0A 4BP3A 1M2WA 3ER9A 3BTUA 5HM6A 1WCXA 3RNOA 1IOLA 1H0RA 3H9QA 4M2LA 2ID4A 1FUEA 2FMIA 4K6GA 4DDTA 3V8QA 4ZZ2A 1ZW6A 1U9CA 5AW7A 2VTKA 5G1OA 4O5AA 1TIPA 2Z6VA 2IP4A 1PNTA 4BO1A 1SUPA 2Z1NA 2I55A 2R6R1 2JFVA 3LDAA 4NYJQ 3U7HB 3CF6R 3F49S 5E6UA 2O7NA 3HPRA 4L4XA 2DPYA 3EVFA 1LV7A 1YIOA 1IH8A 4FFPA 4RPJA 2PFSA 2AFIB 1TB4A 3E61A 5FUWA 3MCAA 3KCQA 3JASA 1NVAA 4JEUA 4R01A 4OQPA 4UARA 4YWJA 3TI9A 3U3KA 5LA6B 3D3NA 1MJ5A 4PG5A 1TK9A 2WM3A 1SVIA 2YY6A 4RVUA 4XYLA 4JOQA 5TPZA 2GILA 3VUEA 4DR4B 4LK2A 4P98A 2HHLA 1JZTA 1QAQA 5BOVA 5JT1A 2WABA 4UHHA 5LLTA 1P91A 4H9GA 3T7AA 2QD5A 3LQ4A 3WHLA 4ZVNA 3P52A 5B12A 2BBOA 4I50F 1GGEA 1RQRA 4IV5A 2F55A 4C6TA 1JWLA 5AVJA 3WLPA 4GPD1 3HXOA 4WOBA 2RH8A 2B5WA 3FVWA 3HR8A 4PC2A 1DIRA 2VRNA 2HIHA 4XM2A 4ZHQB 1HL3A 2XLCA 4YP6A 4TYWA 4CV2A 3O92A 3BT7A 2DCMA 4E31A 4W5QA 1C9EA 2AEJA 4DT1B 1VRVA 4BEWA 3FPHA 4S1WA 1BOFA 3CRVA 2H00A 2JCSA 2FRXA 4Q93A 2PL9A 4YX9A 3PTAA 3CEPB 3LXMA 4LJKA 1MX3A 2WC1A 4Q34A 1WZNA 5FFFA 3REFA 1INLA 3RG2A 5K3FB 3RW9A 3SC3A 4D4GA 3DZJA 4KYTA 2VHYA 4LBZA 4CF7A 2DMRA 1U0OC 2FSVC 2QRGA 4NCKA 4EARA 1E79D 4IIUA 1N1DA 1ZIDA 3KYJB 4GMHA 2V7TA 4PXSA 4KQKA 4TV9B 4CG1A 4JGBA 3G1TA 4LWQA 3AM1A 4D6XA 1ZKDA 1SVOA 3IMCA 3KEQA 2BZ1A 4TUYB 5IMSA 3L8DA 2EERA 2J3HA 3EWIA 3N0RA 4W9NA 2KX7A 5DN6A 4J6EA 2JVKA 5D3MA 4FFOA 1HDRA 4UVGA 1N6KA 4C07A 1CJTC 3ZQ6A 4RVCA 3NKLA 2P4HX 1I4LD 1IWPB 2HU8A 3NAMA 4PO8A 2JEOA 2QRQA 1QGOA 4ASUA 3GVCA 4YT8A 4F86A 6NULA 1YUNA 1QVRA 4DIEA 721PA 1V8ZA 1L5KA 3CB4A 4UFNA 4J0HA 3H4VA 3VC2A 4RK5A 1JR4A 1PK9A 2DT8A 1KJ9A 4K9MA 1UFVA 2PV7A 3L4BA 4GI3A 1UWLA 1V1MB 3NOVA 4PLHA 3VR0A 2WUVA 3IAUA 4EHKA 2NXJA 4RDXA 3V55A 4V0ME 2ONCA 2P78A 3ZHRA 4UXIA 2JH9A 4OP3A 2MSWA 4FBGA 2OSVA 3O74A 3NYRA 3QV2A 5EWLA 4FGWA 4D44A 3UM9A 4ARZA 5E4TA 4L6IA 5F7OA 1KFBB 2X3YA 1V1JA 1O0CA 1R64A 4GKKB 4DW8A 3E9MA 3G59A 1QFMA 3BFJA 2O50A 3H1AA 5CFZA 4MR8A 1JDBC 1ZQ1A 1IZ8A 1NTRA 2G72A 2BEJA 3DTVB 3QXJA 3ENZA 3RC9A 2ZM6B 2VHQA 3MAJA 3IUQA 4S2UA 1SA0B 3DEYX 3NWEA 4NC9A 3TBFA 4E5KA 2WTBA 1VMIA 3FDIA 1E9SA 2CHUA 3PJFA 4J75A 2OAP1 1ISFA 1YIAA 2JFNA 3BSFA 3O7WA 4MW5A 2HH9A 1A5ZA 1PX2A 2MTBA 3SFTA 3TPCA 1MZVA 1G0NA 4L76A 5F2NA 5JO0A 2ZSJA 3PQ7A 4MNTA 4AX8A 4ZK6A 1AO3A 4HPWA 3G2JA 5HOQA 3OURA 1F20A 1GY8A 2E6UX 4PGGA 4BKOA 3KYCB 5H5JA 5KIAA 3QA9A 2P0YA 2EX1A 2I8LA 4LQCA 4POAA 5K20A 3ZVMA 1ZR2A 1M7HA 5BR8B 1QPZA 5L6MB 2GSWA 2WM9B 4GM0A 2CNNA 3OCVA 1JG1A 2F6RA 2PS0A 3Q2KA 4MVJG 4YROA 4F3NA 1RWNA 4KR9A 3PL1A 1P0IA 4URYR 2IP2A 5IARA 4E3ZA 2AOVA 3V4OA 1VL6A 1BE8A 3Q5EA 4IKOA 2MCFA 3QUAA 2EEPA 3ZIDA 5BPHA 1QLHA 1VYTA 4PZYA 2PX4A 5FA6A 5EXPA 1SD2A 4IDPA 2JLWA 2IHBA 3KJHA 3ADPA 3B1WA 5BYBA 3P94A 3TW0A 3PPXA 2WHRA 3EW9A 4CLRA 1HFEL 1C7RA 2OAGA 2V45A 3DMDA 5M29A 2ZLBA 3Q3EA 5B6PA 1VA4A 2NTEA 1ZJJA 2DC1A 3GJZA 1OGYA 2X1LA 1YV9A 2FLWA 4UNNA 5F4ZA 3K73O 3NDJA 4D6YA 1AKNA 1ISHA 4C0QC 3Q3IA 4HRYA 1NFFA 1TT5B 3N7AA 4CFZA 1NVTA 4BECA 3UJNA 1T13A 1PQUA 1FDIA 2WYVA 5EQFA 1MC8A 3CZAA 3EFOA 3CW2A 2BE9A 3A8TA 1YQGA 2JCYA 2HUPA 2OP1A 3V6MA 4QUGA 1ZUHA 3RT9A 5I7HA 4EJ0A 3OIYA 2YW9A 4U2CA 3S7ZA 1M5RA 4ABTA 5HJ7A 4YR9A 1PS9A 4M8LA 3I9LA 1LQ2A 1QH1B 2QAGB 2N42A 3QH4A 3SE7A 4ZGGA 2IUYA 3W6ZA 3PCTA 4DJFC 2XBUA 3DO6A 1WV0A 4EVIA 3JR3A 2FZKA 1ENPA 1KY3A 4N18A 3F97A 3Q7TA 3ND6A 3W8FA 4EF5A 2Q6VA 4MSUA 1HV8A 1AOXA 2O0MA 2E55A 2Q9AA 4KTVE 1MPTA 3RGWS 3H2SA 5EIAA 1VJTA 4PM4A 5ESXA 4ZGWA 1IJFA 4ENSA 1E4EB 3QPAA 3AFNA 5J9FA 3J81A 4RXMA 3GXBA 1JG2A 4P08A 3PGJA 4JT4A 2CJYA 3LGAA 3G8YA 1JR3A 2QRJA 5AXDA 3Q5DA 5AUNB 5ICEA 4B73A 3O2QB 4W9RA 4BQIA 2WSMA 3FW1A 2OLEA 4NCJA 3PGLA 4W9NC 4FBMA 3WKEA 1OGJA 1N6NA 3FYCA 2R79A 1GN9A 2ZYSA 1QHSA 2CFSA 5CFQA 1J4AA 1UJ6A 2XW6A 2NNWB 1HEUA 1WZEA 2ECKA 2IELA 1G8MA 3MQFA 2YQZA 5JXHA 1OVGA 2OAQ1 2R2GA 5EZYB 1CUUA 5BQPA 1ODKA 1SWVA 1X92A 4MULA 5IVDA 1KJIA 4NAUA 2OTCA 1JSZA 4UQOA 4BVLA 2OR3A 3DO8A 3GDHA 3H0EA 4DMGA 4QZVA 5AW4A 5U9CA 1PT8A 2NVBA 1DIOB 1PFQA 2PUTA 5IVKA 3D9QX 3BPSA 3II6X 3L4BC 1ILWA 1DEXA 1XZFA 4JC8A 1CCWA 1R50A 4LS3A 3LPDA 5KWEA 3P9RA 3GVIA 1NF2A 3ZK9A 4LTNA 1KS2A 5IEBA 3GN1A 2JFUA 3I6ZA 4LJ7A 4MMXB 3AUAA 4GKAA 1E0DA 5CJJA 3K0FB 4DLZA 3N87A 2VOEA 2IS4A 3CYFA 1JB9A 1ULUA 4FZRA 4D9CA 1G16A 2VSOA 1CQWA 1XVIA 5CVEA 2Z5FA 4EX6A 4EYOA 2EL9A 5IF9A 3IEVA 5AKLA 2PH1A 2WNIA 2Q9CA 4ML3A 3H9GA 2BI7A 4NBLA 5H3LA 1XCMA 2BI4A 2VYQA 2ZU0C 3KV3O 5FOQA 1D6NA 1H6AA 2XMCA 1XD8A 1ZINA 2RBEA 3KUCA 4GAEA 2R6DA 5BUSA 3HCAA 4QG7A 5IUJC 1QBKC 3BREA 4QLAA 5E6UB 4A0SA 3L8GA 3TYXA 1XDZA 2GCIA 1D7AA 1KARA 1XX6A 3GPIA 2A1TS 3DE7X 1PHPA 1RYFA 5DKFA 3T35A 1M6NA 1VRCA 4GYJA 2AN4A 3ASZA 4KR3A 1IK6A 2ZSEA 3M1IA 1XZNA 1SKMA 3VA7A 4B6JA 3I37X 3AY7A 3IGFA 5CG2A 2IFTA 4F21A 4N65A 3DNFA 4OXRA 3I9JA 4RY9A 4MGIR 4C0BA 3DT8A 4MW9A 2B9EA 2W48A 3T3HA 2OHOA 5KUTA 3S8MA 2ZVDA 3NPAA 2AMLA 1Q6ZA 4JJFA 1XWIA 4RXTA 3TFWA 3G8CA 1GQFA 4M7WA 2HA5A 5BV7A 3F90A 3KJGA 1RAAA 3OD1A 1ZW1A 3DBRA 4TYNA 4C6TB 4D99A 5BN5B 4Z8YA 1J2UA 4FJ1A 3J81k 1WMBA 2NZYA 1A9QA 1P75A 2A4KA 2PJZA 4OBEA 3TQOA 2BKLA 2WKSA 5IBPA 1GZ7A 3GY0A 5JJLA 1M1YA 1O96A 3T3NA 2Z4TA 5AVSA 2G5PA 3C4QA 4FNGA 2DY0A 3GG2A 1A8QA 4G86A 1M0TA 2PEYA 1WB4A 4JP1A 2DBQA 1U8UA 3B1ZA 2FVXA 4AULA 3HM9A 4E32A 3KZNA 2D54A 1P9RA 3PUHA 4MINA 2VT3A 4NDAA 2WZBA 3FFTA 3ONDA 2BFWA 3TQTA 3D3QA 3N8KA 1TX4B 2XNKA 4WOCA 2GWRA 3HB4X 4UU1A 3TG2A 10MHA 3M3DA 2W8BA 2QM7A 4OJQA 3T1OA 1YDHA 4G8CA 4CEIA 4LGMA 1C3XA 3FVVA 5EJGA 3WWCA 4RFSA 2QX8A 1QSGA 8ABPA 2P4SA 4RL4A 3X1YA 4AYTA 4DMRA 1DXQA 5CT8A 1PT6A 3RGGA 4LOJA 4L9AA 4Q9LA 3QVJA 3V4VB 2NPFA 4B4OA 1BVYF 1FYXA 3AXSA 2YOGA 4ZAWA 4DKXA 4QECA 4EQ6A 4U39A 4RV9A 4IP0A 3ZCRA 4OJKA 3ICEA 3BA1A 1J07A 5H4GA 4M21A 2I6QA 3M6LA 1QTRA 2OBBA 2AW5A 5DLPA 1XRRA 3ZK7A 4WQMA 1CDZA 3ZWBA 2HCFA 3AKZA 2ET6A 4MLCA 2ZUDA 1K7YA 3IPCA 4QAJA 4QG3A 5BORA 1AKTA 3FAKA 1X8KA 1ECPA 1KI6B 3DD1A 3RSZA 4ZYVA 1QAOA 5I9IA 3HY6A 3GFBA 3FPEA 4HWTA 5DASA 1QMPA 3REOA 3VZQA 2EX0A 3LQKA 4IF6A 5C8YA 4AWBA 1NMSA 2D7JA 3RHZA 2X9LA 1HE3A 2AN5A 4EUEA 4X8LA 1L0BA 1OGIA 4PC3A 3IPXA 3Q3JB 1LPOA 1EB9A 2GAIA 3IP7A 4KR0A 4ARZB 3HNRA 1Z3IX 3GL9A 4JHLA 3VC1A 4ENUA 5JVDA 3N75A 3VPHA 5TLSA 2A0XA 3IHWA 3PD0A 3CS3A 2H9YA 1ZM9A 3TM4A 1CUIA 2JKVA 4MR8B 1DQYA 3LP5A 1PJZA 2I7TA 4RZIA 2IUTA 4FYYA 2FN4A 2GK7A 3IIEA 2OA0A 2JGAA 3TZ6A 2H59A 3WLLA 4AMVA 5EZ6B 1A71A 4O4JA 1X7YB 3OG9A 4PSCA 4TLBA 1VTKA 4REQA 2FHSA 2ZAOA 4Y0VA 3DDZX 1ID1A 5DHAA 1JLLA 1KAOA 5DGHA 3GO4A 4E4YA 2RCNA 2WVGA 3PI6A 2VT7A 3JZFA 4RF4A 5CEFA 2ZBUA 1LJUA 1ZEJA 2WVAA 4D26A 1CR0A 5CA1B 3UJAA 3RU7A 4QDKA 3AESB 4BVJA 2GO7A 3M34A 4MV9A 5ES4B 1IYZA 3LO5A 4R51A 1EX7A 4B4WA 1H4QA 1ZI6A 2XZDA 3QF7A 1Q84A 1RYNA 5CEJA 1LDBA 4E2ZA 1PWHA 1RVDA 3EBLA 3H86A 4HDMA 1AKVA 2YJ3A 2OD7A 3EY4A 4XYEA 1Q74A 4A10A 4ALLA 3EGCA 3P9QA 4V3CA 3MWKA 1E1MA 4ZVRA 3AM3A 1FFWA 1KP9A 1JHVA 2DQKA 1VFNA 1T29A 3GVXA 1JR2A 3L8EA 2CEAA 1NVEA 2ETXA 2QTVB 4IIJF 4P53A 5CHEA 4A2PA 1P6XA 2K2QB 1KZHA 4LKRA 2ZI3A 3VZDA 3QOXA 1T5IA 1SULA 1X42A 2WQZA 3PGVA 3I73A 1G2QA 4JYCA 4BLOA 2V5AA 4B76A 5JFTA 4OFXA 4E2FA 1V71A 2WK1A 1Q1GA 1J25A 1E58A 3AZQA 4QBTA 4E0BA 1GPH1 2ZM5A 1KETA 4A16A 4M8IA 4CKBA 4ZZ3A 1XMIA 3M6UA 1PYDA 5KDLA 4X8MA 3IBTA 2EFJA 1JSXA 2ASEA 1P7VA 2BMFA 4KQXA 2EKDA 2QJTA 4X90A 4BMVA 4RUKA 2NTVA 2ZI7A 3GH1A 3LPCA 3I8XA 1RQNA 1M73E 5I4BA 3M1AA 4MVJA 1YKSA 4GOMD 4QWWA 1QIMA 4U9IS 3W79A 3GGJA 1S89A 1NN3A 4OHRA 5FOXA 1SCJA 1T3ZA 1U5BB 5D3ZA 4ZVUA 4L08A 1XNHA 2GPJA 3HXTA 2AEEA 3CH7A 5D6NA 4G0YA 1FX0B 1U0EA 1C5KA 2EATA 3GG9A 2JLRA 2L19A 1U3CA 3FKJA 5CFNA 3OM1A 1LLDA 5AVVA 1X8LA 4PYOA 5JEDA 1N0IA 2X4LA 3HXKA 4AD8A 4UBJA 4ZOBA 1P74A 1W52X 4DXHA 3B2QA 1O6CA 1V95A 4I14A 3FI9A 4WV3A 5F1KA 2A84A 3ZBUA 1OLOA 5FRDA 1AZSC 2X4GA 3K5PA 3D6VA 1L7MA 1ACJA 3ORQA 1Q2UA 2BI8A 2D2XA 3B89A 4R8SA 3WE7A 4BMYA 3EEOA 4B85A 1HTBA 1N32B 3L40A 1X15A 3WICA 4WZZA 3X0DA 1SZPA 2FUKA 3H6GA 3TZBA 1EFAA 1YDWA 1S8FA 4ZYTA 3GFQA 4QATA 1HEIA 3NALA 3IQGX 1DX9A 2FEOA 1X2BA 1GRRA 3L9WA 3LL4A 1FQKA 1V96A 1EIWA 1EE2A 3FMIA 4N3NA 3ZUPA 4W82A 4ZPXA 3VNAA 4EGAA 1Z6XA 1P6QA 4WCDA 5SYAA 1YRYE 1MJGM 4WLEA 1VSBA 4CM9A 1F48A 3DEAA 1UK6A 1NV9A 5EJAA 1PR9A 1XRPA 1XQVA 2F3UA 4ZRDA 3L1IA 4RD1A 5CNKA 1US8A 2RFLA 3UB4A 4G36A 3D2AA 3HKCB 4YMIA 4BNYA 3AIOA 5EMMA 4IPTA 2R44A 4YCDA 1LW6E 4IEIA 3I9V1 2I6XA 4ZCTA 2VI5A 1WEKA 2PTHA 3ENNA 4MI1A 5A1JA 1MGOA 1CRZA 4CR8A 4XUGB 1DBPA 2B4AA 1PK8A 2YHIA 4PONA 1CZLA 2DHRA 5SICE 5KOHB 1Z5GA 2QNBA 1CQZA 1JHPA 3QFHA 2YZGA 2AF3C 3QVTA 4XUCA 4G0NA 4YUVA 3WY9A 3U60B 3ETEA 4D3FA 2J41A 1JSLA 3NIWA 1QP0A 2IUEA 4BV9A 2HW8A 5HFJA 1ZOPA 1VDZA 2W0MA 3ZE7A 1H69A 3LPLA 4GO1A 3VYRB 3GLIE 2F1JA 2GK6A 2Q5FA 2O3SA 3EF3A 4EFLA 1E99A 1JHRA 5LXTA 1VJDA 5FTMA 2V6GA 1WO8A 1KOFA 3LLMA 4AY5A 4PS1A 1GIAA 4IINA 1JG7A 3C7AA 5DBEX 2AK3A 4BZZA 1GUAA 4ZI7A 2IY7A 2J0SA 3K4PA 3M8KA 2I1QA 3ZQKA 5A4DA 4Y7CA 3NWBA 1DOHA 1CP3A 2RBKA 3KSZO 3NZEA 1E69A 4R1NA 1KOLA 3CH6A 1FYVA 2H4FA 3CG0A 4KGVA 4QUBA 2VS1A 2WQ7A 3BIJA 3L49A 4PGAA 4KOAA 1NC3A 3ELYA 4Q4AB 4AF7A 2E89A 3HCEA 3JALA 1CQIB 4L95C 3ZD8A 2ZGVA 5AKKA 4JU8A 3DBRB 1LKZA 3L07A 3R3XA 1SBCA 2FNAA 4XGIA 1DKQA 2O2EA 1XLUA 2JCXA 3CZ4A 1R6DA 4F91B 5K4AA 1IZZA 4HZGA 4JBNA 1HNXB 1NVDA 1QYXA 1XO1A 1O96B 2LDXA 3M81A 1KR5A 3F5SA 4RXUA 3I92A 3QBEA 4PR3A 5K8TA 3B7PA 1FXSA 3AEKB 2AZXA 4IMRA 4B09A 1FXUA 2XH8A 1FFXA 4YPFA 3CR3C 2GN9A 7YASA 2I2AA 4LJRA 4JSYA 1RKQA 2H4XA 3BVPA 3QNWA 5JQWA 3UBMA 2QNIA 3KKNA 3TSCA 3F8SA 2H1FA 3K70D 1Z33A 3AONB 4TM8A 1VBMA 3WV4A 2AN3A 4QM7A 1RWVA 3BCRA 3C3JA 1MKYA 3BX1A 1EXMA 3IQHX 4WNYA 3QW2A 1N6IA 3LC0A 2ST1A 3FCAA 4WACA 1MG0A 1Y1TA 3B1VA 1R8XA 4RSMA 5EJMA 1DBIA 1VI6A 5FD8A 5FNVB 3M1YA 3ZY6A 2AQIA 2PMFA 2DLCX 4F72A 4MRRA 3PEVA 4GEGA 1BGWA 1HYBA 3TB4A 1VHWA 3R3JA 4M87A 5J5CA 4EBBA 4ZCMA 1V43A 4Q15A 1C8KA 2CV1A 4A82A 4AJ9A 4G01B 1E79A 2GN6A 3Q12A 2H1VA 4WZAB 3RBVA 3CCFA 4EQ6B 4DR3B 1Y9AA 4H7KA 1TFUA 3IESA 1ZL0A 2O1SA 3RWMB 1GZ3A 5EAIA 3ZW7A 3GOQA 1XQXA 5KX5B 1L7NA 2BJVA 1NDHA 2BZSA 2DETA 4D8UA 5EMKA 2J5RA 2C96A 2LZ0A 2Y0BA 3MWLA 1SBZA 1LX6A 4JLWA 3JQRA 5JH7B 3GLSA 2IY8A 3KZXA 4UDXX 4FT4A 4I4TA 4B5KA 1Z6GA 1ZN7A 1G60A 2XUIA 2DQYA 2I2DA 1YA4A 2V96A 1NE2A 3C43A 3CSUA 1C41A 4TYQA 3RUCA 3TNJA 3RYCA 4BN0A 3AOGA 4XH9B 4AKTA 1SU8A 4ZAYA 2I9KA 3G0GA 3WL8A 3JVIA 3GGSA 5JVDB 2NYRA 4GU5A 3DW3X 3W3AH 5LVAA 4DM7A 2AG6A 2GZSA 1RJGA 3DZFA 2ZJ3A 3LC7O 1E1YA 1VHQA 1N8NA 4RZ2A 3N28A 2I1LA 5D84A 1MHPA 5CLFA 3U17A 2H2IA 4CEHB 4U2KA 3SVZA 4O4LA 3QNUA 1P1IA 3IUBA 3LIPA 4HQ6A 4REQB 3SMQA 5LDHA 4HQ0A 2M9MA 2BSXA 3MS4A 2WZQA 2A5DA 1NLFA 5EP2A 1RLTA 1H6DA 4I50A 5REQA 1X2EA 5H9WA 1GPDG 2GF0A 2XJ9A 4EPRA 1TUBA 3GPCA 4DDWA 2ERCA 4BHTA 3T99A 1Z8HA 1EWRA 2IEYA 4BJHB 2X8LA 1TO2E 3PFNA 4M22A 3KVRA 1NY6A 4PCVA 1CBUA 4M1MA 4YRTA 4ZRMA 3U4CA 1CFJA 3ZK8A 2H7VA 4K9LA 3SZUA 2GEJA 4ZEVA 1I3CA 3RRBA 1VZ3A 2FPOA 3PDWA 3A4MA 4CTJA 1LBSA 1PZXA 1QK5A 1NP3A 4ZT6A 1ULZA 1KBOA 4RACA 1SM4A 3F7TA 1LPSA 1NXPA 4QXPA 3TG8A 1ZCZA 2WG1A 4NCNA 1PT9A 1NULA 2XUKA 5AVXA 4LXYA 2DFNA 1G7SA 2ID7A 3ESDA 3W6OA 3RVJA 1BQ3A 1GITA 3EDYA 4HDSB 3KSDO 5B4VA 1ZGZA 3EDRA 2XGJA 3GRYA 5K6TA 2I66A 1Z4IA 4CKBB 5CJPA 5C8ZA 3ROGA 2ZS8A 3QYFA 1XF9A 2ZTUA 2IBTA 4W7IA 2JGFA 1GZDA 1ZVQA 2GEKA 4UAGA 4BBPA 5IYZF 3LHDA 3LPNA 4Y3UA 5K09A 2OE2A 4LMPA 4MKIA 3U3ZA 2P40A 4XASA 1JJ7A 3WFJA 2JFPA 4UQLA 1UT5A 1VE9A 1KGDA 2ZWOA 1XXHE 1AKUA 3L6RA 3NBFA 4HP8A 4GMKA 4EYQA 1N4AA 2I6TA 4EUHA 1M6WA 4OHZA 4TTQA 4JVMA 1F8GA 1Y37A 4JI8B 5KNBD 1G55A 2W37A 5EHNA 4EAAA 1G66A 1A96A 5AQEA 1FNBA 2IU6A 3WYBA 2OKCA 5ALXA 1XMOB 3B5EA 1KK0A 3JSXA 1JVNA 2WV7A 2I71A 3I34X 3TKAA 1Z4PX 4J3JA 4C5AA 4I1YA 3LWZA 3OOJA 3PG5A 3LRPA 5BO5A 5KOYA 5K3AA 4L9SA 4X1IA 5DNCA 3L43A 1IWBB 1I0LA 3DHEA 5DYGA 5K0JA 2BM9A 3MSXA 4QULA 3SJAA 2WMYA 1GOTA 4DEVA 1MEOA 1U7DA 2YMLA 4PXYA 3T7TA 1EUDA 2WF9A 1WF3A 4NH4A 5JCOC 1D1PA 2DGDA 2GS9A 3G2QA 1K88A 3OZFA 4P7GA 5G02A 4B3CA 5J2UF 4IQ4A 2XOKD 1NXVA 3BXOA 4MHTA 1E0AA 4PSKA 2Y1GA 3DF7A 1FDUA 3KQYA 4R3UC 1CEQA 3CF0A 4OKIA 4RLHA 4YAOA 2IEGA 4HAWA 1PLJA 1U0NA 1OFHA 4RHEA 4XB1A 4BQSA 4R1OA 4WDQA 2DX7A 1JDJA 1MNAA 3AIKA 2OHFA 4UUAA 4DADA 5K0BA 4LY9A 2D62A 4IMIB 5KVCA 4N0PA 1L7QA 5AK6A 1YRWA 2JGRA 2NWQA 2JH8A 3ITDA 4TM7A 4M8KA 3UMMA 3SWWA 1YZ3A 3KZMA 5IT9A 2BFNA 5GWXA 4GEKA 1RTKA 4URHA 4ZP1A 5TY0A 1US8B 4W99A 2ODNA 1FQWA 4H1TA 4G37A 1R9GA 4ANFA 1B0ZA 3M83A 1KI1A 3KAKA 2WM2A 2PUCA 1S2OA 1A76A 1VJGA 1N2SA 3KB1A 1ZG3A 5IKPA 3Q9SA 4TX1A 3DT6A 3HV0A 5DCYA 4NAVA 5HDBB 3A6GA 1DQSA 2H1OA 5IAAA 4DSAA 4R2JA 2YWGA 1ZUD1 1RABA 5JWHA 2GEDA 2BF4A 2VHEA 1UMCA 1MXHA 2QDKA 1BYIA 4FEYA 3GDOA 5CG1A 3HGMA 3EZ7A 1E2HA 2C54A 3BTVA 3OM0A 1W25A 1IBMB 3HK2A 5AJXA 3F8WA 1SH7A 2UYGA 2B9VA 3QXSA 3KWLA 3WL6A 2MSNA 3WB1A 3OU6A 1ZGHA 4WERA 5KC8A 3IH5A 1U0GA 1KIMA 3JWGA 5YASA 2J46A 4NOMA 3TM5A 1RACA 4ZI7B 2FWNA 2ZZMA 3BDAA 3EZ9A 4K5QA 3GLFA 5I8ZA 4CU2A 2QTLA 2P11A 1SOVA 2MU1A 2A9PA 4DMFA 1K5HA 4EIWA 1VCMA 1JWAB 4DUYB 4G6ZA 2B21A 3RC1A 4MCJA 5GJVC 4XX0A 4CTKA 4DIFA 4ENPA 2DKOA 4Y2UA 3R6TA 1SB9A 4WRRA 1MX5A 4L8GA 1R9JA 5BUCA 2ZS9A 4GC9A 4NOLA 5ANRB 1IBLB 4S1NA 3I01A 4FD3A 5EYPB 1EESA 3DZGA 1A97A 5HF9A 1WSWA 1SOMA 2Z3ZA 4UPVA 3TN7A 3F98A 1TF2A 1FBTA 1JEQA 4Q03A 5AI8A 5KJ6A 1KAEA 1Y7TA 5CIYA 3TL6A 2GGSA 3OPYB 1FFXB 3ID6C 1UL1X 2GPYA 2AE2A 5DLEA 1UFRA 3GLVA 4NBSA 4X85A 4YJHA 2R6HA 2VCHA 5T4HA 3U3OA 1I1HA 3BS4A 2QPOA 4M7PA 5FWNA 5M5BA 3WIDA 1N2XA 1L5WA 2BFFA 5I7AA 2G83A 3VH2A 4BNHA 3K1AB 4CM4B 2YWBA 4KNVA 1QHNA 1J1UA 4YR7A 5FYQA 4YT2A 3Q87B 4WESB 4P2BA 3ROEA 4YGXB 2ZBEA 3UNXA 4YGYA 4XD7A 6REQB 2BFEB 3IXQA 4S0ZA 4HNSA 2IKQA 2VDWA 1UC5B 4E09A 4NMMA 2IEBA 3BJMA 3IDFA 2V5UA 2WZDA 4MPJA 5C7LO 2IZ5A 3CLUD 4QU5A 4AKEA 5IXJA 4LOLA 1D0SA 4EMTA 1B0PA 2BFDA 4FYKA 1U8XX 3DV2A 2LW7A 1DKUA 2FFRA 4BNZA 5LB2A 2CCJA 1JWBB 2P1RA 3EZNA 3KZOA 3ROMA 1ZNZA 3PQ3A 4IJVA 4MYTA 4CE6A 1RU3A 3RBXA 3NP9A 3VOBA 4GDFA 3L8CA 3N8GA 4G3XA 3OETA 4MVWA 2GHTA 4U7DA 1T15A 4R84A 2FUCA 5BN4A 1RAFA 2W2TA 1XK6A 3VU0A 2GBPA 1V11B 2WSSD 1Z6PA 4IIXA 4TRMA 5AESA 2NMVA 4HX5A 2B4QA 5JS6A 3VO9A 2QPTA 3DOIA 1DFHA 3EAGA 3ZWAA 5KTTA 2NP6A 5JC1A 1AB6A 2X2PA 3QOFA 3DFUA 4RYDA 1HF3A 2ZRAA 3NJ4A 3KAQA 1SXGA 1B6RA 3BMQA 3PQ2A 4WN3A 1W5SA 3FWZA 1PWYE 2VAVA 3DVLA 3HLKA 3QVOA 5IVIA 3T3GA 5IC5A 4K1XA 2CZQA 1W46A 3VR2D 2X14A 3QF4B 3I9V6 3R9KA 4MV0A 3ZE8A 1KYQA 2V3WA 5CXUA 2OFFA 5GZ3A 1XDBA 4QPDA 5KVAA 2C29D 1PR6A 2ZP1A 2OXFA 1QRUA 1FP4A 3HNPA 5T4FA 4URXR 3VZRA 4N49A 3HQ4O 4ALJA 5GV8A 1QDEA 1UMBB 2GPBA 3H2KA 3MVEA 4QPZA 1GSIA 4R7GA 5K9ZA 4ABYA 5A6SB 4D46A 1TGYA 2Z2XA 4AN4A 5JJ5A 4LFBB 2QXTA 1C7EA 4U2FA 2UV8A 5B2EA 2L69A 1W5AA 1BCRA 5FA5A 3RANA 4B6FA 5DYTA 7MDHA 1OH7A 3G0HA 4B0PA 3AHGA 3NP7A 4QC2A 4N7BA 4R6WA 3HLYA 2DPGA 4XSVA 3RKRA 4BKMA 3O2JA 3HYSA 4GZ5A 3BXHA 5REQB 2BR3A 2OCPA 2R1TA 5C1DA 1PJSA 3LCRA 1QP7A 1P1BA 2I3GA 5DYNA 4HH1A 4U2EA 4AJ1A 1XTKA 4KWCA 4YXFA 4N7JA 2FWPA 2JAOA 2NM0A 5TIIA 1YZLA 3HVKA 4LIPD 3DCNA 1Q50A 2AUTA 2B0CA 3E2IA 3MMXA 2NUAA 3OHMA 3ZGNA 1QUFA 4UUMA 5AXBA 4YCSA 1J56A 4EHIA 3QKIA 1QZTA 2VHWA 3OVMA 4WCFB 4CCYA 4F06A 3TTWA 1RE0A 1L5MA 2HD4A 3A2MA 3C85A 2ZUBA 2C94A 4P31A 3VTAA 4E7OA 4AMUA 1OFUX 3C8UA 1QQ7A 2L18A 3C1UA 3WNVA 2D4HA 5CTJA 1L9XA 1T2UA 4A0RA 4PRZA 4RMJA 5EXDA 4M89A 4Y6RA 2SICE 1H3NA 2R5WA 2BGGA 2RH4A 2XCOA 3KPYA 1T2AA 1T3GA 1XCBA 1T8TA 1QF7A 2FDXA 2V7VA 3RFFA 5IM4F 2HNKA 3HR7A 4OREX 4A0HA 5IJWA 2ZRMA 2FMXA 1Z6AA 3HU2A 3LWBA 1ZU5A 4YQEA 1NFRA 3MHTA 2X8JA 3TRKA 1T4CA 3H3FA 4Q47A 4MS3A 1C8BA 4ES6A 5CVUA 4D0SA 5JADA 3EIWA 4JL6A 4JI0B 4DBZA 3NLLA 3Q1LA 3DUFA 4X41A 1CP2A 1KYIA 1LB1B 2HHJA 2VJMB 1RRPA 3RT7A 3OFSA 2IZ0A 1Z62A 4PAMA 4ZTUB