4JBIA

2.35a resolution structure of nadph bound thermostable alcohol dehydrogenase from pyrobaculum aerophilum
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
333
structure length
333
Chain Sequence
HEMRAAAFSTPGLENLKLVEAETPRPGPGEVLIRVKYAGVNPLDYNVVAGAVKASPMPHIPGSEFAGVVEEAGPGVTGVSRGDPVVVYNRLYCGHCRQCLTGWTQMCEVTGGGIIGIVTQGGYAEYAVVPAKNAVATRADLKEAATLPIGALTAWNMAYRASISPGEKVAVVGATGNVGIYAVQFAKLLGGEVYAISRRKAKVESILKSAGADAVLTPDEAKSAAPFDVVLDPTGSASWDLSFGVLGRGGRYVTAGALTGAEVRLDLRRLYGMQILVIGATGGRRADFNTVVRLLEAGRIKAFLHNVYPLADVRKALEELRSPERVGKVLIAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase (Zinc)
publication title Physicochemical Characterization of a Thermostable Alcohol Dehydrogenase from Pyrobaculum aerophilum.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Oxidoreductase
total genus 108
structure length 333
sequence length 333
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jbiA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4jbiA01
3VH4A 3VPXA 1DEHA 2XF8A 3DTTA 1VJTA 2EKPA 3IC5A 2Y0CA 1VKOA 4MVJI 4N7RA 5JO9A 3H2ZA 2OGUA 1KVQA 1PJ4A 3IUPA 3KVOA 3PJEA 2PZLA 3JQ7B 3ZU5A 4DUPA 4AJ4A 4DPMA 2NVWA 4MJLA 3W8DA 4YYZA 1V6AA 4J91A 3W1VA 4O63O 4D46A 1EVJA 1U2DA 4XD2A 1LRKA 2ET6A 3V2GA 4PRLA 5AXAA 2BFMA 4IJWA 1UXIA 1CJCA 4R16A 4BNMA 3KYCA 3KSUA 4A27A 2BI7A 3AOEC 3DZIA 3JQFC 3N74A 3RI3A 3BMOA 2GERA 5IXSA 4O0LA 4EJ6A 3V5NA 1P44A 2UUOA 3KXDA 5KCZA 3HFSA 4HADA 3JYQA 5KKCA 5CAEA 4WNCA 4YB8A 4DYVA 1WVGA 2HKIA 1JAXA 4M86A 3GAFA 3NDRA 3WB9A 4HFNA 4D3SA 1E7SA 3I9KA 4LCJA 3WGGA 1VM6A 4YJGB 2XAAA 4R69A 1I24A 2JD2A 2Y05A 3H65A 2PK3A 2J6IA 4B7XA 3NT4A 4LISA 1V3UA 3OJ0A 3KRTA 3UUWA 2Q50A 3RU9A 1ZXLA 5IJZA 2DPHA 1MG5A 4E31A 1OFGA 2NTVA 2IDZA 1SEPA 5GZ3A 3AJRA 3WMWA 1C1DA 1HEUA 1P1FA 1UH5A 2JFFA 2RCYA 2AHRA 4XYEA 2Q1WA 2X7HA 2D4AA 1E92A 4RDHA 3PP8A 3RCBA 2FPGA 2Y0DA 1RM3A 2WJPA 4BO2A 4WLNA 3TFOA 2Q4BA 3CTMA 4PLFA 4D3DA 2B5WA 1M76A 5TIIA 5DCYA 5TRTA 3S2IA 2ZYDA 4FFLA 2GN6A 3C7DB 3MTJA 1CQJA 1PU2A 3ZWBA 4QFDA 1MFPA 3GT0A 3K6JA 3ZW8A 3C1TA 5A9TA 5I7VA 9LDTA 3KB6A 2BGMA 2PZKA 1ZIDA 3OA0A 2GASA 4RVHA 1VSUA 3UN1A 2G76A 1H2BA 5JDCC 1EUCA 1U3VA 2QG4A 3GEDA 3VVBA 4B4VA 1A4UA 2PH5A 4INAA 3INTA 1ZXBA 4LGVA 1BGVA 2AMFA 4J7UA 2YJZA 3RSHA 4CV0A 5CEJA 4RVUA 5JBIA 4CMKA 3JV7A 1MV8A 3LC1O 1I32A 3ZV5A 8LDHA 2RBEA 5L40A 5BSHA 4II2A 4A73A 1KEWA 2FOIA 2GR9A 4PVDA 3DB2A 1R0SA 3CSDA 2G17A 2OXIA 3AY6A 2EV9A 2AA3A 4RVGA 2RH8A 2NU8A 1C0PA 5DN9A 3DR3A 4ROSA 4AJ2A 4HV4A 3PHHA 3UICA 4B3JA 4J4HA 1HF3A 3HDQA 1XYGA 1YB1A 4TZKA 2C07A 2PD4A 4R54A 1OAAA 1U8FO 4MO2A 1ISHA 2VWQA 4KDEA 3U4IA 1LDEA 3N58A 4Q3BA 5CDUA 4NBUA 5L3ZA 4DA9A 1LX6A 3FWNA 3BAZA 4XYMA 3AOGA 4MDHA 1UXHA 1OC4A 3C85A 3RJ9A 3FNFA 3PVZA 4WNIA 2ZYAA 3JQGA 1R66A 2FMUA 4NFYA 2VOJA 5I9MA 3IIEA 1B8UA 2J5RA 2CDAA 3H6KA 3IKVA 2GNAA 1H9AA 2X5KO 4BUCA 1LNQA 1LSSA 3AUAA 1VPDA 3DAFA 3GZNA 4IPTA 3WBFA 1TT5A 2Y68A 3PHGA 2GGSA 2Q46A 1ZK1A 3WGQA 2A35A 2V6FA 3GVPA 2GZ1A 3CH6A 3E03A 1QYVA 2OO5A 4TRRA 3KYDA 1AUPA 1ADGA 2ZB4A 4I5EA 4QO7A 4K28A 4CV1A 3RUEA 4F6CA 1H6AA 4C7JA 2VHVA 2WD7A 5CP8A 4G5HA 4J90A 3S2FA 4BL5A 1A4IA 1NPDA 1O5IA 1ZCJA 2J3HA 2O4UX 3HSKA 3WFJA 1O94A 2G1UA 3E18A 4MPDA 4IDEA 2E82A 3I9JA 2D1YA 4MVJG 4Y8VA 1ARZA 3G79A 4A2CA 4BKUA 4BNYA 3OQBA 1EEHA 1JVSA 2IRWA 1GFSA 1SMKA 3C1OA 4Z0TA 4EUFA 1PJSA 3RC1A 2R2GA 1PWXA 1VE9A 3EZYA 3JQBC 4EGFA 1JTVA 4A0SA 2YQ5A 1Q7CA 3IP3A 1HDGO 1A71A 1EDOA 2CF6A 1DRVA 3FPCA 4YQYA 3RIHA 3SBOA 3WX0A 4YRAA 4RPJA 1JN0A 1NFFA 1SEVA 4BNTA 1Q1NA 3TDKA 3KV3O 4YJHB 1XDWA 1CRWG 2HRBA 4RGBA 3D3EA 4XJTA 4MVJH 4BHTA 5JDIA 4OOFA 3GNSA 3EY4A 3ON5A 1Z74A 2X5JO 4IQ0A 4CL3A 4BKRA 1DIAA 1WWKA 1B0AA 2PGJA 3D3WA 4J4TA 1F0YA 1QLJA 4YXFA 2Q49A 3O4RA 1IHYA 3ULKA 3SEFA 3ETDA 1I3MA 3NGLA 1E6EA 5ADHA 3JYOA 4CM8B 3HB5X 1K6IA 1BW9A 4IDFA 5JC8A 3U4HA 1E6UA 4HNHA 3UW3A 4EW6A 1BHSA 2VN8A 3WGIA 1DXYA 2E49A 3PFFA 1W4ZA 1XLTA 3MJSA 3TF5A 4CLOA 4KUEA 4CR8A 1R4MB 4DIBA 1NFQA 2VOEA 5KJ1A 5ILOA 1GZ4A 1JWBB 1LQTA 1Y8QB 5KJEA 3ZWCA 4FB5A 4NK4A 2Z1MA 2NU6A 4L76A 1L1FA 4O6VA 1LBEA 2QW8A 5AQ1A 4OYRA 2GYYA 2Z95A 4KTVE 4ZQGA 4WEOA 2I67A 2BGLA 1EZ4A 2P2SA 1P1KA 2B37A 1NM5A 3QHAA 2C2YA 3QVSA 1GYRA 3DHNA 5ICSA 4DYDA 1SB8A 3ORFA 1Z73A 5AVOA 1N2SA 2SCUA 5JPIA 3F9IA 3QVWA 4MOWA 1HETA 4XEHA 2Y1DA 3EVNA 1C1XA 2B69A 4E3ZA 5KKAA 3B1KA 2DTDA 1TI7A 5KWEA 4UVGA 4YBZA 4AVYA 1MC5A 4WJZA 1P0CA 5CPFA 1SOVA 4DLBA 1Q0HA 4LMPA 4PG4A 4JBGA 4JJGA 3DBRA 1HRDA 3H9UA 5DBGA 5H82A 1QMGA 4WCFB 3AY7A 3U5TA 5T8KA 2PD3A 4GVLA 2O48X 4XGIA 1MUUA 4XQGA 5H83A 1T2DA 1J4AA 3TFQA 3JYLA 1GV0A 4XYLA 7ADHA 2B4TO 1DJQA 2I3AA 2W2KB 2CF5A 1E7YA 3KLMX 4Z9XA 1DC4A 2VCYA 4I9NA 4RQTA 3RFTA 3DOJA 3A06A 1YL5A 2CNBA 2JD0A 1WP4A 5CDSA 4EBFA 1QXSA 1E1LA 1E7MA 3K31A 3EMKA 1OI7A 3I9OA 4OL9A 1BXKA 1IZ0A 4PLWA 4LVCA 2GDZA 1G0NA 2UV8A 1WDMA 1LLQA 4YAGA 3TJRA 3HG7A 1NVGA 5ITWA 1P9LA 4PLVA 1GQYA 4NBRA 4Q39A 3GG9A 3DC2A 4BV9A 4E12A 5ITVA 5JE8A 3Q1LA 4MIEA 1L7DA 1MX3A 2EW8A 1LRLA 4NH4A 4NIMA 1AE1A 1E1KA 4DLAA 4M55A 3RC7A 4GWKA 1X7DA 3GAZA 3PYMA 1MFZA 1VJ0A 1NBOA 4KOAA 4DWVA 3RAJA 4EUHA 5JMPA 3W4KA 4ND3A 4AJPA 3O8QB 4ZRNA 1I0ZA 4J6FA 3RUDA 4JROA 3Q2IA 5JLAA 3H2SA 1NWHA 5CDTA 3WOHA 4XGKA 2Q1TA 4F45A 2GN4A 4O5OA 3AOEA 4YDRA 2YDYA 4EI2A 1R16A 1NP3A 3PLNA 1HZZA 1CF2O 4GX2A 1E77A 3HDHA 4YAEA 1A7KA 1KEPA 1YBAA 2HJSA 4PVCA 1R0LA 5L4LA 4Y6SA 5JMWA 5TJ9A 1Z45A 2W4QA 5ENDA 4OHUA 2PY6A 2X58A 4PLZA 4BO7A 1WMBA 2Y66A 4TVOA 4FOSA 1YQGA 4LN1A 4QECA 1HDCA 3K30A 3KTDA 4WOJA 1YVEI 1C0IA 3O03A 4Y6PA 3P2OA 1AXGA 1IB6A 5FI3A 4RPGA 1FJHA 1W0CA 2AEMA 4OXKA 5A9SA 1DFIA 5F3RA 5I7EA 2HMTA 3KHUA 5IZCA 2HUNA 4ZA2A 4Q3EA 4EITA 4RPHA 2DVMA 1Q2XA 4I5FA 4FFMA 3TL2A 2QHXA 4IS3A 4DTIA 4ZN6A 1A72A 3BTSA 3FTPA 5TT1A 1BDMA 1CYDA 2AG8A 4GH5A 3JQ9A 1TEHA 4RPKA 4ZQEA 1HL3A 1IY8A 1DAOA 2E37A 4JK3A 1E7QA 4RVFA 3FPLA 1YDEA 4RF5A 1DAPA 1ZSVA 4A5OA 2EG9A 5I9NA 4YR9A 1FXSA 5A3VA 1FDWA 4KWIA 4IXTA 3BHJA 3RVDA 3VTZA 1DIRA 3DZHA 3QW2A 4CMAA 2Y1CA 2WDZA 1UZMA 2ZTMA 4M87A 3WGZA 1IYZA 3TZ6A 5T57A 4BB5A 3PPIA 3IOYA 2BGKA 3BMCB 3PJGA 4OXYA 3ZNNA 5C7IO 2P4QA 2B83A 4EEXA 5TGDA 3S2EA 4E4YA 4DC1A 1XR3A 1YOVB 2Q2WA 4U5QA 1M75A 5JFOA 3DBLA 1ISGA 1HE5A 1PL8A 4CM6A 4Y67A 3L6DA 2WD8A 1J0XO 2CZCA 3VH2A 3LYLA 2NU9A 4BO9A 1I8TA 1X7HA 4E5YA 2X9NA 4TWRA 1T2EA 4TRJA 2FR1A 2ZCUA 2QX7A 2FHSA 3VZQA 3DHEA 2QIOA 1GU7A 3CE6A 1CERA 1JA9A 3RD5A 5BR7A 3MWEB 4WLVA 3DZKA 3NDJA 1HT0A 2V6MA 3VC7A 4RJTA 4F6LA 2PNFA 1KC1A 3ZWOA 2Z1NA 2O7SA 3D0OA 3DFUA 1FDTA 1N92A 1B3BA 1HDZA 3EAGA 3LT2A 4TKLA 3ZCXA 3OM9A 4D43A 3PIIA 1YL6A 4WE3A 3D4PA 4GMGA 1ZK3A 4NG5A 1GCUA 1BVUA 4FD3A 1LI4A 4GWGA 1B8VA 3E9NA 4TQGA 5KJCA 3WNVA 4XR4A 4YJDA 1E1NA 3RUAA 1YBVA 4NI5A 3DWFA 3Q9NA 4CQMB 4WK6A 1R6DA 4O59O 4IDDA 1LDNA 3K92A 3TZQA 1G6KA 1LLDA 3OBBA 1U7HA 4BMSA 2GCGA 2FZWA 3DBVO 3E5RA 3CXRA 4W6ZA 2B4QA 3RUCA 4GBJA 1FDSA 4B4UA 2H6EA 4ID9A 3E9QA 4G2NA 3CMMA 4AJ1A 2XXJA 3WQQA 5L7TA 1GZ3A 2GSDA 4L8VA 5EMHA 2A9FA 3INRA 1ZSNA 2PTGA 1CWUA 2HCTA 2VTEA 1EFKA 4B79A 4GX5A 1YJ8A 4YACA 1I3NA 4QFCA 3TL3A 3BMNA 3D5TA 3GGOA 1VI2A 3JQDA 2DTEA 3SLKA 4GI2A 1Y8RA 3I6QA 5EJ2A 1PGPA 1UAGA 3KOUA 1ISIA 3QA9A 3U9LA 3F1LA 4IIVA 5DDIP 3PDUA 1FMCA 3CINA 3GDOA 1WLYA 5IDQA 4GLOA 3GMSA 4YEDA 4W4TA 2F00A 4NFHA 1ZH8A 4IIUA 1NQ5A 3NX4A 3TQHA 4CQMD 3Q9UA 4GX0A 4U6SA 1DFHA 3UVEA 1SOWA 3RJ5A 3OJEA 3MOGA 4CMBA 4YRBA 1B2LA 1YBMA 4D0RA 5JCJA 3ROQA 3IKTA 2Q1SA 3OEWA 5DOVA 5CPBA 2X22A 3WGYA 5THQA 4RDIA 2ZCVA 5C5IA 4B4WA 1ZJZA 2OBYA 1DHTA 1ZO8A 2NWQA 3AUUA 2RAFA 4J1TA 2JJYA 3F4LA 2OP1A 2X4GA 3ONDA 2EGHA 1R15A 3R6DA 3HDJA 2X23A 3EVTA 4PN3A 4ND5A 1JLLA 3FF4A 4UVDA 3OICA 3UGKA 4IDGA 4EDFA 2NTJA 4N5MA 5TQVA 1U2GA 3STHA 1A27A 2F1KA 1LU9A 4NFSA 1A9YA 2WE8A 5K6AC 1C14A 2UAGA 2H63A 4L4XA 2JCYA 2RIRA 4ITUA 2EIHA 5G0WA 1NR1A 3K9QO 3QJ5A 3ZU3A 5JW6A 1XEAA 4XDYA 3GHHA 3U09A 2IEBA 1DOHA 2C7VA 4YT2A 1P31A 3RUIA 3WTCA 5DZSA 4PG7A 5HA5A 2BKAA 1GPJA 4ZRMA 3H5NA 5HRUA 2EW2A 1DO8A 1ZKMA 2DFDA 2P5YA 4NBVA 3OF2A 4BO1A 5L7WA 1ZVMA 4IDCA 4R3NA 1MP0A 4EEZA 2BMAA 1V35A 1BRMA 1PS9A 2HMSA 5DBFA 1OOEA 2B36A 3ZHXA 1UAYA 2VUTA 5A3JA 4Z0HO 5L51A 2FPIA 3QQPA 2NTNA 4J2OA 4WLEA 1ZEMA 3OECA 3AI1A 4IJVA 4XKJA 4CLEA 4TZTA 3JSAA 5EQFA 4YAIA 5L9AA 4GX1A 3GC6A 5ER6A 2QYTA 3WIEA 4JN6B 1JAYA 2VWHA 3GDFA 4FW8A 4OQYA 3F5QA 4EZBA 5IZ4A 4QSMA 3JQ8B 4CQLB 2JCXA 4W99A 1U3TA 4ZQBA 3QWFA 1ORRA 3R1IA 2EJWA 1PZEA 3GVXA 4E0BA 3L0DA 1KVRA 3EDMA 4TKMA 3GFGA 2I3GA 2CVQA 1PGQA 5KOIA 1YE3A 3C1AA 1RWBA 2G5CA 1E3SA 4TRMA 5I8WA 2YUTA 1DPGA 4XRGA 3EHEA 3NJ8A 1WZIA 4N54A 3F4BA 4B4OA 2HU2A 1LDGA 5G2OA 3OJOA 1LC3A 3ETGA 4M54A 4ZQHA 4FFOA 5U9CA 2VHXA 1EVYA 4YRDA 1HLDA 3L6EA 4AJKA 5I9LA 5IFLA 4FSHA 2ILTA 2ZYGA 1BXGB 4AJLA 3HUDA 2BELA 1ULSA 4Z9YA 3AK4A 3BMQB 3GZ4A 4BQRA 4HUJA 4XIYA 2PWZA 2HMVA 5TSDA 3ZGYA 3WWYA 1AXEA 1HDXA 5LC1A 1E3WA 4H7PA 1KVSA 5TJHA 5ILGA 4GGOA 3ZWMA 2P91A 4DRYA 3WJ7A 3RQSA 5KJ6A 3DMTA 3ADPA 1BDBA 4U0KA 3FBGA 3H5RA 1Z75A 3AFNA 2HDHA 3PHIA 4WASA 3PWKA 1F06A 1K6XA 4OAQA 5DNAA 2YHIA 3JQAD 1HSZA 1XWFA 6ADHA 5DP1A 1PQUA 5ES3A 4J7CA 1HDYA 3ROMA 4OM8A 4D42A 1NXQA 1XQ1A 4CMCA 2HK7A 4RLSA 8ADHA 4BV8A 4DBZA 2XOXA 2JCVA 1XQ6A 1NWCA 3L4BC 1GEGA 2JAHA 2JAPA 4O1MA 4CLRB 1LLCA 1Q7BA 4HP8A 1B3RA 1TXGA 1Y8QA 3PGXA 1PJBA 1BTOA 1K3TA 2C7GA 3HHPA 3JTMA 5MDHA 1HE2A 1B26A 3L9WA 3UFXA 3AFMA 3AWDA 4MP3A 3DBHB 2CDCA 4CL8A 3W4IA 3ZWXA 4DPLA 4E21A 1VJ1A 1SCUA 1CIVA 1ENYA 1PL7A 2V6BA 4CLDA 3WTBA 4FIZA 3F47A 2C5AA 2B5VA 2JHFA 3OIDA 5B12A 4RF3A 3CZRA 4GSLA 5G0UA 1JKFA 4KWHA 4BNHA 1KEUA 1FK8A 4PG5A 2GD1O 2IZ1A 2C54A 1U4SA 3ABIA 1UZNA 1MB4A 3HFGA 3VHRA 3JQ6A 4YAKA 5C37A 5GZ1A 4R4JA 1GQ2A 3IDSA 5EPOA 5K9ZA 1YGYA 3SC6A 2PA3A 4R01A 5FFFA 3WNQA 1T4BA 1QRRA 1NYTA 2DC1A 3JYNA 3OEYA 3MZ0A 2AEJA 3O9ZA 1C0LA 1PQPA 3DHYA 1GD1O 2VRCD 3BTVA 3DOCA 4U8GA 3V2HA 4WCFA 3U0BA 4BB6A 3RC9A 2J5QA 1DSSG 2GUGA 3B1FA 5KVVA 3OFSA 3GPDG 2OL4A 4LSWA 4B7UA 1L7EA 2UDPA 2HSDA 2QYSA 4EUEA 2WYVA 2BD0A 3B6ZA 5HTOA 1GPDG 1LQUA 1PQWA 4W9NC 3F1KA 3OA2A 4R1NA 4OJNA 2W2KA 2AW5A 4K1LA 2P9CA 5KVCA 2GPTA 2DBQA 1X7GA 4JJIA 1LXCA 4AJEA 2QRKA 2RH4A 4BNUA 2H9IA 5TF4A 4CR6A 4KTTE 5JYEA 1X0XA 1V3TA 3NTQA 4IDBA 4OO3A 4BNGA 1ONNA 1R12A 3WR5A 3HN7A 1OMOA 4KDFA 4A7PA 3I23A 3AU8A 2X1HA 4DQXA 3DXFA 4J1NA 1JWAB 3PI7A 1P1JA 4J9VA 3QRWA 5IF3A 5G0TA 4FOOA 1I3KA 2BFAA 4CM1A 3VPGA 4KQWA 1ID1A 1MXFA 4OKIA 4WLFA 3EYWA 3AY3A 1MXHA 2ZJ1A 1CDOA 4DXHA 2HJRA 2HAEA 2JHGA 4CV3A 2O2SA 3G0OA 2NU7A 3O8QA 4A03A 3W8FA 3PK0A 4PLHA 2VZ0A 3AI3A 1TT7A 3F6YA 2NVUA 4DLLA 3PHLA 3FNHA 3MJ4A 1HYGA 4M89A 5B4TA 3MJCA 3MTGA 3ZV4A 3DAGA 3ZDFA 3HN2A 4ILKA 1N9GB 1R37A 3GNQA 3GRKA 5AXCA 1GQQA 3KBOA 1DIHA 3OJLA 4HWKA 1WMAA 4GLLA 1RM0A 4E2ZA 2G0TA 1I30A 3H3JA 3Q2KA 2LDXA 5I8ZA 3QWHA 3WQRA 4ALIA 1D1SA 2GZ2A 5KNLA 2AQKA 4LCEA 1NAHA 3LSYA 1MG0A 3PQFA 2OORA 4J1SA 1GY8A 3JD4A 4BNJA 2VYVA 2W2LA 3QWAA 1MC4A 3KEQA 5IN4A 4WPGA 2WSBA 3PRJA 4BGVA 5CDYA 2CUKA 4JX8A 4M8SA 1PZHA 3MWDB 3R3JA 3QWIA 4WLOA 1PJQA 1V8BA 4MVJP 5JSFA 4RZIA 5COBA 2PD6A 3HDYA 3ONEA 1G0OA 4R51A 2YV2A 2V6GA 4LSMA 2VYNA 4IBOA 5L7YA 4E6PA 3PWSA 4GAEA 4J4BA 2VT3A 2VHZA 2QRJA 1O9BA 2OFPA 2O3QA 4K9DA 4M1QA 4IM7A 4E5PA 3KLPX 5BT9A 1NHGA 3CPSA 5JAQA 3S2GA 4BO3A 3PZBA 4QTZA 3SJ7A 4Z9FA 3VOSA 4CM9A 1EMDA 1CETA 5COAA 4Q3NA 4CMEC 1X13A 3K8ZA 1Y9AA 2P5UA 2VUUA 1U7TA 4LVUA 2J3JA 3FHLA 4A26A 4ND2A 3LC2O 3IJRA 4GKBA 1DC5A 4NBTA 3VPHA 3EW7A 2X9GA 4XGNA 3QVXA 2GLXA 3GNTA 1DDOA 3V1YA 3QIVA 3GUCA 3CEAA 2O3TA 4E5KA 2WTBA 4J43A 3FTNA 3OHSX 3ZNOA 3GVHA 2CFCA 1TT5B 1QKIA 3TZCA 1X15A 1IPFA 4ND1A 1LSOA 4URFA 5TT0A 2BI8A 2Q99A 3UHAA 4KP7A 5COQA 3R0IA 5BSGA 5TNXA 3LF2A 5G0SA 4I5GA 4D41A 4DQVA 1ZEJA 3UCEA 1YJQA 3G1UA 1X1EA 3IL2A 3ZI0A 1GYQA 3BMCA 5F21A 1MLDA 4OH1A 2OBNA 1EUDA 3PFWO 5JNLA 3GPIA 1I3LA 1PSDA 1YOVA 4GPD1 2P4HX 2WD7B 3H5AA 3ZH2A 5FEUA 1YL7A 2YHUA 1RYDA 2CMDA 5C7OO 4PZEA 3OQ6A 4IXWA 4UVHA 4Y98A 2ZB7A 3I6IA 3ZU4A 1PJ2A 1GAEO 1R4NA 5LDHA 2DBVO 1E3JA 2IE0A 4ALKA 2CY0A 2R00C 1LRJA 4JLWA 1LUAA 4FPXA 6LDHA 4BNKA 5EQDA 2BH9A 2ZQZA 4GSKA 1I01A 2I6TA 1DRUA 1OBFO 2V7PA 3HE3A 1J6UA 1M66A 4AICA 1VRWA 3NDIA 4HY3A 4UUPA 2HK8A 3WGHA 1PTJA 1J49A 1NASA 4CMIB 1YQXA 5DCWA 5J23A 4H16A 5EIOA 3TZKA 3OIGA 2YYYA 1KY5A 4I8XA 4FFNA 4NJMB 4MVJA 2IEDA 3JQFA 4NQZA 4BGIA 3LDHA 4NMHA 1H0KA 2CVZA 3IS3A 2B0JA 1NNUA 4L74A 1TB4A 4IUYA 1ZMTA 1HXHA 3D3WB 5G4KA 2TMDA 5KIAA 4I5DA 1EQUA 1EDZA 1X14A 3NRCA 4RLHA 4HXYA 3T4XA 4MIYA 1EQ2A 1YDWA 3H9GA 3C7AA 5DCUA 3TOZA 5ICMA 1I2CA 3KSZO 1K5HA 1C0KA 5EN4A 3RUHA 4PG6A 1ZJYA 2HMUA 2GRAA 4DC0A 4NNJA 1YH3A 1A9ZA 5EINA 4JQCA 1NX6A 4G81A 5IN5A 2EWMA 3HNPA 4FJ1A 1DBVO 4BGUA 2PKQO 3SXPA 4XB2A 4XZ3A 2NM0A 4Q9NA 3BTOA 2B35A 1RM4A 3V8BA 3DTYA 2FZEA 3SC4A 1XHLA 4B3IA 4L0QA 4ALJA 1UR5A 1GL3A 3AM5A 3KO8A 2Q1UA 2FRDA 3NAQA 2EHDA 4QXMA 3ENKA 1EE2A 4UUMA 4CMJA 2RHRA 2ZB3A 1Z6ZA 5TLSA 4TVBA 4K6CA 4P4GA 1WDLA 4AL4A 5JDCA 4IY1A 1OC2A 1K2WA 1H9BA 3PYXA 1D8AA 3FBTA 3EUWA 2NSDA 3L9XA 3HZZA 2DM6A 2YV1A 1X0VA 2PR2A 2VQ3A 1T4DA 4DREA 1ZUD1 3GR6A 4EJMA 1B14A 1P77A 1NQTA 1YKFA 3QVOA 1PIWA 2X0RA 3WLEA 2ZTUA 4EJ0A 1PR3A 4UEOA 3RBXA 4BNFA 4Q3DA 4CJXA 3JD2A 4DMMA 3BTUA 3AM4A 3L4BA 4GMFA 2D0IA 3NYWA 4HNGA 1NPYA 4PZCA 1XGKA 1H5QA 3P5SA 3ZW9A 5DOZA 2YV3A 5L53A 2AG5A 3DOOA 3LU1A 4IMRA 3HWRA 3DEYX 3UKOA 3GUYA 1GTMA 3M2PA 2O3UA 4YAJA 1AHHA 2D8AA 5GZ6A 2EJVA 2HMWA 3DL2A 3I4CA 2WWRA 5K1SA 5KVQA 3P7MA 7MDHA 3PJFA 4J7XA 5CHEA 4CM4B 3JYPA 4II3A 3ICPA 3WSVA 1ISMA 3WICA 3NKLA 1KETA 4YT4A 2YZ7A 4MKRA 4P38A 4MKXA 4MINA 1ULUA 4CR7A 4WECA 1T2FA 3JQ7A 1E3EA 3WYCA 3BXXA 1E3LA 3EC7A 4BKPA 1LLUA 3RROA 2AE1A 2ZB8A 1XELA 3LT1A 4UAGA 3DZJA 3IQDB 3B1JA 2EEZA 3DDNA 4UUNA 1NHWA 4K6FA 3WDSA 3D64A 1IULA 4KZPA 4Z6KA 1VLLA 5A4DA 4TRNA 2NQ8A 3ROKA 1IL0A 2C0CA 1QV6A 5HM8A 3ZNPA 2WE7A 5JDIC 4BNIA 3ITDA 3R3SA 1HTBA 1T24A 3P2YA 5HWSA 3LZ6A 4UREA 3DZGA 3GG2A 3I9NA 3FCOA 1F14A 2UYYA 3JQ8A 4CQLA 1UUFA 3JQBA 2PFGA 4YJGA 2FWMX 2J8ZA 4NDNE 2EF1A 4XDZA 3AW9A 5AYVA 2IXAA 5CEEA 1KIFA 2AXQA 3WXBA 4OGWA 1T25A 1PWZA 3CUKA 3HADA 1P33A 1KC3A 1WDKA 1Z7BA 1NQOA 2ZK7A 4IS2A 3QV1A 1XCBA 2PGLA 3LT0A 4YJFB 1LTHR 4R41A 1ISFA 1UJMA 4WOKA 4GVXA 3U49A 4FCCA 1JVBA 2BFOA 1E7RA 2V65A 3PQEA 3C7CB 4JIGA 5GMOA 3X2FA 3UAGA 2W90A 5TS3A 3OSUA 4IDAA 3A9WA 4OIMA 5TX7A 1LEHA 1BXGA 1EK6A 1AN9A 1ADFA 4PLCA 2D59A 3PGJA 3TSCA 3CIFA 1U28A 1Z7EA 4R68A 4XIJA 1H6DA 3NGXA 5KTKA 4JJFA 1SNYA 3QE3A 5IXYA 4DBVO 3I9LA 4W82A 4D7AA 5HS4A 3LVFO 4CMGA 2QZZA 1HWYA 3ROPA 3WSWA 1R0KA 3ZHBA 3ASUA 3Q0EA 4BNLA 3V1TC 3EGOA 3L4SO 1RYEA 4OSPA 1Y5MA 1YS4A 3RKRA 1O6ZA 5G0VA 4WLUA 4E32A 1HYHA 3DBLB 4MP8A 2H1SA 4OSOA 5T8KC 4J3FA 1YWGO 3ST7A 5IG2A 5G4LA 2XPCA 3T4EA 4FJ0A 5B4UA 5JCXA 2YW9A 3L77A 1LDMA 3FWZA 5BQFA 2DUUA 3DONA 1JDJA 5H81A 4U6QA 1HZJA 2OUIA 5AXBA 3WYEA 4ALLA 3JD0A 2OOSA 3HQ4O 3OETA 4KQXA 3UF0A 2PGDA 3I3OA 4CLRA 3F5SA 3PYLA 5L4SA 4JBHA 1IOLA 3G17A 1VL6A 4P22A 4PLYA 4H15A 4MVJF 3I4FA 1O95A 5U1PA 5IAAA 3ZV3A 3EZLA 3OIFA 4PCVA 4BKOA 4QQRA 1QYWA 4LMRA 4CMHA 1CQIA 2GN9A 5I7FA 2BF7A 1PJ3A 3DMYA 4JXKA 1QV7A 2ZIZA 4YCAA 1ZW1A 4E2WA 1N5DA 1PS0A 3HJAA 2IYOA 3H9JA 1JKJA 2J3KA 1N7GA 3I5MA 1UDCA 4G65A 4R1TA 3FR7A 3IJPA 2DBRA 1PZGA 4CUJA 4IINA 4AJNA 1UXJA 1ENPA 3NUGA 4ZICA 1I36A 1TA4A 5JY6A 4BO8A 1EFLA 2CSUA 5I7SA 2WMDA 5F5NA 4J49A 1GEEA 1MA0A 4FDAA 2IZZA 1O0SA 2RHCA 3AU9A 3IAHA 3DZFA 4BVAA 4XQCA 1QSGA 3L07A 4MVJE 1C3VA 3T7CA 1PJCA 4D3FA 4CLHA 4CM3A 1GUYA 2A4KA 1U5CA 1JW9B 5THKA 3AUSA 1A5ZA 4FGWA 3MOIA 2R00A 1GDHA 3INGA 3JQAB 1Q7GA 1T2CA 1XU7A 1PZFA 4NU6A 3RFVA 4R1SA 1P1RA 3NTOA 4JBIA 1LDBA 1N1GA 1U5AA 5IDWA 3N7UA 2NLOA 4U0JA 1N8KA 1ZBQA 2WYWA 4IZIA 1M2WA 3VDRA 1VL0A 5HS6A 1ISJA 2I66A 2VZ8A 3BMNB 2A92A 4R5MA 1Y8RB 3SJUA 1E0DA 4GKVA 1U4OA 4PLTA 2YY7A 5A5FA 5KJFA 3GN2A 3TN7A 2I76A 4C7KA 5A06A 2UUPA 2GN8A 3WG9A 5IZCC 4FC6A 4GQAA 1EBFA 4J16A 3H7AA 3JQCA 1NVMB 4E33A 4PZDA 3E1KA 4YJHA 1K0UA 1NVTA 1DLJA 1F8FA 4UVIA 3QP9A 3COSA 3WIDA 3OMLA 3NT2A 2B4RO 4E2XA 3PJDA 1HYEA 3UCXA 1QR6A 4IZHA 3D7LA 3JQ9C 1W73A 1B15A 1Y81A 4PG8A 4S1VA 4NU5A 1QG6A 1ZNQO 5A04A 2I9PA 2OHXA 3ITKA 4XYBA 3ZWYA 2Y0EA 1ZK2A 3WBBA 1GV1A 2X86A 4CM8A 3RBZA 1SZJG 3H9QA 3WLFA 2FP4A 3ZHZA 1N9GA 1V0JA 2NQTA 3ASVA 4YT8A 3ANNA 1HE3A 3FN4A 5MGBA 4HKTA 2FPPA 3F3SA 3GK3A 4S3MA 4ONEA 3RUFA 3S55A 4QUKA 4RORA 4XA8A 3KZVA 1UDBA 2X6TA 3EK2A 1DIBA 3GRPA 4E5NA 1R4MA 1I2ZA 1PGNA 1DHRA 4X54A 3S1LA 3E9MA 4AFNA 2VT2A 1N1EA 4ZJUA 5CFZA 4JNKA 3PWZA 4OXNA 2OMEA 2AQHA 1VKNA 1SO8A 5HBRA 1KY4A 2UVDA 1ZMOA 2P9GA 1V3VA 1PJLA 5JCJD 2PZMA 2GO1A 4Q3AA 3TZHA 2Y93A 1GUZA 1LSUA 5CG2A 3QWBA 2E48A 9LDBA 4JCOA 5JO0A 2HQ1A 2EGGA 3Q6IA 2DBZA 1UXGA 5BSFA 2Z5LA 3BZUA 1KVUA 4NBWA 2XXBA 2VWPA 4HX5A 4RO0A 4BIIA 1QLHA 3PQDA 3RFXA 3GEGA 3WMXA 3ZHYA 4KUGA 5KVSA 1NQAO 5ER9A 1IHXA 4J0EA 3I83A 3M6IA 4QT0A 4FN4A 4DMLA 3LK7A 2J5KA 3K5PA 1IPEA 4MVJM 1RPNA 3KYCB 1RM5A 1Q0LA 1E6WA 1XKQA 2YFQA 4A10A 4W7HA 3BMOB 4CUKA 3IMFA 3A28A 3PIDA 4CPDA 1QYDA 2PZJA 5F1KA 1DJNA 1DB3A 3RC2A 3BHIA 4J0FA 1H93A 2GZ3A 5A9RA 2C5EA 3ZN2A 4NK5A 3GHYA 2I99A 4B8ZA 4OQZA 3KSDO 3P19A 4L4RA 1DC3A 4M49A 1I2BA 3H3FA 4RVSA 2C20A 1Y5RA 2DU8A 3UXYA 4ZQFA 5FI5A 1TLTA 2JFGA 1KOLA 2IZ0A 4Q3CA 3RWBA 4E2YA 1FDVA 3GN1A 1GYPA 3W4JA 1MGOA 1V9LA 3TRIA 1C1DB 4NZ9A 2ZKLA 4LW8A 1BWSA 5FF9A 3ZZNA 3JQEA 4QX6A 2POQX 2O3RA 3KM0A 3PEFA 3HB4X 1WPQA 1AGNA 3SLGA 4DIOA 4DPKA 1UDAA 2C2XA 2EP7A 4BKQA 1XSEA 1NTOA 3PHJA 1BXZA 1X1TA 2OP0A 4XJSA 3NV9A 4N5NA 3OH8A 2Q3EA 4RL6A 3D5QA 4XCVA 2X5OA 4FQ8A 4HBGA 3IUSA 4CMIA 1B7GO 3K2BA 4OOEA 2JKVA 2AQ8A 3K96A 1E3WB 4NJMA 2Q45A 4J1QA 3ZWVA 4BMNA 1EUZA 5C7LO 1E5QA 3DAPA 2VWGA 3WGTA 3ANMA 1PJTA 3VZSA 2NNLD 3M1AA 3ZWAA 4BNZA 5B4VA 1UXKA 1U8XX 1U9JA 2O4CA 2Y99A 3GFBA 4FR5A 4NJOA 4FS3A 4D44A 1YB4A 2G82A 4N5LA 4P4LA 2YHIB 3KUXA 4E5MA 1O89A 1FF9A 1F12A 3E6AA 3B20A 3TNLA 3GVIA 2ZTVA 3VDQA 1YONA 3DZBA 3L6OO 5B37A 1D7OA 3U4CA 3U62A 1UZLA 5T5QA 2FR0A 3JCZA 5JAZA 5A1TA 2Q2VA 4BO4A 2WYUA 3A14A 3JD3A 3SVTA 5A03A 2IXBA 4QO8A 4BS9A 4IGEA 2WEKA 5T67A 3ZNQA 4RPLA 3B70A 3MEQA 3ADOA 3UH1A 1HDOA 1SC6A 2P68A 1T26A 2EERA 2VTDA 2W98A 4BOYA 2AEFA 1P74A 1VC2A 3GF4A 1F17A 1QYCA 2AE2A 5BNFA 4L4SA 5LDGA 1BVRA 2ZATA 4IQGA 4B7CA 2OZPA 4KMSA 4AJJA 1RKXA 1U1IA 3JQGB 4AJHA 1I10A 4TSKA 3VVCA 4L73A 5EESA 4XYGA 4LK3A 3C24A 3ENNA 3VH1A 4BO5A 3GZNB 4FFRA 3GEMA 3GY0A 3QSGA 4IJUA 4L9RA 3SX2A 1HDRA 1D1TA 2YFHA 3PLRA 4K26A 2D5CA 3VAZA 3ONFA 3FNEA 1A7AA 4F3YA 1H6BA 3KYDB 2ZJ0A 5F5LA 5BNIA 3ZWPA 4QEDA 4YA6A 2O23A 3ETEA 1B16A 4BO6A 5L45A 2BHLA 4H3VA 4PGFA 1WXDA 4FJ2A 1ONOA 3T7EA 5K6AA 3D1LA 2Q4EA 4W7IA 2VNAA 3E5MA 1D4FA 1HSOA 3A4VA 2QZ9A 3MJEA 4RCVA 4YT5A 3RKUA 4DL9A 3E8XA 4TMFA 1GCOA 2R6JA 3DFZA 4AG3A 2PLAA 2X0NA 3GDGA 3DQPA 1LJ8A 3OJFA 1CEQA 3VKVA 1P1HA 1IUKA 3GVCA 2VHYA 4FFPA 1UP7A 1PGJA 3G1TA 2E6UX 3QVTA 4D0SA 1IZ9A 2NUAA 4XX0A 4J9UE 3VTFA 5JC1A 2DUWA 3ZWNA 4XWYA 5EL0A 1KERA 3WWZA 4PFJA 4BNWA 2D3TA 2VZ9A 4RF2A 3WFIA 3NTRA 4RV9A 2Q2QA 1EE9A 1SB9A 2EXXA 5L95A 4UVEA 3H9EO 3VPFA 2X9VA 3H8VA 4CM4A 1H94A 1DRWA 1WNTA 5C3MA 3TOXA 1E1MA 3BHMA 4DVJA 4AJOA 3FD8A 5F1OA 3BIOA 2I5PO 1TVEA 4ALNA 4P8RA 4BNNA 3RU7A 3Q3CA 5U4QA 3I52A 5JAMA 4DIFA 2X0IA 3I9MA 4DGSA 2DPGA 2NVUB 1LSJA 2BLLA 3H4VA 4WEQA 3WS7A 2A94A 3ZV6A 1W8DA 2VUSA 1S6YA 2DQ4A 1BW9B 3RASA 3UCFA 4YQZA 4CQMA 1K89A 1P1IA 2HO5A 4IMPA 2QRLA 2WM3A 3LLVA 1NR7A 4OMUA 3FI9A 1EVZA 5A05A 1LDYA 2O3JA 1WW8A 2VHWA 4XQ9A 4U7WA 4CLOB 1JU9A 5DULA 3GA0A 1UP4A 2GF2A 3DMTC 2NV6A 4UULA 2Y67A 1D3AA 1HKUA 4Y9DA 3NJ4A 4RZHA 5LCXA 3K2EA 2FSSA 2O3SA 3FSRA 5DBIA 4ESOA 1N7HA 3OQ1A 1YB5A 3GMDA 4JGBA 4IJKA 2HK9A 4LRSB 1UP6A 1SAYA 5ENVA 1NPTO 4CV2A 2EKLA 5T64A 4GL4A 5L4NA 2O2YA 4BNVA 1FDUA 3RBVA 2IYPA 1B8PA 3MCVA 3IP1A 4MP6A 5BSEA 5IDYA 1ONPA 2Y1FA 1C1XB 3F46A 4BQPA 4D79A 3U4DA 1U3WA 2LDBA 2PKRA 4YJFA 4I9HA 4KUHA 4MIOA 4PRKA 2X8LA 4LRTB 4XB1A 2BRUA 1M6WA 5JS6A 4NR0A 2J3IA 3PXXA 3E48A 3WGOA 3FRJA 3PTZA 4J2HA 3DBRB 2ZTLA 4ND4A 4L75A 4PLGA 5A5EA 2O50A 2DLDA 1BMDA 1PS8A 3JD1A 1PEDA 4I9UA 5TC4A 4XQEA 5FYDA 4I08A 2Y1OA 3LF1A 1Z82A 1PL6A 1KBZA 1U3UA 1ZSYA 2VYVD 2W2LD 1VL8A 4ALMA 1VSVA 4FGSA 1S7CA 2EKQA 2I65A 2JD1A 2NADA 2X0JA 4E13A 3KETA 1Y1PA 3GOHA 1XA0A 4RQUA 1E3IA 1GZ6A 3TPCA 1T1RA 3VPSA 1I33A 5T6BA 4CM5A 1DC6A 1EK5A 2VYND 3D4OA 4R9RA 1WZEA 4B8WA 2PH3A 1GR0A 3D4NA 3WJAA 4E30A 1ENZA 1DLIA 4YWJA 4CM7A 3MJVA 4CM9D 1J5PA 2NACA 4PLPA 5CG1A 4WCFC 4WUVA 2BFPA 4XRRA 3VKUA 2PKQP 5EERA 1Q0QA 1ML3A 2VNSA 4N18A 2E4AA 1R4NB 1W6UA 3PDJA 2Y1GA 5CEFA 1YQDA 4RVDA 3LQFA 4WCDA 1GADO 2CD9A 4B3HA 1P3DA 1T2AA 2D2IA 4ZD6A 3E82A 3I1JA 4R1UA 5JY1A 2IODA 3WYBA 1NAIA 1YO6A 3W6UA 1PR9A 4ZU3A 2ZQYA 4CLXA 1XU9A 2YDXA 2VRBA 3AI2A 3BA1A 4NPCA 3W6ZA 4D45A 2PV7A 1P0FA 1KS9A 4Y6RA 3G3EA 3GH3A 4JP3A 1OZAA 5FWNA 1PGOA 2AQIA 1EBUA 5JYDA 4P4NA 3ZU2A 3TWOA 3NT5A 1O8CA 2TMGA 1YRLA 1DFGA 2H5LA 4PIVA 1ZZEA 1H2HA 3G49A 3MJTA 4FC7A 4W9NA 5G4KB 1BG6A 4Z3DA 1GUFA 3GQVA 2DFVA 3GGGA 4AJIA 3FR8A 1JKIA 2DAPA 3CZMA 4YVFA 3VZRA 4Z3KA 4UUOA 5JXWA 3BYZA 1M6HA 1AHIA 4YPOA 1E5LA 4JP2A 3CMCO 4RF4A 2YQ4A 5DT9A 5A9SB 4FBGA 4WKGA 1I5RA 1YXMA 1P45A 2FR8A 1ENOA 3OP4A 1K6JA 4GGPA 5AOVA 4WGGA 3WQSB 5BNTA 4CUZA 1WAMA 1HE4A 3KEOA 5B1YA 3GLQA 2CVOA 2O7QA 3JQAA 2NVBA 4OKNA 5IDXA 4MVJD 2W8ZA 3X2EA 1ZK0A 3ICCA 2DT5A 3O38A 3ZWWA 3AUTA 1KYQA 4HFRA 2HRZA 1Y9EA 4BNXA 2JFHA 4BMVA 1T1SA 3M2TA 4XR9A 4ZVVA 4F46A 2C29D 3Q11A 2DTXA 2DKNA 3DO5A 3QLJA 4MKZA 2CDBA 4UEJA 1BSVA 3NEPX 2P9EA 4NHEA 3BMQA 3V2UA 5CDGA 1F8GA 1G1AA 4I1IA 4IQ8A 4UEKA 1ADCA 1ZFNA 3UOGA 2D5AA 2C82A 4EYEA 2FN7A 5DP2A 3GGPA 3M1LA 3AM3A 5GY7A 1ADBA 3CKYA 1NFRA 3FNGA 3U3XA 5A02A 5JAIA 1JQBA 1M67A 3PZRA 3W8EA 2EP5A 4YTEA 4HFJA 1QORA 3VZPA 1Y6JA 3C3XA 1PX0A 1ZK4A 4BGEA 1SPXA 5K0ZA 1LC0A 1SBYA 5DF1A 4C4OA 1E7WA 2FY8A 4R9SA 3A1NA 3K73O 4CODB 2Y1EA 1QYXA 3C8MA 4ZHSA 1KVTA 2C59A 3O26A 4R3WA 1EVIA 3LC7O 1DIGA 1KEVA 3VH3A 1H6CA 4IGFA 4Z0PA 4BO0A 3LLSA 2QQ5A 1RJWA 2VRCA 2FSVA 4CMEA 1HLPA 1IE3A 3V1UA 4TROA 1QP8A 1Y7TA 2JL1A 4R5HA 3ANLA 3QY9A 3S8MA 5F1PA 1XIVA 4DQUA 3KYBA 3LT4A 2HLPA 5AXDA 1LA2A 3DBHA 1XG5A 4HFMA 4ZGWA
chains in the Genus database with same CATH superfamily
3VH4A 4D0NA 1P2SA 2IOQA 3WVNA 1CEXA 2CFIA 4RD2A 4UHJA 3VAYA 3I42A 2Y0CA 4ZKEA 3VNAA 4FD2A 4M88A 1DE0A 3L5OA 4N7RA 4YI3A 1SY7A 4DSOA 4YWHA 4ZGBA 4KPEC 1ABBA 3M6UA 5AJXA 5FPKA 2O5CA 2PZLA 3NVMB 4IIXA 1WUHS 2QT9A 2ZRCA 4DUPA 4NCIA 4YV0A 5AW4A 1JLSA 1IAVA 1TOAA 1UBJS 4J91A 4O63O 1QHEA 4D46A 5EE5B 1U2DA 5LWHA 3EQZA 2XIJA 2KMLA 3H6HA 2PS1A 3GARA 3L1HA 1PTJC 2IHKA 2RHMA 5ELLA 5AXAA 5TR9A 2KLHA 4K81B 3V48A 4EPWA 1T0BA 4HK4A 1V8DA 4UUQA 1UPBA 5F12A 5AW9A 3Q7RA 5AUNB 2BI7A 3CH4B 1OASA 3HU1A 3AOEC 3JQFC 1X77A 4UU1A 3N74A 4ZVRA 2WYOA 2GERA 1FC0A 3BMOA 2WSYB 4GD3Q 3V1LA 2V0CA 3DLCA 2UVPB 2QZSA 1V16B 4AYWA 4B85A 5KCZA 2FOXA 4ZEMA 3JYQA 3MUNA 3REQB 1AM4D 1DUSA 3P2IA 4YB8A 2B6NA 3RYTC 3F90A 3IBTA 4DYVA 4CIBA 4WBNF 3CZQA 3OI7A 1DJMA 3FZNA 3TD2A 5HZMA 3CB4A 4HFNA 4ECAA 4JX9A 4ZDKA 4P0QB 3U3ZA 4BZPA 1INLA 1N3YA 1QIFA 2G70A 4YJGB 2XAAA 4ARBA 4WJLA 4Z8YA 3R5SA 4YHBA 4DRXA 1Y7HA 4PFSA 4QQKA 4C0SA 2YOGA 3VJRA 4B7XA 5EJFA 4LISA 3UKJA 2OV8A 1QIMA 2PKEA 1EA7A 1B76A 1TADA 1WE2A 1U2EA 3ONWA 2XZOA 2MOKA 4OQMA 3VDXA 3R24A 3OC6A 2VIIA 2QU8A 2DPHA 2EBUA 2HPAA 4N03A 4RC9A 3KAKA 2YWHA 3JZMA 5GAJA 3VKHA 1NJ1A 1PNOA 1Q3HA 5TPZA 1UH5A 3KCQA 4AC9A 1A5TA 3O3MB 2XUPA 3AESA 4G5RA 2I4MA 2I4IA 2JFFA 3COYA 3RTDA 3HNRA 2AHRA 1CDDA 3ENQA 4X3OA 2O8CB 2PGOA 1NP6A 2Q1WA 3HFJA 5F77A 1E92A 3PP8A 2Y0DA 2CKDA 3I2HA 3S3TA 1X7YA 1XRRA 1K9SA 1NA5A 1CS0B 2FP3A 2V4ZA 3CTMA 4RV5A 3ZV7A 1NUPA 3FPAA 4LV5B 4RENA 3RGWS 3SSMA 3EFHA 5TRTA 3UFBA 4I1YA 1G5IA 5TIIA 3KJGA 3C7DB 4GW3A 1HE8B 2GA8A 5DHSA 3QG5A 3I5UA 3QNWA 3GT0A 3OCXA 4QJBA 2MSLA 2QVLA 4M8NE 4YMLA 2PZKA 3AHJA 1BCRA 2JGKA 2P0EA 4MW1A 4II7A 3H4TA 4RVHA 1VSUA 1VL5A 2G76A 2GETA 1H2BA 1SKAA 1H5UA 3K16A 3Q10A 2C2MA 3VVBA 3MT7A 5DYTA 5F76A 4AQ7A 5GM2A 1W4CA 2UZ1A 5CX1B 3TIFA 1ZXBA 3ZDAA 1R18A 2EFEB 3CRW1 2AMFA 4TLEA 4Z7QB 4WNAB 3EDCA 1WKVA 5DMHA 1NU6A 3GJQA 3JV7A 2F67A 3K0KA 8LDHA 3MINA 2D7DA 1YVPA 5F4BA 1AF4A 4Z54A 3C39A 4IHKA 5F2OA 1KE2A 3F3MA 5A0VA 2VBCA 1AG9A 1DWUA 4RK7A 1AGPA 5B6PA 5HGXA 1QGUB 2VXBA 4O1HA 4LYJA 1OGJA 2DLNA 4UEQA 1LVGA 2C84A 4IIDA 4ZHQB 5BNZA 4JIMA 1EU1A 2RH8A 2ZYSA 1GZDA 1C0PA 2WFLA 3GBPA 3BREA 2NU8A 3TZLA 4HVCA 5BN3B 2C96A 1JLKA 1T6NA 3AIKA 4HAOA 1Z3CA 3UICA 2PRIA 5ITZA 1MABB 4EK9A 1ZL0A 1PV2A 3GMIA 3QENA 3GLKA 4MS1B 2F17A 1GFWA 4C04A 4HLQB 1W5AA 2W6CX 4OQEA 5J4YA 1OAAA 4MO2A 1VSQA 4BU0A 3HJNA 2GXSA 4NCXA 2VWQA 1MT3A 3A2MA 3U4IA 2YS6A 2XVYA 3FH0A 3GJRA 3D0RA 1LBHA 2QM3A 4CTJA 1KARA 5CDUA 3OZGA 1M6VB 1LX6A 2NPIA 3X1WA 4G0VA 1XLVA 1IH8A 2FQXA 3ACCA 3BAZA 3PQCA 3ZK8A 3AOGA 1YE5A 3MAGA 3QPCA 3AR3A 3VV3A 3TLBA 3FNFA 3KOOA 2J0QA 1GNSA 3RVLA 1G98A 4JGIA 2FMUA 4NFYA 1NI4A 4CEHB 3IP6A 2J5RA 1X9IA 1FU7A 2OILA 4BEWA 1MRZA 3IIJA 3B6MA 4IPTA 3TW8B 1G5FA 3ISVA 3U31A 5B3LA 1IUNA 2Q46A 1UWLA 4ZZ3A 2XBLA 3K1TA 2A35A 4KXQA 2Q62A 3GVPA 3HM2A 1YHNA 1E4EB 2H1VA 3MAAC 4IEFB 5AO9A 3EH2A 3W78A 4H1HA 4TRRA 1OLXA 2HJVA 3O1JC 3K70D 2Q28A 3UOAB 4FNMA 4DMRA 3LUFA 2IEGA 3WLIA 4C7JA 1GG2A 1A2QA 2FW6A 2YKGA 1GUAA 4MWCA 4XWOA 3D6JA 2FQ1A 5FULA 4J90A 1YI0A 3S2FA 2HIMA 3ZVRA 4I19A 4OUKX 1G8PA 3GIDA 3QF4B 2JFPA 3SG0A 1LFAA 1NPDA 1O5IA 4XWKA 5KYXB 3D54D 3W6OA 4TM8A 1F5SA 3FCUB 2G1UA 1JG4A 5D3KA 3PVSA 3OZDA 4PY2A 4IDEA 3SC2B 5D3ZA 2F3PA 4ENPA 5E9WA 1SVIA 2YMPA 3JATA 4X41A 1EFRA 2R7MA 4NE2A 3OQBA 4TLCA 4BNYA 4E4RA 6AT1A 3R9XB 2CLDX 2YVAA 3RAEC 4BUZA 1MO4A 2VDQB 3C1OA 3T3OA 5ITSA 3BH0A 1PWXA 3EZYA 3GRAA 1JTVA 2CCKA 3HLYA 4A0SA 3WRXC 3H1AA 1R8QA 1HDGO 4YQYA 4AUMA 5IH7A 2VP2A 1K88A 4K9OA 5LP6A 5C1OA 4YRAA 1B4DA 3D81A 1C29B 1X1BA 1XHEA 3H11B 4JB8A 4OI0A 2PJZA 4WBXC 1SCAA 3U7JA 1AO0A 3KV3O 4MWDA 2HREA 1AKTA 4CXMA 2PMKA 3RT7A 4WY5A 3HDGA 1YA6A 4BE4A 1O87A 3DE6X 3RVNA 4DR3B 4Q21A 2GTPA 3JWGA 4QUIA 4RGBA 3D3EA 1C9MA 1M2VA 4FGJA 1M34A 4XJTA 1GDTA 3NATA 4L95C 4BKRA 1WWKA 2XUFA 5JVDF 4J4TA 3S5JA 3VM6A 4L3OA 5FAKA 1EVLA 4AS2A 1LPAB 3FLBA 2C7QA 3CW8X 3SEFA 3WB1A 3ZXUB 2GLUA 3OOWA 1I3MA 1CUCA 1AC5A 1E6EA 4JUCA 2W37A 3QHPA 3BD7A 5DLPA 5ADHA 5FWXA 1KTIA 3GLGE 3NANA 1B6GA 1K6IA 2H5EA 2BFBA 2TECE 3GI1A 5HK9A 3LDFA 4EJSB 1JT9A 3KJEA 1NSFA 3TNFA 4X7MA 1LBQA 3CURA 5DSXA 2VN8A 2DKOA 3WGIA 1J0CA 1GGEA 1QDUA 4OATA 5KOYA 1XLTA 3Q2OA 4R1MA 1MF7A 2V0NA 3MIZA 4KI7A 4F3TA 1R4MB 1DO2A 4KQ9A 1NFQA 2KPOA 4DSUA 1V8OA 2WD9A 3E3MA 4IH9A 4QUGA 3WLOA 3U7HB 2Z1MA 1ZCBA 2NU6A 5DEIA 3GB9A 1HK7A 4XASA 2QW8A 2QN1A 3KZXA 4R2MA 4ZT4A 2I67A 2O2ZA 1EZ4A 1LI5A 2P2SA 4CIAA 2B37A 1MQ8B 3QHAA 4KXMA 2LR0A 3ZJUA 5HG0A 2IYVA 2YJ5A 5K20A 3OF3A 5GONB 3ORFA 2J6BA 1D6SA 4RTPA 2JJ8A 3W5UA 5K4AA 3FJOA 4DGQA 3AMVA 5E3HA 4MYUA 5J2UA 4YJ3F 3GLFE 1HETA 3SJCA 4S0ZA 2TYSB 1WLSA 1ZM4A 2DTDA 3B1KA 5KKAA 3RAGA 3KHSA 1T4CB 5CLLA 5KWEA 1RAAA 3LWDA 1KIMA 2WPNA 3E22B 4YBZA 4A3SA 5FL7D 4AVYA 2VHCA 5IBPA 1VP3A 2R60A 5JAOA 1DTWB 1SOVA 2EFHB 1Y9JA 5K4GA 3WAKA 3K05A 4DLBA 1CBUA 2BEKA 4LMPA 3N8IA 3ZLBA 4JBGA 3Q3JB 1N6NA 4ZCPA 4BCCA 4HRVA 3QPVA 3ADCA 1YHYA 5EPUA 1XZFA 4ETIA 1EESA 1OIXA 3DVAA 4LHVA 5EHXA 3U60B 1EG7A 1QMGA 1SXHA 1C7RA 3EDQA 4KSCA 1YC2A 3KZCA 4EPXA 1F2TB 1LPOA 4FONA 5T8KA 4MHTA 5JASA 1NBMA 1NURA 4WXMA 4Q16A 4Y2TA 1HUQA 1J22A 5IKXA 1A8HA 1MW9X 4OV6B 3M4YA 3TFQA 2Q3HA 3JYLA 3AZQA 3E9YA 1OA1A 1EM8A 1PNRA 3M4JA 1GAWA 2I2XB 2CN1A 1FUKA 2QUAA 3NOXA 3QFHA 4J8PA 1CDZA 2B4TO 4OU5A 4QYIB 1II8A 2I3AA 4H6VA 5BYJA 2AFVA 4LKOA 3ZY6A 1XF1A 2ZAYA 4Y6GB 3AZOA 4Z9XA 2YJ3A 3OOHA 4I9NA 2WZBA 2PQ2A 4RQTA 5FO0A 1TRKA 3UB3A 4D6YA 4EO4A 3I61A 2EOAA 3A06A 5JZSA 5M04A 1YL5A 2CNBA 3CX3A 1J99A 2JD0A 5C81A 4EBFA 3ZJTA 3GT7A 1QC5B 3EMKA 2MYNA 5DXAA 4DABA 3QOWA 3SWWA 1ZMRA 1BXKA 3I8XA 4PLWA 4R0VA 2GDZA 1DCTA 1JX6A 1G0NA 2XNJA 3L84A 4G23A 3TJRA 1XZBA 3HG7A 3UPUA 3GX1A 1T9GR 2Q0XA 2XEDA 4UAJA 5DNDA 5ITWA 2HSGA 3R9IA 3NHRA 1H2WA 4NBRA 3A27A 3FSEA 1SC1A 2FMTA 1Q3KA 4BV9A 2C4WA 4DLKA 1JI3A 4KIUA 4MIEA 1HH4A 2X7XA 4NH4A 1WRBA 4N0DA 1S2GA 2DBYA 4NIMA 1E1KA 3ZVKA 1JPVA 2D1FA 3CJQA 1H2EA 1SUCA 4PTZA 1GT6A 4R9NA 2Z2JA 4KITB 4C07A 2L17A 4F1KA 4QNMA 3VPDA 5LYJB 1FQOA 4OI1A 3RAJA 4X97A 3W4KA 4ND3A 4AJPA 4G3XA 2NU7B 1V7QA 1ST3A 1O0BA 2UZIR 4J6FA 1XD2B 1IY1A 4NL4H 4CIVA 1BN6A 1WP9A 1B23P 3DLAA 5CDTA 5BSWA 3WOHA 1ZS9A 3Q5EA 1B0UA 4I36A 1E1QD 4O29A 3U48A 4ARZA 5LKRA 2IBMA 2FSGA 4PRZA 4DV0B 4LY0A 1P4RA 2ZE7A 2C04A 1KEEA 1I3CA 2NXEA 1EXDA 4WH0A 1CF2O 1QLWA 3L1KA 1XHFA 1Z4KA 4Q7JB 5JSQA 1JHPA 4H35A 4I1PA 2G4CA 3CX7A 1XT6A 8MHTA 4KDCA 2RJ3A 1UPUA 2K2QB 4HDOB 3N6XA 1J1ZA 4FUQA 4YMWA 1E9RA 1Z45A 4L8YA 2IWRA 4NH0A 3VSBA 2I3ZA 3CZCA 5ENDA 4O5AA 1P7WA 1HEIA 5B1SA 2XDYA 2Y66A 4TVOA 1DU4A 3JZIA 4QECA 2G1JA 2A59A 1KP3A 3KTDA 4FEAA 5AP9A 3H13A 1W1UA 3FXAA 1SBHA 1AXGA 5B7NA 1DP4A 5JNTA 2AEMA 2PKYX 5F3WB 2ZREA 3BIJA 1MJGM 1K86A 3A6FA 3WLTA 2HUNA 3PNVA 4US2R 2OO3A 1KZGB 2P62A 3E9EA 3FWPA 5F1YA 1Q2XA 4MS3A 2Z56A 1NZFA 1XTRA 5BWNA 1VI5A 2DUMA 3DF7A 4PS1A 3E2MA 1BE1A 4FWBA 4IS3A 4DTIA 4ADSG 3BERA 3IT0A 4N5DA 5TT1A 2ONJA 1BDMA 3ZD7A 1U65A 4HDRA 1ECJA 1ULZA 3JQ9A 3JX9A 4JVOA 4V2UA 3TBFA 4FBLA 1TAGA 1L3CA 3CIOA 2PT5A 3T9AA 1W36D 2KWIA 2OM6A 2H11A 3PQ6A 1I7QB 3LLCA 5CXXA 4RVFA 2HPZA 1YDEA 1E2PA 2X4IA 4ZDJA 5KX5F 1ZSVA 2Q29A 2ZJFA 4FHEA 4XPIB 5KYUA 5IX8A 4YR9A 1SHUX 2P1DA 5BUCA 5D8DA 2PZ8A 4E51A 5KNCD 2OBBA 4IXTA 5DWQA 3RVDA 3UG7A 1W2HA 2HB6A 1EK2A 4OF4A 4Z7OB 4JLNA 3D02A 2VR1A 3FTCA 4HDAA 2HA4A 1P19A 1T5BA 2G28A 2ZTMA 5DGTA 3UB4A 1IYZA 3H5VA 3VPAA 5I4IA 1VYHA 1EFDN 3R7BA 4B17A 2C8VA 2JLSA 3TR0A 1BWQA 2FZ5A 3IOYA 2JBAA 1GTVA 2BGKA 2W0SA 3BMCB 3C41J 3TM5A 3ZNNA 4EPTA 1YAHA 3IULA 2P4QA 1JEAA 3FUXA 3T3IA 4B4VA 4D3YA 3S2EA 4A1OA 3LP6A 5JLJA 1XROA 2QRZA 2REOA 4GZLA 1M75A 2Q6VA 5JFOA 1L4EA 1ISGA 3FPKA 3NNNA 3R0ZA 1KKMA 3NIBA 1U99A 4Y67A 1BS9A 1TUEA 4JA2A 2WD8A 4MTCA 4XUCA 2CZCA 2X3UA 5CNIA 2HGSA 1ITZA 3T3MB 3BJZA 4LBZA 4BO9A 1IXSB 3PC4A 3COPA 3LL4A 2H1OA 2V1UA 1I8TA 2FU5C 1EP3B 2KBFA 2IVFA 2ODPA 5L3SB 2QTNA 4TRJA 4ZVUA 5JZBA 4QUBA 2ZCUA 2HV8A 2RGYA 5KTSA 3NYIA 1JL3A 4KIGA 3HSYA 1JR3A 1FFBA 2QIOA 3A32A 1QQ6A 3CE6A 3PR1A 1CERA 1WSWA 2B4KA 2QW1A 4KLRA 1Y63A 1WXHA 4JAVC 4RKWA 3TEMA 4OJMX 4QREA 1NN5A 1ZNYA 2W6QA 3KUKA 5IBRA 3UQYS 4OLBA 2WWXA 3D6HA 5B2ZA 3NJRA 3S99A 3VC7A 4RJTA 2F59A 1NUAA 5ALLA 2AJLI 4B43A 3PFGA 1GAQA 4RE5A 3T95A 1C7JA 2PNFA 2YWJA 1PKXA 4HBZA 1JP7A 2Z1NA 2J46A 1N92A 2XCUA 3NUQA 2A8YA 4QPZA 1JBQA 4TKLA 4UHKA 1QRSA 3HPQA 5IBCA 4R8KA 3OM9A 3L8MA 1RYHA 3PIIA 3FAZA 3AJDA 1S2OA 3TSWA 1EFTA 1GCUA 3FSJX 4FD3A 1LI4A 4GWGA 4LJAA 2CXOA 4JL6A 3WNVA 2JEYA 5ADWA 3T6KA 3P9SA 2JGAA 3C6XA 1E1NA 1ECBA 3ESAA 5CYOA 2WU4A 4LC0A 1YBVA 4D8YA 3W5BA 3FIJA 3RABA 3OLQA 3M9XA 3UG6A 5AW7A 3K92A 3TZQA 3UAVA 1MV5A 4JV5B 3GW8A 3L6RA 1U7HA 4TVKA 4OHVA 2ONCA 5FH9A 3UPTA 5EXPA 5LQNA 4E70A 1SQGA 2DPXA 1OIWA 1NJFA 2PQMA 2UVPA 3IBGA 4HJRA 1M34E 1V16A 4GBJA 1Z7GA 2ZZKA 5G3ZA 1T3TA 1R0RE 5LQUA 3RV3A 1D7AA 1UBKS 5DM60 4RVOA 2P9ZA 1Z6XA 1G16A 3HBAA 4AJ1A 2XXJA 4ANFA 4FE7A 3T5PA 1VHQA 4BFLA 2C83A 1U8CB 5EMHA 2R47A 8GPBA 2QORA 2AZMA 2VTEA 2RAUA 1CJUC 2XITA 3WY9A 4GX5A 1WY5A 1WF6A 2CWDA 2R5WA 3IMKA 4LJ4A 4WBNB 5ICCA 4RD0A 4DMUB 4MCJA 2F3RA 3G68A 2YY5A 1Y8RA 5A3SA 3IE1A 1YHZA 5EJ2A 1FTGA 1YAJA 3CSUA 5C1DA 1T13A 3HFRA 3PDUA 1FDOA 2ZRAA 3CINA 2DJIA 1WLYA 4IIVA 2VH2A 5IDQA 4YXWA 2E7ZA 3DFFA 3TTWA 2F00A 2GDJA 2EFCB 4IIUA 5A71A 4DUYB 1Q1GA 3TQHA 3E9CA 1U0RA 3CISA 4GX0A 3UVEA 3V1KA 1G64A 2P0YA 3RJ5A 2JLUA 2O8CA 3P4UA 3PSHA 3OPXA 5JRDS 3G59A 3Q9LA 3ML1A 3D1VA 4WADA 1B2LA 1M72A 3EZ7A 3VJMA 4U6NA 5JCJA 2XRYA 4XWGA 3IKJA 4QQFA 1A98A 5A7FA 4R0NA 3WRVA 1FYEA 3OEWA 5TV2A 2JFNA 3WGYA 1VMAA 3ESRA 1V2HE 2ZRHA 4BC1A 1J06A 1PFKA 4ER6A 4TS3A 4P54A 4DLNA 2JJYA 4J76A 3N59A 2OP1A 1VCMA 3TOVA 2XKBA 2OYRA 3R7SA 5DYNA 4L07A 5CX1A 4B46A 2X8JA 3R6DA 4X8OA 2H9AA 2PRKA 1BXRA 4BZZA 4DDTA 1Q0ZA 2EX4A 3BZBA 1SZDA 2IYYA 3RFCA 4F2DA 4PN3A 4DA4A 2QLBA 4UVDA 2GZAA 3OICA 3SXUA 4IDGA 1E9VA 4NYJQ 2XCRB 1YQTA 1XCJA 2OECA 2PHZA 4XVCA 4MYDA 5EGSA 3PGLA 3B1ZA 1S1MA 1W52X 1C9KA 1OHHD 3GP5A 1NBME 3CLHA 3RYHB 1T5LA 4ITUA 4MI3A 2AXPA 2HJWA 2HOQA 3GA7A 1JDVA 4I6JA 4JLKA 3D0QA 1L5NA 3ZY5A 3ZU3A 5BN3A 2Q07A 1ZIPA 1U5BA 3GHHA 1W34A 5A4MS 1Y34E 2H54A 4YH1A 3U09A 4EL5A 2YZKA 1P31A 2E4VA 2XWPA 4TZ6A 1JNYA 1MVNA 2FNAA 1DV1A 2WUEA 3KELA 4PG7A 4MS1A 4R8SA 3R7AA 2ENUA 1J0DA 2P6UA 4ZRMA 1IXYA 2ZLBA 3CJTA 1E5TA 3DXYA 1DJPA 4CR6A 2AHOA 2EW2A 2IU0A 4MMYB 3LO5A 3TSZA 5B6IA 1RWXA 2QZPA 1I51A 2PH1A 4BFXA 4PYIA 1M6VA 3IOMA 4IDCA 4R3NA 1MP0A 1ONBA 2KM1A 1TCVA 3A3NA 3FJ1A 3PEUA 1EEXB 5B58C 1QWSA 2HMSA 2WC1A 5DBFA 2EQ5A 3A3OA 4O4LF 4O2LA 4B3SB 4GHWA 1UAYA 2VUTA 3SQWA 3GPBA 2BMVA 1NW4A 1KK1A 2Q8QA 2FPIA 2V1XA 2NTNA 1M10A 1J7JA 1JR4A 3UWMA 1J8MF 3SR3A 5HCNA 2GTIA 4YAIA 4MUBA 5EQFA 3TW8A 1B73A 3SC3A 4PO8A 3GC6A 3NBXX 3WIEA 4YRJA 3NIFB 1L7PA 2RKOA 4IJ6A 3LZCA 1RCFA 2BUBA 4I9FA 2ZOSA 4Y6OA 5AHOA 1E4EA 3F5QA 4MR9B 4XLTA 1KMCA 4P3NA 5DHTA 3WQHA 3B6EA 5BOSA 3NASA 1U3TA 4NESA 4NQRA 5HOEA 3EPKA 2WU1A 2F8MA 3LUCA 1LVHA 2R44A 3CV3A 1CCWA 4MS4A 4E0BA 5JJIA 1AF7A 3WMRA 3OE4A 3IEKA 2CNLA 2P78A 3GZJA 4JJ8A 3PS9A 1OFTA 1GUDA 4UBNA 4XWAA 5IH3A 2B2CA 3QF4A 2X3FA 3OU6A 1PGQA 1B1AA 1YE3A 2P77A 3C1AA 4BEBA 3R0JA 3ZU6A 2WOOA 5I8WA 3CVJA 3I0MA 2PXHA 1AV6A 1G1MA 1CY0A 2O5VA 3PU6A 3KJIA 1NMYA 4RV4A 3GFPA 3ADBA 3F4BA 3X44A 4B4OA 1RJGA 1SQ0A 2X1VA 3EGIA 3R9XA 1L7AA 1R6TA 4M54A 4ZQHA 3CUWA 3VDNB 2YR0A 4FFOA 5JJ5A 4RNCA 3L6EA 1V37A 1PJZA 2V58A 5I9LA 3CVXA 4A91A 1N0IA 3ER9A 1DWPA 2X9QA 3PGKA 2XUQA 3M6XA 1PFYA 2RGDA 1QRDA 3FPBA 4QICA 4AJLA 2GEFA 4D5EA 1XXHA 1YQUA 2YJNA 3H11A 1PTKA 2N42A 2VL7A 3EFOB 2ZR9A 5F23A 2KB0A 4XIYA 4MR7A 4PAGA 1ZIYA 1AOXA 2GA9A 2DT8A 3ESDA 5HJ5A 2WG2A 1P4SA 4RAOA 1HDXA 3FETA 3IUYA 4W5OA 1E3WA 2OZLB 2RK6A 3ABZA 3O3OB 1W87A 1KP9A 4ZCLA 5ILGA 2IK8A 4QM7A 1TVKB 3KB1A 1KOJA 4OLJA 3ZIAA 2YNMA 4ZEVA 1XTTA 3A6HA 1P4AA 4HQLA 3PWKA 5H3HA 2PMDA 1XJWA 4B5LA 2VDUE 2ZT8A 5HOQA 1K6XA 2YHIA 2P9BA 5F2EA 2D1RA 1N57A 4D4LA 3LOQA 2WKRA 1Z8NA 2W48A 3D1JA 1BD4A 4DAEA 5JVDB 6ADHA 1E9AA 4J7CA 4M0PA 4ZC1A 1HDYA 4HDMA 1XAHA 5DM4A 3ROMA 1R8XA 2XRMA 3RRXA 4OU4A 3FSGD 4D42A 5HKOA 5ELXA 2I2AA 1XQ1A 3B1VA 4LZLA 2C61A 2ID7A 1N9ZA 2VC2B 3UJ8A 5L6LB 4G84A 1XZEA 2DRIA 4HAZA 4DBZA 2XD4A 5CH5A 5D5PA 1ZD8A 3CC8A 3ROEA 1QU3A 1MW8X 1GQSA 4C88A 3X1MA 2WHXA 5C35A 4CLRB 4FQ5A 1BQ3A 2R5NA 1LLCA 1Q7BA 2V3VA 4HP8A 5AHXA 3PGXA 1TQ6A 4ZU1X 5FJJA 1ACJA 2R1TB 3HHPA 1CHDA 3JTMA 3PC7A 3MFYA 1HE2A 4UPVA 5JANA 1CUHA 1XZKA 4G01B 4E09A 1N6KA 5I4CA 2JASA 3AWDA 1HLGA 1ZAKA 4XSGA 1ZINA 2V97A 2WWTA 3G5LA 4ECEA 4MV6A 4GG1A 3CLSC 1WU7A 3EA0A 4CLDA 1GPAA 3KD2A 4FIZA 3ZOKA 2C5AA 2JHFA 2WFMA 1Z47A 3F6RA 4TTPA 1U90A 4FQ7A 5H4HA 4ITVA 5GJWC 3F7NA 2CBGA 3R23A 4F71A 1FK8A 4PG5A 1PT7A 3LK6A 4XWTA 1OT5A 2GD1O 3KOZA 2C54A 1RWMA 1Q0RA 1U4SA 1UZNA 3E22A 3BXOA 3HFGA 3VHRA 3W2GA 5E1MA 5C37A 4GQIA 3OEEA 4RD4A 4YJ3B 1DTWA 1XMOB 1GQ2A 2RD2A 5LD2C 1I6WA 1EP2B 4KC0A 1G20A 4X1YB 2AFRA 2ZE5A 4HNAB 4E15A 1VA5A 5FFFA 2WVJA 1T4BA 3OEYA 4MA0A 4ILEA 4R2WA 1T2VA 2AEJA 1DBRA 1YZQA 2JA1A 1EGMB 1C0LA 4H59A 2XT9A 1XQ9A 4BU1A 4Q1CA 3WGVA 5AW3A 5CYGA 4F3KA 5L6MB 3BTVA 3DOCA 1Y1RA 3KQPA 3V2HA 5FOQA 2ZRDA 3TGLA 3JQRA 5LN1A 1RRPA 4DM7A 3VU1A 1BJRE 3E4CA 4BCDA 1RI4A 4BLRA 4B7UA 2HSDA 2QYSA 1PR5A 2VKTA 4KPUB 1E2DA 2QTFA 2BD0A 2YICA 3B6ZA 4HGYA 4Q6WA 3UK2A 5FD8A 3C87A 3JVDA 2QUHA 3PXEA 3PT5A 2A33A 4AKGA 3KLNA 4B48A 5IUJC 3HCFA 4QYIA 4W9NC 3PNYA 4BVEA 5A2QA 2ZYWX 4UNIA 2H4XA 2QM0A 1Y4DE 1SG0A 5AVWA 3CO5A 3GAMA 3HP1A 2P9CA 4ZCMA 3CU5A 2QRKA 2RH4A 3TLCA 2H9IA 1CC1S 3IUMA 4MQBA 1QC5A 3X1ZA 2H7XA 3FYHA 2YJTD 3CFYA 3N9IA 4KTTE 4TTAA 4OO3A 5F78A 4X61A 4BNGA 5FV4A 1R12A 2V54A 4ZXFA 3WR5A 1Q7EA 4RTSA 1CULC 3UHOA 2P4UA 2GM5A 1JFFB 2X2EA 4DSTA 4IH4A 2QPTA 4PC2A 3D3JA 3HEMA 2ZTSA 4JQSA 1G18A 1EE1A 5HX7A 3C3DA 1JEQB 4K40A 3TOCA 3M6FA 3VOBA 1TVMA 2AMYA 3LWNA 2JGEA 2HWYA 4TT3A 4Y7DA 3S8MA 1I3KA 4CM1A 2PCJA 4LF9B 3RU2A 3OG9A 1EAYA 3VPGA 1ID1A 1MXFA 4MUIA 4OKIA 3B6JA 5DK6A 4WLFA 3RUPA 5LYJA 3DP7A 1V1RA 2MWMA 2AZTA 1KEZA 2ZJ1A 3QIAA 1NJGA 2LZ0A 1FP4A 2ARKA 2NU7A 3K5IA 1YDFA 4L5JA 4JI3B 3W8FA 4A03A 1W5FA 1H23A 1XD2A 3F6YA 1G4UR 3U7EB 3EN0A 3NNSA 2NVUA 3QBEA 4M89A 1HYGA 1PR6A 1J1IA 4HTFA 2IUFA 1XFAA 3MTGA 5IW8A 3SKYA 4F21A 1L4NA 1OI3A 2R7KA 3AKCA 3DAGA 1R5BA 4MV0A 3U81A 3WDKA 3UJHA 2EVWX 2J0UA 2FP4B 2N46A 3L8ZA 4ILKA 3GNQA 1FNDA 5DEOA 4MWOA 2NZXA 2N1BA 1US8B 1XTSA 3C97A 3P0JA 1WMAA 1LVUA 4E2ZA 5JCOC 3H3JA 3V46A 5I8ZA 3WQRA 2MJLA 2D13A 4U9HS 1D1SA 3HXTA 1RXUA 1OR8A 5I47A 2B9VA 3KQTA 3VYRB 1GY8A 2CKMA 4JL5A 1RDFA 3N6RA 5FKJA 5AKYA 1SURA 2VYVA 3QWAA 2WIDA 3DHVA 1VQ1A 1XF9A 1UPFA 1W19A 2WSBA 3MTDA 3L79A 2WSSD 1YZKA 2YFKA 2DUNA 3OCCA 3LHFA 2I0FA 2R2AA 4PQRA 1KP2A 1OT3A 3PNOA 3QWIA 4WLOA 3Q0IA 5EJ8A 4MVJP 3ESYA 3IDFA 2GN0A 2L42A 2PD6A 3HDYA 3ONEA 1SKQA 4KSYA 4PICA 4RMIA 4J75A 4LXHA 4C4PA 4OLHA 3SBEA 4GAEA 1Q1ZA 2R8ZA 2XZDA 5AM5A 1LBTA 2LKDA 3C43A 3VNRA 4K9DA 3GQBB 4M1QA 5LMNB 3Q7IA 2YWXA 3K0EA 1GIAA 1VG8A 3PZBA 1X74A 4YRFA 1F0KA 1IWBB 1KI3A 1M54A 1M7HA 3MPUA 1U98A 2Q8PA 4OXQA 3VR5A 4Q3NA 4MGIR 2Z6VA 3W6NA 4DLXA 3TX2A 1IEWA 1ESEA 4IWXA 4M1OA 2J3JA 1RWOA 3FHLA 3HJGA 3LC2O 3MWYW 3P9YA 2CVPA 1JHUA 1DC5A 5TF0A 3CRNA 3SLRA 1SG6A 4F3RA 3K0SA 4N3CA 3G13A 4XGNA 4LDRA 4RY8A 1USVA 1QDEA 1QGOA 2J9FA 5DBOA 4JMLA 3JXEA 4N39A 3UYKA 2NZVG 5JSHA 1GPUA 4XPIA 3DE2X 4JLJA 1PFUA 5L3QB 2Q4OA 4OGFA 1UC9A 2WIGA 3FTNA 3OHSX 1FXWA 1KK0A 4J43A 3IX7A 4P86A 4E08A 4HWRA 2VZLA 4ZYLA 1JJBA 4D3ZA 4I50A 1SCIA 2VNJA 1SIBE 5KX5B 4S0XA 4KP7A 1CY8A 4DR4B 5JOQA 3ZGXA 5G0SA 2QGNA 1UK6A 1KPGA 1NBIA 1ZEJA 4G63A 2R66A 4X7RA 4B82A 3DOUA 1H0HA 4URUR 4ZV7A 1RRGA 3B3FA 2QNBA 2IPOA 3BMCA 3U9SA 4Q00A 5MN6A 2ZS7A 2NQ2C 4OH1A 1Y3HA 2EQBA 1H4SA 5JNLA 5KHAA 5JH7A 4LJSA 1WDWB 2DWPA 2WD7B 2G9VA 3HI4A 2ZJ2A 2YHUA 5CLQA 3KQNA 1SBCA 3CWZA 4L8FA 2A5YB 1FUIA 4PZEA 3PUHA 2ZB7A 2DR2A 1QQ5A 1GAEO 5DASA 3KIPA 2BFNA 4G0XA 4NOKA 4N01A 2VDJA 4YV1A 1NW6A 1NR5A 2AXEA 1E3JA 3OU2A 2QTHA 1I2DA 2R00C 1FRVA 1I4TD 4RULA 4G09A 1XZIA 6LDHA 2Q5CA 1DTSA 2ZQZA 5L3SA 1I01A 3I04M 2C5GA 3KX2A 2WZCA 2I6TA 3OQJA 4G89A 3S6JA 1DRUA 1OBFO 3AB7A 4AF7A 2V7PA 4Q12A 5F35A 1M66A 2P2NA 2BONA 2EATA 2QJOA 3EQ8A 2B20A 4M1KA 2WI8A 5I7OA 3G2IA 3NDIA 2GAFA 4LXTA 4HY3A 1X86B 3ZX5A 2HK8A 3VX4A 4YRIA 1PTJA 2EFGA 2LIVA 5IT4A 1NASA 4JLOA 4CMIB 2NXWA 2JFVA 3FA2A 3OPYB 1RJFA 1YULA 1WEHA 3D7SA 4KACA 4CKXA 2CEKA 1KY5A 2PMWB 2NPOA 1Q74A 4I8XA 4REQA 3JQFA 4NE9A 4NQZA 4V0OA 1UK8A 1SZCA 5CT9A 3TEFA 1L5VA 5IS2A 5I45A 2ZBFA 3IS3A 3FPGA 3D6NB 3ED5A 2B0JA 3C15C 1XN4A 4L74A 1SK8A 4KXXA 4U2GA 3GRVA 1GZVA 5EWJB 1ZMTA 4DVGA 4KREA 1Y3BE 3DCIA 4I1OA 4JOQA 1VZ3A 5GVSA 2B30A 3B1YA 4GYJA 4J6EA 3FOEC 5JJKA 3JQQA 4F38A 3VYSB 4Q4HA 4I5DA 1QFYA 5KIAA 1WQ3A 1EDZA 2Y1XA 3ETLA 5E9AA 3T4XA 4MIYA 3CBQA 4O2BF 3C7AA 5ICMA 1XXHE 2UUCB 3GEHA 4UUBA 4KCGA 3EZXA 3SZMA 5C8YF 2JJ1D 5IRCD 1IN8A 2IH4A 2HMUA 1KOGA 3VNVA 4NPAA 2ZAOA 4NFLA 3IEMA 1OXSC 1VXRA 3AP3A 1ORVA 3I9V6 4P5EA 5IC5A 2GD2A 2I3BA 1U80A 7GPBA 5EXSA 5K03A 1OWPA 4RIFA 1CUZA 1NUUA 3IAXA 1OTXA 4NOJA 1KI1A 3MQ2A 3N2IA 1NBWB 1K8RA 2JIMA 4JB0A 2EWMA 3C6BA 2SECE 1DBVO 4LOHA 4LMBA 3SJZA 4YRCA 4YHHB 4MW9A 1YB6A 1EHYA 1G6OA 5IANA 1AKUA 3FFAA 3MW8A 2HIGA 1COWA 2YIJA 3KEFA 3WJ2A 1RW4A 4TT3D 1EP9A 3WB0A 4BCBA 3A25A 3IQEA 1OXTA 1VFPA 1XHLA 2WAYA 4ZT7A 3TFWA 4YCDA 4LOJA 1WB5A 3T0IA 4L0QA 4JR1A 1GL3A 4DUGD 4ZOBA 1N3LA 1VHDA 1AKQA 3KOMA 4V0LA 2WQ6A 2BP7A 2FSUA 4QXMA 2HD4A 3CCBA 2DERA 3IBFA 1VLQA 4OJKA 1Z6ZA 2REBA 1ZITA 3FKSA 4N3GA 5C0OE 3WADA 5TLSA 1FBTA 4K6CA 4TXHA 4H7JA 1WDLA 2A0YA 3EDRA 1VOTA 4AL4A 1OC2A 2V7VA 3SX0A 4B2YA 3DTVB 3VVMA 2EC5A 3PYXA 4BNDB 1D8AA 4F93B 1Z08A 4FZRA 2JG3A 5TMBA 2EYUA 4YCCA 2XAUA 3B5IA 1ZJJA 2HQSA 2OFWA 2JFOA 3D6FA 5K1ZA 2J3QA 3VR6A 2A7QA 3BWBA 4BUJA 1KI9A 1QTRA 1B14A 2DSNA 3B9RA 4TVSA 4G4SP 2XUGA 1R88A 2X0RA 4HNQA 2JLVA 1TQHA 4TYWA 5DI9A 3WLEA 3ZD8A 3IAS6 2P40A 3JPYA 2ZTUA 4HVAA 1ZC3A 2GYWA 2YYSA 3C48A 4Q93A 3CPJB 4BNFA 4G26A 4UEOA 4EJ0A 4YRMA 4C7OB 1Z6PA 4UXHA 2DPMA 3JD2A 1I6MA 4ZYYA 3GD5A 5AW6A 1USGA 4HXEB 1N7JA 3AM4A 3OUZA 2EZTA 2D0IA 3IAFA 2QN8A 3KJHA 3NYWA 3IV6A 4HNGA 1XGKA 1LKZA 5HJ7A 3KVVA 3R4VA 5IT5A 1G20E 1P1BA 2FEMA 1KZHA 3JWIA 4QJIA 4ZV4A 3T4PA 4R2JA 4LF8B 3B3QA 3A9UA 4IP0A 4UCFA 3WYGA 1KHTA 1M8KA 2QTBA 3FBWA 5LB4A 1N5JA 4BWFB 3GUYA 4OYYA 1ECGA 4Q1AA 4WW0A 1AHHA 2ABWA 2BKXA 5B1IA 4UASA 2D8AA 4TYMA 5GZ6A 3HZOA 4A9AA 1SN7A 4GXRA 3RYHA 2X7JA 3R3HA 4DLPA 1J2YA 3HL4A 1G4AE 4GFDA 2ZPTX 4PWZA 4QXPA 1FFAA 5JHGB 3IOBA 4QD3A 3TK1A 5K3OA 3JYPA 1VL2A 4UC0A 4N48A 3LTEA 4M0KA 1E0JA 3DDSA 1RBYA 2DGDA 4JT4A 5TEWA 1NG9A 3F4KA 1PV1A 4O4IA 2YZ7A 4BRWA 4P38A 3WGJA 3VR4A 3A9RA 4OXXA 5BO5A 3T3DA 1ULUA 5B58T 5B30A 2R4QA 2F3UA 2D2XA 2GXQA 3EY9A 1Q44A 5E6RA 3SE0A 1KDOA 1E3EA 2O07A 1J39A 3HVHA 4ZDWA 2H2DA 4EVIA 2JANA 2ZRKA 1M0TA 3U1BA 3E23A 3QVUA 2QUJA 3NHWA 4R1QA 1CUFA 5DGDA 4MJ3A 2ZAMA 3GJ0A 4M9QA 1VMDA 2AE1A 2ZB8A 1U0JA 3WL6A 4JYMA 2QXYA 5TXGA 2FZLA 3T15A 3DNPA 2EEZA 4OCZA 4K6FA 3BWXA 3WDSA 5A4DA 1YUMA 2GZSA 4TRNA 1QGDA 2NQ8A 2X42A 2DR0A 4NC9A 4LFCB 1CUXA 3T5CA 4KH1A 5HM8A 4JQOA 4WFQA 3IP5A 3TLAA 2G7MC 4O4LB 5JDIC 3K8QA 1P2DA 1ZD4A 1E2LA 1HTBA 2OMKA 1FQWA 2ZG6A 4JASB 3VQTA 4F12A 5B3AA 4N3BA 4B3FX 1HPLA 1UKCA 2D74A 3G02A 2I2DA 1RQLA 1HFJA 3GRRA 5EOVA 4URXR 1BA3A 3WRXA 3W5DA 4Q9IA 1KDYA 1MJFA 2PSHA 1KKUA 1XO1A 1YV9A 5AYVA 1YRBA 2Y9PB 1TAQA 5AI5A 3QEMB 2AXQA 2IGTA 4UFOA 5ERXA 3I2JA 3WSTA 1P33A 2G3YA 4Y1FA 2WU8A