1Q1NA

Apo and holo structures of an nadp(h)-dependent cinnamyl alcohol dehydrogenase from saccharomyces cerevisiae
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
360
structure length
360
Chain Sequence
MSYPEKFEGIAIQSHEDWKNPKKTKYDPKPFYDHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQRVGVGAQVFSCLECDRCKNDNEPYCTKFVTTYSQPYEDGYVSQGGYANYVRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSMGTLISKAMGAETYVISRSSRKREDAMKMGADHYIATLEEGDWGEKYFDTFDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLSLKPYGLKAVSISYSALGSIKELNQLLKLVSEKDIKIWVETLPVGEAGVHEAFERMEKGDVRYRFTLVGYDKEFSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Hypothetical zinc-type alcohol dehydrogenase-like protein in
publication title Apo and Holo Structures of an NADP(H)-dependent Cinnamyl Alcohol Dehydrogenase from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 107
structure length 360
sequence length 360
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2003-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1q1nA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1q1nA01
4YJGB 4LRTB 1V3TA 3H8VA 4PZEA 1ZFNA 1ZNQO 4WE3A 5IXYA 3HE3A 5COAA 1SOVA 2Y1DA 5COBA 3GF4A 1D4FA 2FR8A 4QECA 1SMKA 5EPOA 1ZEJA 2AE2A 2P2SA 3ZW8A 4BNGA 4WCDA 4LMPA 3VPFA 1B2LA 4HADA 4BO7A 3LQFA 3ZWPA 3JD2A 3OBBA 1EDOA 3DBLB 4O63O 4ZQHA 2C2XA 2VUTA 3E8XA 5EESA 1WLYA 3VH4A 1DRWA 1CYDA 4KZPA 4IXTA 5IN4A 3I6IA 4FFPA 1K89A 1XIVA 2YYYA 3S2EA 4BB5A 5TT1A 2HSDA 4GWGA 2BGMA 4H7PA 5I8WA 1RJWA 2CVZA 2IODA 2VYNA 4M8SA 1DJQA 4YWJA 4BS9A 3HQ4O 1HDYA 3DR3A 5DT9A 3B1FA 4PZCA 2G5CA 3V1YA 3HNPA 3KEQA 3TWOA 3JSAA 4FFMA 1PZHA 3KETA 3F1KA 4PG7A 3AI2A 1T4BA 2YDXA 4Q39A 4Z9YA 4E6PA 5DBGA 4B4VA 4CM8B 4AFNA 2XPCA 3ZN2A 5J23A 1DIAA 2D3TA 3DBHA 1I2BA 4OH1A 3K96A 1T1SA 4S1VA 1BW9A 1MC4A 2GNAA 3S1LA 5A5FA 1J4AA 4PLWA 4Y6SA 1DXYA 3GEDA 2JD0A 4II3A 1XYGA 3H2ZA 1X7HA 4JGBA 4ZQFA 1DBVO 2B37A 1QLHA 4R9SA 1T2EA 1H2BA 4MVJI 2VNSA 3GUYA 5HA5A 3L4BC 1RPNA 1SPXA 1JU9A 3PJGA 4WLOA 3RC2A 1Q0HA 1K6JA 1N5DA 3KLPX 3SLGA 3OETA 1GQQA 7MDHA 4PFJA 5TGDA 3ZH2A 1E1KA 4NMHA 3DMTA 3V2UA 3ETDA 2UYYA 2WWRA 3GEGA 1OFGA 2ZTMA 4J90A 1HYHA 2AEFA 3DHNA 4W7IA 2WMDA 5DN9A 3ZNOA 4CMCA 3ZW9A 2D0IA 2HQ1A 4ILKA 4YXFA 1FDSA 2NVWA 1M75A 3GVHA 2DTXA 3WQSB 2IYOA 1WDMA 3QV1A 4XR4A 5L45A 1QORA 1L7EA 5BSFA 3IIEA 2B4QA 1T4DA 2B4TO 2P4QA 4DA9A 3Q11A 4TSKA 1I30A 4YJHA 1Y1PA 3JQ6A 2B5VA 2P9CA 2J5KA 1GU7A 3IMFA 1K3TA 3GAZA 1ENYA 4GKBA 4RORA 2E48A 5GY7A 3WWZA 2J3KA 3CIFA 5KNLA 3EMKA 3SC4A 3GRKA 1GV1A 1YGYA 4MVJE 3QVTA 4ALKA 5A4DA 1EDZA 1NYTA 3FCOA 4ITUA 4EDFA 4CV2A 2X7HA 3COSA 4IDDA 3MJEA 3IC5A 2H9IA 4Z6KA 3U49A 1JN0A 2GPTA 1KETA 4UUNA 3TF5A 1HSOA 3L6EA 4OL9A 1U5AA 1FDWA 3QWBA 4FS3A 4L0QA 4W4TA 4PLYA 3ZV3A 1X1EA 3D1LA 5JXWA 1PGJA 1LSJA 4Z9XA 1GD1O 1IZ9A 1V6AA 3DAFA 3TFOA 2HJSA 4CQLA 2CVOA 2X22A 3EGOA 2ZIZA 1KEPA 1NM5A 2IXAA 3HDHA 1P3DA 3G0OA 5I8ZA 4BMNA 4IXWA 5JPIA 3HDQA 4LRSB 4CMIA 1V0JA 2CDCA 1MXFA 3LVFO 3EZLA 5FFFA 5BT9A 4XA8A 1P0CA 2VRBA 1T2DA 4RDHA 1DJNA 1PJLA 4K9DA 3GVIA 4NJOA 2R00A 3ANMA 2CF6A 1MA0A 4CV0A 1GYPA 1SEPA 3VH1A 9LDTA 1KEVA 1NWHA 3PZRA 5T8KC 2IZ0A 1LLUA 1WW8A 1GQ2A 3L6OO 3NDIA 3RC1A 1OC4A 3T4EA 2CUKA 3H3JA 4ZVVA 2VOEA 3DAGA 1O0SA 4J9VA 2Z1NA 3SC6A 1PU2A 2VQ3A 3JV7A 3OP4A 4RVDA 3E5MA 5CAEA 1ADGA 1VSUA 3DFUA 4LMRA 1I0ZA 3KVOA 5CDYA 4D3FA 3R3JA 1O94A 1ULUA 2VTDA 1QV7A 2GD1O 2GN9A 3ZWXA 3DHEA 1A4IA 2EERA 2PA3A 2PV7A 1PZGA 4LW8A 4B8WA 2Q45A 1CEQA 1ML3A 1E0DA 4BNNA 5L4SA 3GGGA 1HTBA 1U3WA 1LXCA 5ENVA 1IUKA 3AY7A 2VHVA 1PS9A 3ZV4A 3GNQA 3Q1LA 3U0BA 1GYQA 3HJAA 3NGXA 4OXNA 4TMFA 4NK4A 4YJGA 1D1SA 3DFZA 4DBVO 1WAMA 2BI7A 4BNIA 2HMVA 2Q4BA 2PR2A 4RPGA 5JMPA 3WR5A 1HE5A 5JDIC 3L4BA 1NP3A 2C7VA 4P22A 5AOVA 3SXPA 1BDBA 1V9LA 3P5SA 1KVRA 3ZGYA 1JWBB 3GHHA 3SJUA 1JAXA 1NPTO 1C1XB 3U4CA 2ZQZA 3H5RA 4RLHA 1PSDA 2X8LA 3VPSA 1YL6A 4DPMA 3DBLA 4BNLA 3D3WA 2NLOA 4A73A 4D42A 3NV9A 1Q7CA 1I3KA 1U7HA 2NUAA 1A7AA 3TZ6A 1FJHA 3GQVA 4FFOA 5BSGA 4DQXA 5JSFA 5I9MA 3HFSA 2O48X 1YONA 5CDTA 3RUHA 1QYWA 1T1RA 4OGWA 4A27A 4R01A 4RQTA 1WWKA 3OQ6A 4EUFA 4JIGA 1JQBA 5C5IA 4Q3CA 4IGFA 4I9UA 3JQGB 3KSZO 5JW6A 3C24A 1H6CA 3PJEA 4DYDA 1D3AA 1NQOA 1ONOA 3ZHYA 5JCXA 4GBJA 5K1SA 3WJAA 3VDRA 1WXDA 1YBMA 4ZRMA 4OOEA 5G0VA 3M1AA 1ONNA 2QQ5A 3QWFA 1DHTA 3PDJA 2FZWA 2AMFA 2E4AA 2EKQA 4E0BA 5DCYA 2H6EA 1A9YA 1N2SA 4FBGA 1R66A 1E3SA 1LSUA 4OYRA 3FD8A 4RF5A 1JWAB 1XDWA 2GGSA 3O38A 4DIFA 2VRCA 1PGPA 1SZJG 3JTMA 4IDGA 4YRAA 1RKXA 3WYBA 2JCXA 2Y93A 3ZV5A 2X1HA 4L8VA 4JK3A 1JLLA 1N1EA 2Q1WA 4UVGA 1E1NA 4ZJUA 4DL9A 4N5MA 1UZNA 2NTNA 4YTEA 3RFTA 2GYYA 1X0XA 3PQEA 4NI5A 2VCYA 3WYCA 1U8XX 1EBUA 4UEOA 3F6YA 3HZZA 1AUPA 1DIGA 2HMUA 3JD3A 1M6WA 2J3HA 3HSKA 4DBZA 1M2WA 1UDBA 4L74A 5DP2A 3UOGA 1F12A 5DP1A 6LDHA 3RFVA 3UHAA 4JBIA 1WP4A 5T8KA 3CPSA 2NU6A 1P1FA 5TRTA 3M6IA 4GLLA 1PJCA 2O3RA 2A92A 1A5ZA 5DBIA 3P19A 4ONEA 1E6EA 4DPKA 2OUIA 2Q1SA 3L6DA 3ZHXA 4E32A 1DIRA 2YY7A 2UAGA 2X0NA 4E5MA 1JKIA 4HKTA 1U4SA 2RH8A 3KHUA 4URFA 3UKOA 4FPXA 4F6LA 5A5EA 3I5MA 3UXYA 3G17A 2JAPA 4J7XA 4KTTE 4K6FA 2CVQA 4HNHA 3ROPA 1W8DA 1TA4A 3DZGA 3JQCA 3BMOB 4X54A 1BDMA 3CKYA 1Q2XA 3HFGA 1H9AA 4ZHSA 1N9GB 2CFCA 2GF2A 4M55A 3EVNA 3M2TA 4PVDA 3C7AA 4E5YA 5BR7A 2HRBA 4AJNA 1VSVA 3NKLA 3PWKA 3RKUA 1IB6A 4E21A 1E5QA 4D3SA 3WGIA 3UGKA 1R4MA 3RU7A 5JDIA 4MJLA 2R2GA 3N74A 1YDWA 5B37A 1VL8A 5EQFA 3WX0A 4L75A 2BMAA 2BHLA 4GQAA 1XKQA 4CR8A 3RUIA 3BMNB 3QVOA 3WMWA 3KB6A 3F3SA 3KUXA 4ND4A 2QYTA 1LLCA 3TJRA 2PTGA 3RBVA 1ADCA 2ZYGA 1AXGA 3PFFA 2C29D 5CEEA 4E30A 1P9LA 2B83A 3QY9A 1BG6A 1DC4A 4MINA 3ZU3A 3CZMA 1JKJA 1PIWA 4BGUA 4F3YA 3WMXA 4J3FA 3DMYA 3ZU2A 2IEDA 3AOEA 3F1LA 2ZCUA 4WPGA 4YJFA 5HS4A 3ZI0A 3D4NA 1Z6ZA 4M89A 3ULKA 4U6SA 3A9WA 3TZHA 1B7GO 3BHMA 2PNFA 4AJ1A 4R4JA 1YKFA 4R54A 4YYZA 3U62A 4MVJA 1LI4A 5FI5A 4KDEA 1SCUA 1UH5A 4TRJA 3SX2A 4BO8A 1B16A 2ZJ0A 1EVJA 2BLLA 1PS8A 4GI2A 1CF2O 1EVZA 4B8ZA 3RU9A 4CMKA 1NAIA 4LVCA 5U1PA 5A9RA 3PHGA 4HX5A 4IQGA 5A9TA 2WYUA 4FCCA 4OM8A 3QW2A 1UXKA 2HCTA 2YV2A 3LF1A 3G49A 1PJ4A 1ZEMA 4UVEA 5JS6A 5G0UA 3ADPA 3MJVA 1ZK1A 5HM8A 1HLDA 4DPLA 4RGBA 3IJPA 1U3TA 4WNCA 1DAOA 3RUEA 4BNHA 4BQPA 4AVYA 3GVPA 4AJPA 4A2CA 1YL7A 3KZVA 2DU8A 4WASA 3ON5A 2NU9A 4AJHA 4OAQA 3BAZA 3S55A 4Z3KA 3O8QB 3RUCA 3CSDA 3WWYA 3PYMA 1T24A 1U3UA 5AXDA 3MJSA 3FPLA 4BO2A 4DMLA 3E48A 4P8RA 4NBWA 5F1PA 4XCVA 3WIDA 4LISA 1KIFA 4DIBA 3Q3CA 2OO5A 1QLJA 3E1KA 5CPFA 1KS9A 5KKAA 3ANNA 3E03A 4TROA 4ND1A 5B4UA 2VWPA 2H5LA 2QYSA 5ADHA 1GUYA 5H82A 1QV6A 4PRLA 1PZEA 4FDAA 3WIEA 4HWKA 4GVXA 4NJMA 1B3RA 1XWFA 3QSGA 3OJEA 4B4WA 4CMBA 4E31A 3OJLA 2FN7A 1MB4A 3AUAA 1KEWA 1Y5RA 5JNLA 1Y7TA 1H5QA 3EVTA 2OP1A 4XGIA 1ZMOA 2I99A 1BTOA 4MVJF 4GMGA 3RCBA 1NFRA 2PD3A 3JD1A 1ISHA 2X5JO 1V35A 1U4OA 4B4OA 4GGOA 3WFJA 5JC1A 3ICCA 5L95A 4J0EA 4J7UA 2I65A 3A28A 3DO5A 1XSEA 4IJVA 1R4NB 3ZWAA 4LGVA 4Q3AA 1WNTA 4RF4A 5A3JA 5KOIA 3AI1A 2VHYA 1K6XA 1LDGA 4BGEA 3WGYA 2V65A 3GMSA 2O3TA 4WK6A 1I3LA 3GNTA 4B3IA 1E6WA 1C3VA 1NVMB 4B3JA 4HNGA 3CZRA 4XKJA 3FTPA 2NTJA 3NRCA 1DIHA 3OQ1A 2PD6A 1DC5A 2X0RA 3ZHZA 3ABIA 2PFGA 8ADHA 4ZQGA 3KTDA 1SNYA 2GR9A 4GX2A 4J4HA 3I9KA 1DRVA 4HUJA 1ENZA 2ZATA 4JBHA 5C3MA 2HMSA 3CINA 1A27A 3KSUA 1GDHA 4FD3A 4NG5A 1NASA 3GR6A 1PZFA 3JD4A 1ID1A 2GDZA 2RAFA 3IAHA 3PPIA 2CY0A 3PXXA 4D79A 1EMDA 3UUWA 1GUFA 3I4FA 1ADBA 1JVSA 3IKTA 3DEYX 3U09A 3TOZA 3B6ZA 4YBZA 3TNLA 1DO8A 5THKA 1VLLA 2X58A 3LT0A 5TSDA 5FF9A 4EUEA 4RPHA 3BTUA 2QRLA 4GKVA 4GGPA 2ZYDA 3DQPA 2OORA 3LC1O 1NHWA 1QG6A 3BMOA 3PGJA 2DKNA 3DZFA 4YDRA 2XOXA 1N9GA 4PG6A 4RF2A 4BO3A 3VPHA 2NQTA 4ROSA 2O50A 1BXGB 4QX6A 1PL7A 3KYDA 2BI8A 4MDHA 5F5LA 4YQYA 3RVDA 1TEHA 4IDEA 4CLDA 4PG4A 2B0JA 2Z1MA 2YHIB 4CLXA 3OHSX 3H4VA 3OEWA 3WICA 2NADA 3OA2A 3MTJA 2NSDA 4IDFA 4D7AA 4IZIA 5JFOA 3JQ8B 5L9AA 1R0KA 3PGXA 4Y98A 1PJ3A 1W73A 4A5OA 3K2BA 1IYZA 3OEYA 1HDGO 1VJ0A 4WECA 1OZAA 3R1IA 4GMFA 4PVCA 4RLSA 2D59A 3PHIA 4ND2A 3TZQA 2OXIA 5F5NA 1YQGA 2X6TA 3D3EA 2C54A 2Q3EA 3GZNB 5F3RA 1FXSA 1Z45A 2YV3A 3ZNNA 4CM7A 2Q4EA 2BFPA 4MPDA 5KVSA 2OZPA 3PIIA 1Q7BA 4E2WA 3IUPA 3GDOA 3WGGA 1R37A 3VAZA 4G5HA 3WSVA 3GDGA 4IJUA 3JQEA 1U5CA 4RZHA 3TZKA 2YV1A 3I9NA 4EGFA 4BMVA 2VZ0A 3VZSA 4J49A 3Q2IA 1NFFA 3GG2A 1C1DB 5CPBA 2NU8A 3KV3O 2VYVD 3U9LA 3L9XA 4FJ2A 4PLCA 2OMEA 5B4TA 1HDOA 1KOLA 4FC6A 2FPIA 3EY4A 5JCJA 4BVAA 2LDXA 1BGVA 4WKGA 4CMJA 2WD7A 4PLZA 3ZWCA 4B4UA 3P2OA 3FWNA 4UVDA 1AXEA 3PJFA 2YHUA 4MP8A 5G0WA 1A7KA 3FR7A 4DXHA 1TLTA 3WFIA 2WYVA 5EL0A 1Y6JA 2Q2QA 1OC2A 2JD1A 3I9OA 3JQ9A 4BOYA 5I9LA 2AEMA 3H5AA 4E5NA 1ZVMA 4W99A 1Y8RB 4MVJM 2V6GA 4K28A 4A26A 4EI2A 4FB5A 2DTDA 4RF3A 2P4HX 4CL3A 1F0YA 2W2LA 5TS3A 3ETGA 5AYVA 4WCFB 1SOWA 1QYXA 2ZCVA 2O3SA 1IE3A 3BYZA 1P74A 1EZ4A 3DHYA 1EE2A 1OI7A 4DMMA 5JC8A 4GPD1 4GWKA 5LDGA 1EK5A 3MEQA 4CM4A 2VT2A 1VRWA 3H2SA 3DZKA 4LSMA 4GSKA 4XR9A 5ENDA 3RBZA 4BNVA 2CZCA 5G2OA 3ROMA 5EINA 1TVEA 5KKCA 5IF3A 3JQAA 1WDLA 2Q99A 4OOFA 4BQRA 1DDOA 2UUOA 3DOCA 4ZD6A 5KVQA 3AY3A 3BZUA 2QW8A 4QSMA 4CM1A 2ZKLA 4ND3A 3KEOA 3ENNA 2RH4A 4R41A 5EIOA 4I8XA 4IQ8A 2QG4A 4OXKA 3AM5A 4P4GA 5L3ZA 2IDZA 5IAAA 1OAAA 1M76A 4PLPA 4N18A 1UXIA 2PY6A 1YRLA 1CQJA 2RHRA 2V6BA 3K5PA 1U2GA 3HWRA 3PIDA 1RM3A 1N1GA 2WSBA 3DTYA 1D7OA 3CEAA 3C7CB 3S2FA 4R3WA 2D1YA 3U4DA 2EGGA 3AFNA 5JAIA 3ANLA 1H0KA 3JYPA 4YB8A 1P1JA 2NTVA 4CLHA 1KYQA 1TI7A 3IOYA 2BGKA 5CHEA 3WDSA 1M67A 1CRWG 3JD0A 4TKMA 4C7KA 3CH6A 3QIVA 3GZ4A 4WCFC 4KUEA 4DQUA 1GZ6A 2J3JA 1W0CA 2NU7A 3CMMA 4S3MA 1U9JA 2NM0A 4XJTA 5LC1A 2DUWA 5I7SA 1KC3A 3LZ6A 4W9NC 4NBUA 3Q2KA 1GTMA 4B7UA 4EUHA 1LQUA 5JAMA 4JX8A 3H6KA 1BSVA 3C1OA 1HDRA 2EJVA 5IN5A 1LDBA 2G82A 3H7AA 3RUFA 5IJZA 2VT3A 2HDHA 4TRNA 3WGOA 4C7JA 3FNHA 2J5QA 4KQWA 1LDMA 5COQA 4UEKA 4FOSA 4NU6A 5T6BA 1YL5A 4BIIA 4CM6A 3OIDA 5A9SB 4CM9D 4YAIA 4XYLA 4U6QA 3VTZA 2WEKA 3L4SO 2C82A 2Y1FA 4NBRA 2D5CA 3JYOA 4I9NA 2TMDA 3EK2A 4MVJG 1G0NA 1HDCA 1HSZA 1VM6A 1ZK2A 4XGKA 2PGLA 3QWAA 4BO5A 4XYMA 1QYVA 2EV9A 3UICA 1PS0A 4RPLA 2P9GA 3KOUA 1P77A 1P44A 5FI3A 3UVEA 3RJ9A 4CLOB 1Y9EA 5BNTA 5JBIA 1B8UA 5HBRA 4BKUA 4BO4A 4OJNA 2VUSA 1I5RA 2Y67A 4DQVA 2G17A 1LQTA 2YHIA 3DZJA 4PG8A 4DREA 4BO0A 3AU9A 4YT4A 3TRIA 5IDQA 2EXXA 1HRDA 2ILTA 5GMOA 2AE1A 2C07A 1SC6A 3H9QA 4UUPA 4ZA2A 1GADO 3L77A 3VVCA 5G4LA 1BXKA 2WE7A 3H5NA 1YB1A 1EQUA 4H3VA 5BQFA 1DIBA 1PL8A 1UUFA 1JKFA 4I9HA 4P4NA 5L7YA 1NQAO 4DC0A 4ESOA 5EQDA 5MDHA 2OBNA 3BTVA 1D8AA 4TZTA 4BNZA 2P5YA 3RWBA 1Q7GA 3LLSA 4BO9A 4BNUA 3GZNA 1GCUA 2C0CA 4FC7A 4NDNE 1B8PA 3QVXA 4D0RA 1Y81A 2IYPA 2CNBA 3K92A 4AJ2A 5IDYA 2WYWA 3F4BA 4TQGA 2Q49A 2BFOA 4FJ1A 5I7EA 1K2WA 2VRCD 2DVMA 3BMQA 3LLVA 3H3FA 1P1RA 4M1QA 4P38A 2HKIA 5CDGA 2FY8A 3W4IA 5MGBA 5KCZA 5LDHA 1XG5A 2CF5A 1NPYA 1AHIA 2GUGA 5CDSA 1UP7A 2I76A 3HADA 3H9UA 3GFGA 5T5QA 5A05A 2GN4A 1UP4A 1E3EA 1GEEA 3Q9NA 4A10A 1YDEA 4D41A 2X9NA 2PGJA 2ZB3A 3OF2A 4YAGA 4YR9A 3DZIA 1A72A 4W7HA 1LA2A 2HUNA 1WZEA 3DOOA 3ZWOA 5FWNA 1OMOA 1R6DA 1BVUA 1SAYA 1K6IA 3L0DA 4DGSA 3IDSA 3D5TA 3FPCA 4BB6A 4K1LA 3MWEB 2C5AA 4KOAA 4L4XA 1HEUA 1MXHA 2HK9A 3AOGA 4BNMA 4YRBA 2Y1EA 2W90A 4J1QA 4JJIA 1VJ1A 5DZSA 1PGNA 2NVUB 4UVIA 2FMUA 1I01A 4ALIA 3UCEA 3JQ7B 3NJ4A 4EYEA 5TX7A 1T2CA 2FSSA 2PZKA 3I83A 1PWZA 3QQPA 5DF1A 4CM8A 2ZB8A 4ZQBA 2C59A 1J49A 2FRDA 3BHJA 3MJ4A 4G81A 2X5KO 3K2EA 2BF7A 2EIHA 2JFGA 4TWRA 2W8ZA 2A94A 2A9FA 1YOVB 3BIOA 3K30A 4A03A 5EERA 3W8FA 3GLQA 2J6IA 1C0IA 1ZMTA 4NBVA 3C7DB 4OMUA 2F1KA 3RBXA 2GSDA 1MX3A 4DVJA 3HB4X 4DC1A 1UZMA 1E77A 1Y8QB 3G79A 4GVLA 4M87A 3VZRA 4R9RA 5K0ZA 4OKIA 4YVFA 4O0LA 1KBZA 1XR3A 3G1TA 5AVOA 3WS7A 1S7CA 5G4KB 3UW3A 2Y0EA 2JD2A 2VNAA 2AQ8A 3C1AA 3MWDB 4JXKA 4J4TA 1DFHA 3BMCB 1ZO8A 4MKXA 1E92A 4XB2A 4FFLA 4RVGA 4XDZA 2QZZA 2YQ4A 2B5WA 2X5OA 4JN6B 3WBBA 5ES3A 2B35A 4BMSA 3SEFA 3TOXA 5I7VA 1DSSG 4K26A 3WSWA 3OFSA 4H15A 4TVOA 3DBRB 4NFSA 4BNXA 4NFYA 4CMHA 1E6UA 2GZ1A 1DFIA 3GK3A 3KSDO 1PR9A 4BNWA 9LDBA 1AN9A 5DULA 2JCVA 5THQA 3EAGA 4DLLA 1JDJA 3LK7A 1J5PA 1CQIA 3IP1A 1LNQA 4J16A 1MGOA 1G0OA 3WLEA 4YAJA 3GFBA 3ICPA 4E13A 3NTQA 2WD8A 1UAGA 3AFMA 4BV8A 1JVBA 1PQPA 3RC7A 4BV9A 5B4VA 4XQEA 1CIVA 1E7SA 3JQBC 4OXYA 4WJZA 4EJ6A 1C0KA 3AW9A 3BTSA 3I9MA 4XQCA 2XXBA 4WEOA 1ULSA 5A9SA 4NNJA 1N7HA 2VZ8A 4KUGA 3PP8A 2FOIA 1LJ8A 4CODB 4E5PA 2I6TA 4CJXA 1KY4A 4J1TA 1F06A 2JHFA 4LVUA 5K6AC 1ISJA 3IP3A 1O6ZA 5DDIP 4BNYA 5TQVA 4F6CA 4D3DA 1VKNA 1YH3A 5I7FA 3U3XA 4Y67A 2HK7A 1U1IA 4MIOA 5AXBA 5ICMA 4QEDA 1CERA 1J6UA 4Z3DA 5JO0A 2Q50A 1OBFO 1YQDA 2E6UX 3T7EA 1Z75A 3VKUA 3FNGA 3WTBA 2DPHA 5G0SA 3GNSA 2Q2VA 3WLFA 2Y1GA 1RM4A 4Y9DA 3JQDA 2OFPA 3I9LA 2FP4A 3MJTA 3E5RA 3WGZA 2C2YA 4KMSA 3P7MA 2X4GA 3TL3A 3EC7A 4QFCA 2VUUA 4LN1A 3SLKA 1YB5A 3PYLA 1EVIA 1E7QA 4A7PA 1YBVA 2PD4A 3D7LA 3V2GA 3W8DA 4CR7A 5BSEA 1Q1NA 4XJSA 1NNUA 4A0SA 4EITA 1ZSNA 1TT7A 1ADFA 4UUOA 2AQHA 1IZ0A 5BNIA 4CL8A 1H94A 1C0PA 2PKQO 3OJOA 4HBGA 5JAQA 1XU7A 5HWSA 2EJWA 3TZCA 2NWQA 4PCVA 2QRJA 1P1IA 4CMAA 2Y1OA 5KJ6A 3E6AA 2CDBA 3INRA 4UEJA 3QVSA 3GH3A 3GDFA 1YXMA 3D64A 4L4RA 1E3WB 3JQFC 4RVSA 3UCXA 4WOJA 5TT0A 4IBOA 1E5LA 3WGQA 1ZH8A 4AJLA 1C0LA 1C1XA 2FHSA 1GEGA 1ARZA 3KXDA 4HFNA 3UAGA 2VOJA 4TZKA 4ALNA 2EKLA 5T67A 4L73A 1WPQA 1IPFA 3ZWNA 4E4YA 1AHHA 1L7DA 4J0FA 1HL3A 1B15A 3AK4A 1NXQA 4JP3A 3W6UA 4RVHA 2Y66A 1ISMA 1P33A 2NV6A 1PWXA 4BGVA 1XCBA 5H81A 1HETA 4IDCA 2GZ2A 4RPKA 4CQMD 3JQGA 1DAPA 1F8GA 1QXSA 2X86A 3AY6A 4OSPA 2WTBA 3WTCA 4MVJP 1E7RA 7ADHA 5JYEA 1MUUA 4UULA 2F00A 1LX6A 3LT2A 1DC6A 1UDCA 1V3VA 3FHLA 3DBHB 1N92A 3JQBA 1BW9B 2O4UX 3CMCO 2NVBA 2VN8A 2FR0A 1SEVA 5EJ2A 3HN7A 4KQXA 4LK3A 4PRKA 1ZUD1 3O9ZA 2RBEA 1Y8QA 3VC7A 1FDTA 4IUYA 3NT4A 3LF2A 4AJIA 1IHYA 2VHXA 2AQIA 5A04A 4R1UA 1LLDA 4MKRA 3DC2A 1Y9AA 2QZ9A 4ND5A 4WLFA 4IQ0A 4U0JA 2NQ8A 3PWSA 1PR3A 4GLOA 4JP2A 1XLTA 5EMHA 3I23A 3AM4A 2AQKA 2ZTVA 2EP7A 4J91A 2ZYAA 3ZU4A 1NAHA 1GQYA 2Y99A 1EFKA 4R1TA 2ZB7A 2D4AA 3F4LA 1P0FA 3HHPA 2DFVA 5JAZA 5C7IO 1V3UA 3PHLA 4FFRA 5FYDA 1XQ6A 3VZPA 3W8EA 3UFXA 1HZJA 3KRTA 1GR0A 3Q9UA 4YJHB 2QHXA 1DEHA 4XYEA 3B70A 4XYBA 2EP5A 1SO8A 2YQ5A 1T2FA 3GPIA 5HRUA 4J7CA 4KTVE 2CDAA 4EEZA 1UXHA 4J1NA 4EEXA 4U8GA 2AW5A 1QP8A 2CD9A 4IPTA 1ISIA 4WNIA 2HRZA 3B1KA 4DRYA 5JY6A 4M86A 2O4CA 4BNKA 1UR5A 3LT4A 1ZK4A 1DB3A 4PN3A 1RYEA 1HT0A 4FW8A 3INTA 1R15A 2EHDA 4O5OA 3SJ7A 3V2HA 2XAAA 3VDQA 3EHEA 1UDAA 5GZ6A 3NTOA 1MFZA 1ZBQA 2H1SA 3OSUA 5KIAA 2FPGA 2CMDA 2G1UA 3HB5X 2VTEA 3AUTA 2P68A 5TLSA 1YO6A 5AXAA 1YE3A 5CP8A 3RQSA 1AGNA 1ZW1A 2EG9A 4R5HA 3OJFA 4AG3A 1F17A 2W4QA 2BFAA 2VYND 4CQLB 2Q1UA 1BMDA 4UVHA 3BMNA 4YAKA 1N7GA 1DRUA 1I8TA 1RM0A 4GSLA 2D2IA 3IJRA 5DOVA 2VWHA 4R3NA 1FMCA 4U7WA 4BO1A 3FTNA 4RVUA 1RWBA 1KVQA 3DZHA 2RCYA 2Q46A 2I67A 5JY1A 1EUZA 5A03A 5H83A 3NT5A 4FN4A 5L4NA 3VH3A 4G2NA 4R68A 2PZJA 1E7MA 4INAA 3D0OA 4MKZA 3DWFA 1E7WA 2JL1A 3OQBA 4CM5A 4WUVA 5GZ1A 2E49A 4LSWA 3JQAD 3AUUA 4O6VA 4NPCA 3HN2A 1GUZA 4XRRA 1BXZA 5IG2A 4BNFA 3S2IA 3NEPX 3DOJA 1L1FA 4CUKA 1LBEA 4AJJA 3AWDA 3RROA 1FK8A 1ORRA 4C4OA 1BVRA 3NAQA 2O7SA 3KLMX 5DCWA 2W98A 3GA0A 3PDUA 4D45A 3LSYA 1XU9A 4RL6A 4HY3A 1P1HA 2WDZA 4XD2A 1P31A 1G1AA 1VJTA 4M49A 1QRRA 1LDYA 1EQ2A 4YEDA 3QVWA 5HS6A 4J43A 4DWVA 1NR7A 5F1KA 2I9PA 3C85A 4OQYA 4XB1A 1PJ2A 4ZRNA 4EJ0A 2VHZA 4KDFA 3RAJA 3U5TA 3F47A 2OBYA 5L4LA 2SCUA 4IM7A 2DC1A 1HWYA 2ZJ1A 4MO2A 5JMWA 1NBOA 2GCGA 1P45A 1TXGA 3EUWA 3RUAA 2UV8A 3HDYA 4IS3A 1O8CA 2J8ZA 3K6JA 3M1LA 2JKVA 3O8QA 2R00C 1DLIA 3O03A 4JLWA 3WG9A 1FDVA 4UREA 2YUTA 3V1TC 1UXJA 1EUCA 3HG7A 5L40A 3GN1A 1N8KA 1K0UA 2O3QA 1PL6A 4Z0TA 3D3WB 2ZQYA 3CE6A 4YT2A 1WDKA 4FSHA 4WEQA 5C7LO 4WLEA 3FN4A 4YCAA 3QRWA 1HE4A 1ZKMA 2PZMA 5K9ZA 4ZN6A 1EK6A 4HXYA 1U28A 1E3JA 3H9EO 3QWIA 3GG9A 3ONDA 1KEUA 4YACA 4ALJA 3HDJA 4IIVA 2Z5LA 4ID9A 3STHA 3F9IA 3JYQA 1SB8A 4IDAA 4DLAA 2DFDA 1YWGO 3QA9A 4BO6A 3ZNPA 4MOWA 2OHXA 3I4CA 1R12A 3WGTA 3DL2A 2H63A 1R4NA 3GC6A 2AXQA 2HJRA 4I5EA 3ZWBA 1LC3A 3EZYA 3LYLA 4BL5A 3K73O 1E3IA 4PIVA 1DC3A 1Y5MA 3ONFA 3ZNQA 4IDBA 4R16A 2E37A 3GVCA 2HAEA 1NHGA 5KJFA 4UAGA 3FF4A 2RIRA 2V7PA 1YS4A 2VYVA 1ZCJA 3ZHBA 1NQTA 3EDMA 1XHLA 3GEMA 3E82A 3PHHA 3PQFA 3PYXA 3W6ZA 4AJOA 4IJWA 1I3MA 3OA0A 5BSHA 4AJKA 1H6DA 3GGPA 5CG1A 4RDIA 4DIOA 3TL2A 3AUSA 3UN1A 3VPXA 3T7CA 3I6QA 1PJBA 1Z74A 4CMEC 4OKNA 4RCVA 4BKPA 3ROQA 3ZWYA 5AXCA 3AM3A 2ET6A 3VOSA 5C7OO 4W82A 4EW6A 4FIZA 3FBTA 4BKRA 1ZXBA 4ZQEA 1X7DA 1EVYA 1LTHR 4B3HA 3F46A 1TT5B 4J4BA 3HUDA 1HE3A 3ZWVA 1H93A 4EJMA 1Q0QA 3ORFA 4W6ZA 4IGEA 1XELA 5JLAA 4GL4A 3Q0EA 3DZBA 3OMLA 5L51A 2BGLA 1CETA 2FR1A 2V6FA 5ILGA 3S2GA 3TSCA 4EZBA 1I32A 2GERA 1IY8A 3GY0A 1BXGA 3AU8A 4OSOA 5T64A 2VHWA 4O1MA 1JTVA 1B14A 3WJ7A 2NNLD 4FGWA 5A06A 2HU2A 4CUZA 2XF8A 4YQZA 1VPDA 3WNQA 4LCJA 4NFHA 4PGFA 3ZCXA 1PJTA 4JROA 2DBRA 4YT8A 2DAPA 1O89A 2GZ3A 1I10A 4I1IA 1VI2A 2O7QA 2W2KB 3JQ8A 1B0AA 3RIHA 1IULA 1R4MB 4N7RA 4YAEA 2HMWA 4HP8A 4WOKA 1H9BA 4FQ8A 3FSRA 2I5PO 1LRKA 3L07A 3ROKA 2FSVA 1TB4A 2FPPA 1EE9A 1WZIA 3X2EA 3ZU5A 1LSOA 3PZBA 2YZ7A 3TN7A 1GAEO 3D4PA 2JAHA 2YW9A 2DPGA 3BTOA 5EN4A 3AJRA 1ZSVA 2JFFA 2LDBA 4NK5A 3D4OA 3DBVO 4KUHA 3ZWMA 3CXRA 1V8BA 5TJHA 5IZCC 4FFNA 3KBOA 1R0LA 4FR5A 3IKVA 3SVTA 1U8FO 4YJFB 1PGQA 3C1TA 1C1DA 3RD5A 3H9JA 4MP3A 3IS3A 3DXFA 3JYLA 5T57A 2P9EA 3C3XA 1GV0A 1WMAA 3A14A 4QUKA 1PEDA 2D8AA 3PEFA 4IIUA 1J0XO 5KVCA 3PFWO 5TNXA 1CWUA 1VC2A 4ALMA 5ILOA 1R16A 2OP0A 4QTZA 1PQWA 1P1KA 5KJEA 1I2CA 1PJSA 6ADHA 1ENPA 1M66A 4NQZA 1LEHA 1EBFA 3KM0A 1BRMA 4AJ4A 5ITWA 2BFMA 5KJ1A 2IZ1A 3NTRA 4CM9A 2QX7A 4K6CA 4Q3DA 3UCFA 4D44A 1IOLA 3O4RA 1EUDA 2DLDA 1Y8RA 1GZ3A 3NDJA 2DUUA 4E2XA 2IRWA 1YJ8A 1W6UA 2UUPA 2YDYA 4MP6A 3WOHA 5IFLA 2HLPA 2A4KA 4WCFA 3WQQA 3GOHA 5TC4A 1LC0A 3K9QO 4ZU3A 4XQGA 5G0TA 1LUAA 2EEZA 4Q3BA 1LDEA 1NFQA 2WJPA 4RV9A 2DBVO 3WGHA 4D43A 4W9NA 2FZEA 3OM9A 3GT0A 1FF9A 4CMEA 3S8MA 3FNEA 4O59O 5HTOA 4U0KA 4B7XA 3AOEC 3KYBA 2IZZA 3NYWA 4R69A 5C37A 5FEUA 5B12A 2JCYA 4IINA 5IZ4A 1VE9A 4JQCA 3RKRA 3NX4A 3ST7A 4RQUA 3LT1A 1JAYA 4Q3EA 2QIOA 4NJMB 3VKVA 3QWHA 1F14A 1IPEA 1NX6A 2VWGA 4TKLA 2UVDA 1I36A 5IDXA 1ISFA 1B3BA 1H6BA 1X1TA 3WBFA 4IJKA 1T2AA 4J9UE 4UUMA 3FWZA 3ENKA 1KVSA 5KVVA 1U2DA 4PZDA 1QSGA 2IXBA 3FI9A 3PWZA 2POQX 4KWHA 4Z0PA 3ITKA 4I5DA 5JE8A 2O23A 3GVXA 5A02A 3JCZA 3MZ0A 2IEBA 2PZLA 1KVTA 3D5QA 4NBTA 1U7TA 4XIYA 3CTMA 1FDUA 2I3AA 1ZZEA 1CJCA 4II2A 3G1UA 4OIMA 5CEJA 1OOEA 1SBYA 4R1SA 1HYEA 3PRJA 1S6YA 1ZJZA 1QMGA 3W4JA 1UZLA 3EW7A 2Z95A 3FNFA 3JYNA 4NIMA 5JDCC 2P5UA 3UH1A 3GPDG 1HKUA 3LC7O 4LCEA 4Y8VA 1I2ZA 3R3SA 4N5NA 1PX0A 3ZDFA 1A4UA 5ICSA 4M54A 3PJDA 3RSHA 1HXHA 2EW8A 3LDHA 2DBQA 2PGDA 3PI7A 1QYCA 4R1NA 4AJEA 1ENOA 1LLQA 2GLXA 4Z9FA 4FGSA 3TQHA 4MVJD 4B7CA 5A3VA 1VL6A 3GRPA 1H6AA 2I3GA 3M2PA 4ALLA 3PLRA 4JJGA 1EFLA 4PLHA 3E9MA 1TT5A 1XGKA 4BNJA 1MFPA 4CLRB 4FOOA 5LCXA 4DLBA 5IZCA 1A9ZA 4GX1A 5DNAA 4JJFA 4OO3A 1T26A 2BKAA 3OICA 1AE1A 4RPJA 4CQMB 1DOHA 5CFZA 3TFQA 4I5FA 1LSSA 1DLJA 3NJ8A 2HK8A 4NU5A 4YT5A 3X2FA 1KVUA 2G0TA 4CLOA 4DYVA 3N58A 1GPJA 1X15A 1ZJYA 3WB9A 5KTKA 4HFRA 2B69A 1Z82A 4IZHA 1E1MA 3V8BA 4HFMA 3KYDB 1KERA 4CPDA 1EEHA 3RUDA 5TF4A 2O2SA 1XEAA 2W2KA 2BD0A 4F45A 5F1OA 3GAFA 4YJDA 4E33A 4BKQA 2FWMX 4GH5A 2DTEA 1MV8A 3ITDA 2VZ9A 1CDOA 1MG0A 4CMGA 4F46A 5L53A 3ZV6A 1GPDG 1ZIDA 3DB2A 1F8FA 2YFHA 2C7GA 4E2YA 1E7YA 4NR0A 1MP0A 4GX0A 3VHRA 3O26A 4TVBA 3CUKA 3PHJA 1U3VA 4J1SA 3RC9A 4Z0HO 2O2YA 4R51A 3RASA 3ASVA 3NT2A 1HZZA 3SBOA 3ASUA 4DUPA 2PKRA 2BELA 4XWYA 3WXBA 2Y05A 1QYDA 1PJQA 2ZK7A 2CSUA 1GY8A 2PWZA 3W1VA 1MG5A 2BRUA 4I5GA 4NH4A 2DT5A 5DBFA 3Q6IA 3KYCB 4J2OA 1RM5A 4OQZA 2AA3A 5TJ9A 4NHEA 8LDHA 3GMDA 1LU9A 3F5QA 4EBFA 4L76A 5IXSA 1HDXA 1DFGA 1Z7EA 4L9RA 1LDNA 1GCOA 3E9QA 3GGOA 4PG5A 5BNFA 2J3IA 2O3UA 1RYDA 1DPGA 4IS2A 1LRLA 1B26A 3E9NA 1R0SA 4CUJA 4D0SA 1PGOA 2VWQA 4OHUA 4B79A 2TMGA 4XIJA 2AEJA 2V6MA 3MCVA 3PVZA 2WD7B 1JA9A 4IMRA 5ER9A 4D46A 2D5AA 2GN6A 4XDYA 3I3OA 2EKPA 2Y68A 1O5IA 4BHTA 2GASA 4E5KA 2ZTUA 1I33A 4E3ZA 3ADOA 2Y0CA 3PLNA 1E1LA 3DONA 2UDPA 1XQ1A 2JJYA 3FBGA 2HMTA 2DM6A 3PQDA 4HFJA 2C20A 4CV1A 1IHXA 1YBAA 2EGHA 2NVUA 3OJ0A 3P2YA 4WLVA 3L9WA 2O3JA 5CDUA 1X7GA 3JQ7A 1X0VA 2G76A 5JDCA 1PQUA 3DTTA 3MTGA 1Z7BA 3VVBA 1B8VA 5ITVA 3I9JA 4CR6A 1ZK0A 3DAPA 3R6DA 3UF0A 3W4KA 2BH9A 3I52A 2GRAA 3QE3A 4XRGA 3RJ5A 5AQ1A 2JHGA 1H2HA 3R0IA 1IL0A 1O95A 3ONEA 4GAEA 1YOVA 1VKOA 4KWIA 2Y0DA 1NTOA 3V5NA 5GZ3A 1SB9A 5I9NA 4CM4B 3G3EA 4ZGWA 1UJMA 4YRDA 3MOGA 5L7WA 4MVJH 2OOSA 1HDZA 1KC1A 1NWCA 4I08A 4XQ9A 2A35A 1YVEI 4R5MA 2X0JA 4BGIA 3JQAB 3DDNA 5B1YA 2J5RA 3OH8A 1G6KA 4XEHA 3U4HA 3IUSA 1NVTA 4TRMA 3I1JA 5G4KA 1LRJA 3B1JA 3LU1A 3N7UA 4XZ3A 4ZICA 3FR8A 1WVGA 3WNVA 2PK3A 4WLNA 3BMCA 5K6AA 4HV4A 3VZQA 1YJQA 3INGA 4PLVA 4XYGA 1Q0LA 3A1NA 1K5HA 1MC5A 2WE8A 1UP6A 1ZXLA 3NGLA 4GX5A 3RFXA 4KP7A 4U5QA 3TDKA 3JQ9C 1PTJA 2B4RO 4XGNA 4CV3A 4G65A 1QKIA 3MOIA 3DBRA 2X9GA 1ONPA 2ZTLA 2IE0A 1BWSA 1X13A 4PLFA 2B36A 3ZWWA 5DOZA 3GN2A 1ZK3A 3LC2O 4RZIA 1UXGA 3H9GA 4QO8A 4JBGA 2E82A 1Z73A 3A4VA 4QT0A 1NQ5A 1KY5A 3VPGA 1I24A 3EYWA 3PTZA 4WGGA 4RO0A 5F21A 1DHRA 4MIYA 3WQRA 1X14A 3VTFA 3OECA 2EF1A 2X0IA 3GHYA 5JCJD 1A71A 2QRKA 4N5LA 3NUGA 4Y6RA 3TPCA 3MJCA 2NACA 3AI3A 1NPDA 1NVGA 4JCOA 4Q9NA 4CLRA 2I66A 3GUCA 1T25A 4H16A 5U9CA 3KO8A 4PLGA 4TRRA 2OL4A 3ZZNA 5CEFA 2GN8A 5TIIA 3F5SA 1I3NA 4CQMA 2Q2WA 3QP9A 4L4SA 4WLUA 3BHIA 1BHSA 4RJTA 3RI3A 4E2ZA 4AL4A 2XXJA 1GZ4A 5DCUA 3JQFA 2ZB4A 5JO9A 5KWEA 3IL2A 3DMTC 3K8ZA 1WMBA 3QHAA 1D1TA 3T4XA 5JYDA 4YA6A 3BMQB 4NZ9A 1HE2A 5ER6A 4BNTA 4CLEA 2W2LD 4XX0A 3ETEA 3IQDB 4PLTA 4FJ0A 2AG5A 3BA1A 4YPOA 4CMIB 1GL3A 1ISGA 3U4IA 5CG2A 2X9VA 3A06A 5U4QA 2JFHA 2AHRA 1QR6A 3BXXA 1GYRA 2PLAA 3WYEA 2X23A 2C5EA 1YB4A 2R6JA 1MLDA 1W4ZA 3OIGA 3PK0A 4MIEA 4P4LA 3VH2A 4QO7A 4QXMA 4E12A 5IDWA 4Y6PA 2WM3A 4J2HA 1JW9B 4JNKA 4CM3A 4DTIA 2PH5A 1HF3A 3V1UA 1E3LA 1M6HA 1NR1A 4Q3NA 4BUCA 4IMPA 1VL0A 2DQ4A 1YQXA 2OGUA 3B20A 3C8MA 5A1TA 4BKOA 2DBZA 3H65A 4IY1A 1O9BA 2PKQP 2PH3A 4QQRA 2RHCA 3QJ5A 3E18A 1C14A 4J6FA 1ZSYA 2YFQA 3OIFA 2P91A 1UAYA 4N54A 4AICA 2YJZA 5KJCA 3FRJA 2EWMA 3NDRA 2GO1A 4RVFA 2EW2A 3K31A 1HYGA 2HO5A 1GFSA 3KYCA 2Y1CA 4QFDA 1HLPA 2Q1TA 1XA0A 3QLJA 5L7TA 2AG8A 1E3WA
chains in the Genus database with same CATH superfamily
4YJGB 3HY4A 3BK2A 3WC4A 1J8VA 1NM5C 3FM9A 1GARA 3A6FA 1LNSA 1WXWA 5IXYA 3KZNA 1Y9ZA 2A1IA 2W22A 4ND7A 5FX2A 5KYKA 1J20A 2WT9A 2IT1A 3NGMA 4JKIA 4DE5A 4EGAA 1ZEJA 2XY4A 4Q16A 4US1R 4BNGA 1HFWA 1NF8A 3CLVA 7GPBA 3BIFA 4M9ZA 2G70A 3T1YB 5F4ZA 2J1LA 1KGSA 4BO7A 2IBSA 3L8GA 4AG5A 2FZKA 4RXTA 3LM8A 3H05A 1RLUA 3JD2A 2ISCA 1ZGZA 1X7ZA 3PR1A 4O63O 1XAJA 2WAMA 3QK7A 4HH3C 2VUTA 3IPXA 4OXXA 1ZKDA 1WLYA 1DRWA 2X7XA 1OV6A 4IXTA 4KZPA 1D9XA 3I6IA 1K89A 2EVWX 2P4EA 3PXGA 3E2PA 1NSFA 4MRRA 2BFFA 4HC4A 1SXGA 5FUVA 3DHVA 5TQ2A 5IBQA 1RJWA 5B57C 5IH7A 1REQB 4Q48A 2HT6A 4JMPA 5F76A 5CX1A 5CLFA 1BYUA 3B60A 1GQSA 1NVAA 3C5VA 3O93A 1WSWA 3HNPA 1H1LB 4GPIB 3JSAA 4IAOA 4K05A 5IFKA 1GUAA 5HHTA 3BGSA 1NXVA 4G8JA 1CEEA 4Q9DA 2NO0A 4B4VA 2F48A 2BSAA 4MWSA 4CM8B 2OZLA 2XPCA 3ZN2A 4V0SA 1BD3A 5JHGB 1DIAA 3DBHA 4OH1A 1JDZA 1P80A 3GJ3A 1BW9A 4S1VA 3SD7A 2GNAA 1TVKA 2NUBA 3S1LA 4PLWA 2OQRA 2W83A 3HXKA 4Y6SA 3A2KA 1DXYA 3TYXA 4II3A 2BMVA 1FFYA 1H05A 1FU4A 1NXXA 1UWKA 1XYGA 4JGBA 4Q3LA 4EKYA 5JNWA 1Z5OA 1QLHA 4R9SA 1T2EA 4L72A 4MVJI 3T54A 2VPPA 3KSMA 1RPNA 1Q19A 3OT1B 1PDVA 3PJGA 4MPRA 3W2EA 3KVYA 1X86B 4ROTA 2OV1A 4BKMA 2Q2OA 3IEPA 1L8OA 3DH0A 2RBKA 2OHJA 3KLPX 1GQQA 3MS4A 3ZH2A 3EZ9A 1QUFA 2P2NA 4G0ZA 2I2XB 4B09A 3ETDA 3OZBA 5I3ZA 3DW1X 5BOSB 1M8PA 2XV1A 4DT1A 4X3OA 1HYHA 1UADA 2BBWA 3ZNOA 4JUDX 3ZW9A 3GJ5A 2D0IA 3IV7A 2NVWA 3GVHA 4BX0A 2WTMA 2GCOB 5EGSA 3QV1A 2I2FA 4KDCA 2RGAA 2QDXA 3RYCB 4JMLA 3RVJA 3IKJA 4IXMA 2GXQA 1KFKB 2NU6B 2P4QA 3A10A 3LCJA 4QWMA 2HUPA 4TSKA 4YJHA 3RM3A 2AZDA 5CDFE 4DV6B 1FTQA 3AVYA 1V8DA 2P9CA 1KARA 1E2LA 3HB7A 2OAGA 3IMFA 1TOAA 2OGSA 3HYTA 4MAFA 1JYEA 4GKBA 5GY7A 1QB7A 4ZI7A 2J3KA 4UKDA 2NO5A 1V11B 5JS7A 1K7SN 2D1RA 3EMKA 3PNKA 4LMAA 4TKUA 2C03A 1J09A 3GRKA 1YGYA 4DJDC 1EK2A 1CQIB 3OPNA 3HEAA 4H7FA 3TSZA 4MWEA 4ALKA 4EPYA 3U7QB 2DCMA 5A4DA 3UPUA 1EDZA 3CWZA 4RLQA 1PR5A 1R50A 3IE0A 1ZD1A 4E1VA 2R7MA 1XTVA 4I50F 2E5WA 5E0KB 3GGJA 3N0WA 4G8BA 4UFOA 1LH0A 2I03A 5AJWA 1R8QA 3GJQA 2CUTA 2YS7A 1EWVA 4L7VA 4WXHA 3MLAA 4FK8A 3TTUA 4I2NA 1RADA 4EMBA 2QL9A 2V03A 3C41J 1E4OA 2RGNC 2VDVE 3EDYA 2GXUA 3I8SA 4UHJA 4UU7A 3RSFA 5BW5A 2CUNA 3D1LA 1PGJA 1RYNA 4TWIA 5AJHA 4Z9XA 1GD1O 3LQ4A 2VDWB 4NF2A 1ZUWA 4D4IA 4L08A 4HDSA 4S1WA 1LPPA 2FPLA 3IBTA 3LYAA 2NPOA 2CVOA 2X22A 4FYXA 2VSYA 3AKEA 4OHCA 5B2ZA 4UZEA 1DP4A 3SOZA 2IXAA 1XZNA 3H4MA 1I2AA 3LMKA 5BWCA 2IZOA 3F6EX 3RSCA 1G17A 2IZ5A 4MRPA 4BDTA 2XOEA 3E2IA 4NMLA 1U9IA 3N8HA 3AC0A 4P3OA 3HDQA 4LRSB 1Z16A 2ICAA 2PRZA 3UWDA 3ZX5A 4BGDA 5KKNB 4XA8A 3A9RA 2HO4A 5EIFA 1K06A 1Y4AE 2GBIA 3DYVA 1K4KA 4K9DA 4B75A 2XZTA 3LYUA 3ZGVA 4RAOA 1UDRA 4K86A 1JH9A 2B2CA 5KOHA 1KEVA 3PZRA 4OFZA 2IZ0A 1J8DA 2OEPA 1WW8A 4DCTA 2QVBA 4ZC1A 2F43A 1OC4A 2BCEA 3T4EA 2O0LA 5LVAA 4ZVVA 2VOEA 1XRRA 2FMHA 4MMXB 3ZU6A 2EFJA 4RJLA 2A7XA 5J5VA 3OP4A 4RVDA 4DNPA 5FLXA 5SYAA 1VSUA 4P83A 1BO6A 3QOFA 4LMRA 1ZD3A 3KVOA 5CDYA 5JANA 1GU1A 1E5DA 3K5WA 3I4LA 1H8HA 3SZMA 4D98A 2VTDA 4J16C 4EYSA 1ZOPA 4DJAA 1J8QA 1QE0A 2WSMA 3DHEA 4X97A 4L28A 1ATIA 2AKAB 4BIMA 4DEXA 1UWLA 2PA3A 3VR5A 3JQPA 1WVIA 3S1AA 4EFMA 1Q91A 2BMEA 4MWBA 4YJ3F 4X95A 1WCV1 3UANA 2IX9A 5L4SA 3GGGA 1O0BA 1HTBA 4HOYA 1LXCA 1YJAA 4V03A 3VR6A 1IUKA 4RJJA 1YKSA 4YI5A 3ZV4A 3GNQA 3Q9LA 4HDMB 3NGXA 4OXNA 4K46A 2GX6A 4NK4A 1D1SA 5FLYA 1WAMA 2Z5GA 4BTLA 2HMVA 1EP9A 2NW6A 1DV1A 2FN9A 2PR2A 2Q4BA 4M9CA 5JMPA 5IXJA 2IH4A 3L4BA 5AVSA 4HWOA 2HV9A 5AOVA 2WF8A 1NJ1A 2FCRA 3S7TA 1XJWA 1W1UA 3C3KA 3O8CA 3ZJVA 2IPMA 3E4DA 4FYPA 1V9LA 2BHNA 2HLDD 4GZ5A 3GHHA 1SPBS 3K6RA 3SJUA 4CEJB 3E8MA 2OSBA 1NPTO 3OFJA 4TXMA 1WPXA 2W0MA 3PEUA 1N34B 3H5RA 1TQ8A 1TADA 1E3TA 1Z2CA 3KFLA 3HRIA 3VPSA 1BU8A 5D00A 4ABTA 2ODEA 2CFOA 2A9PA 3QFCA 2J6HA 3EPLA 1A8SA 5C4GB 1KQFA 3VI3B 5IANA 3THYB 3FSGD 4A73A 4B3DA 3NV9A 5FJJA 1U7HA 5ED4A 1E63A 3U16A 3D8NA 2NVOA 2NUAA 4K3UA 1AUOA 3N87A 3EGCA 1X74A 2R7LA 3VBEA 3ESDA 3NEYA 1R64A 2PRIA 4Q37A 5I9MA 4BP1A 1V4NA 5AKLA 3FHCB 3T9FA 4DQXA 5GAJA 4L16A 4Y9SA 1OA1A 1OROA 2BGRA 1YONA 1WL8A 2YVQA 3QMWA 4QHTA 5LM3A 2W42A 1NRXA 3PEVA 3GYBA 2NTEA 5FBHA 1ORHA 1WWKA 4UBMA 1G5TA 1MQ8B 3FMGA 5JH7B 4JIGA 2J09A 3ZCTA 4JUAA 3VKHA 1QIDA 1VIDA 1JDBC 3OU2A 3PJEA 3EARA 5T3YA 5EFZA 4P80A 3I42A 5BN1A 3OCXA 3R7BA 3FLBA 5JCXA 5CA0B 2PWYA 5KYGA 5K1SA 2HNAA 1SUWA 3EEOA 1XPRA 1N6RA 1WXDA 1YBMA 3DDZX 1Q95A 3K53A 3PUJA 4KWCA 4OOEA 5G0VA 5KYNA 1F7UA 1ONNA 3WGUA 2H3EA 2NX2A 3L6RA 4C04A 5BUSA 2FZWA 3DO8A 2ZUBA 1XOIA 4FHFA 5HUHA 1OFVA 1BMQA 3GZJA 4MS4B 3TKAA 4A8JB 1R18A 2H6EA 4RHTA 1N2SA 2FPSA 1M2HA 1E3SA 5DCLA 3FD8A 2QQEA 521PA 1JWAB 1XDWA 1Z3CA 3OM8A 4FYWA 2KYRA 5KYWA 1N78A 1SZJG 5FPQA 3PPWA 3JTMA 4IDGA 1RKXA 2I4LA 1QZTA 2JCXA 3VPCA 2B1IA 2B1QA 2IYZA 1JLLA 2OD7A 3MJHA 3NNDA 3QVUA 1DL5A 4JK3A 1M3SA 4M46A 3BXHA 5EJ4A 1NMXA 3DYBA 5BSKA 5J63A 4CHGA 3MCUA 3PQEA 4NI5A 4KVZA 5E9QA 1JE0A 3WYCA 3SIRA 4EG5A 1U65A 4HAIA 1IBMB 1EBUA 3BD8A 1A9PA 4KXWA 5AVTA 4XFDA 2GDJA 2BH2A 4DZZA 3TOSA 2NOAA 2JAXA 2C1XA 1NBHA 2R3SA 3HFJA 4XTCS 1FVXA 3D7RA 5AWFC 1RYBA 3UMBA 1E2IA 3VJMA 4BC1A 1JBQA 1M2WA 5DSXA 6Q21A 4PSVA 3R09A 3K0CA 1JIUA 3UOGA 4EELA 3TGWA 1MX1A 3T9AA 3T95A 2H4WA 1ZL2A 3AEZA 4R40A 4WVFA 4JBIA 4LI3X 2AUNA 5G3ZA 5T8KA 2B8WA 1DUSA 2HJVA 2WICA 3HNOA 2GK7A 3M6IA 4G5SA 1XXLA 4C4YA 3I2JA 4ENQA 1VSTA 2P3OA 2EZ4A 1GNQA 1CZUA 3BSFA 4YP9A 3M9XA 3AP3A 3RC3A 3ZYZA 5A4FS 5EOVA 5CLJA 4TYMA 3STXA 3PDCA 4ONEA 5AM1A 2Q9BA 1R6TA 1C7FA 2Q1SA 2DSNA 4KB5A 4UUAA 5HTKA 5JD5A 4XM1A 4DR1B 2ZWOA 2XD4A 3MBIA 1EFUA 2FPXA 3ZS9A 4E5MA 4ZK2A 1U4SA 1M2KA 1XDBA 2V7QA 2V45A 3CH5A 3PKIA 3UKOA 3V9AA 2ISSD 4IDOA 5HFAA 4F6LA 1IUNA 1L9KA 3C8UA 3H84A 4J7XA 5H02A 3DBOB 4HNHA 4DCSA 1W8DA 5TPWB 1JI3A 2Z4SA 3B6JA 1YHYA 2BMFA 4RPCA 5L3QA 3HFGA 1R9NA 3QFSA 4AP5A 3M4JA 1MKYA 2GF2A 3M6XA 4LJRA 1V9SA 2C7BA 3EVAA 4DCNA 4C06A 3ZW7A 3RKUA 3P20A 5BW8A 5H68A 1G60A 1E5QA 4QGBA 4WZBA 1W4BA 4N12A 3W9YA 4EF5A 1K68A 3SF8A 4X00A 1CY8A 3GJYA 4C0WA 1HNWB 3HCNA 2BMAA 3N76A 2WD9A 2HSJA 1AMUA 1SBZA 3VHLB 2FW1A 1E3MA 5IYZF 5AFSA 5JBQA 1WV1A 2B6HA 1Y4UA 3KUXA 2I91A 4XWOA 1Q1BA 2QYTA 4HN4B 2MR5A 4OFBA 4OUDA 3QTLA 5FOUA 4QLBA 4JLMA 2VQDA 3PDWA 2JA2A 3M6LA 3PFFA 5KYXB 2CUZA 2VYQA 2ZS8A 3MG9A 3T3HA 3W5SA 3EGXB 2VUHB 3QY9A 4IWXA 3AB7A 2VNHA 4EG3A 1P2DA 4D8WA 1DC4A 2ZVPX 3KPVA 2MYUA 1JKJA 2PYIA 1WCIA 4NZYA 4LYDA 3E3OA 4PC7A 1Q77A 1T6NA 3QEMB 5HUQA 4TTAA 5H8WA 2IEDA 1UJ2A 2MTBA 3E84A 1SVWA 3F1LA 1CRZA 4GMKA 4TWJA 1HRKA 2FN4A 4X5OA 4EX7A 4LV6A 3C6ZA 4N7JA 1H9CA 2CDNA 3D4NA 1BWRA 3WFZA 2L82A 3F49S 3IXLA 4DZTA 4IVNA 3F8WA 5JOQA 4IOKA 2YYZA 4AJ1A 4B3RB 4O2AF 4R4JA 3KSAC 3OZWA 1YKFA 5CLHA 2GAFA 2PT9A 4RZQA 1E1QA 1M5UA 4P0TA 1AX9A 2AX3A 2CHGA 4QBFA 3SX2A 3NM5A 4O33A 1XLVA 1E9EA 1KH2A 2BLLA 5F1YA 4IIGA 3PFIA 3RVRA 1EVZA 3JX9A 4GOOD 2FWBA 3QHQA 1HNNA 3PV0A 4ZMBA 2H2WA 1ZOSA 1I1QB 3EDCA 5LKAA 1ZD8A 3FDXA 3OQMA 1N8NA 4A0QA 2RC6A 1XZHA 1MOQA 4KQ6A 1FQWA 1T5BA 1Z29A 4OM8A 1ABFA 2FK7A 3EQZA 2AN5A 4U7FA 2DXIA 1JG1A 3D4IA 5KYUB 4MV4A 4ZQIA 1ZEMA 2KBEA 2O2DA 3AZOA 3O6VA 4BFWA 2V0NA 1ZK1A 3RRFA 4IHJA 1ZI8A 2O0KA 4YCBA 4BZPA 3QKSA 4Q93A 2Q2NA 5A5DA 2ZXUA 2G6BA 2Y8EA 3GA7A 4WNCA 3RUEA 1X8XA 4L57A 1MO5A 4AVYA 1V7ZA 3IDFA 4WESA 4Q18A 4BEBA 1A2BA 4LOLA 2JLBA 1O87A 4ZREA 3NYIA 3ON5A 2ODNA 2NU9A 4YI3A 3U1BA 2REQB 1DKLA 2W6NA 3I5YA 4WKNA 2C9YA 3G2OA 4KE7A 2IS2A 4FLFA 3RVBA 2VHJA 2BFNA 3R9XB 4ME6A 1EUCB 3A26A 3MINB 3JS5A 3GGCA 3TIXB 1IM8A 2GBFA 3KK0A 4UPVA 5ESRA 2ORIA 4DMLA 4X66B 4KXUA 5DIZA 3VDMA 5FAKA 1KI1A 5F1PA 4HT3B 3JZMA 1MX9A 3WIDA 3QLUA 1T5HX 1C7QA 1OXSC 4ZOLB 1BMFA 1YR3A 3OWOA 2LW7A 4B87A 3A6EA 2VWPA 4IUCS 4ZCPA 3PGLA 3THSA 4D99A 5B4UA 3ZE7A 2XNDD 2PS9A 1A0OA 4MB6A 4IEFB 1AQJA 1BS9A 2GO7A 2VG8A 2LCQA 2NUPB 5CFPA 5L6LB 1H85A 4NJMA 1NUPA 3WV5A 2M6SA 2P11A 4JVMA 4PQGA 2QMOA 4B33A 4DA6A 4E5DA 2VDKB 4XJVA 1QFJA 5KDLA 1Q17A 3AUAA 2WJAA 1Y5RA 5JNLA 1QHXA 3FPSA 1WQ1R 4FTWA 1UOPA 2XCLA 4GVPA 4MWZA 2BJVA 3PNSA 1F4VA 4WZAB 1T8UA 3A1WA 1U0NA 1NFRA 3WWDA 4CFZA 3HM9A 1P6UA 1L0BA 1E9DA 2X42A 1QH1B 3SXUB 2FSGA 3W2HA 3THRA 4EY8A 1TYDE 2X6QA 3CBGA 3K0AB 1Q1ZA 5I7HA 3ZWAA 1OY1A 5KOIA 5A3JA 1IG0A 4CCSA 3MCTA 3QBDA 5G1PA 1KZ7B 1QM5A 4WK6A 1I3LA 4DEVA 4G4IA 3EEIA 1BN6A 3SSNA 4EBFA 3RAFC 4HNGA 5EKXA 1TTTA 2NTJA 2QD4A 3KQWA 1QO7A 3NRCA 2B4YA 4TS9A 4NYIQ 5LNK1 3AUKA 2PD6A 3OQ1A 4P5EA 2X3UA 4MJ7A 1FTYA 1UBHS 3ABIA 3AHJA 8ADHA 2OQ2A 1PEKE 1U02A 3D54D 2GR9A 1N6OA 4LBVA 1E5XA 4ZTZB 2JLWA 1V3QE 2ZATA 4UE2A 4TUYF 2WSSA 5EUMA 3TVYA 1A7JA 3NWBA 4XWAA 2JJ2A 1A27A 1EXNA 1GDHA 1XE3A 4N8SA 4FE4A 2X2EA 2DQYA 2EX1A 5LQUA 4KL8S 3JD4A 4JLVA 2VF2A 4ER7A 3F7NA 4P92A 4A16A 2EKDA 4ZI3A 4Q1FA 4ZVRA 1QK5A 1HOXA 1TF7A 3UUWA 5DXAA 1C8BA 2QLNA 3G89A 1M2EA 3IVAA 3QMMA 4BATA 4QXRA 5J43A 3CVYA 4MUHA 3TJMA 2Q5IA 4RSRA 4YWHA 1LGYA 1QFZA 2ZRAA 4B5KA 3DEYX 1FRFS 4CKCB 3NR2A 1PUJA 4L8YA 4AP6A 5THKA 4I1PA 2JFXA 2X58A 1EFVB 3KALA 1P0QA 4NPAA 5LUBA 3KPJA 4JJ4A 4YRMA 1E1CA 3ECAA 3P96A 4C1NA 1AGPA 2Z8YA 1IQRA 2GD0A 4K6HA 5K0JA 4Y3UA 2MYTA 3G68A 5D51S 2Z3VA 4Q9KA 1Y6GA 1B0UA 3O2SB 4PQEA 2OORA 4BFZA 3BT7A 3LC1O 1JXOA 1XLWA 2C00A 1ZOLA 5J1SB 3V3TA 5H3CA 2JH9A 1O8BA 2B5OA 2XOXA 3IV9A 1N9GA 3OCYA 3Q9SA 1R4ZA 4KPUA 2Q3JA 4RMJA 5DV9A 4BO3A 4C78A 2VF7A 5M34A 4QX6A 1FW8A 4U7HA 1VMEA 1Z39A 3IULA 4MDHA 4QTXA 2CD7A 3IIJA 1G98A 4RY0A 4NCIA 4L02A 3OTOB 2UZ1B 4ZI5A 1NBMA 2WG2A 5CVEA 4BJ1A 3LQRA 4CLDA 2B0JA 2Z1MA 5ELMA 1E2PA 1MB9A 4CLXA 1ZR2A 1VA5A 2Z08A 3QEOA 1FOEB 3I2HA 4AMUA 5L9AA 4WNYA 1QH9A 1NOKA 1R0KA 3PGXA 4MDEA 3FUCA 3NLLA 4HWRA 1MD9A 4C6RA 1W73A 2G04A 3KP1A 4D80A 1Q83A 1G5QA 3A8TA 3H6GA 4MUIA 2QA5A 2FU5C 3K2BA 1HDGO 1I4LD 4UM9D 3K1JA 4ARCA 2B1GA 4GYKA 4BRUA 3EXHA 3PHIA 2H2DA 1JA1A 2W8BB 4ND2A 4ZCMA 1LF0A 2E3JA 3LUGA 3GLGB 3HVJA 4AI6A 1WHTA 2X6TA 3D3EA 3UT6A 1J8FA 4KBYA 1TTHA 4I3GA 1FXSA 1MTZA 1NVXQ 2ONYA 1GKIA 2YV3A 3ANXA 3OZIA 3QBJA 5FA5A 1GFWA 4YO7A 1A8IA 3PC2A 1BXRB 2CLLB 4FT4A 4JOCA 3O75A 5IVDA 3RK1A 3H0CA 3QFFA 4FYMA 3GDOA 4QUAA 2FWIA 2Y9MB 3VAZA 3WGGA 3GDGA 3T41A 3RTDA 3RARA 1NLYA 4DR3B 1CIJA 5LQCA 2YV1A 3SQMA 1CE8B 1BNCA 1GGMA 1Y9DA 1XC7A 2QM8A 4HWGA 2ZJBA 2C3UA 3ETCA 3OESA 4J49A 3MTQA 1NFFA 4ZAFA 4ZCTA 4B32A 3E1GA 4NMMA 4RK1A 5CPBA 2DRIA 3KV3O 2PEYA 2LVBA 3L9XA 4C30A 4BVFA 2OV8A 1YZHA 3IEXA 4AN4A 1M2OA 4AUEA 4GNRA 2PAFA 4YDSA 5JCJA 4BVAA 1BGVA 3WV4A 3K4PA 1V26A 1SZPA 1RXYA 3CR3C 5C31A 3WP0A 2WC1A 3OG9A 4PCUA 3RYFB 1SQFA 2JDID 2WUWE 2XMGA 3DWIA 3BAFA 3G6KA 1XK7A 3FYUB 3FWNA 2VJMB 4UVDA 2R1TA 3TBFA 4DMCA 4HLUC 5LZ2A 1T8WA 1TLFA 1Z6PA 4AMYA 3KXKA 4MP8A 3UBTA 4EA9A 5G0WA 2CHVA 3B2EA 2ZULA 1HEIA 2RGEA 3IHKA 4G5OA 4WRRA 1ST3A 2WYVA 5EL0A 5KTSA 2WW8A 3DEIA 1OF1A 1IY0A 1U0HC 2JD1A 3JQ9A 1VHTA 2AOUA 5AKYA 2X6RA 2AEMA 4G25A 4B3SB 1TCAA 4E5NA 3ZJUA 3MRXA 4W99A 5K99A 1NVBA 4MVJM 1BA2A 2V6GA 2BY4A 3CQ9A 1YR8A 2PMEA 4FB5A 4LOJA 2DTDA 2AJCA 4DV3B 4CL3A 4FKZA 3DVAA 4K0KB 3NTLA 1PT6A 4AS3A 1Y1QA 1C9MA 3LUFA 1QHSA 3ETGA 1SOWA 5F2OA 1EG7A 1UDWA 5AVKA 1NX9A 1WSBA 2GQ0A 2PQ2A 4PCLA 1AQUA 1KZ9A 3LE8A 3C5CA 4G85A 4ZU6X 4DIUA 4DMMA 4GWKA 2QGFA 1J9GA 1K27A 4UMEA 3MEQA 2Q5CA 4UHKA 3COVA 2ST1A 5FOSA 3CLRD 4LJ7A 4QC2A 2VT2A 3H2SA 4XR9A 2QE7D 3BUSA 4MCAA 1FRVA 1OFUX 3D3NA 3KR9A 2ZSFA 2ECPA 3H1BA 4KGXA 6PFKA 5KWIA 1F38A 4QHSA 1M1YE 1LKZA 4TZ0A 4J0DA 4OOFA 3R23A 3R7WA 3D8HA 3A1TA 2AX4A 4IG9A 3MLEA 4QDXA 1CJKC 4BQRA 5KNCA 3U4QB 3WRYC 3B9BA 2QW8A 1Y3AA 2H1LA 2RKOA 3DGEC 4ZHQF 2HF7A 3BORA 4JQSA 1Q15A 4ND3A 4UAJA 1EXVA 2RAPA 4O3FA 1NUHA 3THWB 4DWWA 2G4VA 4H1VA 4K9RA 1S3GA 4I8XA 2YJ3A 5D85A 2H51A 2IDZA 3OPYI 5JZ9A 3LY8A 5EWLA 4ARZB 5H4GA 2XBMA 1YRLA 4LX0A 5CCXA 3BWYA 3C5EA 1XZJA 4DLNA 4QXQA 5IYZB 1A7UA 4ISCA 1XTQA 3AUFA 3ND7A 2Q7OE 1D7OA 1NU8A 1PZNA 2HWKA 3DMHA 2FJPA 3NWOA 1O6BA 2C84A 2O5RA 5JAIA 2XUJA 3JRNA 1RTKA 1FXWF 2DY1A 3IT3A 4HEQA 4P7GA 1P1JA 1XA3A 5BW6B 1KYQA 1TI7A 4P08A 2YJ6A 3IOYA 4L5BA 1K5PA 1JTEA 1Z0SA 1PT5A 2BGKA 5CHEA 3DAHA 3W9BA 1KK1A 4EVIA 1RACA 3QIVA 3GZ4A 1NJ8A 4WCFC 4DQUA 4PNPA 1GZ6A 2PS1A 2OBFA 2NU7A 3EXEA 2AWOA 4KAAA 4S3MA 3OT5A 1FYVA 4MW5A 2JHPA 3B7GA 3G5UA 2IYYA 1UBRS 2WTEA 2WLTA 2OXTA 1UJBA 2WM2A 4H3SA 1KC3A 1QLWA 3WRVA 4FIDA 2IXFA 4HQFA 1KJ9A 1A8QA 5HQ3A 2WOOA 4FMCF 1CR4A 4O4HA 3THXA 2X1VA 3COPA 1LWOA 2AS0A 4KVGA 4QTUB 1NUSA 1QPBA 2YTZA 3SK0A 1UEXC 2HDHA 4TTSA 5LP6B 3LAWA 3N2YA 3OCZA 5HCNA 1L3BA 3RVLA 3TNJA 3WDKA 4EYQA 4ZAXA 4TQUS 3CS3A 4U3JB 4UEKA 5T6BA 1YL5A 4BIIA 4CM6A 3OIDA 5DI3B 4O4IB 2PUWA 2AV6A 3T7TA 4CM9D 4CKZA 3AMVA 1FFXA 1JHQA 4LDPA 3UMMA 4WFKA 5F52A 1JEJA 1UPCA 2XDQA 4BCBA 3B89A 1TEVA 3KYIB 4HMQA 2VPQA 1PLLA 2TMDA 3N07A 1VM6A 5B7GA 4BN0A 4PZUA 4P4UA 1MJGA 1ZMRA 4AZ3A 4BU0A 1L5YA 3UICA 4PYJA 1OR8A 3ZWDA 5B3LA 1XZMA 3ZJYA 3ZDZB 2C2BA 2N46A 1HQCA 4NBNA 4CLOB 1S2MA 3OQIB 2W9XA 1LK0A 1SXJB 4B2YA 1IZZA 2CK3A 1KOJA 5FBWB 3RS2A 5KU7A 1M1XB 4QEKA 2DHEA 3DWGA 3SFTA 3R7FA 3OLQA 3AYXB 2HPHA 4BLWA 1OX4A 4KNWA 2OFWA 2EXXA 2H08A 2BJWA 4P32A 3L7IA 1Y4SA 1T36A 3KR0A 4ZA2A 1RBZA 1X9IA 1BXKA 3H5NA 3IUJA 3KAKA 4NJEB 1J23A 3DLHA 5BQFA 4CTOA 1RPZA 4F2HA 2A1TR 1I9GA 1X9GA 1O97D 2WF6A 1VRCA 2D7CA 4MUYA 1C8LA 4O4JA 4PRZA 1GHTA 1UUFA 3PNLA 3ZPXA 4CTKA 1ZU4A 4H3KB 1UJ6A 1NQAO 2R8PA 3LHIA 2FFAA 2IXEA 3TTWA 3BTVA 4DC0A 5DWVA 1DKOA 4YXWA 1QHHB 5LYYA 1Q7GA 4IKOA 3ZTYA 3EJ6A 1KA9H 2FPMA 2WKRA 1YFJA 1VDMA 1K8QA 3P45A 4NDNE 5EC8A 1Q0ZA 4FYIA 2FQQA 2JLVA 3UJ9A 2WHEA 2IYPA 2XR1A 4LFCB 3T9EA 3VGPA 4PSAA 3WDLA 2QE6A 4S0ZA 4U7TB 2ZI9A 1IWPB 3K92A 1HLFA 1PT7A 1YRQA 3C1UA 3M0EA 2QZSA 5DVZA 6AT1A 2NYUA 3F4BA 4CI9A 1FP2A 1P7WA 3DUFB 2G88A 4GHWA 3QMVA 5J4YA 2IYSA 5TQJA 2DVMA 4EQ6B 3BMQA 4F3KA 1USVA 4G1CA 3HYSA 1YS2X 4P38A 1X2EA 4FSDA 4WH0A 5CDGA 4R7TA 5HF5A 4CTNA 1XG5A 2CF5A 3R8CA 5CDSA 5MGBA 2R4UA 2WU0A 1DMSA 1WA5A 4JQZA 5JATA 3IBFA 1AQNA 2I76A 3HADA 3GFGA 3EC1A 1TX4B 1T15A 2R4TA 2WAAA 2FEPA 1NN1A 1XEXA 4LRQA 3TQOA 1WX1A 4BQEA 1YDEA 5AVZA 4D41A 1DEKA 2X9NA 4EHFA 1QVRA 1AB5A 2I1LA 1ESEA 1CS4C 1N2BA 2EAUA 3FKSA 5FTMA 2Z6VA 3HCPA 3TIGA 1XZBA 2AFHE 1ZN8A 2ZDHA 3KDSE 4QRIA 1I4WA 2HU8A 3EXIA 1OMOA 1TNDA 3MSXA 4REQA 1H4VB 3ZWOA 5F7OA 5FWNA 1NIPA 5KWJA 1YUBA 3G6WA 3JAKB 3U81A 1N1MA 2QROA 1H23A 3MWEB 2K2QB 3IPYA 2RGWA 4ILEA 4TKVA 4XQ0A 3AOGA 4ZO6A 4BNMA 4DIEA 5TS2A 3AJAA 3WL8A 2G9ZA 5CM2Z 3ADDA 1EK0A 1BS2A 4J1QA 4QG7A 4XPZA 3K8QA 4KYTA 4CKXA 3CZAA 4JJIA 4P0QB 3HLTA 2HU5A 4J2TA 4RTNA 1NNI1 1NN5A 2H4FA 1C30A 2TS1A 3W8NA 3QEAZ 3NJ4A 5C8ZA 3ZV7A 4B3GA 3GD7A 4LTMA 1SCAA 1IBSA 5TX7A 2P9HA 4JYZA 5DF1A 3DEZA 3PG5A 4OJKA 1NYRA 4ZQBA 5K3FA 3EB9A 1ZN2A 4Y7DA 5JCOC 3STYA 1YDMA 3FVWA 1SUCA 1J1UA 2FRDA 2XUHA 4FEGA 1IK4A 1P81A 3G7NA 3K2EA 3ZQJA 2EIHA 1P7YA 2BISA 2IHTA 1Z83A 2A94A 4L15A 2MSCB 3IEIA 2LV8A 3OZEA 5CRIA 5AKKA 3WIUA 1XVLA 2Q5FA 5EERA 4ERNA 3GGDA 4RD0A 2J6IA 4E1BA 2R66A 1EK1A 4NBVA 4O2RA 4OMUA 4U1RA 5EVCA 3VKWA 4EFNA 4GL2A 1QX4A 1YNSA 4URZR 1U0SY 3HB4X 3VZRA 4AWBA 4LDRA 4R98A 4GVLA 5K0ZA 4OKIA 2D13A 4KGZA 3ZHVA 4O0LA 3VR2A 3UMYA 1E1RA 3TD2A 3FGNA 3G1TA 1OI2A 3OKFA 3IH5A 4XX1A 5AVOA 3WS7A 3IIMA 4E11A 1XZLA 3AL3A 3D8TA 4NP6A 3V4VB 2JD2A 2AXNA 2BHTA 1W29A 2ACKA 1A2QA 3IQGX 2XKKA 2AQ8A 4PGHA 2H8KA 5EJMA 3MWDB 3QIAA 4JXKA 1DFHA 1UK9A 5IC5A 1A95A 3LW7A 4B2PA 4BE7B 1E92A 5A2GA 3MTEA 3T3IA 3QU2A 1JS1X 4GKJB 1XJ0A 1O6CA 5DM70 4Y6LA 4WBXC 5I7VA 2FMTA 4L6AA 3I04M 4JD5A 5H16A 3PFNA 4G0YA 5H3HA 3QUAA 4MO9A 3T1VA 5C1BA 3IYLW 1G8GA 3LPLA 1PFGA 4G86A 4MLZA 3DBRB 3HZHA 5DHTA 2HPZA 3S8EA 2XECA 3FETA 4CMHA 1E6UA 2GZ1A 2XWBF 4L7QA 1DFIA 4I1YA 3UFXB 9LDBA 1AN9A 1PJRA 1AMNA 2O6LA 2QAIA 2CNDA 2QAGB 5DULA 3THOA 3D5EA 2W70A 4GC5A 3EAGA 3LK7A 1J5PA 2J08A 1DKQA 1WU7A 5JXIA 3IP1A 3FDFA 4MGEA 4J16A 1MGOA 2B94A 1Q14A 5TB5A 3GFBA 4OAPA 4RULA 3I6BA 3K2IA 1VMIA 3S4YA 3H97A 3VYUB 4E13A 5KNDH 4BV8A 3WKCA 4YHHB 4V0NA 4OATA 3EGDA 5B4VA 2RFLA 2PT7A 1CIVA 1E7SA 4OXYA 4NHOA 3A2LA 3PUIA 4Y2UA 3T7DA 1C0KA 2XMQA 5GIOE 1T0JB 5ALDA 4AY4A 3W06A 1BDHA 2FJ0A 3Q40A 4GM0A 5LA6F 2Q1XA 4DLRA 1ZAKA 3FIJA 4GWLA 2VXYA 2OUKA 2ERCA 3QBVA 2OVBA 2J45A 2R8EA 4NNJA 3VOAA 2VZ8A 1XQWA 1KU6A 3S29A 1UKZA 1V2GA 1DTEA 2AR0A 2Q3HA 1LJ8A 4H2DA 3SZRA 2WQ7A 2I6TA 4NAUA 5AICA 5FBVB 1DWOA 2FPGB 3HBMA 4CJXA 3QPAA 4J1TA 1F06A 1FTWA 3K9NA 4HGYA 1MIHA 3N5KA 2JHFA 5AUOB 1TCUA 4I3HA 4TVSA 2Z9BA 1ULTA 3I61A 3MTBA 1H2ZA 2HA0A 1JHOA 1O6ZA 4DARA 2O54A 5JJIA 4AULA 5LB4A 4YMLA 5TQVA 4F6CA 2R8YA 3BSWA 2IW1A 4FR0A 2P6PA 3U3XA 1YACA 2ZWAA 1OH7A 1SD5A 3IRVA 2JGDA 4MIOA 3ZK9A 2DQSA 4HUQA 1DDGA 1V8PA 4OFWA 4H0FA 3R4CA 1BU5A 4EL5A 4AY3A 1OA0A 4Z3DA 4NE7A 3O8DA 2Q50A 3BDAA 1V5IA 1O95D 4KOEC 2WR8A 3UENA 5LOVF 2QLMA 3WTBA 3B8HA 3LXXA 1G3MA 3PQ4A 1XHEA 2W6MA 3DB1A 1JG7A 3IO5A 3WLFA 2Y1GA 4X20B 4Y9DA 4RMNA 1EHYA 2E4UA 2FP4A 1JJ7A 5DM0A 2Z2KA 2WKPA 1YRWA 4LN1A 3ZZUA 3H8JA 1BQEA 2AVDA 4CR7A 1FZQA 2DP4E 4PWZA 4ZAWA 4X62B 2KHZA 1J21A 4B2IA 4CN8A 1RIIA 1RWMA 4IDNA 4Q4JA 2FN8A 1ADFA 1DBRA 2VK8A 1XUOA 1MAWA 3E15A 2AQHA 4HLDA 1ZH2A 2IOHA 2R6HA 5BNIA 3H83A 2VJCA 1NVKA 2EKZA 1C0PA 2PKQO 3KT6A 2E5FA 2R8OA 3OJOA 4N82A 3WI7A 2EJWA 3GFTA 1XTPA 2NWQA 3E6AA 3IEVA 2CDBA 4FVTA 2QUAA 4D81A 1OI3A 3DTVD 5JS2A 3EYAA 1I3CA 2H1WA 3F98A 5TV2A 3WHLA 3GDFA 5DNUA 4ZDJA 2PRSA 3STTA 4C89A 4ZGBA 2PBLA 1WHSA 3L1IA 1QGUA 3VDNB 1NLZA 3WGQA 2XRZA 4G23A 5EE0A 4IVQA 4WBSA 3K0SA 1IIRA 4CIAA 1WIWA 1ARZA 3H1AA 3CJTA 1D0VA 2VOJA 3VTKA 1JKMA 2PZFA 4X3CA 3S2SA 1XRPA 2QN1A 1SCQA 3TOVA 5JJ5A 1CDZA 1A4XA 5T67A 3ZZ0A 2X41A 4L73A 4UASA 1IPFA 1IWBB 2OFOA 4YRKA 3U40A 3AO0B 1Q3TA 2AMVA 2QTGA 3DF9A 3GT4A 4QVGA 4L6IA 4X7RA 1EPUA 4QXOA 5IVKA 2Y6VA 5DBOA 1R8SA 4J0FA 5DFAA 1Y80A 1AD2A 1JB9A 1G2OA 1HL3A 3HV2A 3IGFA 4OQPA 1OZHA 2IVFA 2PRJA 3BWEA 4I81A 3W6UA 4EVQA 1ZUNB 1OIWA 3PC7A 1X70A 1RLTA 1RJ9A 2HX1A 2GZ2A 4IDCA 1Q0UA 4YP0A 5B58C 4CQMD 4L2IA 1WXFA 1Y4DE 3A70A 3JQGA 1F8GA 2V5VA 4R6WA 1GPWB 3LRXA 4C43A 3LO5A 1S89A 2WF7A 3F9CA 2PMCA 3C5WP 3P97A 2WTBA 4MVJP 5JYEA 1SBCA 5KHLB 1A1SA 4EQZA 1S9HA 2FFJA 4UULA 1KJ8A 3BL6A 1ZGAA 1UDCA 4PHGA 1EFCA 2JIZA 1S3IA 3OE7D 4AU1A 2O4UX 3F0TA 3L6UA 2NVBA 3O5AA 5SYMA 1SEVA 4IFIA 4EIWA 4JVLA 3ROXA 5KX5B 1CRPA 1C41A 5CBPB 4YMSA 2GMWA 4RTMA 1OGYA 1FXUA 5LQRA 4Z49A 3FPHA 2OCBA 5FT9A 2WWYA 2WTXA 3LF2A 3C98A 1VG0B 3PUKA 4QRHA 4R1UA 1LLDA 3B3QA 1Y9AA 2FR8C 1IOZA 4ND5A 3E70C 3LPNA 5BWNA 5JROA 1P17A 3NM4A 4U0JA 4Q3OA 4QBGB 1QONA 3LRPA 4JP2A 1JG3A 1WCWA 2YC4C 1COZA 2YJTD 3BD9A 4IL5A 4J91A 2EP7A 3VOBA 2XF2A 2ZYAA 4MGHA 3ZU4A 1GQYA 2Y0BA 1SVNA 2CL7X 3L41A 4K6KA 2Y99A 5KBYA 3QBTA 3AYZB 3ZDQA 2IYLD 1TF2A 2ZSDA 2IP2A 1ZLYA 3LFTA 2WIFA 4NX2A 4ARIA 3GMIA 4HEA1 1NW7A 4FEAA 4U9UA 2ZTSA 4G5GA 5AKIA 1PG0A 3GEPA 4HYEA 3AKCA 2EDAA 2C78A 3WKAA 1WBJB 3AJ8A 4OGLA 1OLUB 4E7OA 4PINA 3EBOA 2YRXA 2CHUA 1TD1A 1B76A 1OWLA 1HZJA 4F5WA 2DWOA 3LWDA 2C4WA 3IB6A 4MV6A 4PFKA 2FG7C 5CFLA 3Q9UA 4JI2B 5B53A 3ZR4B 4YP6A 1GSHA 5FNVF 3EFOB 4LYYA 4D3XA 4DIMA 3AW8A 5IT5A 4PGAA 1SO8A 4JDUA 3M34A 1DCTA 1VLVA 2NG1A 3T3OA 1GSOA 1UPUA 4Q7EA 5BYJA 1EA7A 2VNKA 4HNTA 4G5XA 4U6NA 3B3FA 4JB8A 4KN8A 1HA3A 2QF7A 4V3CA 1SA0A 2F3SA 4J1NA 4EEXA 3K8YA 3Q3VA 5KYYA 2XHZA 1XXHB 2QI9F 2GTPA 3B1KA 5JY6A 4YY3B 1K7FB 2IEIA 3G2HA 3LPCA 3E7FA 1W9HA 3B8EA 3R6TA 4WKOA 2XBLA 1OBOA 3D0KA 3GWGA 1JJFA 1T3TA 3INTA 3SYKA 1ZMXA 3TXYA 2C4HA 4P2BA 2HU7A 1RBMA 5AUPB 2C5BA 4AW9A 4ETIA 2L2QA 2OZVA 4AY6A 3AVXA 4FMDF 3A6DA 3ASZA 3ZE9A 2H1SA 3QU7A 5BN5A 1E3DA 1K1EA 1AGRA 2G1UA 1KZ1A 1Z34A 3HB5X 3HKCA 3VU9A 1N0IA 2P68A 1YO6A 4RANA 2WF5A 5CP8A 5AXAA 3T3MB