4EEZA

Crystal structure of lactococcus lactis alcohol dehydrogenase variant re1
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
339
structure length
339
Chain Sequence
MKAAVVRHNPDGYADLVEKELRAIKPNEALLDMEYCGVCHTDLHVAAGDFGNKAGTVLGHEGIGIVKEIGADVSSLQVGDRVSVAWFFEGCGHCEYCVSGNETFCREVKNAGYSVDGGMAEEAIVVADYAVKVPDGLDPIEASSITCAGVTTYKAIKVSGVKPGDWQVIFGAGGLGNLAIQYAKNVFGAKVIAVDINQDKLNLAKKIGADVTINSGDVNPVDEIKKITGGLGVQSAIVCAVARIAFEQAVASLKPMGKMVAVAVPNTEMTLSVPTVVFDGVEVAGSLVGTRLDLAEAFQFGAEGKVKPIVATRKLEEINDIIDEMKAGKIEGRMVIDFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase 1
publication title Structure-guided engineering of Lactococcus lactis alcohol dehydrogenase LlAdhA for improved conversion of isobutyraldehyde to isobutanol.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Oxidoreductase
total genus 107
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4eezA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4eezA01
1QORA 2C07A 1ZBQA 4N18A 1N9GA 4TQGA 3CH6A 3G1TA 1ORRA 3PXXA 2GNAA 2RHRA 5ENVA 5A9SA 3EK2A 1H93A 2AQIA 2I6TA 3QQPA 2BELA 1SB9A 4CMEA 2AQKA 1R0LA 3JQGB 1BW9B 1N5DA 3OJ0A 4R5MA 3ZNOA 1HDRA 1VSUA 1F17A 2P5UA 4LRSB 4B3HA 1I3MA 1NX6A 2EWMA 2QZZA 1KY4A 3JQEA 2P4HX 1SOVA 3KSUA 3LT1A 1A71A 3E6AA 5DP2A 3D3EA 1X1EA 4FQ8A 1XYGA 4S3MA 2J3IA 3FCOA 2NVBA 2FMUA 3RFVA 1NQAO 4BNVA 1AXGA 3BIOA 4OGWA 4WECA 4ALJA 2YHIB 3NDRA 5AXDA 1UZNA 1J49A 5LC1A 5T5QA 1NQ5A 2EGHA 4L4SA 1H2HA 3K9QO 5JCJD 1ADGA 2CVQA 3RKUA 3VPHA 4F6CA 1T2FA 3KETA 1KEUA 3JV7A 3K6JA 3WGQA 3IKTA 3FN4A 3FBGA 4NMHA 5G0UA 2JFHA 4GLOA 2DFDA 3RC2A 3FF4A 1T24A 1E3SA 2GRAA 3OQ6A 1NYTA 4IXTA 2EXXA 2PR2A 3O03A 4Y67A 1GUYA 1WLYA 2EJVA 3PEFA 5DT9A 3W4KA 2JD1A 2WJPA 1HE5A 4DPLA 1KBZA 3D4NA 3VH3A 2CUKA 2UVDA 1E6WA 3FHLA 1XG5A 2AG5A 2DKNA 5AOVA 4R41A 5EERA 1NBOA 2I99A 4ROSA 4I5EA 2OFPA 3VTZA 1ADCA 4YA6A 2G1UA 4P22A 4ZGWA 1P0CA 4TRJA 3V1UA 1DB3A 1YL7A 1KEVA 2FOIA 4NU6A 4KDFA 4BGUA 1JAYA 3GRPA 1EDZA 4R9RA 2OORA 1YRLA 4FBGA 5I9NA 5JY1A 3QVXA 2Q99A 3VPXA 1UXHA 4UEJA 4YT8A 3OA0A 4G65A 2UUOA 3EAGA 5HS6A 3V2GA 5HBRA 2CF6A 2X6TA 4WUVA 1N7HA 1L7EA 4J0EA 4CM8A 3MWDB 4K6FA 3HWRA 3KVOA 5EQDA 5DN9A 2TMDA 5K0ZA 1EFLA 1HT0A 1U28A 2BHLA 2RHCA 3AFMA 3WLFA 3K31A 3PIIA 1EUDA 2YY7A 4LVUA 3NTRA 3KBOA 1H6CA 3ROKA 3V1TC 5JDIC 1PJ3A 1H5QA 3LSYA 1TXGA 4MOWA 1PSDA 1GD1O 2E49A 3JYOA 1H0KA 3BA1A 2YYYA 4RL6A 5DNAA 3SLGA 2YQ5A 4WLVA 1SBYA 4ZQFA 4OQZA 1U3UA 1YL6A 5KCZA 3V2HA 3FWZA 4ALIA 2OUIA 3H9JA 1DAOA 5BR7A 4E5NA 2D8AA 3VAZA 5A04A 3VTFA 5G0TA 1MB4A 4IPTA 5U9CA 3VKVA 2O4CA 4RZIA 3PWSA 4FDAA 4MVJA 1Z73A 4GX0A 4WCDA 3TSCA 1PR9A 3KYCA 3NT2A 3ZHYA 3QW2A 3DL2A 2VOJA 3KSDO 4YJHA 4DLBA 3DZBA 3JQDA 1MC4A 1S7CA 3C7DB 1PJBA 3P5SA 4Z0HO 3RUFA 4QXMA 3AJRA 2Q2VA 1MP0A 3RBXA 4XCVA 3HDHA 2PZLA 3LDHA 2V6GA 3H6KA 3PFFA 4YAEA 2VQ3A 3IAHA 5IAAA 1E1LA 4BQPA 2WE7A 4XGKA 4ND5A 1XEAA 3Q1LA 4PG5A 3VH2A 4GX1A 2JFFA 3WWZA 2NV6A 3CPSA 4CMBA 1V0JA 4TMFA 3W4JA 2QQ5A 2BMAA 4IZHA 3HQ4O 1EVYA 3ONFA 1LU9A 1YOVB 3O26A 4YRAA 5BQFA 1Y6JA 1BRMA 3S2GA 4PG8A 2VUSA 3EVTA 4ZRMA 4XYMA 4I9HA 4KDEA 3FNEA 5DOZA 4IJKA 2H5LA 2PLAA 3RQSA 2SCUA 4RPGA 3K2EA 4PLGA 5IZCA 4WLFA 1OMOA 4AL4A 4HUJA 2E37A 5L9AA 1VJ1A 4UAGA 1SOWA 2JKVA 3MJ4A 4FN4A 3QVOA 1RM3A 4WK6A 3ZDFA 2BRUA 2V6MA 1ISHA 4YB8A 2DBQA 4J90A 2RCYA 4KOAA 3UGKA 4A2CA 4F6LA 5ILOA 4CMCA 5FWNA 1Y8QA 2C59A 4E0BA 1KVSA 4JBGA 2VHWA 4ITUA 1H6BA 3GDOA 3GEDA 4WASA 3I83A 1MA0A 3PZBA 2O50A 4BNZA 1KS9A 4FCCA 2BF7A 4OKIA 2Y1EA 3PRJA 1I36A 2DT5A 5HA5A 5T6BA 5I7FA 4BGIA 3C1OA 5B4VA 2QIOA 4DQXA 4ZQHA 1U3VA 4XDZA 2DFVA 5FFFA 3BMQB 2HDHA 1T25A 4MKZA 4ND3A 4UUOA 5H83A 3MTGA 1PX0A 3GNSA 5CDSA 1GU7A 1PJCA 5CPFA 4YVFA 2B4RO 1BTOA 3UICA 4BMSA 4MVJP 4GX2A 2CDCA 3RUHA 3ZWYA 1ADFA 1DIRA 3ABIA 4EUFA 1CETA 4DXHA 1D1SA 2FP4A 4CL8A 4E2XA 4W4TA 1WDKA 2DUUA 3EC7A 1J6UA 3KLPX 1AE1A 1OOEA 2AEFA 3ENNA 3JQGA 2HRBA 1BW9A 3MEQA 5HTOA 2AA3A 2WD7B 3IIEA 1B3BA 3AOGA 3FNFA 1SNYA 3F9IA 4YAGA 5ITVA 3HJAA 3CEAA 2JD2A 1P44A 4DLLA 1XHLA 3E18A 1H6AA 4AJJA 4DBZA 5LDHA 3A14A 3O9ZA 4D42A 2Y0EA 4L76A 2IZ1A 2ZCVA 1DJNA 4M8SA 1IOLA 3I4FA 4YBZA 4BUCA 2EIHA 2YHIA 2PGLA 4GL4A 2Y1CA 3GPIA 3X2EA 2AXQA 1CYDA 2GSDA 1DSSG 1Z75A 4A03A 4A0SA 1SO8A 1YL5A 2C54A 2DQ4A 2AE1A 3GR6A 3DZKA 3A1NA 3WTBA 1GEGA 2B83A 2ZTUA 2GO1A 1U1IA 5KKCA 1GUZA 1A4UA 4I8XA 4YACA 3TWOA 1PQWA 4OHUA 1BMDA 1ZJYA 1N1EA 3C3XA 4UUPA 1KYQA 1VKNA 1Z6ZA 2HJSA 4L4RA 4ONEA 1U5AA 5DZSA 2CNBA 2HLPA 2J5RA 3F4LA 1GEEA 3ZW9A 3DMTA 1ISGA 5JXWA 1QMGA 1MX3A 4R1TA 1DLJA 5BNFA 2DBZA 4AJPA 3DBRB 4E30A 2PZJA 1VE9A 5K6AC 2NM0A 1GDHA 1K2WA 2NU6A 2QYTA 3EY4A 4DC0A 3JSAA 1HZJA 1LTHR 3JQ8A 3E1KA 3SXPA 4HNGA 1T2CA 4IZIA 3BZUA 1B8VA 4ZJUA 4YEDA 4GPD1 3R3JA 4RPKA 1H9BA 4EGFA 5CHEA 1Q7GA 4CM4B 1DFGA 1O9BA 1NXQA 1EUZA 4CL3A 4CR7A 1S6YA 1GUFA 3PGXA 4TWRA 2VTDA 2BGMA 1P1FA 3U9LA 4MVJI 1P3DA 5BSEA 2VZ0A 4INAA 1LRJA 3EYWA 1FDTA 4KWHA 4FS3A 3PTZA 2OO5A 2Q50A 3OJEA 3VZRA 4BNFA 1PZGA 1IE3A 3F5SA 1PL7A 4B7XA 3JD4A 1EBFA 3PFWO 3VPGA 1UAGA 5GMOA 3VOSA 1LSJA 1D7OA 1E3JA 4NBRA 1Y5MA 3H3JA 4XB1A 3WMXA 1LDMA 3AK4A 5GZ1A 4MPDA 3UVEA 1GR0A 3CIFA 4NR0A 1ULSA 1E5LA 3H8VA 2JJYA 4YCAA 3M2TA 5HM8A 4BO4A 4RLSA 1GAEO 4MVJD 4AJIA 1YBAA 2EP5A 3K2BA 4BVAA 4BNLA 1NPYA 3KYDA 5L95A 4BKOA 3TZQA 2Z1MA 3HE3A 5K9ZA 1C1XB 3BTOA 3JYPA 4M55A 1PZFA 5COBA 1CIVA 4JJGA 3GRKA 3OSUA 1E7RA 1B14A 2R6JA 4DUPA 1QLJA 1K3TA 3O8QB 3RC9A 3W4IA 4DREA 1Z45A 2JHFA 1TI7A 3PZRA 4CMIB 4U6SA 3DTYA 3MWEB 4K9DA 5C7IO 2OGUA 2NVUB 2EW2A 4NNJA 1P77A 4OMUA 4L8VA 3AOEC 2CDAA 2PGJA 2G17A 1O94A 4MDHA 3TPCA 4HY3A 3R1IA 4ZRNA 1QYWA 1T1RA 4KMSA 3VHRA 2W2KA 2WTBA 1UDBA 2X8LA 1MXHA 4BQRA 3N7UA 3TL2A 4BV9A 4YT2A 4D45A 2ZB7A 1Z7BA 4FFOA 4TRMA 4C4OA 2NU7A 1JQBA 4S1VA 3D1LA 1TA4A 4KQWA 4A26A 2BFOA 3WNVA 3IKVA 4Q3EA 4TRRA 2FR8A 3WDSA 5FF9A 4BO2A 1PQPA 3T4EA 1V35A 2ZYGA 3BXXA 3ZHZA 2ZJ0A 3HADA 3CMCO 4R4JA 1DC6A 1W8DA 1W4ZA 1AN9A 1HYGA 2IZ0A 3JQCA 3A28A 4J4TA 2UYYA 3ULKA 3OBBA 2X9VA 4JX8A 2DM6A 3PJEA 4OJNA 5H81A 4DVJA 2DTEA 2PD3A 3H2SA 5COAA 4E12A 3D3WB 5A4DA 4O59O 1CRWG 3TL3A 1NM5A 4ND4A 2P91A 5ITWA 4FPXA 4RF4A 1EE2A 4Q3AA 3WIDA 1Y1PA 4BNKA 4CMJA 5CEFA 1V6AA 2JHGA 5CEEA 1X15A 3GFGA 2P9GA 3NRCA 4KUGA 4JK3A 4E33A 3ZGYA 2W98A 5THKA 1P74A 1JVSA 1FXSA 1TVEA 3K96A 4YQYA 4IMPA 9LDTA 3TRIA 1I10A 2R2GA 4YQZA 5KJ6A 3RWBA 1EBUA 1E7YA 1GCUA 2JCYA 1LX6A 2VOEA 4MKRA 3RVDA 3UHAA 1DEHA 3ON5A 4Z6KA 2GN8A 3U09A 4WOKA 4YDRA 3AY6A 3WBBA 3D7LA 4C7JA 4CQLB 1PGJA 2WD7A 4CMEC 1NFRA 1B2LA 3I3OA 3DB2A 4NJMA 4XJTA 2PTGA 2VYVA 3CZMA 3CSDA 3I23A 3KM0A 4YYZA 1A9ZA 1DJQA 3I9KA 1CERA 4QT0A 4EJMA 1H94A 4IUYA 3ZV6A 4JQCA 3KYBA 2BGKA 3E48A 4J4BA 1SEVA 2QYSA 1VL0A 5T8KC 4AFNA 1ZK3A 4UEKA 4XB2A 4OXNA 3N74A 4NJOA 3ZV4A 1AUPA 1LSSA 1VLLA 1YQXA 3P2YA 2B4QA 4EZBA 1Y9EA 1PEDA 1W6UA 1JKFA 3DOCA 1YWGO 3BHIA 3IJPA 3U62A 3WQQA 5ICMA 5JY6A 2IEBA 4B79A 1Q1NA 3GVCA 1U2GA 2HMTA 2FPIA 1A4IA 3AUTA 3CE6A 1ZK4A 3JYQA 4GBJA 2VYNA 4HADA 3LT4A 2A4KA 3B1FA 4Q3BA 2NNLD 2DBRA 4E13A 3ZWOA 1J0XO 5TT1A 1BHSA 1J5PA 4H16A 5TNXA 5EPOA 4KQXA 5IDYA 5JBIA 1XU7A 3I6QA 2CZCA 2PY6A 3ZI0A 3LLSA 3K5PA 4LCJA 3DBRA 4LW8A 2Y1FA 4JGBA 1EVZA 5JLAA 3LQFA 1YB5A 3LZ6A 4N7RA 2BFPA 1ONPA 4RORA 1CQIA 2D5CA 3AM4A 5JO9A 2X23A 2X5KO 4NHEA 4PZDA 2HK9A 5DDIP 3GA0A 4B8WA 1V9LA 4NIMA 1PJTA 3Q0EA 4WE3A 4BIIA 1Q0QA 3OA2A 1BDBA 4CM4A 1DC5A 3OHSX 4NQZA 1LDGA 1XQ6A 5KVQA 4NK5A 3H7AA 1HKUA 5A3JA 1OFGA 2HSDA 4HFJA 3RROA 5KTKA 5F5LA 1E3EA 2HAEA 1F8FA 2Y99A 3OP4A 3AI1A 1SAYA 1MFPA 3U4HA 3DOJA 4IDCA 1CJCA 1KC3A 4YR9A 1UP4A 4UUNA 1I2BA 1B8PA 2G5CA 5KJCA 3S2FA 1MGOA 1F0YA 2X7HA 2X58A 4IDFA 1O6ZA 4I1IA 4OO3A 1XGKA 2VT3A 3IJRA 4KUEA 3QWAA 3OQ1A 2O2YA 2QRLA 3GK3A 3ORFA 3OIGA 4OSOA 1P31A 1BXGB 4WEQA 4E31A 1YJ8A 1BWSA 1EVJA 1T26A 1NAHA 1RM4A 4IDEA 3WICA 4FB5A 2FY8A 3MOIA 5GZ6A 3WFIA 3PPIA 4GGPA 1FDWA 2PKRA 3E03A 4U5QA 3RUIA 1XR3A 2O3UA 4J7CA 4BO7A 1SZJG 2P68A 2Q45A 2OP1A 4PLPA 3BMOB 3OM9A 3F6YA 2C7VA 4GWKA 3AM3A 2CD9A 2DPHA 5FI5A 4L74A 3ZU3A 4JBIA 2VUTA 3DTTA 1KY5A 1JU9A 6LDHA 2I9PA 1I30A 2X5JO 3ZWBA 4B4OA 2D4AA 4DGSA 3NV9A 4IIVA 4BNGA 4QO7A 4CMIA 3QP9A 2JL1A 1XA0A 2OMEA 1YDWA 1F06A 4WKGA 5ILGA 1R4MB 2I3GA 1H6DA 2NVUA 3PJGA 5KJFA 5MGBA 3OJLA 2D2IA 5JMWA 2GDZA 4FFNA 4FJ2A 2UUPA 2VUUA 3GF4A 5T8KA 1AHIA 1DC4A 1GYRA 1E3WA 1MLDA 1HRDA 3GQVA 3UW3A 2X22A 1DHTA 3RUAA 2ZKLA 3AY3A 3IUSA 4QECA 3WGHA 2B36A 1HWYA 4B3JA 4U0KA 4II2A 4QUKA 3WYCA 3DAPA 1G6KA 4YXFA 3DBLB 1KVQA 3PJDA 3PWKA 4BV8A 4EUEA 5IZCC 1R37A 4HKTA 3P7MA 5DBIA 3LF1A 3ZH2A 2PGDA 5CPBA 2J3JA 2WE8A 5I8ZA 2FN7A 3NGXA 3PQEA 4JP3A 1C0PA 4FGSA 4KP7A 5C5IA 3IL2A 1NTOA 1VM6A 2YQ4A 3HHPA 5COQA 3VH1A 3UN1A 1DIBA 4DRYA 5B4UA 1LLCA 2VHYA 3E82A 4E5MA 3ANNA 2W2LA 3D5QA 3WSWA 1YQDA 2HKIA 4GVXA 1M6WA 3GC6A 5F1OA 5BSHA 1M75A 3D3WA 4BB5A 3GPDG 4A73A 5G0VA 5ADHA 4BO3A 5J23A 3KV3O 2OXIA 3ZHXA 3PYLA 3PQFA 3DBHB 1Q2XA 3HFGA 3HNPA 2P2SA 3PIDA 3UF0A 2OP0A 4UUMA 3WG9A 2B35A 5CAEA 2FZWA 4J2HA 2WEKA 3TN7A 4NK4A 2OBYA 4J1TA 3ICPA 5FYDA 3UCFA 1U3TA 4JXKA 4TKLA 4CUKA 3RI3A 3KLMX 4AJ4A 5TT0A 5LDGA 4BNNA 1AHHA 4ILKA 2BGLA 4HP8A 5IF3A 1KVUA 3DR3A 5B12A 4MIOA 1HEUA 3OFSA 2AG8A 2YW9A 1JAXA 1EUCA 1VPDA 3VZQA 3MJSA 4CQLA 4OIMA 5AXBA 4NFHA 1ZZEA 4Q3NA 2I67A 3Q6IA 1UXKA 2YDXA 1G0NA 3HUDA 4BGVA 3RUDA 4GLLA 3ZWXA 2VYVD 4RPJA 3GNTA 1FK8A 1KETA 1H9AA 4B4UA 1PU2A 2QZ9A 4PZCA 4BO6A 4AJ2A 4CQMA 4TSKA 3PI7A 3F5QA 1YBMA 3ZWNA 5A9RA 1I32A 3H9QA 4ID9A 1KVTA 2A35A 3QWBA 1KC1A 4O63O 1QP8A 3GMSA 3VVCA 3F1LA 1C14A 1HDGO 1TB4A 4YRDA 4LK3A 4EITA 4L9RA 3WGIA 5BSGA 3GHHA 2P9EA 4Z9YA 4CV2A 1WMAA 2VN8A 3V5NA 4K28A 1P1JA 5L4LA 4OXYA 3P2OA 4Y98A 4FC6A 4PVDA 1V3TA 1M2WA 4XJSA 2VWHA 2VWGA 3FBTA 3MTJA 5BT9A 1I3KA 2O3SA 4W99A 4JBHA 1MG5A 2X86A 1GPDG 1PWXA 4DYDA 5DBFA 3DMTC 2OOSA 2VNAA 2VHXA 1P45A 1IZ9A 3W6ZA 4EEXA 1XELA 4JROA 3HZZA 1PS8A 3PHHA 2I76A 4J4HA 5JE8A 4YJGA 1Y9AA 3WJ7A 2OZPA 1M67A 4PLFA 4BNHA 1TT5B 2GCGA 3WQRA 5CFZA 4YWJA 1YONA 1C1DB 3AWDA 3JQAA 3A06A 1QLHA 4Z3DA 4NFYA 3B1KA 1ZXBA 4FOSA 4XD2A 1UXIA 3VC7A 4I5GA 4R9SA 1RYDA 1JDJA 1E7MA 4FC7A 3ETEA 2UDPA 1DOHA 1X0XA 2DUWA 5TC4A 1ZK0A 3EHEA 3H2ZA 4RF2A 1C3VA 1NASA 3BMCB 1U9JA 3I9JA 4OQYA 2B5VA 3BHMA 1PZEA 1ZFNA 1TEHA 2VHVA 4HWKA 4PLZA 1A9YA 3GDFA 1JTVA 2IDZA 3DHNA 4XYGA 3E9NA 2Q2QA 3VH4A 4XQ9A 4BGEA 1AXEA 4CMKA 1FMCA 1NQTA 2B37A 2C20A 4WNIA 4CM1A 1D3AA 3QV1A 2WSBA 1GV0A 2YV3A 1BXGA 4DMLA 2VHZA 4E4YA 1ZNQO 4L0QA 4NBTA 3GH3A 2JCVA 1XKQA 2ZIZA 1NNUA 3A4VA 3DZHA 1PJ2A 1QR6A 3C24A 3NGLA 2E48A 3C85A 1WNTA 4FIZA 1ISFA 4UULA 1K6XA 3DFZA 2CSUA 1F8GA 4OOEA 3ZNPA 2DBVO 2P9CA 1QV6A 1P1HA 1XU9A 3AU8A 3PQDA 1GYPA 4YJFB 5ENDA 3JD1A 2J5KA 3BMOA 1QYVA 4NDNE 1KVRA 4JNKA 1T2DA 2ZTLA 3D0OA 1O95A 4LGVA 1GL3A 3DQPA 1GPJA 5JSFA 4Y8VA 1WW8A 1RM5A 2IODA 3E5MA 1YH3A 3RKRA 1HYHA 5IG2A 1I8TA 4OYRA 1P0FA 3RBZA 1LJ8A 3FWNA 1D4FA 3EUWA 4B7CA 4IQGA 1PGQA 2GR9A 2ILTA 3AY7A 3B1JA 4E2ZA 1ZCJA 2X0IA 4IQ8A 4LMRA 2P4QA 2Y0CA 4PIVA 1KIFA 3RC1A 1HE3A 4GMFA 1BVRA 1YJQA 1JN0A 3GOHA 2OL4A 4RGBA 5LCXA 1FDVA 3JQFA 2BFMA 4GVLA 4UVDA 5CDUA 2WM3A 3OECA 1NP3A 2XOXA 4DPKA 5IN4A 4DPMA 4GI2A 1U4SA 3FI9A 4PLHA 1U7HA 4GWGA 2GN4A 2RH8A 3UAGA 3DBLA 1JKJA 3GG9A 4J1SA 4MVJH 4BO9A 2YHUA 4HXYA 2QG4A 5EINA 4NFSA 4D46A 5AQ1A 1P1KA 5IJZA 3INRA 5IDWA 4PLVA 2HK7A 4B4WA 2EW8A 3TZHA 3JTMA 3UFXA 1ONNA 5EIOA 1OBFO 3LC2O 4LSWA 3QSGA 4KWIA 2EHDA 3AUSA 1MUUA 3CINA 1UP7A 2C0CA 2EEZA 3H9EO 3ITDA 4N5NA 4PLTA 1KEWA 3I9NA 4OH1A 1HDYA 2GUGA 2V7PA 2W2LD 1DC3A 2HU2A 3JQ7B 4H7PA 2NLOA 4XGIA 2ZK7A 3NUGA 5DCWA 1GFSA 4B8ZA 4UVGA 2Q46A 4DL9A 3SVTA 3G1UA 4BNUA 3DAGA 2GN9A 4RQUA 1YB4A 1E0DA 1X1TA 3DBHA 4JN6B 1UXGA 3VVBA 1FDUA 3W8EA 1NR7A 1O0SA 1P9LA 4P4GA 1CDOA 5TQVA 4CLRB 3H65A 4Z9XA 4BNYA 3CMMA 3GDGA 3TFQA 2NWQA 3KO8A 3KSZO 4J1QA 1LI4A 1ZEMA 3QWIA 5B4TA 3D64A 2EV9A 3VZPA 1UR5A 5G4KB 3GT0A 3HN7A 4MINA 4W6ZA 1MC5A 2JD0A 4P8RA 1FJHA 2YJZA 4XQEA 5A1TA 3AUAA 3IS3A 1LSOA 1GADO 3ASUA 4FOOA 1A72A 1U8XX 2GLXA 3DZFA 3FR8A 2J5QA 3PYMA 4AJNA 3JQ9C 2EJWA 1HYEA 3Q3CA 2PA3A 4XGNA 3H3FA 3INTA 2AQHA 2EG9A 3W1VA 4JP2A 4CV1A 4URFA 1BG6A 3H4VA 3K8ZA 4M89A 1JVBA 5DOVA 3RJ9A 3S55A 4FD3A 1QSGA 5K1SA 2PFGA 3MJEA 1RPNA 4TROA 4D3DA 2HMWA 4XWYA 3T7EA 2W8ZA 4CQMD 1P1IA 2ZB3A 4RPLA 3CZRA 1WWKA 3JD3A 5CG1A 2AEMA 4GMGA 3IP3A 4TRNA 1E1KA 3ZN2A 2GD1O 3VPSA 3C8MA 3N58A 4H3VA 2FHSA 5KJ1A 5A3VA 1B7GO 4Y9DA 3RFXA 1Y5RA 3O4RA 3GUYA 3WYEA 1ZK2A 1WZEA 3DAFA 2ZQYA 1GY8A 4J91A 4Y6RA 4IS3A 5F3RA 5GZ3A 2EKPA 5IXSA 3GHYA 1PZHA 4Q3CA 2DTXA 5I7VA 1VJ0A 2NU9A 2I66A 1LC3A 5TF4A 3BTSA 3TZKA 3I5MA 4M54A 4EBFA 4U7WA 4ALLA 4NU5A 5G0SA 1VI2A 1YOVA 4B7UA 1PTJA 4J0FA 1ZK1A 1TT5A 3DC2A 4IIUA 5A5EA 4YPOA 5IN5A 2X0RA 2PNFA 3KOUA 3M1LA 4BNIA 3U5TA 3H5RA 2X0NA 1ID1A 2CVZA 3RCBA 4J9UE 3JQAD 3ZWAA 1HETA 1MG0A 1Y81A 1OC4A 1Q7CA 3BYZA 3WTCA 4UEOA 3GMDA 1ENZA 4DBVO 2O3TA 4XIJA 4GKVA 3RD5A 1TLTA 2XAAA 4XZ3A 4EJ6A 1QXSA 3Q2KA 4NI5A 1KEPA 4R1NA 2AHRA 3KEOA 4IJWA 5TRTA 2H6EA 4RVUA 1LDEA 4R1SA 5KKAA 3UH1A 4B4VA 3RUEA 4IY1A 3GVHA 4IM7A 1EQUA 3MZ0A 4CM6A 1DRUA 3GN2A 3WWYA 4DTIA 1Q0LA 3EZLA 2GGSA 4BO1A 4WGGA 4M87A 3LU1A 1GYQA 4GSLA 3R6DA 3WGTA 1PJQA 2G0TA 1B3RA 2NTNA 2NUAA 2C2XA 2BLLA 3ANMA 1YDEA 2GZ3A 3IUPA 4IS2A 2VZ8A 3D4OA 3BMQA 5DBGA 2WD8A 1E7SA 3OQBA 1R15A 3H5AA 2AMFA 3SJUA 2E4AA 3BMNB 3MJTA 1IHYA 4MIEA 3GEGA 5KWEA 3OIFA 1PL8A 3W8FA 4E5PA 1ZUD1 5GY7A 1E7QA 2NTJA 2VRCA 1NVMB 2O3JA 4EJ0A 5A9TA 2HRZA 4LCEA 1PIWA 2X1HA 4IDDA 4WLEA 5I8WA 3GGGA 4XR4A 5JDCA 4FW8A 4I08A 4BHTA 3E8XA 3ETDA 2XF8A 3JQ9A 2J3HA 2YFHA 3VDRA 3WFJA 3NAQA 3NJ8A 3ZHBA 1ZVMA 4RVFA 2W90A 2Q2WA 3Q9NA 2YV1A 3Q9UA 4RVHA 5C37A 4JJIA 1W0CA 4LMPA 3JYNA 1G1AA 1OC2A 2IXAA 4QFCA 2HMVA 2EF1A 4PRLA 5L7TA 4R69A 4ZU3A 4A7PA 1G0OA 4YTEA 1V3VA 3W6UA 4BKQA 4E32A 2R00C 4CM8B 3VKUA 2CY0A 3QLJA 4D3SA 5I7EA 4Q3DA 5DP1A 2ZCUA 3KTDA 3WYBA 4W9NC 1ENPA 3C1TA 4P38A 4TKMA 5A03A 4J1NA 3AI3A 4NZ9A 9LDBA 1NR1A 4DMMA 5HRUA 2QW8A 3DEYX 1EMDA 1I33A 3ONDA 3CXRA 2EKQA 2PKQO 2QX7A 1NFQA 1E1NA 3WJAA 2JAPA 1RYEA 5ER6A 5JPIA 4EYEA 4CLEA 1R66A 4LISA 1N8KA 2PH5A 1UH5A 5AXCA 1E6EA 4GKBA 1JW9B 3DHEA 3ROPA 4D7AA 4IGFA 4JJFA 4XEHA 2YUTA 1PJSA 4GAEA 2PK3A 4RV9A 3JQ7A 2XPCA 1C0LA 3HB4X 3CUKA 4R54A 1T4DA 3M6IA 5EMHA 3OEWA 4D0SA 4F46A 3DZGA 4YJHB 3SEFA 1LLUA 2Z5LA 1VSVA 1EZ4A 3NTOA 3NDIA 4IXWA 4DQVA 3TOXA 3RBVA 4CR8A 2OBNA 3QVSA 3ZW8A 2ZYDA 3TFOA 1SPXA 1LDYA 3OEYA 5B37A 3AU9A 2WYUA 4XRRA 4BO5A 1ZXLA 4WJZA 4QFDA 3ZWMA 2HQ1A 4AJ1A 2HO5A 4QO8A 2PWZA 5G4KA 4DQUA 3GZNB 1GQQA 3G79A 4D43A 4RCVA 2O2SA 2IEDA 4FR5A 5L7YA 2EGGA 2PZMA 2B5WA 1I0ZA 3A9WA 5AVOA 4HV4A 2J8ZA 3DZJA 3C1AA 2Q1UA 3PP8A 4FGWA 4CODB 1EEHA 1EDOA 4YAJA 2Y1DA 1X13A 2GYYA 1LLQA 3S1LA 3U3XA 5FI3A 2NSDA 3EW7A 1UDCA 3D4PA 3OJFA 7MDHA 1PWZA 1B0AA 3LC1O 3W8DA 1M66A 2DC1A 3L4SO 4J16A 3GUCA 8ADHA 3UXYA 2BH9A 2G82A 3KUXA 4L73A 3LYLA 3LLVA 1HDCA 3DONA 2QRKA 3FNHA 4II3A 5JS6A 2FRDA 1QG6A 2JAHA 4ZD6A 5C3MA 1DRVA 2D59A 3AFNA 1DLIA 4TZKA 1YB1A 3ITKA 3PLRA 3ADPA 1LRLA 4IJUA 4J49A 1HTBA 4DA9A 1NHWA 1NAIA 1C1XA 2WDZA 1A7AA 1KERA 4EDFA 4WNCA 1PR3A 3UKOA 1E77A 3IMFA 5L53A 1Z7EA 4RZHA 3X2FA 4Z3KA 1RWBA 4CM5A 3GG2A 3O8QA 4MIYA 3VPFA 3LC7O 5KOIA 1C0IA 1ZSVA 1ISIA 3LK7A 4PZEA 3QJ5A 1UZLA 3HSKA 3R0IA 3V1YA 4EUHA 5JCXA 1XLTA 1JLLA 5KVSA 2Q49A 5EN4A 1UP6A 3SLKA 5JAIA 3DDNA 1IHXA 4I5DA 4BNMA 2V6FA 3GAFA 3PVZA 3UCEA 3GVIA 2H1SA 4E5YA 4R51A 3HDQA 4CV3A 2R00A 1EQ2A 4ESOA 3F47A 1CEQA 5HWSA 2DLDA 2PD6A 2FR0A 3GVXA 1TT7A 4RDHA 2PZKA 1Y7TA 3ONEA 1LUAA 2HUNA 1KOLA 4W9NA 3WOHA 1GCOA 1F14A 1HDXA 3WNQA 1PGPA 1M6HA 4R01A 5EJ2A 1VC2A 3HFSA 1YE3A 4BO8A 1N92A 3SC6A 1IPEA 3IQDB 1BVUA 1LSUA 2D3TA 4ZVVA 5L45A 1LXCA 4UVHA 5FEUA 1RM0A 4PVCA 4RVSA 1IL0A 3WMWA 1K6JA 1H2BA 3LF2A 4PLCA 2B0JA 1GZ6A 3L4BC 1B26A 4NBWA 4U0JA 3E9QA 1ZEJA 3G3EA 4U8GA 5DCUA 3RFTA 1QYCA 4MP8A 4N5MA 1LDNA 4BB6A 5EQFA 1GTMA 4TVBA 5A06A 3WR5A 5JYDA 1D1TA 2GN6A 5A02A 3JQBC 4ZQGA 5JC8A 4FSHA 1BDMA 4ZHSA 4CMAA 5IDXA 4I9NA 3WLEA 2CDBA 1UZMA 3ZNNA 4LN1A 3T7CA 4KZPA 1T2AA 3BMNA 4HX5A 4ND1A 4CLXA 4J43A 1HXHA 1LNQA 4LVCA 3WGOA 3TZ6A 4AJHA 3ENKA 2O3RA 2Y66A 3L6OO 2RAFA 2Y67A 2VRCD 5F1PA 1ARZA 3GLQA 1WP4A 3PWZA 3JCZA 3JQ8B 2RH4A 1ZJZA 2UV8A 3B70A 4NH4A 2DAPA 1E3LA 4J3FA 3RC7A 1LLDA 1XIVA 2FPPA 3EMKA 4IJVA 5IXYA 5JAZA 3DXFA 4RVDA 1I24A 1GZ3A 3NJ4A 3NTQA 1EK6A 2I3AA 2Y0DA 3INGA 2XXBA 2D0IA 3AW9A 1U8FO 2BI7A 4CM9A 3ADOA 4BNXA 5C7OO 1HZZA 4OL9A 5G4LA 1YGYA 5L3ZA 4PLYA 3JQFC 3QY9A 1OZAA 3ETGA 4NBVA 1ZO8A 5CDGA 5KIAA 3PHIA 1IB6A 4ALNA 3G17A 1MFZA 3F3SA 4G2NA 3ZU2A 1VKOA 4MVJM 4YT4A 1XQ1A 1UJMA 3L0DA 3LT0A 1ML3A 3NKLA 4KUHA 4PGFA 3COSA 4WPGA 4R5HA 4R68A 4ZQBA 5EESA 3U0BA 3PHGA 1DFIA 3ST7A 3P19A 4PRKA 4RO0A 4EW6A 1NPTO 2ZQZA 3F46A 4BO0A 2C29D 1LRKA 2VYND 5F1KA 1EVIA 1NVGA 3FD8A 4IQ0A 4XR9A 4CR6A 1IYZA 4MJLA 5BNTA 4HFRA 5KVCA 2C2YA 1XDWA 1I5RA 2HCTA 2W4QA 4MP3A 1Q7BA 2NQ8A 3PDJA 4OSPA 3FR7A 1X14A 2DTDA 2I65A 3KYDB 3PDUA 1QKIA 1WXDA 1Q0HA 4MVJF 3GNQA 3K30A 4QTZA 4CMGA 2ZATA 4XIYA 1QYDA 3IP1A 3RU9A 1U3WA 2VTEA 3DMYA 4E3ZA 1NQOA 2FR1A 1T1SA 2NADA 4I5FA 4J6FA 3GVPA 4J2OA 4ZA2A 5CG2A 3GZNA 5DCYA 4AJEA 1N7GA 2YV2A 2PH3A 2Q4BA 1MV8A 2F00A 3EZYA 3ZU5A 4WCFB 1YS4A 3JD2A 2C5EA 1GV1A 3WBFA 4MKXA 5JO0A 3ZWVA 1NHGA 4AICA 2O48X 3L4BA 1HLPA 5C7LO 3S2IA 4M49A 4XYLA 1EE9A 2W2KB 5TIIA 1E1MA 1K5HA 1CWUA 3L6DA 1UAYA 2ZB8A 4I9UA 3L9WA 4EEZA 4BKUA 1PJ4A 3KRTA 2JFGA 1DO8A 1SB8A 2GERA 3GAZA 4QEDA 4DIOA 4N5LA 4XQCA 4CPDA 1DRWA 3OH8A 4Q39A 4BNJA 1X7GA 3JQBA 3L6EA 1U5CA 1R16A 5DULA 3RUCA 3U4IA 4ALKA 5KVVA 5JNLA 2J6IA 1VL8A 1DIAA 1ZIDA 1CF2O 4Q9NA 1HSOA 1YBVA 3OIDA 1O5IA 3FSRA 4H15A 2G76A 3U49A 1N1GA 4DYVA 3TJRA 1WPQA 2Y05A 4PFJA 5CDTA 1ENYA 5L51A 2Q1WA 3DFUA 5EL0A 1I3LA 4A10A 4AJOA 1UUFA 2C7GA 3RAJA 2FSSA 4XRGA 5TLSA 2PD4A 3QWHA 2H63A 2JCXA 3B20A 5TX7A 1DBVO 3BHJA 4R16A 1YQGA 3VDQA 3STHA 1Z74A 2IYPA 4UVEA 5CP8A 5H82A 4DIFA 3TF5A 1PGNA 3FTPA 3V2UA 1WVGA 1YO6A 3JD0A 1R4MA 4W7IA 2LDBA 3PLNA 1LDBA 3QA9A 4G81A 4OM8A 1RKXA 1EK5A 5F21A 5JW6A 2O7QA 3G0OA 3SC4A 3VZSA 5L4NA 3IDSA 3G49A 4W7HA 5THQA 2YDYA 3UCXA 4CM3A 1U4OA 3PHLA 2D1YA 2V6BA 3RIHA 4BKPA 2F1KA 2RIRA 1I2CA 1WMBA 2O7SA 2V65A 5JDIA 3GN1A 4WOJA 3NYWA 4KTTE 2EERA 4NJMB 1J4AA 4RF5A 2AW5A 1NPDA 2BFAA 5TJ9A 3O38A 2PKQP 3DOOA 4R1UA 4WCFC 4P4LA 4PG4A 1QYXA 3PGJA 1DIHA 4K26A 4J7XA 1BSVA 2Y1OA 3RSHA 1LQUA 3UOGA 3DBVO 3OJOA 1U2DA 1GQ2A 4D79A 4BKRA 3B6ZA 4RLHA 3OETA 5ES3A 3OF2A 3NT4A 1PQUA 2CFCA 5CDYA 4QQRA 2ZYAA 2Y68A 3JQ6A 4FJ1A 2BD0A 3ZNQA 1R4NB 1PL6A 4ZN6A 1ZSYA 2DPGA 5U1PA 3NT5A 3F4BA 4BS9A 3KEQA 2Q1SA 5U4QA 3RASA 2ZJ1A 4J9VA 3ASVA 5JYEA 1FDSA 1OI7A 3AM5A 5BSFA 1QRRA 2A9FA 4GGOA 1XWFA 4XDYA 3I9LA 1VRWA 1I2ZA 3DZIA 4E2YA 4GSKA 1WZIA 3SX2A 3FRJA 1GZ4A 1IZ0A 3LVFO 1E6UA 3QRWA 4O5OA 1Y8RB 4O0LA 3ZWPA 1B16A 5L7WA 2HK8A 3I1JA 3AUUA 2WWRA 1B8UA 1HF3A 2HMSA 1A7KA 5JDCC 4B3IA 2ZB4A 2H9IA 2VWPA 4OKNA 2DU8A 3C7AA 4HFNA 3I9OA 3TNLA 1JWBB 3HG7A 4R3WA 1HE2A 4AJKA 3F1KA 4OOFA 3DHYA 4MO2A 5JAQA 3WSVA 1ONOA 2IE0A 4D3FA 4CV0A 4M1QA 1RJWA 1A5ZA 3GFBA 4GH5A 4IDAA 3ROMA 4GX5A 1ULUA 5G2OA 4KTVE 4RJTA 3TOZA 3ZWCA 2YFQA 3T4XA 3WGGA 5DF1A 4CLOB 4D41A 3KZVA 2IRWA 2AQ8A 4CM9D 1ISJA 2C82A 4BMNA 1ZSNA 1X0VA 4AVYA 3L77A 3WQSB 4DLAA 1LC0A 4WLUA 1ZW1A 1LBEA 4NPCA 3WGZA 4D0RA 3PK0A 2VWQA 3AI2A 2UAGA 2A92A 4J7UA 3S2EA 1BXZA 3C7CB 3IOYA 4BNTA 1QV7A 3OICA 5A05A 2PV7A 5BNIA 1M76A 2QHXA 3H9GA 2IZZA 2CF5A 6ADHA 1LQTA 1R0SA 3ANLA 4MVJE 2GASA 5L40A 3BTVA 1N2SA 4M86A 4UVIA 1O89A 2E6UX 3PHJA 2FZEA 1I01A 3ZZNA 3ZV5A 2O4UX 1PGOA 1PJLA 4HFMA 4RPHA 1E3IA 1YXMA 3CTMA 4F45A 1N9GB 2Q1TA 1IUKA 5IFLA 4O6VA 2IYOA 3Q11A 4XYEA 3FPLA 4Z0TA 4IBOA 4CMHA 3ZU4A 4UREA 3L9XA 1O8CA 5A9SB 1C1DA 1DHRA 1E5QA 4PCVA 5I9MA 3S8MA 2NVWA 3EVNA 4JLWA 1R0KA 4JCOA 1ISMA 4IGEA 4JIGA 1E7WA 5JFOA 1D8AA 3MJCA 1UDAA 4FJ0A 4RQTA 2VCYA 4WCFA 5KJEA 4MVJG 4PLWA 4YRBA 3QWFA 3FNGA 1K6IA 2EP7A 3BMCA 4K1LA 4G5HA 4O1MA 1E3WB 1CQJA 2RBEA 7ADHA 3HDJA 4XQGA 2FPGA 4OXKA 3GZ4A 1DFHA 4NG5A 1HDZA 3WXBA 1MXFA 1AGNA 1HE4A 8LDHA 4P4NA 1SMKA 1DPGA 3KB6A 1K0UA 2HMUA 3EDMA 4ND2A 3KHUA 2X4GA 5JCJA 1L7DA 4HNHA 3HDYA 2VRBA 4FFMA 1DIGA 2VNSA 2AEJA 2Z1NA 3R3SA 3DO5A 5TGDA 4X54A 2AE2A 4Z9FA 1IPFA 5HS4A 5T67A 3I6IA 1SEPA 1BGVA 1UXJA 2Y1GA 3M2PA 4YJFA 3K73O 3GEMA 2NU8A 4XX0A 3ICCA 2GF2A 2X0JA 5A5FA 5ICSA 2ZTVA 3WX0A 4DC1A 5K6AA 3ZV3A 3BAZA 1B15A 5L4SA 2EKLA 4ZQEA 2Q3EA 3QVWA 5T57A 3E9MA 2B4TO 1T4BA 4MP6A 5MDHA 4F3YA 3H5NA 4OAQA 4WLOA 3NEPX 2XXJA 2LDXA 1DXYA 2OHXA 4Y6SA 3QVTA 4GQAA 2O23A 3H9UA 1I3NA 3GGOA 2VZ9A 1ZMTA 3BTUA 5KNLA 2Y93A 3WB9A 2FSVA 4TZTA 4ZICA 3DWFA 1OAAA 4K6CA 4BOYA 3V8BA 3M1AA 1YKFA 4HBGA 4FFLA 4L75A 1DAPA 4E5KA 4ALMA 4U6QA 1VJTA 1Z82A 3MCVA 3SBOA 1NFFA 3QE3A 1X7HA 3JYLA 3U4CA 1W73A 5G0WA 4WLNA 5T64A 3L07A 3PJFA 4BMVA 3HB5X 2POQX 3Q2IA 5JAMA 1EFKA 1T2EA 1P33A 3I9MA 4AJLA 4R3NA 3U4DA 2WYVA 1U7TA 4CQMB 1LA2A 2FWMX 3I4CA 2IXBA 4CUJA 5TS3A 2VT2A 4RDIA 4IDGA 5AXAA 4A27A 3WGYA 2B69A 3WIEA 1VL6A 3QIVA 2BI8A 4AG3A 4LSMA 1NWCA 3MJVA 3E5RA 3KYCB 1WAMA 1SCUA 2E82A 4L4XA 3NDJA 1R4NA 1DDOA 4BL5A 4D44A 5JMPA 3ZWWA 1ZH8A 1P1RA 4FFRA 1V8BA 2GPTA 2J3KA 1ENOA 4Z0PA 2NTVA 4QSMA 4CLRA 4CLHA 4N54A 4FFPA 1LEHA 5I7SA 2CVOA 3KXDA 3UUWA 3RJ5A 1GQYA 1X7DA 2WMDA 3IC5A 4RVGA 1XCBA 5ER9A 4CM7A 2GZ2A 1HL3A 2Q4EA 5AYVA 4QX6A 1L1FA 4A5OA 2A94A 4WEOA 2TMGA 1Y8RA 4PG7A 1F12A 1HDOA 1E92A 1JWAB 3TQHA 3ZCXA 2D5AA 4YAIA 1R12A 2Z95A 3CKYA 3TDKA 4YJDA 3AOEA 4YJGB 2X5OA 3WS7A 1SC6A 3GGPA 3OMLA 3D5TA 3LT2A 4PG6A 3I52A 4TVOA 4DWVA 2NQTA 1FF9A 5B1YA 4Y6PA 2CMDA 2QRJA 4RF3A 1JA9A 1HLDA 3QHAA 4NBUA 3JQAB 1NVTA 1ADBA 1YVEI 2DVMA 4W82A 4YAKA 3TZCA 5TJHA 2BKAA 3SJ7A 1PS9A 1BXKA 3GY0A 4CLOA 5F5NA 5IZ4A 4DIBA 3RU7A 1HSZA 1A27A 5IDQA 4IMRA 4CUZA 1V3UA 5TSDA 1XSEA 1ZMOA 2C5AA 4LRTB 2YZ7A 2X9NA 3MOGA 4E21A 5CEJA 3FTNA 1K89A 1Y8QB 4BNWA 4PN3A 3EGOA 1R6DA 4IDBA 3HN2A 1IY8A 1C0KA 4E2WA 2O3QA 3PYXA 2X9GA 3FPCA 4XYBA 5JC1A 2GZ1A 2ZTMA 3K92A 4XKJA 2HJRA 3NX4A 4XA8A 2ET6A 1ZKMA 2P5YA 3ROQA 1JKIA 1WDMA 4YT5A 4C7KA 1WDLA 4CLDA 5I9LA 4IINA 2NACA 4EI2A 1IULA 4E6PA 1NWHA 2I5PO 2WYWA 4CJXA 1PS0A
chains in the Genus database with same CATH superfamily
5BW4A 2WNIA 1N2JA 1QORA 1JJFA 4BZXA 2G1JA 3ORYA 4KI0A 5LKAA 4Q9JA 2UZIR 1N4DA 3QKRB 1AT1A 1PDWA 2IY9A 3KKOA 4G6ZA 3L7DA 1F38A 4O4IB 3VSAA 2C96A 5EMMA 2OCPA 2OSBA 3GEPA 2PAAA 5K2OA 2O2EA 1RPJA 4OM7A 1JYSA 2AQKA 4RY8A 1N5DA 2P62A 4Q4JA 1AVTA 4U7HA 5DI3B 4DHWA 4U9HS 1NUAA 2MYUA 1VSUA 3L40A 4ZCRA 5I47A 4N01A 4WXMA 2OHFA 4IH1A 4BX8A 2HIAA 4LGCA 1F7VA 1E9RA 2EWMA 2W6CX 4YRCA 1KY4A 1QQTA 3UT6A 4E15A 1T8SA 1A71A 1Y4AE 4RXUA 5GJBA 2WT9A 4RV4A 2IH5A 1KMNA 1CP3A 1NUSA 1XYGA 2OQIA 4S3MA 4ZV4A 2GK4A 3MIIA 2ZSFA 1WV0A 3C45A 4RBNA 4OGWA 2XNDD 2A0XA 3QU5A 5FLXA 5ALRA 1DRKA 4L57A 1BGXT 4COOA 2DR0A 1NQ5A 4L4SA 3H2JA 3IAS6 2CN1A 4LDRA 5B64A 1S1MA 1GPUA 1UMKA 2FSFA 1WNFA 4W7SA 4AY6A 3K9QO 5JCJD 4AZTA 3VPHA 4DR5B 3H17A 1KO1A 2YHAA 1KEUA 3K6JA 3WGQA 2KHZA 1RQXA 5DIZA 3IKTA 3FBGA 1QGDA 4HQFA 4NMHA 2JFHA 2DFDA 2JGFA 3RC2A 2QN3A 3FF4A 1T24A 2E87A 2GRAA 4MROA 4DQ0A 2J5XA 1JNXX 1XLVA 3ICVA 4IXTA 3MW8A 3ER8A 3L7JA 2HWKA 2VTKA 4IQFA 4RK0A 4RM3A 3VR5A 2WIDA 4U2DA 3THYB 1HE5A 4N0PA 1A9XB 1JIQA 5HUHA 1BYUA 2NXJA 3FIUA 3KHKA 4JU9A 3EIHA 3PVSA 4X84A 2RGBA 5EJ9A 1G3RA 1XP5A 2GTPA 3FZYA 3T5AA 3FHLA 3H1AA 5EERA 5AOVA 1OAOC 1DKQA 4AULA 4K88A 1LFDB 3N76A 3L8HA 4FB4A 1HKHA 2I99A 2I54A 1TC1A 4RD3A 4EG6A 5ES4B 4A36A 5AI0A 1QGUA 1N34B 3FJ1A 4BPBA 1RWOA 2Z6VA 3QYPA 1W47A 2X9QA 3I0NA 1UBFA 4J7AA 1KEVA 2FOIA 3SYTA 3ZBTA 4BWYA 2O8EB 1QH1A 4BGUA 4GEGA 2W22A 1EDZA 5KHOC 1JFSA 1PX2A 4J3JA 3AFHA 5JY1A 4E7OA 5JSZB 3QXSA 1IEXA 1P4RA 1J22A 4YT8A 3QM1A 1EXVA 5BN5B 1E62A 3ADDA 1P3JA 3OA0A 1XRMA 4G65A 5DHFA 3EAGA 4C20A 4NZOA 4MYHA 4AN4A 5KTSA 5M34A 1ABEA 1BQ4A 2DKFA 3EGWA 4UHDA 3DV2A 4CM8A 2GCIA 4HGOA 3AERB 5EJ6A 1B74A 4AU1A 2BHLA 2RHCA 3AFMA 1K88A 1H4SA 4K81B 5DCLA 2VQDA 1CLEA 1P0MA 3AEQB 3TPFA 1H6CA 3A27A 3K5HA 3SQNA 1KDPA 5BRJA 1H5QA 3PDCA 2ZT5A 5K0ZA 2B1IA 3BA1A 1GP2A 2YQ5A 2I7TA 3GJ0A 4MPTA 4WLVA 4OX9B 2LCIA 1FFHA 4ZQFA 3OD1A 5K0BA 2XDAA 5KCZA 2HSWA 1TZMA 1HO3A 3TCNA 4JP8A 3WP1B 1IZYA 1V5IA 3ROXA 2C61A 2F43A 4F8JA 1XVTA 3BF7A 5AM4A 5K0LA 2X1VA 2B4AA 2O4CA 1JVNA 1QCDA 1GUAA 2BMVA 2XHEA 3E1SA 5D3MA 1AGYA 4GX0A 5FPPA 2JKZA 2NTEA 3TFWA 1TCUA 1PR9A 2PHZA 3KYCA 3ZHYA 1JFTA 1UINA 2VOJA 2W6ZA 3OQJA 2C94A 3OPYI 4YJHA 3GCXA 3JQDA 1CY2A 3P5SA 4IUCS 3REGA 2XXAB 5H3CA 3EXIB 1XD2A 1USKA 2Q2VA 2ZJOA 4LJYA 4P36A 2DR3A 2Q6TA 4M0EA 4XCVA 3SLRA 3TLGB 3T1TA 4LYJA 3HDHA 2YS6A 2PZLA 3WL6A 5CDFE 3BZBA 3H6KA 2XCOA 3AYZB 3H4IA 1YUMA 2JHPA 4YAEA 4OI0A 2RH9B 4XASA 3S1AA 3V48A 4COKA 5AVQA 1CHNA 2JIZA 1XZEA 1F2UB 5IAAA 5IJAA 2F3UA 1S2MA 1ZVJA 1MB9A 3EQ8A 4KDRA 3EZFA 2F64A 2YZ2A 5TDHA 1XZCA 3QU4A 4XVUA 1FFBA 1AF4A 4FYJA 3WWZA 5IF9A 1R8QA 1Z0KA 1V0JA 4TMFA 3SFVA 4ZYWA 1OH7A 3EIFA 2BMAA 1OPXA 2PRKA 2E4VA 4IZHA 2VZEA 1WLSA 1X7YB 3BHNA 4GDMA 4B1FA 4C4YA 1RABA 2DEUA 3PNYA 1T1JA 3O26A 2Y9MB 3S44A 4DCTA 1U7DA 3GJSA 1Q3HA 1LNSA 3OEED 4PG8A 1J1ZA 4H1TA 1AO3A 1JG7A 4XYMA 3KXPA 5JNVA 1UT8A 2P6UA 2AUMA 4ID3A 1JHXA 3LCRA 4L50A 3ZE6A 5D6OA 1UBSB 2IYEA 4IJKA 3M4ZA 5SYMA 1MC8A 1U0OC 3FZGA 3Q15C 4IDOA 3WHKA 3F7TA 4RPGA 3K2EA 3TLMA 1JEYB 5AUQA 3ECAA 3DVAA 1OMOA 2PSSA 3A4TA 4LDZA 5JSUA 2W4IA 5ICFA 1YI0A 4RKRA 4AL4A 4GMDA 1CR2A 1P8AA 1YCFA 3EHDA 2QPLA 2QLNA 1T9CA 1VJ1A 3D8UA 2JKVA 3SS9X 2LZ0A 3T7DA 2HBQA 1NMZA 1RM3A 4KQ1A 2BRUA 1C4OA 4AAYA 3NMUF 4I8DA 4PYNA 5J2TF 2DBQA 3X1KA 5ILOA 1T91A 5C46F 2H51A 3IPRA 1KP9A 4DQLA 1SR8A 4CMCA 5FWNA 4RVOA 2O9JA 4EYQA 1IVSA 3GJYA 1ZVQA 1GARA 2GK6A 2IELA 1RBYA 1RW4A 4TUYF 1QBKC 4URYR 3VVLA 1ECJA 1ILWA 3MINA 4P98A 1NMXA 5C31A 3LW8A 3SF8B 1VZ3A 4DMUB 3I83A 1C8BA 2C5LA 4FYPA 1D1PA 4BNZA 1VOTA 3V55A 5AFSA 1NLUA 1WUKS 3DLIA 3KPYA 2Y1EA 3R0JA 3CX3A 5T6BA 4LJLA 3AUKA 4BGIA 1DWOA 2C9OA 4OLAA 3S29A 3C1OA 2BJWA 1L6IA 2G9ZA 4OLJA 5JNSA 3SHQA 1SXQA 2EAUA 3ILHA 2DFVA 4RENA 5FFFA 3AR4A 5FULA 3VQTA 3WL4A 3X0DA 3F6PA 5C52B 3A2KA 3BREA 4ND3A 1TQ8A 3RF6A 1Z2NX 3OFVA 4EFLA 1RQLA 2IHUA 1UJ5A 2M6LA 3BCRA 1AS2A 1QMPA 3V4RA 2RGYA 1MO5A 2GXQA 4TKVA 4YVFA 4YX9A 1BTOA 3SQWA 2HU5A 1DIRA 2VRNA 1PR6A 1EFAA 2AYXA 1LVGA 3LC0A 4YJ2A 4E2XA 3DAHA 4W4TA 4R7TA 2IT1A 5A4IS 5BSWA 2AEFA 2R6ZA 3JQGA 1PK9A 1BW9A 1TJ5A 3PUHA 3K1TA 4OBWA 3A1SA 3MNFA 1I4EB 1RCUA 2KB0A 4Y1RB 3O92A 3W1EA 1XTRA 4ASUA 4AROA 3A10A 1ZOPA 1CLUA 2VDOB 1GNQA 5BR1A 3FNFA 1R9JA 2R62A 3OE1A 3DZCA 4RHCA 3WLHA 1PW5A 2ZSKA 3H1EA 4FU0A 2J3EA 2QRNA 3BL5A 1P44A 2J6CA 3UW1A 4KJXA 4RGYA 4UBMA 3R3ZA 4TL7A 5ALMA 1XKTA 3SP1A 3V00A 1G18A 3ZCSA 5JD4A 1IOLA 5E3HA 3I4FA 2C9ZA 4IHJA 3ZI4A 3PFIA 4BUCA 2H1HA 1ADJA 2EIHA 2H16A 3DZDA 1QHHA 1ZIYA 2Q9BA 2GLTA 3ODPA 2PYZA 4A03A 5E1BA 1DSSG 3I28A 3V3KA 1K5DA 4EGAA 1TQ4A 1AQYA 3EW9A 3QVLA 1IB0A 3G2JA 4DM7A 5ALSA 1VB3A 2B83A 2YXLA 1M6NA 1SXHA 2GO1A 2GPAA 2ZTUA 1OBCA 1WD5A 4HSEA 1SXPA 3ZDCA 4MKGA 1MB0A 4DNQA 4I8XA 3PT9A 4YACA 3VKGA 4UW9A 5LP6A 1TM5E 1PQWA 3U7QA 5CT5A 2QMUA 4X1IA 2FPIB 1TMGE 2HCJB 2IPNA 3A36A 1NU6A 3LLUA 3LY8A 3QI2A 1K98A 3DXYA 3BWVA 4UUPA 1Z6ZA 1VKNA 2HJSA 4YMTA 1QU2A 3BL6A 1SXIA 2HBZA 1CTQA 1NI3A 3G8CA 3BM5A 3F5DA 4WKOA 3R77A 3IPLA 1O9GA 5KQMA 2NOAA 1JH8A 1W1UA 5M29A 4LF5B 3MTDA 1NVWQ 1ISGA 5A0TA 3KUCA 1QZTA 3EAQA 5EJMA 1P5RA 1T6NA 2DBZA 4L8FA 4WKCA 4FKZA 7AT1A 4O3FA 1K2WA 2NU6A 4DSZA 3C5EA 1NM5C 3P9QA 4EP1A 2AT1A 2YNMD 1BX3A 3WIUA 5JYBA 1JG3A 3SXPA 5IK2D 4REQB 3GA5A 3TCXB 1TLLA 4CGYA 2ZR0A 1WSBA 3LWNA 5B7QA 1HEYA 3LXMA 1H2AS 1LK5A 1QRTA 1STOA 3BDIA 1U7UA 2X4LA 5B36A 1W88A 3R6GA 4I4TA 2AZTA 4X20A 4BE4A 2IYUA 2P90A 3O74A 4LBVA 3EFOA 3KHTA 4GPD1 4AKTA 4RKFA 4CIVA 1JPJA 1WU7A 5CHEA 3GI1A 1Q7GA 3DBOB 2PGNA 2XD9A 3O75A 3RAPR 1MQAA 5JRJA 3AF6A 3B9PA 3SF0A 5CIWA 1KBOA 1Y6GA 4CR7A 5B7NA 1JALA 1GUFA 2XKKA 1Z7GA 3MWDA 4HEHA 3VNQA 2VNHA 2VF8A 2WUVA 3DE7X 4MA4A 5CW2A 4MVJI 1P3DA 3U9LA 2HADA 2VZ0A 3HCEA 1YI1A 4QREA 1LRJA 4GRAA 4UXHA 5DK6A 4F5YA 1CUGA 3PTZA 1MB2A 3WA7A 5IWAB 1XF9A 2G63A 1NJ8A 3U37A 2PL3A 3O8BA 3NXSA 5EOVA 3VZRA 2XB9A 4WNAB 1M2HA 1Z06A 1ZOLA 1Z26A 4RE5A 2QTMA 3WB1A 1DNPA 1H1LB 1UFKA 3PFWO 3LFUA 4UJ3A 5A7HA 3KLNA 1UKZA 4PZAA 2I2FA 5TMDA 3DLHA 4AK9A 1TKCA 1E3JA 3WMXA 1Y5MA 3H3JA 2ZM6B 1WXQA 3HACA 3FFBA 4NE7A 3NEYA 2FX2A 3WRXA 2Z6AA 1YZKA 5LZ2A 5GM1A 1IQUA 5JS7A 1JIXA 1KEEB 4H3HB 4DV2B 5DMHA 2B4KA 2H9YA 4IV5A 4YCAA 4BO4A 4RLSA 2CNWD 2B3DA 4LECA 4LUCA 2KSQA 3DC7A 3CNBA 4BKOA 2QI9C 4BBJA 4PNHA 1ZCZA 2M6SA 2E4WA 2HA5A 4RADA 1U2GC 1XTZA 2AI1A 2GD0A 1DIOB 4RV5A 2PRJA 4D57A 5K9ZA 1PO7A 3DLAA 4Y2QA 3BFXA 1CS0B 3EXHA 3HSYA 4I3GA 4FE7A 9ATCA 1PZFA 5FO1A 4Z4EA 1CIVA 1P2SA 3CWZA 1W4AA 3GRKA 4M7RA 5LYJF 1W49A 1E7RA 3LY7A 1Z5VA 3O1JC 1YZFA 1W59A 1AKMA 4FX5A 3AL0C 1K3TA 3O8QB 4N8DA 4XAQA 3RC9A 1XRSB 3ZGZA 5KHLB 3HXQA 4JITA 4KDCA 5LBTA 4U6SA 2OHGA 4YCLA 3G8BA 2OBMA 4PICA 1LZKA 5C7IO 4LTDA 3EWNA 4PR0A 1MTOA 2NYRA 2OGUA 3EF0A 3L8FA 3QOWA 3H04A 1CUAA 4ZVNA 3T4PA 1M5TA 1D04A 1T5LA 3WNDA 2C2OA 5HQ3A 4JJ8A 4XE5A 2G17A 2VFAA 1XN1A 2HF2A 5LXTA 1K75A 2BEUA 1RT9A 2Q6OA 3KAPA 1VB5A 5LLDA 2HRQA 4B6EA 3IMEA 3SJAA 4CIXA 1OLXA 3EFHA 4D8XA 2F9MA 4EW1A 1YB2A 2PUJA 2ONJA 3TL2A 5C35A 3CF0A 4L2IB 1D2MA 1VMKA 1LPMA 1MOZA 4RMHA 1Z7BA 1C3XA 4WY5A 4TRMA 1RYMA 1I6WA 2NU7A 2AFHB 1ZD8A 1TA4A 1PD1A 1NNLA 2BFOA 3WNVA 4A26A 2JGRA 4B5KA 1GRCA 4O4LF 8GPBA 5FPQA 4WFJA 2Y2VA 4LXGA 4LJSA 1JIVA 4PCLA 1NZDA 4HPXB 1FNSA 2JLWA 4ZFNA 1YVRA 2ZJ0A 1PSWA 1PT7A 1W4ZA 4N7MA 3GO4A 2IZ0A 2ZTHA 3KZMA 4V2IA 2I4OA 3ULKA 4J4TA 2QSZA 1XCOA 3OBBA 2ZI3A 1SHTX 3GGJA 3OLXA 5BN1A 4FM9A 4DVJA 3H0KA 2Z09A 1U0BB 2QUJA 3H2SA 3C3JA 3D3WB 3ASYA 1TCVA 5E7QA 4O59O 2GPSA 3TECE 1UKVY 1UQUA 3LVQE 4JVLA 1AOXA 3ECCA 4K9QA 5AH0A 3PXCX 3T0FA 4B31A 5ICEA 2HT1A 4PYMA 2ARKA 1R74A 2W2MA 3WJ2A 3WIDA 4RK7A 1JMVA 2ERYA 3T5TA 1UBTS 4R2KA 1NBEA 3VC2A 1V6AA 3WGMA 2P9GA 2FEXA 3H87A 2P9QA 2ZRJA 4E33A 3ZGYA 1XDZA 4HUTA 1J56A 1TVEA 4AZSA 3Q10A 4IMPA 3KQUA 5E6RB 2DLCX 1I10A 4YQZA 4K9NA 5FBHA 3RWBA 4EPRA 1ESCA 2VOEA 1I9CA 3RVDA 3UWDA 5C8ZA 5K09A 1FDRA 1KH3A 2XNHA 3EDQA 5FR2A 5JXJA 4KO8A 1HG1A 5JH7F 3AY6A 3D7LA 4C6TB 3F90A 2WD7A 3RVNA 4X66B 1NFRA 1YZHA 2D7CA 2XUAA 4Z1OA 3H2GA 1FP7A 4TTJA 1VJGA 1YGPA 3O8CA 4NJMA 4LV5B 2DRIA 1E4YA 4XJTA 2PTGA 3CZMA 3DP9A 3KM0A 5EAIA 4NOJA 4YYZA 1IJEA 5BOSA 4JXXA 1DJQA 3SQDA 4RQBA 3B8HA 1CERA 1H94A 3U4QA 3ZV6A 3FVWA 4YRLA 1OX4A 2BGKA 3HA7A 4U00A 4CCYB 4TYWA 5T8KC 3OCZA 1ZK3A 3QPVA 2YWHA 4XB2A 4BMXA 2NUTB 4NJOA 4D9CA 1IEQA 3HDTA 4N0DA 4ETMA 4JBNA 3CISA 4ZKEA 3IT0A 2B4QA 4WL0A 4ZV9A 1EAMA 2Q4RA 1JKFA 2W58A 3DOCA 4QDJA 1ECPA 3V8QA 3U62A 3IJPA 1PDVA 2EJBA 5JY6A 4KODA 2VDWB 2LKCA 5ADVA 3K0EA 1Q1NA 3GVCA 1PT5A 1UEIA 5ECWA 4KO3S 2ZIFA 1ZK4A 3JYQA 4HADA 4Q3BA 4KR3A 2O19A 5JOQA 4Q93A 2CWDA 2NNLD 3I58A 1ACMA 1W5AA 3ZWOA 1Z33A 3NHRA 2GJAA 2FSPA 3BE6A 3SEAA 3QU2A 4H16A 1Z29A 2EIXA 3A1CA 2H1IA 1UBLS 2PS1A 3JARA 2CZCA 2PY6A 5BWCA 2ACKA 3U13A 4Y7CA 5KKNB 1KJJA 4LCJA 2QZJA 1RAEA 3DZ8A 1KKUA 2YY6A 1BS1A 2O0KA 2Y1FA 3E22A 1NIJA 2DH5A 2BONA 2QLBA 3LQFA 2QMZA 4DJJA 1Y4SA 1ONPA 3FWPA 5K0GA 2A0WA 1MJNA 2H4ZA 5DW3A 1CQIA 5I7UA 3KE9A 5BR4A 2BDEA 1W94A 5JO9A 3KKLA 5JSKA 4NHEA 1XZFA 4PZDA 3DDWA 3GFQA 3TGLA 4P83A 4BN0A 4WK4B 4QGBA 1DDIA 4B8WA 1FP2A 4LDPA 5CX1A 5FRDA 4F9TA 1KAOA 1V9LA 4Q37A 4B47A 2V54A 3GARA 1MHPA 4J1TC 4ZHQB 2QQFA 2YH2A 1RXWA 2NMVA 2Q0HA 5KSWB 3TNYA 1VLVA 2XY4A 2RE8A 1BDBA 4CM4A 4PXSA 1PFKA 3FSEA 3D31A 2RGUA 2Y2UA 3LD9A 3GUVA 5J2TB 2VVTA 4FR2A 2Z3WA 2H2WA 1LDGA 4Y6OA 1XQ6A 4EVIA 4NK5A 2D1QA 2Q5LA 1NW5A 2BFWA 3H7AA 1OFGA 3I64A 2HSDA 4B2YA 4D96A 1ZI8A 4X41A 1QAOA 2XCLA 4OI2A 4G85A 1NGSA 2Y99A 3EB9A 3OP4A 2RHLA 2OAP1 5IBRA 2H2FA 4CQJA 2H57A 1HMYA 3KKMA 1I2MA 1KC3A 4IDCA 1YB6A 4JUDX 1M1ZA 1JJ7A 1PLLA 5A0FA 4N3NA 4BE7B 4EKDA 2GLUA 1G17A 2UZ1B 3HYNA 4G0PA 1LBHA 1E2JA 2XMDA 3S2FA 1HV8A 3SZRA 3STXA 1N9ZA 4OO3A 2HNAA 1O6ZA 1EP2B 1XLWA 4NJEB 1HEIA 3E5NA 3IB3A 3OQ1A 4HR7A 5AJYA 3OIGA 3GJ6A 4E31A 3K71B 4WEQA 1QIDA 1RPAA 1U98A 5ALIA 1NTRA 3KC2A 1NAHA 1RM4A 1QAQA 3FNBA 4X7RA 4BJ6A 3DMNA 1PK8A 1QFJA 1UKAA 1HE8B 2DBYA 2GHRA 2FY8A 5GZ6A 3WFIA 3PPIA 1KAHA 2PKRA 3E03A 3P96A 4U5QA 1XR3A 2BEKA 1D1QA 2BUBA 4UOZA 4IRXA 4XIIA 5DLDA 4MRRA 2F4VB 5FLKA 5LMUB 3DAYA 3OM9A 1NLZA 5AJUA 1E20A 3OBIA 4JC4A 3ZGNA 5A5GA 2AOUA 5K0SA 3AM3A 3N2LA 1E2DA 3H1TA 3QV2A 5FX2A 1RU3A 4TL6A 3Q87B 3LXRA 4LJKA 2I9PA 1L3CA 3SG0A 1I30A 4MV5A 4RY0A 4BB0A 1K8RA 1MA3A 4IIVA 4PX5A 3RTDA 5CVDA 4FI3F 3S2YA 4CMIA 4ZI7A 1XRPA 2KX7A 2JL1A 2WF6A 3M3DA 3QBDA 1XA0A 2OMEA 1AU9A 1F06A 2DH6A 3H5OA 3OG9A 3P9NA 4FEYA 4WKGA 2GZMA 5FV4A 1WZ2A 3RG8A 4KXNA 2BFCA 3OLZA 3PJGA 4XSGA 3RS8A 5MGBA 3OJLA 4QICA 2TMYA 2D2IA 3G2OA 2IV7A 5HPYB 1TGYA 1CXZA 1R00A 3JYHA 2IPMA 1B0PA 1CEXA 3IV6A 4EW3A 3GQVA 2O2ZA 1YFLA 4C3OB 2C88A 1PV4A 1YZYA 3MSXA 4JVMA 3BMXA 3IUSA 3EPKA 4G1BA 3KPJA 3I9V1 2JLXA 4JLVA 1SZCA 4O2BF 1R8YA 4U0KA 2LD4A 4QUKA 2GZSA 4YXFA 4TLAA 3DTVA 1I6LA 1N0VC 3CT6A 1YHZA 4Q7QA 4S04A 1T13A 3O4JA 1J5XA 4AMYA 2HOQA 1QG2A 1H3FA 1WJGA 2DPYA 1BOFA 2BMFA 3MS7A 1Z07A 2J3QA 4GI1A 4YXWA 4XVQA 4QU5A 3K09A 5DEOA 4RLFA 4TLCA 2WWIA 3QU7A 2WVAA 3LOUA 4GMHA 4Q24A 5CPBA 4JP3A 4YCBA 4EKNB 4F1WA 4ZU1X 2ZE8A 1VM6A 1LVHA 5A4MS 1QK3A 4KZKA 4U9IS 1UPCA 2UXDB 3EDYA 4TMTA 3OJCA 2B82A 2HJWA 3B13B 4AYTA 1DUVG 2VHYA 3OT5A 1ZPDA 2XWBF 4ISBA 4FK8A 4CE6A 4E22A 3PJRA 2W2LA 3A6ZA 3G5AA 3K9NA 4MW0A 3ZQ6A 4V1CB 1M6WA 2WOOA 4ZRDA 5EFOA 2RHJA 5T41A 2N1MA 4NF2A 1TJNA 4Y6GB 4LJ7A 1R6XA 3BORA 4NS4A 5CYFA 4EZEA 5K3FB 1Z36A 1RP1A 3SIRA 3B53X 1Q3KA 2ZAOA 2WFZA 3HFGA 1E99A 1FSGA 1Q2XA 3IELA 4ND8A 3K8YA 5BUCA 2P2SA 1J1UA 3UF0A 3PUWA 3BDVA 1DEOA 1HQKA 1XFDA 3SX4A 3WG9A 4EVRA 2B35A 2O0MA 3DUFA 3SC2B 1Z8DA 1G8KA 3JRWA 1J70A 1FP1D 1SBIA 4J2HA 2DETA 1R6UA 3PUIA 1JSZA 3AVQA 1WZUA 4Y6LA 2UXBB 4BV3A 4CUKA 2XZTA 3RI3A 3ZQ4A 1SC9A 2PGXA 3G0CA 3HXTA 4BNNA 3PKIA 1BH6A 4Z8XA 4E5VA 3BD8A 4HP8A 2H3EA 4F9GA 1A76A 4RYDA 3IEUA 1T9DA 1V4NA 5B12A 2CV2A 1HEUA 2EFDB 2YYAA 3OFSA 1AKYA 5FI1B 2PU7A 4GQIA 4IHKA 3SK0A 4YR7A 1DKLA 1KRHA 4CEJA 1JAXA 1KI1A 2ACVA 2V5AA 4CQLA 3DW1X 3F2IA 5HG0A 4KVZA 3UFBA 1IN5A 4NFHA 3TEFA 4FYHA 1H2FA 1UXKA 4KXYA 2YRXA 1K4KA 1ZGBA 1G0NA 3HUDA 2IDJA 3RC8A 4GLLA 5C9ZA 1DT5A 1TU0A 3M5WA 3NUQA 3PGVA 5AKKA 2VJOA 4A5SA 4M0LA 1QS0B 5CVCA 2OVBA 3ICWA 2H85A 4BO6A 4DR7B 2NW6A 3BGOS 4CQMA 3KUUA 1XCPA 3WDKA 2PM8A 4GE0A 2P6PA 4WH0A 2QUIA 2VXYA 4KW7A 3W3ZB 3O1IC 5AW5A 1KAMA 1KPIA 3QWBA 1XAHA 3BAFA 3EVDA 3GMSA 2BPOA 4YRDA 3G9ZA 1IWBB 2WJIA 1E64A 4L9RA 4NZNA 5DTIA 3TW0A 1XTQA 1WHTB 3TXYA 2ZIXB 3CE9A 5BSGA 4CV2A 3F3YA 1GFWA 1V8DA 1WMAA 2OBBA 1P0PA 2HH9A 4MXDA 4MVYA 3T38A 3V5NA 5CRIA 3AEXA 1P1JA 1NNEA 4G23A 4GKAA 1DJLA 1ODFA 3AUXA 1RLOA 1V3TA 1M2WA 3I5XA 3M6XA 1NJ5A 2CWWA 2GM4A 1YRBA 5ARDA 5FWYA 2O3SA 3T1HB 1U2ZA 4FSDA 2X86A 1G3QA 4D4IA 1QF9A 5B7GA 4YV7A 1NBMD 2IUTA 1XRNA 4UTOA 5DBFA 3U4MA 2JIDA 5H70A 2XW6A 2ZAMA 3T1QA 5A3QA 4RVNA 5KPDA 3NIFB 2YWBA 4IIJA 3L41A 2YWGA 2PQ6A 1TM2A 1IZ9A 1KGDA 4TZ6A 4XXHA 1OFIA 1XELA 4JROA 4TXHA 3ZBQA 3ZJ5A 4EEXA 2XQFA 4MPRA 4J4HA 2X8JA 1F2TA 3H5IA 3ZWKA 5H9VA 3AJEA 2OZPA 3UH0A 1T8RA 5GONA 3G0GA 2IP4A 3CXUA 1TT5B 1JQAA 1XZQA 2GCGA 2VA8A 1N6KA 3WQRA 5B2ZA 2R8OA 4ZYZA 5CFZA 3CEJA 3LT5A 4UD6A 4KFSA 1ODSA 1D2HA 4XD7A 4IRMA 4EI8A 4EO9A 1MDFA 2AMYA 4Z0NA 4NEQA 3GRCA 4Z3DA 2ZU6A 3GP3A 1K1EA 3OQMA 5ALQA 2F3SA 3C4QA 1ZXBA 2OGZA 1EFHA 1E2KA 1YR9A 3LX6A 4FOSA 2WI8A 3IO5A 4RK4A 4RTNA 1RYDA 3WDMA 5B1DA 3S68A 2C8KA 4TZ0A 5CT6A 2UDPA 1BWRA 1ACLA 2P9HA 1X0XA 2DUWA 4TVKA 4F4HA 2PBLA 1XALA 3E1GA 3IBTA 4N7BA 4N5HX 4CDRA 4HXGA 2ZT7A 5DEIA 2ZYSA 3R9WA 3TPZA 4JLSA 4EHJA 4U7DA 3BHMA 2CUNA 2P3QA 3FMVA 1PZEA 4TYNA 1XNHA 5HIMA 1CUYA 2I2WA 4P53A 5DXJA 1K9SA 1BCRB 5DGXA 2P6NA 1W0KA 2GRJA 2IDZA 5EFZA 3DT9A 1JHPA 2IYRA 3DHNA 3N86A 4QFMA 3KJXA 3O83A 4RW0A 4XYGA 2Q7OE 5ALXA 4LF9B 2X40A 1R6TA 4MICA 3EUFA 3EVEA 2HSGA 3KNZA 3L0ZA 4R2HA 4W1SA 1AXEA 3URMA 4BGEA 4CMKA 1FMCA 1JL3A 3ET4A 4MWCA 5J40A 3PBKA 1RR6A 3KXLA 1MEOA 3QV1A 3VU8A 2WSBA 3PIRA 2Q29A 2C5GA 3L8CA 4R2XA 4V2UA 5CNJA 1VBKA 1LWNA 1Y1TA 2H1CA 4L0QA 2VZLA 3GH3A 4NBTA 1SVOA 3NIWA 3SE7A 3FPBA 1NRIA 3ZIAD 1QR6A 1IMJA 2VEDA 3C24A 2RGCA 3F9CA 4IAOA 4JJ4A 4M60A 4OJTA 3WYDA 2HYIC 4UULA 3G1WA 1NVBA 4JWTA 1X9GA 2NUPA 5EEGA 2P9CA 4EA8A 3U4AA 1RHKA 3UENA 3BMOA 5JH7B 5EMJA 1BHO1 1XXHB 1IU9A 5F2KA 1KVRA 2CK3A 2X8WA 3C14C 1T2DA 2ZTLA 3NPAA 4JNKA 5JSFA 1Y5IA 2OPBA 1GPJA 3DQPA 4Y8VA 1RM5A 2Z58A 1CUWA 1I8TA 4KQHA 1I1NA 1E3MA 1ZN9A 1VYTA 1DAEA 4V0OA 3TQOA 2P35A 4WVFA 4JJEA 2Z43A 3FWNA 4HQLA 2C92A 1RHRA 1M1YB 3EUWA 3MMZA 4RIFA 2DCUA 1X74A 3TNFA 2V1UA 3NRBA 1QVZA 4J2TA 2ILTA 3I37X 3KWMA 4BNDB 5KYVA 1YRQA 4E2ZA 1CZHA 2J46A 5HZHA 4IQ8A 2Q6KA 3EJ6A 4E1BA 1U1CA 4HGNA 4C30A 5DWQA 4M21A 3RC1A 3HS3A 3C4VA 4HWSA 1IZZA 1JN0A 2ZVPX 4Y18A 1XTVA 4B32A 2Q0SA 3U2QA 2OFWA 1L5WA 2BFMA 3V8PA 1QWSA 5JLJA 2WM3A 3GIDA 1BCSA 4X1OA 4QOIA 4EG1A 2QP3A 4GI2A 2JLRA 1J8YF 3ZX5A 1QK4A 3URKA 3FI9A 4M4SA 2PV0A 3COJA 1CDZA 1WVMA 3QVJA 3G2NA 5I5GA 4PGMA 3DBLA 1QV9A 1FX0B 1JKJA 1OYOA 2RHGB 2W6NA 4FOLA 5EWMB 5FV7A 4PAQA 1JA1A 2AFHE 4G1MB 4NZMA 5HF5A 4D46A 3BFKA 2VBFA 4PBSA 1OVGA 2J85A 5IDWA 3MA0A 4B4WA 5LMNB 2EW8A 3KOXA 1ONNA 3TQFA 1T9GS 2FW7A 4MV8A 4FYXA 4D5GA 3LC2O 4LSWA 1G291 5CM8B 4ZT2A 4UBOA 5BWNA 3BXHA 1XE3A 4TSFA 2MTBA 1MUUA 4LMBA 4WBNB 1W85B 5BSRA 4B2IA 1UP7A 2EEZA 4GLJA 3GPCA 2X6RA 4UU1A 3TKLA 2AKAB 3VR5D 2J3MA 2QY9A 1JU3A 2GUGA 3OEHD 2VBIA 3O21A 5EIHA 4K5QA 3ABZA 4XGIA 2ZK7A 4KACA 4B6GA 3U61B 2JS7A 4UVGA 4EG0A 2XNSA 2WM8A 1OCEA 1DX6A 1YB4A 1DBIA 5I6DA 3DBHA 2Q5IA 2GBLC 1KYTA 1G16A 1VA5A 2PT9A 3VVBA 4IO0A 1GA6A 4HEQA 2DHDA 5F77A 1E2IA 1Y6RA 1JDBB 4LOKA 4XLTA 2IHNA 1G8YA 4GM1A 1MABB 2P6RA 3CJQA 4GF5A 1C7QA 2QF7A 4EKIA 4LXQA 4Z4HA 2Q1XA 2BHRA 3LDFA 1LI4A 5E6SB 1A95A 4YCJA 1I0LA 5LOVF 2CYCA 4BJ1A 1F0PA 1BEEA 1UZUA 1C3OA 1PHRA 1CEEA 2ZS7A 3HN7A 3VFDA 1NZFA 3BH0A 3NPMA 3FJOA 1MC1A 3HJUA 6AT1A 1MC5A 3OY7A 1U90A 4LX0A 2H00A 4P8RA 3D2AA 4R1MA 2I6GA 5AHXA 1FJHA 4KH0A 3CLSD 4XQEA 2PCJA 3W2HA 3Q3HA 4M1TA 4E4RA 5A1TA 5BMVF 5K8CA 1LSOA 3VSCA 1OX6A 3ASUA 4FOOA 4ZDKA 1A72A 1LPSA 1GVHA 3FR8A 1YBHA 3JALA 4MUAA 3FYCA 1E61A 5KYXA 5FAKA 2BMWA 3Q3CA 4B6PA 5JJ5A 3OCUA 3K32A 5FOTA 1CSEE 5P8WA 1REQA 3H3FA 3INTA 5LQSA 2RIPA 4AB1A 5DNCA 5FH9A 3FDXA 1T0IA 1R64A 4XUCA 2GEJA 3C6QA 2HV8A 3L02A 3H4MA 4URFA 4CV1A 1BG6A 1P81A 1V37A 3GLIB 1I0IA 1F6WA 3VDNB 4WUTA 4WZAA 1ZH0A 4NHOA 4QVGA 1QIMA 4QUHA 1R8SA 4TROA 3T9AA 1M33A 4AP6A 4PYLA 3RVJA 3T7EA 3NASA 1A04A 1P1IA 2Q6IA 1TADA 2X1MA 3CZRA 4QATA 1QO0A 1RQGA 1RXIA 4KNWA 4YMIA 3JD3A 1WXWA 1WETA 1HQYE 1P7YA 3HR7A 4KV9A 5LN1A 2GD1O 3VPSA 1FTGA 5FNZA 5K99A 3EIQA 3RYHA 1K7CA 1M1UA 1AQ6A 2FHSA 1GNSA 3FVQA 2NO7A 4FFDA 1ZX1A 4OHXA 3U31A 4MW2A 4HAOA 3MLAA 4DDMA 5GINE 1UEJA 3IMCA 4R40A 2BZ1A 2A7XA 3WGJA 1B7GO 3CSUA 2JZOA 4Y9DA 3O4RA 2FOLA 4JOQA 4BQEA 2FF5A 1E0JA 2YRWA 3DAFA 4Y6RA 4PTLA 3W2IA 2GQ0A 1WD7A 2P3LA 4QYSA 3PUZA 4EW2A 2WTAA 3CUSA 1JG1A 3G5UA 4DCCA 1K7FB 5IXSA 1L7QA 4M1KA 1L5NA 1RQNA 2ZETA 2C57A 2WIGA 3O1LA 4Z7OB 2DTXA 2N9UA 4L0CA 4DABA 5I7VA 1DZIA 2NU9A 3BTSA 2VSQA 3QEMA 2MU1A 4MV7A 3NAMA 1JIKA 1JLLB 4B3FX 4D6YA 5A3RA 4RX1A 2FEAA 5AW1A 3WGKA 4Q00A 3WV5A 4JYMA 3NORA 1VI2A 1YOVA 1QE5A 3BGSA 3AF2A 1CUBA 1FP4A 4B84A 2AI2A 1QH8A 3DC2A 5KPJA 1UPXA 4JUIA 5K0CA 2O2JA 4YPOA 3N39C 2O5EA 5IN5A 1MO2A 2BIFA 3OMWA 4C7OA 5IAKA 3DH0A 1ODTC 3ZK8A 5CJJA 4HUQB 4Y2GA 5AM2A 2WSLA 5HOQA 4NZYA 1UFOA 5CJ2A 3ZWAA 4WMLA 2CXHA 1SVLA 2FW1A 3ZY4A 4MHTA 3B51X 3GLFA 3C8DA 2AFIA 2ZPUA 1NNSA 1O87A 4TLEA 1JILA 4TT3A 4UEOA 1ENZA 4HDSA 3ZE9A 4G0QA 3F74A 4DTIA 3JQRA 3C48A 4KR0A 4QDZA 3T99A 2ODPA 3BBPA 3OFND 4XIJA 4NABA 1FBTA 2R6R1 4XPIA 5ESRA 5BUQA 1J09A 1GZHB 3WXMA 1SA0A 2HWYA 1A69A 2RHDA 3NHMA 1GCGA 4Q47A 4JENA 2AHRA 3PEWA 4IJWA 3L49A 2DYKA 5TRTA 2M98A 2O7NA 4BCBA 1NULA 5CCEA 1W1IA 2IHVA 4LEIA 4D26A 1LDEA 2D06A 3C43A 3KXKA 3UH1A 1SKUA 5HDBB 1KI3A 2WYIA 3N28A 4IY1A 2Z5FA 4RIGA 3MZ0A 2XTJA 1RRMA 5CA0F 3GN2A 1A9SA 1Q0LA 1UM9A 3GOQA 3HI4A 5CVEA 2PR7A 4ZO8A 4WGGA 4C1BA 2GNPA 3KB1A 4GSLA 4QRHA 1ZGAA 3WGTA 1PJQA 1B3RA 1KXJA 2NTNA 3J7TA 2AKEA 1YDEA 4H59A 4FMPA 2F1HA 2XUIA 5AICA 3WWOA 4DXAA 2VJBA 4FOTA 4DA7A 1AG9A 3OQBA 1RVDA 2PZGA 4R1LA 3BMNB 4WKPA 2GFQA 1IHYA 2Q3MA 2W2OA 3MJTA 3GEGA 1OFHA 4U39A 5J5CA 3TK1A 2FPWA 1PL8A 3VNAA 4MDEA 2FE1A 4PRYA 2JASA 4FYYA 1YIOA 4RCYA 1E7QA 2VHQA 4MWTA 1NVMB 3ICQB 1H8ED 3CRZA 2O3JA 4EJ0A 5HF8A 3S7ZA 1T5DX 3SHVA 3SNHA 4D9BA 2VTBB 3LBFA 4ZAYA 2X1HA 4IDDA 2ZYTX 4XR4A 3WL7A 2C84A 4QGFA 5EHZA 1V71A 1ZQ9A 3P2EA 2GNOA 3C6MA 3ETDA 2XF8A 3IE2A 3UB3A 1N2ZA 4FLFA 2DKOA 3NJ8A 3ZHBA 5MN6A 5K4AA 2FPPB 2VF4X 3VJLA 3CPEA 2OQVA 3ZDBA 3Q9UA 1P1CA 3IKJA 1KFCB 3COPA 4LMPA 5H4GA 1Q7RA 2RI0A 4DEXA 2QA5A 3A9UA 1OC2A 5CVTA 4S1TA 3I34X 2EF1A 4IH4A 4PRLA 3ERCA 2ECQA 1UKEA 3I01A 1JLSA 3JWGA 4MMXB 3EQZA 1NYRA 5DW0A 1PWHA 5KOYA 4V1CI 1Z2OX 3PFCA 2CY0A 5AJZA 4IMIB 5I7EA 3OF3A 5GJCA 1WMSA 4Q3DA 4U3JB 5DP1A 4QPNA 5GPBA 4RTRA 4O2AB 3KTDA 3WYBA 3MRXA 2PMWB 1ENPA 2WQZA 3T7AA 4A0QA 2ON6A 4H08A 4TKMA 5HGJA 3QPCA 1RXYA 1E2PA 1NR1A 2I4TA 3U1TA 9LDBA 5IXJA 3SSAA 2QRPA 2GUWA 2XTZA 3DWEX 1EMDA 3KLOA 3ONDA 5BVGB 2PKQO 7REQB 1UBHS 1NDQA 2A1UA 3AZPA 1NFQA 1E1NA 3MOSA 1DV1A 4NDAA 5ER6A 2WOJA 5JPIA 4EYEA 4PONA 3UXMA 1R66A 3ROPA 4UNNA 2XODA 3W9SA 4LRUA 1P2FA 5KYYB 5E9WA 2QXTA 4JJFA 5H5JA 5HHTA 2YUTA 2IH2A 1GAJA 1VIVA 3D02A 3PXDA 2J0UA 3RIYA 1P4GA 2ZRLA 4YUAA 4Z4QA 3C98A 1OQAA 3JQ7A 3KQPA 2XPCA 2A7QA 5F2EA 3EY9A 3HB4X 1T4DA 1Q44A 2FCAA 2H4FA 5AUNB 4F46A 5FBKA 3VXKA 1LLUA 3ABQB 3TOXA