1Q1NA

Apo and holo structures of an nadp(h)-dependent cinnamyl alcohol dehydrogenase from saccharomyces cerevisiae
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
360
structure length
360
Chain Sequence
b'MSYPEKFEGIAIQSHEDWKNPKKTKYDPKPFYDHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQRVGVGAQVFSCLECDRCKNDNEPYCTKFVTTYSQPYEDGYVSQGGYANYVRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSMGTLISKAMGAETYVISRSSRKREDAMKMGADHYIATLEEGDWGEKYFDTFDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLSLKPYGLKAVSISYSALGSIKELNQLLKLVSEKDIKIWVETLPVGEAGVHEAFERMEKGDVRYRFTLVGYDKEFSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical zinc-type alcohol dehydrogenase-like protein in
publication title Apo and Holo Structures of an NADP(H)-dependent Cinnamyl Alcohol Dehydrogenase from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 107
structure length 360
sequence length 360
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2003-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1q1nA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1q1nA01
1LQUA 1P1IA 1Q7CA 2NLOA 3JD0A 4RVUA 4CMAA 4CR8A 1E6UA 3BIOA 3GVPA 4YT5A 2PV7A 1C1XB 3AU8A 2HU2A 4CMGA 3ZNQA 1UXGA 2C29D 3R3SA 2VHYA 2DAPA 3PYLA 4IS3A 5JE8A 3UH1A 3FNGA 3K8ZA 1EEHA 1AUPA 1B7GO 2E4AA 2GRAA 4XA8A 2ZCVA 1BXZA 5KVQA 2VZ9A 5IDWA 1IYZA 3PJGA 3TOXA 1A71A 3E1KA 1ZSYA 4JLWA 3PVZA 3IAHA 1E77A 1ZXBA 2YV2A 3IP3A 2D5CA 4FFMA 3EYWA 3GNTA 5MDHA 3V2UA 5CEJA 3DZBA 1W6UA 1PQPA 1J5PA 4R5MA 4CV3A 1CQIA 3JQ8A 3GNQA 3ZNNA 4YRBA 3UFXA 3SEFA 4XYEA 4TVBA 2ZATA 3SX2A 1WDMA 3U4HA 5CDSA 2GF2A 3O4RA 4E12A 4I08A 3NJ8A 1V3VA 1EQUA 2UUOA 2RHCA 3KUXA 4NDNE 3FSRA 4INAA 3KYCB 1ID1A 4HUJA 1AHHA 4YRDA 4B4VA 2ZB8A 3CKYA 4FCCA 3NX4A 3VKUA 1BXKA 4UEKA 1YB5A 1EE2A 7MDHA 3JQDA 1KEPA 2DBVO 4QSMA 1PGJA 1K6XA 3G1UA 1XCBA 3HWRA 2Y0CA 3P2YA 3V1TC 2X86A 1A4UA 4BKRA 4BL5A 1OI7A 4NNJA 4ALLA 4XDZA 3U3XA 4EW6A 2VOEA 3ROQA 3VPSA 5T57A 1TI7A 1A4IA 1KVSA 1R0SA 2D8AA 2GNAA 2VNAA 4GPD1 3RUCA 2AEFA 3JQCA 4XQCA 1Y5MA 4OO3A 1HYHA 1C0PA 3BXXA 4XDYA 3TZHA 3WQRA 2J3IA 2PZLA 5JMWA 1IY8A 2Y67A 2Q45A 3ROPA 5A04A 4U0KA 1FDUA 2G1UA 4GX2A 5IN4A 4QFDA 4FFRA 3ZV5A 3VZRA 3ZWMA 4R1SA 2YHIB 1KVUA 1V8BA 3FI9A 2QW8A 4TSKA 5FFFA 3RC1A 5CEEA 3GPDG 1RM5A 2JD1A 3DONA 4RORA 5BNTA 2HQ1A 3RC7A 2FZWA 4KDFA 3S55A 3ANMA 2QIOA 1U3UA 1HKUA 4Y6RA 5ES3A 5I7VA 2UVDA 4J4HA 1OBFO 2WJPA 4RVHA 3QA9A 2NM0A 5KKAA 1F8FA 1XA0A 2VYNA 1K6IA 1QG6A 3DTTA 1ADGA 1T4DA 2BD0A 1YWGO 3STHA 5CFZA 4BQRA 1ZO8A 2JAPA 1HTBA 3FWZA 3DMTC 4PRLA 1K89A 3OJ0A 2A35A 5TC4A 4BO2A 4CODB 2EJVA 4B7UA 3U4IA 3ENNA 3GVIA 3EVTA 4R68A 2WYUA 4BGIA 2I3GA 4KQXA 3JV7A 3WGZA 2LDBA 3BTUA 3HDJA 3KYBA 3PQEA 4HWKA 3WGGA 4GI2A 5A9TA 5JDCC 2H5LA 1DFIA 1SOVA 2E49A 1HDXA 1W4ZA 2C54A 1UJMA 3QVOA 4NPCA 3N58A 2D3TA 4L4SA 3PGXA 3ZU4A 3AY7A 5JNLA 1NR7A 4MKZA 2GR9A 5JCJA 5HA5A 1VJTA 1GPJA 4WCFC 1IL0A 3D64A 5A3VA 3PFFA 5TJ9A 3PFWO 1V35A 1JKJA 1QV6A 2QRKA 5EJ2A 3GA0A 1C1DB 4Y67A 4Q3DA 3GVHA 1EZ4A 4D79A 5TGDA 4CJXA 3U62A 2IDZA 1U5CA 4B3JA 1SMKA 4BNHA 1E7QA 5TQVA 1H9BA 2X7HA 3PHLA 1U9JA 2G5CA 3PYMA 2YYYA 4MIYA 4MVJM 4TKLA 4Y6PA 4DQVA 1K6JA 3EY4A 3AFNA 3N7UA 4HNGA 5AYVA 4NR0A 3AW9A 5ILGA 4DPKA 3ZWAA 4IMRA 1I3MA 5CDTA 3T7EA 5KTKA 5BSEA 3C1OA 3IOYA 2TMDA 2Q2WA 1F8GA 3CZMA 3IKVA 1EVZA 5IZ4A 5LDHA 3WGTA 4CM4B 1XU9A 2O4CA 4IY1A 3H9JA 5DP1A 2VOJA 4IDGA 1CRWG 2NU7A 3LLSA 1WP4A 5JC8A 3MOIA 4R51A 4CMJA 1M67A 2DC1A 2NQTA 3RUIA 5F1KA 2HK7A 3NDRA 1GV0A 2G82A 3MEQA 2YV1A 1BWSA 2HMTA 1PTJA 4A2CA 2I6TA 1U7HA 1PZEA 2V65A 1ZK3A 4OSPA 3I6QA 1GYRA 3PI7A 5IXYA 4J6FA 4EYEA 4ZJUA 2X0NA 3JQ7B 4CMHA 3LVFO 4IQGA 4PLVA 4U0JA 3IUPA 3X2FA 2BRUA 3TZ6A 3DBLA 4CL8A 2YDXA 2VT3A 1XQ6A 3M1LA 2W90A 3S2GA 1U4OA 3ZV6A 4W82A 4WE3A 1P44A 1I2CA 4CM1A 5KJCA 4J7CA 3M2PA 3GN1A 3AUSA 1FF9A 3JQFA 4JXKA 1MG5A 2GN4A 1PJSA 5DCUA 5B12A 3GHHA 1HE4A 4R5HA 1GDHA 2F00A 3DZFA 1O5IA 4WEQA 5TT0A 4K9DA 2B5WA 2HAEA 2VQ3A 4YJGA 5IAAA 4BNVA 4TWRA 4XYGA 2D59A 2A94A 5H81A 4NH4A 1PZHA 2FP4A 2Y93A 3L9WA 4BNFA 2IEBA 4A73A 2E6UX 2IRWA 3D5QA 4OM8A 3VTZA 1J49A 2Q1SA 4UEOA 3ASUA 4GX1A 1ISJA 4MP3A 3H3JA 2EW2A 4EUEA 5IFLA 3LQFA 2ZYGA 2G17A 2DQ4A 5KJ1A 1X13A 2AQ8A 2IE0A 3PP8A 1BSVA 3VPFA 4PG8A 1SEVA 2W2LD 3HDQA 5DF1A 1ADFA 4UUNA 4S3MA 4IINA 3DXFA 4JROA 1I30A 4CM8A 1LSOA 4URFA 2Y1FA 3WGQA 2ZK7A 5JYEA 3QWIA 4XB1A 3SLKA 5G0VA 4QQRA 3A4VA 1U1IA 3HB4X 4Y8VA 4AJKA 4Z9XA 3Q3CA 3UN1A 2P91A 1GR0A 4J90A 1ZUD1 2IYOA 4OQYA 2HK9A 3H2ZA 4G5HA 5L7TA 2YJZA 4TQGA 4YQYA 3GNSA 2DBRA 1YOVA 4DMMA 5AQ1A 1GD1O 4R54A 3NYWA 1IPEA 1MXHA 3NAQA 3RUDA 3RFVA 1ZZEA 1XWFA 1RYEA 2H9IA 4J9VA 2AXQA 4NBWA 5ER6A 3WNQA 1DOHA 4JJFA 1Y8RA 5CG1A 3JQAA 5DCWA 5C37A 2EEZA 3WOHA 4X54A 2PTGA 3JQEA 5CDUA 2Y05A 5L40A 3ETDA 2X4GA 4UVEA 3ZU5A 2VYND 2Y0DA 4HXYA 3DBHA 1R15A 4IJVA 5LC1A 1EDZA 1NHWA 1LC0A 4D3FA 2EP7A 1XQ1A 4JCOA 3HFSA 3B20A 1YB4A 4M89A 2ZB7A 3F9IA 1GV1A 3ROMA 2C82A 4CM9A 2IZZA 1BG6A 3BZUA 2FPPA 3AM3A 4XJTA 1E6EA 3ST7A 1UXHA 2X1HA 4JNKA 5JYDA 1NYTA 1LDYA 3OQ6A 1KEWA 4QX6A 4DQXA 4CM6A 1PIWA 1P77A 1XDWA 4BO0A 2P2SA 1ADCA 1JW9B 3WMXA 3AI2A 4BO8A 2B4TO 1HDGO 1KC1A 2PZKA 1EVYA 3VZPA 4E2ZA 3SC4A 4A26A 4RF2A 5JCJD 1UP7A 5K6AC 4BKOA 2I5PO 1LEHA 4BNGA 4R3NA 1GL3A 4FIZA 1DFHA 4I5FA 4CQMD 1P1FA 2JKVA 4JBHA 1E7RA 4Z0PA 2VYVA 1U2DA 3QHAA 2FSVA 3SBOA 3G1TA 1EFLA 4FDAA 5JAMA 1MG0A 1X7HA 3IUSA 1O6ZA 4Q3AA 5DNAA 2Q99A 1MX3A 1XHLA 3BTSA 3RASA 3GVXA 1XG5A 1C3VA 4UUOA 5IDYA 3LK7A 2I3AA 2Q3EA 2WD7B 3AUAA 1NQTA 2GSDA 3WMWA 1I01A 4TRRA 5EPOA 1E5LA 1WZEA 3L6DA 4MVJP 3GHYA 3C24A 4DYDA 1GZ3A 3PXXA 5K0ZA 4IQ8A 4BNUA 1BVUA 5I8ZA 5I7EA 2PKRA 2O23A 5L4SA 2FPIA 4E5PA 4LCJA 1H94A 4KWHA 4R41A 4EDFA 1DJQA 1GEEA 1LC3A 1ZKMA 3OIFA 3VH1A 4UVGA 1I3KA 4L74A 3OQBA 3MZ0A 4Q3EA 4KMSA 5COQA 1B3RA 5ENVA 2JFHA 3WJ7A 1QKIA 1Y5RA 1E1KA 3L6OO 1HYGA 3PIDA 5EIOA 2NTNA 3Q2KA 4KUEA 5JDIC 1JVBA 3VDQA 3IJPA 4RQTA 1NAIA 2O2YA 2ZYAA 4WASA 3RCBA 5AOVA 1V3TA 3ORFA 3KTDA 1MV8A 1YVEI 4BVAA 2WWRA 4DXHA 3IIEA 1CWUA 4PLWA 3ZN2A 4AJHA 2IXBA 3GY0A 4EEZA 3TL2A 5C5IA 1ISGA 4BO6A 2DPHA 3DMTA 4JQCA 3UGKA 4LCEA 1PL7A 2P68A 4RVSA 3HNPA 4J0EA 1KS9A 4KWIA 3EZLA 3UAGA 4YXFA 1D1TA 2BHLA 3PWSA 2WEKA 2Q49A 2HK8A 4LRSB 1KETA 3WBFA 3F47A 1BDMA 2I76A 5TT1A 4CV0A 2DM6A 3BMCB 2Q46A 5JDCA 4PFJA 3GC6A 3I6IA 4G2NA 1ZFNA 2D0IA 1Z75A 2FR0A 3WYBA 4D44A 3TN7A 3A1NA 1PR3A 2QQ5A 4ND5A 4BNLA 5KOIA 1XKQA 2HMUA 4PZEA 4PG7A 1N92A 4WCFA 5FWNA 4L8VA 1MA0A 2OZPA 1SB8A 2HJRA 1ZK0A 3JD3A 1VI2A 2AQHA 5L4LA 4LMRA 4U6QA 3EVNA 3KLMX 4YDRA 3U5TA 2J8ZA 4ZICA 2P9GA 1MFZA 4E0BA 1T1RA 2C07A 2PKQO 5HM8A 2VWHA 3VPXA 3B6ZA 3WQQA 4ALJA 4XRGA 4EZBA 5COBA 3S1LA 4CR7A 5TS3A 3NDIA 4MO2A 4MP6A 3KXDA 2JCVA 3CEAA 4J16A 3DAFA 1KY5A 3UHAA 1XU7A 1NAHA 3MTJA 3CE6A 1YJ8A 4TVOA 1LDGA 4B4OA 1N5DA 3QIVA 4K6FA 3RKRA 3O8QB 3VKVA 1U28A 1E3SA 4E5NA 1HT0A 9LDBA 2X0JA 3ZW9A 2OO5A 2X22A 3MCVA 4P4LA 1XYGA 4G65A 4QTZA 4I5EA 3BTVA 4WECA 3WICA 4BGVA 1V6AA 4BMSA 3E6AA 1YBVA 2NU9A 3LT1A 1U3VA 3NTRA 3CPSA 2VT2A 2XOXA 2BKAA 2UYYA 3DWFA 3ICPA 2X8LA 4CM9D 2AW5A 4WLVA 4Z0HO 4NJMB 1HLPA 3JD4A 2HLPA 3FR8A 4IDFA 2O3SA 2YW9A 2V6FA 1JKFA 1NX6A 3ZCXA 1NFFA 4BUCA 4PIVA 5JY6A 3UKOA 2OBNA 5ILOA 3QY9A 5GZ6A 3DHEA 5I9NA 5IF3A 3RUEA 3SC6A 3NT2A 5HWSA 3KZVA 3M1AA 5AXBA 3GEGA 4R9RA 1DXYA 1Q0HA 3NDJA 1KEUA 3CSDA 3H4VA 1H5QA 1NHGA 2Q50A 1DHTA 3FR7A 1HE2A 4LMPA 1PX0A 4RF5A 1A7KA 3W8DA 1SBYA 3DZGA 3GZNA 4L4XA 4R9SA 3WGHA 2NQ8A 3NT4A 5IJZA 2GUGA 5JFOA 1MC4A 3FWNA 3WBBA 3OECA 3E48A 4KDEA 5EL0A 4PLTA 2BF7A 4ND2A 4XR4A 1F17A 2QG4A 1N9GA 3C8MA 3P7MA 4Q3NA 4NBRA 4EGFA 1BTOA 2DU8A 2Z1NA 1SPXA 5A9SA 3VZSA 2RH8A 3RBZA 5U9CA 5C7LO 1T2CA 4FFOA 1OOEA 4D46A 1IZ9A 4YAKA 4EJ6A 2HO5A 1NPYA 2H1SA 2RCYA 4ZN6A 2PR2A 4R16A 1ISIA 2EF1A 1T4BA 2PFGA 4IM7A 4PLCA 1WWKA 4ALMA 3D1LA 1W73A 5CG2A 4JK3A 3W4IA 3ITKA 3WSWA 4BO1A 1E3WA 4C4OA 3PDUA 5L9AA 2XAAA 5BSFA 4N5NA 4OQZA 1ML3A 4Z6KA 3SJ7A 3DFUA 4J2OA 4F6CA 3E03A 3UCFA 1VL8A 1HDRA 4U6SA 3AM5A 5JY1A 5KVCA 4I9NA 1GQYA 5DN9A 3V8BA 4YJHA 3GQVA 2J5QA 3G0OA 3K92A 3WWZA 1LLDA 4WOKA 1X15A 4ZA2A 1PS8A 4XQ9A 3S8MA 4MPDA 3MOGA 4OL9A 1C14A 4AJLA 3UXYA 2CNBA 5ER9A 1H6DA 2H6EA 3I83A 1PS9A 3F1KA 1FJHA 1HDOA 4LRTB 3DHYA 2W2KA 3IS3A 1I2BA 3ZU2A 3OM9A 4RVDA 1Y7TA 2CF6A 1UZMA 2JFFA 2X6TA 1B0AA 1K2WA 3QWAA 4EBFA 3JQ9A 3FHLA 3E5MA 1H9AA 2ZIZA 4QECA 2VRBA 1F14A 2G76A 1RM3A 3F3SA 4RZHA 1JN0A 1PQUA 2IZ0A 4YAIA 4AJJA 2EJWA 3ZI0A 1I32A 2B37A 1JKIA 3HDHA 1SAYA 1GFSA 4U8GA 2IYPA 2Y1EA 2FWMX 4XIYA 1KVRA 2WD8A 3JQ8B 1D3AA 2X5JO 2JFGA 4IIVA 3I4FA 3DFZA 4YAGA 2J5RA 2E82A 3AFMA 4AJOA 3E82A 3DOJA 3GT0A 5F1PA 1VJ1A 1E7YA 1Z7BA 2C0CA 4YT2A 1TB4A 1LA2A 3OSUA 4NHEA 2B36A 4YT4A 5K6AA 1M6WA 3A9WA 3G3EA 4ROSA 3HADA 1N7GA 2PLAA 2W2LA 2WMDA 4CR6A 1ZH8A 2W4QA 4CUJA 4PLYA 3BA1A 1MXFA 4KOAA 4PG5A 4TKMA 2GDZA 1EE9A 4BHTA 4BNXA 2Q1TA 3NRCA 1FK8A 3OEYA 4YA6A 4YVFA 2ZQZA 3M2TA 2Q2QA 3QWHA 4J3FA 2FPGA 3B1JA 3TZQA 1A9YA 3IJRA 1XGKA 3BMQA 3C7CB 1PJTA 2ZCUA 2VZ8A 1GUZA 1GCOA 1HDYA 1YE3A 4IDEA 3EC7A 2EKQA 3VOSA 3Q2IA 2ZTMA 4FC6A 4UAGA 3WDSA 3DC2A 3INRA 4RDHA 5BT9A 5B4TA 4YACA 1P74A 2O3QA 1YQDA 3H6KA 3ZDFA 1D1SA 4CPDA 4IUYA 1I3LA 4GVLA 1E3JA 2CF5A 2O7SA 1NVGA 3KSUA 3MJEA 1LJ8A 4E21A 4DIBA 2GN9A 1Y8QA 4ZQGA 2ZJ0A 1HWYA 3NT5A 3RROA 1M76A 2V7PA 4DPMA 3CIFA 4DWVA 4F46A 4DL9A 3QV1A 4QFCA 1QRRA 4FD3A 2GLXA 1YXMA 2CUKA 2Q4EA 4ILKA 3KM0A 4E5MA 3RIHA 1GPDG 5JDIA 1HEUA 3H9GA 4R69A 3ZGYA 1UXJA 4HKTA 5EQDA 3ZHYA 4AJ2A 2GN6A 5TIIA 1WAMA 2EXXA 3JQBC 2O2SA 2XF8A 1I24A 3D5TA 5F21A 3JSAA 3LC7O 4W6ZA 4E13A 4XX0A 3W4JA 4CMEA 1DPGA 2C7VA 5IZCC 5KVSA 2PY6A 1RWBA 2CVZA 1UR5A 3TF5A 3WTCA 2AE2A 1ZK1A 3IMFA 5B4UA 1HF3A 5IDXA 4E5YA 4K28A 1P33A 2HMSA 3ZW8A 1ISFA 1GYQA 2OGUA 1HLDA 2VUUA 3GOHA 2X9VA 1TXGA 2ZTUA 1X7DA 3FD8A 2BFOA 3RD5A 3QJ5A 4WLOA 1H2HA 1CF2O 1PZGA 3DAPA 2FR8A 1PL8A 4CQMA 3AI3A 4UEJA 4ND3A 5JLAA 1OC2A 1R0LA 4WNCA 5A1TA 4BNMA 4YTEA 2C20A 3NTOA 3ZWNA 4XGKA 2CZCA 5AXAA 1BHSA 5HBRA 1O95A 1VC2A 2JCYA 4OHUA 4P8RA 3WJAA 3MJTA 4OAQA 1JU9A 2AEMA 4EITA 3FNFA 3ZNOA 1LTHR 3PZBA 4PG4A 1T2EA 5IN5A 4RPLA 3T4EA 1EK6A 1E1LA 3E8XA 1ULSA 4GSKA 2BI8A 4XQEA 4BOYA 4N5MA 2XXBA 1PGPA 5T5QA 3LZ6A 4RVGA 4YT8A 2WM3A 3ONEA 1QLJA 3PPIA 3KV3O 3F6YA 2V6MA 2PK3A 4A03A 5K9ZA 3C3XA 3KO8A 4RL6A 4MIEA 3VTFA 4D0RA 2B4RO 3LT0A 3QLJA 1ZMTA 3E9NA 2NVBA 1L1FA 3GUCA 4MJLA 2PZMA 4AJIA 1SZJG 4QXMA 3ASVA 3L9XA 2D1YA 4R1TA 1HYEA 2AHRA 4PG6A 5C7OO 5TNXA 2UV8A 5I8WA 3AOEC 1DC5A 1PJLA 2O7QA 4YYZA 3DOOA 3GAZA 4PLFA 4XKJA 3C85A 1UAYA 1R4NA 3PHHA 4N5LA 4UVIA 1BRMA 3GFGA 2BLLA 1A72A 3F5QA 3F1LA 4J4BA 4L0QA 4JX8A 3DBLB 3JD2A 3RI3A 1B2LA 1LDMA 3CH6A 2WE7A 3LDHA 5JPIA 3RVDA 4M54A 4B79A 3FBGA 4Z9YA 2DVMA 2GZ1A 1W0CA 4DC1A 5JBIA 5G0WA 3JD1A 4BV8A 3M6IA 3FTNA 4CMIA 1FDTA 1R4MA 5CHEA 3HFGA 5TLSA 5EN4A 5G0UA 1ENPA 2DTXA 2YQ4A 3G17A 3L4BC 4Y98A 4KZPA 5U4QA 4YJGB 3RC2A 3OA2A 2AQIA 4R01A 3HB5X 2Y68A 4ZU3A 4B3HA 1VKOA 4RLHA 3R1IA 4M8SA 3I23A 2R00C 4H7PA 1NXQA 2D5AA 2RH4A 3IDSA 3WFJA 1DBVO 3TNLA 4DIOA 2PD3A 3IC5A 4BQPA 3Q9UA 4E32A 2GN8A 1AXGA 3LYLA 2YZ7A 5ITVA 2I99A 3D3EA 4G81A 4E3ZA 1DC4A 3K73O 1NASA 2OHXA 2Y1DA 2IEDA 1ENZA 3CZRA 5G4KA 1CERA 1NR1A 6LDHA 4CLEA 4FJ2A 1UXKA 3PYXA 4GGOA 4BV9A 4DPLA 5GMOA 3BMOA 4MVJG 4MKXA 2H63A 3PQFA 1VLLA 4CM8B 5B4VA 1ISMA 1T1SA 4LGVA 5THQA 6ADHA 2OUIA 2QHXA 1YDWA 5FEUA 1H6CA 1IOLA 1ZVMA 2EGHA 3L6EA 3O03A 3Q0EA 3I9MA 3JQGA 5TF4A 3JCZA 2D2IA 4J2HA 5BNFA 3H65A 3I5MA 5HS6A 2EKPA 4IXTA 3UVEA 1DO8A 3K9QO 1PSDA 2DPGA 3HJAA 1O0SA 4Q39A 1ZK4A 1YOVB 4HFJA 2PGLA 3AJRA 5H83A 1Q7GA 2PGJA 3INTA 1BXGA 1U5AA 4WKGA 5EERA 1T2AA 4I9UA 4MINA 1DLJA 4J49A 3DBRA 4AFNA 1P1KA 1Y8RB 3IQDB 1PJ2A 4OYRA 3JQAB 4CM5A 3JYNA 3A28A 3BMNA 3NTQA 4NZ9A 5JO9A 4KTVE 1N1GA 1BVRA 4RJTA 4I9HA 1KOLA 2NSDA 1IUKA 3DBHB 4PLZA 4RQUA 3U49A 3FPLA 5FF9A 1P1RA 4FB5A 2X0IA 4TROA 1Z6ZA 2A4KA 5L7YA 1SC6A 4NG5A 1LSJA 3JQ6A 4I8XA 3EGOA 1A5ZA 3QE3A 4BNZA 4RGBA 2PD6A 4R4JA 1O9BA 3CMMA 2NWQA 4A10A 3EDMA 2I66A 4DYVA 1GUYA 2EV9A 3H5AA 4OKIA 1R6DA 1UDCA 1CEQA 3OJOA 1Z82A 3ITDA 1DIGA 4J0FA 4CV2A 4YJFA 1HZJA 4E2WA 3ZWXA 3WXBA 2D4AA 1UP6A 5KCZA 2PD4A 4LW8A 1YBMA 4I5DA 3Q11A 4QT0A 1SB9A 1D4FA 1N1EA 1LX6A 1ADBA 3D3WA 1U3WA 1S6YA 4GQAA 2AMFA 4CLRA 1T25A 3KYDA 3QRWA 1Z74A 4O0LA 1SNYA 4DVJA 4GKBA 2BFMA 1HETA 1F06A 2VHZA 3ANNA 4MKRA 4IJWA 8ADHA 3PJFA 4W9NC 4GMFA 3O38A 2C5EA 1B26A 2DTDA 4AL4A 4F6LA 1LLUA 3KLPX 5HS4A 3EK2A 2Q1UA 4PLHA 4BS9A 4DUPA 3AY3A 1XR3A 3AUTA 3C1TA 3PHIA 5L51A 1KC3A 3D0OA 3PLNA 5ENDA 1CDOA 1T24A 1HE3A 2C2XA 3UCXA 4WCDA 1YJQA 2EP5A 1ZMOA 3I1JA 3I9NA 3LU1A 2Y1GA 5EESA 2BFAA 4OXNA 4PGFA 4MVJH 3UW3A 4IDDA 1P0FA 4Q3CA 3OETA 3CTMA 1GU7A 3DZHA 5KWEA 4F45A 4J4TA 2GO1A 3RFXA 4BGEA 2HSDA 3BHMA 1JQBA 5JO0A 1I3NA 2X5KO 4HFNA 4OKNA 4IXWA 2FHSA 1VKNA 3ADOA 2CFCA 3R6DA 2Z5LA 1OAAA 2V6BA 1LDEA 3D4OA 4BNTA 3BHJA 1DIRA 1ZJYA 2O50A 1NTOA 5F1OA 2VN8A 1U2GA 4CV1A 4O63O 3ONFA 5LCXA 1R37A 4ZGWA 3KETA 2BMAA 5JCXA 2AG5A 4Z3DA 4BNIA 1E5QA 2P5UA 2W8ZA 1R0KA 4PVDA 5L3ZA 2PNFA 5J23A 4CM7A 4FGWA 2OBYA 4BB6A 2B35A 3VZQA 3WSVA 4HADA 3GG2A 3LC1O 3JYQA 3H3FA 1RYDA 1Y81A 4ND1A 1PZFA 4EJ0A 1EFKA 3C7AA 4IDBA 1WMAA 1DIAA 3D4PA 2I67A 3L77A 3C7DB 5T8KC 1YL7A 4D42A 2WYWA 4MOWA 3JQBA 3L4SO 1U3TA 4W4TA 2Q4BA 1KEVA 1YBAA 4FS3A 4CM3A 3ETEA 1JA9A 1UAGA 3COSA 3OFSA 3V2GA 4IDAA 5A03A 3OA0A 2VZ0A 5T6BA 5IZCA 5L4NA 1P3DA 2NV6A 3CUKA 2HMWA 2F1KA 1N8KA 4TRJA 1WPQA 1DC6A 1TLTA 3Q9NA 1CQJA 1DAPA 1C0IA 2CDAA 1EBUA 1BW9A 2XPCA 4WLUA 4XZ3A 5CPBA 4YAEA 1YL5A 3WGIA 1FMCA 1IHXA 1V0JA 4DBVO 1PJ3A 4DGSA 2VTDA 4EUFA 1NQOA 4XCVA 2DUWA 4FFNA 1G1AA 3ANLA 3W1VA 4FOSA 4C7JA 2JL1A 5CDYA 3EUWA 4U5QA 2YQ5A 3PEFA 3DO5A 3TZCA 3H8VA 1PJQA 3KOUA 4UVDA 3RUHA 4CQLA 4WCFB 1YO6A 3MTGA 3ZNPA 4DREA 4DLLA 3UUWA 2P4HX 1LRLA 3NV9A 5B1YA 1X1EA 1LI4A 4U7WA 4QEDA 1ORRA 3UOGA 4ZHSA 1H93A 5KJEA 5F5LA 3BAZA 3SVTA 4TRNA 3HE3A 2B4QA 4GAEA 4FFPA 3I9JA 3ADPA 3PGJA 4RPGA 1E3IA 5ICMA 1Y1PA 1ZEJA 1EUDA 3DQPA 3AI1A 3ZWPA 2RBEA 5L95A 3EAGA 5JC1A 3DR3A 3GG9A 2VTEA 4IMPA 3LSYA 1NP3A 1L7DA 4D3DA 1DRWA 4KUGA 3QW2A 1LRJA 1ZJZA 3PWZA 1JWAB 3FPCA 1P0CA 1NFRA 4WPGA 7ADHA 1M6HA 1I0ZA 2OFPA 2SCUA 5TRTA 1TVEA 3R0IA 2QYTA 2CD9A 3MWDB 4F3YA 2VWQA 4K26A 4HNHA 3KHUA 4XIJA 4P4GA 2V6GA 3AOEA 5DBFA 3E9MA 2OXIA 3QVWA 5C7IO 3KVOA 1QYCA 3MJ4A 3HQ4O 5FYDA 4B7XA 5DDIP 4JGBA 4FQ8A 4HV4A 1EVIA 1OMOA 2A9FA 3OICA 2UUPA 1FDVA 3PRJA 4R1NA 3B1FA 5JAIA 4FC7A 1IPFA 4DLBA 3GPIA 4E30A 1C0KA 3AM4A 5COAA 4AJNA 2X23A 1O89A 1VL6A 3OF2A 5F5NA 5GZ3A 1NPTO 3JQFC 2NVUA 1HE5A 4BKQA 5HTOA 4WGGA 1X7GA 3V1YA 1XSEA 4J7XA 3WYEA 4ALNA 1LDBA 3QVTA 5L7WA 1NBOA 2VNSA 1HDZA 3FN4A 1WMBA 3L07A 5EINA 3GMDA 1NNUA 2JCXA 1KIFA 2GYYA 4HY3A 2DFVA 3GDFA 3L4BA 1ENYA 1HDCA 3E18A 1LLCA 1WW8A 4FJ0A 4OXKA 1ULUA 1B3BA 2ILTA 3PJDA 4QO7A 4YPOA 2PGDA 3WLFA 1H6AA 1RM0A 3GZNB 2R00A 2B69A 2CDCA 3QVXA 1GZ6A 3ICCA 4LVUA 1X1TA 2BGKA 4NFYA 4OSOA 4OXYA 1NFQA 3QWBA 4CUKA 4YAJA 3P2OA 1FDSA 3GVCA 2VHVA 2BELA 2X5OA 1G6KA 1N9GB 2C59A 4JBGA 1GCUA 4MVJA 1C0LA 1N7HA 3TDKA 5A9SB 2FZEA 4II2A 4I1IA 1MUUA 3WTBA 4XYBA 3INGA 5A05A 3LT2A 1V9LA 4XB2A 4PN3A 1D7OA 1H0KA 1SEPA 4NK5A 1YH3A 3VPGA 3TPCA 2DLDA 2OL4A 4I5GA 4MIOA 4AVYA 4KUHA 4J1TA 4Q9NA 4C7KA 3F4LA 1E3WB 4JP2A 3GAFA 3RSHA 4WK6A 4OOFA 4GKVA 3TQHA 2GD1O 2GZ3A 4Z3KA 4NBTA 4NJOA 4NIMA 2O48X 1A7AA 1QR6A 3EHEA 1DLIA 2GCGA 1AE1A 3G79A 3MJCA 4BO3A 2YV3A 5A5EA 4CLOA 1MC5A 4YJHB 4WOJA 2CDBA 2VRCD 4N18A 2RIRA 1U8XX 2IODA 1UZLA 4MDHA 2XXJA 1PJBA 1P1JA 1Q0LA 5BNIA 4RLSA 2HKIA 1C1XA 3K6JA 3K96A 4D41A 3A06A 3ZWBA 3UICA 4A5OA 5I7SA 2W2KB 4J1QA 1RM4A 4RDIA 4TMFA 4ID9A 4RZIA 1YRLA 1ZCJA 2EKLA 2HRZA 2Z95A 3QP9A 3OMLA 2JAHA 4GLLA 3ZHBA 3GDGA 3I52A 1WZIA 3ON5A 4DA9A 2CVOA 4YQZA 1QYXA 2JD0A 4BKPA 1YS4A 3I9OA 4ITUA 2DTEA 1J6UA 1LBEA 1ZXLA 3F4BA 1P31A 1K3TA 3OHSX 2EGGA 1RJWA 2NADA 4PLPA 1GAEO 5AXCA 4CLDA 4MVJI 4IDCA 1BDBA 2EIHA 3CINA 5B37A 3FCOA 4FR5A 5THKA 2EWMA 2NACA 3H7AA 4K1LA 4IPTA 3AU9A 3NEPX 1DAOA 1LSSA 3ZH2A 2Y1OA 1OC4A 1AXEA 3KYCA 4B3IA 4NU5A 1I36A 5KIAA 3ZWVA 2EERA 4NU6A 1X0VA 4E33A 4YRAA 2RAFA 1JLLA 3RU9A 5JAZA 1E6WA 2FN7A 3D7LA 4W9NA 5DOVA 1ARZA 3EW7A 2Y99A 3HDYA 1IE3A 2A92A 3D4NA 3S2EA 2X9NA 2ZKLA 5EMHA 1EK5A 3FTPA 4L75A 2O3RA 2NU8A 1R12A 3VDRA 5DULA 3HUDA 3VPHA 1B16A 1DHRA 1XIVA 1K0UA 5A9RA 1DIBA 2CVQA 2B83A 3BMQB 4UUPA 3KSZO 1I2ZA 5G2OA 3SLGA 3EZYA 2PH5A 4CMKA 2CY0A 4DLAA 5JW6A 3N74A 3I9KA 3NKLA 5ICSA 4B7CA 2YUTA 1TT7A 4ALIA 4IGEA 1QLHA 1T26A 1ZBQA 2J3JA 1LDNA 2YHIA 3O9ZA 5F3RA 3T7CA 4FW8A 3WFIA 3U09A 1E1MA 2BH9A 3AWDA 1ZW1A 2ZTVA 5TJHA 2P9CA 5C3MA 4K6CA 4UVHA 1I33A 1YB1A 4XRRA 3ENKA 1Y8QB 2WYVA 4HFMA 3VVCA 4UREA 1N2SA 2NNLD 2RHRA 1NVMB 5H82A 3OIDA 2FY8A 3RFTA 1H6BA 2WE8A 4IZIA 1G0NA 1P45A 3W6ZA 3R3JA 2QX7A 1E7SA 5A3JA 3HG7A 3C1AA 4LSWA 5JS6A 4CLXA 3VHRA 4DC0A 2QYSA 1PGOA 4AICA 1M66A 2C7GA 2ET6A 1B8PA 2PWZA 2O4UX 2DFDA 4IZHA 1U4SA 2CMDA 5T8KA 3WR5A 3WWYA 4BO7A 2OP1A 1DB3A 2P5YA 4AJPA 4GL4A 4DIFA 2G0TA 2AE1A 3GUYA 2PH3A 2GGSA 1EQ2A 4FFLA 3X2EA 4M1QA 1HRDA 4BNJA 1EUCA 4OIMA 4R3WA 2Q2VA 4FSHA 4IGFA 5CAEA 3RJ9A 2FRDA 4BNYA 2OOSA 1QSGA 2I65A 5JMPA 3DB2A 2CSUA 3FNEA 1LQTA 4ZQEA 1UP4A 1XEAA 1SOWA 4CQMB 4A0SA 4ZQHA 2QRLA 3B1KA 4JJIA 2J5KA 2B5VA 3DZJA 3JYOA 3FNHA 4MVJD 2E48A 1GUFA 3U4DA 3LT4A 1XLTA 1WLYA 3ZHXA 1C1DA 1IB6A 1U7TA 4XYLA 5BQFA 1PGNA 1O8CA 2HRBA 3IKTA 3DTYA 3DMYA 3K5PA 4WEOA 1E92A 4CL3A 1DIHA 2HUNA 4N54A 3T4XA 3KEQA 4RPJA 3P5SA 4P38A 3H9EO 3ZV4A 1UZNA 3K2EA 1AHIA 3WG9A 3KEOA 2UDPA 4XD2A 1PS0A 2WSBA 4DMLA 3LF2A 4CM4A 4XEHA 2C2YA 2R2GA 3E9QA 4GH5A 1A27A 1LSUA 3DEYX 1NVTA 4W7IA 4YCAA 3HHPA 1ZIDA 1ZEMA 4D43A 1JAYA 1F12A 3VVBA 1GYPA 1PL6A 2BGMA 3DZIA 4LSMA 3UF0A 3UCEA 3RWBA 3BTOA 4WUVA 1R16A 2OP0A 4BO9A 4JBIA 2EW8A 2NU6A 4FPXA 4WLEA 4ZQBA 3VAZA 3QVSA 1OFGA 1X0XA 4IQ0A 5KVVA 3DBVO 2HDHA 2ZJ1A 2R6JA 3JQ7A 3PTZA 1A9ZA 4JP3A 1R4NB 4BO4A 1YDEA 1P1HA 1EVJA 5DBIA 4ZVVA 4FOOA 4Y6SA 3GRKA 1J4AA 3H9UA 1KBZA 4P4NA 2PKQP 1O94A 4GWGA 1OZAA 2J3HA 4CLHA 5TX7A 4J91A 4W99A 3DL2A 4BIIA 4EJMA 4CMCA 4YB8A 1B8UA 2FR1A 1Q7BA 2DUUA 3Q1LA 1QP8A 2UAGA 4DBZA 5BSHA 1YQGA 3OJLA 5KJFA 4KTTE 1W8DA 5TSDA 4CMIB 4FN4A 1R4MB 2P4QA 4Y9DA 3Q6IA 1PQWA 5CDGA 1U8FO 2NVWA 5JXWA 2VCYA 1PJ4A 4O1MA 1T2FA 3TL3A 4E2XA 5JSFA 1HSOA 4XYMA 2QZZA 1Q1NA 2O3UA 3U9LA 2DBZA 3U0BA 1JVSA 3IP1A 2BGLA 3KSDO 3WX0A 1M2WA 1X14A 2YDYA 4A27A 3SXPA 4DQUA 1Z45A 1UXIA 3W6UA 4B8WA 4H3VA 4AJ1A 3WYCA 1VM6A 4B4UA 4GMGA 4IJKA 5G4KB 1PWXA 2NTJA 3LF1A 2X9GA 5KJ6A 3WGYA 4MVJF 5G0SA 3BMOB 3HN2A 1I5RA 1WXDA 3AY6A 3RUAA 3JTMA 4HFRA 4PZCA 1MB4A 5I7FA 3K30A 3U4CA 4D3SA 5EQFA 3OP4A 2GZ2A 1KVQA 1QMGA 3AOGA 5KKCA 3JQGB 5A06A 3I4CA 4J7UA 4BO5A 3WS7A 4NQZA 4FGSA 5MGBA 4OH1A 2PZJA 1KY4A 4XQGA 1QYVA 4OMUA 1GTMA 3A14A 3DDNA 4II3A 1NWHA 2Z1MA 1Q2XA 3OH8A 4AJ4A 4YWJA 1BXGB 1VE9A 3ONDA 4ND4A 3H9QA 1M75A 3DBRB 4OJNA 4YJDA 4OOEA 1BGVA 4TRMA 1B8VA 4N7RA 1EMDA 2DT5A 3BMNB 4FBGA 5AVOA 1MFPA 3GK3A 4PCVA 4BMNA 4ESOA 4XJSA 1GY8A 1JTVA 1WNTA 3S2FA 1EBFA 5KNLA 4TZTA 3GN2A 1YQXA 2HCTA 3MJSA 4WLNA 1UDBA 3PZRA 3JQ9C 1NQ5A 4WNIA 2Y1CA 1HZZA 2OMEA 4M49A 1I10A 1E7MA 2IXAA 2BFPA 2BI7A 4NK4A 3ZWCA 3PK0A 4J43A 1GEGA 1GQ2A 4HX5A 3GR6A 4ONEA 3ULKA 4RF4A 1UDAA 4O5OA 4H15A 5AXDA 3V5NA 4RCVA 3PHJA 3V2HA 2QZ9A 4YJFB 1Z7EA 2ZB3A 3S2IA 1CIVA 1JWBB 3FF4A 5T64A 2YFQA 1UUFA 1ONPA 1PGQA 4E4YA 4L4RA 3OBBA 3OEWA 2O3JA 3D3WB 4RPKA 4DTIA 3L0DA 4HP8A 4BKUA 3IL2A 4CLRB 4NI5A 5GY7A 3KYDB 4UULA 5FI3A 5K1SA 4GSLA 5DP2A 3NJ4A 5IDQA 4AJEA 2J6IA 3H2SA 3GMSA 4YBZA 4BNNA 1E3LA 1LUAA 1P9LA 1MP0A 3VC7A 1JAXA 5JAQA 4E31A 3PJEA 2NTVA 3NUGA 4PRKA 4WLFA 3V1UA 2WD7A 3ZWYA 1DFGA 2AEJA 4RF3A 1B15A 3NGLA 3E5RA 4BB5A 1KVTA 3H5RA 3MWEB 3ZZNA 1QORA 2GERA 1ONNA 4JIGA 4LK3A 2GPTA 1VPDA 3EMKA 1ENOA 3GFBA 2P9EA 1ZSNA 2Q1WA 1LXCA 3K2BA 4HBGA 3ZU3A 8LDHA 2YFHA 1Z73A 3TFQA 3HZZA 3AUUA 3W4KA 1F0YA 1NM5A 1AN9A 3PDJA 4LN1A 3AK4A 5IG2A 1TEHA 3WLEA 4E2YA 3ETGA 5GZ1A 4ZRMA 2VRCA 2Y66A 1YL6A 3OQ1A 3WIDA 3ABIA 2GASA 1CYDA 1ZK2A 3VH3A 4L9RA 2NUAA 4MP8A 2VUSA 1ISHA 3VH4A 3MJVA 3GDOA 4NBVA 3RU7A 2DKNA 4AG3A 5L53A 5HRUA 2ZYDA 4Z0TA 5ADHA 1WVGA 1BMDA 1L7EA 2C5AA 3GH3A 5G4LA 1I8TA 1PU2A 3PWKA 4O6VA 1IZ0A 4CMEC 2VHWA 1KERA 3ZV3A 1HSZA 3BYZA 1CJCA 4EI2A 1GQQA 3WIEA 3GLQA 3NGXA 2W98A 2WTBA 5A5FA 1IHYA 1JDJA 4OGWA 2DBQA 1VRWA 1QV7A 4YR9A 3BMCA 4W7HA 1QYDA 3QSGA 3RUFA 3TSCA 4CMBA 4NFHA 1DDOA 3DHNA 3WB9A 1B14A 2FOIA 4JJGA 1BW9B 1MGOA 3RC9A 2VUTA 3DAGA 3HSKA 4BNKA 4M86A 5IXSA 4H16A 1IULA 3VH2A 2ZTLA 2YHUA 3WQSB 2LDXA 3DOCA 3GZ4A 1E7WA 5BSGA 4RVFA 2TMGA 2X58A 4LVCA 3GEDA 4CQLB 1HXHA 4BGUA 2E37A 1WDLA 3QQPA 1S7CA 1UH5A 4L76A 4NMHA 4R1UA 5CP8A 5DZSA 3F46A 1DRUA 1D8AA 1XELA 3RQSA 2JD2A 3TFOA 5A02A 1J0XO 3PLRA 3P19A 3PQDA 1PR9A 1HL3A 4CUZA 5DOZA 5I9LA 3GRPA 1ZNQO 4XR9A 4GLOA 3OIGA 4DRYA 1VSUA 4XWYA 3W8FA 1DC3A 3JYLA 1PJCA 3RAJA 4J1SA 5A4DA 2HJSA 1TA4A 3WGOA 2X0RA 5CPFA 3F5SA 1NWCA 5BR7A 1V3UA 4ZRNA 4KQWA 3O8QA 2ZQYA 1AGNA 2OORA 1NQAO 4D45A 4XGNA 4UUMA 1SCUA 4EEXA 4MVJE 4YEDA 1PWZA 2FMUA 3JQAD 3O26A 1VL0A 3PHGA 4IBOA 1LRKA 4TZKA 5LDGA 1E0DA 3B70A 1DEHA 1E3EA 3TOZA 5G0TA 2Y0EA 4KP7A 5CEFA 1T2DA 4GX5A 1YONA 9LDTA 4BNWA 2J3KA 3RJ5A 1SO8A 2O3TA 4NJMA 3TRIA 2VWPA 1RPNA 2YY7A 1DSSG 1Y9AA 2PA3A 3OJEA 4RO0A 2AQKA 3KBOA 2ZB4A 1GADO 1ZSVA 3G49A 4ZD6A 4B4WA 3RKUA 4E5KA 4PVCA 1ONOA 2NVUB 1LLQA 2AG8A 4P22A 1NPDA 4JN6B 5I9MA 1VJ0A 4IIUA 4RPHA 3TJRA 3BHIA 2QRJA 4ZQFA 3TZKA 4GWKA 1WDKA 3KB6A 4NFSA 4O59O 3ZWWA 5L45A 4RV9A 1K5HA 1VSVA 4WJZA 5DT9A 2IZ1A 1Q0QA 5T67A 1R66A 2WDZA 2B0JA 3K31A 4GGPA 4GX0A 2JHGA 1GZ4A 2JJYA 5FI5A 3W8EA 1MLDA 3OJFA 4M87A 1TT5A 2VYVD 3GGGA 5U1PA 3CXRA 4QUKA 1QYWA 1YKFA 4GBJA 4L73A 1QXSA 3HN7A 3DZKA 1H2BA 3GGOA 3ZHZA 2POQX 3LC2O 3ROKA 3H5NA 3GEMA 1Y6JA 2JHFA 2I9PA 1TT5B 1CETA 2FSSA 3GF4A 1KYQA 4PZDA 5DBGA 4S1VA 4Q3BA 4B8ZA 1E1NA 1LNQA 3SJUA 3FBTA 3TWOA 1EDOA 2AA3A 3I9LA 3CMCO 3GGPA 4FJ1A 1FDWA 2HMVA 4IJUA 4E6PA 1LU9A 5DCYA 3JYPA 4ALKA 4IS2A 4J9UE 4M55A 2EHDA 3LLVA 3QWFA 4XGIA 1DRVA 1YGYA 2EG9A 1G0OA 2VWGA 4BMVA 4Z9FA 1DJNA 4D7AA 1EUZA 3RBXA 3RBVA 4GVXA 4D0SA 3KRTA 4NBUA 5ITWA 3PIIA 1Y9EA 3ZWOA 2VHXA 4A7PA 1FXSA 4QO8A 4CLOB 4J1NA 4EUHA 1RKXA 3FRJA 4PLGA 4LISA 1PEDA 3WNVA 3I3OA
chains in the Genus database with same CATH superfamily
3Q3JB 1LQUA 4KXQA 5H5JA 2C8JA 5CX1A 2X13A 5FADA 2BCEA 3MMZA 4L8FA 3GVPA 1WULS 4PQFA 4YT5A 3W5IA 3PX2A 3VVMA 5F7OA 3U7QB 1VBNA 4XFJA 3AXSA 1FOEB 1SK8A 2JFYA 3ZNQA 1SM4A 3R3SA 1F4PA 5AM2A 2OXRA 2YL2A 1OZ0A 1PJZA 2IQ5A 3FNGA 2MSCB 1LI7A 1HC7A 1B7GO 2B61A 3TSZA 4RELA 4XA8A 2DT8A 2W0MA 3O8OB 2ZWIA 3NHKA 1MB3A 2C4VA 5ALDA 1WY7A 1P6XA 5F4ZA 3TOXA 3E1KA 3OT1B 4JLWA 4FCTA 4QDJA 3IP3A 2YV2A 1ZXBA 2BP7A 4IIJB 2B21A 2D5CA 3PUJA 4FFMA 3VO2A 2ZIGA 1NBEA 3HB1A 4CKEA 2XKBA 5KDDA 1WCV1 2B2CA 3RIEA 2AVNA 2QTLA 5CEJA 5J9FA 4MWDA 1SC9A 4OQMA 4D4MA 4ZJPA 1DXQA 3KG2A 2JLAA 1RLTA 5D1HA 3ZNNA 4X1YB 1AY0A 2C4UA 4PONA 5AVRA 3A3PA 4CKEB 5HZGA 4REQB 1JHQA 2WNIA 3ESXA 4TVBA 3H2HA 2YWXA 3TPFA 1UXOA 1AQLA 1WDMA 3K09A 4RIGA 3U4HA 3R0QA 3AFIA 2GF2A 1TQDA 3FRHA 3O4VA 4MRRA 3UPUA 4DAOA 1V3VA 4L7QA 1Y63A 2GAFA 3GUUA 2UUOA 3RSGA 3I01M 3QA3E 4P4SA 1ID1A 4YRDA 1D1QA 1QIIA 3AWIA 4INZA 4ZO8A 1KH3A 2P67A 5GM1A 3AVXA 1OZHA 2WMOB 1EE2A 1AA9A 2P9ZA 7MDHA 1KXZA 3CLSC 3SQOA 2EEPA 3L1JA 1K6XA 4JJ7A 4KC0A 4UUBA 1BDHA 3P2YA 1I6WA 1GFIA 3HWRA 4K9QA 4O4LA 3V1TC 2WG2A 5IJ0B 3B5JA 9GPBA 2RK6A 4U7JA 1KBOA 1SU6A 2VUIB 5BVGB 1OI7A 3BJEA 3EXEA 3RQIA 2VOEA 3T3DA 1EFDN 5T57A 1A9SA 2GNAA 3IEKA 4P7KA 5DHAA 4FHFA 2QUZA 3WDKA 1ZNWA 2R6GA 3BXXA 3WQRA 1WW2A 1P2BA 4CI9A 5CIYA 1LBTA 1G4HA 1FNDA 1JUDA 1V7PC 2NZYA 2ZETA 2G25A 4JYMA 5PGMA 2EZUA 3ROPA 2YKGA 5CVVA 1GG8A 2A1IA 1MJNA 1CUJA 4MLCA 1AG9A 4U0KA 4A9AA 5KPDA 5AVSA 5IN4A 4B2YA 4QFDA 4FFRA 3KUDA 3IH5A 2XUGA 1DOZA 2E4VA 2YHIB 3ZWMA 3ZDXB 3EGDB 1T3TA 1BMFD 4TSKA 3RC1A 1Q15A 3CVVA 3MQ2A 3HYTA 2JI9A 1RXIA 1RACA 3OFVA 3DONA 3MN1A 2WHQA 4QBHA 4RORA 4XH9B 5BNTA 2HQ1A 5J47A 4GDMA 2IVZA 4KDFA 4YJ2B 3ANMA 3S55A 1VIYA 1Z0DA 3AV3A 1LPNA 4J0GA 2WPDA 1FDOA 4Y6RA 3DO8A 4C4TA 5HX7A 5K5EA 2AUMA 1EFRA 2WJPA 4RVHA 2BGWA 1DDGA 4MYCA 1ZN2A 2HA3A 3IBCA 4FEAA 4HI0E 4NEQA 4XTRA 5CA0A 2XLCA 1QZXA 3REFA 4B45A 5CYGA 3U60B 3E8SA 1DTWA 1RMQA 1K6IA 2FFRA 5FTMA 4EHLA 3I0MA 4TSFA 4ZVPA 3STHA 2CLDX 2W37A 3DXYA 5LQCA 2F2TA 3OHPA 4DCCA 4DUZB 1QJCA 2VJYA 5ALIA 2DSNA 1L3IA 3DMTC 4PGAA 1JXMA 1OLXB 3VNUA 3MJRA 4YMVA 1QH8B 4JT2A 4DLNA 2GMWA 3QBDA 3JZFA 1Q1GA 4GF5A 5B6PA 4DB4A 2VLBA 3PRKE 4B7UA 3HVIA 4UQLA 3L7JA 4GOLD 2GEBA 4IZOA 4HLCA 5DYWA 2TMKA 3AF5A 5FV7A 3RRBA 2BM8A 4LIPD 2LDBA 3BTUA 1QOPB 4QWWA 4RDXA 3VJKA 4HWKA 1KZ1A 2J0UA 3AERA 4K87A 2GBGA 3U7EB 4CG3A 3DMNA 2H5LA 1TFRA 2VZLA 1YB6A 5E9QA 3OCUA 2NVOA 4F4CA 2JFUA 1K0FA 4XPIB 3RS2A 3SQMA 2WIAA 2J31A 3IVAA 2VF4X 2J0UB 4RHFA 3AY7A 2GBLA 3V42A 1NR7A 1QHHA 2GR9A 4MKZA 5JCJA 4OXRA 5CW2A 3TR5A 3V9AA 3G2JA 1PK7A 1PKEA 1VJTA 4L5IA 2JLRA 3ESYA 5A3VA 2YN2A 3PFFA 3KOXA 1T8SA 2QTHA 1QUFA 2I2FA 1VHWA 1EX9A 2QRZA 5IUKC 3C6ZA 3ECAA 5F7ZA 2D1SA 2E85A 4PBRA 2F64A 4DBLE 2GEDA 2I2DA 2ZYWX 4UZEA 3GVHA 1EZ4A 3T7JA 2ZIUB 4LV5B 1XP8A 2LIPA 2XNCA 1SMKA 5FWDA 1VL5A 4P32A 5EHIA 3QQ5A 3ME5A 3OCWA 4CDGA 2DETA 2F90A 4POAA 1U9JA 4MIYA 3U4MA 1K6JA 3EY4A 3AFNA 4ID3A 5AYVA 4NR0A 4LOHA 4DPKA 5KTKA 2XQKA 1I3MA 4IMRA 4RJIA 3OQHA 3UK0A 2JLBA 2OAEA 2Q2WA 2WMYA 3M4YA 1RHKA 2ZRFA 1CY7A 3AG5A 3CZMA 4FEGA 3GJ7A 3WGTA 3BUSA 3U81A 5IZ4A 2J3MA 3CZ4A 3H9JA 1AMUA 4PU0A 1VZ3A 2PCLA 1CRWG 4MCIA 2QVGA 4U7HA 2XQIA 1A1SA 3AO0B 5JC8A 3F8WA 4R51A 1IVYA 2DC1A 4G0ZA 4TVKA 3RUIA 3SXJA 1CUZA 1CNMA 5F1KA 3U56A 3OKCA 1H8HD 2JJ1D 3NDRA 1N0UA 2AGVA 2AW3A 2FWJA 2Q6LA 4KXMA 2HMTA 4CNQA 5FTNA 1YR8A 2B7CA 1JFLA 3O83A 4HDMB 2V65A 2SHKA 4ZALA 3UMBA 1GYRA 2QVBA 4J94A 1K3FA 1VL1A 4J6FA 3JQ7B 3LVFO 4PQEA 4LHXA 5CA1F 2QPOA 5LQRA 6NULA 2BRUA 4DM3A 4EG7A 2NG1A 1H2RS 5CB4A 2LKCA 2VT3A 1GAWA 4QXAA 1NMEA 2Q4RA 3K4HA 3HKDB 3KZKA 3QBJA 4LI0A 2BM0A 4X6XA 4YJKA 1Z2AA 1Y3IA 3I28A 5IBPA 1I2CA 4CM1A 1SCKA 4FR2A 4KE8A 1I0LA 5KJCA 4V03A 3OUUA 3RSSA 5JECA 2BFWA 1Z4OA 5E4FA 5BOVA 5IBCA 1Z8DA 5HF8A 1VE6A 4EB6B 3JASB 4JXKA 2VIIA 3OTWA 1DG9A 1YR7A 4WY2A 3R7WA 3Q2OA 5FNVF 3M9LA 3I1FA 1XQ9A 2F00A 2RKWA 1O5IA 2YJ5A 5DM4A 1TA0A 3FFBA 3B48A 5HUHA 3EBOA 4K9DA 3BRWA 2PGNA 1XTRA 2HAEA 3DUFA 4OFBA 4YJGA 1FE8A 3UJCA 2OWEA 2ZJYA 1VKZA 4L0CA 5G02A 2VP5A 3K6KA 5H81A 2FCRA 1H2WA 1PZHA 2FP4A 4KQJA 1M2FA 2CVFA 1GN8A 2E6UX 2M2IA 2GD6A 1J49A 1TLLA 4I1YA 2DP4E 4MYRA 4WKCA 5KMGB 4UEOA 4Y3UA 2QW0X 1NULA 1ISJA 1WCIA 2EQBA 2OFXA 4EUEA 4GL2A 4NE7A 3PUVA 2VXOA 4WBNB 1W36B 2JW5A 1X13A 3MT9A 4K6GA 3PP8A 1AM4D 2JIRA 4TGLA 2CKMA 1SEVA 1L1RA 2ISCA 1U04A 1IWBB 4QD3A 3U7IA 2WJHA 1W2HA 4Y9RA 5DF1A 3CJQA 3ZDBA 3HLKA 3DNMA 2OCAA 4UUNA 5IW8A 3TX6A 2QL5A 4JX9A 3ZTWA 4QPCA 5JNTA 4HR7A 2G9RA 3DXFA 2YCLA 4CM8A 4PFKA 3G0CA 5FR1A 4GR9A 1D09A 3EIQA 5EYPB 3WGQA 1ZUIA 2ZK7A 3PIRA 3RVSA 2F67A 1EG2A 3Q5DA 4C30A 1XQVA 3N2ZB 4GZ6A 4QQRA 2HZ7A 3HB4X 4WI1A 2CFTA 4NXMB 5SV2A 2P0EA 1GR0A 1JIUA 3QEJA 2IYOA 4PZZA 3ZDEA 1L7BA 3H2ZA 2FMIA 1FFAA 3NYQA 5JVDB 1DTEA 1W5FA 1P6QA 4CKWA 5ESXA 3OURA 4KEAA 4CN9A 2V3CC 1YOVA 3QUSA 4DMMA 3QPDA 4DR7B 4WKBA 1BA3A 4AYXA 1UM8A 4HWGA 1NE2A 2Z0MA 4R54A 1E4YA 2HI0A 3ZGVA 3L8EA 2GEVA 1EZZA 1AKTA 1L5RA 3FZYA 4HSEA 1U0EA 4ZKEA 1XWFA 3RUDA 4RTQA 1QRUA 3PEUA 2VHUA 1DOHA 3BIJA 3EIOA 2HW8A 3LA8A 4MCHA 1LGYA 4CTOA 4WZBB 1SXJB 1VFNA 2C3MA 4GZ3A 1P2SA 5EEHA 5HMMA 3ITNA 3PI6A 1GZ5A 4L15A 3PGLA 3WOHA 4X54A 2R6AA 5C37A 1ZR2A 1YFKA 1X8XA 2Y05A 4N3NA 2X4GA 4UVEA 5AW4A 2RH9B 1SD1A 2XBLA 2Y0DA 3V7UA 2A5JA 1PV1A 3MTAA 1EXMA 13PKA 1IXKA 5LC1A 4EG0A 1NHWA 4KITB 3OOJA 3I0ZA 3SE7A 4JCOA 3COPA 3RF7A 4BKMA 2FFHA 2HCRA 2R8EA 1TVKA 1ZW6A 1LS1A 2HCBA 2ZB7A 1FMJA 2K7ZA 4Q12A 3RADC 1VP9A 5I9IA 4ZI7F 2V7BA 3VPBA 4HHEA 2GN2A 1ECGA 1VPVA 1B41A 1SG0A 2X2FA 1E6EA 1UXHA 3FROA 3G1WA 1D5CA 5J2TA 2QNRA 4H1HA 2X1HA 5JYDA 1JZTA 2OLJA 1G2IA 1T1JA 1KEWA 3OQ6A 4DQXA 3ZQ6A 3EWAA 3RYTC 1U63A 4D8WA 1PIWA 1AS2A 1ZRMA 2YIVX 1FSSA 1HORA 2QP3A 2ZAOA 4G26A 4GBGA 4BO0A 3H1PA 3LBFA 1RAGA 5IVDA 2A86A 3GUVA 1HDGO 2PZKA 5HSGA 2XT6A 3LO8A 4UBLA 3VZPA 3E2MA 1OXUA 4E2ZA 4Z3OA 4JVNA 1RADA 4HX9A 2DXIA 2PRJA 5I4KA 2ZJAA 1EP1B 3MWYW 4OBEA 5AOBA 2OHVA 2IV7A 3THYA 2I5PO 3CZ9A 1N3IA 4YQEA 4C4PA 3GEEA 2HIGA 4I5FA 3TQTA 4CQMD 2E4WA 3CH7A 5F52A 1OYWA 2I4TA 3RH0A 1P0MA 4QYIA 1GL7A 2ERYA 2OAGA 4Z0PA 2VYVA 4DXDA 1NBWB 1PUJA 4J3JA 2CB0A 3THYB 2CFSA 2XLBA 1XCGB 2ZP1A 3LOUA 2XEXA 3KKZA 1DCFA 1X87A 1ZIPA 1WOMA 1O6ZA 3R2JA 3L0CA 4QYIB 4Q3AA 5C4MA 1W30A 3OE5A 3HEAA 4OP2A 1MX3A 2RGGA 3BTSA 2UZ3A 2VJDA 1G55A 2J9FA 4TKUB 3P9PA 2A33A 3GVXA 2YWHA 1A4XA 2E1RA 2QY6A 2XTAA 5EMLA 5IDYA 3TG2A 2J0VA 2I3AA 2Q3EA 4NL4H 1QB7A 2WD7B 3WISA 2Z9CA 3VR1A 5AIBA 4PWZA 3B9PA 5DM1A 5GTDA 5IJ9B 4P80A 1GQRA 4F9FA 4TRRA 2P7IA 4MYTA 1XF9A 3I37X 4GQIA 2X14A 3L6DA 1X9HA 2HMAA 1NG1A 4M0EA 4G4SP 3C24A 4YX9A 3EDOA 4W9MC 1M0TA 1GZ3A 3PXXA 2CVHA 2PT9A 4KYIB 2CWWA 2OK7A 1OLUA 3HA7A 4QLOA 4BNUA 2IP1A 4S1OA 4DNXA 5I8ZA 3ASYA 2B98A 5D3ZA 1CVRA 2W58A 5HRAA 4FDVA 3EFOB 1YC2A 2QJFA 4AQDA 4EDFA 3OIFA 2I1LA 4QUAA 3TOCA 1OLUB 2OQIA 4WKPA 5JIBA 3CNEA 4QYTA 4Q1CA 1JJIA 2H2IA 4D4LA 3KQQA 3WNZA 3WK6A 2JCSA 5COQA 2VDPB 5G53C 2GSWA 4KI0A 3ZLUA 3U44B 4FYVA 4LF4B 4O4JA 1KRHA 5ENVA 4Q4JB 1QKIA 2VBGA 4B4DA 3L49A 1CZKA 3AUJB 3L6OO 1HYGA 1QDEA 2VPXA 4O8CA 3Q2KA 4KUEA 5JDIC 3FJOA 3RSOA 1NAIA 2O2YA 3PFGA 5ELMA 4WASA 1NNLA 1NW7A 3HJBA 3B36A 1V3TA 1MO5A 1MV8A 1NI4B 1VDMA 1KU0A 2F3QA 5EZYA 1QIHA 2V1XA 3LKBA 2Z09A 4DXHA 2IZ6A 1CWUA 4PLWA 3ZN2A 4HS9A 4US1R 2W2QA 4LCBA 2NO1A 4MB2A 3RJMA 4KHPB 4B2LA 2CXPA 4PNHA 1T9BA 2HV9A 2IXBA 1Z5ZA 1L6RA 2JK0A 2WI8A 2ZJ3A 4JR2A 3U1TA 3V1KA 4G1CA 4EEZA 5BV7A 3KQHA 1EIWA 3NXSA 3HBJA 5G1OA 5JZBA 2BH2A 1R2QA 3DMTA 5DRTA 2D7CA 2GHTA 4LCEA 1FQKA 1XQXA 3K16A 5EMKA 5JD5A 2HADA 2P68A 3O75A 2IIBA 4PZUA 4CKYA 3ZHUA 5KTTA 3EZLA 1HFEL 4DLSA 4YXFA 4URZR 2R6DA 2RHOA 2BZ0A 2WEKA 1MD9A 1Q2UA 2Q49A 1M2JA 2PSFA 3MT8A 3PE4A 1M1UA 1NI5A 2QTTA 4HYTA 4UBKA 2C9BA 3BF8A 3VYUB 4ZVQA 3FYTA 1ZD3A 2I76A 5BQ5A 1ZX1A 4K2AA 4CV0A 2O7NA 2W2NA 4Q37A 4PFJA 1CY4A 3CBQA 3LPCA 5EE5B 3GJ8A 4YRPA 2GD0A 3MTBA 1M1NB 5JCOC 5AUQA 3ZD6A 1UEJA 4X85A 1E2KA 2ROQA 5CDHA 3ZVMA 2D0IA 1QE5A 3WYBA 1G42A 2FR0A 2G71A 3NHBA 5BN4B 3A1NA 4D8UA 5TMPA 1C5KA 1LH0A 3LL4A 1GWNA 3SQDA 1BXRB 1GNLA 1LKZA 1ODJA 2E6KA 4B3XA 1KDVA 4PG7A 3RVOA 1W52X 4YUYA 1X7ZA 1N92A 1EJBA 1MA0A 5CR9A 1WB5A 1G8YA 1E2GA 1XDSA 3DDWA 3PD0A 5CBPA 1MNAA 2QTMA 4FU0A 3EDCA 4ARZB 5L4LA 3EVNA 3GLIB 3KLMX 3T61A 1W4CA 4YDRA 2ZITA 2LCIA 1E2DA 2HPAA 3UA3A 3ZGLA 3T1OA 4E0BA 3NHMA 3KTFA 2DERA 3KB2A 4R2XA 1PAUA 1J97A 3AP1A 3QEMB 1ACLA 1ZIOA 4BV3A 4DRZA 1KIMA 1TQ6A 3HA3A 4CZ2A 3N8DA 4ER0A 1HMPA 5JISA 4MGKR 2B1IA 2GA9A 1NURA 1J0BA 3ODGA 4TM8A 2PS3A 3D43A 1COWD 1IN4A 1YDHA 1XL0A 3DHWC 3MHPA 3N9IA 4K9LA 5DHFA 5HK8A 1YJ8A 2HCJB 4TVOA 3SR0A 3X1ZA 1N5DA 2Q3LA 3HY4A 3NTLA 4HDKB 1RZRD 3GDHA 1IQPA 1FSPA 4M0UA 3DPUA 3QYPA 4K6FA 3O8QB 3VKVA 5JJLA 3CLRC 4C1NA 1IH8A 4IHJA 1Z7YA 3FLEA 4L85A 1RRCA 4BMXA 2OLEA 2V6IA 1RI2A 2QYOA 2OO5A 5EMMA 4RM2A 3WA6A 3WL3A 1JEQA 2Z5FA 3F2IA 3MCVA 2C4NA 2XA9A 1XD2A 2RGAA 3BFXA 3LZDA 3OOSA 3S81A 3BTVA 4G23A 3MWLA 4WECA 3CURA 2NAPA 1V6AA 1ZPDA 4BMSA 3E6AA 4DMHA 3VQTA 4N41A 4HH0A 1XB2A 3OT5A 4JQOA 3LT1A 5J43A 3NTRA 3TXAA 2VT2A 5K0CA 2XOXA 2UYYA 3FWHA 3ICPA 3EW9A 4G1EB 1QVRA 3ETNA 3ET4A 1QCDA 5IK2D 4J76A 1JG4A 4ODIA 2C7PA 1ILWA 2DFKB 4PR0A 2FPWA 3FR8A 1XNJA 2RKBA 3HLTA 4AB1A 4TXNA 2WFLB 4UAUA 2V45A 4RZ2A 1JKFA 2P27A 4JY7A 1NFFA 3OQOA 1DKOA 4BUCA 2WOJA 4PIVA 4WCVA 5JY6A 1SUEA 3QY9A 1NIPA 1K68A 1ZH2A 2FMXA 2P9YA 3AEUA 2YCBA 3ZZUA 3N0TA 2RHBA 1YS2X 3VVLA 3HZOA 3PC4A 5KNBD 4B43A 1RRVA 1UC5B 1Q0HA 5CBKA 1U2QA 3H2JA 3V7YA 4UBMA 3FKJA 1BX0A 1TM1E 4H18A 1E79A 1NHGA 5REQB 1DHTA 1GLNA 3FR7A 3G5TA 5EWMB 4JSTA 3MILA 4LMPA 5CYOA 3VUEA 4F71A 3IP8A 3W8DA 1SBYA 2N9UA 1SXPA 3BJIC 2IYQA 2C42A 3PUYA 4XOIA 3LKZA 2ZJ2A 3LBYA 4YPVA 3R74A 3ML1A 3E48A 5JMOA 4G0YA 5J4VA 2DPLA 1WUJS 3HYNA 2W4MA 1SJ9A 1YQWA 1F17A 1XZLA 3P7MA 4EGFA 2I4NA 2YHSA 3O8NA 1ZHOA 3K0FA 1SPXA 3EG9A 4ZAWA 3VZSA 3ZLVA 2Y2UA 1II9A 5E9JA 2VP0A 4LYGA 1JZQA 1L3BA 1OOEA 1VSQA 2ZPTX 3I92A 5C0OE 3VSDA 2BIFA 3QU9A 4GRIA 3ZYCA 2HO5A 2FZVA 1OU4A 2XQVA 3OE7A 4IVPA 4KL8S 4PQRA 5IFKA 5KHOC 1E2JA 2H1SA 2ZTHA 4LNHA 2PR2A 4DEYA 3TUZC 3FVVA 3O2JA 3BCRA 3WAJA 1ISIA 4IM7A 3O8LA 1WWKA 2Q2NA 1ITZA 1MOQA 2UVPB 2VSQA 1B8OA 3D1LA 4ALMA 4JK3A 4DOMA 4BO1A 2OB2A 3W8NA 4EW1A 3KXLA 4OHKA 3ND8A 4UPVA 3PDUA 4U7DA 4NZNA 4D8XA 2XAAA 2VNKA 5EEGA 1H3FA 5BSFA 2WFZA 2OBFA 5K3EA 4PPQA 2AX3A 4MS4A 4PBTA 3SJ7A 1Z5NA 1EM8B 1D6JA 2P6NA 4F6CA 6ADHA 3UWKA 3QKUA 1VLQA 4I3FA 1ECBA 4I2NA 5BPHA 3N0VA 4DCOA 4GEKA 4QU8A 4MZDA 2BCGY 1Y34E 4UD6A 1Z38A 3W05A 2C3UA 3S8MA 5I3ZA 4TKVB 3HFJA 1N0WA 2WU0A 3MAAC 3AQIA 4QBFA 2IEZA 1RQGA 1KK3A 2Q3CA 3FUUA 3RODA 4A0GA 4RZ3A 3B53X 1UDXA 1SBQA 2H6EA 2YWJA 3I83A 1Q1AA 5YASA 1G5RA 3F1KA 3TIFA 1HDOA 3MYRA 3B89A 3FOEC 2PSHA 2R65A 2VJLA 3EXG1 1IZ8A 1KP2A 3SZUA 5FTLA 2ZJ7A 3N2NA 2ONZA 4RVDA 1PFWA 2V4UA 2CF6A 3GFPA 1CR4A 2RMKA 3RFUA 5JSUA 2X6TA 4IMJB 4HAWA 3FHLA 3E5MA 1TZMA 1UC9A 3EFBA 4KYVA 3REOA 3FVQA 5EJ6A 2EJBA 1K6MA 4JB0A 1B0ZA 3HXMA 2PMKA 4GUDA 1YR6A 1PQUA 3P2KA 1EFHA 4YAIA 4BFLA 3O4FA 3M6VA 2EJWA 4B0OA 4Q4AA 4H08A 2B37A 5HDBB 1TKRA 1FQOA 4YP1A 3SZGA 4A8JA 1JEYB 4O4IB 4U8GA 1U4NA 5K03A 2Y1EA 3L04A 5KNCH 3SFVA 4DHEA 1A8HA 2WWIA 3UT6A 4JYPA 5JNVA 2JFGA 1Z08A 1YASA 2E5WA 3UFXB 1HO3A 3B2EA 5JALA 3VR4A 2HQSA 4AJOA 3AHEA 2IX9A 4NMMA 3SYTA 1E7YA 1Z7BA 1Z8HA 2W0SA 3COWA 1TB4A 3IQFA 2EJCA 1U5BA 1IG3A 2XCQA 3CU5A 3F5DA 3PUHA 3N70A 2FCAA 1UJ2A 3R41A 2BTQA 1U0JA 1Z5VA 3H1TA 5C5EA 1T3SA 1T6ZA 3DO6A 1FCJA 4JLAA 3OUTA 3RK4A 5HZKA 3QF7A 4MGYR 1JIVA 3BA1A 1U5BB 3KZCA 1MXFA 1R7RA 5J2UA 4RKWA 3BGDA 1VYVA 1SUDA 1NBHA 2HT6A 5IT4A 1ESNA 3LHFA 1O4VA 1KDRA 4BHTA 5BN3B 1U2ZA 5EQJB 1JYSA 4BNXA 3NYIA 4JMPA 2XKKA 4N9WA 4B6PA 1XRMA 2ZQZA 3M2TA 3D7NA 4M2LA 4QOFA 4PXAA 3RRNA 5C8YB 2FPGA 4FEYA 4RJLA 3RLIA 3E81A 2OZLB 4JL6A 3C7CB 4UHBA 1GCOA 1W49A 1YE3A 2QPLA 1Q0PA 2ZIEA 3HXKA 4A0FA 1G8MA 4C88A 3LUPA 2I8AA 4FC6A 1F9EA 1G3IA 1N8TA 4M53A 4UAGA 3INRA 3H84A 1XKXA 3PQ4A 2XVMA 2YJ6A 3BCUA 4ZQCB 2O3QA 4IL5A 3ZUPA 3ZDFA 4DQKA 1UFOA 4X3PA 2PMBA 3RWMB 4INOA 4CPDA 5BV1A 4M9QA 1IVNA 1A82A 1NVUQ 4PQGA 4O3MA 1I3LA 1E3JA 2O7SA 1DWOA 3RAGA 2G6TA 4MPRA 3MM4A 1SD2A 2NXNA 1ESZA 3CZPA 4AWAA 4E21A 2GN9A 2DOKA 2C04A 3TW8B 3I2IA 1XZBA 4ASUD 3TSYA 4IDPA 2ZDHA 3ZZTA 3VC1A 4G8BA 1T91A 4HSGA 5CT4A 5CCBA 4F46A 3FZEA 3DE0X 1GT91 4NZOA 1QRRA 2CUKA 4HVAA 3DF7A 1VHJA 4ILKA 4Q3KA 4MB0A 3EA5A 1PBTA 5JDIA 2HBZA 1HEUA 3H9GA 2F43A 3ZGYA 4U3JB 4OQ4A 3SJBA 4BFWA 3ILXA 2XVZA 1F51E 3ZHYA 2O7RA 4TWBA 3VU1A 5FLKA 2FMTA 3HMKA 1W5TA 1I24A 3KR9A 2ALJA 5F21A 4RA9A 1PD1A 1K7SN 5B36A 2AL7A 1JIIA 5P21A 2PRSA 4W6ZA 2QUBA 3D5EA 4XX0A 4LGYA 3W4JA 4CMEA 3A3KA 3GRFA 1DPGA 2VA8A 2GOYA 1L5SA 2YIJA 5IZCC 4F3NA 1RWBA 3QLEA 2JI7A 2G9QA 4RLQA 1NT4A 2AE2A 3K8OE 4I1SA 4UCWA 1CYEA 4P84A 2P4EA 5B4UA 3DT9A 4OF4A 3MSCA 5CJPA 4YI5A 4K28A 4DDMA 1P33A 3ZW8A 4EF6A 1UJNA 3ADBA 4A6PA 1TXGA 5F76A 1WM1A 3E58A 2VS1A 3QJ5A 4K6KA 4WLOA 4YQFA 2BEJA 4HQKA 3VC2A 2I2XB 3PQ8A 4NY1A 1PL8A 3KJHA 2A58A 5ITSA 2OEPA 5LA6F 2I9KA 2P9BA 1JHRA 2IEGA 4LFCB 4V2IA 5JQGA 1MVOA 2YY5A 1XFDA 4YTEA 5JCOA 3ZWNA 5KQSA 2N0SA 5AXAA 1ZAKA 1IN5A 4F2PA 4F5ZA 5K8IA 2W9XA 5FP0A 2JEYA 2IBSA 4QDXA 4P8RA 3GUHA 4EUNA 4YP0A 2E4UA 3MJTA 4XQ0A 4N8EA 2AEMA 1JKJB 3GGCA 1KZ9A 1BJRE 1X94A 3H4MA 4CIWA 1ZUWA 3ZTTA 5CB0A 3PT5A 3B6KA 1LTHR 1ZI9A 3P26A 3WDLA 3ZHVA 2G9NA 1YA4A 3LCCA 3ZI7A 2UXBB 5K7SA 3BB3A 4MW2A 2AR9A 1ULSA 2DUJA 5INTA 1IXZA 1MJ5A 3PITA 2ZRDA 5T5QA 5I9TA 4L27A 1Z2DA 4RVGA 4YCMA 1QLJA 1PD0A 4EM6A 2A5FA 4LZWA 1GT6A 4QUBA 3F6YA 1ZH4A 2NV0A 2FG5A 2QX8A 2V6MA 3C3XA 4HPXB 4RL6A 1R6TA 2JS7A 2X77A 4YMWA 4D0RA 1V1MA 2GYUA 1UQTA 2ZROA 3LT0A 4LRUA 3QLJA 1VA5A 4Z53A 1YF3A 2GESA 3UJ7A 2BWJA 4MJ7A 3EULA 5J40A 4MJLA 2PZMA 4AJIA 3L06A 3QKRA 1KZ4A 1N9KA 1DO0A 3IAS1 3SDZA 1CNEA 1DQNA 1HYEA 2ILVA 2O1WA 1F3LA 1D0SA 5KPJA 2UV8A 3AOEC 1DC5A 1AUQA 2JGLA 2VF7A 1VGVA 1TU4A 1ZQ1A 2GAIA 3GAZA 4C03A 1JIXA 2CL6X 4OV6B 4E94A 1R4NA 4N5LA 4LPKA 1GRNA 3AEQB 2PQ2A 2PBZA 4DABA 3KQVA 4JLPA 4YRIA 1OBOA 1A72A 2I87A 3C3JA 3F1LA 4L0QA 3EMBA 1IZYA 3DBLB 5D51S 3WY9A 4X9XA 1JR3E 4D6PA 5FOSA 5HKOA 3D3JA 4Y2JA 4EJ2A 4FM9A 1K63A 4ARUA 1NV8A 3UUEA 5CLQA 1CUAA 1RS0A 2Q3JA 3SR4A 3HK2A 3NVKI 4BQEA 3E9CA 4N48A 4B79A 2IOFK 3EVEA 5LP6F 2BDUA 5GPBA 5DBEX 1CQWA 4BASA 1M7HA 1G60A 2RHTA 2GZ1A 3FMIA 4ZYTA 1VKHA 3KE9A 2B8JA 3PPVA 1X80A 3HRHA 4CMIA 1R4MA 4IUDS 2P8JA 1XAHA 4N0EA 1ENPA 5JATA 2CBZA 3H1EA 3I34X 3LVRE 3WYDA 2OR3A 5H59A 2VRNA 1NUUA 5J1TB 2QVLA 1C9EA 2ECPA 1M2GA 2G09A 3R9IA 4EQ6A 1RWXA 2Y68A 1Q14A 5TMEA 4B3HA 3EZ9A 2ZRLA 3R1IA 1VIAA 2L19A 3PDCA 4MGEA 5DLYA 5ECDA 4LXTA 4K9SA 4K40A 1NUQA 2D5AA 2RH4A 1TQ8A 1LCIA 3C5HA 3TNLA 3WBJA 3Q4GA 4DIOA 1GM5A 4R31A 2GCPA 2P35A 5DX0A 1ODSA 4OGLA 1PHRA 1RQLA 1KF0A 3LYLA 5ITVA 2YZ7A 2OQRA 3K05A 1E1CB 3A25A 1G8AA 3D3EA 3MXOA 4XVQA 3VM6A 3G2OA 5BR1A 1DC4A 3FTFA 5A5DA 2SKDA 3DTVB 3ORYA 2Y1DA 3TQOA 2DWCA 1NGSA 1AK2A 4ENRA 4KYTA 2HF9A 1N2BA 4FJ2A 3PYXA 4BV9A 5F78A 4AZ3B 1FYXA 1EP3B 1LPBB 2WKWA 4MKXA 1CULC 5F3DA 1DKNA 2B82A 1VLLA 2AOTA 2FSIA 2BFBA 2DY0A 2OGZA 3MELA 1SBHA 2WJ3A 2OUIA 1Z3IX 5THQA 1TK3A 1V37A 1XJ5A 1NUAA 4OXQA 2XTZA 2OCDA 2IJGX 4OYYA 2IYXA 1T3HA 4G0NA 3MSXA 3L8CA 3BSYA 3BWEA 3I9MA 1H9CA 3RANA 3UW1A 5CMLA 4BVHA 4CKCA 1O97C 1CUYA 3RRFA 4IYRA 1P2GA 2QGNA 2YMQA 3N53A 5BNFA 2ZM5A 4JXZA 1X7XB 4IXTA 3UB4A 1DO8A 1XMVA 4GR5A 1F2TB 1QS0B 4J0DA 2DPGA 4HX2A 3PXDA 4Q39A 1M8JA 2H0RA 4W5OA 2YOHA 3ETHA 5CDSA 2PGLA 1V95A 2XUFA 2JFOA 4LF5B 3OTHA 2ID7A 2PGJA 3INTA 2MTBA 4E08A 1U5AA 1U99A 3ZX4A 4I9UA 2O57A 4G07A 3QTLA 5E2BA 4H3SA 4CDRA 1RXVA 1PJ2A 3JQAB 5DK6A 3PCRB 5AVVA 1N0VC 4CM5A 3NTQA 1SVUA 3A28A 4NZ9A 4DIDA 1ZD9A 3V8PA 2DSTA 2IL1A 1GA6A 1Q0SA 3KOYA 1PK9A 2HU7A 2AOUA 3S0JA 3U49A 1V16B 3WL4A 5FF9A 2ODNA 4MW7A 4FB5A 4ZDIA 2UVQA 4TROA 3AIKA 3AT1A 1P4AA 3BJZA 3BK1A 4ZXFA 1TM5E 3O4JA 4NG5A 4PNEA 1E8NA 1O9HA 2B7BA 1Q91A 2O8DA 1KDOA 1PR6A 4EY4A 4RNDB 1FSFA 1KDZA 3GQBB 2PD6A 2X1VA 4A23A 1YCGA 3IP5A 2I7TA 3CMMA 1RXEA 2NWQA 4PSVA 3F4KA 1MENA 1J70A 1GUYA 1FVOA 2VUHB 3NGMA 5MFZA 4QA9A 1T9ZA 5TY0A 3CLUD 1CEQA 3OD5A 3ONVA 5FHQA 8GPBA 3ZVKA 1KFCB 3V9PA 1AQIA 4MKIA 1LPSA 3IKMB 3I0NA 4J0FA 4MV0A 3KQNA 3RU2A 1HZJA 1PV2A 3WXBA 2I54A 3T7AA 1WJGA 4REMA 1EFVB 1AV6A 2PD4A 3Q3IA 4HL6A 5DGTA 4PC1A 4R6XA 5EKDA 5TQ0A 3QIAA 1JPNA 4IRUB 3Q11A 2PUAA 1SB9A 1D4FA 1N1EA 1OWMA 1IM8A 1ADBA 3D3WA 4HNAA 1GGHA 2VEOA 3G7SA 3ZR4B 4HDNB 3TH5A 1T25A 2RJOA 3IQEA 2QM0A 4RW0A 1SNYA 1WPRA 1NV9A 3EWIA 1O95D 3W9BA 3FTQA 4DVJA 2JLSA 5IC4A 3QKWA 2VHZA 1PLJA 3VJRA 2FEMA 2J9RA 3QU2A 3D8TA 4GMFA 2C5EA 4HNAB 4M4SA 1M1ZA 1EK0A 4P54A 3QPAA 3T1QA 3U3ZA 3ROTA 3SEQA 4C0LA 5HS4A 2AFHA 4M9UA 1FFXA 1V9SA 1P0QA 3DVAA 1ZESA 1XR3A 1I2MA 2FUNB 3C1TA 3W5VA 3PHIA 5IUJC 3FOFC 3ED1A 3MQFA 3PLNA 1CDOA 1VCIA 2LZ0A 1REQB 3R3YA 1K9SA 2C88A 1W35A 4G0OA 2E89A 2IYNA 5JPCA 4XSGA 1M8FA 2P2CA 3ESDA 2HIHA 2G9ZA 1UM9A 3NWOA 2AZXA 1TEVA 1PLKA 4TUYA 4B73A 4U63A 2BFAA 5B3JC 2JHCA 4MVJH 1JTEA 2IHZA 4UBOA 5EGNA 4Y2PA 4MUKA 2ZT5A 1Q44A 4TZ0A 3MGKA 4N7BA 4KBYA 4Z2AA 1Q11A 2Z8YA 4KQ1A 4F45A 1JAIA 2GO1A 1KQGA 1NXSA 2WVAA 4LY9A 4F2GA 3N28A 3BHMA 1I4EB 2AJ8A 4KQIA 1EWRA 2I80A 4FCWA 2QRHA 2X5KO 3HCPA 4GEGA 4YAOA 3ADOA 1VKNA 4BZZA 1CFJA 1X19A 2V6BA 1RBQA 2FWBA 5DB4A 3CLTD 1U8ZA 1Z4LA 1YHZA 2JKYA 2O50A 3FPKA 4LNUB 5EXXA 4B7ZA 1I5EA 1LTKA 3FE2A 3SHQA 1SVOA 4CV1A 3GDWA 1EFTA 2RKOA 3ONFA 4GZLA 5LCXA 4LJ7A 3UWDA 4ADSG 1TKBA 4OLJA 4Y6QA 1LNSA 2BMAA 5E9WA 4AMGA 5IVHA 2RSLA 2Q9CA 4X00A 4Z3DA 1EP2B 3W7BA 2W8ZA 5L3ZA 2FKNA 1DBWA 1Z36A 3K7EA 4CM7A 2OBYA 4D9KA 4BB6A 4EMTA 2B35A 3MINA 4JLSA 3WSVA 4HADA 4EO9A 4Q4HA 4PNPA 4DW8A 1UJ5A 2HWUA 4Z1MA 4OSEA 4OUDB 4Z51A 1PZFA 2B8WA 3GFFA 2E2WA 4IEIA 5KNCD 1CZRA 2ZIFA 1V5EA 2KHZA 1OU0A 2C4WA 2I67A 1JP7A 2PT5A 1CU1A 5TF0A 2WYWA 1KI7A 2FOXA 1C9KA 1JJAA 4AKGA 3NIDB 3QMMA 4M7PA 1RLJA 3WZLA 1L4EA 1ZNYA 1XHEA 2V7QA 1PHPA 2KLHA 4IDAA 3F71A 2PKEA 5SYNA 3U3OA 3KPVA 2QN6A 2VZ0A 3OQIB 4COOA 2O8BA 3GWGA 5IZCA 1C41A 1C3OA 1FFBA 1P3DA 1EESA 1FYEA 4LTNA 2NV6A 3PQCA 2H54A 2V7UA 2FRDC 1E4EB 4NMWA 2F1KA 2FW7A 1N8KA 2HMWA 2IF2A 1WS6A 2PRIA 3AZQA 3IE2A 4TRJA 2FYTA 4BP9A 1WDTA 4CGYA 1L9KA 4AS3A 1TLTA 2FU5C 5A6VA 2CDAA 4WL0A 4F6RB 1M72A 3P71T 1ODLA 1YR2A 3JSXA 1F4LA 1MJGM 4KQKA 2Z2XA 5BYJA 1W36D 3LQRA 2ZZMA 3GPCA 1EWVA 2JVJA 2WUFA 1RBYA 3HCOA 4DUGA 1YFJA 3ZGOA 1I7LA 4EUFA 4OFWA 5DMXA 3IR6A 5AI9A 1P0IA 3L93A 4FOSA 4EYOA 5JXIA 3FLMA 2XMZA 3DO5A 2PAAA 1PJQA 2QN9A 3IP9A 4ANFA 5IRCD 1YO6A 2O20A 3MTGA 1HT3A 3FDZB 4R0VA 3UK7A 1ULAA 6Q21A 3AEKA 3ZEAA 1ZCBA 2VJQA 1LRLA 1CKEA 2XQGA 2XVXA 3NV9A 1ACJA 5I47A 5B1YA 4QEDA 1N0IA 1ORRA 2HEIA 3OY2A 4IMIB 4NENB 3UOGA 1H93A 4P83A 2Q5EA 4CWAA 4FNMA 2GAOA 5F5LA 4D4GA 5BXQC 2GEKA 4BFTA 5LLDA 2B4QA 1MB9A 3U1VA 3DFMA 2VHQA 3VKHA 2HDNB 4JUDX 1QV9A 5ICMA 1ZEJA 1EUDA 4GXQA 4TWIA 3AI1A 3TTXA 1MEOA 3EAGA 2JLYA 3IQGX 4TTQA 2VTEA 2NO4A 1TZCA 1PT8A 5H68A 1EP9A 4QBIA 2GAAA 3TQIA 4HMPA 1GNQA 4DFDA 1ND5A 3QW2A 1LRJA 2EDAA 2ZR8A 3HM2A 3PWZA 3FPCA 3E1SA 2WU8A 1XJCA 5C52B 3T3GA 2W43A 5LQUA 2OFPA 3ILSA 2SCUA 1TVEA 3UMJA 1NY6A 2QYTA 3TD6A 4JQZA 4H0CA 4K26A 3TMKA 2NO7A 2BYTA 4PTZA 1K8XB 3H0EA 3TQCA 4P4GA 4G8DA 1JMKC 2PGAA 2V6GA 2VDRB 2H1FA 3AOEA 4IFTA 2APJA 1LI5A 4BDSA 2XDQA 1CUUA 1KYTA 3D6JA 4HRAA 4XUEA 2OXIA 3S99A 1MPTA 1O94C 2C92A 1QYCA 3MJ4A 3HQ4O 5K3AA 5F77A 1IZZA 5DDIP 3U1BA 1J06A 1YR3A 1ETHA 3WLKX 2W6MA 4WXEA 3I2HA 2UUPA 3UIEA 2A14A 4FDLA 4FI3F 3B1FA