4EEZA

Crystal structure of lactococcus lactis alcohol dehydrogenase variant re1
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
339
structure length
339
Chain Sequence
MKAAVVRHNPDGYADLVEKELRAIKPNEALLDMEYCGVCHTDLHVAAGDFGNKAGTVLGHEGIGIVKEIGADVSSLQVGDRVSVAWFFEGCGHCEYCVSGNETFCREVKNAGYSVDGGMAEEAIVVADYAVKVPDGLDPIEASSITCAGVTTYKAIKVSGVKPGDWQVIFGAGGLGNLAIQYAKNVFGAKVIAVDINQDKLNLAKKIGADVTINSGDVNPVDEIKKITGGLGVQSAIVCAVARIAFEQAVASLKPMGKMVAVAVPNTEMTLSVPTVVFDGVEVAGSLVGTRLDLAEAFQFGAEGKVKPIVATRKLEEINDIIDEMKAGKIEGRMVIDFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alcohol dehydrogenase 1
publication title Structure-guided engineering of Lactococcus lactis alcohol dehydrogenase LlAdhA for improved conversion of isobutyraldehyde to isobutanol.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
total genus 107
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4eezA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4eezA01
4ND5A 2RBEA 3WYBA 3ZI0A 4GH5A 2CVQA 4I1IA 4OIMA 5ES3A 5F5NA 2WE8A 2HUNA 3LZ6A 4MO2A 1DFHA 2NVUB 3EVTA 3H6KA 3T4EA 4CV3A 3OIDA 4PG4A 2HRBA 2Y68A 3GUCA 4YR9A 2NADA 2BHLA 3K31A 1QV6A 3UUWA 3QW2A 5L95A 1C0PA 2Y67A 3GDGA 3JD1A 1AXEA 4QFDA 1HDOA 4BB5A 2V6GA 1Q7BA 2J3IA 1DAOA 3PDUA 5JS6A 4CODB 1P1KA 5ADHA 3DHEA 1NX6A 5KJFA 4IQ8A 3LT4A 1QG6A 4E21A 2OP1A 5FF9A 1YOVB 1ENPA 4CM9A 1L7EA 2R00A 4NBVA 2O3UA 4E13A 2P68A 3PYXA 4YQYA 2PFGA 4W4TA 5L4SA 3I3OA 1R15A 2OL4A 5EN4A 4R9RA 1Y7TA 3JQ7A 1QLJA 2OUIA 4BNIA 4GSLA 5LDHA 4A73A 3N58A 3BMOB 3JYLA 5JSFA 4N18A 5I9MA 1NPYA 3LT0A 3GNQA 3JQ8B 3L6DA 1KETA 3H7AA 1UDAA 5BSGA 4IS3A 5A05A 4KP7A 3BHJA 4EJ0A 4J7XA 4YQZA 1H93A 3NRCA 3ZNQA 3ZWBA 3NDRA 4BOYA 3PWKA 4DA9A 4TKLA 4Q3BA 3INGA 3VPGA 4BO2A 2I76A 2VYVA 4Q3AA 4UVEA 1EFLA 1LDNA 2B83A 1K2WA 4A5OA 4E32A 3DTTA 2Y0CA 4CMBA 1MGOA 3B1KA 5B4TA 3O26A 2ZQZA 4DWVA 3WBBA 4QQRA 4HFNA 5JY6A 2OP0A 4IPTA 4BNJA 4D45A 4DIOA 5BSHA 3OH8A 1E7SA 2VRCA 1MXFA 2ZCVA 4CMKA 3PJEA 3VH4A 2BKAA 4JCOA 4JK3A 4YAKA 4P4NA 7MDHA 5CPFA 2P9CA 4BNKA 5EERA 3SC4A 3QWIA 2X9GA 3TPCA 1ZMOA 2YJZA 4Y9DA 4CV1A 5CG1A 4DXHA 4FFLA 1YB5A 1GZ3A 1OBFO 5DP2A 3PYLA 2QG4A 3TDKA 3JSAA 4M55A 3ZWNA 1P0FA 1DC3A 4GX0A 4ZVVA 1EDZA 4BNUA 1IHXA 1DLIA 4LCJA 1JVBA 3H5RA 4BQRA 4GX5A 3PQDA 4E5PA 2O7QA 2GN6A 2VHXA 1SOWA 3VZPA 3PFWO 1VPDA 1IOLA 1LTHR 2VT3A 4K28A 4ND1A 3GH3A 2NV6A 3W4KA 5I7EA 4UAGA 1BVUA 1DO8A 3PJDA 5COBA 5AXCA 5L51A 4U7WA 2Y66A 3TL2A 4MP6A 3Q2KA 2AEJA 2C5EA 4FJ2A 5TQVA 1R6DA 3UW3A 3DEYX 5EL0A 4ALIA 3DQPA 4Q3EA 2HLPA 3RUFA 3WNVA 3H9QA 2JCYA 3H3JA 4KWIA 4RLHA 4XYEA 2GN9A 1XWFA 3DHYA 1PJTA 4GQAA 3RUIA 1T4DA 4PLCA 1HZJA 3OF2A 1I0ZA 4J7CA 4RDHA 2FY8A 4GGPA 4ZGWA 2VTEA 1B7GO 3I9JA 3I9MA 1WDKA 3D4NA 3CE6A 4BVAA 4EEZA 3QWBA 1YE3A 1WDMA 1PJSA 1TXGA 1A9YA 1DSSG 5IG2A 1H2HA 4J43A 3GMDA 1AE1A 1OC2A 2D8AA 2DUWA 4RVDA 4RPHA 3OECA 3S2GA 4H15A 3B20A 1I5RA 5L53A 4CM7A 5IDXA 1D4FA 2A9FA 1ZIDA 2Y1GA 2AQKA 4XX0A 1B3BA 1QYWA 2BI7A 3INRA 4TZTA 1XG5A 2O2SA 4YAJA 1RYDA 4BNGA 3W6UA 1NM5A 5H82A 3BZUA 3QVXA 2CZCA 3WQRA 2Q1TA 2DBQA 3KLMX 5TGDA 4E3ZA 4XB2A 2IDZA 1ENOA 2JAPA 4M8SA 2HDHA 2VUSA 4Q3CA 3K5PA 3LF1A 3GEDA 1M66A 4CPDA 4WPGA 3QSGA 3WYEA 5KJEA 3OJLA 3MCVA 3NX4A 5DCUA 3TZCA 1O94A 4YJFA 3V1UA 3VZRA 4BUCA 4B7CA 3NYWA 2X0IA 2YDYA 1C1DA 4D43A 3FTNA 2O4UX 5JW6A 4MPDA 1KBZA 2PD6A 3BTSA 4OSPA 2LDXA 3JQAB 1NQOA 2RAFA 3ZHZA 5CDUA 3SLGA 1PS0A 4DC1A 1H6DA 4J2OA 4IDFA 4GKVA 1E1KA 1DIRA 4TRMA 2FSVA 2J6IA 6LDHA 5I7SA 3AU9A 1O9BA 1XQ6A 4TKMA 2OBNA 5CDTA 4YRBA 1O89A 3WS7A 3C7CB 1W0CA 3JD2A 4ZD6A 1H0KA 3GVCA 5IDYA 1BVRA 2X0RA 2C5AA 3K2EA 7ADHA 1UXJA 3ZZNA 3HHPA 3KSUA 5ICSA 2X9VA 3QIVA 4MVJM 1CETA 4B4UA 1GEEA 4GPD1 1GEGA 1ONOA 3I9NA 1E7YA 3DXFA 4DREA 4L4RA 1GYPA 1PX0A 4ZQFA 1I2CA 5TLSA 3U49A 4I9UA 3TJRA 3P2YA 4KQWA 1CYDA 4R4JA 2UV8A 4PG8A 2FR8A 1VJ0A 4RORA 5AXDA 5ILGA 4LN1A 1KOLA 3BMQA 4IUYA 4Y6SA 2VZ0A 4KDFA 4PG5A 1EK6A 1H6BA 3FPCA 3LC1O 4WCFB 3VTFA 1PQUA 2JD1A 3ZDFA 1PJLA 1HLPA 2FPIA 1P45A 3PWZA 4U6QA 5A3JA 4AJIA 5TC4A 1T1RA 1W6UA 1J4AA 3LU1A 4PLWA 5KVQA 4TSKA 4YJHA 1Z82A 1EBUA 3BMCA 3GN2A 1UXHA 3C1TA 4YCAA 2H9IA 2O3SA 3AW9A 2W98A 4WJZA 3S2IA 3QHAA 3OM9A 3JYNA 1K6IA 1ZXBA 3PYMA 1KVQA 2B5VA 3GRPA 4EBFA 2UVDA 2TMDA 2XPCA 3DZKA 4ZQBA 3VTZA 4KQXA 5AYVA 3GVPA 4BO7A 2Y0DA 2P5YA 4L76A 4WNIA 3AY6A 1F8GA 3AUAA 5T67A 1A4IA 2VUTA 3JQFA 4AJ2A 1UP6A 1NPDA 2GN4A 4I5GA 3TQHA 3TL3A 4O63O 4OSOA 1E1LA 1A71A 1IY8A 1XSEA 3H9EO 4LMRA 4NFYA 2IODA 5COQA 3JV7A 3U9LA 2NTNA 4XYMA 5MGBA 2IXBA 3MOIA 2B4TO 2GPTA 4QUKA 1JWAB 1E7RA 5TT0A 3LK7A 3ABIA 1GUZA 2A94A 3WB9A 3CXRA 1UAGA 1RPNA 4JJIA 1ARZA 3KYDA 5L9AA 1I32A 2FZWA 4MIOA 1HSOA 3V1YA 3DZBA 1U3WA 1E6UA 1OI7A 3DZGA 2X23A 3L9XA 2OOSA 4PZCA 3X2FA 2OHXA 3ZWVA 3LSYA 1XYGA 2VYND 3AI2A 1UXKA 1SEPA 4DMLA 3IOYA 4MKZA 4PZEA 2ZB4A 3D0OA 1AHHA 3BAZA 4L0QA 3WYCA 2H5LA 1R12A 3DO5A 3JD3A 1EE9A 1T26A 2PGDA 3L6OO 4KUGA 4R51A 4DLAA 1ONNA 1FF9A 2YQ5A 3F1KA 4OKNA 4R68A 1HE3A 1U3TA 1XU7A 3O4RA 3ITDA 1E3WA 3GFGA 4FFRA 5DOVA 1AHIA 4CV0A 3UICA 4NBTA 3C8MA 3PHHA 4CJXA 3RROA 3RQSA 2PNFA 5C37A 3WSWA 1GV1A 1ULUA 3OA2A 4E2ZA 4HKTA 4OKIA 4XQGA 3G17A 5L7TA 2VHWA 2ZJ0A 3HE3A 3AOEC 1ADCA 3EC7A 1N7GA 4I5EA 4B4WA 1WW8A 1L7DA 3R1IA 2Y1OA 4FQ8A 3NJ4A 3W4JA 4D46A 4RJTA 4CMHA 2POQX 4CMEC 2X1HA 1F0YA 5DBFA 4BS9A 1PR3A 3HN2A 1CDOA 3C1AA 1Y1PA 3VZQA 3WLEA 2NLOA 4WCFC 1FK8A 3GG2A 4BO4A 4FN4A 2O4CA 4KDEA 1LRLA 1LX6A 1DFIA 5B12A 3M2PA 4FC7A 1PWXA 1B0AA 1DC4A 2B5WA 2PY6A 1UDCA 1R0SA 1HXHA 5JYEA 1QV7A 2DTEA 1I3KA 1QYXA 3WGOA 4WLOA 4DTIA 1YVEI 1WWKA 1PEDA 1DPGA 3DWFA 1LRKA 3PLNA 3AY3A 1OFGA 2AEFA 2NVUA 2UDPA 3BMNB 2EP7A 1JDJA 1PWZA 2Q3EA 4O1MA 3DDNA 3RD5A 1K5HA 2DBZA 4IDBA 3DAFA 3WGTA 3ZHXA 3UVEA 4MVJF 4R3NA 4Q39A 3QRWA 4BKQA 4D41A 3ROQA 1NTOA 2WDZA 2EGGA 3U4DA 1U7TA 1T2DA 5CPBA 2B4QA 4N5NA 4ZHSA 5JC1A 3SBOA 3UKOA 1LSJA 3E82A 3PZBA 4WKGA 3W6ZA 4O0LA 3ZU3A 1YOVA 3G3EA 1C3VA 5A1TA 5ITWA 1JTVA 3W8FA 3DONA 3WJ7A 1DRVA 1BXKA 1LC0A 2A4KA 4CUKA 1YDWA 1MV8A 2OORA 2VHYA 3QJ5A 2X58A 4O6VA 5EESA 1ORRA 1GDHA 3BMOA 5TX7A 3OA0A 5ICMA 4JN6B 3JQ8A 1DEHA 1R0KA 3PJFA 1SNYA 3DBRB 3NDIA 2CVOA 1A9ZA 1ZW1A 1ADGA 1NQTA 2PKQP 2Q4EA 1DIGA 4BHTA 4MKXA 4BNYA 1UP7A 3RUEA 2EV9A 5G0TA 3TZQA 3VPSA 1YB1A 1BMDA 2VOJA 2PA3A 3GZ4A 3BTVA 3S55A 3DZIA 1DC5A 3ORFA 4BIIA 1VC2A 4P22A 3CKYA 4E31A 2I3AA 1MC4A 4BO5A 4OMUA 2JHFA 2XXBA 3ETDA 3H8VA 4UVHA 1LBEA 4PFJA 4IM7A 4BKUA 3OEWA 4L4XA 3T7EA 5L4LA 5JMWA 4JJGA 4NJMB 1GQYA 3EK2A 3AM3A 3O03A 1ULSA 5GZ1A 3GPIA 3JQ9C 3EAGA 1SZJG 2NU7A 4FJ0A 1Y9AA 2VWPA 4GAEA 4FD3A 1YXMA 4D79A 1KEUA 1D8AA 1I01A 2W90A 5IXSA 1HWYA 1M76A 2VWHA 3ADOA 1E3LA 1SAYA 3HFGA 1EVJA 1G0OA 3LLSA 1YL6A 4WEQA 2QRLA 5COAA 4WLEA 4TMFA 3PK0A 5EINA 4Z0PA 4RZIA 5AXBA 4J4BA 4ZRMA 4AJNA 3TFOA 1X13A 1D7OA 3F6YA 1NPTO 1PL7A 3DAGA 4CLRB 4I5DA 1Q0QA 3IKVA 2QHXA 1NFQA 4PGFA 2ZCUA 4J1SA 4H7PA 4CLXA 1ZZEA 1BXZA 3OHSX 5JDCA 1FDVA 5GZ3A 2I67A 2WWRA 3DBHB 4KTVE 2X6TA 1I36A 4OXYA 1U4OA 3X2EA 5FEUA 2GUGA 4XA8A 5DDIP 1JW9B 2CF5A 2EJWA 2RH4A 1LSUA 3H4VA 1ISJA 1XA0A 5FYDA 5JE8A 1ZBQA 3AWDA 1L1FA 3WIDA 1PJ3A 3WBFA 4B7UA 4ZU3A 4CLEA 4A27A 3L9WA 1UXIA 5HRUA 5IDWA 1SB8A 3GVHA 1M6HA 1QR6A 4QT0A 1I2ZA 1HRDA 5F1OA 3ZWPA 4RL6A 2EW8A 3VZSA 4XQ9A 3TZHA 5IDQA 2PH3A 3KTDA 4MVJP 4TWRA 3I5MA 3U0BA 3KV3O 1HDRA 5GMOA 1EFKA 3AFNA 2D1YA 2WE7A 1P44A 4BO1A 2PZLA 3D1LA 2VHVA 2WJPA 4FFOA 2WM3A 3ZWWA 3MEQA 4GX1A 1RM4A 4MIYA 1ZEJA 1Y5RA 3MOGA 4R9SA 1VLLA 3ZNNA 4L8VA 4YEDA 1WNTA 2Q2VA 4F46A 2V6MA 1ZH8A 3S2EA 1YDEA 2IYPA 3ZU5A 1K3TA 3OIGA 3OP4A 1I24A 4JP3A 1WLYA 3EDMA 2RIRA 2DBRA 4RZHA 3WGGA 3ROPA 3CH6A 4FB5A 2BGMA 5JYDA 1PR9A 3AUSA 1WZIA 2V6FA 1X15A 1A72A 1CIVA 4BGEA 3ZHBA 4HNHA 1WVGA 2WSBA 1B2LA 4CL8A 4HV4A 1UUFA 3T4XA 1R4MA 5IFLA 3AI1A 3RU7A 1UH5A 4D7AA 1GCOA 4E5NA 3UGKA 4AG3A 4CM8B 5BSFA 3JQAA 1NR7A 5J23A 2ZTUA 1G0NA 4QECA 2X86A 2DQ4A 2BGKA 3ZNOA 3V5NA 1ISMA 4J0EA 4GBJA 1DBVO 2Q1UA 3DAPA 3LVFO 4YBZA 4G65A 2PK3A 5JMPA 5A9SB 3GLQA 1NXQA 3PPIA 1YRLA 2Y1FA 2ZB3A 4RF2A 1HDZA 3GHHA 3ONFA 5H83A 4DLBA 2C07A 4N7RA 3KM0A 3FSRA 3I6IA 5JO9A 4ITUA 4J6FA 1EVYA 1BDBA 1RWBA 2Z95A 3OIFA 2O50A 3KRTA 1NHGA 4XYLA 5JO0A 1DHRA 4XDZA 3A1NA 5LCXA 5ILOA 4IJWA 2ILTA 3RUCA 1KY5A 3O9ZA 3CPSA 3AOEA 3E1KA 1BDMA 1Y8QB 1YBMA 3ZV4A 1N92A 3LYLA 5JPIA 4CMEA 1MB4A 2FOIA 5I8ZA 4KZPA 5JCJA 3A06A 1R4NB 4WCFA 1VKOA 1B8PA 2RH8A 3ZWOA 3C7DB 3RWBA 2FWMX 2TMGA 4TRJA 1PTJA 2GYYA 1P33A 4PLVA 2EJVA 1C1XB 4IINA 1HDCA 3M6IA 1LEHA 2DFVA 3DZFA 3PHJA 4LW8A 3FCOA 4U6SA 2JKVA 4FDAA 3KVOA 1BXGB 1I3MA 1FMCA 3JYOA 1VSUA 1EMDA 2BI8A 2YHUA 1P1RA 2JD0A 1YO6A 1R37A 3NEPX 2G82A 1B3RA 2Y99A 3AFMA 4FOSA 4DQUA 4DYDA 4NZ9A 3GZNA 2PLAA 5FI5A 4E5YA 3JD0A 2OGUA 1ZXLA 1EZ4A 5BNTA 1WAMA 3A28A 1K0UA 2H63A 3D7LA 3EZYA 3MTJA 4ZA2A 3SJ7A 4GMFA 5DT9A 3OJFA 4R1UA 4J91A 1IUKA 4FCCA 4YT4A 2VWGA 2EF1A 4UEKA 4RPGA 3RBVA 2DKNA 4BNZA 4JP2A 1XLTA 4YA6A 1YJ8A 4W9NA 5FFFA 4YAGA 1LA2A 3FNGA 5A06A 4TVOA 3G79A 1P0CA 1F8FA 1HL3A 3OICA 2NQTA 2IZZA 1XEAA 1K6JA 1FDSA 3P7MA 3ANMA 4CR6A 4MVJH 4HX5A 3LT2A 4FSHA 1GY8A 2Z5LA 2Y05A 1OC4A 3HWRA 4RQUA 4NPCA 3KZVA 2DPGA 3HZZA 1CWUA 1FJHA 2DTDA 3GC6A 3SX2A 3G1UA 5KVSA 4YRDA 1PJCA 3GVXA 3RC7A 4MINA 3ASVA 4MP3A 4MVJA 2FR1A 9LDBA 1QXSA 4WECA 1IB6A 4DL9A 4R1SA 1H9BA 1MUUA 1TVEA 1PQPA 3GGPA 2BFMA 1H6CA 2FSSA 4TZKA 5TJ9A 3OQBA 5A5FA 2Z1NA 3WTCA 3MWDB 4BKPA 5CEFA 3F3SA 2OFPA 2QIOA 1KY4A 2Y1EA 4EI2A 5L45A 2JCVA 4FC6A 4XWYA 2YV2A 4LCEA 4BNXA 2CF6A 3QWHA 1FXSA 5EJ2A 2W4QA 1J49A 1GUYA 3VOSA 1C0LA 2P4QA 1KC1A 1VL8A 3H5AA 1GFSA 5C7LO 4CM1A 4OJNA 4D44A 3AY7A 2H1SA 3AM4A 1GQ2A 3JQ9A 3PEFA 1I33A 4NK5A 4U5QA 5DCYA 4B3IA 5ITVA 1TA4A 4DRYA 1N7HA 4RF4A 4IZIA 4HUJA 3UCFA 4G81A 3CMMA 5G0SA 3WTBA 3IJPA 3GQVA 2YUTA 2I3GA 1QYCA 2J5KA 3VKVA 2BGLA 4TROA 4ZQGA 1N1EA 5TS3A 2VOEA 1EBFA 1EQ2A 3ZGYA 2BD0A 2HMWA 3F1LA 1Z7BA 2Z1MA 5A5EA 4DLLA 2V6BA 2Q2QA 4A10A 3GHYA 2EWMA 3W8EA 1I30A 4BV9A 4L9RA 2RHCA 2PD3A 3NTOA 3BMNA 3HDJA 4GMGA 4NQZA 4Z3KA 2D5CA 4IGFA 2PGJA 3ANLA 4B4VA 4PZDA 4A7PA 1YQDA 2P4HX 1QMGA 3QVSA 4PIVA 4PRKA 3GVIA 3DFUA 4NU5A 4XKJA 2IEBA 3GAFA 3PRJA 3RBZA 3PHLA 3RCBA 3CZMA 5F5LA 1Y9EA 4U8GA 4E6PA 3FBTA 4WE3A 4L4SA 3IUPA 4CMIB 2D59A 3GA0A 1YONA 2EGHA 4R41A 1JWBB 4R1NA 5ER6A 2D4AA 3I4CA 1PZEA 4GX2A 3TWOA 3EGOA 3OJEA 1B16A 1KEPA 1MFPA 2YHIA 3GGOA 1E6WA 3GGGA 3JQGB 1GD1O 3GEGA 4P38A 3H3FA 4RVFA 4EUHA 4YXFA 3GUYA 4Y6RA 5FWNA 4HP8A 1XGKA 5L7WA 1X7DA 3ITKA 1BTOA 4DIFA 1JKJA 4R69A 3DBRA 2NQ8A 1EVIA 4CQMB 4ID9A 3LF2A 5CDYA 1PIWA 2F00A 4BL5A 2HMSA 2ZYGA 3DOOA 4B4OA 4J0FA 2EG9A 1EUZA 3JQBA 3ZCXA 1GU7A 4FPXA 2W2LD 1ENZA 3GPDG 3L4BC 4I8XA 5U4QA 3WGIA 2AW5A 4BGUA 2X5OA 4OXKA 4BGVA 4CMGA 4UUMA 3HN7A 1EVZA 5IZ4A 1V3VA 3FNHA 4INAA 1VJ1A 2ZYDA 2AE1A 1GZ6A 4B3JA 1LSOA 3CSDA 4KUHA 5IF3A 5C7OO 3H2SA 4XRRA 4IJKA 3WGZA 3BXXA 4XR9A 5F1KA 1PL6A 1LLUA 3C1OA 1JKIA 2EKPA 2PZMA 4XGIA 3VPFA 1BW9B 1SOVA 3JQEA 5DP1A 3D5TA 3W4IA 4D42A 4NJMA 4KTTE 4FBGA 2B37A 4XJSA 4ZICA 5F3RA 3TSCA 4KWHA 3A9WA 1OZAA 4YWJA 3V2HA 1E92A 4YPOA 3DR3A 1PGQA 4NMHA 1B26A 4XD2A 2AG8A 2NU8A 3ULKA 3UF0A 1CQIA 2X22A 1IZ9A 4II2A 1RM3A 4XIJA 4RV9A 5CP8A 1Z73A 5G4LA 3RSHA 3V1TC 1H94A 4AJEA 2D2IA 1GYQA 2UUPA 4S1VA 5DBIA 2VUUA 4K6CA 2CFCA 5THKA 2QZZA 1D1SA 5U9CA 1PJBA 5TT1A 2EHDA 4AJHA 1QSGA 3WWZA 3K2BA 1U8FO 2RHRA 3BIOA 1A5ZA 1RM0A 2NU9A 2BMAA 4TRNA 1XR3A 3DBHA 3COSA 3CIFA 1D1TA 4Y98A 1LDGA 4R16A 4AICA 1V8BA 1DFGA 2FN7A 3E9MA 4CMJA 4LMPA 4A0SA 1NNUA 2NWQA 1IULA 4E12A 4BMSA 3F5SA 3E9QA 1RM5A 4F6LA 3LDHA 1P77A 2UUOA 4BV8A 3ENNA 3DHNA 1PSDA 1YBVA 3GDOA 4W7IA 4OQYA 3VDQA 3DTYA 3RVDA 4CV2A 4W99A 4EJ6A 1LDMA 1ZUD1 1Q0HA 1F06A 1U9JA 3BTUA 3DOJA 2PKQO 3Q3CA 4Z9XA 2YZ7A 3GT0A 4TVBA 3S1LA 4O5OA 2WTBA 1Z7EA 2FRDA 4ZN6A 4ZJUA 3RC9A 4TRRA 3V8BA 1O5IA 2BF7A 2IEDA 1XU9A 4MIEA 3AUTA 4AJ1A 3E48A 4M86A 1O0SA 3HSKA 2YFHA 3WDSA 2ZB7A 5BQFA 4JBIA 4PG7A 5TIIA 1HF3A 2JHGA 1P1HA 1LI4A 3C7AA 2Q1WA 4B8ZA 2NTJA 2C0CA 3FI9A 1B15A 3KO8A 1U5AA 2IZ1A 2HQ1A 4DBZA 1YS4A 1TT7A 2HMUA 2B36A 1E1NA 3PQEA 2H6EA 4ESOA 1C14A 4B7XA 2VT2A 3F47A 3ENKA 1Y6JA 3AU8A 4UUOA 4B3HA 3GAZA 3ZNPA 2YW9A 1PJQA 2OZPA 2BELA 1E3JA 1FDUA 4PLTA 1DDOA 1HYGA 4QX6A 5HTOA 4PVCA 1IPFA 1I3NA 1UAYA 2Q1SA 1SB9A 3I83A 1HE5A 4A2CA 3JYPA 4X54A 4YYZA 2C54A 1YL7A 4RO0A 9LDTA 4CM8A 5CAEA 2E49A 2FMUA 3H9UA 3BA1A 3VVBA 3WSVA 1LXCA 1U2GA 4BNNA 4WCDA 4CLHA 3I6QA 4J9UE 5KOIA 2ZATA 4UREA 5A9SA 3WFIA 1PJ2A 2NVBA 3L4SO 4YJGB 3I1JA 1H9AA 1X14A 1JAXA 3IDSA 2BRUA 5I7VA 1HE2A 4FJ1A 4PLZA 3LLVA 3MJSA 4ILKA 3UXYA 3DOCA 1ZJYA 3EW7A 4JGBA 4YAIA 3PDJA 1ZKMA 3JCZA 3ZU4A 3GDFA 1E3IA 4XGKA 1ZK4A 2Y1CA 4HY3A 2NM0A 2V7PA 2OBYA 3E8XA 3OETA 2GLXA 1JLLA 1LDBA 3TN7A 3VPHA 1CEQA 1Y8QA 2C2XA 3ICCA 3ZV6A 4YT2A 4FS3A 4XGNA 2Q4BA 3QE3A 2P2SA 2JL1A 4YVFA 3SJUA 4JJFA 4Z9FA 3TZKA 1BSVA 1R4NA 4AJPA 3K92A 4CQMD 4BNFA 5K9ZA 5C3MA 2EEZA 3JQ6A 3V2UA 4CM5A 1B14A 3JYQA 2PKRA 2GO1A 1A7KA 1X0VA 5JCXA 1ISIA 1C1XA 1NBOA 3LC7O 1E7QA 1E5LA 2CUKA 2AQ8A 2X5KO 5JAQA 3WXBA 5I9LA 1PGOA 3HNPA 4WEOA 3U4CA 4XIYA 3PTZA 1BXGA 3INTA 4WGGA 4IBOA 1IYZA 2ZK7A 3EHEA 3IMFA 3Q1LA 1ZK3A 4YB8A 1B8VA 1AUPA 3WICA 3DB2A 1XELA 5T8KC 2QYTA 1T2EA 3NDJA 3ZW8A 4CLDA 1I3LA 3OFSA 4AJKA 4B79A 4OHUA 3MJCA 3ON5A 4NBUA 1GL3A 1GAEO 3GR6A 3WGHA 4DQVA 4CQLB 1IPEA 2O3QA 1N9GB 4URFA 1WDLA 4BB6A 5A04A 3RJ9A 4YTEA 1EE2A 2WD7B 4DPLA 1EUCA 4JROA 3DBLB 3EYWA 3M1AA 1YQGA 4B8WA 2JD2A 1MX3A 4YRAA 1H5QA 3IUSA 3Q0EA 1OMOA 4ND2A 1NHWA 3W8DA 4IMPA 4Y6PA 4E2XA 3B1FA 1YB4A 2YFQA 5G0UA 3I9OA 3QWAA 2DBVO 3NGXA 4LSWA 2A92A 2ZTMA 2VHZA 4PG6A 1BRMA 5HBRA 4WNCA 4XQCA 4WLNA 3Q9UA 1VL6A 1YWGO 2Q2WA 8ADHA 5TSDA 4JQCA 3VC7A 4P4LA 1J5PA 2O23A 2ZQYA 3AJRA 1I10A 2DFDA 1GTMA 1LJ8A 2JFFA 3CUKA 4FFNA 4DPMA 1YL5A 1PZHA 1SMKA 1QYDA 2I99A 3KYBA 2GGSA 1VSVA 4CM9D 5A3VA 1TI7A 4AJOA 3L4BA 2XAAA 1QKIA 1HLDA 1TT5B 3GOHA 5TRTA 1A27A 3W1VA 3WQSB 2QW8A 2OMEA 4BO9A 2HJSA 4NBRA 2JCXA 4NFHA 2GERA 2VYNA 3CZRA 3BMQB 5T57A 2QZ9A 2IXAA 2O48X 3BHMA 4BO6A 2AHRA 3LT1A 4F3YA 1Y5MA 1MP0A 1QLHA 1W73A 2Y0EA 4AJ4A 4DGSA 3ZWCA 1A4UA 1ZJZA 4DMMA 5A9RA 1QP8A 3AM5A 5EMHA 2X5JO 2AEMA 3Q9NA 3ONDA 1LDEA 1Z74A 4MJLA 3E5RA 3B1JA 2VYVD 4FGWA 1IHYA 4CUZA 4KMSA 3PZRA 4YJHB 4IDGA 1E77A 4QXMA 1DIBA 3PGXA 4BGIA 3D3WB 4RPJA 4CR7A 3MZ0A 4WLFA 1O95A 1Y81A 1NFRA 1ZNQO 4NH4A 4KOAA 3H9GA 4PLFA 4GVXA 2VRCD 3WJAA 3BHIA 2I9PA 4OGWA 4QSMA 2EERA 3SC6A 4AJJA 1T24A 3FNFA 3NT5A 5ENVA 4RCVA 5I8WA 5GY7A 2FR0A 1GUFA 4R01A 4J2HA 4K1LA 5ER9A 3GEMA 1PGJA 1TB4A 1JVSA 3QVOA 1ISFA 1XQ1A 1ZEMA 2PZJA 5IAAA 3NKLA 1ZCJA 3IS3A 3OQ6A 2QRKA 1M75A 3OSUA 4LRTB 1G1AA 1V0JA 2F1KA 3SLKA 1ZSYA 5C7IO 5JFOA 3JQCA 3ZN2A 3RIHA 2VQ3A 4GLOA 1NVTA 2HO5A 3F9IA 3GF4A 2NU6A 1HZZA 5DCWA 1HEUA 5JNLA 3EZLA 3OJOA 3EUWA 4DPKA 3PFFA 4CMIA 3D4PA 1HSZA 2CSUA 1GYRA 5EPOA 2AQHA 3U3XA 3LQFA 2GRAA 4Z0TA 1V9LA 3HQ4O 4M54A 3ZWMA 4FR5A 4UULA 4Q3NA 4HFRA 3ZV3A 3MJVA 3ZWYA 3JQGA 1UDBA 4AJLA 3CEAA 3HB4X 1AXGA 4D3DA 2HJRA 2Q46A 4MP8A 4J1QA 4E5MA 4XDYA 4ZQEA 2G5CA 4O59O 2PGLA 3L0DA 5JDIC 1K6XA 5BT9A 5L3ZA 4Q9NA 4RLSA 2DPHA 3KETA 1EEHA 4CMAA 3DZJA 4PLGA 3HDHA 4JBHA 1U3VA 5HA5A 4M89A 1NFFA 3E18A 3WLFA 4EW6A 2VZ8A 3F4LA 2YV3A 4UUPA 3B6ZA 4AL4A 4MKRA 3TOXA 5AXAA 4UVIA 1Z6ZA 2C7GA 1HDGO 4KUEA 3WGYA 5B4VA 5L4NA 4RQTA 3UFXA 1HDYA 4UUNA 3IL2A 1HKUA 1NAIA 3TRIA 3DMYA 3ZWXA 1NQAO 3GK3A 3TOZA 4YACA 2EKLA 5KJ6A 2XOXA 5BNFA 3KHUA 2CDAA 3R3SA 3ZHYA 1BW9A 3IIEA 5ENDA 4C7KA 1X7GA 3P2OA 5KKAA 3IJRA 1U28A 4J3FA 1X1EA 3ZWAA 1H2BA 2NSDA 5BNIA 3QY9A 1TEHA 3NTRA 2HKIA 4GVLA 3OBBA 4RF3A 5CHEA 1LLQA 3E03A 4C4OA 1R16A 4OOEA 4YAEA 1Q0LA 5H81A 3JD4A 3FHLA 4BKOA 3ZH2A 4MDHA 4C7JA 4NI5A 2BFOA 2G76A 3JQFC 5DBGA 3CTMA 3PIIA 4CM4B 2O7SA 5HS6A 1ZK0A 1KVUA 3WQQA 3C3XA 3WFJA 3F5QA 3U5TA 3RC2A 3UCEA 2FHSA 4ZRNA 1T2FA 2C82A 1YQXA 2O3TA 2P5UA 4J16A 4E2YA 3I9KA 2J3KA 3D64A 1U4SA 1V3TA 2AG5A 3B70A 2BH9A 2ZTVA 3KOUA 1G6KA 1LQTA 1LLDA 5G0VA 5KVCA 2GDZA 4PLPA 4IMRA 4ALMA 3RASA 1D3AA 2Y1DA 3U4HA 2G0TA 4FGSA 3E9NA 5AVOA 4BO0A 2DT5A 1KVSA 3G49A 4RVUA 3SEFA 1KEVA 1ZO8A 4DC0A 2GF2A 4N54A 2P9GA 5DOZA 3KXDA 1N8KA 3C85A 4M87A 1E3SA 1N1GA 3FF4A 2Q50A 4XQEA 2HMTA 3A4VA 5BSEA 3IC5A 3QQPA 1E0DA 3RC1A 1WXDA 2B35A 4PRLA 4EGFA 3MTGA 3KYCB 1CJCA 3ETEA 1E3EA 3TFQA 4CUJA 4N5LA 5T8KA 3N74A 3WG9A 5G0WA 2WYUA 1K89A 2HCTA 3SVTA 4F45A 4E30A 1Y8RB 1VKNA 4CLOB 1X1TA 4GLLA 1FDTA 3UOGA 2X4GA 1RYEA 1YKFA 4EZBA 2RCYA 5CEEA 2AE2A 3HADA 2FPPA 1VM6A 3RUHA 2IE0A 3PIDA 4EEXA 2ZJ1A 4LISA 4LGVA 2DTXA 4NFSA 4U0KA 2Q45A 4JIGA 1ADBA 2X7HA 4OM8A 3DBVO 1LSSA 5A02A 1E1MA 4MVJE 2JJYA 3I4FA 1QRRA 1MFZA 3G0OA 3GMSA 2HK8A 1DOHA 4NK4A 3WR5A 2HRZA 4J49A 5LDGA 5G4KB 2I65A 4BNLA 1O6ZA 1DJNA 2R2GA 2CDBA 2R6JA 4Z9YA 4EITA 3GG9A 4FFMA 4HNGA 3RAJA 3VAZA 3FN4A 1U1IA 4ZQHA 5KVVA 2J3HA 2V65A 1M6WA 2CNBA 4IXTA 4MOWA 3QWFA 4GSKA 1DIAA 4BO8A 3FRJA 4YJGA 4IGEA 1M67A 1HE4A 4EJMA 2JAHA 1Z75A 3G1TA 2NUAA 2VCYA 3M2TA 1LUAA 1JAYA 2B69A 3VKUA 4IQGA 2B4RO 1VI2A 4G2NA 4D0RA 3QA9A 4L74A 4I9HA 1QYVA 4JBGA 5IZCC 2GCGA 2GNAA 4OH1A 4HFMA 2O3RA 2ZB8A 3N7UA 1N2SA 3RJ5A 1U8XX 1J0XO 3O8QB 4NR0A 1KYQA 4P8RA 3H2ZA 1N5DA 5THQA 1SPXA 1GR0A 2J5QA 4LK3A 1XKQA 5T64A 1WMBA 4GI2A 1PZFA 2AQIA 1RKXA 1WZEA 3S2FA 1CQJA 3ZV5A 1CRWG 5TNXA 3K30A 3HG7A 1PU2A 3PP8A 2OXIA 3NT2A 1ONPA 2BLLA 2BFPA 4GGOA 1NYTA 5AOVA 3PVZA 5B4UA 3HDYA 3PQFA 1IE3A 2I66A 5JAZA 5I9NA 4L75A 1X7HA 2EIHA 3ROMA 3BTOA 2D5AA 4NU6A 3RI3A 5BR7A 4LVCA 4S3MA 3HDQA 1NWHA 3K6JA 4A03A 3K9QO 1PGNA 3OEYA 1KIFA 3PI7A 1V6AA 2UAGA 4UVDA 2NACA 3RFXA 1ID1A 1DLJA 1W8DA 4BMVA 1JU9A 4EUFA 3PXXA 3ROKA 4R3WA 2VNAA 1PJ4A 1ADFA 5T5QA 4CQLA 1A7AA 4P4GA 1P1JA 1N9GA 1R4MB 1TLTA 2UYYA 4FOOA 5EQFA 2WD7A 3DBLA 3Q2IA 3NUGA 4XYGA 2P9EA 2W2KB 2DM6A 3U4IA 5DNAA 5CEJA 1Z45A 3RUAA 1XDWA 4YT8A 4YJDA 4BKRA 1Q2XA 5A4DA 1NASA 2ZIZA 3JQDA 4NIMA 4D3FA 4XEHA 3A14A 1DJQA 2PV7A 2X0NA 1LQUA 3I23A 5JY1A 4BNMA 3CMCO 3AI3A 5A9TA 3WIEA 4UVGA 1W4ZA 1FDWA 1Q7GA 4GWKA 3I52A 4Y67A 3PGJA 3TZ6A 1U7HA 5B1YA 2J3JA 5JDIA 1SEVA 3EY4A 2GD1O 4HADA 3Q6IA 5AQ1A 2CY0A 1JN0A 2WD8A 4XRGA 5TJHA 2EW2A 3DC2A 1EDOA 2Q99A 3D4OA 5EQDA 5JDCC 1KEWA 1TT5A 1S7CA 1F14A 4Q3DA 3HUDA 1I2BA 4J9VA 4CL3A 3M1LA 4CLRA 4U0JA 3MJ4A 4WASA 1UJMA 2E48A 4NDNE 3VH1A 3FD8A 4JXKA 5MDHA 1MG0A 2C20A 2CVZA 1ZK1A 3AOGA 1BWSA 4RVSA 5GZ6A 4HWKA 4I08A 1MG5A 1AN9A 4W7HA 1BG6A 2LDBA 3L77A 5KKCA 5JAIA 1R66A 3JQ7B 3HFSA 4J7UA 2G1UA 3WOHA 1VL0A 5HWSA 2C59A 4IIVA 4LVUA 3D3WA 4BNHA 5L40A 2AA3A 1OAAA 3FWNA 5TF4A 4W6ZA 3UAGA 2C29D 3E5MA 3IP3A 1VRWA 4ALNA 2YY7A 3QP9A 1I8TA 2YYYA 3QV1A 4MVJI 5KJCA 1XIVA 3RUDA 4DIBA 2VTDA 3GFBA 2QX7A 1F17A 4R1TA 2E6UX 3GZNB 4OOFA 1NWCA 6ADHA 2NNLD 2FP4A 5KCZA 4AFNA 1HTBA 2QYSA 1OOEA 3P5SA 3QVTA 1ISGA 4HBGA 4NHEA 1H6AA 1T4BA 4JLWA 4XZ3A 5KWEA 1ZSNA 3OQ1A 4GKBA 4QEDA 4A26A 4ALKA 3PJGA 4RPLA 3D5QA 1P9LA 5K6AC 5K1SA 3WMWA 1RJWA 3QLJA 1Q1NA 4OL9A 4ONEA 4JNKA 2YV1A 3VVCA 4OXNA 1MA0A 4J4HA 3KLPX 1C0KA 3KB6A 5F1PA 2E37A 1GQQA 5G2OA 1GZ4A 3T7CA 4D3SA 3IQDB 2VN8A 5JAMA 3NT4A 2X8LA 4XR4A 3MWEB 2GZ2A 5B37A 4UEJA 3S8MA 5KIAA 4DUPA 5IJZA 5DULA 2DAPA 2C2YA 4UEOA 1P1IA 1KVRA 4XCVA 1ISHA 4PCVA 4H3VA 2D0IA 4ND4A 4HXYA 4PVDA 2DU8A 5A03A 2GASA 3DMTC 1AGNA 1UP4A 1HDXA 3FPLA 1LRJA 2W8ZA 3ST7A 1DIHA 2WYWA 4BO3A 2GR9A 4OQZA 4DYVA 1P3DA 2QRJA 4GWGA 5K0ZA 4Z3DA 4CM6A 5JXWA 4NJOA 4DBVO 5KNLA 3I9LA 4E0BA 4IDEA 1E5QA 3IP1A 3DFZA 3R0IA 4YT5A 2QQ5A 2ZYAA 1EQUA 2AMFA 3L07A 4E2WA 2VZ9A 2XF8A 3FTPA 1DXYA 1NR1A 4GL4A 1PGPA 2FPGA 5CDGA 1LDYA 1J6UA 1MLDA 4M49A 4WLVA 4XYBA 3E6AA 4EUEA 5IN4A 4IJVA 4AVYA 1PS8A 4ALLA 4L73A 1P31A 2R00C 3RFTA 2W2LA 4QO8A 5C5IA 1NVMB 3PLRA 1HYHA 3RBXA 1WMAA 1DB3A 2WMDA 3UH1A 3VH2A 3VHRA 3RU9A 2FZEA 1ZVMA 3SXPA 3K8ZA 1CF2O 3H5NA 3HB5X 3UCXA 4OAQA 5CDSA 4IQ0A 5I7FA 2VNSA 1NVGA 2IYOA 5L7YA 1GADO 4IIUA 5FI3A 2YDXA 3PHIA 3ONEA 3ICPA 3TF5A 1V3UA 1LC3A 4PLHA 4ALJA 3F4BA 3WNQA 4RDIA 4CM4A 3NAQA 1UZNA 5CFZA 3JTMA 3ADPA 1V35A 3UN1A 4CMCA 3C24A 4N5MA 4E4YA 2EP5A 4Y8VA 1DRUA 4BNWA 3FBGA 4IXWA 4K26A 1KVTA 3JQAD 4QTZA 5HM8A 5IZCA 1PQWA 4W9NC 1ZSVA 5EIOA 4RVHA 1O8CA 2YHIB 3ZW9A 2NVWA 4TQGA 1M2WA 4R54A 4E33A 2X9NA 1JKFA 1YGYA 3K96A 1B8UA 1VJTA 4YJFB 1QORA 3U09A 2I6TA 1U3UA 1C1DB 3LC2O 4RF5A 3VPXA 1IL0A 4BNTA 3RKUA 8LDHA 3PHGA 5IN5A 3O38A 1LNQA 4MVJG 4D0SA 3K73O 1PL8A 3KSZO 3WX0A 5KTKA 3Q11A 3AUUA 4RPKA 5JLAA 1NQ5A 2VRBA 1BGVA 2WEKA 2ZKLA 3FR8A 2EKQA 3KUXA 3PWSA 4NG5A 1T25A 2O2YA 5DN9A 1ZFNA 3UHAA 5JC8A 1CERA 3KYCA 2PD4A 1ML3A 1JA9A 2HAEA 5T6BA 3VDRA 2PH5A 3DZHA 1MXHA 1SCUA 3FNEA 4DVJA 2I5PO 3KBOA 1EK5A 3VH3A 3OMLA 5JCJD 1YH3A 4QFCA 3ZU2A 3H65A 1Y8RA 1X0XA 3EMKA 4CLOA 5JBIA 1XHLA 1F12A 1UR5A 1NAHA 2GZ1A 4YDRA 4OYRA 4WK6A 5LC1A 1S6YA 4J4TA 3WGQA 1JQBA 2BFAA 2Q49A 1U5CA 3D3EA 2CD9A 1GPJA 3RFVA 3IKTA 4FW8A 1PS9A 2B0JA 4WOKA 4R5HA 1KERA 1DAPA 3DL2A 1DC6A 4IDCA 2HMVA 2JFHA 3GY0A 3HJAA 5F21A 5U1PA 5KJ1A 1HT0A 3ETGA 5G4KA 5CG2A 3R3JA 2O3JA 1KC3A 4IS2A 2DVMA 3KEOA 4J1TA 1UZLA 3F46A 5IXYA 3MJEA 3BMCB 2A35A 4J1NA 3NJ8A 2PTGA 4G5HA 3BYZA 1E7WA 2DLDA 4IDDA 4K9DA 1Q7CA 2IZ0A 1KS9A 2EXXA 1SO8A 3NV9A 3WWYA 3GN1A 1R0LA 2DUUA 3FR7A 4NBWA 3OJ0A 2G17A 2HU2A 4IZHA 1LLCA 2WYVA 2HK7A 4I9NA 4WUVA 1SBYA 1E6EA 1NP3A 4W82A 1PZGA 2HSDA 3L6EA 4WLUA 1IZ0A 3STHA 3MJTA 4IJUA 4BMNA 4NNJA 4WOJA 2E4AA 2VWQA 4ROSA 3O8QA 3TNLA 2PR2A 4RVGA 4MVJD 2DC1A 1DRWA 4PLYA 2OO5A 2PZKA 1UZMA 3KYDB 4II3A 2J5RA 2CDCA 4LRSB 2J8ZA 3R6DA 2PWZA 4CM3A 1HYEA 1ZK2A 3FWZA 1E7MA 4R5MA 4BQPA 2E82A 4OO3A 3JQBC 4XJTA 3WMXA 4Z0HO 1UXGA 1C0IA 4IY1A 4QO7A 4I5FA 1P74A 1GPDG 3KEQA 3NGLA 4F6CA 1GV0A 1YJQA 1DHTA 2P91A 2IRWA 3GNTA 4CQMA 2XXJA 1ENYA 5DZSA 4E5KA 4EYEA 4CR8A 3ASUA 1E3WB 3CINA 3ANNA 1U2DA 4H16A 4LSMA 2CMDA 3EVNA 4Z6KA 5K6AA 4FIZA 3H9JA 3U62A 1EUDA 1HETA 4M1QA 2D3TA 4IDAA 1ZMTA 4HFJA 5HS4A 2GZ3A 2AXQA 2NTVA 1MC5A 4EDFA 1T1SA 2ZTLA 3KSDO 3GRKA 1SC6A 3RKRA 2YQ4A 2SCUA 2Y93A 4JX8A 2W2KA 2C7VA 1GCUA 1VE9A 4J90A 2HK9A 1LU9A 4XB1A 3QVWA 4DQXA 2GSDA 4FFPA 4RGBA 1WPQA 1T2CA 3IAHA 1WP4A 3P19A 1YBAA 3V2GA 4PN3A 4K6FA 1P1FA 1XCBA 1T2AA 2ET6A 4BNVA 1BHSA 3AK4A 3NTQA 4ND3A 2JFGA 3DMTA 3GNSA 5DF1A 2X0JA 2GN8A
chains in the Genus database with same CATH superfamily
1UFQA 3WYBA 3D7KA 5E1OA 4G0QA 3AEYA 5KQGA 1GPBA 5FOXA 4MRRA 4BBJA 2WIDA 3OTQA 5C32A 4HG2A 4R2KA 1KDTA 4JIMA 3ZCRA 2WE8A 3GLHB 3ZXXA 1C7JA 2G36A 1B6GA 2DOKA 3H6KA 3K6SA 1M0TA 2X1MA 4YR9A 1JAIA 5CX1B 1KMHA 2EZTA 3K0HA 3KOOA 1AXEA 1MX5A 1HDOA 3PWTA 4RGVA 3REQB 1N5JA 2V6GA 3NOXA 4BB5A 4JC5A 3E84A 2G9RA 3AZQA 4UU0A 1DAOA 3KDSE 4PYNA 4Y2XA 4CODB 1Z2OX 1FSSA 4D4KA 3QVKA 5ADHA 1E2EA 1NN0A 1N0VC 1QFYA 4G0XA 3HWWA 4IQ8A 5KJFA 3EIOA 3EN0A 3VU9B 2P1DA 5B7NA 4CM9A 1DQNA 3R7FA 4HB0A 2HTFA 4NBVA 5K4AA 3OURA 5ALOA 4E13A 3SQXA 5L3VA 1BD3A 4W4TA 2G40A 2HPVA 4PF1A 1V5FA 4BASA 2WA2A 2C00A 2VQFB 1TF7A 4D96A 2OUIA 4HYYA 4N3GA 1RJDA 3DSRA 4Q05A 7ABPA 3JYLA 3QE9Y 1QWOA 1IAVA 4N18A 4PAGA 5I9MA 1NPYA 3DWEX 3ICWA 1QGOA 4M1KA 5FNVA 3UK1A 4KLNA 1F38A 2AV6A 5CVTA 1Z2NX 2AZXA 2REXB 4R81A 3ZE9A 2NO4A 1SVSA 1WCYA 5JRZA 2PLWA 1CVLA 1YMUA 3N1UA 4GNRA 4JDUA 4X92A 4AMVA 5BRJA 2OESA 1NP7A 1FRZA 5CNIA 1H2XA 5BVGB 3ZC3A 1ND6A 1NQVA 1VXRA 4DCGA 3QEBZ 3OBIA 2V5VA 3C70A 1NMSA 2R5WA 3TR6A 3D2AA 4OUDB 4N5DA 3NTVA 3LUFA 3N8KA 4DWVA 2ZQZA 5B4TA 4HQKA 1Y8CA 1RMQA 4QQRA 3VQTA 1CUYA 3V4PB 4AD8A 4CL2A 1A9XA 1SH7A 1LNZA 1FRFS 1SBHA 2LPMA 3CNBA 4Q34A 3ETLA 4TQAA 5EUMA 2IE8A 1M5TA 3T5DA 1O5TA 3B5EA 4FE4A 5DXJA 5JSHA 1PWYE 2A1UA 2BKAA 2WG2A 1ZJWA 2C8VA 3EARA 3QFCA 5CPFA 3X43A 4UXIA 1LLFA 6YASA 4YIHA 4Q7QA 4F06A 3SLRA 1LTQA 1U1CA 2VIIA 4JEUA 3SC4A 5CD9A 4AN1A 4MHTA 4JT2A 1JXAA 2YXNA 4YS6A 1ZMOA 4Y9DA 4TKZA 4JR1A 4TS4A 1G6Q1 1IUNA 1AQIA 3BEOA 3N9IA 4ER3A 2PPLA 3PA6A 5EVJA 5DGHA 4WOPA 3QPWA 3UMCA 3O8BA 1ID8A 4LJRA 5DP2A 1A2BA 1C3LA 3PYLA 2BGUA 2J9YB 3AUKA 3TDKA 3V8PA 3X1ZA 2OV8A 1DC3A 1AKNA 1WO8A 2HSWA 1KMIY 2OUKA 3D54D 4OHPA 4OQPA 4PE5B 4PX2A 2QK4A 1RXCA 2V59A 3H5RA 4I2VA 2GBCA 4NL4H 5H4HA 4WY8A 2I2FA 3ISTA 3NQ41 3LG2A 4FXOA 3S2YA 4BNDB 2JB9A 4FUQA 4IGKA 2CCJA 1IOLA 4ND1A 4FDUA 4DHWA 5DK4A 1RFGE 2C4KA 2FMKA 2VRWA 3GH3A 3TCKA 1WCXA 5FO0A 5I7EA 4AQ7A 5AXCA 3MGCA 3PJDA 4BFYA 2LV8A 3GP8A 2NMVA 4M1OA 3V1MA 1H1LA 1IXKA 1YAJA 1HMPA 1OU0A 2IIVA 2O2GA 2AEJA 4MLPA 3OJCA 5GGXA 3ZOKA 4BZWA 3NDBB 1LPPA 2P6NA 3VSEA 1QQTA 4DLTA 1Y3BE 1R6DA 4G97A 2Q6OA 4R40A 4RHYA 3DOEA 3CUSA 2W6ID 2Q0XA 2CBXA 1HBJA 3DQPA 3DXXA 2HLPA 3QNMA 4Q3EA 2XKKA 3RADC 5LQAA 1A5BB 3H9QA 3MQFA 4OMDA 2CLIB 2FFRA 4LGMA 1Y48E 4RLHA 4XWGA 4UPEA 4Q4CA 3CRQA 1U9ZA 1GAQA 1C7RA 4GQAA 1H05A 1T4DA 2LBPA 3EA5A 3Q3GE 1D2RA 2JKZA 3GELA 1P7YA 4PLCA 2FE4A 3GGDA 1I0ZA 2ASVA 3I5AA 4J7CA 4X1KB 3IB6A 5BXYA 3DNMA 2BE9A 4RDHA 1FL9A 1MB3A 5ALQA 2P9YA 1B7GO 2FFBA 1EJBA 1NLMA 1CUXA 4H3SA 4TM7A 3GUUA 3EIWA 4BVAA 4EEZA 5IEJA 3QWBA 1OA1A 5K1ZA 3STVA 1PJSA 1Z29A 1A9YA 4MVXA 4QELA 2BVNA 3C6KA 3KZXA 3R7LA 3GMDA 2ZTSA 1OC2A 1RAAA 2D8AA 3R41A 4YDQA 4G37A 2QPTA 1IRXA 2DUWA 4PM4A 4RVDA 1AX9A 5DB4A 3IUQA 4QTXA 4EB0A 1R27A 3GD5A 3S2GA 2PUWA 1I5RA 3TTSA 4WIAA 5I47A 4CM7A 1O96A 4BVHA 3T9BA 1B3BA 1QYWA 1V7ZA 2BI7A 3INRA 1YBHA 2O7RA 4HYEA 3KZMA 5SY4A 3R0XA 3W6UA 4BNGA 3JZFA 1A8QA 4LKOA 2XBUA 3B78A 1BE1A 1YUMA 3QVXA 3WQRA 2DBQA 2I22A 4E3ZA 5LZ9A 2QZPA 3PNLA 1TOAA 2V45A 4XB2A 2JAPA 3QG1A 1S8OA 3O7WA 1KR5A 4HUQB 4M8SA 1OWOA 3WLTA 3ZD6A 3N76A 4Q3CA 1NNLA 3D6TB 1V5EA 3LF1A 4QUGA 4G6ZA 1CJVC 5HJ2A 2A0KA 4CPDA 5C4MA 4JI5B 4K88A 4JASB 4NV1A 5KJEA 3PFHA 3W2HA 2A9OA 5KNCH 5LNK1 3AFHA 4EUKA 2R66A 4LHZA 4KQ1A 4M83A 1TZ2A 5DCUA 1RE0A 1O94A 4IKPA 4RSMA 3NYWA 3OZWA 1DG3A 4XM2A 1JMVA 4M22A 1SOAA 4L2IA 1TMKA 1KBZA 1ZI6A 2GVNA 3DDCA 3BTSA 4IL5A 4UARA 3JQAB 3FBWA 5AK0A 3VM6A 4DDVA 1K86A 7GPBA 4EG7A 3T3EA 2C4TA 4CI9A 3OPYI 4H6PA 1H6DA 1GLVA 4UCFA 5EJ4A 4RQBA 3WHKA 4IDFA 5GOTA 5C3UA 1RRKA 2ZPAA 4TRMA 5EKSA 2J6IA 4B1FA 6LDHA 5I7SA 1V3QE 5C7LO 4MGIR 3WMRA 3C5VA 5CDTA 3HVIA 4JVSB 1USIA 2IP1A 4OREX 4DV4B 4EQ6A 2UYCA 1KP9A 2PMCA 2F48A 4B6PA 4NZPA 3JD2A 1H0KA 5IDYA 4AECA 1H23A 2C5AA 4CHGA 2FXVA 3ZZNA 3OZTA 1ZXXA 4ZZ1A 2BEVB 2MDTA 1E5TA 4JKYA 3OP1A 2X9VA 2WVJA 4JVNA 3QIVA 1E1CB 4MW0A 3B2NA 1Z4KA 2ZB2A 5LLSA 2QTFA 3DT8A 1GEGA 4RK0A 4MQUA 3QA3E 2H0QA 5FBHA 1XDDA 2WPNA 1PX0A 1R0WA 5T3YA 1U6IA 3WVNA 3DGEC 2OXEA 1TMGE 5EWMA 1PKXA 5FLKA 5LB4A 4KQWA 3BJIC 1QPZA 5A7GA 4N9QA 5ILQA 4J0DA 3WGVA 4PG8A 4IOJA 5ALSA 4BATA 4RVOA 5ILGA 4LN1A 5LFAA 3UC9A 3V4RA 2VZ0A 2A9JA 3OCYA 4JLNA 1ZGHA 2R3SA 1DDGA 4PYKA 1H6BA 1IONA 3KZOA 1J1ZA 2JD1A 1R8JA 3C43A 1K8ZB 1BOFA 1D04A 1VMKA 4TYWA 3ESYA 3RIMA 5A3JA 1XJCA 5AIBA 2HJ9A 3R6LA 4X1YA 2GTPA 2LCFA 4MPTA 3SXJA 1GZUA 4BBAA 2P6PA 3UG6A 4YJHA 1U3DA 1TIKA 1DINA 1Y1QA 1T4CB 4M37A 3GN2A 4RHXA 3CSSA 5MFZA 3B9BA 4YP5A 2B1JA 4DB4A 2MSWA 3PYMA 2I55A 2B5VA 3U7HB 3AR4A 2XPCA 3VTZA 2HMAA 4IKEA 5AYVA 3W2TA 2XGSA 3PC7A 4DLPA 3LO8A 4UE6A 2X8JA 3AY6A 1IMOA 1F8GA 3GLIA 1D07A 2REQB 1YIDA 4WGFA 2JZCA 4ZAZA 2HWWA 3TLAA 3TQHA 1FQJA 5KNDH 3V4FA 2LE0A 4OSOA 1OAKA 4K9KA 1IY8A 5JR3A 2ZG6A 2OG1A 1SY7A 3H9EO 3L92A 1WB6A 1GARA 2I34A 2EATA 3FUXA 4XYMA 5CTAA 2IXBA 1ZRMA 2FG5A 3IHTA 4HR7A 5HDBB 3PNOA 3P0HA 3TB6A 4L15A 2CNNA 3CB2A 1ORHA 3BE6A 4O4HB 2X42A 4ZTBA 1E3MA 1GUZA 2AKYA 1ZW6A 2BN4A 4QJ4A 5BWBA 3AERA 5K09A 2V9PA 2WP0A 2ERCA 3MTEA 3U1TA 5L9AA 2O8BA 1I32A 4MIOA 4LY3A 1VG0B 5AKJA 2BFEB 3QI2A 1N3YA 3UJ9A 1HE8B 3X2FA 3L9XA 1U8CB 2X23A 3UBMA 2V3CC 2OHXA 3ZWVA 3ZDBA 4NF2A 2D0PB 2VYND 1U7OA 1SEPA 2C2WA 4Z3OA 2AK2A 2CHGA 2QTVA 3H4IA 3IOYA 2H5JA 3WYCA 4XFJA 5JWOA 4MV6A 5HEKA 2RJOA 5CFOA 1YDMA 3DO5A 4RETA 5FNZA 4IRUB 1T26A 4KUGA 4CEHB 3Q5EA 4DLAA 1ONNA 3F1KA 4OKNA 3QNWA 4Y2VA 3OQNA 2G6BA 2J4CA 3I1FA 3ITDA 4FEYA 3B12A 4PTZA 3S2ZA 3UICA 3C8MA 3NIFB 1D6JA 1QH0A 5ITZB 5C37A 1YDGA 1SUWA 2Q0QA 3GP5A 5E1MA 3WSWA 2V98A 3AEQA 3H6HA 4HKTA 5GM2A 3PNMA 5K0JA 1QX3A 1F6BA 2WWTA 4KN8A 1Y8AA 3G2NA 4MS3B 1O95D 4QNMA 2HIMA 2I1WA 2VHWA 3T5PA 4HH0A 3EC7A 2X5NA 1L7DA 5AJHA 1IEWA 2Y1OA 3LPDA 3NJ4A 4A8JC 5JATA 5JBQA 1LJUA 1QVZA 5DYWA 4X44A 2EW1A 3TLKA 2P4UA 1OBCA 2WC1A 1QYIA 4CKYA 4BS9A 2Q41A 1MTOA 3C1AA 4DA7A 4WW0A 3WLEA 2NLOA 4WCFC 1FK8A 1KQOA 1ZRSA 1W2WB 2VPTA 4OQDA 4BAUA 2ORED 3EJWA 2I4NA 5DYNA 3I09A 4ICIA 4HNUA 3WK6A 3WYGA 1J09A 1YASA 2VXBA 3M2PA 1HA3A 5EJGA 1DC4A 2D74A 1G2PA 1E9EA 1UDCA 4AU1A 3WK9A 3ELWA 3LDAA 2VTBB 4LJ4A 3A0RB 2EJBA 2P6OA 2WNHA 1V37A 5KOJB 3ANYB 1J99A 3NG1A 3Q0TA 2BDEA 3CNEA 4C01A 2UU9B 2P2YA 1WUYA 3GLHA 4YV7A 2QN8A 1H0HA 1QHYA 4YMLA 2QM0A 2HFKA 4PZ9A 5TS2A 2R6GA 4GQIA 4KWCA 2AL7A 2JLVA 3N3AC 3NHMA 4GOLD 1WSDA 1J2EA 2BMWA 2UDPA 3OIVA 4L1KA 3O3CA 4YX9A 1TEZA 3HP1A 4ZT6A 1HLGA 1PWZA 2Q6TA 4O1MA 5CX1A 1PNRA 2P2LA 3A1TA 3QELB 4WSOA 3RS2A 3VR2A 1SA0B 3UVEA 3CYFA 1RTTA 2I4RA 1NJGA 3OEED 2OBMA 3REQA 1B74A 4ILEA 1TK3A 3STUA 2P3LA 3ZUGA 4D41A 2WDZA 2AHOA 2EGGA 2OWDA 4ZO9A 4O4JF 3E05A 2RIPA 2RGNC 1AC5A 2HCJB 3AJ9A 4DLUA 4R2WA 4UZFA 3QPUA 4FX5A 2PUVA 5B1SA 3A6GA 4MROA 1DBQA 3VU9A 1ZRHA 4IQ4A 3GJRA 4N39A 3W8FA 2ZT6A 1X6VA 3DONA 4JB2A 4MO9A 4PQEA 4DM3A 1V4VA 1EFAA 1KIMA 1IATA 2GAFA 3U3MA 1JJAA 2X7JA 3KWLA 1ICIA 4C6RA 3F74A 1YR9A 2X58A 5BURA 1NF8A 2VPWA 3TXYA 1AG9A 4ML3A 3IMGA 4IHQA 3ICOA 2EWWA 2C3PA 4Q00A 1DEHA 4OHWA 2WIKA 2ZRCA 3AHIA 1CRPA 3BZWA 3E7XA 3PJFA 1OXXK 1FXWF 1JEQB 1ZHHA 3DPSA 4HK4A 5LP6C 3G2LA 3M8KA 2HPHA 5AOAA 4ATNA 1PLJA 1A9ZA 2BE7A 1ZW1A 4PWYA 2FN9A 2M98A 5FH9A 1NQTA 2PKQP 4DT1B 3LQKA 4CXMA 4ZC1A 3KOWA 4XVUA 1NVKA 2XUJA 4MKXA 3LBFA 1NE2A 4X3PA 5BVGA 4I4TB 5AFSA 3VPSA 1SU8A 1BMDA 1YB1A 2VOJA 3K09A 5DIZA 2PA3A 2PO5A 1I51A 1T3ZA 2VPYA 4OY3A 3COZA 3GZ4A 4MKHA 4OUDA 3TQIA 3ZK7A 4D9JA 2V7VA 1DC5A 4URVR 5C8ZA 1EXVA 1GQRA 1K8XB 1VC2A 3D6MA 4A8PA 4BIIA 4N0DA 2OG2A 3W7AA 4AB1A 3T5CA 5BSRA 5B3KA 3ETDA 4GEGA 1N0UA 3I2JA 3RTBA 3RV3A 1ZCZA 1OX6A 1VL5A 2XDWA 3OEWA 5FTJA 4QG3A 1QU3A 3O1IC 4L4XA 2QRHA 1XMIA 3OY2A 5L4LA 1YQ9A 2A84A 3KUKA 4ZAFA 1YV9A 2H06A 2P3QA 4V0OA 1WUJS 4S1WA 1CRLA 3O47A 2Z6QA 2WWHA 2X19A 3MT9A 4RCZA 1XRNA 3M49A 4XJXA 3T3MB 1QMPA 2ZJZA 1SZJG 4CIXA 2FU5C 4QRDA 3KFXA 1KFJB 4O2AF 3T1YB 1X1SA 3I2YX 1I7LA 4P3XA 2J4DA 2H11A 1D8AA 1VE3A 2VWHA 5CM2Z 3H99A 4A0GA 3DVRX 1G0OA 3O9MA 2QRLA 5COAA 1BS9A 1K7EB 1RKVA 1TCCA 2C1XA 3NU1A 3SZ3A 5FT9A 1A8IA 1KK2A 3T1NA 3ABQB 1D7OA 1Y1SA 4BNDA 1Z4PX 4BRUA 3NTLA 2Q5JA 4PC6A 1Z0SA 1OH8A 5DX8A 4RENA 2PUEA 2XUHA 2W0MA 1SXJE 5JTTA 3E3NA 4CLXA 3ZGXA 3IBSA 1ZZEA 4EELA 3MMSA 4QPCA 3U7QB 3AF6A 2JK0A 1THZA 5DGDA 3K05A 3UK2A 4ZO6A 4I4TF 5MGNA 5GZ3A 1SBIA 4R2JA 2G9NA 3K1ZA 3ODPA 4OXYA 1RRCA 2R7MA 1X7XA 3CSUA 1YVDA 1E2NA 4JLBA 4LDJA 3STWA 2OYSA 4NE7A 4HQFA 4YLYA 3MYRA 4V0KA 2ZOSA 3CRRA 5AT1A 4V0ME 4NMLA 3UY4A 1DEXA 3ZHQA 2A3NA 3AVOA 3B7WA 3BE4A 2GWRA 1PJ3A 2X7XA 5D01A 2CYAA 3EH1A 4ZO7A 3WIDA 4B7UA 4CLEA 4Z7QB 4FZ3A 4A27A 4AWAA 5IDWA 3ZYZA 3ZGVA 3C5EA 1Z5NA 3FJOA 4X1KA 3DH0A 4B4KA 1M6HA 2HHJA 4QT0A 3WZ2A 5F1OA 2V3VA 3MJHA 3CVYA 3N53A 2EW8A 1ECFA 4G1EB 4C43A 1IOWA 4RADA 3ZKWB 4H59A 4Q3LA 4TWRA 2O7VA 1KFBB 4RESA 4ZVTA 3SS8A 1Q22A 4N48A 1HDRA 5GMOA 5CM9C 3H84A 2ZBVA 3RSLA 5LVAA 4BUJA 4JENA 3AVTA 1P44A 2WHYA 4BO1A 2PZLA 4FFOA 3U3DA 1HEYA 1IDN1 2AF3C 2AF4C 1CLUA 1Y42X 4GX1A 1SGWA 3ROEA 1ZA2A 4KC0A 4CG0A 3ZNNA 3IVCA 1HGXA 4L8VA 2GD0A 4F46A 4BX9A 3S2EA 4AUNA 3HB9A 3PNVA 2IYPA 2GPWA 5LNK6 2O6LA 3OP4A 5JJBA 3KJNA 3U4QA 4RE5A 5A4FS 5L3QB 2D54A 3RSGA 3MB5A 1EA7A 2B98A 3C5CA 3EDMA 1K4MA 3WWDA 2JRCA 4V0SA 5JSKA 3ZZTA 4RZHA 3F97A 3WGGA 2HOQA 2N75A 1EXWA 1J8DA 1ZD1A 2QB5A 2V4ZA 3LCUA 3ZJ4A 3NYIA 2WMOB 1ABFA 2V6FA 1P17A 2FNAA 1MCZA 2QL5A 4HUQA 1R9MA 3VZDA 4BGEA 3LL7A 2ATCA 4ER7A 3TOCA 2GSWA 2WSBA 1TDJA 4RHUA 5AW5A 3UPUA 4CL8A 1CYEA 5BORA 1UUFA 1YOBA 3P5BA 1WD5A 4OBWA 4EENA 4WKBA 4DV0B 3E15A 3FLAA 2FF7A 5IFLA 5IK2A 3ELYA 3AI1A 5F2KA 5JRJA 4BGDA 1RRFA 2NSYA 3GFSA 5D7NA 4HHEA 4RK4A 1MHTA 3UGKA 4KR7A 4AG3A 4WKNA 5D3KA 4KJXA 5LMUB 3JQAA 4WOCA 4HMPA 2WW8A 3OIYA 4JHLA 5A3RA 1WEHA 2XMSA 1H4QA 2ZTUA 4L8LA 5B36A 4UFOA 5I6DA 3P1JA 4QECA 3ZX5A 3I2GA 4AUMA 1ISMA 5CB8A 1SBCA 5A2GA 5JMPA 4B2YA 3LVFO 2H00A 1SD1A 1E79D 1SBTA 5CK5A 3GLQA 1DCTA 1VIMA 4RF2A 4W1QA 1HDZA 4XFKA 5KI6A 5K8CA 5H83A 1CUJA 4DLBA 2C07A 3UXMA 1CS0B 2WM9B 4FKZA 4C6SA 1MHPA 3FSRA 3KM0A 4LY0A 2PRJA 3IOMA 4DM7A 1CSEE 2FPGB 1XQXA 3B5IA 1IFXA 3IMKA 4J6FA 1GTSA 2BEVA 3MUNA 2OCLA 3NH6A 4P3PA 1BDBA 3ZLJA 1IDOA 3R75A 1IM8A 2O50A 3KRTA 3GUHA 1E1CA 4GG1A 3M7IA 3T1HB 3U61B 1ZH6A 1BO6A 5JO0A 2CMFA 2WUGA 3VPCA 2IUUA 1DHRA 3LUCA 3RAPR 4MV8A 3VMFA 3IPCA 2B94A 3BFJA 3E1KA 4HVLA 1BDMA 1Y8QB 3ZV4A 5AHRA 2DY1A 4HWTA 2IYWA 2PM8A 1UWLA 3I73A 1EUYA 4K81B 2FV8A 5I8ZA 3T54A 2YBEA 2IYAA 2VUIB 1R4NB 2YZNA 2A5YB 5FPTA 3BD9A 5TPZD 3RAGA 3PR1A 4L5JA 4D81A 3U4MA 3D1VA 1JHOA 3CG4A 4XWKA 4PGMA 4FI3F 2TMGA 4QE3A 2AZ4A 3BF7A 4GBMA 3ZE6A 2GYYA 4D9IA 4PLVA 4P32A 4N12A 4IINA 1RAEA 1HDCA 1T0UA 1LEHA 2B8NA 4UZEA 3PEVA 1UBUS 2GXAA 3NBFA 4OK3A 3QJGA 1FP4B 3L7DA 1T4CA 1EGAA 1Z7GA 2JAWA 4U6SA 4UM9D 1LK5A 2FUKA 3B6MA 1BXGB 1I3MA 1LD3A 1NSYA 3CUTA 3N5KA 4N1AA 3EQZA 3SGLA 3ECAA 1ESNA 4YRFA 3PC6A 2BI8A 3O74A 5ALLA 2ZR7A 2IHJA 3BORA 4DDTA 1T3GA 4RD4A 1R37A 3NEPX 1OE0A 4EL0A 2CJWB 1B3RA 3KZCA 3TIGA 1W6RA 3QF4B 4DA4A 1MO4A 2LGJA 2NP7A 5DJ5A 2ERXA 3QMVA 5T64A 2V97A 1XTTA 1JZQA 4M1MA 3ZDRA 2REQA 5CB4F 1EGHA 1AHNA 2PLAA 5MFPA 4PCAA 4QVKA 3DKIA 3KV1A 4IO0A 1RHJA 4TS9A 3UUGA 3MCZA 1EZ4A 3G88A 1WAMA 1RQNA 3EZYA 3D7LA 1ORVA 1EUCB 2MMGA 3K9GA 3M6WA 1JQ3A 3H5OA 1QVVA 5FO1A 4R1UA 2VAXA 4FCCA 2UXDB 4YT4A 3LPLA 2I9KA 1VPTA 4UASA 3T4PA 4ON9A 1MPTA 4YA6A 5T41A 2QRUA 1JT9A 1LA2A 4P93A 3URMA 4O4HA 1S01A 5A06A 1OB2A 1UJ4A 1K7SN 2P9FA 3G79A 3OICA 3RSCA 1K27A 2NQTA 1WQ4A 4G23A 4ZVOA 2Q5EA 1FDSA 3ANMA 2TRSB 4UAJA 2ZRFA 4MVJH 4TGLA 3R44A 4BWYA 3HXMA 1DJMA 2O5VA 1GY8A 3C15C 3HWRA 4CCYB 2BFEA 4RQUA 4EFNA 2H51A 2XR1A 4ZI7F 1T1GA 4G01B 4BMDA 1BCSB 1KEZA 4LX8A 5IAGA 3SX2A 1BWQA 3GC6A 2CYCA 5HQTA 3G1UA 2WWYA 2RGXA 4YRDA 4B85A 5JXJA 3K6RA 8OHMA 4QOJA 5JMOA 1TEXA 1NVAA 3OLXA 5GVRA 4MVYA 2YVLA 3TD6A 4ZV7A 4RZXA 1YQWA 2FR1A 4FYIA 1DMSA 1QXSA 5ALMA 1IB6A 1MOQA 1ZRNA 4DY4A 3E3AA 3EODA 1CKEA 3X1YA 3ZQ4A 4QOEA 4CEHA 5KSPA 4A0QA 2C0QA 2X8AA 2BFMA 1H6CA 4UQOA 4IP0A 4RFSB 3OQBA 3DL0A 4YMWA 5A5FA 3W3AD 2PU5A 2FFQA 2ZWIA 4JOCA 4X93A 3WNDA 3SS7X 3QX7A 2NZ2A 3WIVA 1PBNA 4OYHA 4JB0A 4OBXA 5ITZA 1QQAA 4E2FA 1GGHA 4W5QA 4R83A 1W1UA 4FFSA 4F60A 2NP6A 3HWSA 4QKQA 4MS3A 3HA3A 3L0CA 1IQUA 3TQOA 4E07A 4URXR 4MICA 4BNXA 3QUBA 3QWHA 4M7OA 5EJ2A 3SJAA 4EK9A 2INGX 1NW6A 1B43A 1YK0A 2QAGB 2ZBGA 3KUCA 1GUYA 3PEUA 1C0LA 3QUSA 3T0GA 3FYTA 1FXWA 1T8PA 1SU6A 2ES4A 1MO3A 3IHWA 1I7NA 1Y5IA 3Q3EA 4LEIA 5HIMA 2IV3A 4CM1A 4D44A 1KZ1A 3CS3A 3CLTD 1YR1A 3L5OA 2H1SA 3AM4A 2CGEA 2F59A 4U5QA 4I81A 5DCYA 5ITVA 4U6NA 1RBMA 2PGXA 4HQ0A 4LC9A 1N7HA 1ISSA 2VDJA 5KYGA 2I7DA 3COYA 1GG2A 3CRW1 5E9AA 2WK1A 3IJPA 4DR2B 1CUSA 1T8YA 4G0YA 4L5YA 4GXNA 1I6MA 1ZNWA 2GWHA 2I3GA 3ONWA 4HWPA 2IX9A 2BGLA 3RS8A 1Z8DA 4ZQCB 2AZTA 5KOJA 2II6A 1EQ2A 4HF7A 1KDPA 2R6FA 1T9GR 1N7IA 2BD0A 2QSJA 1B93A 5A5EA 4DLLA 5KSZA 2Q2QA 2DR3A 1R0CA 2EWMA 1QK5A 4Y2SA 5A4KA 2H4ZA 4BV9A 1M6VB 2RHCA 3NTOA 4N82A 4BU0A 4MWCA 2DFLA 1Y3AA 2XB9A 2FFHA 6Q21A 2D5CA 4IGFA 4KK4A 4H1WA 4B4VA 4UQLA 1ZNXA 1W36B 1N1MA 2P4HX 3T1VA 1Q7EA 2PS9A 1QF9A 1ZD9A 2FYTA 2OQRA 1KQPA 2LD4A 2ZSJA 3GVIA 3DFUA 1PK9A 3ND8A 4NU5A 1IZZA 4K9LA 3G9QA 2OA0A 4PAQA 2B2NA 5F5LA 3RBZA 3RCBA 1FW8A 2CUZA 4WE3A 2QX6A 3GBSA 1B76A 4CMIB 3IMEA 3FOFC 4DUGD 2IBSA 2HIGA 2H2IA 4UOEA 1E59A 2YC2C 1LFAA 3U3RA 1T6BY 4G41A 3QIAA 3NBKA 3LRTA 3RRJA 1FFYA 1AKYA 3TUJC 3M83A 1B16A 4OA8A 1MFPA 3E58A 4EMSA 2OCIA 3GGGA 1CPYA 4P38A 5F1YA 4YXFA 4NBLA 3GUYA 4ZHQB 4GI7A 1S02A 1KNQA 2VPQA 4GOND 4K6OA 5FWNA 5L7WA 4ZTZB 2M6RA 3TW4A 5E6SB 3GPCA 3W6OA 2VQEB 2VUHB 2FWAA 1JEQA 1DTEA 3K9BA 4S12A 3WLIA 4H4EA 4ID9A 4QYSA 3LF2A 2VSNA 4QDZA 4B80A 2JLBA 3D7MA 5CDYA 2EX0A 4PPGA 3OTOB 1PIWA 2HMSA 4IIEA 3ZY4A 3S6JA 1I2MA 2K4MA 1G9XA 1H65A 1O97D 2XW6A 3JQBA 3WYDA 4I4TA 3NUQA 1LZLA 4GOOD 5KHLB 1ENZA 4I8XA 1U8UA 4CTMA 3WGIA 1WXXA 4GSYA 2AW5A 2I3DA 1XQVA 3OX4A 4IIDA 5D5PA 1PT5A 4DUZB 1OHHD 2JA1A 3QU5A 4PC2A 4UUMA 3QOYA 1EVZA 4Q9KA 1V3VA 4GDMA 5AM1A 1GRNA 4E15A 2AE1A 3UFXB 4GWLA 3A6FA 1X80B 4KUHA 5C7OO 1EFVB 3H2SA 1TU0A 4FBMA 4AM8A 1JEOA 2YX1A 3MSCA 1DXHA 4B3XA 1FNBA 4BPRA 3WGZA 1AS2A 1B2RA 4MRPA 3ODGA 4XGIA 1J22A 3L0ZA 1KWKA 4D42A 1PUJA 5FORA 5DMHA 5J4LA 4KTTE 4FBGA 3VNSA 4PSUA 2OLKA 2O2IA 1KMCA 4JJ6A 3A9WA 2O8FA 5HZMA 4A6EA 1XTSA 4DSAA 3EX7C 4NOKA 3GCZA 1OZAA 3HRHA 4MRAA 4BWGA 4CG1A 4QYMA 5HUHA 3DLTA 3SY8A 4ZT2A 3DR3A 4NMHA 1B42A 4Q9IA 1PHRA 1Y3HA 1JHUA 2QLFA 4KPEC 3OPYB 3N2GB 4FYJA 3TNJA 3ULKA 3UF0A 5K8TA 2QOEA 5MHTA 2ZIVB 1ES9A 1RM3A 4XIJA 4YQFA 2YIJA 1PR5A 4LHSA 3RG2A 1XK6A 1K8RA 2D2IA 1GYQA 2P67A 1J8VA 5F4ZA 5FLEX 3MT8A 4C07A 1OVGA 4RHCA 4ZHQF 4B0PA 4Z51A 3IE0A 2NO7A 3N07A 4XIIA 4ZU6X 1LVGA 1OPXA 2XMRA 2CFCA 4GQBA 4NZOA 3OEHD 4UC0A 5CURA 1D1SA 1LS1A 1PJBA 2XRMA 3DOHA 3FE2A 2Z9DA 3OE7D 1AF4A 1WULS 2EHDA 4KXLA 3BSSA 4L51A 5FBKA 1QSGA 5TT1A 4AJHA 4RV5A 1Z3CA 1MQ8B 2O2HA 1NXWA 2BM8A 2J1LA 3BIOA 4QQFA 3BXZA 3OPQA 1P6XA 3U7QA 4DLYA 1RM0A 1DOAA 2MT9A 3IVRA 4NG4A 4C08A 1XR3A 3C3KA 3W5JA 3Q12A 4Q47A 4EP1A 4R16A 2UYGA 1SC3A 4AICA 2WFMA 1ZLYA 1T8TA 1UC9A 2POCA 3DKRA 3HKDB 4N8EA 3T5BA 4A0SA 4PN7A 3T94A 5LU8A 1RFLA 4C7XA 3GV0A 3VFDA 4KPYA 3C3JA 2F4NA 3QKTA 2BTEA 2C95A 5CVDA 4M0MA 3PXEA 4QD3A 4W7IA 4DA0A 4RFVA 5PNTA 1KOFA 2PRSA 1AMOA 1Y1LA 2FJ0A 1JSXA 1X86B 1NXTA 4YMVA 1ZUD1 4G0MA 3ZZ1A 1P61B 2W6IA 4K05A 3ZKWA 1CDEA 4Y7DA 2APJA 3W5SA 2YZ7A 4K9OA 3ZHOA 1N6PA 1JHAA 4MCJA 1EXNA 1Z7EA 2FRDA 2WTBA 3DV9A 4CTOA 4ZJUA 3V8BA 3CZAA 1QDUA 3VR3D 5IKPA 3UMGA 4GKKB 2QZSA 5CIQA 2MTBA 2PS0A 2HV8A 2FEOA 5DHUA 3KPVA 4L7QA 221PA 5ALVA 4M86A 2IZ5A 2FKAA 3UA3A 3WDLA 1QF7A 5ALDA 1CR4A 3DYIA 3T52A 2NZXA 2C4NA 3UJBA 5CD1A 1HF3A 2KQUA 1P1HA 1LI4A 1R7RA 1NQWA 5JSQA 3NPMA 2NTJA 1YK1A 2C0CA 5H68A 2X0FA 1P9NA 3ABZA 2HEGA 3IT0A 4PPYA 2PRKA 4TTRA 3R6TA 4OG2A 5K3BA 5KYVA 2W70A 3SJZA 4F4UA 2HQ1A 2QZJA 2FPPB 2HMUA 2B36A 1E1NA 2FX3A 3C5WP 3M9WA 3PQEA 3K8YA 3R23A 4FINA 4GPIB 5EZYF 4EKNB 3WGMA 4B7XA 2VT2A 2MSNA 1Y6JA 1JG4A 1UWVA 2D7JA 3GAZA 1PLKA 2IOFA 3ZNPA 2YW9A 4TN5A 2B0CA 3G02A 3RVSA 2OZPA 4UEWA 1E3JA 3GP3A 2HL6A 5AQEA 4LJLA 5HTOA 4Q4LA 2UZAA 3E9DA 5IKOA 3I42A 4V39A 4M8LA 3JYPA 4KPGA 5K0EA 4X54A 1U28C 2C54A 1YL7A 3E3OA 4P2GA 2Z6AA 1H1DA 4RO0A 2JLXA 3U9SA 5CAEA 2FMUA 2RH9B 3H9UA 4UCXA 3VVBA 2XMCA 5LZ5A 3WSVA 4DSUA 5HUQA 4R8MA 1K98A 3I6QA 3QVLA 1EP9A 3MXOA 4F38A 1WXGA 3CEJA 3L1UA 4J9UE 1X77A 2BF4A 2JW5A 4JLSA 4OFXA 3JVUA 1C9NA 1KAHA 1C9MA 1ZGJA 2H7XA 2YYZA 3QE4A 2P8JA 3L4SO 4YJGB 1JJ7A 3T9AA 2VDKB 2AR9A 2YJ3A 1JAXA 3T95A 1RMTA 1GGNA 2BRUA 1CS0A 2E4YA 3WK5A 5EPEA 1N0WA 2Y1XA 3G0DA 2ZUEA 3EXG2 1KA9H 1VCHA 4J3NA 4R8LA 2J30A 1FFXB 4PLZA 3OPNA 3T8YA 1A82A 4ILKA 1D1QA 2IUTA 1C80A 1TU3A 4OQ4A 4EHJA 4Z7JA 2VBGA 1ND5A 1RQLA 2WKRA 2HYDA 4EQZA 4H0NA 4QHSA 2IKQA 3OCJA 4PICA 4F7WA 3QNUA 3I0MA 3OPXA 3UV3A 2GPNA 1F48A 1ZKMA 2CXHA 1Z17A 1E3IA 3MWJA 1EX9A 1ZK4A 4AJ9A 4HY3A 2NM0A 2V7PA 3VR0A 5JPDA 5LQCA 2OHIA 4OH7A 3NO4A 3PEYA 1Y8QA 4QUIA 3HCNA 3TAXA 3ZV6A 2CHFA 4FXPA 3QE3A 2YRFA 2QNIA 3S5UA 3EVGA 5BV1A 3CZQA 4ZI7A 4ZEWA 3U26A 3N7AA 2IDMA 1E6MA 1NXXA 1R4NA 4CBVA 1F8YA 1KJ8A 1KAQA 3IV9A 4CQMD 2ZIWB 5I7WA 2VBCA 4A2PA 5K9ZA 2EEZA 4IVQA 4LXGA 5D1HA 3IUEA 4CM5A 1TJ4A 1B14A 3ITNA 1W5AA 2PKRA 3JYQA 3OZBA 1Z07A 4JP5A 3G9UA 5JCXA 3A6EA 1NBOA 3LC7O 2GVDC 4N3CA 4FK8A 4MWSA 1FP4A 1PGOA 2FPXA 2XTNA 3Q3IA 2FFAA 3PFCA 3UA4A 1XVLA 1BXGA 3INTA 3PTZA 4XSVA 1HY3A 3EHEA 5LYYA 5BN1A 3EDYA 1PWEA 1O9HA 1ZK3A 2VYCA 5EZSA 4EPYA 1P5JA 3IYLW 2QYTA 3NDJA 4UQPA 1JJBA 2VLIA 5GJWC 2FSUA 2HF7A 3QF4A 1TM7E 3SYTA 1XDSA 3OFSA 1VJCA 4FEEA 4D4HA 3MJCA 4NBUA 3X1WA 4MDEA 4B3RB 1S8AA 2A33A 3WGHA 3RTCA 4BLSA 1R5NA 1J97A 4I7EA 4CQLB 4UM9B 3O3NB 4KXUA 3RJ9A 2WUDA 4YTEA 1EE2A 1G3MA 2ECOA 2I3ZA 1EUCA 3IULA 1EK0A 4M1YA 3DBLB 4YP7A 1OYVA 1XMSA 3M1AA 1JHVA 1CQXA 1AZWA 1YR7A 1NOIA 1TF5A 1P5FA 2VAVA 1VI5A 1V1JA 3G0BA 3KVRA 2LUOA 4DLXA 1GUAA 3EXG1 3KKMA 4ARUA 1OMOA 3L8ZA 1CS4C 2AWNA 3IR7A 1SD2A 4N01A 4DYHA 1RMYA 1QF6A 3HDTA 4TWAA 3K70C 5ALGA 4K87A 1XZLA 4LSWA 1SC4A 4DNPA 1GRCA 4PG6A 5DNCA 2V74B 1DDIA 5LN1A 4F2GA 3R8FA 5HBRA 1YZQA 2DKOA 4QG7A 4WNCA 2B9EA 4XQCA 3DPUA 3R5FA 3NBQA 1NF9A 1VL6A 1XMPA 2Q2WA 4MUYA 4CCYA 2IUYA 2C57A 1PDWA 3A4LA 1BCSA 4RXMA 3WRVA 3IUJA 3WAGA 1GTMA 2JFFA 3CUKA 2E55A 3RM3A 1EFRD 3SF8B 1YL5A 2GHQA 5J59A 3VJRA 2ODBA 1T3SA 2I99A 2WKPA 4YO7A 2AC7A 3MRXA 4RIGA 1TAQA 4GRDA 3O2JA 1II8B 3IQIX 3L4BA 2XAAA 2EFDB 1HLDA 3TCXB 4B6QA 1SVLA 2FPRA 2OMEA 4IKOA 4RFLA 4N8SA 1AZLA 2HJSA 4RFSA 2IWRA 4F4JA 2JCXA 3AR5A 4NFHA 3DCNA 1WL8A 4PBSA 2VYNA 4NS4A 1YZTA 4OJMX 1U1DA 3K9FC 3BMQB 5AKIA 2QZ9A 2IXAA 2O48X 3BHMA 2DULA 3L49A 3OTHA 4KSBA 4AMUA 3D3NA 1QLHA 1W73A 2Y0EA 3X2SA 3PT9A 3BWCA 3IHKA 3IODA 4K9QA 4MQ6A 5C4IA 5FADA 1JHMA 3T7TA 3CE9A 3NDPA 4Q9HA 3TSOA 1PD0A 1G20B 2HREA 3N5CA 3VPAA 1Z74A 2QAGA 2W6MA 3O7MA 5FXMA 5K0TA 2YRXA 4FGWA 1AHPA 5KWVA 1G59A 3PZRA 5FYQA 1E77A 3DFFA 2ODNA 3TBHA 2EBWA 2J3DA 3FUUA 3ZLVA 3KE8A 4EB6B 1XQWA 1ZIXA 3GLVA 3O93A 3PT5A 4ER6A 2FZGA 4G5YA 3D6UA 4RPJA 3EB9A 1WZ2A 1CUUA 4MW9A 1GSHA 4JI1B 1O95A 4MI3A 1BAPA 3A9SA 3BSFA 4IJMA 4QSHA 2ZXFA 3R3XA 4Q9JA 4FR2A 1VPEA 2GEDA 5ECGC 4AJJA 1FMFA 2BZGA 2MHCA 3LUDA 4YMSA 1ZWLA 5I8WA 5AJUA 5CCBA 3BGOS 1GUFA 1L5LA 5ER9A 4LBZA 1PGJA 2K7FA 1QB8A 1DCMA 3B53X 1ISFA 1DRKA 1LV7A 2ZI5A 4MAMA 5DHSA 1M6VA 2AJ8A 1PNVA 2XQKA 3TD9A 1IVYA 1C7FA 1V0JA 5D3MB 1ZSYA 1M7BA 4GPTA 3U2QA 4LJSA 5A71A 5J43A 1D4AA 3FFXA 2QX4A 3B85A 3D2BA 3HBJA 4GLOA 5H16A 1XLWA 1O94C 5DI9A 1NN5A