4JBIA

2.35a resolution structure of nadph bound thermostable alcohol dehydrogenase from pyrobaculum aerophilum
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
333
structure length
333
Chain Sequence
HEMRAAAFSTPGLENLKLVEAETPRPGPGEVLIRVKYAGVNPLDYNVVAGAVKASPMPHIPGSEFAGVVEEAGPGVTGVSRGDPVVVYNRLYCGHCRQCLTGWTQMCEVTGGGIIGIVTQGGYAEYAVVPAKNAVATRADLKEAATLPIGALTAWNMAYRASISPGEKVAVVGATGNVGIYAVQFAKLLGGEVYAISRRKAKVESILKSAGADAVLTPDEAKSAAPFDVVLDPTGSASWDLSFGVLGRGGRYVTAGALTGAEVRLDLRRLYGMQILVIGATGGRRADFNTVVRLLEAGRIKAFLHNVYPLADVRKALEELRSPERVGKVLIAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alcohol dehydrogenase (Zinc)
publication title Physicochemical Characterization of a Thermostable Alcohol Dehydrogenase from Pyrobaculum aerophilum.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
total genus 108
structure length 333
sequence length 333
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jbiA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4jbiA01
2J5KA 2X1HA 4GGOA 1WXDA 2PGLA 2VWGA 5A5FA 1JW9B 1JN0A 1RJWA 1YBMA 2FZEA 3PGXA 3VC7A 3PHIA 5A02A 1NVTA 2HU2A 2WYVA 4WASA 4D42A 4EEXA 2Q2VA 4AJHA 3I9OA 1UZNA 2VOEA 1SC6A 3FNHA 4E21A 5LCXA 5A1TA 3K96A 4W99A 2PZLA 3MZ0A 1MG0A 3U49A 3AUAA 5JMWA 1U3WA 1R12A 3X2EA 2Q1SA 3NGXA 4CLEA 4BNWA 4U7WA 3FI9A 4YTEA 3C7AA 4L73A 3JV7A 2O7QA 3TZ6A 3L6DA 1VSUA 3OA2A 3KYDB 4B79A 4CL8A 3S1LA 2CVQA 1R4MA 5L4SA 2B5VA 2C7GA 3Q3CA 3ABIA 3C85A 3MJTA 1L7DA 3EMKA 5KNLA 1CETA 1M67A 4RVDA 3V1TC 4EJ6A 2B35A 4F6LA 1ADBA 1LX6A 2DFDA 4JBHA 1Z45A 3QA9A 3HHPA 3W4IA 4CLHA 1E7WA 3WQRA 5JAZA 5MGBA 4A03A 3JQAD 4PG4A 4JX8A 4CMBA 3LT1A 3GLQA 1D3AA 1SB9A 3IUPA 2OOSA 1B0AA 4R51A 2QYTA 4C7JA 3GMDA 1DEHA 3K31A 4RF4A 1P9LA 3IAHA 4FPXA 1SMKA 3WSVA 3KETA 2PH5A 2GDZA 2Y67A 3KB6A 1BGVA 1ZK4A 2DUUA 1YB5A 3R6DA 4IZHA 5DCWA 5CFZA 1G1AA 1P1HA 4CLRB 4BKRA 2ZB7A 1UH5A 1Y8QB 2EV9A 3ITDA 3BHIA 3S2FA 1EE9A 2A92A 4FIZA 3JQDA 4WNCA 5CDSA 3DR3A 1I33A 1TLTA 1TT7A 1I24A 3FPCA 4DYDA 2ZB8A 3T4EA 2RH8A 3ZZNA 3DZGA 3D4NA 1EQUA 2O3JA 1C0PA 4BKPA 4K9DA 4D43A 2ZTMA 3HFGA 2B83A 4JXKA 3JQ7A 2ZB4A 3WMXA 3OH8A 4BNKA 4FFRA 2DTEA 2V6FA 2C5AA 4F45A 1ARZA 4MJLA 3VDRA 3TL2A 1G6KA 3GNSA 4CV2A 2BGMA 3EDMA 3JQAB 3RSHA 5K6AA 1PEDA 5G4KA 5JY6A 5HRUA 1SOWA 3V1YA 2HRZA 3GRKA 5EIOA 3LC1O 2B0JA 1AGNA 3JQGB 2E49A 1YOVA 1YL6A 4E2ZA 3OICA 1ORRA 1Q1NA 4BS9A 2PNFA 4KDEA 4E5NA 4WLOA 5CEFA 3BYZA 4LVCA 3HADA 4WPGA 2X5KO 4CV1A 7MDHA 3IQDB 3G79A 4BO4A 2DLDA 3E82A 4XYMA 5A9RA 3BMQB 4FJ0A 2OXIA 4A0SA 1E3WA 2EP7A 4KQWA 4R69A 1NR7A 1Q7BA 3AOGA 3L4SO 5FYDA 4A2CA 3H8VA 2O2SA 4EUFA 5JDCA 1NM5A 3GVCA 1YDWA 1ZCJA 2X8LA 1ZXLA 1XSEA 4NU6A 3DB2A 4LVUA 3E18A 1DSSG 4BGEA 3AOEA 2Q46A 2JHFA 3W8DA 1QKIA 2PKRA 1OMOA 3VKUA 3GOHA 2DT5A 2GD1O 3AK4A 4MKXA 1UXIA 4K26A 4WOKA 3DBRB 1I30A 3F1KA 2WYUA 2V65A 2R00A 1G0OA 2VRCA 2VT2A 1AXEA 2O2YA 2A4KA 3I9JA 4O5OA 4K28A 4FFMA 3Q9UA 3P2OA 3OQ1A 4BO8A 4HXYA 1U5AA 1F06A 1VE9A 1E77A 3H3JA 4M54A 3CUKA 1E1LA 3WGOA 3BMNA 3IS3A 1GEGA 1V35A 2GERA 3GRPA 2OO5A 1NXQA 4OHUA 2FR8A 4YPOA 3PHJA 2PK3A 5K6AC 2C07A 3TOXA 3DAFA 3GPDG 4PGFA 4D3FA 4CQMD 1YXMA 3PP8A 1C1DA 1SPXA 4NI5A 4Z0TA 2DBVO 4DIFA 1ZK3A 3QQPA 4WK6A 2BFOA 2Q3EA 2DPHA 3CEAA 5TQVA 3OEWA 5A04A 1KEUA 2B37A 5I9NA 4CM6A 1UXGA 4WCFC 3PHLA 5FEUA 2LDBA 3WIEA 1E7MA 2HJSA 3EAGA 2PFGA 2Y1DA 4PLTA 4FQ8A 5L7YA 5L7WA 1PGOA 2Q4EA 1Z74A 2QX7A 5JDCC 5KTKA 5BSHA 2X22A 4GLLA 1P77A 3IDSA 1NHWA 1H6BA 3B6ZA 2Y0DA 1AHIA 3HB4X 3TZHA 1P31A 3OA0A 1TI7A 1YO6A 2P4QA 5FF9A 3AOEC 2VN8A 1PL6A 1XGKA 1V8BA 3L77A 3N58A 3NT4A 1F8FA 5JCJA 2PWZA 5JYEA 2OBNA 2YFQA 1N1EA 1Y8RB 4IDEA 4I1IA 2IXAA 2Y68A 2J8ZA 1U4OA 3AJRA 2WD7A 1PSDA 3AM3A 1A4IA 2YDYA 3KEOA 4L8VA 4F46A 4CQMB 3JD1A 4EZBA 3DZFA 4NJMB 3WYBA 1D1TA 2AEFA 3ZWMA 3MWDB 3Q6IA 3K73O 3RI3A 1X7GA 1PQUA 3QP9A 1MUUA 4J43A 5A3VA 5I7VA 3KM0A 3GN1A 3RJ5A 4AJIA 1ISGA 3R1IA 4BB6A 3H3FA 1E3LA 1XCBA 2YV3A 3NX4A 1UXJA 4CR7A 4OAQA 1LA2A 1DIAA 4NBRA 3BMCB 2CSUA 1A27A 1E3SA 1G0NA 8ADHA 3WICA 2B36A 4JNKA 5IDWA 5TNXA 4CMIB 4FDAA 2DBZA 2NU6A 4RZHA 1H5QA 3JQ6A 1KS9A 2GUGA 1QYCA 5IN4A 1H6AA 4OOEA 2DM6A 4RDHA 1ZJYA 4BL5A 3KLMX 1HDGO 4QEDA 1DXYA 2IDZA 3ROPA 4GVXA 4DMMA 1GQ2A 3LT4A 2GPTA 4QX6A 4MVJP 1XKQA 1HF3A 4JLWA 5ICSA 4RDIA 2Q2WA 1P74A 5BSFA 4B4UA 1ZMOA 5CEEA 1KVSA 3QVWA 4AVYA 3CTMA 2X6TA 3I83A 4CM8A 1KYQA 5G0VA 3WSWA 4R9RA 5C3MA 3P2YA 1SB8A 3COSA 3ITKA 5B4VA 2C82A 1ZKMA 1PWZA 2HMWA 4XCVA 5CG1A 1Q0HA 1PGQA 2B4TO 1PGPA 1A5ZA 1BW9B 4PCVA 4WJZA 3ZNOA 1GUFA 3OQBA 4GGPA 1SEPA 4EITA 1KC1A 3DC2A 3RU9A 5K9ZA 5JAMA 1KIFA 1NFRA 2XOXA 1DFGA 1LC0A 4IMRA 4BO2A 2AE1A 2NVBA 2PKQO 3WGQA 4E30A 2I65A 1GQQA 3WXBA 1GYPA 4GX1A 2Y1CA 3NEPX 3JD2A 3LF2A 1C0IA 1I3KA 1Z7EA 1U3VA 4AJKA 3QSGA 5EN4A 3ETDA 4WEOA 1KVRA 7ADHA 3JD3A 1EVJA 4YJFB 4JQCA 4W9NA 3PK0A 4HNGA 3RAJA 4KUGA 1GAEO 4QQRA 3FTPA 4HFMA 4GQAA 4Q39A 3QVOA 2WD8A 2YDXA 2GNAA 4IJWA 3IJRA 5F21A 4YYZA 1GQYA 1NQOA 3JD4A 3BTOA 3MJEA 4NK4A 3OETA 1DC5A 1GZ6A 3QW2A 4H3VA 2AA3A 5JAQA 3DHYA 3I9LA 4C7KA 1H2HA 4YDRA 1A9ZA 3WQSB 5MDHA 1PL8A 3K8ZA 4MKZA 3ASUA 2AEMA 1I36A 1Y5MA 3PLRA 4BO6A 4R54A 1EEHA 1B8VA 1HE2A 1XR3A 5EJ2A 5HBRA 4CM5A 4Z9FA 1LLDA 2IZ0A 1PZGA 4Q3EA 4NPCA 3E1KA 2RIRA 3EK2A 1N5DA 3QVTA 1YE3A 2HDHA 1QV6A 2Q49A 5L4NA 3NTRA 4J91A 3E5RA 3G1UA 3PWKA 3EVTA 3PQDA 4PN3A 4L4RA 4ALIA 1HETA 2YQ4A 1RWBA 1LSUA 1RM5A 1YVEI 1VKNA 2QZZA 1CYDA 1WPQA 3FHLA 3ONFA 2CNBA 3HZZA 1P45A 1TT5B 4ALJA 4E31A 3CH6A 4G2NA 4HKTA 5DDIP 3U5TA 1BXGB 4XIJA 3ZI0A 1SBYA 4XYEA 5C5IA 5KVVA 1TVEA 4R1SA 1S6YA 1VM6A 5COAA 3KLPX 3GEMA 1DB3A 4PLYA 5LDGA 4D7AA 1I8TA 1DFHA 1ONNA 3OJEA 4YT4A 1UP6A 4WCDA 2XPCA 1YJQA 4W9NC 1SO8A 1IE3A 2J5RA 3PRJA 1Z75A 1AHHA 3PJDA 4YAIA 3UCEA 1OBFO 3VZSA 1VL0A 3IUSA 1PZFA 2I5PO 3E9NA 3JQ9A 1X1EA 4IXWA 4XJTA 4DLAA 3WOHA 4M8SA 1DO8A 3HDYA 1Y5RA 2EW8A 3U3XA 1LEHA 3AWDA 2WTBA 1F14A 1HRDA 3DOOA 3RBVA 2IEBA 5A9SB 1L1FA 3ZW9A 1HWYA 5C7LO 2DBQA 5EINA 2ILTA 5L9AA 1LLUA 1U3TA 2CDCA 4EYEA 2OFPA 4NFHA 4AJNA 1E3EA 4DQXA 5U9CA 1C1XB 1LDNA 1BVRA 1LTHR 5ICMA 3DXFA 2NUAA 5JCXA 3W4JA 4PZDA 1VC2A 4XKJA 2G5CA 1NASA 2IODA 4R3NA 3D1LA 4BNIA 5G2OA 3HSKA 2BRUA 4IDDA 1B3BA 3DHEA 3NV9A 4QUKA 4A7PA 5T8KC 2Y0CA 1LUAA 1O89A 3Q0EA 1QSGA 2C0CA 4W7HA 2O7SA 3DZIA 4PLFA 4LMPA 3QWIA 4B4VA 2XF8A 1VRWA 1LSOA 3EUWA 1DIGA 1N9GB 4J1TA 3NYWA 3HN7A 5THKA 4KDFA 4FSHA 1XEAA 4J9VA 5GMOA 3PYLA 1Y6JA 1K3TA 3ASVA 4HADA 4N5MA 3G1TA 1IOLA 2ET6A 4ZQEA 3GT0A 1O6ZA 3ZHBA 4O1MA 4UVHA 5BSGA 3B1FA 2UDPA 2QQ5A 3UCXA 1VL6A 3L4BA 2ZIZA 4WNIA 4XDYA 3LT0A 3KRTA 1BXKA 4IPTA 1IL0A 1UXHA 4FGSA 5IDXA 1GCUA 1WAMA 3UICA 4URFA 5G0SA 2VHVA 2VQ3A 5L40A 5A06A 2V6MA 1PJSA 3GG2A 1LI4A 1QYVA 3P7MA 3UW3A 4RL6A 4QTZA 1I0ZA 1N7GA 2C2YA 4H7PA 3WG9A 2E4AA 3SLGA 2YJZA 3I3OA 3DZHA 1EK5A 5C7OO 2VRBA 1H6CA 3FNFA 3RU7A 4KQXA 1CERA 2C29D 5I9LA 4OQZA 3VPXA 1HLPA 1ML3A 5IF3A 1NVMB 1CQIA 1IY8A 3DTYA 3F46A 1OZAA 4NNJA 4ND4A 1SZJG 1YONA 2QRKA 2Y0EA 3OJOA 1PL7A 1XU9A 1E6EA 2PD4A 2V6BA 4ALMA 4OGWA 3R3SA 3I9NA 1IHXA 1ONPA 5ADHA 4IQ8A 1R4NA 1PS0A 1H2BA 4XQCA 2Q1UA 1E5QA 2PLAA 3HUDA 4B7XA 5DOVA 4KP7A 3H7AA 5DCYA 2P4HX 1CQJA 3ON5A 5ER9A 3FF4A 2JFHA 2PD6A 3T7CA 3H2ZA 4RVSA 1OI7A 3GQVA 4NG5A 3C3XA 4CM4B 3WTCA 1K89A 3O8QB 1YKFA 3C7CB 3AUSA 1XELA 3RC9A 4CV0A 1ZMTA 4D3DA 2Y1OA 4FFLA 4F6CA 4E5YA 2F00A 2X0RA 3CKYA 3MJSA 4DIBA 2H63A 2VNAA 4U5QA 1V0JA 2OL4A 4BNHA 3MJ4A 3H6KA 4ONEA 4OKIA 3L4BC 4D44A 1XG5A 2NM0A 2OBYA 1U1IA 2D59A 3FRJA 1WMAA 5L95A 3G0OA 2DKNA 2PA3A 3OMLA 1M76A 1LLQA 2FR0A 3HB5X 1HYHA 4EUHA 1SAYA 5ER6A 3H5NA 2E82A 3QWAA 1LU9A 1RKXA 1QYWA 3TZKA 4AJ1A 4Z0PA 1XYGA 4PRLA 1KBZA 4N54A 1ADFA 4HFRA 1Q7CA 1ZH8A 3WGZA 3INTA 1FF9A 5CHEA 4QO8A 1GU7A 3OIGA 3DBVO 1HDCA 3TF5A 4L75A 3Q2IA 3PHHA 2ZQYA 3JYQA 1QRRA 4AJ4A 1FDUA 1HKUA 1YQGA 2X0JA 3AU9A 4Y6SA 3WFIA 3TWOA 4UULA 3EHEA 4HP8A 1HXHA 2CVZA 1JVBA 3TDKA 1EQ2A 4CQLA 3KOUA 1ADGA 4JBGA 1T26A 3WGIA 1WW8A 5ENDA 4LK3A 2YQ5A 2P5UA 3VTZA 3INRA 1ONOA 3QWBA 2J3KA 1E1KA 2Q50A 3ICPA 3K5PA 4J16A 5ENVA 1GV1A 3ZH2A 3H9JA 5CDTA 5B4TA 4RZIA 5JNLA 4BKUA 1U9JA 3GZNA 3L9WA 1NWHA 1U5CA 4EI2A 1I2CA 5TRTA 2LDXA 4NHEA 1IZ0A 4ILKA 5H83A 2I76A 2X4GA 2YV2A 1R4MB 3A06A 4Z3DA 3GVHA 3SBOA 4IM7A 4LCEA 3UVEA 1BTOA 5EQDA 3R3JA 4DGSA 1I32A 2CUKA 2FSVA 1E1MA 1LNQA 4CV3A 4MVJA 3DO5A 4J4HA 2VTEA 3VAZA 1TA4A 4K6FA 2VWPA 3KSDO 1NR1A 5HS4A 4L9RA 2YUTA 3NDJA 1GADO 4I08A 4K1LA 4OIMA 2FRDA 4XZ3A 2NLOA 1PJLA 1R6DA 5ITWA 3ADPA 3EVNA 4QFDA 3I23A 5AXAA 1MB4A 5TF4A 3ETGA 1EK6A 1JWBB 3VKVA 3VPHA 4DA9A 1Y9EA 3GA0A 5H82A 2FZWA 3PZRA 3PQEA 3GN2A 4MVJF 2X0IA 3KYDA 2VWQA 2GN4A 2HK8A 4KUEA 4CMCA 2BMAA 1BSVA 9LDTA 3S2IA 3RKUA 3AM5A 2VCYA 3E9MA 4RF5A 3KYCA 1O95A 4ZRNA 3WBFA 1U2DA 3GDOA 1DOHA 1YBAA 3GNTA 3ROMA 5CEJA 4UUOA 1KEVA 4ZN6A 3GAZA 3OHSX 5JFOA 2WEKA 2W2LA 3FBTA 3JQ7B 1ZSNA 3N7UA 3A14A 3E48A 4OKNA 2NTNA 4XB2A 4AJ2A 5T67A 1E7QA 5JE8A 3C1OA 3U0BA 5DULA 2R6JA 4XQ9A 4MVJE 5G4KB 4M49A 3ULKA 2NACA 3S55A 4BNVA 2VUSA 3ZWOA 2VRCD 3GY0A 2Y66A 1YOVB 2IEDA 5BT9A 1IPFA 5TIIA 3ZWVA 1Y8QA 3VTFA 3WWYA 4FCCA 3H9UA 4MP3A 3IMFA 5TJ9A 1RM4A 6LDHA 3QJ5A 4JK3A 5JY1A 4YQYA 1BMDA 1M75A 3QHAA 2GGSA 4R41A 5TT1A 4LSMA 5EERA 1E3WB 3AI2A 4GX5A 4WCFA 4EDFA 4XRRA 1VJ0A 4BOYA 1HDRA 1HE3A 1T4DA 1XQ6A 3KYBA 5ITVA 2YY7A 1Y7TA 3WYEA 3ZNPA 5JAIA 4W82A 4DUPA 2FP4A 2PZKA 3H9EO 2VTDA 3RWBA 2V6GA 2JD1A 2O3RA 1HL3A 3SJ7A 2EG9A 1YL5A 3TRIA 3SVTA 3VZPA 5K1SA 3GHYA 1Q0LA 4OXNA 4YACA 3TFOA 2AMFA 3BTVA 4BQRA 1F12A 3AI3A 3RCBA 4TROA 1I3MA 3DHNA 4QXMA 5KVCA 5T64A 3ZV4A 4I5GA 4KWHA 3ZCXA 4DIOA 1UZMA 3F4BA 1HDXA 1GYRA 3PYXA 2PR2A 1E7SA 1WDMA 2C5EA 4FFPA 3SXPA 2GF2A 1XDWA 4PG5A 1KEPA 2NVUA 1R37A 4D45A 4A73A 3NJ8A 2C54A 2PZMA 4P22A 4BUCA 2HK9A 3B1KA 3RC1A 1VJ1A 3BMNB 2ZTLA 2I67A 2J6IA 3A4VA 4YEDA 3WGGA 2CD9A 2PKQP 1BDMA 1H94A 1MFPA 3PJFA 1GDHA 1UDAA 2NSDA 2G0TA 4GBJA 3EZLA 5DBFA 1XU7A 1GTMA 1MC5A 5H81A 2UAGA 4J7UA 4HUJA 1C1DB 1PR3A 3BIOA 2EXXA 2PGDA 3RASA 1VL8A 3DBRA 3PGJA 1P0CA 3I52A 1D1SA 2O3SA 1U7HA 5JO9A 4IGEA 3S2GA 2Z1NA 3ZHYA 4BNTA 2EGHA 4RVUA 4BHTA 4PZCA 2Z95A 2GYYA 1PJ2A 3BMOA 4OYRA 3WJAA 2PZJA 3I1JA 4MVJG 4CJXA 5IDYA 4MVJI 4RO0A 1X13A 2DPGA 4GMGA 3TL3A 5KJEA 2Q45A 1KERA 4B3IA 2CFCA 4JP3A 3W6ZA 3ZU4A 3SX2A 4C4OA 3IOYA 4E3ZA 3GUCA 1DIRA 1E1NA 4LRTB 3WNVA 4DPLA 2O3TA 3PTZA 2AW5A 3VDQA 3W8FA 1E92A 4IDAA 1I3NA 4R3WA 4YRAA 3GPIA 2IRWA 1HZJA 1T1RA 3K2EA 3K2BA 2WD7B 3GVXA 4R01A 3WS7A 3ZWNA 5KCZA 4FS3A 4MOWA 2X9VA 4YJGA 3G17A 2X86A 5JC8A 3H9QA 3OJ0A 4YAGA 1LSSA 1GZ3A 4DQVA 3JSAA 1Z82A 4IY1A 3BXXA 3O26A 4Y9DA 5LDHA 3U4CA 2AEJA 4HX5A 4U0KA 1WDKA 5T57A 4BNUA 3GEDA 3AI1A 1YRLA 1UDBA 3PFFA 1QYXA 4QECA 1JKFA 1QXSA 4XB1A 4MINA 4GI2A 3ONEA 4BNFA 2X9GA 4CLXA 5CDYA 1GR0A 2BD0A 4KMSA 4BVAA 3LU1A 4DPKA 4CPDA 5I7FA 2WYWA 4Y8VA 3KEQA 4ZICA 4RVGA 5F1OA 2YYYA 1Y8RA 5IDQA 3ENNA 1N2SA 2EJWA 4KUHA 4PIVA 4CQMA 3NT2A 2IYPA 4M87A 4Z9XA 2D3TA 5CG2A 5GZ1A 2PY6A 1DJNA 5DP1A 3RUCA 2W90A 3JYOA 5TLSA 5C7IO 5JBIA 5JS6A 2X58A 5JXWA 3HFSA 2F1KA 3AY7A 4J1NA 4TSKA 2Q2QA 2VYND 3NDIA 3ZWPA 1TB4A 3QY9A 4H16A 4CM8B 3AFMA 4YJHA 3E6AA 2JAHA 2Y1FA 5DZSA 2DUWA 4B7CA 4CM9D 3DZBA 2EKPA 1ZFNA 2WE8A 4PFJA 4CMIA 5GZ3A 4L76A 3CXRA 3UN1A 3A1NA 5G0WA 3RUEA 1NQ5A 1EVZA 3MEQA 1ISMA 1I2BA 1PQWA 3RFVA 2X5OA 1FMCA 1KETA 5T6BA 1ENZA 5AOVA 1ENPA 3ZU2A 3IL2A 4R1TA 4O6VA 4A10A 1PGJA 2VZ9A 5DNAA 3G3EA 4RPKA 2QW8A 3QLJA 5DN9A 1E3JA 1VI2A 1XA0A 1WVGA 3I4FA 4JBIA 4UEKA 2OGUA 4KZPA 4CR8A 1GCOA 2G17A 3T7EA 4Y98A 1LDBA 4ZD6A 3GH3A 1VKOA 4AICA 3WQQA 1EVYA 1NAIA 2VOJA 2P2SA 1DC3A 2E37A 3U9LA 1LDEA 1HYEA 4YJDA 2WE7A 4CLDA 3ZWCA 3PHGA 5JPIA 4BNLA 4L74A 2OMEA 4XR4A 3A28A 3FNEA 2BF7A 1DAOA 3H4VA 5TT0A 3ST7A 4BMVA 3ORFA 4DLBA 5KJCA 4TRJA 4E5KA 2BELA 2UYYA 3DBHA 3DZKA 4TWRA 3VVCA 3CZRA 1ADCA 4JJIA 2ZYDA 3Q1LA 1N8KA 1F0YA 1B8UA 4JIGA 1AN9A 1ZJZA 3WJ7A 2QYSA 1X7HA 4J9UE 4RPHA 4WLUA 4NFYA 3PYMA 4PLWA 1FDVA 1ZK2A 4E2XA 4GH5A 3ZWXA 2NU9A 1GUYA 1QMGA 4IDCA 3DAPA 3RROA 3H5AA 2HQ1A 2NV6A 2DFVA 1T2CA 2FPGA 2Z5LA 1ISFA 1YJ8A 2P5YA 4XDZA 1QORA 1X0VA 2D5AA 3PWZA 1SCUA 3RQSA 3F9IA 4FGWA 4TRMA 3M2PA 4IZIA 1I01A 3HE3A 3OBBA 4BV8A 1NTOA 1PJQA 3C7DB 5IXYA 4XRGA 2O4CA 1OC2A 1NPDA 3CE6A 4DPMA 1MGOA 4AL4A 3E5MA 3SC4A 2J3JA 3E9QA 4N7RA 3KO8A 3FBGA 3MTJA 5BNFA 2IYOA 2R2GA 2UV8A 1U4SA 3TOZA 2WWRA 3DONA 2HK7A 1IPEA 3B70A 3PVZA 4RVFA 4ZQBA 4OQYA 2I99A 1T4BA 3VPSA 2J3HA 2ZJ0A 2JHGA 1E5LA 5T8KA 3TN7A 4YT5A 3UKOA 4ZJUA 1O5IA 1LDYA 1V3VA 3LLVA 2YHUA 3RBXA 3JYNA 1LRLA 2GLXA 4CM3A 2P9EA 3GAFA 4KWIA 4O59O 2ZTVA 1PU2A 2WM3A 4WLEA 1V9LA 3ANNA 3UFXA 2WSBA 3ZNNA 3QIVA 3JYLA 3RC2A 1WWKA 2QIOA 1I5RA 4QO7A 1DIHA 2BLLA 1O9BA 4IUYA 2OORA 1X0XA 4YQZA 4Y67A 1U8FO 2ZYAA 1MLDA 3DBLA 4BV9A 2CMDA 2RHRA 3IP3A 1JAYA 1YB1A 2OHXA 3JQ8A 3KUXA 3LC2O 4IDGA 2IE0A 3ZWBA 3DWFA 4EJMA 2FHSA 1TT5A 2YZ7A 4XYGA 1UP4A 2BI7A 4R68A 3NGLA 4LISA 3WIDA 2Y1EA 3FPLA 4GX2A 1RPNA 3HWRA 3WLEA 3AFNA 4PLHA 4CM1A 3DL2A 5B37A 3CINA 2HCTA 3JQFA 3GVIA 1EUDA 5COBA 3X2FA 4BNGA 5IAAA 1DHTA 4NFSA 1LBEA 3LF1A 3IKTA 1IULA 2A9FA 4DMLA 3EYWA 1M2WA 1FK8A 4OOFA 3V5NA 1PS9A 4NIMA 5KVQA 1EDZA 4RLSA 1ID1A 1L7EA 2GN6A 1K6JA 2DBRA 4G5HA 4IBOA 2NADA 1NQTA 2NTVA 3WGHA 2VUTA 1X7DA 3V2UA 4ROSA 5TC4A 4NK5A 4GWKA 1NAHA 1EFKA 1B3RA 4H15A 3KHUA 3WLFA 3RFXA 4UVDA 2FY8A 4TQGA 4UUMA 4Y6PA 4JCOA 4E0BA 4LCJA 3OJLA 4CUJA 2NQTA 3RUAA 5B4UA 1HEUA 5F1PA 1H9AA 2ZB3A 1ISIA 3OF2A 3HDJA 2HSDA 3QVXA 1Y9AA 1QR6A 5JMPA 1DRUA 4DC0A 1DFIA 4CMJA 1B26A 4J4TA 2GN8A 4CODB 2B4RO 4I5FA 3FCOA 4NQZA 4ZRMA 5T5QA 4MVJH 4BMNA 8LDHA 1J4AA 5EPOA 2UUPA 3OJFA 5HS6A 3S2EA 3N74A 3D3WA 1LRJA 2IZZA 5IG2A 2VYVD 1HE4A 3TZCA 5A03A 1KY4A 4MDHA 4XR9A 1EDOA 3EC7A 2A94A 3AY3A 3D4OA 4KTVE 4D41A 4WKGA 4XQGA 2W8ZA 2QRJA 1GPJA 5EMHA 1WZEA 1N1GA 5ES3A 1J5PA 4UUNA 3DMYA 1RM3A 1UR5A 3AY6A 3JQFC 2PV7A 2J5QA 5I7EA 3VH4A 4WUVA 2P9CA 3DDNA 5EQFA 2RHCA 1ENYA 2AQ8A 1ZBQA 1AUPA 3HQ4O 1ZSVA 3QWFA 2DU8A 4TVOA 3IP1A 4GMFA 4GX0A 5HTOA 1W4ZA 4OXKA 3ZHXA 4D0SA 3KBOA 1R4NB 4CLOA 2B69A 2RH4A 1W6UA 5B12A 1ISHA 1OFGA 2JAPA 4TKLA 1KY5A 3BZUA 4N18A 1XIVA 2RBEA 1KVUA 3OM9A 4LGVA 5I8WA 1FDTA 3PLNA 3UUWA 3TPCA 1EUZA 1P1RA 1GFSA 2QG4A 1YBVA 4Q3CA 2WJPA 2AQIA 1DBVO 2JKVA 2JJYA 4Y6RA 4FFNA 1NNUA 4A26A 5IN5A 1V3UA 4TKMA 3NDRA 4BO7A 2DTXA 1C0LA 3LSYA 3RUIA 2WMDA 4DWVA 3RFTA 1OOEA 4Q3NA 5DBGA 3FWNA 3SJUA 3VH3A 4BB5A 4ESOA 2P68A 1BVUA 4R4JA 1CDOA 1MV8A 3FN4A 4ZA2A 3ZV6A 2YHIA 3DMTC 4XIYA 2HMTA 4RV9A 4BKOA 3WDSA 3HDQA 4GWGA 4L4SA 1P1JA 3TFQA 2VHWA 1CRWG 1IB6A 1KOLA 3UCFA 3VZRA 3I4CA 2D1YA 4RORA 1HT0A 4AG3A 5CDGA 1WLYA 4IS3A 1IUKA 1DDOA 1A71A 4ND2A 5ILGA 1B15A 2FOIA 1E7RA 3HG7A 4XX0A 1QLHA 4MVJD 3I6QA 1MXFA 4YBZA 1B8PA 1JLLA 2X5JO 1ZZEA 3W1VA 2SCUA 1RM0A 1IYZA 1KC3A 3RIHA 4EBFA 3M1AA 3O03A 3QWHA 2O4UX 1AXGA 3AU8A 4M86A 4OJNA 3GDGA 4Q3AA 5F5NA 3TZQA 3W6UA 4CMEA 5L7TA 4U0JA 4YAKA 4O63O 1T1SA 2PTGA 1I3LA 1Q7GA 4DBVO 1ISJA 4ZQHA 4BO0A 2I6TA 3TJRA 4XYBA 4CMAA 3WNQA 3JQBA 1ZEJA 4RQUA 2EIHA 1BDBA 4DBZA 3WGYA 4FOOA 4MPDA 3GZNB 4UEJA 5HWSA 4I8XA 2P91A 1JKJA 3KV3O 3F47A 2VT3A 3ETEA 2W2KA 1V3TA 4M1QA 4II2A 1DLIA 2BGKA 1Q2XA 4J3FA 4JN6B 4WOJA 4HV4A 1T25A 2W2LD 3MWEB 5DT9A 4FN4A 2I3GA 2E48A 4E32A 1LRKA 1LDGA 4ZQGA 3RKRA 4XYLA 2ZKLA 4UVEA 3ZDFA 3GGOA 5C37A 5HM8A 2JD2A 3E03A 4D46A 3EZYA 4E12A 3E8XA 4N5LA 4WECA 4XJSA 1T24A 1T2DA 2TMGA 4U6SA 4B8ZA 3SLKA 4ND3A 2UUOA 4HFNA 3RUHA 1TEHA 4OSOA 4D3SA 3WR5A 2JCXA 5F5LA 2C7VA 2O50A 1ZVMA 5TJHA 2GO1A 1ZK0A 5JLAA 4PLPA 2C20A 1EE2A 2NWQA 1H9BA 2ZK7A 4JP2A 4NBWA 1O0SA 4PRKA 4EUEA 3PFWO 1EBUA 4WE3A 1W0CA 1PX0A 4FJ1A 4YXFA 4BNNA 4BNXA 1DLJA 3KYCB 3D4PA 1R0KA 4TRRA 3JQCA 3BTUA 1JVSA 3Q2KA 3LVFO 4HWKA 4P38A 1C3VA 1P1IA 1PTJA 5DP2A 4IQ0A 1UAGA 4JROA 5CP8A 2EW2A 3D7LA 4CMEC 2JFGA 2BKAA 1DRWA 3GR6A 2VHZA 5CPFA 4E6PA 3C24A 4XGNA 1R15A 2H9IA 4B3HA 4FR5A 1NPYA 2GZ2A 3NJ4A 4N5NA 4QFCA 4D79A 3DEYX 3I6IA 3JQBC 1NQAO 1PZHA 5KOIA 3RUFA 5KVSA 4FBGA 4FD3A 1D7OA 3MOGA 4BNZA 3RC7A 3B1JA 4ND5A 4RLHA 3FR7A 4LN1A 4DC1A 3V2HA 2Y99A 1A7AA 1DAPA 2ZQZA 4R5MA 3UOGA 5DOZA 1UP7A 2JCYA 3HJAA 4CLRA 5F3RA 5KWEA 6ADHA 2I66A 4YVFA 4S3MA 4YRBA 1OAAA 4MKRA 4WCFB 1EFLA 3IC5A 5L51A 3LYLA 1HYGA 5KKCA 4R1UA 1GD1O 5TX7A 5JC1A 2JCVA 3D64A 3V1UA 4CMKA 4F3YA 3PWSA 1HDZA 1MP0A 3C1TA 1HSZA 4J4BA 2XXBA 1ZK1A 4WLNA 2HJRA 4A5OA 9LDBA 3GGGA 4AJEA 2FPPA 3UGKA 5A9TA 4O0LA 1DHRA 3JQAA 3CSDA 2AQKA 3JQEA 3IKVA 3VVBA 3F4LA 2D8AA 4PG7A 4JGBA 4XD2A 1ZEMA 1X15A 3I9KA 3JQGA 4BGVA 2HAEA 3DZJA 4YCAA 5FFFA 4J1SA 1VLLA 1EMDA 2HKIA 1E6WA 3BHJA 3U4HA 1I10A 3GK3A 3JYPA 4P4LA 2NVUB 3GNQA 4YA6A 2PGJA 4J2HA 3K9QO 3I9MA 3F3SA 4JJGA 2I3AA 3BMQA 1YWGO 4UREA 4ALNA 1YGYA 4LMRA 4CUZA 1GPDG 4I9NA 2TMDA 4RVHA 3U09A 2B4QA 2RCYA 1K5HA 2HLPA 2DAPA 5JCJD 2D5CA 2ZCVA 3AUUA 1R16A 4FC6A 3GFGA 4ZVVA 1HTBA 1ZO8A 4YT2A 3ZV3A 3WFJA 4PG8A 4WEQA 3RD5A 3NKLA 2O3QA 1GL3A 4XGKA 1FXSA 3D5QA 3OECA 1DJQA 1K2WA 3MTGA 1LLCA 4P4NA 4BNYA 3CMCO 1EVIA 2FSSA 5I9MA 1U28A 5F1KA 1PJ3A 5L3ZA 3G49A 4PLGA 1MXHA 1XQ1A 1QG6A 5JO0A 3DFUA 3FTNA 4EJ0A 1K0UA 3ZWWA 3LZ6A 4AJOA 5G0UA 4NMHA 1WMBA 2D2IA 2Q1TA 3BMOB 3DQPA 3FWZA 3ZNQA 5IJZA 2UVDA 3LK7A 1B16A 4RPJA 4NH4A 3S8MA 1JA9A 1PQPA 2GZ1A 4FB5A 1ULSA 2VZ8A 2BFPA 1E0DA 3KVOA 1ZSYA 1UDCA 2GN9A 1MFZA 3H65A 4Z6KA 4X54A 4XWYA 4IJVA 3IJPA 2DQ4A 4J6FA 1E7YA 3DOCA 2W98A 2AG5A 2Z1MA 3H9GA 4IXTA 3WWZA 2C59A 3PDJA 5KKAA 3VPGA 3AM4A 4P4GA 5JYDA 1VSVA 4YJGB 3U4IA 1P1FA 2BHLA 1O94A 4CMGA 3OEYA 4PG6A 3LLSA 1Z6ZA 5CPBA 4GSLA 3ROQA 3ZN2A 3NUGA 3SC6A 1M66A 5LC1A 1LXCA 2POQX 2EF1A 4BO5A 4QT0A 1A72A 2O3UA 2EHDA 3PXXA 3GFBA 4BGUA 1UZLA 3GZ4A 4L4XA 1WP4A 1C0KA 2CF5A 4J7XA 3V2GA 3WGTA 4IQGA 1FJHA 1HE5A 3CZMA 3DAGA 1PIWA 1XWFA 3OSUA 1QP8A 2GRAA 4NBVA 4G65A 4DL9A 1ZNQO 4E5MA 1PJTA 1CEQA 5A05A 1DPGA 2BH9A 4P8RA 4PLVA 1NX6A 2BFAA 1YDEA 3RJ9A 4GPD1 1JAXA 2R00C 1NWCA 3HNPA 3M1LA 2NU7A 3W8EA 3B20A 5AXBA 2YFHA 3V8BA 2C2XA 3PPIA 1NBOA 4I5EA 5BNIA 4NJMA 4NU5A 1PR9A 2IXBA 2HMUA 4FFOA 4RF3A 3D3EA 1P33A 4HBGA 2FR1A 3GVPA 1HSOA 4OSPA 2FWMX 3ZV5A 2FPIA 4YJHB 4KTTE 1YQXA 1JDJA 4GAEA 1QV7A 2DTDA 5EESA 1B2LA 5KJ1A 1A4UA 3LT2A 5TSDA 5AXDA 5IFLA 3PJEA 3BMCA 1BRMA 1O8CA 2FMUA 2VNSA 3WTBA 3GF4A 2ZJ1A 4R16A 3K30A 4BGIA 3UHAA 3VZQA 1GEEA 2P9GA 3MJVA 1PZEA 3FD8A 3MJCA 5AQ1A 1MX3A 1XHLA 5JSFA 2EGGA 2Y93A 3NT5A 1XLTA 2CF6A 2HMVA 2NNLD 4E5PA 4XQEA 3BHMA 3P19A 5DBIA 3VH2A 1A7KA 5L45A 4GKBA 1U2GA 4HY3A 3GC6A 3EGOA 5L53A 1LJ8A 2AHRA 3K92A 1LSJA 4XGIA 1J49A 2NTJA 1DC4A 2G82A 3ZU5A 1ULUA 2VHYA 3UXYA 1KEWA 4ALKA 2D0IA 2EKLA 4MIOA 5I7SA 4TZKA 1U7TA 4YAJA 5IZCA 4J2OA 5KJFA 1UUFA 3PEFA 1PJCA 4ID9A 2GCGA 1UAYA 1T2EA 1EBFA 1JQBA 1R0SA 4IJUA 1H93A 5COQA 3L6OO 1M6HA 3RVDA 1BWSA 4J90A 5I8ZA 2OUIA 3C8MA 4YRDA 3DBHB 3BTSA 1YH3A 1P44A 4BNJA 3ANMA 4BO9A 5A3JA 1CWUA 4Q3DA 1K6XA 1BW9A 3O9ZA 3OFSA 1E6UA 3AW9A 5A4DA 4YAEA 4II3A 4RF2A 5KJ6A 3HN2A 3ZWYA 2O23A 4B4WA 3WYCA 1RYDA 4I9HA 4IDFA 4NBUA 4IIUA 4MIEA 1B14A 1U3UA 3PJGA 2WDZA 5U4QA 4IS2A 1HDOA 5IZ4A 4PVCA 2VYNA 4OH1A 3ZGYA 2X0NA 1A9YA 1JU9A 3GHHA 1NHGA 3KSZO 2D4AA 1SNYA 3QE3A 4UVGA 4CMHA 1MC4A 5TGDA 1GV0A 5AXCA 4AJPA 4PLZA 4CM9A 3DOJA 1WDLA 4WLVA 5U1PA 1FDWA 2BFMA 1S7CA 2VZ0A 4YJFA 3ROKA 4PLCA 1IZ9A 4NR0A 1PWXA 2H5LA 5JDIA 1Y81A 1F17A 4BIIA 5BQFA 3F6YA 3PI7A 4PVDA 3C1AA 5J23A 1OC4A 4ZHSA 1EZ4A 1NP3A 4YT8A 2VUUA 3NAQA 2GASA 5ILOA 1RYEA 1DC6A 3CPSA 4RPLA 3VH1A 4E2YA 2XXJA 1R0LA 3OP4A 1Z7BA 2CDBA 3R0IA 4NJOA 2CY0A 1GUZA 1M6WA 3O4RA 5IZCC 1P0FA 3TSCA 4A27A 3WX0A 3ZWAA 2CZCA 2X23A 1BHSA 1MG5A 4JJFA 4TZTA 1HDYA 1X14A 1UJMA 2G1UA 1JWAB 3TQHA 1GY8A 3ANLA 4XA8A 4B7UA 3LDHA 3PZBA 2GR9A 2NVWA 4FC7A 3L07A 2Y05A 4GL4A 2Q4BA 2JFFA 1NPTO 3DBLB 1LDMA 2E6UX 2DVMA 3AUTA 4YB8A 3JQ8B 3QRWA 4LSWA 5A5EA 2GZ3A 3L9XA 4Q3BA 1ZIDA 3A9WA 5EL0A 3U4DA 1NYTA 3UAGA 3I5MA 3UH1A 4B3JA 1HZZA 2Q99A 2X7HA 3EY4A 3GDFA 3RUDA 3WB9A 1HLDA 3ZHZA 1BXGA 3LQFA 2EEZA 2HO5A 3EW7A 3FSRA 4BQPA 5FWNA 3JTMA 3Q9NA 3U62A 2Y1GA 5G4LA 1GYQA 4MVJM 1ZW1A 4L0QA 2EJVA 4KOAA 4BKQA 1P3DA 1X1TA 5K0ZA 1N92A 4RCVA 5FI3A 4ITUA 4I5DA 1PS8A 2NQ8A 2VWHA 3L6EA 2JD0A 1KVQA 3JCZA 4NZ9A 5KIAA 2ZCUA 4FJ2A 2OP0A 5JDIC 4AFNA 3FR8A 4K6CA 4E33A 1LC3A 4XEHA 3HDHA 1SEVA 4UAGA 4S1VA 4M89A 4BO1A 3KSUA 4ALLA 3BA1A 5GZ6A 4DRYA 4QSMA 4MO2A 1TXGA 4B4OA 1YL7A 5BNTA 4UUPA 4W6ZA 3VPFA 2AE2A 5A9SA 2X9NA 4NDNE 4DLLA 4GLOA 3CIFA 4TVBA 5GY7A 4DXHA 4MP8A 1BG6A 4OO3A 3GG9A 2GSDA 4M55A 1LQTA 1C1XA 3K6JA 4OL9A 2YW9A 4D0RA 3O38A 2QRLA 3NTOA 1ZUD1 1PJ4A 4TMFA 4W4TA 1N7HA 4ZU3A 4CR6A 2HMSA 3ADOA 3L0DA 3DTTA 2YV1A 1FDSA 3D3WB 3OQ6A 2HUNA 4LW8A 4NBTA 1PGNA 4CM7A 2VHXA 2QHXA 3IIEA 1BXZA 4PZEA 1YS4A 4Q9NA 4G81A 3NTQA 1GZ4A 4ZGWA 4IGFA 2OP1A 3M2TA 2EWMA 3H5RA 3KXDA 4RJTA 3DMTA 4INAA 1QYDA 2O48X 5IXSA 3ICCA 1V6AA 3GEGA 5JW6A 3ENKA 1MA0A 1VJTA 4DQUA 4OM8A 4BO3A 2W4QA 2HRBA 2ZYGA 2BI8A 1F8GA 1N9GA 3Q11A 4J7CA 4GSKA 3STHA 1W8DA 3VHRA 4BNMA 4OMUA 5DF1A 3OIFA 3D0OA 3NRCA 3W4KA 2V7PA 2RAFA 2CVOA 4IMPA 4MIYA 1P1KA 3JQ9C 2EP5A 2PH3A 3KZVA 4CLOB 2J3IA 4FOSA 4WLFA 3H2SA 5THQA 1H0KA 3T4XA 3PIDA 3TNLA 3ZU3A 1D4FA 4EW6A 4IJKA 3UF0A 4WGGA 3RBZA 3INGA 2AXQA 5FI5A 4UVIA 2PD3A 4IIVA 1J0XO 1CIVA 1E3IA 3FNGA 1YB4A 3M6IA 3D5TA 3MOIA 4UEOA 1B7GO 1D8AA 1Q0QA 4CL3A 1EUCA 2IZ1A 1T2FA 4FW8A 4E2WA 1I2ZA 1DRVA 1JKIA 5L4LA 2EERA 3F1LA 1ZXBA 4BMSA 4GVLA 3PQFA 1WNTA 3CMMA 3DFZA 4DYVA 4EGFA 4J49A 1DIBA 1K6IA 4CUKA 4IDBA 2JL1A 3ONDA 3F5QA 2Q1WA 4RGBA 2AG8A 1LQUA 3MCVA 5AYVA 2QZ9A 4Z9YA 4OXYA 3WMWA 3BAZA 3P5SA 3PDUA 5CDUA 4YR9A 1ENOA 2EKQA 2NU8A 1IHYA 5G0TA 2YHIB 2ZATA 4E4YA 2OZPA 1AE1A 1CJCA 1QLJA 4J0EA 4ND1A 3GMSA 3SEFA 2VYVA 4Z0HO 1T2AA 1NFFA 1W73A 4YWJA 1Y1PA 2BGLA 4AJLA 5B1YA 4CM4A 1NFQA 4R1NA 2H1SA 3O8QA 4U8GA 4E13A 1Z73A 1J6UA 4B8WA 4EEZA 4R5HA 4ZQFA 4DTIA 4J1QA 5BSEA 3GGPA 4LRSB 1YQDA 2XAAA 1KVTA 4I9UA 1U8XX 5DCUA 2FN7A 4RPGA 4HFJA 4MP6A 4W7IA 4DVJA 5CAEA 4TRNA 1JTVA 5HA5A 4CQLB 3KTDA 4U6QA 5AVOA 5BR7A 2H6EA 3JD0A 2A35A 4Z3KA 1H6DA 2CDAA 5TS3A 3OIDA 1NVGA 4GKVA 4R9SA 1PJBA 1CF2O 4RQTA 3F5SA 3PIIA 1WZIA 2B5WA 3ZW8A 3LC7O 3QV1A 3GUYA 4HNHA 2AQHA 2I9PA 4DREA 2G76A 1C14A 3WBBA 3QVSA 4AJJA 2W2KB 2ZTUA 1SOVA 4IINA 1R66A 4J0FA 1UXKA 1VPDA 3VOSA 2DC1A
chains in the Genus database with same CATH superfamily
2OG2A 5FQNA 2CLMB 5CB4F 3A9TA 3E84A 3LWNA 1R8YA 3FAKA 3KE8A 1I5OA 1RJWA 1W0KD 3LX8A 1PN3A 3WYNA 4R71A 4C0JA 5KMGA 3IFSA 3CONA 1CHDA 1YBMA 3PGXA 1RTKA 3VC7A 1FJ2A 1E3DA 2HU2A 2YYZA 5SZHB 3RTAA 4D42A 1DJOA 2FOLA 1UC4B 2QA5A 2QG6A 4Q4AA 3WV5A 4B4DA 4YRMA 1VDMA 5KC9A 4AJHA 4IH1A 3ZE7A 4BLWA 2GESA 3I9FA 3I9OA 3C4QA 2VOEA 3FNHA 4KGVA 3VR6H 3K96A 5B7NA 4QUIA 3NP9A 1GCAA 3AUAA 4C03A 1DKLA 3CRW1 2R9VA 4HQRA 2DBYA 1HBJA 3PXUA 4ARAA 3NGXA 4M0MA 1D5WA 3N53A 3LQ4A 3SEQA 1MOSA 3CHYA 4ZVPA 4W8HA 1BMFD 4L73A 3SIRA 3UJNA 1Y5LA 3TZ6A 4ZT2A 1VSUA 1P2TA 3KQOA 4W1SA 2EZTA 1W36C 1XRPA 1Y1KE 1SIBE 2H16A 2QVBA 3O6VA 3PQ8A 2BTEA 3PS9A 2O8EB 3Q3CA 1RW4A 2K4MA 3LY5A 2JGAA 3EMKA 5EXXA 3NIFB 3TTYA 1CETA 2QAIA 1XXHB 3M1IA 2DFDA 2YC2C 1FFYA 3IAAA 4JBHA 3DYVA 2H2FA 4ER3A 2O8BB 3PUWA 4HO1X 2LV8A 4ABYA 5CDHA 1VRCA 3OZDA 1CJKC 1GGEA 3W1EA 4JX8A 2FWIA 4R2JA 3LT1A 4KBGA 5IXJA 3GLGB 1HUQA 3HBFA 2AF4C 3L4EA 4JUCA 4OU5A 2BY4A 2WICA 3X3HA 3IAHA 2Z4TA 2OCAA 2FKAA 4Q93A 3VR4H 4JBYA 5DLEA 2IYZA 3ASYA 2GDZA 5AOAA 4Q6BA 3HA7A 1BGVA 1YRYE 4DR2B 4UNIA 2GXQA 1ZQ9A 3A10A 4Q1CA 1P1HA 3CVUA 4Z4QA 2PXAA 3HEBA 4KSBA 1AS3A 1UH5A 1XJWA 4FS8A 4BKRA 5KKNB 1YR9A 2MDTA 4O4HF 4WNCA 1I33A 1VYHA 3HXQA 4IG9A 4KR2A 2BKLA 1RHRA 3T4EA 2A8YA 5J4YA 1T0HB 5LA6A 1GZ7A 3PUXA 5AHXA 4P33A 2JIDA 3FFBA 1C0PA 3SVZA 2ZWMA 3UB3A 4BKPA 1Q11A 4YIHA 2EYUA 1QGUA 2GD0A 2ZTMA 3MJHA 3M5WA 4JXKA 4MV3A 3OH8A 3AMVA 3UA3A 4IIFA 4UOQA 1ARZA 5G1OA 4G63A 5A6SB 3FZGA 3EDMA 3JQAB 4INPA 3IQIX 1SOWA 3BEDA 1A8UA 3G2OA 3GRKA 3V1YA 2GFHA 3FPBA 3LC1O 1L1RA 4I66A 2WJGA 4PZ9A 2KB0A 3H84A 4Q47A 1YOVA 3D6MA 3C98A 3FGPA 4B35A 1Q1NA 2A1UA 3ID6C 4G4JA 4MLCA 4X45A 4BS9A 1RYBA 2YWEA 3LP8A 1A9XA 3ZYCA 1NONA 1WUHS 5CEFA 1G41A 4WPGA 4F9EA 1R74A 1TL7C 5DCLA 4K9QA 3IQDB 2HO4A 4BO4A 5KYUB 4F56A 2XB4A 2R60A 4XYMA 3PDIB 3LIPA 4FJ0A 4MUBA 1NL3A 5CVEA 4A0SA 3OPVA 2EP7A 4R69A 3DMFA 4P7GA 4CE6A 3J81A 3O3OB 4X20A 4DSAA 4L15A 1L1EA 4HMQA 2A5JA 3CJQA 1BCSA 3GPLA 3U60B 4ZO8A 1NM5A 3NRJA 1ZCJA 4KQMA 1VGRA 1ZXLA 2W00A 4JLPA 4C4XA 1WNFA 1XWWA 1IHPA 2IXTA 1I3CA 3ETHA 4OXIA 3RVLA 4BRZA 4D1YA 4XWKA 1DSSG 4F4FA 2Q46A 1N2CB 1A8IA 3FTDA 3URKA 3BDIA 1OMOA 5B3AA 3PHCA 4U7PB 1SC1A 3D8NA 5AKGA 3IQZA 4KRGA 2VYFA 1KZ6A 3A6LA 1E18A 1UXIA 2XH8A 1SU6A 5SZJA 1I30A 4DA6A 5IANA 1O08A 1XMJA 3F6SA 2V65A 3GARA 1G0OA 2VRCA 3H5OA 4QGGA 2HBZA 4ENRA 2XQKA 3PCTA 3FPEA 4K28A 2ZLBA 2W4MA 4FFMA 2H2GA 5JFTA 3TQQA 1Y48E 2ZRBA 1XBTA 3OT1A 3OQ1A 4BO8A 4M6WB 5DN6D 3O4VA 3VR4D 5CH8A 1YS2X 1NX9A 4FTWA 3C6KA 1LPOA 3JAKB 5HFNA 4BAUA 2XKJE 1GEGA 4GOJA 1TJ3A 2XGGA 1L4UA 4NAUA 2HLDD 2ZJ5A 5TEWA 4ARIA 4CFYA 5BN4A 1HFJA 2XQJA 1NI4A 2WSIA 3HDTA 5F3DA 1HA3A 1JDTA 1VE3A 3GMTA 2W2VA 3DVQX 2PK3A 3EFHA 3JR7A 3UUEA 3TOXA 1JLKA 3DAFA 3GPDG 1RQRA 1Z0FA 2C98A 1NQWA 4IG4A 5AI4A 7YASA 2Q5IA 2EKDA 3DWIA 4N8EA 2WIBA 2FDRA 3BN3A 4XSVA 3UXMA 5EJ6A 5L3QB 4PGHA 1ZK3A 3ZWQA 2DPHA 1SZPA 3AXTA 1ZD3A 2MOKA 2VNIA 5C1PA 5I9NA 3CLVA 2LE0A 2H1WA 4WCFC 3RSZA 2YV5A 5FEUA 1VE6A 3PG5A 2VLBA 4Y1EA 3ZDRA 4DV1B 4UXJA 3IV9A 3QXJA 3VTKA 1E7MA 2PSHA 3EAGA 2WUDA 4EI7A 4HQFA 1URPA 1XP5A 2HSWA 1IZYA 1PGOA 1BE0A 3PC2A 4RIFA 1IXYA 1VYVA 3ELDA 2X22A 4GLLA 1P77A 4R1MA 1NHWA 3E58A 3WLHA 5ICEA 3FOZA 2VDQB 3D43A 3EAQA 3ZE0B 4ITVA 3OWHA 3TZHA 1XK6A 4FFSA 4RPIA 3OA0A 1YO6A 2M6LA 2P4QA 4WN3A 4YGXB 3NT4A 2I6SA 3MBIA 2VJDA 3A4NA 1QK5A 2PWZA 1FLDA 5D01A 3SZRA 2OBNA 2YFQA 4LV8B 4G5SA 1ZGZA 2QMQA 2YHAA 1YU6A 1GZVA 3VO8A 3M8KA 4IDEA 2W2MA 2XITA 1SOMA 2Q28A 3AJRA 4G86A 5J58A 3RK4A 1DCMA 4L8VA 5FOUA 3TLMA 1K4MA 2VP3A 4ZIRA 1KWKA 2I54A 4EZBA 4NZMA 4NOKA 1X7WB 8GPBA 4QDOA 4LDJA 1ZQ1A 2L69A 4QYXA 5AKLA 3IB3A 3ZWMA 2C7OA 4K6OA 1WABA 4P54A 1QWSA 1REQA 1VDZA 1PQUA 1WUJS 3RI3A 4B34A 1UWKA 2UVPA 1OH6A 4PY2A 1MUUA 4HXEB 5I8PA 2BGIA 3VR0A 4RJ2A 4AJIA 1TO1E 2ISCA 1DUVG 4DCUA 2YV3A 3AV0B 3HC7A 3EDRA 1RE1A 5ADVA 1MU0A 5AW5A 1T8WA 1LA2A 5LQRA 1YFZA 4ZAZA 3BMCB 4E7PA 4MAMA 5K0BA 3VC1A 1WV1A 2L2QA 2RBKA 3CW9A 3WL3A 4DMKA 4EJSC 3IMCA 5LUBA 2B36A 3L0ZA 1J2EA 1KEKA 1II8B 3FNQA 4CMIB 3IE1A 5FWYB 1JQ5A 2ETVA 2HQSA 2IHYA 2NU6A 3KUKA 4FDAA 1NW4A 4MA0A 1BU8A 5LQUA 3E3MA 3U40A 1H6AA 3NHJA 1TZJA 1YB2A 1ICIA 1ZJYA 1CD5A 2DM6A 1WZCA 3BOSA 1HDGO 1E2GA 3RU2A 3ADCA 3NMUF 3HUEA 2CLFB 5IBRA 2BWJA 1KJYA 1E6MA 3NTLA 4C4RA 4DJ5X 1KDOA 2G1JA 1XNRB 1G2IA 1HF3A 1XKQA 2H29A 3L8EA 4EGAA 3Q3IA 4X5OA 4P36A 1R6TA 4TKUA 1ZAYA 1GHTA 5LLSA 4NE9A 5IJWA 1KIAA 2NYAA 2VR1A 1L7BA 4ETMA 5CEEA 4Z4IA 4J29A 4WZBE 4GWLA 1CRZA 5CTJA 4TS9A 3H7IA 4LI3X 4MARA 5DISB 1P1CA 5AVVA 3WSWA 3E9YA 2W6ZA 1WXWA 2WK1A 5C3MA 3N3AC 1VG8A 4TWAA 5IH7A 4RFVA 1Z36A 2GHRA 5CA1A 3SZGA 3NASA 5B4VA 1LPAB 2GTHA 2QSZA 4XCVA 5AKJA 5KTRA 3N70A 4O02B 1UMBB 2R8ZA 4ECAA 2V9CA 5HE9A 1FFXA 1J7JA 9ABPA 1B41A 4OBBA 1E9DA 1A5ZA 1KFBB 1DOZA 4WJZA 3WLLA 4RDXA 7AT1A 4YJ2A 4GYKA 3OQBA 3T95A 1OFTA 3FB1A 4LI0A 2VPYA 1TD9A 4CT0A 4F85A 1G8KA 3OZBA 1U0TA 3FLMA 3ZDQA 4DNOA 4JENA 1LQ2A 1VJCA 4ARZA 1MMFB 4IMRA 4BO2A 3LLUA 4ZI7B 2NVBA 3WGQA 5KX5F 4E30A 3L18A 3WXBA 2IYXA 4EX6A 3CCBA 1GYPA 1KZ9A 4EG0A 2Z2KA 3NPAA 4ZI3A 1PJ8A 4LDZA 2Y1CA 1VP3A 4XOIA 4XWOA 3NEPX 3JD2A 4TTPA 4XM1A 3NHAA 2X2OA 1WCWA 3LTEA 1N2IA 4PCUA 2VJQA 5EN4A 4ZDWA 4RZUA 4AKTA 4DLPA 1BMQA 1NIPA 2QN7A 4G67A 2WF8A 4GC9A 4CKWA 1OXBB 4YJFB 4BLOA 4KW7A 4YR7A 2RGRA 1Z4MA 2ENUA 4J6EA 3G1WA 1VPVA 4KUGA 1GAEO 2FETA 3F4KA 4Y30A 4L72A 4BECA 3FTPA 4HFMA 4U2KA 3F3KA 2CLEB 1SIUA 3RG8A 4J0DA 1Y7LA 1QH9A 1ZISA 2OGWA 2J67A 2WINI 4FI3F 2ZRDA 4B73A 4D0LB 2XXAB 1IOWA 3KT8A 4UD2A 5HZGA 1X1BA 1MA3A 1XD2A 4GBGA 4NK4A 2JGEA 1T5SA 4UC0A 1ZJ4A 4CKXA 2CT8A 4AF7A 1Z8NA 3E5NA 3EVEA 5JAQA 3DHYA 1HGXA 3R41A 1H2HA 4KACA 4NNPA 4I1YA 4C7KA 2ZWAA 5MDHA 4UXIA 1PL8A 4AAYA 2ECPA 4PF1A 3ASUA 5LJLA 4UU8A 1TLFA 2V5AA 2VKTA 4IX9A 1Y5MA 3PLRA 5IH3A 4AS1A 2XHEA 3I9V6 3ZHCA 1NJSA 4R54A 5C0OE 3UY4A 4J0CA 1LLDA 2QEQA 2P1DA 3OPMA 3MAGA 3I01M 1NUAA 3EK2A 1FUKA 4J0KA 4JJ4A 4PYNA 2HDHA 5IWCA 3E22A 4R1QA 4L4UA 1D2AA 5H1YA 3KXLA 2J0SA 4J91A 1ZM9A 4NOMA 3BL8A 3N8GA 3V33A 2IW1A 5DTQA 3Q7PA 5H3HA 2A14A 3JVVA 1RWKA 2I1LA 1QRTA 1VKNA 1E2UA 1L5FA 4JBNA 4CNBA 4Y3UA 4DGQA 1WPQA 3FHLA 4MYTA 2QX4A 1FUIA 1L8QA 2D5BA 4OH7A 5C81A 3OQNA 1ZD8A 4P0PB 1C4OA 3CH6A 4WFJA 3H0CA 4PX3A 3OOSA 4PCAA 5TPZD 2FLVA 3DL0A 3AEZA 3PFCA 1NTRA 5T41A 1SBYA 1WXQA 4LBVA 4XYEA 1BEZA 3U6KA 4X90A 4E5NA 4RV5A 2P7HA 3S8YA 1VM6A 1OXXK 2ZYTX 3KLPX 4JDPA 3GEMA 1DB3A 4PLYA 4URWR 4DQKA 3ERCA 2M2IA 4IF4A 3EXEB 4Z1MA 3GLHA 2QLFA 4WFQA 3IQEA 3KDSE 1I6WA 2CNWA 1XPUA 3AEUB 5CXQA 1OTHA 2GZMA 1EK1A 2GLTA 4IUBS 4W9NC 5HQ3A 2JANA 2QM0A 3JVEA 1TEZA 1XN4A 1IE3A 1UMKA 1E6LA 1O2DA 3DMGA 1PEYA 1VB3A 4OFXA 4YAIA 3RYHB 5BOSA 3CUVA 1XPJA 2WVHA 3EOAI 3H97A 4IRXA 2ZUUA 1PZFA 3BQNB 2IXDA 3E9NA 2CLCX 3JQ9A 1N33B 2WBLC 1M8KA 4ZAFA 3RVOA 3K9BA 4DCJA 1QYIA 1XCLA 3NOOA 2H00A 3U3XA 1LEHA 1F2TA 1BO6A 4IOJA 3DOOA 3KSMA 4QBHA 2ID4A 4BQIA 2P2ZA 3W2IA 1IM5A 3ZCQA 1OJLA 3QHPA 5E0OA 2JIRA 5LLTA 3LD9A 3GDHA 5EINA 1XQ9A 4QBIA 5AI5A 5ARBA 1H8EA 1NUQA 2FEWB 3A1WA 3COWA 1X7ZB 2MJLA 1SUIA 2OFPA 1Z62A 3NAMA 2PRZA 5EFOA 3VR3D 5HHTA 4ZAGA 1JIJA 2BZGA 4HWOA 1ORWA 3IAXA 3TE6A 5C4MA 1HNZB 2QTNA 4A8PA 2H3EA 4ZQCB 1MT0A 3ELWA 1ZUWA 1JL3A 2DP4E 2BE7A 2CB0A 2HA2A 4W8OA 1ZCFA 5CLIA 4YROA 3UWOA 4XKJA 5C8YB 3L5OA 1QQ6A 4LZPA 2IODA 1ZH2A 1GA6A 3D1LA 4M1TA 2FCAA 4R3NA 5DM1A 3HSKA 2BRUA 2N75A 1WCXA 3HXLA 1RPAA 3ITEA 3GLHE 4A7PA 4DOMA 5G53C 1JPJA 3ZH9B 1TFUA 2Y0CA 2HHJA 4C4PA 4GHWA 4H2DA 1QSGA 4MS3A 4QICA 4PLFA 2OGZA 2ZVQX 1GG5A 2XDWA 3I42A 1RJ9B 3MW8A 4B4VA 5AW1A 4DJFC 4UTRA 4KEAA 2CZQA 3I92A 2DKOA 3FRHA 4BLPA 1DIGA 1N9GB 1R0CA 3WK5A 5KWJA 4KDFA 4FGLA 4FSHA 3M4XA 4GOMD 4YGYA 2ZM5A 2WSYB 2PQMA 3M6AA 3EXG2 3PCXA 1Y6JA 5IKMA 3ASVA 1ZUNA 2HI0A 2Z3ZA 4HADA 4TM8A 2C8KA 1SN7A 4ZQEA 1YRAA 4DCPA 5JSZA 4DY6A 2VHEA 4RY9A 4O1MA 1GRCA 1WXIA 5BSGA 5K8LA 1E63A 1EI9A 3B1FA 5C8YF 4RTPA 4RESA 3ZZUA 2WLSA 1XLWA 1TQDA 2JGMA 3NZEA 4G1CA 1QB8A 3NBFA 1VL6A 5E6RB 2ZIZA 1OTYA 3OCWA 3TEJA 4BB0A 5CXSA 1JEYA 2BGJA 4NS4A 3ZHQA 1GCUA 1WAMA 2ROQA 1AK9A 2BUAA 1PTKA 4TT3D 3OHMA 4A91A 2FE4A 3K09C 2VQ3A 3P2KA 2QUBA 1BGWA 2Q9AA 2PWAA 2DY1A 1DBPA 1LI4A 5F76A 1U9IC 4ERXA 5F2EA 1J00A 4EK9A 1I0ZA 4HQ6A 1I4WA 5DBHX 3W5AA 4AZ0B 1JQAA 5HQJA 2CEAA 3SLGA 3CU5A 6PFKA 5LZ9A 2ZT5A 3HLYA 4HQLA 1W30A 4F1KA 5C8ZA 1QP7A 4OJKA 4Q9AA 4FDTA 3RU7A 3FNFA 1DTWA 2HEGA 2RGWA 4HB4A 1UKZA 2QRGA 3A6JA 3MIZA 4I36A 2XWJI 4G0PA 4MQEA 5AI8A 4F3TA 3MCAA 4EFDA 1RFLA 5AKHA 3SICE 2JGRA 3PI6A 1DAHA 3SF8A 4P86A 1JQ3A 2GB4A 3EFOA 5CB0A 3B1WA 1SZJG 3C0KA 3KIPA 4C43A 1YONA 1WCYA 2QRKA 3TG2A 1HRKA 5TS2A 3OJOA 1T3GA 1PL7A 1H3NA 5IJ0A 2LXNA 2VSYA 1K4YA 1ZWLA 4A6DA 4ALMA 4F4IA 3T1NA 2HJVA 3I9NA 3QVKA 1ZZGA 3STWA 5H4GA 4QOEA 4CIYA 1UK7A 1KYTA 2PCLA 2XA1A 3E3LA 4MQ5A 3WA6A 5F33A 4AK9A 1H2BA 1KO1A 1FMJA 2CXTA 2Q1UA 3HRKA 1SVUA 4QRIA 2EDAA 2PLAA 3PSAA 3HUDA 4S2EA 4B7XA 4IQ4A 2M98A 4MKIA 4YPVA 4RV4A 2CYBA 5HSGA 5DCYA 4C07A 1KS2A 2XZPA 1N8SA 3TGPA 3A1UA 4DCOA 2Z8XA 2KE5A 3HCRA 4NG5A 3C3XA 1QLWA 3GLVA 2Y2VA 3KQKA 2X6RA 3O8QB 3BK7A 5JI2E 1EUYA 3K5IA 3D31A 1T36B 2L19A 4HMOA 1Z5UA 2C7RA 4NBSA 2CC2A 5DYIA 4DIDA 3KELA 1OXUA 5PGMA 3WWPA 5B36A 4DR3B 1T8YA 4XFDA 3H1BA 1NVDA 1YDFA 3CKYA 4R6WA 3MJSA 3ZIAA 2H63A 1OGIA 3C3YA 4LRXA 4M9RA 4AG5A 3ZJTA 3RTGA 1VGQA 1LD3A 3IEIA 1YJXA 2WP8J 3PD0A 2HGSA 1SQ0A 5IJ9A 4OKIA 4D44A 4RHXA 1CVRA 1U1IA 3FRJA 1FYFA 1Z2CA 4BCDA 2PN1A 5L95A 1R64A 3LHKA 2ECQA 3NM4A 3UMGA 2CB9A 5LWHA 1GG9A 2BC9A 2PA3A 4LQDA 4N6OA 1B93A 4NH0A 4QQNA 5LB4A 1E1DA 1LLQA 2FR0A 1NU6A 2YMPA 3KKOA 4LV5B 3MN1A 2IV7A 3V7UA 1BEEA 2B7CA 1EZZA 5G41A 3RUPA 3TM5A 4BN5A 3WQBA 5HR5A 4AJ1A 4BWGA 2QTMA 3I62A 2ODAA 4CTNA 3DO6A 4ARBA 1ADFA 3QVGB 4PONA 1KZ1A 1ZH8A 3SR0A 5ALHA 1FF9A 1GTJ1 1KSHA 5JRZA 3AF5A 1GU7A 1XTVA 3L7CA 1V5WA 4M1KA 4BTEA 4PYIA 5MF6A 4U2GA 3ZE2B 4ZRDA 4B44A 2VPTA 3LL4A 4GEGA 3QLVC 1FDUA 2TMKA 2J48A 1CNEA 1SQSA 2GXUA 3ICWA 4G3XA 1SD2A 1OPRA 3I34X 3ZTYA 1SKBA 1Z4QA 1VBNA 2ANCA 4JEHA 1UBMS 4QZVA 2ZJ7A 2ZBEA 2OAEA 2WWWA 4M0CA 1XNQB 3T7RA 4WD3A 1DBQA 2QP3A 1AC5A 3H2YA 1Z38A 4G6ZA 4ZO9A 2HEIA 4LOLA 2MCFA 3GOQA 3INRA 3VTZA 2OSVA 1T9AA 3QWBA 1AKYA 2FW8A 2J3KA 2IZOA 2Z2JA 2IZ7A 3PWTA 3MWJA 1ZA2A 1Q20A 5AVKA 1P6XA 5ERXA 1XEFA 3H1GA 4DLUA 1VXOA 4MWSA 4CRWB 3PDCA 1EWRA 4EI2A 1D2NA 3MMPA 1ACLA 1IZ0A 1DS6A 7GPBA 2A0KA 2I76A 2YV2A 1SR8A 4RIEA 2DFLA 4MPPA 3AHEA 4Z3DA 5K0LA 1O96A 3BE4A 4JP5A 1BTOA 1Q84A 2CUKA 5LJIA 1F8UA 4XUDA 2QY6A 2XCRB 5D6OA 4MVJA 3DO5A 2NV2B 2A1TR 3IMEA 3JVDA 2NZJA 3K8QA 3QLUC 4G0MA 3ROTA 5BV0A 1FFBA 2ZXEA 3Q10A 1CF4A 3IBYA 2VWPA 2F55A 3KSDO 5HS4A 2DRIA 3N2KA 3NETA 2RI0A 2YUTA 4GI5A 2I1VB 4QU5A 4MLPA 4A8TA 1EH5A 3NDJA 1P29A 4GLBA 2C9ZA 4DSTA 1OLSA 4I08A 1IBCA 4K1LA 5TMBA 1T5LA 2FW7A 3WLMA 1OU0A 2FRDA 2JBAB 3LZDA 1Z13A 4LYDA 3HVUA 1PZMA 3ADPA 3B2EA 3I23A 1MB4A 5TF4A 3VKVA 4WOBA 3X1JA 1O8BA 4DA9A 1RI2A 4GUDA 5H82A 1SHJA 5JEDA 3Q8MA 4KXFB 2PMBA 5JQGF 4OU4A 3GN2A 1TZBA 3PNKA 4JDUA 4QELA 2GN4A 4CMCA 1LPNA 4DDKA 2CV1A 4FSXA 1BSVA 4UJ3A 2BHRA 2GCOA 3RKUA 1YR2A 4R8SA 2HRRA 1L4LA 3E9MA 4RF5A 4NV0A 2AOUA 4QXRA 3CF0A 4HBZA 3O0TA 4RYLA 5DK4A 1DOHA 3GNTA 3ROMA 3GQBA 1YIAA 3U26A 4F3CA 2OXFA 4UUOA 1KEVA 4ZN6A 1W0KA 3T7SA 2WEKA 4MRAA 3SBXA 4DE5A 5BUSA 5K8TA 3JQ7B 4OQMA 1U90A 3A14A 3LMKA 4I1SA 1MAWA 4WUTA 3B60A 1GNVA 1JSRA 5GJWC 3G88A 4N3CA 2WT4A 1D0SA 3U0BA 5DULA 1BD4A 4H7JA 2JLAA 4BMPB 1D8TA 4MVJE 4RVNA 4XQ9A 3V4LA 3CH5A 1UFKA 4WXMA 2HHLA 2NACA 3S55A 3S68A 3HR8A 2VUSA 1E2QA 5BT9A 2IEDA 2P30A 3HPQA 4F11A 4ZALA 4IP0A 3EVDA 3ZWVA 2PX6A 3VTFA 4C14A 2RFLA 5BORA 4DA4A 1NRWA 4PGGA 3GD7A 2HTEA 3MD0A 5EJEA 2FG5A 1BMFA 1SWVA 3AZPA 1RM4A 2FFQA 3QJ5A 1KDPA 4LXIA 1KOGA 1BMDA 1M75A 1MCZA 4PHFA 3QHAA 1E3WB 2OXEA 3P0EA 4DQ0A 1J8FA 4EOGA 4EDFA 1U1FA 4XRRA 1XPOA 1SBNE 1HDRA 2RBGA 4MK4A 1F8YA 2WJIA 3P97A 5JG7A 1QHNA 1XQ6A 2Q6OA 3DM5A 3N2YA 1NNSA 1SKAA 2CV2A 1J8DA 2JAWA 3ZNPA 4NC9A 2C94A 1J07A 2ADOA 2VTDA 3RWBA 3TRIA 2WWIA 2H0AA 2BCGY 4PSAA 4RM3A 1PVOA 2GZRA 3TFOA 2AMFA 3BTVA 3AI3A 1YK1A 4QRDA 2WABA 1G8SA 3ZWDA 1T5TA 1NVWQ 4Q1BA 4R7ZA 4RUKA 3IAEA 3ZCXA 1CRQA 3F4BA 4DIOA 3KEGA 1E99A 1I6LA 3PR3A 5IBPA 1RAAA 3V9PA 3ZLBA 4IDHA 3GCXA 3KPJA 4DV3B 4JCCA 3OZGA 5HJEA 2GF2A 3J7TA 4WFKA 3Q7IA 3RS8A 1GTSA 5HILA 2Z6QA 2J4CA 3UJ8A 2AXNA 3IBFA 3PEVA 4D45A 3ZY6A 1O1YA 2P75A 2PJZA 3NJ8A 4PO8A 2C54A 5IHPA 3QNMA 1DCTA 2H4WA 4CL3A 4BDSA 2XWPA 3HR4A 3MUEA 3A32A 1NUPA 1Z39A 3JATA 1Z2EA 3QH4A 1DKNA 1P0PA 1GM5A 3R9KA 3HKBB 2CSXA 3V9AA 4HAWA 2FZGA 1ORDA 3G2KA 3PHBE 4DNQA 4KGXA 1CDZA 3WDMA 2ZXUA 4J0JA 1GTL1 4U9IS 3UTDA 1K75A 3WDLA 4XJVA 3HGQA 1NMQA 4DEXA 5DBFA 3JAWB 1C4WA 1XU7A 1PG0A 5DW3A 1J21A 3MHPA 2UAGA 4QFBA 3ZLVA 3BE8A 3Q85A 4HUJA 4RGYA 4HG2A 2G1AA 4BLSA 1A76A 3TD2A 1J0EA 5BVHB 5HE8A 3TKYA 2XI4A 3U9SA 1VL8A 4MB0A 3PGJA 3BXEA 2HF9A 5SY4A 1P0CA 3EEIA 3NHRA 4ZO7A 1RRKA 4E1BA 2I34A 4C20A 4BNTA 4BHTA 3O3MB 1K8RA 5B3LA 1W75A 1GZ5A 4PZCA 2Q5HA 2Z95A 3VPDA 4U7JA 1T9GR 1XEWX 2P0EA 2G6BA 3P0IA 4OYRA 3WJAA 1ICEA 2XECA 2B8TA 2JH9A 4MVJG 4PE5B 3N07A 2FUG1 1LF0A 1KERA 3G8YA 3SS7X 1L5MA 4FEAA 2FUCA 3UAXA 3MGCA 4C4OA 1YZLA 2DCUA 1ZMBA 1XVAA 4MDEA 2CNDA 2WFLA 1G8MA 4L50A 3ZUPA 3RRFA 3I6MA 3MXTA 2BFFB 1E92A 1L9KA 3A27A 4FMDF 4IDAA 2QUAA 4R3WA 2IRWA 1JXOA 1M2OA 3H1PA 2PM8A 3IDQA 5KWSA 1NJ1A 3AJAA 4LHYA 1DP4A 4A4DA 1FVOA 2VF4X 1PP4A 4R01A 2VEOA 3WS7A 1TTTA 2REBA 4FS3A 1JILA 1UMDA 1U8ZA 2JLRA 1TM2A 4MQ4A 4OBXA 4QTTB 3ADBA 2FQWA 4KR0A 3ZGNA 1X1QA 5JC8A 5E7IA 3LPLA 2PZEA 4GLJA 2RE8A 3AZQA 4RCZA 3HK2A 2CFOA 4ZCQA 3CKLA 3S2SA 1MH1A 3FG9A 3LUKA 4FW9A 1HI9A 2RC5A 2H9AA 1QFJA 4MQ6A 1FNSA 1FP2A 2ZITA 5FNVA 3DLBA 3O26A 1M0WA 2Y8EA 3E2PA 5CGQB 1PNRA 3L93A 1UWCA 4TZ6A 2AEJA 4BNUA 1WDKA 5KNDH 2C77A 5BQOA 9MHTA 5DN6A 1YRLA 4LAFA 2HF8A 5BYKA 4XB1A 4XIIA 3VR4A 4KPEC 4LEIA 1AK1A 4BNFA 2FFBA 1I4LD 2PX3A 2X9GA 4MEBA 4O4LA 2BD0A 3K32A 4KMSA 1QFXA 5IMSA 3L8GA 2HLDA 1MVOA 1HOXA 1XB2A 4Y8VA 4ARCA 3KEQA 4GXNA 2W8BB 5CT4A 1M2GA 5GGYA 3MMSA 3NHWA 3ENNA 4AN0A 3SP1A 3PUHA 4B6RA 1WL8A 3AFGA 1OX5A 3I2GA 3NDBB 3QVUA 5DBOA 3QUTA 4IRUB 1YU9A 4OFZA 5FNZA 3PTAA 5DEOA 3NT2A 2QBYA 3R9XB 1GZUA 3A9SA 2QMEA 4Z9XA 1W48A 2ZRQA 5C2JB 1NLZA 1WEKA 3RREA 4KAJA 2JLBA 3KFXA 5AOCA 4DZZA 1MENA 4HT3B 5DM4A 3OURA 5DP1A 4ZCSA 5WRFA 5LD2C 2X7JA 2HWYA 1RQPA 3KB8A 1GPYA 2X58A 4WBNA 1Y80A 4OJQA 1ZC4A 1T15A 2B92A 4OREX 1A97A 3QF7A 4Y7CA 4TSKA 1NW6A 2Q2QA 1EXMA 3SXJA 5AHKA 3RVSA 3UQZA 3ZWPA 3SFTA 1QQTA 2WHPA 3CVJA 3QXHA 4E5DA 3KQSA 4CM8B 3EVAA 4LDRA 2HXYA 3E6AA 4Q05A 5A2GA 1O9HA 2DUWA 2DWOA 1FYVA 4R98A 1OY1A 3G5AA 4RKFA 1GKIA 2J33A 4BBPA 4F9FA 3C5CA 1X2EA 1M1NA 1ZMRA 3CNBA 2C83A 1NQ5A 3L7YA 4WESA 4GKAA 1I2BA 1TEXA 4O2AA 3TAHA 4B6FA 3SJZA 4ZGGA 5AVXA 1ENZA 2XMZA 1HG0A 3A6PC 1KDVA 3KHTA 5D5PA 3IL2A 1U3CA 1ZM3A 3FF1A 3OQIA 4WXEA 4DA8A 5AIBA 1PVVA 5DNAA 3OP1A 2WQ6A 1KMQA 2VNHA 4D2IA 3SU8A 4QAJA 1GPLA 1XZFA 3JW8A 3IXLA 1KHHA 2NZ2A 3UK1A 2OGUA 2P6NA 3D6NB 5I3ZA 5K2OA 1CDDA 3KT0A 1OGYA 1ES9A 5D5QA 3T7EA 4JB2A 4Q37A 4ZD6A 4BX3A 2AYYA 3EEBA 4L7VA 2N1MA 4AICA 5DHFA 4FGUA 1NAIA 1D4OA 1MC8A 4AUKA 4QL3A 5IU6A 2E37A 4KR9A 1LDEA 2CXRA 2DJIA 3ZWKA 4MW9A 3BE6A 1K86A 3M6MD 2XKAA 4EYGA 4DV6B 7REQB 1JR3D 4U3JA 3NORA 4CI9A 1FFCA 2ERCA 2CYAA 2CHUA 5JPIA 3BX1A 4L74A 1QRSA 2Z5GA 2V55B 3ZY5A 4JT2A 3VJLA 1BVYF 4ZCLA 1PT7A 1DAOA 3H4VA 5TT0A 5FPPA 4FYWA 5BR4A 3ORFA 1TZ2A 3DBHA 3DZKA 5KNDD 1WW2A 1RRGA 3BWEA 3Q1LA 4NZPA 1F0YA 2NIPA 3KQHA 3U1BA 1Y8AA 3TS1A 4RULA 3ZEIA 2G9UA 1Q57A 4IWXA 5JANA 4ZO6A 1ZD9A 5J59A 2RGXA 2M6KA 1JIQA 3SZ3A 4GMHA 2REQA 4GH5A 3DUWA 1QMGA 1XRRA 4QWWA 4ER0A 2FK7A 5JSQA 2HQ1A 1R4AA 3M6UA 1UWVA 2NV6A 3L0OA 4JR2A 2P4SA 4B7ZA 1TOAA 3AB3A 2H5EA 3RJMA 3W8NA 5K8VA 4XDZA 1QORA 2D5AA 4KE8A 4X1IB 1ZG3A 3LW7A 2N42A 4YPFA 1IY0A 4IZIA 2O2HA 3FFXA 3GLUA 4FD2A 2PMDA 4DIEA 5KOYA 1H85A 2O4CA 1CLUA 3CE6A 1UMCB 3L7LA 3OZFA 3KEFA 3QI2A 1ZNZA 2JK0A 3IXQA 5ICFA 3RVMA 2J3JA 1FS5A 3FCXA 1Q5PA 1ZC3A 3SC4A 1Y7PA 3ONWA 3FBGA 2AN9A 3R7WA 4EFKA 1U2GC 5BWCA 2WWRA 2X2FA 2W83A 5I01A 1BNCA 1IPEA 3B70A 3PVZA 3A31A 2K6GA 2I99A 1T4BA 4OQYA 3ZKWB 1DT3A 2BGUA 4CG3A 1O4VA 5CBKA 2ZUBA 2R85A 2ZJ0A 1KYWA 2VT7A 2JHGA 3FPFA 4MI1A 4E11A 3TN7A 4YT5A 4ZJUA 1YQUA 3S5JA 3KLOA 1THGA 4YJ3F 1L4GA 3DLCA 3FMIA 1LI7A 4PYRA 3NWJA 1V2HE 2WHRA 5BQPA 5HOQA 2O8FA 4KHZA 5E2IA 4H77A 3JWGA 3ZTWA 1IN8A 4UPDA 5CK4A 4M8KA 3W5SA 1V3VA 3LLVA 3UFBA 1L5OA 4UTXA 3ZCUA 3A4YA 1KFKB 3MUFA 4PICA 2C3UA 3GAFA 2C9MA 1XRMA 3LX4A 2XD9A 4RA9A 4TTSA 1FPMA 1NOKA 2WM3A 3ABZA 5CIYA 4OLHA 3ANNA 2NZYA 3DMNA 1NNEA 4FMPA 1ODFA 5IM5A 2WSBA 4D4HA 4PX2A 4LDQA 1ZICA 2GZAA 2VXCA 3RC2A 5HKKD 1UFOA 1BCRA 2PU7A 1T3ZA 2I6FA 3FROA 4QYWA 1GOTA 2P8JA 3BF7A 4G84A 2B1GA 4JUIA 2GM4A 1FQWA 1TCAA 2ZYAA 3VOTA 2CMDA 4BV9A 4E46A 3IP3A 1JAYA 3K0HA 3KUXA 4IDGA 5LYJB 4RMHA 4K6MA 1TGVA 3IB6A 4KK4A 4ADSG 4DV2B 1YK0A 2BYTA 1DCKA 2OCLA 4F6RA 1EFRD 4V1CA 5FO1A 2GVNA 4CIXA 4C5BA 1UP4A 1SUCA 2EATA 2QZ4A 2BI7A 1XJ0A 2DE0X 3MWYW 4R68A 4RFSB 4XCQA 3HKDA 4YECA 3WIDA 2Y1EA 3DAHA 2Z6VA 3TW8B 1NKVA 1KBQA 1A98A 2BM1A 4ENPA 1P7WA 4NCAA 2QD4A 3I37X 1INLA 3K0AB 3TTUA 5B37A 3KB1A 2GWRA 3BIJA 3KXPA 3JQFA 4HNAA 4OHPA 5EWJB 4TL8A 4DAOA 4YCLA 4BNGA 2I7XA 5IAAA 4S0ZA 1SG0A 3DYBA 4MMXB 2UXCB 2CXQA 4QUBA 1IULA 5E3JA 1A8HA 3C5VA 3BGVA 4IMIB 1G4HA 4NIMA 2ATCA 3D6HA 1EDZA 5LYJF 2W43A 4RLSA 5HJ5A 4C3ZA 1FFWA 3ESQA 3OF3A 3LC0A 4JA0A 5LIPA 1JSXA 2VDNB 4BMOB 3TH5A 2VNKA 2HX1A 5H68A 4PXSA 1Z07A 2NTVA 4HDAA 3QEOA 3OWXA 2VUTA 1XTJA 3VJKA 2IW3A 3ED5A 2PT5A 5TC4A 4GWKA 5F2OA 3SQNA 4O29A 3PQ5A 2HPAA 3V8NA 2A9QA 2UZ3A 2YWCA 4X6UA 16PKA 5FORA 1ZH6A 4IIEA 3COPA 1RBQA 4TLLB 5C18A 4KREA 4QLBA 1YZFA 3OJLA 4KLRA 1GG8A 5A4KA 1J09A 2XDQA 2NQTA 3BSFA 3MPOA 4BZQA 1YVRA 4TL9A 5ESXA 2H3HA 4B6GA 4HNRA 4Y2XA 1ND5A 2FG6C 2BBTA 3A2NA 3OF2A 1TYZA 2MHCA 1PUXA 3QOWA 2VDRB 2JFYA 4L2IA 3QVXA 4TKVA 4I14A 5JMPA 4BYGA 3EGXB 1FX0A 4CMJA 2PQ6A 1WPRA 1ONBA 4J4TA 4NZZA 1UIMA 3INYA 4PFQA 1JJIA 1BDJA 3FCOA 3KTFA 4TTQA 4A0GA 8LDHA 1BN7A 1CFZA 5HS6A 4F7WA 2Y3IA 3MMZA 4TV9B 3EQ7A 5DU2A 2IWHA 1TF5A 5AW9A 4DY4A 2VYVD 1H8HD 4GP9A 4XR9A 4ZXFA 2GFIA 1N2EA 1JAZA 2JGJA 2C31A 4KKXB 4RKRA 4REQA 2PKCA 2PWBA 3SQLA 1TX4B 2IL1A 4NAVA 2F3PA 3D4OA 5FADA 4KO1S 4XQGA 4OQXA 2MMGA 4ETWA 1E4VA 4D56A 5ES3A 1WZEA 2EGUA 4O2RA 3TIXB 2ORIA 5FX2A 1W36D 2JH8A 4JQYA 3ZVKA 3DMYA 4HQOA 1GXSA 1CQIB 2VIIA 2GRJA 5BW6B 3L1VA 2WSSD 3VR3A 1DDIA 1QO7A 1VXRA 3A1SA 3FTQA 2QLJA 3QYPA 2QTHA 4OQPA 2RGBA 2AUTA 4M7RA 1WXXA 2HJHA 5E38A 2PX8A 1RLJA 1CVLA 3CA8A 3A4IA 2DU8A 1RADA 3G82C 3IP1A 4TWJA 5E1DA 5K3DA 3V00A 1W4ZA 5B58T 2Z1DA 1XTSA 1JJAA 1CB0A 2F67A 2IEYA 3LKZA 2YOGA 2JNWA 5LSAA 1ANKA 2B69A 4LJRA 4O4JA 1RFGE 3MGBA 4PRZA 3BZUA 4C4YA 5AD1A 4HTFB 1HH4A 3QUAA 1RCTE 2G9ZA 2ZOSA 4YRTA 1RRCA 1N5RA 2C00A 2RHBA 3KSAC 1V43A 3B9BA 1YCDA 2E55A 2G36A 4MUKA 4OM7A 3TPCA 3CWQA 4MW0A 5CCDA 2YFKA 3CVYA 4PQFA 4JSTA 5DYNA 4L3WA 2JJYA 3UAOA 2QTGA 4Z7QB 3DE2X 3A05A 4RK0A 4AQDA 1V16A 2P9JA 4LIPD 2J3DA 4LXXA 4EB6B 3K0SA 4JI0B 3HY3A 1X8XA 5ALOA 4BO7A 1P8JA 3PVSA 2FLWA 3HO6A 2G4CA 1YCFA 2LCIA 3LSYA 1MO5A 4C9BA 4BNDA 3RUIA 4D9HA 4F3RA 3PVCA 1Y9JA 4V2UA 5E8JA 1P60A 4OQ4A 1DXQA 1MAHA 3UNXA 1DO2A 2OVBA 2YJNA 2Z09A 2YJGA 3AHJA 3CRMA 3FWNA 3HCPA 2LUOA 3C3KA 2VAVA 3A3PA 4Y1RB 4ESOA 4Y2UA 5ALPA 3MC1A 4O1HA 4UNPA 4Y1GA 4ENUA 1W93A 4ZT5A 4ZA2A 2JFUA 1ZU4A 1W5FA 3HU3A 4AY5A 4B3MB 3IYLW 3MINB 4UCQA 4D46A 4EATA 5M04A 2COKA 4T