4JBIA

2.35a resolution structure of nadph bound thermostable alcohol dehydrogenase from pyrobaculum aerophilum
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
333
structure length
333
Chain Sequence
b'HEMRAAAFSTPGLENLKLVEAETPRPGPGEVLIRVKYAGVNPLDYNVVAGAVKASPMPHIPGSEFAGVVEEAGPGVTGVSRGDPVVVYNRLYCGHCRQCLTGWTQMCEVTGGGIIGIVTQGGYAEYAVVPAKNAVATRADLKEAATLPIGALTAWNMAYRASISPGEKVAVVGATGNVGIYAVQFAKLLGGEVYAISRRKAKVESILKSAGADAVLTPDEAKSAAPFDVVLDPTGSASWDLSFGVLGRGGRYVTAGALTGAEVRLDLRRLYGMQILVIGATGGRRADFNTVVRLLEAGRIKAFLHNVYPLADVRKALEELRSPERVGKVLIAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase (Zinc)
publication title Physicochemical Characterization of a Thermostable Alcohol Dehydrogenase from Pyrobaculum aerophilum.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Oxidoreductase
total genus 108
structure length 333
sequence length 333
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jbiA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4jbiA01
4K6FA 3IAHA 2VTEA 5TGDA 3UVEA 3DWFA 1VSVA 3W8EA 3A14A 2NU9A 4E5MA 2EJVA 3ST7A 1PQWA 3DZJA 1GEGA 3RJ9A 1JN0A 1H6DA 1T2DA 4JIGA 2GN4A 3E9MA 1U4OA 3DTTA 2ZB3A 3OFSA 4IDAA 3U3XA 2O3RA 2DKNA 2RHRA 1PJQA 4HUJA 1PWXA 3UN1A 4B4OA 4OO3A 3VKUA 1YOVB 4CQMB 2DBVO 3GVCA 3GG2A 5HA5A 1I33A 3QV1A 4CPDA 2YQ4A 4YB8A 1UP6A 1Y8RB 2ZK7A 3KBOA 1E1NA 1E1MA 3AOGA 4PLFA 4E32A 2VRBA 3EUWA 2X4GA 2GD1O 2ILTA 2VT3A 3CINA 3JD1A 1C14A 4KUEA 1BVRA 3DOCA 4MO2A 4XGIA 4XYMA 3PP8A 4MP3A 3WMXA 4BB5A 1ADBA 5I7VA 3I9MA 4QFDA 1KC3A 3AI1A 1P74A 2DC1A 4AJPA 1G6KA 3WQRA 2VYVD 2B37A 3ORFA 3T7EA 1E5LA 4DIOA 1VM6A 4OOEA 1JKFA 4R01A 4D0SA 4F3YA 4BHTA 1IYZA 3WQQA 4FIZA 3FI9A 1X0XA 2HO5A 4IDEA 2ZB7A 2FZEA 5KVQA 3TQHA 3WICA 4ALMA 4ZN6A 1J5PA 2PA3A 4WECA 3P2OA 3A4VA 4M87A 4E4YA 4WGGA 1L1FA 4BMVA 2IYPA 1Z45A 4RF2A 1NQ5A 3DDNA 4RVDA 4E2YA 4HWKA 2C07A 3TZKA 4TMFA 3PIDA 4AJHA 4RF5A 3EK2A 4HKTA 2GPTA 3AUUA 1GYQA 1C1XB 3KXDA 3PQFA 1GZ3A 5ADHA 4JQCA 1I10A 1NPYA 4PVCA 1E6UA 4HV4A 1VJ0A 3SVTA 2B69A 4Y8VA 4PLHA 4YT8A 5L51A 2Q1WA 3WXBA 4BNKA 1YBAA 3CIFA 2O4UX 5L7WA 1VC2A 4B7XA 1R6DA 4NG5A 2QZ9A 2AW5A 4UREA 4YJGA 4JCOA 5COBA 3PYLA 1YL7A 1L7EA 3F47A 3JYOA 4WLNA 3K73O 1MGOA 4BO6A 1ID1A 3QE3A 2C0CA 1F0YA 3BIOA 1JWBB 1TT5A 1JAXA 3FNFA 3LT2A 4MPDA 1ADFA 2Q1TA 3V1YA 3ITDA 5DOVA 3ROPA 4RPHA 5FI5A 3JYLA 1PR9A 1R4NA 4FCCA 4GLLA 3BYZA 1D1TA 1PGJA 4RLSA 4RVGA 4E21A 3RKRA 1PJ4A 3U0BA 4H7PA 4BL5A 2CDAA 4IJKA 3I6QA 1AGNA 3IMFA 3NDJA 4OXYA 4UUPA 3WGTA 4GMFA 3PQDA 2Q2VA 3PJEA 5I7SA 1E6EA 1MG0A 1QV6A 1WMBA 2B83A 2IXAA 2CDCA 3MWDB 5KCZA 1F06A 2XPCA 5F3RA 4MKRA 1ISJA 1VL0A 2WD7A 3DXFA 3AM3A 1UXKA 4R69A 1ARZA 3PPIA 5I9NA 1HDYA 2NTNA 1U2GA 4FB5A 1Z82A 2OP0A 1Y8QB 1C0PA 3S2EA 3ADPA 4TSKA 4QX6A 3F1LA 1XA0A 5BSHA 5ILOA 2EKQA 3EZYA 1UDBA 3RI3A 1Q0QA 1YJQA 3GNSA 4R1SA 4FOSA 2XXJA 1Y9EA 4W99A 2UUOA 5TS3A 4ZGWA 1W73A 1ZK4A 2Y0EA 2LDBA 2NQ8A 2B5WA 3WSWA 1R0LA 1SO8A 3L4SO 2VNSA 3RUEA 3DAPA 1JVSA 3PDJA 5KKCA 3DZFA 3F46A 2JL1A 2CD9A 3C3XA 1ZKMA 1NBOA 4CM8A 1PGOA 3AOEA 3JQ9C 5MGBA 1ISHA 2JFFA 1C0KA 5EINA 4CQLA 3H9GA 3KYDA 4H16A 4XR4A 3GR6A 4IJVA 1LBEA 3E48A 1P3DA 1QSGA 4XQGA 3Q3CA 2FPGA 2HMTA 5B4UA 4ZQFA 3H9EO 1LSUA 3HQ4O 4J16A 5T6BA 4CR7A 4Y67A 1P44A 1UZMA 1Z74A 3S2IA 3E1KA 1X14A 2I99A 1M76A 1E7WA 4BNGA 4CUKA 4A26A 5K0ZA 5JBIA 1PWZA 4WCFA 1TB4A 5H83A 3CTMA 1P0FA 4IDCA 3JQGA 3ZHXA 3ASUA 2VYNA 4UEJA 3JV7A 4R5MA 1A7AA 4NJOA 3PHIA 2VT2A 4XQCA 2GYYA 4B4UA 2Y1GA 4E5YA 1X1TA 4Q3NA 3E5RA 3DAFA 1EBUA 2Y1FA 4W9NC 2WDZA 1EVIA 1CERA 4FGWA 1KVQA 1ZVMA 3LU1A 5TJHA 2BF7A 1B8PA 1EK6A 4TZKA 2J6IA 2FPPA 4TQGA 5CP8A 4OOFA 4YJFA 3JD2A 3VAZA 3DBVO 5AXAA 4E13A 3K6JA 4FC7A 3HSKA 2HDHA 1MP0A 4A2CA 4BGEA 1NFQA 3GEMA 3H7AA 2Y66A 5CDGA 2E6UX 2X86A 1DLJA 2PKRA 2DUUA 3FSRA 1N8KA 1ZSVA 3WLEA 2QIOA 3WDSA 2Q4EA 4EYEA 5JE8A 3Q6IA 3IUPA 3O03A 3FNGA 1HDXA 1RYDA 3R1IA 4KWHA 2PH3A 2H1SA 3UGKA 4CM4B 3GF4A 3FD8A 3ICPA 5ENVA 4JJFA 2O3JA 3H6KA 4B79A 3CMMA 3INGA 1SZJG 4DL9A 4DIFA 2OXIA 1MLDA 1UAGA 2RH4A 4GPD1 3KEOA 4UUOA 1D1SA 1PJTA 4CL8A 4YT4A 4AFNA 1ZO8A 1M2WA 2J5RA 5EPOA 3I4CA 4ZRMA 1YH3A 3FBGA 1EVZA 3WWZA 2Q2QA 2GLXA 3DBHB 4XCVA 5T8KA 3GHHA 2Y1DA 1TT7A 2JAPA 4PG7A 2NNLD 3EGOA 2BH9A 3CH6A 1EMDA 2W2KB 4QXMA 3FPLA 2YHIB 2V6MA 4YA6A 3ZI0A 3OJ0A 4LRSB 1YWGO 2BRUA 1KBZA 5TLSA 1EDOA 1LA2A 3AFNA 3F6YA 3ZGYA 4URFA 4ZICA 3R6DA 1PJ2A 2NV6A 2BI7A 2VRCA 5IG2A 1AUPA 1T1SA 2HMSA 1LU9A 3HG7A 4WK6A 3OETA 4PZDA 4S1VA 5LDHA 1DFHA 2PZJA 3VH4A 5A04A 4DQVA 1AXEA 4HP8A 1NHGA 3VTFA 4O1MA 1ZJYA 4UUNA 5EQDA 1AN9A 3PGXA 1O0SA 5F5LA 4K28A 1Z6ZA 3LK7A 1HZJA 3DHEA 3ZWAA 3BMCA 1I2CA 3MJTA 2J5QA 1MB4A 4OQZA 3WTBA 2OL4A 1MUUA 3JQ7A 3WGIA 1UP7A 4CMEC 3E6AA 4O59O 3ANLA 4XJTA 2ZJ0A 4IM7A 1JU9A 4CMKA 4AL4A 3L07A 1UAYA 2BFPA 3JCZA 3K96A 5JC1A 2OO5A 1ZXLA 3ZDFA 2JHGA 4F45A 4DBZA 3AI2A 4W6ZA 3SJUA 4TRRA 2VZ9A 4DA9A 1B16A 3WLFA 4N18A 2FPIA 1E5QA 2IDZA 3PYXA 4NZ9A 1HL3A 4FBGA 3RC9A 1DIAA 3ETDA 2AQIA 3L4BA 1KERA 3WTCA 4QUKA 2J3JA 3GGOA 1I01A 1AHIA 4L74A 4WNCA 1YB1A 5IJZA 2I65A 2FSSA 5B4VA 3UXYA 4NNJA 3GFGA 2PK3A 4FJ2A 1I8TA 3BTSA 1F14A 2ZB4A 3NTOA 5IDWA 1HT0A 4XD2A 1ML3A 1S6YA 2OOSA 1VI2A 3JQ6A 4HFMA 4NI5A 3OMLA 4XA8A 4Z9XA 5A4DA 4GL4A 1DEHA 3E18A 3QVWA 3LC1O 4CL3A 1GCOA 3L6EA 4MVJG 3DBLA 4TVOA 1LLCA 4MINA 4P22A 3H3JA 1WDMA 1WLYA 4CLEA 4OSOA 3NRCA 1NPDA 1EFLA 3LVFO 5TT1A 2W4QA 4FPXA 1BXZA 5LC1A 5KVVA 1XU9A 5G0TA 1XKQA 3LQFA 5GY7A 3GAFA 5C7OO 1HYEA 3BTUA 3NGLA 4NK5A 4KTTE 1PL8A 2DTEA 1I24A 1BW9B 5EERA 5JO9A 1E1LA 5BNIA 1SBYA 2HMVA 2VRCD 4XYEA 4D3FA 1Z7EA 2QYSA 4BKUA 4CV0A 3R0IA 5I9LA 1PGNA 3W4IA 1NQTA 1ORRA 2P9EA 2YYYA 3KSZO 3ZW8A 4Q9NA 2P2SA 5T57A 4DC1A 4XYBA 2CSUA 4DUPA 3I83A 4NBWA 5H82A 3CXRA 3M1AA 4EJMA 3VPFA 2Y1CA 1DC5A 3TZQA 1E0DA 1U5AA 3LT1A 1YL6A 3GDFA 4IDDA 2O7QA 1WNTA 4BNTA 5EJ2A 1J0XO 1QYWA 2EV9A 2YY7A 5T67A 4QTZA 2VNAA 2AHRA 4I5DA 3SLKA 4OAQA 3ZWCA 4YAIA 1XWFA 5JDIA 2PWZA 4FGSA 4FFRA 4XB1A 5THQA 3AWDA 3PGJA 1GYPA 4CLOA 3JQBC 4KDFA 4B8ZA 1MC5A 4BO9A 5L3ZA 3Q11A 5G0UA 2GERA 5DCYA 1NFRA 4RCVA 5ER9A 4LW8A 1CDOA 5TRTA 3INRA 3FTPA 4C7KA 5DBIA 1PJBA 3VVCA 5I7FA 1YE3A 1PZHA 3JQCA 4J91A 3W4JA 4MOWA 2CMDA 1UXIA 2VHVA 1MFPA 4RF3A 1HDGO 1KVSA 1XR3A 4IS3A 2B4QA 4A5OA 3W8DA 2CZCA 3WYEA 5DZSA 2Q99A 3A06A 3FR7A 2WEKA 3K92A 2NTJA 4HFNA 5COQA 4BNJA 1Y5RA 2Q46A 4L8VA 2JD1A 4UVGA 4E31A 4NH4A 2J3HA 3WBFA 1JLLA 2EWMA 2R2GA 4E12A 4J9VA 3F4BA 3NT5A 4YT5A 2UAGA 1B8UA 3JD0A 3Q1LA 1GFSA 2EKLA 5I8WA 2JD0A 4CMIB 4D44A 3HWRA 3QQPA 3IS3A 4P4GA 1HEUA 1SOWA 3U4HA 4D43A 4D42A 2P9GA 1ISMA 4TKMA 2E49A 1X1EA 1DC6A 3HDHA 5IXSA 5A3VA 1GYRA 4PN3A 1XQ6A 5JAMA 1LUAA 3TF5A 2FOIA 2P91A 1PU2A 1KIFA 1NR1A 4IZHA 4Q3AA 1ENYA 1SCUA 1QLJA 4G5HA 1F17A 4JJIA 2X5KO 5A1TA 2DLDA 4XGNA 3EYWA 1DAOA 1P1HA 2O3SA 4BNHA 2EP7A 3GEGA 3PLNA 3Q2IA 4J0EA 3SC4A 4DYVA 1U8FO 1E7SA 1U2DA 2E82A 2ZTLA 3DMTC 4CR6A 1LEHA 3DB2A 5KJCA 2X58A 3WG9A 4DPLA 4ZQHA 1E3LA 4ZQGA 4BKRA 3U09A 1MG5A 1DFGA 1SOVA 2BELA 4NFYA 4Q39A 4XRGA 5A9SB 3JD4A 3RC2A 4BOYA 1Q0HA 1JWAB 3PWSA 4FDAA 4XGKA 1NTOA 1JVBA 2BKAA 3IJPA 4OKNA 4YBZA 2ZTMA 1BXKA 3G49A 4BNWA 3PFWO 3NJ8A 4EEZA 3ON5A 2PFGA 1FDSA 3GMSA 3ZU3A 3NEPX 1PJSA 4J1QA 3UW3A 4GX0A 3TWOA 2OGUA 3C85A 1WDLA 3PXXA 3U49A 1NM5A 2P5YA 3HN2A 1EFKA 2HMWA 3QVSA 2JFHA 5JMWA 2QQ5A 4D3DA 4YAEA 4GLOA 3SLGA 4WJZA 3JQAD 3B1KA 3ETEA 1GPDG 1X7DA 4WEQA 1ISIA 4QECA 4OYRA 4FFOA 3VZPA 1D4FA 4PVDA 4J7XA 4IMPA 3TFOA 1YONA 1K5HA 2HKIA 3C7DB 1E77A 3OHSX 9LDBA 3OEWA 3V2UA 1KYQA 1I30A 3JQBA 2EGGA 1Y6JA 2X9NA 4CLDA 3UICA 1V3UA 4R3WA 5C37A 1ZSYA 3BMOA 3KEQA 3I52A 3RUFA 5L7TA 2G1UA 3VDRA 4MVJF 3KYBA 4JBGA 3COSA 2ZQZA 3PZBA 4N7RA 2UYYA 4J4HA 2HK8A 5CG2A 5F1KA 1DIGA 1UP4A 2Y05A 5B12A 3IKVA 3DAGA 4XQEA 1VLLA 2YQ5A 3AU8A 4MKXA 2GO1A 2QRLA 3GVHA 2P68A 3E5MA 4AICA 1R66A 3RJ5A 3ZU4A 2D1YA 4CMBA 2EXXA 2Y0DA 4CV2A 3PYMA 3UCFA 5KOIA 2DAPA 4CLRB 1DIHA 3LF1A 5A9RA 2QZZA 5I8ZA 8ADHA 1ULUA 3UKOA 1QLHA 1HE4A 3MOGA 3TZCA 2AE1A 2WYVA 4O5OA 1ONOA 4GGPA 1JTVA 2PD6A 4TRMA 1DC3A 3WR5A 2IZ1A 1P1RA 4MVJP 5AYVA 4PIVA 2FRDA 5K6AA 2ZQYA 3ZWWA 2VN8A 4UEKA 3ULKA 2R00C 2OZPA 3H5AA 3QY9A 5DNAA 3JQEA 4OKIA 1KEPA 3OICA 4LISA 2ZYDA 1XSEA 4QEDA 4XX0A 1T2CA 4Y6SA 2NUAA 3GA0A 1EK5A 1NHWA 3JQDA 3PHGA 4FW8A 4NBRA 1IHYA 4ZVVA 3DMYA 3BZUA 4YPOA 5GZ1A 4AG3A 2J3IA 1YS4A 2BGLA 4IJWA 1O5IA 2YFHA 3GK3A 3I3OA 1Y7TA 2AEMA 2Y68A 3U5TA 3U9LA 1XCBA 1V9LA 1YL5A 2NVBA 4HNHA 3UHAA 3BHIA 1Z7BA 2EW8A 2QRKA 5ITVA 1DXYA 4N54A 3TL3A 1K6XA 5L4NA 5HM8A 5A06A 2V6FA 2DBQA 3D3WA 2WTBA 4NJMA 4D45A 1ZK0A 4I08A 1YVEI 1YBVA 1WXDA 1NWHA 3KVOA 5TNXA 1GV1A 3H65A 4NQZA 3T4XA 3O8QB 2P9CA 1EVYA 2BFAA 2WWRA 1VSUA 4Y9DA 5GZ3A 1SAYA 3OBBA 4HBGA 1HZZA 5KVSA 2VHYA 4DGSA 1ZJZA 1WDKA 2YHUA 1DRUA 3OP4A 1BRMA 4GSLA 1E7MA 2BI8A 2C20A 1DOHA 3PLRA 4UVHA 2X0NA 5JAQA 3D7LA 1T24A 5DP2A 2E4AA 1YXMA 3B20A 1C1DA 3RFXA 4E5PA 2HRZA 2IZZA 4YJGB 1GQQA 6LDHA 3PJDA 1LI4A 1I0ZA 4AJ2A 1FJHA 3KB6A 4I8XA 5IXYA 2CF6A 4OL9A 3NDRA 3VH2A 1C3VA 1EQ2A 1TT5B 2VQ3A 5CPBA 4EI2A 4ZJUA 1NNUA 1PZEA 4BO5A 4U0JA 4I5GA 5KVCA 1O89A 4D79A 3VHRA 1R4NB 3D5TA 3L6OO 4NBUA 2X5JO 3QWBA 1ONNA 2HJRA 1H5QA 5G0SA 5FYDA 2GNAA 3HE3A 1U5CA 1YQGA 2F00A 4N5LA 2O50A 5JSFA 1DHRA 2CVQA 4QO7A 5G4KB 4GWKA 4M8SA 1QYXA 2WM3A 2Q1UA 3WS7A 3QWAA 4CQMA 5LDGA 3BHMA 2WD7B 3STHA 4OHUA 1U4SA 1HE2A 1RM3A 3GH3A 3D4PA 1LSJA 3W6UA 2A35A 2JCVA 4ESOA 4QFCA 3NJ4A 1XELA 1SB9A 3UUWA 2FZWA 4OQYA 6ADHA 1XLTA 3IJRA 1QR6A 3N58A 1QORA 3BMNA 5JDCC 3OA0A 3ZNPA 4NU6A 3PZRA 1H94A 4J7CA 4J1TA 2EHDA 2P5UA 4TROA 3L6DA 1A72A 2HSDA 2W8ZA 3EC7A 3OIFA 1R15A 4TZTA 1I3KA 3MWEB 4YT2A 2J3KA 3M2TA 1PS8A 2DFVA 2R00A 4CM8B 1XIVA 4RVHA 4L4SA 5ITWA 5JPIA 1G0OA 4LCEA 4DLAA 2JHFA 3KYDB 4E2XA 3OIDA 3GFBA 4E2ZA 4DREA 1EEHA 1GQYA 3TPCA 1DAPA 4RGBA 1NWCA 4YVFA 2VOEA 2GASA 3DBRB 1YQDA 3MJVA 1TVEA 2X23A 2GSDA 4XKJA 3G3EA 1R16A 3WIDA 5TSDA 1VKNA 2G0TA 3D4NA 4YDRA 5FI3A 4ONEA 3VVBA 5IZ4A 3PIIA 5HS4A 4GH5A 2P4QA 1B14A 3GG9A 1LSSA 1EQUA 4WCFB 1QMGA 3GPDG 3RU7A 5IFLA 2EGHA 5B1YA 1DO8A 1M67A 5IDXA 5HRUA 1SEVA 1SMKA 1PSDA 2PD3A 2RHCA 3KO8A 4RQUA 1P77A 3TNLA 1MA0A 4UVDA 3O4RA 2ZJ1A 2DT5A 1BGVA 1ZCJA 1SPXA 2FWMX 3O9ZA 5BQFA 2XOXA 4CQMD 2VWGA 1D8AA 3C7CB 3WJ7A 2I76A 4CLXA 1C0IA 3ROKA 1HDRA 3VZQA 1WAMA 1XDWA 3G17A 4B3HA 4BKQA 1IPFA 2HAEA 3GT0A 2Q4BA 3OF2A 1DRVA 1N1EA 1V35A 4PZEA 1T25A 4WE3A 5F1PA 1DSSG 1M75A 4YCAA 5LCXA 4G2NA 2CUKA 1RM0A 4CUZA 4HFRA 1F8GA 2WYUA 3GGPA 4RVFA 1I3MA 1GV0A 3VZRA 3BTOA 2HJSA 2BHLA 3RD5A 4PLYA 4BNIA 4I9HA 2X8LA 1Y8QA 2Z1MA 3DZGA 3GZNA 4XDZA 2QHXA 2EW2A 1N9GA 4CMAA 3BXXA 1IHXA 3HUDA 4R51A 1T1RA 4GQAA 3T4EA 1E3WA 1A4UA 1UUFA 1LNQA 4YRBA 1KY4A 3B70A 1LXCA 1MXHA 4BV9A 5JFOA 4M55A 5EQFA 1XYGA 3EZLA 2HLPA 1P1FA 3K2BA 7ADHA 5C7LO 1YO6A 1NFFA 2FMUA 1W6UA 1JW9B 5KJ1A 1NP3A 3WGOA 2BGMA 4IQ8A 3GZ4A 3QVXA 3EMKA 4BNYA 4BNLA 4XIYA 5C5IA 4RVUA 4WLFA 3BHJA 5JDCA 4J0FA 5BR7A 1F12A 2DQ4A 1E3JA 4J7UA 1KVRA 3FWZA 2ET6A 5L4SA 4ZQBA 5J23A 3MCVA 3SXPA 2D59A 5CEEA 3QSGA 1H93A 4BMNA 1U1IA 4XJSA 9LDTA 3DL2A 3M2PA 2ZYAA 3O26A 4KQXA 4AJIA 1IY8A 2NVUA 3ZV4A 2AXQA 2G76A 4D0RA 3JQ7B 3ZH2A 2I3AA 2Q45A 2AE2A 2O2SA 2C5EA 1FDTA 3ETGA 3RFVA 3VDQA 2D0IA 1D3AA 4S3MA 4U5QA 1I2ZA 1QXSA 2GUGA 2FY8A 5JS6A 2NU7A 1T2FA 1LRKA 3GDGA 3LSYA 5AXCA 4CMHA 3ABIA 3S8MA 3ZU5A 2GF2A 3K8ZA 1HYHA 1CF2O 2VCYA 3N74A 4K26A 5JY6A 3D64A 1PQUA 1ISGA 5CDSA 5B4TA 3HN7A 4JBHA 2A94A 2D3TA 3G79A 2X0IA 4LSMA 4B3IA 3C24A 3DTYA 3JQ9A 2D8AA 4PLZA 4CM6A 2CY0A 4FFNA 3WYCA 4R5HA 3C1AA 3AFMA 5DCUA 4BGVA 1KS9A 1PGQA 1B8VA 1U3WA 2Q2WA 3MJSA 4ZA2A 1HETA 2HU2A 3TOZA 2E48A 1ENOA 3S1LA 1U3VA 5THKA 4J3FA 3ANNA 1V3TA 4MP6A 3NTQA 3KM0A 4E3ZA 3G1TA 1B7GO 1IZ9A 3AI3A 4J1SA 4R3NA 2RAFA 3T7CA 3W8FA 3WNVA 4TWRA 3VC7A 4N5MA 1OC2A 2NVWA 3ZWXA 3V2HA 1CEQA 5TIIA 5K1SA 1HTBA 2H6EA 4BS9A 2AMFA 3PK0A 4O6VA 4UVEA 1LLQA 3DFZA 1L7DA 1MXFA 4E6PA 2PNFA 3RUHA 1IPEA 4EITA 3PQEA 5EN4A 3V8BA 1P1JA 1I3LA 1KY5A 2AG8A 2I3GA 3ENKA 1LLDA 2G82A 4OM8A 1PX0A 4DPKA 4LVCA 4W9NA 1HF3A 2V65A 2NTVA 3AM5A 4IIVA 3KV3O 1FK8A 1SB8A 5T5QA 1BXGA 3GN2A 1DC4A 3PHJA 2AQKA 4NMHA 5A3JA 3AY3A 1LSOA 4BO4A 1UDCA 2PKQP 2V7PA 4IMRA 2GCGA 3EVNA 3HDJA 4RPJA 3B6ZA 4AJ4A 4HADA 4CLOB 2GZ1A 2FR0A 4R54A 1BSVA 2YV1A 4B4VA 1EZ4A 4CUJA 1CWUA 2OBNA 3NX4A 1YJ8A 3IIEA 4U8GA 4DC0A 1P31A 3QIVA 4GWGA 1N7HA 1U7HA 3E82A 2QW8A 1E7QA 4LCJA 4MJLA 1PL7A 4JNKA 3RUIA 3WFJA 4B3JA 4FS3A 1E1KA 1VE9A 3HZZA 2C54A 1Z75A 1R0KA 4TKLA 2GZ2A 4XQ9A 1UXJA 2YDYA 3ZV3A 1R37A 1IULA 2O7SA 3FWNA 2VUSA 3U4IA 4XYGA 3I1JA 4JROA 4BQRA 3L77A 4I5EA 5ES3A 1E3IA 1XG5A 3WFIA 3QRWA 4K6CA 1J49A 4EUFA 2EP5A 4NPCA 4WEOA 4U0KA 2X0RA 2Y1OA 1PEDA 4YAJA 5JO0A 5TC4A 4C4OA 4ALNA 4KZPA 2TMDA 3DOJA 5A03A 2DTXA 4YTEA 4EBFA 5COAA 3DFUA 4WOJA 4F46A 1K3TA 1LRLA 1DDOA 2D2IA 1KEVA 2EKPA 2OUIA 2SCUA 3CEAA 3KLPX 7MDHA 4M1QA 3UH1A 2BFOA 1LC3A 4XIJA 3F5SA 2ZIZA 2VZ8A 3ONDA 3WGZA 4ND3A 2LDXA 4Z6KA 4MIOA 1GUFA 4JGBA 3KYCA 3C1TA 3GPIA 5EIOA 3DO5A 4MVJI 2AEFA 2PGJA 3GVXA 3QA9A 4BGIA 5IZCC 3A28A 4DIBA 3K2EA 3FHLA 3JQAA 2WE7A 4J9UE 4TRJA 1DPGA 1EVJA 3JQFC 4IBOA 4WLEA 3ZHYA 3MJ4A 2IRWA 3VKVA 3AM4A 4XWYA 3ZWMA 3MJCA 3NV9A 1I5RA 2VWPA 3UOGA 4OXKA 4CMEA 2B0JA 1X7HA 4M49A 5CFZA 5A02A 3EDMA 3GVPA 3E03A 3IKTA 1FDWA 1NX6A 3AY7A 4P38A 1NQAO 5CPFA 4XYLA 2Z1NA 3TFQA 1NAIA 1U3TA 3PWZA 1CETA 1X7GA 1GR0A 1Q2XA 3ZHZA 4IS2A 3OEYA 3Q9NA 1HLPA 1VRWA 3WSVA 2DVMA 1BDMA 1YQXA 3WJAA 4ZHSA 2Q3EA 3TL2A 3OJLA 3QLJA 3IOYA 5L4LA 1GQ2A 1JA9A 2UVDA 4YJHB 3WIEA 3WOHA 5MDHA 1IUKA 4ND1A 1ZUD1 1F8FA 4NDNE 3PWKA 4R68A 1PZGA 3MTGA 2YFQA 1H9BA 1ZK2A 2JCXA 1O6ZA 3GRPA 4N5NA 1HDOA 2EJWA 2BD0A 1U9JA 4NFHA 5IDYA 3QWHA 1VKOA 4BNMA 3QWFA 2X9GA 2C2XA 2OHXA 3I9NA 3I9KA 1NR7A 3NYWA 3WGQA 4B8WA 3GEDA 4CMCA 2YJZA 1PL6A 1UXHA 4GMGA 3BMOB 4GAEA 3AW9A 3JYNA 4FOOA 4XRRA 4XB2A 1WZIA 3WQSB 4EEXA 4J1NA 3V2GA 2O3QA 3F3SA 2NQTA 2C82A 4K1LA 1ZNQO 3EVTA 3OQBA 3PVZA 3HB5X 4L75A 1Q7BA 3S55A 4CMIA 3ZWYA 4KQWA 1ADCA 3AU9A 2A9FA 4R9RA 4MIYA 4Z9YA 4EZBA 1HDCA 1T26A 4DLBA 4BO2A 2Q50A 4F6LA 4L73A 1PIWA 1K6IA 3OA2A 4Y98A 2ZTUA 2OP1A 2C7GA 4Y6RA 5BSEA 2QG4A 4JK3A 4WCDA 3NAQA 3VH1A 3ZV6A 1LDNA 1X15A 5G0WA 2O4CA 4CM7A 5GMOA 4RPLA 3RQSA 4WLVA 1YB4A 1AE1A 1V3VA 1PTJA 5L45A 1CYDA 3PJGA 3H2ZA 4DMLA 1HE5A 4L76A 4PLVA 4DLLA 2IE0A 2AQ8A 1XQ1A 5A9TA 2B35A 2FHSA 3F4LA 2AG5A 4BO3A 1B3BA 2HK9A 2NADA 1PQPA 3H5NA 1B3RA 1NYTA 4ND2A 1H0KA 1PS0A 3RCBA 4YRAA 1P1IA 1LRJA 1UXGA 2HUNA 3KHUA 4H15A 1Y5MA 5IDQA 3BMQA 4PLGA 1W0CA 1DB3A 2PTGA 2DBZA 5TT0A 4YAKA 2C7VA 3O38A 5DOZA 1NASA 1M66A 1Q7GA 2A92A 1GADO 4GVLA 4BO8A 3C1OA 5DT9A 2EIHA 3CKYA 4R4JA 4CM9A 5JAIA 1LDMA 3RFTA 2Y1EA 1Q1NA 3A1NA 1WZEA 2FR1A 4MIEA 4UVIA 1JDJA 5JXWA 3D3WB 3SC6A 4A03A 4DXHA 4NJMB 4CMJA 2YV3A 1GD1O 2OFPA 1QRRA 3W1VA 2I9PA 2NM0A 4IPTA 4D41A 4CV3A 4C7JA 3DHNA 3LZ6A 1RYEA 4DRYA 3DZBA 3DZHA 4PFJA 4CODB 2FR8A 5ER6A 1W8DA 3PJFA 2JKVA 1WPQA 1S7CA 3U4CA 4A27A 4OGWA 5HTOA 3F9IA 4F6CA 3NT4A 4RZIA 1HKUA 3H9QA 4DPMA 4GSKA 1YDEA 1GAEO 2WSBA 3S2FA 2UV8A 1HE3A 1ZXBA 3AJRA 4AJOA 3FN4A 1GEEA 1Y9AA 4OH1A 1C1DB 3MZ0A 4JXKA 5HBRA 4FFLA 1R4MA 3GN1A 1QP8A 3RUDA 5G2OA 3RVDA 1R0SA 3DMTA 1M6HA 3HADA 2NWQA 3DOOA 5A5EA 3H2SA 3OM9A 4Z0TA 3WGGA 2VUTA 3TDKA 1IB6A 1N5DA 3Q0EA 1GZ4A 2PV7A 4CM1A 5BSFA 5T64A 1DLIA 3A9WA 2XAAA 1P0CA 3L9XA 3P2YA 2IEBA 5KJEA 3OJOA 5TF4A 4FD3A 1ZBQA 1ZMOA 2EG9A 5CDUA 2P4HX 3GAZA 1OAAA 2VHZA 1MFZA 3ZHBA 1KVTA 3LC7O 4FJ0A 2WYWA 2DBRA 3DONA 1U3UA 4IIUA 1UJMA 5EMHA 4QT0A 1N92A 3GUYA 3KLMX 3MOIA 4CLRA 2ZCUA 5C3MA 4BMSA 2W98A 1YBMA 2W2LA 1WWKA 4YEDA 3SJ7A 3IL2A 3IP3A 1O8CA 3UF0A 4IXWA 1ZFNA 4GBJA 4Q3DA 1BVUA 2B5VA 3ZWNA 1CJCA 3RKUA 4Z9FA 1E7YA 2VWQA 1ZK1A 1VJTA 4CM3A 4LN1A 1LDEA 5ILGA 4JLWA 5IF3A 5L53A 3JYPA 4CM9D 4Q3BA 4ALJA 1A4IA 4E33A 5KWEA 1V8BA 4FR5A 4XR9A 3FBTA 3IP1A 2H5LA 3BA1A 3AOEC 1KC1A 4NFSA 3JQ8A 3TOXA 5KTKA 1ONPA 2JCYA 4Y6PA 3UAGA 3I9JA 1DJNA 4PLPA 5I9MA 3AUAA 3CZRA 5JYEA 2ZATA 1WP4A 3BMNB 1UZNA 2DFDA 1B2LA 4EJ6A 2RCYA 4H3VA 2DU8A 2F1KA 2QRJA 2ZKLA 3F5QA 2XF8A 3GUCA 2NU6A 2AQHA 3GMDA 1H6BA 3PRJA 3DEYX 4Z0PA 4HXYA 2HK7A 3VZSA 4FN4A 2X0JA 2C29D 1PJ3A 1GPJA 3ZW9A 3DQPA 2PD4A 3RROA 4JX8A 5DCWA 4BNNA 4R1UA 2GRAA 2OBYA 3NTRA 1O94A 4WCFC 4CM5A 3E9NA 4IZIA 1YOVA 1UZLA 3PFFA 1OC4A 2I66A 3FPCA 3O8QA 3NGXA 1FMCA 2Q49A 3NDIA 3D4OA 1A9YA 2BFMA 5K9ZA 4BO7A 1Y8RA 5HS6A 1A5ZA 4PGFA 3JD3A 4DBVO 4LVUA 3W4KA 3OJFA 4MVJD 3AK4A 3CZMA 4GVXA 4UUMA 5I7EA 2WMDA 4GX1A 4NR0A 1SEPA 1LX6A 3QP9A 4CV1A 2PZMA 4MVJH 2HQ1A 4A7PA 2GN8A 4RDHA 3WMWA 1ZMTA 1YB5A 3ZU2A 3P5SA 4KUHA 4HNGA 2AA3A 4XDYA 4AJ1A 5CDTA 4PG5A 1LDGA 2FN7A 3E9QA 1K89A 1LQUA 5HWSA 3KETA 1G0NA 4R9SA 4CQLB 3ZWOA 1NVGA 2VHWA 2W2LD 5GZ6A 4YXFA 1K6JA 5JLAA 4R16A 4DQUA 4DYDA 4RZHA 4PG6A 4AVYA 3H8VA 5ENDA 3ITKA 3ZWVA 1FDUA 1PR3A 3VTZA 1GDHA 4LMRA 1QYVA 5B37A 2FSVA 3OH8A 2J8ZA 1D7OA 3CPSA 3IUSA 2YDXA 4PRKA 4LRTB 1Y1PA 3IDSA 2E37A 5IAAA 3PI7A 4Z0HO 5CEFA 1C1XA 1JAYA 2IODA 4I5FA 4TRNA 1FXSA 5G4KA 5ICSA 2GDZA 3AY6A 1ZZEA 3ICCA 4BIIA 1EUZA 1WMAA 1EDZA 5T8KC 1SC6A 3RWBA 1MC4A 3JQGB 1WW8A 1ZEJA 3QHAA 2JAHA 1AXGA 3M1LA 3KRTA 1KEUA 3P19A 3PTZA 1EUDA 2VWHA 5A5FA 2CVZA 4ALKA 4YAGA 4BNVA 5G0VA 2D5CA 3GZNB 4P4NA 1N9GB 1U7TA 5DBFA 1W4ZA 4KUGA 4W4TA 1E3WB 4KOAA 2DPHA 4HFJA 3SEFA 4BV8A 4EJ0A 4YJFB 1UDAA 4ZD6A 1V6AA 1CQIA 3H3FA 2DUWA 5KNLA 5JNLA 4RPKA 3LT4A 4EW6A 4UULA 5AOVA 5L95A 4UAGA 4LMPA 1ISFA 4HX5A 5TX7A 2VHXA 4QSMA 3K30A 2WJPA 3OQ6A 4DVJA 3KSUA 3K31A 1HLDA 4HY3A 2WD8A 3SBOA 2DTDA 1HDZA 4ALIA 5DF1A 3EHEA 4J2HA 1OMOA 2WE8A 4GX5A 4JJGA 5KKAA 1VJ1A 4CJXA 3H4VA 2POQX 2NACA 2VUUA 1IE3A 4JBIA 2IZ0A 4YACA 3QVOA 1B15A 3HDYA 5TJ9A 1RM5A 4J4BA 1ZSNA 3LT0A 3DBRA 2PZKA 3WGHA 3I9LA 4BQPA 4Q3EA 1PS9A 2CNBA 3I4FA 1VPDA 3WGYA 3FRJA 4YQYA 3G0OA 4A10A 4YYZA 3AUSA 5DN9A 1R12A 3L4BC 5EESA 1A7KA 3RBXA 2QYTA 1PGPA 3V1TC 2PGLA 2NVUB 1HSZA 4X54A 4JN6B 5L7YA 4IJUA 3R3JA 4E30A 1JKJA 4YR9A 1E3EA 2VTDA 2Z95A 3HJAA 3GNTA 3ONEA 5A05A 4I9UA 1PJLA 1LTHR 4NU5A 1RPNA 5JAZA 3R3SA 3RBZA 5KJFA 1KVUA 2UDPA 2O48X 1DRWA 1I36A 4Z3KA 3FR8A 3RBVA 3B1FA 3LLSA 2IXBA 3CMCO 3HB4X 4ND4A 1QYCA 4LK3A 1T2EA 4RORA 1Q0LA 2VOJA 1I2BA 3IQDB 2X6TA 3VPSA 5U4QA 3F1KA 4TVBA 3VPXA 4MVJM 1P33A 3G1UA 1KOLA 3GHYA 4W7HA 3HFSA 4W82A 4E0BA 3RC1A 4E5NA 1ULSA 3WBBA 3BMCB 3IC5A 2CFCA 3P7MA 4ITUA 2YV2A 3QJ5A 4Q3CA 4FSHA 4PG8A 1E92A 3ZNQA 2C59A 5JCJA 1OZAA 1XHLA 4KP7A 1GU7A 5BNFA 1DFIA 4FJ1A 1OBFO 1DIBA 2C5AA 4O63O 4D46A 1EBFA 4GKBA 4ID9A 2RH8A 4GI2A 2GN6A 4CMGA 3UCXA 1M6WA 4BVAA 3S2GA 3GGGA 3ZCXA 3ZNOA 1QKIA 4BNZA 3I5MA 4KWIA 2I67A 1LJ8A 1XGKA 3W6ZA 2V6GA 5AXBA 1K0UA 2GN9A 5JDIC 2O3UA 2RIRA 4CLHA 1NAHA 4M86A 2ZTVA 1VL6A 4O0LA 3PHLA 5JC8A 3GNQA 1E6WA 3U4DA 5KIAA 5F21A 1PZFA 4L0QA 4J2OA 1OI7A 2G17A 3HHPA 3JTMA 4ILKA 4BKOA 4AJJA 3H9UA 3ZWBA 4WASA 1P1KA 3E8XA 3DBLB 4A0SA 4CM4A 5JY1A 1NVTA 1BXGB 2B36A 2CDBA 1JQBA 2VYND 4PZCA 3NUGA 2CF5A 1H2BA 4IUYA 1QG6A 4L4XA 5F5NA 3FCOA 2UUPA 1GY8A 5FFFA 5CAEA 5U9CA 3UFXA 3WX0A 3INTA 4INAA 1JKIA 4DWVA 4IY1A 1RKXA 3TZHA 1E7RA 1ENPA 3DBHA 1DBVO 4ND5A 2AEJA 4B4WA 2PR2A 2W2KA 3N7UA 3KSDO 2YHIA 3QWIA 2JD2A 2ZYGA 4ALLA 2PZLA 2Y0CA 1A9ZA 1PJCA 3ZZNA 3EW7A 4OMUA 2JJYA 3U62A 4L4RA 2CVOA 2DPGA 4P8RA 4PG4A 2PY6A 4R1TA 2Z5LA 1HWYA 4WUVA 3RIHA 4R1NA 4EGFA 5JCJD 4P4LA 2IYOA 4PCVA 3HDQA 1O9BA 3MEQA 5H81A 4NBVA 4WKGA 2PGDA 1RWBA 4J6FA 1ENZA 5BNTA 1NXQA 4QQRA 4RPGA 1YDWA 1BTOA 3QW2A 4OIMA 3ZN2A 1TA4A 2Y93A 4BB6A 3ANMA 4BNUA 5JCXA 3I23A 4J43A 3OSUA 4FC6A 4G65A 2O3TA 3DZKA 4BNFA 3VPHA 3ROQA 3LLVA 3ENNA 3TJRA 1QYDA 3L0DA 4ZU3A 4MVJE 5CHEA 1Q7CA 1U8XX 3KYCB 2DM6A 2EERA 3NKLA 3VOSA 4D3SA 5IN4A 1IL0A 1CQJA 1CRWG 4ZQEA 2V6BA 5DP1A 3EAGA 3GVIA 1TLTA 2NLOA 4IDFA 1O95A 1I32A 3GQVA 4FFPA 3JQAB 3M6IA 4RF4A 3RUCA 3RAJA 5CDYA 8LDHA 1T2AA 1B26A 4OJNA 4YQZA 5FF9A 4BO1A 1C0LA 3QVTA 4OXNA 4AJKA 3ADOA 4CR8A 4PLTA 1BHSA 1FF9A 2RBEA 1HSOA 3CSDA 2PH5A 1P9LA 3LC2O 4JP2A 1IOLA 1RJWA 4BO0A 3B1JA 4YRDA 3FNHA 2HCTA 4G81A 3D5QA 4GX2A 4RDIA 3RC7A 3UCEA 3X2EA 3PHHA 5JMPA 4YJDA 3RU9A 1GTMA 1CIVA 1YRLA 1NQOA 4WLUA 1LDBA 3OQ1A 4XEHA 2NU8A 3GOHA 3KOUA 4ZRNA 1BW9A 2A4KA 5BT9A 4IXTA 4E2WA 5AVOA 3FNEA 2TMGA 3WYBA 4KTVE 4EUHA 1J4AA 1EUCA 1RM4A 3WB9A 4U7WA 2C2YA 2ZCVA 3BTVA 1TI7A 3CE6A 4U6SA 2QX7A 4OSPA 4AJLA 3ZNNA 3D3EA 1GL3A 5CEJA 5C7IO 3PDUA 4I1IA 4UEOA 1YGYA 4GKVA 1Z73A 4DQXA 3C8MA 1BMDA 4KMSA 4AJEA 2X1HA 3K5PA 4WLOA 2GGSA 4I9NA 3X2FA 4B7CA 4ROSA 2Q1SA 4M89A 2BLLA 4WNIA 4D7AA 4II2A 4XZ3A 4PLWA 2X9VA 1DJQA 2I5PO 5K6AC 4MP8A 2GZ3A 3MJEA 3GLQA 5JYDA 3LDHA 5BSGA 2BMAA 1E3SA 1MV8A 4RO0A 1WVGA 4MKZA 1BWSA 3FF4A 1DIRA 4L9RA 3OECA 4RL6A 1YKFA 3DR3A 4IDBA 4II3A 4PRLA 3CUKA 2H63A 4IQ0A 4DTIA 3KZVA 1FDVA 1GCUA 3GRKA 3TRIA 2ZB8A 1ZH8A 4NHEA 5DULA 5EL0A 1KETA 3TSCA 3WNQA 4J4TA 4FFMA 3GC6A 2YZ7A 4BNXA 2VZ0A 1QV7A 1I3NA 1EE2A 2B4RO 4RVSA 2OORA 4NBTA 2W90A 3RSHA 2Y67A 3BMQB 3SX2A 2YW9A 2EF1A 2OMEA 1GUYA 4BGUA 1VL8A 5U1PA 3Q9UA 1J6UA 2IEDA 1BDBA 1ZK3A 3AUTA 1K2WA 3ZWPA 3H5RA 1UR5A 2J5KA 3FTNA 1SNYA 3ZV5A 4PLCA 2R6JA 4E5KA 2XXBA 3GDOA 1ADGA 4RV9A 1T4DA 1ZIDA 1P45A 2D5AA 2Y99A 4WOKA 4IGEA 3ONFA 1XEAA 3EY4A 3RUAA 2PLAA 4BKPA 3MTJA 5AXDA 4J90A 2X7HA 1HRDA 4LGVA 3DZIA 3RASA 1GUZA 3HFGA 4QO8A 4M54A 2X5OA 3V1UA 3C7AA 1B0AA 1HXHA 1BG6A 1XU7A 2D4AA 2FP4A 1OOEA 4YJHA 4A73A 3D0OA 2HMUA 1LC0A 1TXGA 1Y81A 4EUEA 5DDIP 5KJ6A 4Z3DA 1G1AA 5L9AA 4U6QA 3D1LA 5A9SA 4J49A 1H6AA 1U28A 1KEWA 1NVMB 5DBGA 2PKQO 3BAZA 4IQGA 3K9QO 3H9JA 5AQ1A 2X22A 1ZW1A 2JFGA 2G5CA 3OIGA 4DMMA 5IZCA 1GZ6A 1H9AA 1R4MB 1X13A 2O2YA 4LSWA 4GGOA 3JQFA 1EE9A 1A27A 3PEFA 1A71A 2H9IA 4JP3A 3V5NA 4RJTA 2O23A 4IDGA 3I9OA 5IN5A 4RQTA 3KTDA 1H6CA 4B7UA 3DC2A 3DHYA 1OFGA 2YUTA 3Q2KA 4YWJA 3JSAA 1NPTO 4K9DA 3WWYA 3NT2A 3LF2A 5ICMA 2VYVA 5CG1A 1UH5A 4KDEA 3TZ6A 3GY0A 3JYQA 4W7IA 1V0JA 2I6TA 3L9WA 4R41A 1AHHA 3I6IA 1LLUA 1HYGA 4FQ8A 3LYLA 4NK4A 4WPGA 5L40A 5TQVA 1T4BA 4NIMA 5F1OA 1MX3A 5G4LA 1N2SA 3TN7A 5FEUA 2HRBA 4AJNA 2BGKA 4IGFA 3OJEA 4IINA 1ZEMA 2EEZA 1TEHA 4BUCA 3HNPA 1LQTA 1H2HA 4EDFA 2GR9A 1IZ0A 5FWNA 3VH3A 1N7GA 2B4TO 1X0VA 2NSDA 1LDYA 4RLHA 4MDHA 5JW6A 3VPGA 3JQ8B 3ASVA 1N1GA 3ROMA 3KUXA 4MVJA 1DHTA
chains in the Genus database with same CATH superfamily
4K6FA 4XQGA 5JNWA 5EIBC 2BGTA 1GA4A 3KJQA 1V8DA 3OY7A 2GKGA 2XVZA 5TGDA 5AKHA 1YE5A 3W8EA 2HWUA 1SHUX 2QAIA 3IDZA 1NQWA 1VG8A 3ISJA 1F6DA 3L01A 4BU0A 5B1IA 1U3CA 4D57A 2NU6B 3M4ZA 4IDQA 5IC6A 1ZRHA 3ZDRA 3D4LA 1QBGA 2LCIA 4C5AA 5HZGA 2ZSIA 1ZM3A 2CBXA 3DZJA 2BM1A 1I13A 2H29A 3IH5A 1X80A 5DSTA 2RK6A 2IWRA 4ZV9A 1EIZA 3D0KA 3KJIA 4LQDA 1XJ0A 3OFSA 3MB8A 1EX9A 2DKNA 1PJQA 4JR1A 4YAFA 2XSZD 1T9AA 1ZIPA 3VKUA 3HCNA 4CQMB 3BD8A 4LY0A 1RPTA 4DM3A 2RJOA 3R7LA 1C2TA 3OT1B 4CIAA 2C58A 2G4VA 1SC4A 4I4TA 4MVXA 3OPYA 1SC1A 1HNXB 2YQ4A 1IRXA 4MV0A 1OZ0A 2HJWA 3L4KA 4EB0A 3LSTA 2I4OA 1KJ9A 2QT9A 3Q3GE 4RTQA 1FW8A 4CI9A 1F2TB 5F9HA 4ZT3A 2EYQA 3EUWA 2X4GA 2VT3A 2ILTA 3CINA 3O0TA 4GGMX 2J3LA 3DOCA 1AURA 3HBMA 4MP3A 5GQSA 1ADBA 2HF7A 4V3BA 4TV8F 5AK0A 1DG9A 5IPFA 4Q4AB 2VYVD 2FFBA 3WQRA 2FW0A 3EN0A 3SR0A 2O8DA 1K0FA 2G5TA 3L6RA 3T7EA 5KTOA 2BT4A 3OCUA 1IDOA 3KUDA 3ETLA 5A7FA 4DB4A 1IBMB 3CCCA 5H7XA 4RK1A 5EXSA 4HLQB 1QO7A 2GBCA 4F3YA 4BHTA 4D0SA 3WQQA 4Z4IA 1GGVA 4Z0NA 2FCRA 4IDEA 5D6NA 1SD5A 1W0KD 5DTQA 3RLFA 2ZB7A 3P9NA 5KVQA 1IBRA 2J41A 1E1RD 4DXAA 3P9KA 1NF8A 2D2EA 1DG3A 2WTEA 2QE7D 3P2OA 2JHAA 4WGGA 4OF4A 1V25A 2C7BA 4EG0A 3BDVA 3RABA 1T8RA 3WADA 4B31A 1OB5A 3D0RA 4RF2A 1CT9A 3EEFA 2G7MC 4DF3A 1II8B 4EF6A 3TSWA 1G20E 2RC6A 4N3GA 4NCBA 1ZJ6A 2I4NA 1R9NA 4GOXA 1SM4A 4X6UA 4LWPA 1LPAB 1VYHA 2JGDA 4HKTA 4U2DA 3UJDA 3VYSB 2F9LA 4F5ZA 5FH9A 2QQEA 1ZHOA 3A58B 3QFSA 3PT9A 5JSKA 5ADHA 1GZ3A 1VI6A 4G5OA 2E1RA 1GDTA 3KQYA 2B69A 3QG1A 3THXB 1Y6FA 4IRMA 1AKTA 1YBAA 4XSGA 4HQNA 1XKLA 3TQFA 3G0BA 1MW9X 1R6DA 4YJGA 1WBJB 1MT0A 3T9FA 1OX4A 1KQNA 2LKCA 4OJKA 4MGHA 3HB7A 3JYOA 1J9GA 3E2PA 2GX6A 4UTNA 2FW7A 2CHEA 4NZPA 5AICA 3SQXA 3O3NB 4V39A 1JWBB 3TG2A 4B32A 1ADFA 2Q1TA 2IY9A 5HQTA 3NEYA 3ITDA 1SBZA 1ZWKA 2R11A 5DOVA 2IU3A 3WHIA 5IUNC 5I7WA 1KXZA 3JYLA 1XMOB 1JEYB 4BXOB 3QVGB 2IX3A 2PT9A 2WPNA 1PGJA 1IJEA 1O97C 3IODA 4KNWA 1ZOIA 1EBBA 1UJ6A 2O06A 1A95A 1AB5A 4UHBA 3LYHA 3ZUGA 4D80A 2CDAA 2YFKA 3NDJA 2RHBA 3SC3A 4EHJA 1ACLA 4LRXA 4P3OA 2Q6OA 4GMFA 4MGEA 1QIIA 2YJ6A 1WMBA 3A1UA 4U8HA 1T5TA 4NENA 5HJ2A 3FMVA 4JB8A 2EX1A 3O8OA 2V7QA 3GCWA 4BPRA 3NIDB 4F0JA 2YMPA 4MKRA 4CGYA 3WAKA 1VBNA 3IE1A 3CSUA 4HWGA 3AM3A 1W36C 2A78A 4R69A 1TE2A 1K7FB 4P93A 2QMUA 4TPKA 4JB2A 3ZK8A 2O8BB 3RB8A 3RFCA 4FDLA 4YMVA 1KEZA 4KV7A 4TXMA 2G25A 3S2EA 4KZKA 2J08A 2FEKA 4G8JA 4BQOA 5AVYA 1PV1A 2GLTA 5EMJA 4J0GA 1XA0A 1TO2E 2QAGA 2AT1A 1UDBA 2ACVA 3QLVC 2ODEA 2ZROA 4FOSA 1T9KA 4W99A 2WNIA 1G8MA 5EWLB 3D6FA 3FZEA 5JCPA 4NZYA 1WABA 2CVPA 3QEKA 4MUYA 4QGBA 3TLJA 5B7NA 2DLCX 2NOAA 3DZFA 3C3XA 2N1BA 2GHIA 2Q6LA 4YGXB 3RLIA 4AZ0B 3AOEA 1OLUB 2Q5OA 3PKJA 4JELA 3SZRA 3FROA 5FUQA 2F48A 5EINA 3U3RA 6REQA 4ZARA 1C1YA 4ARIA 3RT1A 3KYDA 3ZY4A 4IFBA 4NCXA 3WP0A 3WLIA 4P84A 5FDFA 4LNUB 4YUWA 4G37A 4GT1A 3NRJA 1P3DA 4ON9A 2BY4A 2QPAA 3GJ3A 3LQ2A 1R5BA 3NBMA 2C2ZA 1RAFA 4GP7A 2FPGA 1E9DA 1DC7A 1ZWLA 3HXTA 1GFZA 3I09A 3S4YA 4A9AA 4BV2A 5B4UA 4FP9A 4HUQA 1LSUA 3CRZA 3K2QA 2AOVA 1O9HA 3TAHA 4Y67A 2F3QA 4PHHA 1D04A 2ZBPA 1UQTA 1RQPA 3G88A 4D4LA 1CTQA 1G9TA 4Y9UA 3SIXA 1M76A 1QPBA 1UPAA 2NIPA 3BJIC 2GVDC 5EIWA 2M1XA 5BSEA 3RIYA 3DXYA 4A26A 3EVAA 1I4OA 3S40A 5FA6A 1PG0A 3CV3A 3K0FB 2VDRB 4RA6B 3LBAA 3A6PC 4M1EA 4IDCA 2OV3A 4HGPA 4RSMA 3UUFA 2H1WA 1TIPA 3ASUA 4UEJA 5AJHA 5LZ7A 3WMGA 3ZHXA 1EP9A 1I4DD 4NJOA 4DM7A 3KSBC 5KDDA 3JWEA 1WBBA 3L41A 5AI8A 1Q15A 3E5RA 4GU5A 4TTRA 4XWOA 4BWGA 3EJWA 2FW9A 4NV1A 2X4IA 4QYIB 4ZK2A 1KVQA 5CFOA 1ZVMA 3IVAA 4QWWA 1AMNA 2V7GA 1C9JA 1V5IA 1Z22A 1VBMA 4TZKA 5TJHA 5CP8A 2Q3DA 1EFRA 4UPVA 4QXOA 4Z5XA 3RV3A 2Q7DA 4FC7A 4KW7A 1P17A 2ZJZA 3WZLA 4BGEA 2C5GA 1W5SA 3QFTA 4IW3B 4LXTA 5H59A 4CEIA 5GGXA 2DUUA 3FSRA 1L5FA 3WDSA 4EYEA 4ZYUA 2PMDA 1DBQA 3C39A 2DRIA 1SVKA 3DE4X 3FLAA 2HNAA 2GEJA 4DLPA 5ALTA 5CB8A 2PIDA 3CLRC 5C8XA 4JJFA 2O3JA 3OLXA 3OE4A 5AM2A 1E63A 2OGSA 4DIFA 4ZT5A 3UB4A 5JSYA 3C8DA 2OXIA 3STTA 5BR1A 1ZGAA 3UAOA 1MLDA 3IB6A 3CN9A 2VIIA 3H84A 1OFTA 1H2WA 4H7HA 2VRWA 4JHXA 4JUIA 1Z0FA 5GONB 1D1SA 5CAEB 1PEYA 4BC1A 1ANKA 5EPOA 3HYNA 5KYWB 1QE0A 2EGUA 1COZA 1D9XA 2I7XA 3WC4A 1L7BA 4EKNB 5K8JB 4JR2A 1X7YB 3FF1A 1EVZA 2JBWA 1N6IA 2Q2QA 3PNOA 5EJFA 1C3EA 3UUGA 2VJMA 3Q7SA 1Y1RA 3QNMA 1OILA 2JAPA 4GOMD 4JMLA 2NNLD 4HF7A 4O8ZA 2JGIA 3RU3A 2R6CA 2HA7A 2BH9A 3SYTA 5K4AA 4FONA 2OVBA 4ZVTA 2W2KB 4OQLA 3ITNA 2YHIB 2V6MA 5IHPA 2B30A 1JDVA 4INJA 3STVA 1YWGO 5HW0A 2BRUA 3N0TA 3F73A 4UASA 3O8RA 1EDOA 2JRLA 3FMOB 3EIXA 3ZGYA 1JG2A 2GA9A 4HQFA 4ZICA 1PJ2A 3J81A 1E61A 3F71A 3ZIAD 3IA2A 4HQRA 4I5IA 3VXKA 1V8PA 1SELA 2FV8A 4NH0A 1NJ2A 2YXBA 4TS4A 1T1SA 2JI4A 3ND8A 3WYFA 5JPDA 5C8ZA 4UCWA 1ICEA 3ZXYA 3D31A 2ATVA 1DFHA 5EJMA 2PZJA 4ERXA 2G36A 1Y7LA 1CCWA 3O6VA 3OWOA 4OV6B 1IZ8A 1ZX1A 4I55B 3TIFA 4O1MA 2FWAA 3MJDA 4NQRA 4Y9SA 4OQQA 3V8VA 1EFPB 4BQEA 1O0SA 1ODCA 4J94A 4FZ3A 1Z6ZA 4GECA 4RK5A 1G5QA 3DHEA 4CDRA 3OTGA 821PA 3IAFA 1I2CA 1XOIA 2AOTA 3HNOA 4ZZ0A 4KHPB 4Y30A 3GT7A 4I14A 1N2GA 3TKLA 5ELMA 4O59O 3ANLA 3COZA 4IM7A 3PRYA 4AJOA 2FSGA 2VC2B 3JZAA 4NYJR 5ELLA 1HT2E 4A8TA 1CQJB 3LXRA 1KJJA 4KKVA 2JLQA 5J63A 1E6MA 1XTJA 3NM6B 1GXSA 5F35A 2X5XA 5BPFA 2JHGA 2HSWA 1N5OX 3Q0IA 2WKPA 3GBPA 5D6OA 1T8WA 4B7AA 2FPIA 1YQWA 3P4YA 3UH0A 5LSAA 1G2QA 3UPTA 2UYHA 3ETDA 4LI3X 2Q6IA 3WTCA 3GGOA 3IPCA 1BEEA 1QU3A 4X45A 4WNCA 1YB1A 3KKNA 1U8YA 2I65A 1SZDA 2FUG1 5KNCH 1O97D 3QUCA 3B2QA 1KI8A 2ZUSA 1YJAA 3HKDA 4WAUA 1RC8A 2IYSA 2WUWE 1KI1A 3EUFA 4HO1X 4Z53A 3RJZA 3FG9A 1S6YA 4B6FA 5AVVA 1VI2A 4XA8A 3SHVA 4XFJA 1XMXA 2I4RA 4F4FA 2QRMA 2WPDA 3KQQA 4QXQA 3LC1O 4WD3A 1UBHS 1ZC3A 3DBLA 3D81A 1X7XA 3H3JA 1WDMA 5CVDA 4G26A 1VMDA 3ED5A 3PUKA 4ECAA 1BKYA 2GZRA 3N8NA 4H7DA 2W4QA 4FPXA 5HIAA 1W36D 3K09C 3MD0A 1XU9A 2QOEA 4R8RA 1E1DA 2NPOA 2H1HA 2J46A 4N7JA 3GAFA 5GY7A 3UAWA 4PPFA 4ZOLF 4NK5A 4EJFA 1I3CA 4G5GA 4EW2A 4NAVA 5JO9A 4EA7A 2Z43A 3VR2D 2VRCD 3AO0B 4XYEA 1XTVA 1Z7EA 3FYUA 3V34A 4RPIA 4JVNA 1QVZA 2A5GA 3HP7A 4CV0A 1ZI6A 3RUPA 5I9LA 4FNAA 4C14A 3C5WP 2YYYA 4ED9A 3IPLA 2HA2A 5T57A 3A4LA 1DAKA 4A0QA 4MUHA 4XYBA 3FVQA 2PWYA 4NBWA 4EJSB 4EJMA 3IALA 4EYSA 1TM2A 3MW8A 4DR3B 3CTPA 3AIIA 2E4UA 2PZAA 1IXRC 4N82A 5HOEA 1A0OA 2EAUA 3REGA 2J4CA 4AW9A 3FTEA 1Q0PA 2H2FA 2J07A 1R8YA 3G59A 1T9ZA 1YL6A 4HGRA 1QIDA 4F3NA 4IDDA 4JIMA 3GCDA 4OB8A 4QUDA 1WNTA 1VDZA 4R7ZA 1VMAA 3KYJB 1Z37A 5EJ2A 2EV9A 4OQMA 4QTZA 3G1WA 2XQFA 4O4JF 3C4QA 4OAQA 4FEGA 2CJYA 4FGSA 3IXQA 1FLAA 4CDNA 4FFRA 2BZSA 4C5BA 3F7NA 4XB1A 4DLTA 2Z04A 1DXHA 3R8XA 2QU7A 4V1CB 3KZKA 4QG7A 4Q66C 2C7OA 1NXTA 4KDFA 1BD4A 5L3ZA 4MW0A 3AKZA 2ZPUA 2DHRA 1G3RA 2QLMA 4YQEA 2CXTA 5E0KB 3Q11A 1NATA 1XMIA 3UENA 5BW6B 2YH2A 1C7EA 4HJXA 3KQVA 3CLUC 1ULAA 1XBTA 4FDTA 4K9QA 4TGLA 2WJJA 1CDOA 5TRTA 3INRA 3FTPA 4IDOA 2APJA 3OIVA 3PXAA 4CIBA 1P4JA 3Q7TA 1V47A 4QHTA 1Z0SA 2GN1A 2AZXA 2KS6A 1KVSA 4V0ME 1U7WA 3HK2A 2C7QA 2VO1A 3W8DA 1UT8A 4GXTA 1CZLA 2BTQB 4DRXB 4PX2A 3K92A 3O75A 2W6MA 3UZUA 1J0BA 1ULBA 1AK1A 4OU4A 4MRMA 3DDCA 4UVGA 4E31A 3RYTC 4F5DA 2C78A 5SY4A 1ONBA 3R6GA 1OH5A 3ZX4A 1QRAA 1B8UA 3ESQA 4RHCA 3BDAA 4M53A 4F4UA 3JSXA 4LE0A 3ZWDA 3QSYA 3EWSA 2HADA 2GOYA 3H1PA 4ASUA 4NYIQ 5I6DA 1TJYA 2D7CA 5I8WA 4RVNA 4O2BA 2FMXA 3OQVA 3U4QA 1O03A 3NDPA 3PI6A 4D43A 1F2DA 5AHOA 1DCMA 4D42A 1J0AA 4MWEA 4AF6A 4TKMA 4N0DA 3WYNA 4KGDA 1JB9A 1JI3A 3GJ0A 2Z3VA 3ROFA 3HDHA 3VSEA 5JH7B 1BNCA 4H59A 1D2AA 3C6XA 4WZBA 1QGUB 4QATA 2RARA 2ACKA 4IJ6A 3UJ7A 4XW2A 4Q82A 1KP9A 1KOJA 3TMKA 5BV1A 5CCBA 3GL9A 3ZY6A 4JJIA 2Y71A 1FXUA 1NZJA 2DLDA 4Q9IA 2XH8A 2NSYA 3DE0X 3TQCA 4JKYA 3EYWA 5B7QA 4TKZA 1P1HA 2O3SA 4LHSA 2HT6A 3KXKA 4U7FA 1F3OA 4YFVA 5K2MA 3PLNA 5DM2A 4FMDB 4J0EA 4IR7A 4AJ9A 4DYVA 2E82A 1E7SA 1U2DA 2QM0A 4FD2A 3ZQUA 4Q4HB 4ES6A 5HCNA 4FZVA 2PU7A 1LVGA 2WI8A 3W0LB 1ESMA 3EEOA 1BS9A 4ZQGA 4RTSA 3EXIA 3T5GA 4ZRDA 1DFGA 3UM9A 4B3MB 3E7FA 5AKXA 3WB1A 2IXEA 3JD4A 1Q0HA 2HPHA 1OQAA 3KS9A 4G5YA 4BP3A 1AH2A 3KKPA 4FDAA 5B7PA 1BEUB 1PK8A 1L5YA 3ZQKA 3K16A 4YBZA 2ZTMA 4QDXA 2P27A 2JVJA 4KX3A 3ERCA 3FJ1A 4PS0A 4EEZA 3CZAA 4AQYB 1KMCA 1FYWA 2WA1A 4AMUA 4P31A 1WA5A 1OROA 1FDSA 2N42A 2PFGA 4J03A 5CA0B 3R5FA 3ZWQA 1TM5E 3UW3A 4DILA 3NNSA 3A04A 1GRCA 3OZCA 3U49A 1NM5A 1SUCA 2P5YA 1IU9A 1EFKA 4L5AA 2FRXA 1EGVB 1QHXA 3M5WA 5YASA 4E51A 4KO3S 3IRVA 1WR8A 4YAEA 5CNMA 2C00A 1WKCA 5BQPA 3H0CA 4LXIA 2BDEA 2SICE 4L6IA 5CVVA 1N2ZA 3JQAD 5HX7A 4ZYXA 1OTHA 3LUCA 1P6UA 3I0MA 3OY2A 2CLCX 4Y2VA 4TWIA 1U7DA 1DXQA 3L7IA 1X7DA 3KUCA 3L0SA 4L9SA 3WJ2A 4TUYF 4N7MA 5E3JA 5EP3A 1NT4A 2DGDA 4OQ4A 3I9FA 4TLLB 5HTKA 3GWGA 3LBIA 3DV2A 3NXSA 2XSZA 1Z33A 1UWKA 3PD0A 4ZALA 3BZBA 1PFWA 1WD7A 5BW8A 1N0VC 1WF6A 3UICA 2ZWOA 5EMMA 2F64A 4I6EA 1J33A 1QQ5A 1GUBA 3TAXA 1ZD5A 5C34B 2V5UA 1TPZA 4ZI7B 4MVJF 2OAQ1 5LJIA 4JLDA 3DKKA 4CTOA 4OLAA 1Q19A 2HK8A 1XTKA 3F7OA 4R2MA 3TLEA 3GIDA 3I45A 3OJWA 3FOFC 2AZTA 1DIGA 1UP4A 1Z7GA 5CYPA 1NJ8A 2A3NA 4XQEA 3C3AA 1VPWA 3ANTA 4MPTA 4K8OA 3TKYA 2W8BB 2GAAA 1FNMA 2QRLA 2FWBA 4O4HA 1XZJA 5IABA 1NUQA 4CMBA 3GLSA 3K0HA 3RJ5A 4EP1A 1I1HA 3I32A 1YZVA 3M4JA 4CV2A 3UCFA 3WA6A 1X80B 5CGQB 3ZCUA 4OI1A 1HC7A 1RDFA 1W0KA 2JAQA 2XYGA 1P7CA 2C5FA 1KFKB 4EYGA 2G04A 1EM6A 2ECPA 5FADA 3LYUA 1V1JA 5SY6A 3BEOA 1I5OA 3IBCA 3MOGA 3D7NA 1T8SA 1VFPA 2AE1A 2OWDA 2WYVA 3PNPA 3EX7C 1PZMA 3IDFA 2DE0X 4XD7A 2XTAA 1JTVA 4DJDC 4TRMA 2HU5A 2CLIB 1JI0A 1P7VA 3NKFA 4J3JA 3B82A 3I73A 4KWTA 4P1ZA 5H8WA 3EBLA 4Q7MB 5K6AA 1IZZA 1K6MA 2ZQYA 4I4TB 3OPYB 2VN8A 3T54A 4NECA 2R00C 2OZPA 4LOHA 2YIMA 2BR4A 4L7QA 3JQEA 4PGMA 3DP9A 4CT0A 2OK7A 1IQUA 1E3TA 1XX6A 3CKMA 2NUAA 4Y6SA 2QL9A 1EK5A 1NHWA 5F64A 4BP9A 2QM7A 3JQDA 4JH0A 4NBRA 2BUCA 2GBFA 3BZUA 1Y89A 2Z9CA 4WW0A 4AG3A 4YPOA 2CHUA 4QPCA 1H65A 1NXVA 2K2WA 3DKPA 3U5TA 2O8DB 1XCBA 4D3YA 3ACDA 4MMYB 1EGAA 1YL5A 4HNHA 2FSVC 2G83A 4O4IA 3THWA 2EW8A 1IHOA 2PANA 4P3XA 1IONA 1EG7A 4ZVLA 5B3KA 4N54A 3KOZA 4GOKA 3K9HA 5L4NA 3M5CA 3M6FA 1M0SA 3S70A 3CT6A 1QOPB 2GBLC 3HJTA 4MQ4A 1ZK0A 4FK8A 2B9EA 4Q9JA 3T7TA 2PGXA 3AXTA 3D8NA 3GCZA 1NWHA 3QBEA 1CUGA 4G56A 5E4JA 4D9IA 5IT9A 3ICVA 2X1MA 5HK8A 5BP7A 2Q4OA 1MJFA 5KQLA 2Y3IA 1NMYA 4DEXA 2JS7A 1EVYA 4LJ6A 4UU0A 1A50B 2WWRA 4BN5A 2HLHA 1C29B 1UEXC 4Y9DA 5ECGC 5GZ3A 1SAYA 2XYHA 3NYIA 2IUUA 1T4MA 4MVWA 4LXHA 1Y37A 5EE3A 2PGOA 2ZSDA 1WO8A 1A9SA 5CGZA 5KVSA 2F3TA 2NO4A 2JGDB 3PA6A 3PF8A 4LZZA 3W2HA 3WLQA 1LKZA 1TJ3A 5ALHA 2JK0A 4XTCS 1T3LA 3RREA 1L3IA 3HZOA 3PLRA 3D02A 1Z12A 2XEDA 4EHHA 2XBLA 3SKYA 3C4VA 3D7LA 3BK2A 2P3LA 1Z56C 2NT3A 4IV5A 2V58A 2E4AA 2FPKA 3PU6A 5EYPA 5LP6A 3RSGA 2F9FA 5GWXA 1WUHS 4X5OA 4YJGB 3A3YA 1OX4B 2WM2A 2FYTA 4B75A 1DBRA 3PJDA 5TQJA 1I0ZA 1KFBB 2WJIA 1L4KA 4QT4A 1DOZA 4DSTA 1RC0A 5DVZA 5IXYA 3WL6A 4MTCA 1SIWA 4OL9A 3FI0A 3NDRA 2LXNA 4XUGB 2KPOA 3PXEA 2EFCB 2YIDA 4MV1A 3G7SA 4NESA 3ZE1B 1NNUA 1ILEA 2A2ZA 4UBIA 2YJ3A 4I5GA 1XNHA 1YK0A 2J9RA 2XLBA 2ZI4A 2RD2A 4F93B 4NBUA 2CMHA 2FJUA 2J0SA 3QWBA 3R0ZA 5EXDA 1HDIA 4EPVA 1DAHA 4F12A 1AGRA 4UCXA 3AR7A 1YF3A 4TYWA 2PSHA 3LKBA 3RS7A 1NW8A 2GNAA 4L78A 3AB3A 4M1YA 1SOAA 4G8DA 4UE3S 4UMFA 4MV5A 1MAVA 2F00A 2Y1KA 2DPMA 1IG0A 2O50A 3CRVA 3T9AA 5JSFA 4QM6A 1NL3A 1QH9A 1KA9H 3C74A 5G4KB 3F78A 1R6XA 2XCTB 1E99A 2MJLA 4EHIA 1ODJA 4R1QA 2QMHA 4J76A 4NENB 3BIXA 5F2NA 4EG5A 2Q1UA 3O8OB 3QWAA 3RARA 5LFAA 5LDGA 3BHMA 2IHJA 2JFWA 2QTRA 3O9MA 1N2XA 2XODA 1RM3A 2IIPA 3GH3A 4UM9D 3ZCRA 4MPPA 4LZLA 4ZZIA 2JCVA 1PWYE 4E09A 4UAJA 3F7TA 4LDNA 5BYBA 5C53B 1SB9A 3UUWA 2QLNA 4NXMB 4JI1B 1XLTA 1E8MA 1QG0A 4PCLA 2QAGB 2Z6UA 4P0QB 1QORA 1WW3A 3H87A 2E2WA 3ZZ1A 5KTYA 4TROA 3L6DA 4KR3A 4LF4B 2H2HA 4EI7A 2FWPA 2PHZA 2FVYA 2FG5A 2W8ZA 3G23A 3EUEA 1R15A 4XCXA 1XDZA 1Y3IA 4HB2A 1K7SN 1WD5A 4G5SA 1M54A 3LY8A 1OGJA 3M2TA 4KNVA 4XLTA 4RVHA 3SLRA 1DQRA 4PAGA 4YI3A 1M6EX 2YWDA 5LA6F 2VDMB 1HDEA 4C6SA 2NGRA 3T7DA 4JFAA 3KYDB 4MJ3A 2W4IA 1G19A 2X19A 3GB9A 2PMKA 2PUTA 2I33A 3QPAA 2LKDA 4E2ZA 2CLOB 5IC4A 4DG5A 4LZWA 3B48A 5DLPA 2FPGB 2Q3HA 3F8WA 4XUDA 1CUVA 1PDWA 4WX2B 3EGDA 1T0IA 1X77A 1XJWA 4FSDA 3DBRB 4F06A 4QLOA 1C3JA 2YJGA 5EIHA 4AU1A 1H23A 1VXRA 1YQDA 1TVEA 3MJVA 5FYQA 4B5LA 4AKHA 3GCGA 4XKJA 2JFQA 3PIRA 5J4YA 4Q3OA 5FI3A 1YRQA 2PMEA 4NCIA 3S5UA 4IHJA 2CD7A 5FTLA 1B14A 1E1QA 5GJWC 5HDQA 2A0WA 2E4ZA 2JFNA 3H1BA 5IFLA 1M8KA 3HVHA 3TSOA 4C1BA 5KS2A 1UOEA 1M67A 3C87A 4PYRA 3TQRA 2ZSAA 5KYVA 4BZPA 3ZZ0A 3QVJA 1SMKA 4W8OA 1A1VA 1PSDA 2RHCA 3M5PA 4F9FA 2NZ2A 3TCKA 2WP0A 3O4RA 2WTUA 4B74A 1X8JA 2YZMA 1SPXA 2FWMX 2QX4A 2YMLA 3WDLA 2IU4A 2XB4A 4PAWA 1UFVA 2Z8ZA 1XC7A 5D86A 2Q41A 3UB3A 1GFIA 5EJ8A 10MHA 2VWGA 3MHPA 4A23A 2QMQA 4D3ZA 3C7CB 3LVQE 1JSRA 4EFMA 4HAUA 2BBTA 4EO9A 1BMQA 2IDJA 2XI4A 1AXRA 3HY3A 4POOA 5IT4A 5DLDA 4BX8A 4IF6A 3SX0A 3GT0A 1EHCA 4NF2A 1OB2A 4PZEA 1CIJA 1N1EA 1UEIA 3ASYA 3O95A 1VMIA 2A67A 1DSSG 2F1OA 2WWVD 3ZIAA 3AB7A 4KQFA 1J2RA 4OLJA 2I3ZA 4G2NA 2CUKA 2C4KA 2R7AA 4QUHA 3TXYA 1XDUA 3OOEA 3VR6H 1CZRA 2VS1A 4HFRA 2A9KA 3I30X 4C2BA 4DNQA 4NZNA 4P2BA 1Z4MA 4FEYA 4ZYTA 4XWAA 1NW4A 1ISPA 1U3FA 2G72A 3QZUA 2I7CA 2LV8A 3BTOA 3VZRA 4UNIA 1G3MA 3JW8A 3M6MD 3NYRA 4NEHB 5FV4A 4P3NA 4WWHA 3GZNA 1Y8QA 4MYDA 4MUKA 3WK9A 1N9GA 1XZBA 4CMAA 3BXXA 3P4UA 3HUDA 4Q1VA 1T1RA 3T4EA 4F85A 1J23A 1NYQA 1ZMXA 2CCKA 2IYXA 4U7TB 3SYLA 4D92A 5IVIA 1PR2A 4RIGA 4D6YA 1Z06A 2VJMB 5EQFA 1XYGA 1YCFA 2ZBRA 1KEEA 1RMQA 3KQKA 4K03A 1FRVA 5FWYA 3CVUA 1O77A 2AHOA 5BWOA 1NUSA 1P1FA 3K2BA 2OYCA 3WNBA 2X0EA 7ADHA 3W5BA 1NUHA 1W6UA 5LVAA 4A1OA 3AQIA 1HT1E 1JW9B 1RBQA 2HZ7A 1IY1A 2ZEJA 3MCUA 1CJUC 5LYJA 3VM6A 2YWFA 3QVXA 3KHKA 3ER6A 3T3NA 1SUDA 4CIXA 1C4OA 1E2JA 3O4VA 5C5IA 4RVUA 3RSCA 1ZD2P 5KNCA 1L7QA 4GS5A 5UKDA 4B9EA 2Z4SA 5JDCA 4JI8B 1SJ9A 5BN1A 2DY0A 1I1QB 1XTQA 3KE9A 2DQ4A 2P5SA 3F6BX 2HU7A 2ZIFA 3FWZA 3BFVA 3RSZA 4EYOA 3KDAA 4F38A 2OR3A 4BBPA 5H16A 2D59A 4FT4A 3N6VA 4QULA 5D2CA 2H1RA 4WI1A 1O95C 3QSGA 4JLKA 5KDLA 3UFXB 2PTHA 2I6XA 4IOKA 4XJSA 3ESYA 4I4IA 1Z2PX 4BMNA 1U0RA 1GSHA 2K5UA 1IY8A 2AOTB 4GOJA 1ZL2A 2NVUA 4KLNA 2ZYTX 1DE0A 4R0MA 4D0RA 1NDUA 3AEUA 2AKYA 3KK0A 3U7QA 1F8YA 3IR5A 2Q45A 2QXYA 4C5CA 7ABPA 3BRQA 4L6AA 5LZ5A 1SKUA 4RMNA 3TINA 2O2SA 1Q1QA 2C5EA 3VDQA 3HXOA 2WKQA 4OPMA 3UHPA 1D3AA 3P2KA 5DASA 3RVLA 1G4AE 1I2ZA 1EX7A 1GXSB 1QIHA 2R97A 3SQNA 3ZVLA 5JZ9A 1AZWA 3N05A 4JXJA 3JRWA 5KVAA 5EY5B 1T2FA 2PO7A 1XK6A 4EHKA 2FPIB 3QLVA 4X41A 4PC2A 3CNEA 2GF2A 2IU0A 3S8MA 3WLTA 3TGLA 2D4HA 4MO9A 2PA0A 4PNZA 5FBHA 3LX5A 2ZUTA 1CSEE 4K26A 5H4GA 5JY6A 4MYRA 4TLMB 3LWBA 1IJFA 2YWCA 4I55F 3RSSA 4V0QA 4DA6A 3SX4A 2ATCA 5B4TA 4F3CA 3T35A 4JBHA 2A94A 2ZRGA 1VIYA 3G79A 3Q1KA 4B3IA 4FN5A 4EA6A 1WDTA 2D8AA 2CY0A 3SZ3A 4OL0A 4RBNA 1NLYA 1OH7A 3BZWA 2RB5A 1SURA 5DCUA 1TZJA 1X7XB 3NIGB 3PJRA 2RGWA 1PGQA 5JTTA 2WWGA 1U3WA 5EPEA 3KKOA 1PVOA 1SBNE 3MIIA 1HETA 3MMPA 1V39A 3HO8A 1BWPA 2E48A 4R8KA 3S1LA 5K8TA 1U3VA 4J3FA 2GZDA 1W1WA 2QPOA 4HPXB 5ICEA 4KQ2A 1B4DA 3P45A 3KM0A 4RKQA 1F48A 1B7GO 2FTKE 4J1SA 4TL6A 2DB3A 2PYIA 3VC7A 2IXGA 5KKNB 1P60A 3FYUB 2G9QA 1N6OA 3KHSA 5AVRA 1CEQA 3WOVA 4B2YA 5IVHA 3INYA 5K1SA 1HTBA 1HKHA 4O6VA 1H2AS 4UM8B 1BKSB 3SAJA 3TIXB 2PNFA 2FZ4A 4HVAA 1Z07A 1F20A 1LZKA 4G1CA 1RZVA 1JFSA 4B6GA 1BX1A 3ENKA 3QOFA 3NWJA 4YRMA 5KC8A 2JDIA 2GPNA 2RI1A 3ZBTA 5AK4A 4HNVA 4RXMA 3VMFA 1HNWB 4IIVA 3AM5A 3E61A 4D9HA 4MW9A 1OE0A 3IOBA 5DM1A 3HXMA 3PQ6A 1FJGB 2RHJA 1RCUA 3JX9A 3G2KA 1XDDA 1MOQA 2YRWA 3DL7A 5AO9A 3DVAA 1MENA 3BKWA 4BO4A 2V7PA 5GP1A 3EVNA 4HLUC 3ZEAA 1HOTA 1KZ6A 3BIJA 3PXDA 4UQOA 2HDWA 2CHVA 3N28A 4AJ4A 5H9WA 4R9NA 1E6KA 4R54A 1MJNA 1YQTA 3I5XA 1Z6PA 1G8KA 2YN4A 2R84A 4CUJA 2W6ID 4QBTA 4BB0A 1Q2UA 2OBNA 2P6PA 3KV1A 1YJ8A 3IIEA 4U8GA 4DC0A 5CXXA 1Z5NA 1N6HA 3T3HA 2Q9BA 1ECLA 1N7HA 2D06A 4HX9A 2IOFK 4OYLA 3HWWA 2BSQA 4U6NA 4LCJA 8AT1A 1PL7A 4J0HA 3WFJA 1ZVKA 3Q0TA 2OORC 1QTQA 4DM4A 4YUVA 5K7SA 2EBHX 5DHQA 4HLDA 1UXJA 3EIUA 5EUMA 4IGIA 2B2XA 3RTCA 1SRQA 1FNBA 1K7EB 2QKYA 4A91A 3VGPA 4Q3LA 3L77A 2LE0A 4BQRA 4HPWA 5IM4A 3RHZA 3HJFA 4W8HA 3PICA 3AGPA 4MRMB 2ZYVX 4EUFA 4LPKA 4PR0A 4JI2B 1KFJB 3CRMA 1E2HA 4R7TA 2D8MA 4NTZA 3GJ7A 5DI9A 5IBPA 4JKIA 2Y1OA 2TMKA 4PZLA 4D8UA 3RIEA 4YAJA 1S2NA 4ROTA 2VUHB 4C4OA 4KZPA 4PTZA 4LNAA 2BM9A 2GZAA 3DOJA 1ZS9A 4K81B 1JFLA 2DTXA 5CTAA 4O2BB 1PTJC 4YTEA 3SS7X 2CSXA 3U4QB 4D9BA 5KWJA 1UCFA 5TPWB 1L3BA 2EKPA 2JANA 3HJGA 3IEPA 4O25A 3KLPX 2W0SA 1LJLA 4NLLA 3TM5A 2KHZA 3B78A 4TM8A 3CHYA 1OT3A 4L3WA 4LGMA 4MA0A 2Q5EA 3W9YA 3ZE9A 4Y1FA 4XIJA 2ZI3A 2X8BA 3F5SA 4NICA 4WZBB 4M0FA 2QUJA 1ST3A 5CVJA 1U9IC 3WGZA 1XEXA 1Z5PA 2LDXA 1FTSA 3ESRA 3T0GA 3TVTA 4Z6KA 1GPUA 3UC9A 3GJQA 2RKOA 2R1TA 3R5HA 4TOIA 3G8DA 4UHEA 1DS6A 2C9BA 3C1TA 2EJCA 2R4TA 5LD2C 1QB8A 1NBAA 3CX6A 4B4DA 5DSZA 4X63A 1K2VN 3X2SA 2HJ9A 4AYWA 3HR4A 5TMDA 2OCKA 2P9QA 4YP9A 3JQAA 1OAOC 5IKOA 3Q3VA 4QPNA 2YN2A 4WLEA 4UHDA 2GM9A 4BJ3A 1CR6A 1VGQA 4YROA 3HR8A 3THYB 3H04A 1IXSB 3DL0A 5GVRA 3VUEA 2HT1A 1IQRA 2MDTA 4OXKA 3EXIB 4RXTA 4M49A 3PNVA 1N9KA 4QLBA 2Z8YA 4M0PA 4NMXB 3KWFA 2CMFA 4BFSA 5JANA 3W79A 1T3SA 3QUTA 5CPFA 3FSEA 5JH7F 2Z1NA 2GETA 1NAIA 4PFSA 4M1TA 1XMJA 4P53A 1X7GA 3EVBA 1PG5A 4YRZA 1Q2XA 5MN5A 4Q4JA 4IS2A 3CEMA 4B17A 1HLPA 1M2VA 2L0XA 4IHAA 2XUDA 5JTUA 4Y0NA 2R7KA 2DVMA 4AI6A 3HY6A 2QZSA 1D1PA 1MEJA 1Q44A 1W47A 4ENSA 2Q3EA 4KFRA 4TV9A 2UVDA 4QARA 1CR2A 1O95D 2FLVA 2FP4B 2J1LA 2I4MA 2RGAA 2C4WA 3WIEA 3IDAA 1GGHA 2JJ1D 4IIXA 1TTQB 2K2QB 4FOLA 1XQWA 3OIYA 1F8FA 3PWKA 2I2FA 3QUAA 4KRGA 3X44A 2BFFA 1ZGHA 3ME5A 2YFQA 3CZCA 4LHWA 2V9PA 5CH3A 1ZK2A 3GRPA 1D2EA 3BORA 2IBTA 1HDOA 1REQA 2EJWA 4FXOA 2LNDA 1DEOA 2Q3CA 4GM4A 1U9JA 3OQMA 3K09A 4JB3A 3VOBA 4JLPA 2ARKA 2CHFA 2X9GA 3IV7A 3GXBA 3ND6A 3NYWA 3Q3EA 2VJYA 1KDZA 3WGQA 3QBDA 4LOKA 3NGMA 2YJZA 2WT9A 5EI5A 3WIVA 1Z5WA 2BJHA 1UXHA 3EQ7A 4LV6A 4CDMA 2JIPA 5AKKA 5BN3A 4F92B 3EWIA 4M2LA 4FOOA 4MV8A 2J7KA 3WQSB 4DLXA 1DJPA 4DLVA 2NQTA 3NHYA 4BIMA 3DEJA 3ORYA 1TYAE 1FFDA 1HTWA 1Q7BA 5D8DA 5EJGA 3S55A 1JQ5A 3K9FC 2VAVA 4FW9A 1MJHA 4R9RA 3MRVA 3OX2A 5A6VA 3R3UA 5EP4A 1L6IA 4L5CA 4DLBA 1X1BA 2BE7A 3E2IA 4O4HB 2MSCB 4F6LA 2RHTA 3AZQA 2BR3A 4UFNA 4WN3A 5C18A 1PIWA 1K6IA 2B6HA 2WHPA 2ZTUA 3A1TA 1HFKA 4Y6RA 1F2VA 1R64A 1XVLA 1QRUA 4HWOA 3VH1A 1OF1A 3BK7A 3ZV6A 2O4CA 3PDIA 4RWEA 3RF7A 3CJTA 2FMIA 4FYPA 2YXLA 2B61A 2ZJBA 3UK1A 1XZKA 4DMLA 1Z0JA 2XGMA 5TB5A 2IHKA 3WB0A 4S2EA 1UT5A 1ZCAA 4GYYA 5A9TA 1JYSA 4M8LA 3O82A 4BO3A 3A1FA 1B3BA 4REMA 1LY1A 1J2TA 1PEKE 1H0KA 3DWGA 1AQJA 2ZYWX 3GJ6A 1NJGA 1LRJA 4MW5A 1O57A 3KHUA 4JC8A 4H15A 5EKXA 1XF9A 3G9XA 2DUMA 1V4BA 3BMQA 3D6HA 3PL1A 2PT7A 3MMXA 3QU9A 2H3EA 4YAKA 4JOCA 1YZ3A 1PJRA 3LFUA 4GVLA 4AG6A 5TMPA 1TVMA 2EIHA 2YVLA 3QX9A 4R4JA 5FBZA 1G41A 2Y1EA 3A1NA 3THWB 1KMHA 3OD5A 1WZEA 4O4IB 3JRXA 3FPJA 4KIWA 4HZGA 3GLGA 2JEOA 4AN4A 2J4FA 4FMBB 2VJLA 1F4LA 3K1JA 2IV3A 2YVKA 5BQOA 4CMJA 2ZRBA 2F67A 1QRRA 2HNBA 2I9PA 2XUFA 1SVLA 5JZBA 5LJLA 4PHGA 2JJ8A 5DM0A 4HNTA 1BVYF 3SMQA 3IBFA 4B40A 4C3VA 4TWAA 3LHKA 1R6BX 2GRUA 3OBIA 4KE9A 2A5DA 5CBPA 3X43A 3PJFA 1F7VA 1GP2A 2YOFA 2XZOA 5J4KA 1PT9A 3D9QX 2NXJA 1S7CA 2WTMA 3N2KA 4B0PA 4LWZA 2ETXA 3JU3A 3TGPA 2ACEA 1CLUA 4F6CA 1MTZA 4P0TA 1OFUA 1R10A 5HFNA 2YRFA 2K4MA 2ZZKA 3RAPR 3QY0A 4DPMA 2ZRLA 1NG9A 1GAEO 3S2FA 3EIEA 3O84A 3AJRA 4PCAA 1GEEA 1V41E 3NAMA 4I1YA 1X1QA 3S6JA 3FX2A 4OH1A 3TMYA 3N2EA 3PC7A 3KQWA 4BCDA 2VNJA 1NN0A 1MVLA 4XEUA 4LF8B 4RVCA 3GH1A 4U5XA 4D2IA 2NWQA 4P3YA 1X8XA 2FN8A 1ZITA 2VUTA 2CNW