4EEZA

Crystal structure of lactococcus lactis alcohol dehydrogenase variant re1
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
339
structure length
339
Chain Sequence
b'MKAAVVRHNPDGYADLVEKELRAIKPNEALLDMEYCGVCHTDLHVAAGDFGNKAGTVLGHEGIGIVKEIGADVSSLQVGDRVSVAWFFEGCGHCEYCVSGNETFCREVKNAGYSVDGGMAEEAIVVADYAVKVPDGLDPIEASSITCAGVTTYKAIKVSGVKPGDWQVIFGAGGLGNLAIQYAKNVFGAKVIAVDINQDKLNLAKKIGADVTINSGDVNPVDEIKKITGGLGVQSAIVCAVARIAFEQAVASLKPMGKMVAVAVPNTEMTLSVPTVVFDGVEVAGSLVGTRLDLAEAFQFGAEGKVKPIVATRKLEEINDIIDEMKAGKIEGRMVIDFT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase 1
publication title Structure-guided engineering of Lactococcus lactis alcohol dehydrogenase LlAdhA for improved conversion of isobutyraldehyde to isobutanol.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Oxidoreductase
total genus 107
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4eezA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4eezA01
5EJ2A 2VRCA 4FC6A 4BO1A 3NDRA 1PU2A 4J90A 4C7JA 5JBIA 3WNVA 3F5SA 4MVJM 4JJFA 1P31A 4XRRA 1MXHA 4E12A 1GZ3A 3CH6A 2O3JA 3NDIA 3OH8A 4FFNA 3SBOA 2O3SA 3PLRA 3PWKA 5JDCC 1QV7A 4FJ0A 2Q2WA 4YBZA 3WXBA 4UVHA 3K2EA 4YQYA 5COQA 3B70A 3CZMA 3RUCA 3NT2A 2VNAA 2RH4A 4UVDA 1T25A 4RL6A 2VHZA 1R15A 2VRBA 5DN9A 5L95A 4R1SA 3OP4A 4J7UA 5HWSA 2D1YA 2V6BA 1PZFA 3LVFO 4BNZA 3V5NA 4PZEA 1KVRA 3D4PA 4U8GA 2HO5A 4EUFA 3K2BA 4CQMD 1XHLA 3IKVA 1CJCA 4PCVA 1PL7A 1GPDG 3M1AA 4E3ZA 1Q2XA 1YJ8A 3U3XA 3A4VA 1J5PA 5KCZA 3UVEA 4NBVA 2C82A 5G4KB 3C7CB 3WTCA 3TFOA 4RQUA 1S6YA 3ZHYA 4CM5A 4RF2A 1I10A 3IJPA 1VL6A 3HN7A 4UEJA 4DIFA 3OHSX 4CM1A 2C59A 1X0XA 1LSSA 2JFHA 3H9UA 3JD1A 3P2YA 1SZJG 2OHXA 4WUVA 5BR7A 1QMGA 4GX0A 1M6WA 2G76A 4RORA 4A5OA 1N8KA 3DTTA 1I5RA 3BMCA 4U7WA 1D1TA 3KYBA 4RO0A 1PR9A 2DM6A 3ROKA 1XEAA 2WM3A 5AYVA 3PJDA 2OXIA 4GLOA 4HXYA 3T7CA 3W8EA 2PKQO 3MJEA 3PYXA 3L4BA 5A3JA 1VLLA 4EI2A 1UP7A 3ICCA 3UH1A 2J3JA 4A7PA 1WAMA 3PQEA 1U5CA 1DLJA 2I99A 4R9RA 1NWHA 4U6QA 3QWHA 4N7RA 4XGNA 1OBFO 1GV0A 1HDOA 1BXGB 2DAPA 4R4JA 3SJUA 3VVBA 4A73A 1W4ZA 3QP9A 4CM6A 1ZH8A 5I7FA 3HNPA 1ADBA 2WE8A 4TROA 4BQPA 1NFFA 1UXIA 4FFPA 4LVUA 1LTHR 3Q9NA 6LDHA 2EHDA 1ONNA 2BELA 3LT2A 5EL0A 1NHWA 2HRBA 2GR9A 4RVHA 1A27A 1DBVO 2O4CA 1HL3A 4R1TA 4E30A 4Q3NA 2A35A 1HE3A 1KEWA 2CVZA 4BKRA 5IJZA 1JDJA 4F45A 4MVJP 4N18A 3VOSA 3UHAA 2FR0A 3QVTA 2NLOA 3VPGA 3V1UA 3ROMA 3A14A 1T24A 3O38A 5LC1A 2DUUA 3OETA 4G81A 1F12A 1G6KA 5ENVA 3VH3A 3RUEA 3PK0A 2O2YA 1QG6A 3F46A 1AHHA 1T2DA 4XYMA 4MPDA 1PWZA 1UXKA 4FFRA 1U8FO 5TRTA 3JQFC 4HP8A 2FR1A 4BMNA 2O2SA 4BS9A 4P8RA 5CDGA 3ULKA 7MDHA 1T2CA 2PZMA 5JFOA 4ALNA 1UR5A 1NBOA 2GN6A 3DZJA 1GL3A 2VCYA 2GERA 4L0QA 4P22A 5I8WA 1Z6ZA 2ZTUA 2Y0DA 1DIGA 1KEPA 1T1RA 5MGBA 4BKUA 1P1JA 2AA3A 5KJEA 2I6TA 2D3TA 2UUOA 2RBEA 2EP5A 4E2WA 4JX8A 1CF2O 3QLJA 4R68A 3DOOA 1FK8A 1U28A 4I08A 5KOIA 3O9ZA 4IINA 3JQ8A 1DXYA 4D43A 3SXPA 2BFAA 3DBRA 4AJHA 4IQGA 2BGLA 3QY9A 2CDAA 3AI1A 5JYDA 3C8MA 1UDAA 3AY7A 3F1LA 2WYUA 4HFNA 1I24A 3KSZO 1H6AA 4DA9A 2Q2VA 1OI7A 4RLHA 5ADHA 4NU5A 1UUFA 1ZVMA 3JTMA 4RVDA 4QO7A 4YAEA 3V8BA 5LDHA 4CMIA 5KJ1A 2O7SA 1FDUA 1LDMA 4NJMA 5ER9A 2RHCA 4B79A 2CF5A 1SPXA 1I36A 1MFZA 5CDYA 4WECA 4RQTA 2B4TO 4OMUA 4D42A 4WLVA 2VYNA 3C7DB 3ZWYA 3SC4A 1KVUA 5AXCA 1DDOA 4IXTA 4CPDA 2VHWA 4JNKA 4RLSA 2DBZA 3FR8A 4PLZA 1NWCA 2X9NA 3H8VA 3ETDA 3E03A 3GR6A 1GD1O 2NU9A 3U4IA 3KYDA 1ADGA 3BMOA 1GEGA 3IP3A 3ZZNA 3RJ9A 2P5YA 4TRMA 4LW8A 3UN1A 3FF4A 5TJHA 4D7AA 4JP3A 5L51A 4CODB 1NX6A 2D2IA 4TRNA 3GQVA 4B4WA 3HG7A 5TT1A 1NM5A 4RVFA 4CJXA 1TEHA 1DC5A 5L4NA 3EGOA 2ZIZA 3E9MA 5T8KA 3W6ZA 3KHUA 2O48X 3QVSA 4BUCA 3VTZA 4PLGA 5IXYA 2FZWA 4BVAA 3C7AA 2X4GA 2HSDA 4IMRA 4PN3A 3IAHA 2HMUA 4FDAA 3DQPA 5DBGA 2VUUA 1NPYA 3D3WA 4E5YA 1EZ4A 1H0KA 3HE3A 3WTBA 2EJVA 1KEUA 1ULSA 1BW9B 4OKIA 3WGOA 1GZ6A 2PA3A 4CLRA 5G0SA 1PGOA 2BGMA 4I5GA 3H65A 3RKUA 5H82A 2H9IA 4L9RA 5HA5A 4TRJA 1YS4A 3VDRA 1HZJA 4O6VA 4JBGA 5A05A 1HDRA 4B4OA 2ZKLA 3NX4A 1KYQA 3IOYA 2Q45A 4XR9A 2BFMA 4U0JA 4BO3A 4CMBA 2VNSA 4DUPA 1ZBQA 3ETEA 1FF9A 2GNAA 3D4NA 1I3LA 2HUNA 5TJ9A 3ZW9A 1XIVA 1LDYA 1C3VA 5T64A 2HK8A 5CDSA 3KXDA 3G49A 5JSFA 2VZ0A 1SBYA 4XJSA 1H5QA 2AW5A 3K31A 4YQZA 1KVSA 5HM8A 1CERA 3IP1A 5JCJD 4GX1A 1A5ZA 4CUJA 1I2ZA 4FPXA 4BIIA 4J9VA 4LISA 5HTOA 5F1KA 4ZQGA 4YXFA 1YOVB 5TIIA 2DTDA 1ENZA 3OEYA 3S2FA 1JU9A 4CL8A 4QUKA 2R00A 3TZQA 1PJTA 5CPBA 5A9RA 4CV2A 1SCUA 1ZMOA 2C0CA 1HSZA 2NU6A 2X9VA 3QA9A 3QV1A 3GVIA 2GRAA 4TRRA 4CM3A 1MA0A 2JKVA 4EITA 1CWUA 1C0LA 2G1UA 3JYPA 1EQUA 4D3DA 2VWGA 3H9JA 3BTVA 3U49A 5IXSA 3A1NA 1ZUD1 3ZU3A 4ONEA 1AHIA 4NH4A 3ZWXA 4ZN6A 1BSVA 3QVXA 3DOJA 3P2OA 4WCDA 2NVUA 2OOSA 3AY6A 3TF5A 2OORA 4J0FA 3G79A 1PJLA 2C29D 4K1LA 4WLFA 4ALMA 4TZTA 1Y7TA 3FSRA 4RVSA 3BMQA 3H5NA 3H5AA 1LLUA 2QRLA 3GEMA 1GEEA 1JLLA 3WQSB 1W6UA 1A72A 3MJCA 2Y1FA 5COAA 3PQFA 4BNKA 1O5IA 2W2KA 3I3OA 1Q0QA 5JC8A 4EW6A 5C5IA 5CEJA 1N1EA 3RUHA 3ZHZA 4PLFA 3RUDA 1P33A 2NTNA 4IIUA 1ADFA 3JQ9A 1EDOA 3DEYX 5DP1A 2JAPA 4GWGA 4UUMA 3PWSA 3E1KA 3NJ4A 3PJEA 4YJGA 1MGOA 5DCWA 1PJ2A 4BL5A 3GLQA 3I5MA 3P7MA 3KLPX 4XB1A 3JSAA 4KMSA 4JBIA 4CLOA 1ISIA 2ZB7A 4H7PA 2B5VA 2B83A 3WOHA 1GCOA 2IZ0A 2J3HA 4BGUA 4BGEA 2J5QA 5BNFA 4J9UE 5K6AC 4ALLA 3GVXA 1CIVA 4A10A 4CR6A 2EKLA 3C1TA 5CPFA 4NG5A 4DMLA 5CDTA 2YZ7A 4CMAA 3IJRA 2CMDA 1GYQA 2D59A 3LLSA 3BTUA 1P1RA 4N5LA 3EDMA 3I4FA 3ZWOA 1HZZA 1KEVA 3ORFA 4X54A 1N7GA 2FPPA 2C5EA 1ID1A 4WKGA 4IDDA 2YQ5A 3AUTA 2F1KA 4HNHA 4IDCA 2W90A 1E92A 3FTPA 1ISMA 3S2EA 2X6TA 5JAMA 1R0KA 5JY1A 2UYYA 2YFQA 1UXJA 1PGQA 1EVJA 4YVFA 4L75A 3NAQA 3UUWA 1A71A 1Y5MA 1CQJA 4AVYA 2LDBA 3U4HA 4EEXA 3SX2A 3BMNB 5FWNA 3FNFA 1EUZA 4CM7A 2XF8A 1N5DA 2VT3A 1Q1NA 4CV3A 2ZQZA 4HX5A 1HTBA 4ALKA 4J43A 2B69A 3V2UA 2Y1DA 5L7YA 4DBZA 2NNLD 3B6ZA 2I76A 2OP1A 1R4NB 1QR6A 4J4HA 3PJFA 3G3EA 3GN1A 3H7AA 1YONA 3ZU5A 1NTOA 4YAIA 5ENDA 4L74A 5GY7A 1ZFNA 5A4DA 5C7LO 1YH3A 1O6ZA 3COSA 3TJRA 4DPLA 3ZGYA 1I3MA 4TSKA 4AJEA 3CIFA 5JLAA 1GYRA 4E0BA 1UH5A 1XWFA 4KQWA 4D0RA 4D3FA 3EW7A 3RBXA 4YT2A 5U1PA 2PFGA 3M6IA 3UFXA 3WLFA 2HDHA 4ND5A 2VTDA 4NBUA 4J4TA 3PYMA 4PFJA 3WSWA 2O3UA 5GZ3A 4YAKA 3TOXA 4NBTA 2ZJ0A 1U5AA 2YW9A 3ROPA 4I9NA 3OM9A 2G82A 2AE1A 2JHFA 4OXKA 4KTVE 1ZK1A 3K6JA 5L7TA 4RVUA 3L77A 4J7XA 3AOEC 5HRUA 3AM3A 3JYNA 2Y66A 4IJUA 3AY3A 3GEGA 2O4UX 3GGGA 5EQDA 1ISFA 1KY4A 1K6JA 3L9WA 4II2A 3BHIA 4XYBA 1E3SA 1K2WA 3G1UA 4AJ1A 4DRYA 2XOXA 4MIYA 1TT5A 4IDBA 4IZHA 3S1LA 1QYDA 4NZ9A 1DHTA 4WNCA 1YWGO 2X7HA 3OQ6A 4FQ8A 4MP6A 2ZCVA 5JS6A 1NP3A 1UDBA 3GPIA 3HDHA 2WD8A 5KJFA 2IDZA 3EHEA 4AICA 5BSHA 1X15A 2PWZA 4PLYA 4BNYA 2FPGA 5T5QA 3F3SA 2B5WA 2D4AA 3V1YA 1EUDA 4FBGA 3NRCA 5AOVA 1J49A 4E32A 4XQ9A 3GN2A 5BNTA 4DGSA 1GPJA 1K89A 4PG7A 3G17A 1X1EA 2P9CA 3AUUA 4DL9A 1HWYA 1AGNA 5AXAA 4IMPA 3ST7A 4P4GA 4CQMA 2X1HA 1WP4A 2CFCA 4WASA 3OFSA 4GVLA 1F06A 3M2TA 4MVJF 2IXAA 1A9ZA 3I6IA 4XX0A 1WDMA 1B8VA 1E7WA 3JQGA 3JCZA 1YBVA 2C7GA 2X5JO 2A4KA 4Y6PA 4NFYA 3INRA 3O03A 2GF2A 3O4RA 4UEKA 1WLYA 1B3BA 4MVJD 1BHSA 1SB8A 3B1KA 4Z3DA 3TZHA 3NTQA 1DOHA 1R0LA 3E6AA 5FF9A 1EBFA 4BNIA 3DZIA 1HDGO 1DLIA 2EGGA 3OSUA 4WLOA 3ZWMA 3I4CA 3ZH2A 2GCGA 2W2LD 3M2PA 2PD4A 2X23A 4C4OA 2V6GA 3QVOA 1PTJA 2W8ZA 2VOEA 4IJWA 1WZIA 4HFJA 2A92A 3I9MA 4NK4A 3M1LA 4DIOA 3JD2A 2QHXA 1HDYA 4FJ2A 4BNVA 4BO9A 4FR5A 3JQCA 4RF4A 5L3ZA 5BNIA 2X86A 1IOLA 1B3RA 2DBQA 3AI2A 3WIEA 4CMEA 5JCXA 1XCBA 3QW2A 1NPTO 3JD4A 2Z95A 4CMGA 1XYGA 2BI8A 2O3RA 3ADPA 3WYBA 4UVIA 4ND1A 1NQAO 3QVWA 4R54A 3RI3A 4R3WA 5JW6A 4BNJA 1BTOA 1E7QA 1XLTA 2CVQA 3CUKA 2QYTA 1UJMA 2WDZA 2Y1CA 3ZU2A 4YYZA 1P45A 3QQPA 4XA8A 1RPNA 1P9LA 5BT9A 4OO3A 3AFNA 2AHRA 5IDYA 4GPD1 4XEHA 5I7SA 4K6CA 1H9AA 4P38A 5TS3A 1RWBA 2ZATA 2GZ1A 1MB4A 3S2GA 3ZCXA 3WMXA 3BMCB 4BOYA 1G0NA 3LQFA 3CINA 1LQTA 4LSMA 1NASA 2CNBA 2NM0A 4UAGA 1K6IA 2DTXA 1BVUA 2BD0A 2NUAA 2PZLA 1U3VA 4H15A 2ZYAA 3UAGA 1LDGA 4FN4A 1YQDA 3U4CA 1VKNA 2J3IA 3WGZA 3PZBA 2WJPA 4ND3A 2C2XA 3T7EA 3U0BA 4L73A 4BNNA 3FRJA 3VHRA 2NTVA 3E5RA 4NK5A 3ICPA 3KRTA 3KBOA 4BKQA 4CM4A 1YKFA 1ZSVA 4K26A 3PDUA 3WLEA 4BB6A 3W8FA 1ML3A 1ZSYA 2Q4BA 5JDIC 5ICSA 2D5AA 4R01A 2NTJA 3RQSA 3CMMA 5J23A 1U3WA 4JLWA 4KDEA 2OFPA 1KBZA 1GV1A 3AUAA 1GCUA 4XRGA 1M2WA 5JMWA 1E3WA 1Q7BA 5JE8A 4JGBA 1YB4A 1IULA 1I8TA 3ZWBA 3RC1A 1BRMA 3WJAA 2O23A 5K0ZA 1BXZA 4IXWA 3IQDB 4MOWA 3DO5A 1LUAA 1QYCA 1NFQA 4DPKA 2Y1OA 5ILGA 4NIMA 1R37A 3ENKA 4CMCA 2NQTA 1PR3A 3VPXA 1T4BA 1U4OA 5G2OA 4ZJUA 1VE9A 1O8CA 4J1NA 1ZXBA 1AN9A 2P2SA 5A9SB 2PH5A 1EVIA 1Y8QA 5JYEA 2C54A 1PJQA 1D8AA 1BMDA 2VHXA 1LU9A 1PQUA 1RM5A 4K28A 4W4TA 3LLVA 4JROA 4UVEA 1IYZA 3WWYA 2J8ZA 4I5DA 4URFA 5C7OO 1I3KA 6ADHA 1R16A 1Y1PA 3GMDA 2X8LA 4GL4A 4IUYA 4Y8VA 5G0VA 3VC7A 1N9GA 4BKPA 1E3LA 4LRTB 1EFKA 2YHUA 3ANMA 4YJHB 4OGWA 4WPGA 5KIAA 3EMKA 4GKBA 1XR3A 2CDCA 2TMDA 1MG5A 3OECA 1ZO8A 4XYGA 3DZKA 4AJJA 3CTMA 1PGPA 3GRKA 4R16A 5COBA 1KC1A 5EINA 2YY7A 5F5LA 3PFWO 3O26A 3NTRA 5JC1A 1R12A 2HJRA 3C85A 1BG6A 2P9EA 1RJWA 3JQ8B 1J4AA 3DBRB 5G4LA 3FR7A 5IZCA 4Q3DA 3OA2A 4YDRA 5DOZA 1KC3A 3OIDA 4ZRMA 3AOGA 4GLLA 3F4LA 4XGKA 2HK7A 1LXCA 1S7CA 2DKNA 1Q0LA 3H9QA 3NDJA 2RCYA 3GFBA 3UCFA 5EERA 2BRUA 4WLNA 3GNSA 1F8GA 4AJ4A 4BO2A 2ZYGA 3RFXA 4WEQA 2RH8A 2Y1EA 4CMIB 4DREA 1E6EA 4NJMB 1LC0A 1E7RA 2NWQA 4IS2A 5T67A 5IDXA 2H6EA 2JCYA 2ZB4A 3DBHA 1P0FA 1IZ0A 4FIZA 2QW8A 3HHPA 4PVDA 2NU8A 4F6LA 4UUPA 5DP2A 1IE3A 5T57A 3WQRA 4XYLA 3L6DA 2NV6A 1Q7GA 1CRWG 1LSUA 2GDZA 3EC7A 4IDGA 2GN4A 4EZBA 3KZVA 2WD7A 4J3FA 2OL4A 3BHMA 1B26A 4W82A 1C1DB 3DMYA 3W1VA 5HS6A 3S2IA 2VYVD 3ONFA 4BV8A 1LQUA 1O89A 2BKAA 3HDQA 5CAEA 2DU8A 1BXKA 1CETA 1SAYA 3JYLA 3K30A 5U9CA 3AJRA 4LMRA 1F8FA 4M86A 1VRWA 3GAZA 4RDIA 3Q2KA 3DB2A 1NHGA 1Y9EA 3RFTA 2IXBA 1O94A 5EMHA 2YQ4A 2YV1A 4ZVVA 3DMTC 2P9GA 2Y68A 3I9JA 1Y6JA 4QQRA 3S55A 3U09A 1U3TA 4MP3A 3RIHA 3N58A 3D3WB 4FD3A 1T2FA 1E1MA 4O63O 3X2EA 4CV1A 3VZPA 4ZQFA 3IDSA 4CLRB 4EEZA 3RAJA 1HLPA 1I01A 3WBFA 1QRRA 2HMSA 2CVOA 2D5CA 2YFHA 4TWRA 4MJLA 2BLLA 3I1JA 4YTEA 4BO7A 4RPGA 1KVTA 4HWKA 2ZQYA 2GUGA 3A28A 2X58A 4R1UA 3DAGA 4UUNA 3RUAA 3FPCA 4A03A 2GGSA 4QT0A 3SC6A 1A7AA 1SEPA 1ZSNA 5JO9A 1VJTA 1ZW1A 2VWQA 4W9NC 3ITKA 3IL2A 1PL8A 3PTZA 4R5HA 1JAXA 3JQ6A 3OQ1A 2JCVA 1MP0A 2AXQA 3TFQA 2GN8A 1GQQA 2Y93A 3Q3CA 3F4BA 5KKAA 3DFUA 1LJ8A 1NYTA 3JQAB 3RBZA 1BXGA 2PH3A 3IIEA 4BKOA 4R3NA 2CUKA 4FFOA 5ITVA 4TKLA 4ZQHA 1ZK3A 4YT5A 5A02A 2WYWA 5AVOA 4AG3A 3ZHBA 5TX7A 3KETA 5H83A 1YQXA 3FTNA 1ONPA 3TOZA 4CR8A 2Q1WA 2JFGA 4OXNA 2J5KA 1WMAA 3D3EA 3VAZA 3V1TC 1ZCJA 5U4QA 1ZJZA 2NVUB 1P1IA 3RFVA 1UZMA 3E5MA 4YCAA 3ON5A 4NMHA 2Q50A 5F5NA 2C7VA 1DIAA 4W7HA 5F1PA 1U9JA 1PX0A 3CSDA 3DXFA 3INTA 4PLHA 2Z5LA 4BHTA 3R3SA 4IIVA 5A3VA 1LLCA 1SNYA 3JV7A 3B1JA 4BO6A 4ZQBA 3ZHXA 1I33A 1PSDA 2QZZA 2PR2A 4L4RA 2HJSA 4XQGA 5L40A 1OC2A 3K9QO 3WFJA 1MX3A 2W2KB 4DVJA 2J6IA 4E4YA 2GSDA 2Y99A 4PIVA 5TT0A 3ZV5A 1UP4A 2Q1UA 5EN4A 3GH3A 3NKLA 4E13A 3LZ6A 1O9BA 1MUUA 4MIOA 1GY8A 3L9XA 3GRPA 4OL9A 2DT5A 4E31A 1ENPA 4YJGB 3JQ7B 1YRLA 1ISGA 3RD5A 4WOJA 3PEFA 4B7UA 4L8VA 5IDWA 1HE5A 4B4VA 1H6BA 4PLWA 4N5MA 1U7HA 4PLCA 1Q0HA 1HKUA 4RF3A 1M76A 4WCFA 3HFSA 4GBJA 1W0CA 3QE3A 5AXDA 1UP6A 5I7EA 2I66A 4E5MA 1L1FA 2EXXA 3TZCA 2FSSA 1E6UA 1MC5A 4A0SA 4DPMA 5JO0A 3QWBA 3FN4A 3WX0A 1B16A 1RM3A 4I9UA 1WWKA 5K1SA 1NVGA 1F14A 3DWFA 1E1LA 4W99A 2E37A 2OO5A 4FFMA 3OJ0A 1Q7CA 4YRDA 5THQA 4OOFA 4U6SA 5KVQA 4CMHA 3EUWA 2Q46A 3TZKA 1F17A 3DOCA 1ZNQO 4O5OA 1WVGA 3HWRA 3JQBC 2GO1A 1P44A 2AE2A 4B7XA 5G0UA 1ENYA 1ISJA 3W4IA 4PLPA 1Z7EA 4CLXA 4FGWA 1RM4A 2BF7A 5THKA 3ZV6A 4NI5A 4FGSA 4OXYA 4IQ0A 3QWFA 5BQFA 4EJ6A 4CM8A 1U2DA 2P91A 2IEDA 3LSYA 4AJOA 3OJOA 3F1KA 5KJ6A 4CQLB 4BO4A 1UXGA 3H2ZA 3CXRA 4YA6A 2R2GA 3W4JA 2NSDA 1X13A 4OH1A 2NU7A 2PGLA 1DJQA 2GASA 4J1SA 2ZTMA 1HT0A 1Z75A 3DDNA 3PHLA 1NPDA 3RWBA 3VZSA 1FXSA 2WYVA 1QXSA 3JQDA 1BDMA 4NFHA 4Q3BA 5ILOA 1K5HA 3Q1LA 4E2XA 1DFGA 3SVTA 1QKIA 2DBVO 5EIOA 4YR9A 3E48A 3MJVA 3NJ8A 1P77A 3PHHA 2HK9A 4QFCA 1XA0A 3D0OA 1NR7A 3GFGA 3FWZA 1YGYA 2A9FA 4AJ2A 4D3SA 9LDBA 1EE2A 2PGJA 1E7SA 3KEOA 1ZKMA 4O0LA 4II3A 1N92A 2I65A 1ZK2A 2JL1A 3TDKA 1BW9A 2BMAA 3EVTA 4UVGA 4WJZA 1DRWA 1XDWA 4U0KA 1V0JA 4IJKA 4TMFA 4ZA2A 4NBWA 4AJLA 4YACA 1QLJA 3E9NA 1YL6A 4HNGA 3GDFA 1KVQA 2W98A 4IZIA 1LC3A 1KY5A 4KDFA 4ESOA 1LSOA 3HJAA 4YAJA 2H1SA 5A5FA 2X0NA 1YXMA 3DBLA 3H9EO 2EF1A 3B20A 5FFFA 1LLQA 4HBGA 4YB8A 4CR7A 1NNUA 5L7WA 3VKUA 2I5PO 1U4SA 3GMSA 1C14A 4BMSA 3TZ6A 2D0IA 3LC2O 3FWNA 4H16A 1T2EA 3MOGA 4ITUA 5IG2A 1GUYA 1P3DA 2VHVA 4Z0HO 1C0KA 4OJNA 3EY4A 4F46A 1JAYA 5GMOA 5L53A 4KTTE 4E33A 4CUZA 3HN2A 1OMOA 1XU7A 2HLPA 1WXDA 3VPSA 4GX5A 2JD1A 1V9LA 2VT2A 4OYRA 1XSEA 3GZNA 4D46A 3PFFA 4YPOA 2Y0CA 5B4VA 4RV9A 1ZK0A 3MWEB 3L07A 3GGPA 3UF0A 1E0DA 2FRDA 5B4UA 5K9ZA 1YDWA 1YE3A 5I9MA 3RC9A 3Q0EA 4B4UA 1KIFA 4JJIA 3GUYA 3GC6A 4IDAA 4IGEA 3K5PA 3PXXA 3H5RA 4KP7A 1HLDA 1HETA 3DFZA 1Y8RB 4ZICA 4B3JA 2X5OA 4PZCA 1FDSA 4KWHA 1C1XB 2UUPA 3NT4A 1DRUA 4IGFA 4PLVA 3PWZA 4GSLA 3TRIA 2C20A 4PG5A 1R6DA 3DL2A 1EEHA 3PIIA 3FI9A 3ZNOA 1AXEA 4J49A 3D1LA 5TQVA 2G5CA 2GLXA 5IZ4A 4I9HA 1EK6A 1E3IA 5A1TA 2FP4A 4XD2A 3GOHA 2TMGA 5IN4A 4CM9D 3JQAD 3DZHA 4L76A 3PP8A 1KS9A 1SOWA 4RF5A 1OAAA 3L4SO 5I9NA 2PKQP 3GA0A 2GPTA 1PS8A 2QIOA 3RROA 4D45A 2WSBA 2YHIB 3OIFA 3BHJA 5HS4A 5IAAA 1T1SA 4IS3A 1E1KA 1EUCA 3KSDO 5DCUA 2OGUA 1PEDA 4NPCA 1EK5A 3PHGA 3FCOA 3IS3A 4KQXA 1LDBA 4Y6SA 3U9LA 3CKYA 4FJ1A 5B12A 4RJTA 3LDHA 2WE7A 4IBOA 3KYCA 2GZ2A 5CEEA 3VVCA 2PZKA 4JJGA 1LRJA 5KKCA 4OQYA 4EUHA 2V6MA 4FW8A 1U2GA 4R41A 4FSHA 3KM0A 2W4QA 4BV9A 1N1GA 4HUJA 3OF2A 2HMWA 3GK3A 3WGYA 5DT9A 3PPIA 4HKTA 1SB9A 3QHAA 5IFLA 2P4QA 1EE9A 3ONDA 1LA2A 1EVYA 3ADOA 4KUGA 3E8XA 2JAHA 1V8BA 4DQVA 2UDPA 5TC4A 1GYPA 1H6DA 2Q3EA 4WLUA 3H3FA 1VJ0A 4YJFA 1DO8A 3OMLA 1JKIA 5LDGA 1YBAA 1LEHA 3PGJA 2EW2A 4J0EA 1E77A 1SC6A 3Q6IA 1SMKA 3KEQA 3LC7O 1P1FA 5TLSA 1M66A 2BI7A 2V7PA 1M75A 2P5UA 4J91A 5B37A 4GGOA 5TNXA 3IUPA 2Q2QA 1GTMA 2O50A 3C1OA 4JCOA 3DONA 4OOEA 3K73O 3VPHA 4G2NA 1JTVA 4YWJA 4MVJE 4J1QA 1E3WB 1R4NA 3UICA 1IPFA 3R6DA 4Q3CA 1AUPA 4LSWA 4AJPA 3L6OO 1M67A 3VTFA 4RPJA 1E3JA 4QFDA 1A4UA 3WS7A 4A2CA 2AEFA 3LT0A 4XWYA 1DRVA 4MO2A 1IPEA 2D8AA 4R51A 1TI7A 1HF3A 3L6EA 4RGBA 3T4EA 5C7IO 1LLDA 1UDCA 1LBEA 3LT4A 8LDHA 2ZB8A 3H9GA 2P68A 4G65A 1W73A 3HSKA 4JN6B 1WNTA 3L0DA 3LYLA 3L4BC 2DLDA 3E9QA 3AFMA 1W8DA 1ZMTA 5AXBA 3F9IA 4DQUA 1OZAA 4XDZA 4ID9A 4I5EA 3WGTA 2EERA 2NVBA 4LMPA 3TPCA 1JN0A 4B3HA 3PLNA 3OJEA 5GZ1A 1N9GB 3O8QA 3ZWAA 5KVVA 4OSPA 5CEFA 2VHYA 5KNLA 1G0OA 4IM7A 4LGVA 4GAEA 3ZWNA 1YJQA 3LC1O 4B7CA 3MEQA 4BNLA 3HB5X 1XELA 4DLBA 1C0IA 1FDVA 2Q1SA 3K8ZA 3HFGA 1CEQA 3AI3A 3IKTA 4E2ZA 3W8DA 5EPOA 2IRWA 4PRLA 1C0PA 1UAYA 2UAGA 3TL3A 4BNHA 2Y67A 3DZBA 3D5TA 1YB5A 4B8ZA 1X0VA 2VYVA 2FZEA 1GZ4A 4R9SA 3STHA 4Q3EA 1E1NA 3PIDA 3ZWVA 2HMVA 1D3AA 2FPIA 3GVPA 4GI2A 1YL7A 3AUSA 4IDEA 1Y9AA 3AOEA 2RHRA 3LF1A 4HFMA 4KUEA 1SEVA 4OQZA 2HKIA 1D1SA 4HFRA 1EQ2A 1P1HA 3A9WA 1RYEA 4XZ3A 2QX7A 4J16A 1MC4A 3ASVA 1GDHA 1PGNA 4AJIA 1B0AA 4KOAA 1EDZA 4L4XA 1VSUA 1LRKA 3ASUA 3HB4X 1NQ5A 3OJFA 3TWOA 3DBHB 3U5TA 1PZGA 3ZU4A 4EJMA 1PWXA 1HYGA 2BFOA 2Z1MA 5ITWA 3WGQA 1AE1A 4S1VA 3WB9A 4AFNA 2POQX 5KVSA 4Z3KA 4YRBA 1A9YA 3ZI0A 2WD7B 1D4FA 3CPSA 1DAOA 2EEZA 3DHNA 3RJ5A 3MJTA 3S8MA 1E5LA 1B2LA 3W4KA 3CZRA 1F0YA 4Z9FA 2FMUA 3PDJA 4F6CA 4LVCA 2AQKA 4DQXA 5A9TA 1FMCA 9LDTA 5IF3A 1DIHA 4AJNA 4IPTA 4FOOA 4YT8A 4FC7A 4OHUA 1DFIA 3V2GA 4DBVO 3ONEA 2RAFA 2WMDA 1H9BA 3GZ4A 1NVTA 1FJHA 4DLAA 2UV8A 1PS0A 3RC2A 5L4LA 4CLHA 1B8UA 4BNUA 1X7DA 3PZRA 1VKOA 3FBGA 2IZZA 1J0XO 3PHJA 1BWSA 1WW8A 2EGHA 3IC5A 1OC4A 3TQHA 4NQZA 1VJ1A 1JA9A 1R4MA 5A04A 1JVBA 2DVMA 4Q39A 3C24A 3LK7A 4TZKA 3GNQA 1ARZA 1PJ3A 3FBTA 4E5KA 3K92A 2UVDA 3T4XA 3H6KA 3WGHA 4IQ8A 3KV3O 5H81A 4MKXA 5DCYA 5FYDA 3RUIA 3FNHA 5A03A 4BO8A 2LDXA 1KETA 4FOSA 3H2SA 1HSOA 4DIBA 3ENNA 4L4SA 2DPGA 5ES3A 4C7KA 2JD0A 4ND2A 1VC2A 3MWDB 4H3VA 2JJYA 1D7OA 2J5RA 2QRKA 2EV9A 1SO8A 3W6UA 5C3MA 4E2YA 1VSVA 1K3TA 4QTZA 3MJ4A 5KVCA 4OSOA 1QYWA 4J1TA 3LF2A 1HYHA 2YV2A 1WZEA 1YL5A 5T8KC 5A06A 3HUDA 1VL8A 4LRSB 4AL4A 4O59O 1QORA 2Q4EA 3WYCA 1EFLA 1OOEA 2ZJ1A 2NQ8A 4LN1A 4W7IA 3I9LA 4BNGA 2GN9A 4CL3A 1MV8A 3DBVO 3FHLA 3R1IA 4XKJA 5GZ6A 4HY3A 3VKVA 3WR5A 4UULA 2PD6A 1O0SA 4XQEA 5F21A 2DUWA 1I0ZA 1WPQA 2FWMX 2C5AA 3BMOB 3KYDB 3FD8A 2VZ9A 4PRKA 4QEDA 5IN5A 1BVRA 2IE0A 2OP0A 1P74A 1QSGA 2EIHA 2B36A 2FOIA 2ZK7A 3ABIA 1X1TA 2FN7A 2BFPA 4U5QA 3JD0A 3DHEA 4GGPA 1YO6A 3PI7A 1DIRA 3CMCO 3P5SA 4GVXA 7ADHA 2XXJA 3NGLA 4ZU3A 3BTSA 4CMKA 4BNTA 1EBUA 3GNTA 5FI3A 5JCJA 3AM4A 4CUKA 4ILKA 1HRDA 3ZWPA 1XQ1A 4YRAA 2NACA 5JDIA 1LSJA 5LCXA 5EESA 1ISHA 3I23A 4K9DA 5JDCA 3A06A 3NEPX 3ZDFA 5A9SA 1PS9A 4FCCA 3IUSA 2VRCD 4GSKA 4WCFC 3WNQA 1I2CA 4UREA 3WQQA 2X0RA 3EYWA 3DHYA 3HZZA 1BGVA 5G4KA 1NR1A 3FNEA 1HYEA 3HDYA 4E5PA 3G1TA 2Y1GA 2Y0EA 2CSUA 1XKQA 2AQ8A 4ZQEA 4N5NA 3TN7A 4MVJG 1Z82A 3BIOA 4MKRA 3GT0A 5EQFA 1PQPA 1Y81A 2VUTA 4YJHA 2R00C 4D79A 8ADHA 4XIYA 2OUIA 2AEJA 3SEFA 4BNXA 1K0UA 4EBFA 1XGKA 4DMMA 2C2YA 2F00A 4A27A 5DBIA 4DC0A 1TLTA 2PZJA 3DTYA 5DOVA 2IZ1A 1UZNA 1V3TA 2Z1NA 4WCFB 1YVEI 5KJCA 3NT5A 2FY8A 3NUGA 3ZWWA 3PHIA 1DC4A 4DYDA 5F1OA 4NFSA 5BSEA 4A26A 1TA4A 1WMBA 4I8XA 3MJSA 5G0WA 4YEDA 4J6FA 3UKOA 3EZLA 1L7EA 4XDYA 3NTOA 5IDQA 3GVHA 1CQIA 2WEKA 4LK3A 3C3XA 3DZGA 4NR0A 3RCBA 3UOGA 2IYOA 3KSUA 2EWMA 5JMPA 5B1YA 1IZ9A 5A5EA 1H2HA 3AU8A 2OMEA 5BSFA 5CHEA 4XJTA 2AMFA 3UW3A 5JY6A 4Y6RA 2FHSA 1PJBA 3OA0A 4XYEA 3U62A 5I9LA 5JNLA 3OJLA 2OBNA 4RVGA 4D44A 4GH5A 4DC1A 2BHLA 1J6UA 4BNMA 4CLDA 2O3QA 3DAPA 1U3UA 4NJOA 3JQ9C 2X22A 3VDQA 4Y98A 3H4VA 4ZD6A 3MCVA 1LX6A 3I6QA 4KUHA 1NFRA 4NDNE 3GAFA 4OIMA 4CM8B 2XPCA 2P4HX 4WOKA 2YV3A 4MKZA 2JD2A 2C07A 2Q49A 1C1DA 5B4TA 5MDHA 1IL0A 3SLKA 3BMQB 3GUCA 1XG5A 2BH9A 3KVOA 2I67A 2O3TA 3G0OA 1WDKA 1ZXLA 3PRJA 2Q99A 4RCVA 4MINA 3VZQA 2VTEA 2GYYA 1B7GO 1Y5RA 4LCJA 5KWEA 2V6FA 1VM6A 4MVJI 3HADA 1DFHA 2AEMA 4LCEA 2VWHA 1GAEO 4J4BA 5FI5A 1JWBB 2Y05A 3ZN2A 5TGDA 2VQ3A 4YT4A 3PJGA 3QJ5A 2YDXA 3VZRA 1ADCA 3BAZA 1RM0A 3ZNPA 2XXBA 3R3JA 4CLOB 3P19A 5TSDA 4NU6A 4QSMA 2PTGA 1TXGA 2AG5A 2PGDA 2VWPA 4F3YA 5CG2A 1DEHA 1LDNA 1PGJA 5T6BA 2HRZA 4Z6KA 4TQGA 1LRLA 3Q9UA 3BTOA 4OKNA 1FDWA 1HE4A 3JQFA 1IUKA 3WGGA 1I2BA 2PK3A 3QWAA 1LNQA 4M49A 3WIDA 3JD3A 3DMTA 3DAFA 1GQ2A 4GX2A 4CLEA 5C37A 2ZTLA 3DBLB 4HV4A 1XU9A 3H3JA 4XIJA 1ULUA 1HDXA 3IMFA 3GDOA 2HCTA 4RZIA 4WLEA 2JHGA 4MP8A 4J2HA 4QXMA 2JFFA 5DNAA 1QYVA 4I1IA 3VH4A 1FDTA 4D0SA 1Z7BA 2BGKA 3RBVA 4KWIA 1WDLA 4FFLA 3TL2A 5CFZA 1R0SA 1M6HA 4ALIA 4EDFA 3JYQA 4XGIA 4CM9A 3MZ0A 3JQAA 2R6JA 2PNFA 1B15A 1ZZEA 2G0TA 3GZNB 3PYLA 4KZPA 4OM8A 4ZGWA 1MLDA 1IY8A 4M55A 3GG9A 1VPDA 2B35A 3WDSA 2E4AA 3RU9A 1TB4A 4BNWA 2GZ3A 2HQ1A 1H93A 2PKRA 2CY0A 1A7KA 1V6AA 3TSCA 4W9NA 1IHXA 1I3NA 2HMTA 3PQDA 4M54A 5JAZA 3QSGA 4NHEA 1PIWA 2ZYDA 5BSGA 4E6PA 3N74A 1MFPA 3BA1A 2I3AA 3FNGA 3CE6A 4J2OA 3ANLA 3VH1A 1ZEMA 5DBFA 1I30A 4J7CA 3QIVA 1B8PA 3D4OA 1DC3A 3GHHA 4QX6A 1R66A 4EJ0A 1PQWA 2A94A 1ORRA 1GUFA 1ONOA 2G17A 2OZPA 4PG6A 2YJZA 1T4DA 4AJKA 1NQTA 5L4SA 2HAEA 3Q2IA 2EW8A 4YJDA 3GGOA 1KERA 1N7HA 2VYND 4DTIA 5DF1A 2WTBA 3CEAA 3I9NA 2X9GA 3HQ4O 3PVZA 3D5QA 2EKPA 1GADO 1V35A 3BYZA 4M89A 2GD1O 2CDBA 3GVCA 4XQCA 4JIGA 2VUSA 1G1AA 1TT5B 3RU7A 3JQ7A 3I52A 2QG4A 3AU9A 3RSHA 1O95A 1X14A 3KLMX 4E5NA 4MVJA 3RC7A 3R0IA 3GPDG 3EVNA 2PV7A 2DTEA 2E82A 3WFIA 2XAAA 5JPIA 4PVCA 1IHYA 3KUXA 3AWDA 3LT1A 3KYCB 3X2FA 2DBRA 1KOLA 2W2LA 3K96A 2EKQA 4M8SA 4WEOA 3WG9A 3WYEA 4Q9NA 4DWVA 2B4QA 4Z0TA 1PJCA 4PG8A 2EP7A 4O1MA 3B1FA 4WGGA 1TT7A 1YOVA 2OBYA 3SLGA 1E7MA 4UUOA 1DPGA 1HEUA 4CQMB 4ND4A 4NBRA 5CG1A 1IB6A 3UCXA 2DQ4A 3GEDA 2H5LA 4WK6A 1PZHA 1Z73A 4YJFB 4IY1A 3JQGB 2DC1A 1JKFA 1DC6A 2ZCUA 1V3VA 1XQ6A 1YQGA 1X7GA 4HADA 3HDJA 1RKXA 1MG0A 4N54A 3ZWCA 3OQBA 4BQRA 4CMEC 4M1QA 2NVWA 2YYYA 4Z9XA 3INGA 4XR4A 1JQBA 3LU1A 5I7VA 2QRJA 4BGVA 2CZCA 2ILTA 5JAQA 1I32A 3GF4A 4D41A 2NADA 2HU2A 2DPHA 4CQLA 4GQAA 2O7QA 2J3KA 1B14A 1AXGA 2ET6A 2FSVA 3ETGA 4FS3A 1DJNA 1ZIDA 1QV6A 3NYWA 1JW9B 4YAGA 4RZHA 3AW9A 3E82A 3JQBA 3KB6A 4BNFA 2AQIA 1PJSA 1JKJA 1QYXA 3WICA 3OBBA 2IYPA 2VZ8A 4JXKA 4M87A 4PG4A 4FB5A 3MTJA 3NGXA 4ZRNA 3RASA 3WMWA 5CP8A 4DYVA 2IODA 1HDCA 3GHYA 4E21A 1DB3A 4GMFA 3BZUA 5JAIA 3DR3A 3AK4A 3EAGA 1CDOA 4PLTA 5KTKA 1VI2A 3OEWA 3O8QB 5ICMA 1DSSG 3GY0A 2I9PA 2CF6A 4EYEA 3Q11A 5JXWA 1LDEA 4DXHA 4XCVA 3WSVA 4R69A 1VL0A 4PZDA 4BB5A 2E48A 4OAQA 1BDBA 1ZK4A 3VPFA 3ZNQA 4G5HA 2VN8A 1E7YA 5G0TA 3RUFA 4Z0PA 4RPLA 3OIGA 1OFGA 3VH2A 3ITDA 1U1IA 2V65A 1YBMA 3I83A 2H63A 2JCXA 3PGXA 1GR0A 3GDGA 4R5MA 4XB2A 3N7UA 3FPLA 4ROSA 5L9AA 1NAIA 2PD3A 4CM4B 2I3GA 5FEUA 4WNIA 1ZEJA 1HXHA 1U8XX 5K6AA 2FR8A 3BMNA 4PGFA 1RYDA 4GWKA 5DULA 4Z9YA 4IJVA 1GFSA 4B3IA 4IDFA 2CD9A 1E3EA 1T2AA 4R1NA 3BXXA 1DHRA 1YB1A 4BO5A 2QZ9A 3KOUA 1UAGA 2ZB3A 3MOIA 4I5FA 3OICA 2EJWA 2DFDA 4P4NA 4S3MA 4DLLA 4GMGA 1GU7A 2YDYA 1E6WA 1E5QA 1HE2A 1HDZA 2X5KO 3C1AA 5CDUA 5I8ZA 3MTGA 4RPKA 4UEOA 4Y9DA 4CMJA 2DFVA 1TVEA 1GQYA 2IEBA 4MIEA 1K6XA 1L7DA 3JQEA 4EUEA 2AG8A 2EG9A 3ZV4A 1Y8RA 2PY6A 1CYDA 3RKRA 2VOJA 1EVZA 3ANNA 4JP2A 3EK2A 1T26A 1C1XA 1UZLA 3DZFA 4ZHSA 5TF4A 1Y8QB 3F5QA 1NQOA 3E18A 1EMDA 1V3UA 2X0JA 1JWAB 5F3RA 3UXYA 2YUTA 1X7HA 3EZYA 3I9KA 4W6ZA 1Z45A 5IZCC 1MXFA 1U7TA 1N2SA 2WWRA 3QRWA 4NNJA 5HBRA 4BGIA 1P0CA 1H94A 3F6YA 4P4LA 4ALJA 1P1KA 3I9OA 3DC2A 5L45A 2QYSA 3WBBA 3ZV3A 1NAHA 2E6UX 4WE3A 2RIRA 3AM5A 1GUZA 1SOVA 2YHIA 2PLAA 1QLHA 1H6CA 1ENOA 1QP8A 1DAPA 1R4MB 4Q3AA 3V2HA 3KTDA 1LI4A 1UXHA 3GG2A 4BMVA 3ROQA 4QECA 4B8WA 3F47A 4JK3A 1NVMB 4JBHA 2QQ5A 4Y67A 3NV9A 4BO0A 1PZEA 4CV0A 1A4IA 4QO8A 4GKVA 3SJ7A 1DIBA 5ER6A 4EGFA 4TVBA 4TKMA 3U4DA 5DDIP 3JYOA 4INAA 4MVJH 3RVDA 3WGIA 1PJ4A 1PL6A 1ZJYA 2SCUA 3KO8A 2B0JA 4RDHA 3TNLA 3D64A 3WJ7A 3UGKA 1JVSA 2E49A 1H2BA 1YDEA 2AQHA 1Z74A 2X0IA 4K6FA 3ZNNA 1NXQA 4MDHA 5DZSA 4JQCA 2B4RO 3D7LA 3QWIA 4TVOA 2B37A 3WWZA 2ZTVA 3ZW8A 2Q1TA 4RPHA 5AQ1A 3UCEA
chains in the Genus database with same CATH superfamily
3EA5A 4DZTA 1O94C 2VRCA 1NIPA 1IK4A 2SICE 1PT8A 4HB0A 3WNVA 4CTJA 2HV8A 4XRRA 1NG1A 1EFPA 2ZAYA 2LRHA 3BRWD 3KL4A 5GINE 4E12A 1GZ3A 5BOVA 1UBJS 3CH6A 3OEED 4IV5A 2NG1A 2QT0A 4WD3A 3NDIA 3M6LA 3OH8A 3DOIA 2O3SA 3O4VA 2WKQA 3PWKA 4ZEXA 4M1KA 1AD2A 3R5KA 1MIHA 5IHXA 3LAWA 3TLBA 2OC4A 1PEAA 3ENWA 3ASZA 5COQA 3B70A 4AZ0B 1QYRA 1L5HB 1DAFA 3NT2A 2YZ2A 3L6CA 4OHWA 2O19A 3HO6A 4ZVMA 4EW1A 2PUWA 3MMXA 2RH4A 3B1ZA 1N6IA 1NW6A 3BB3A 2Y76A 2V4MA 1SXQA 2CHQA 2H2AA 5LP6F 2VRBA 2DP4E 3NIBA 2HIMA 3P9NA 1IUPA 1ICIA 2CB9A 3OZBA 1VOTA 4IFIA 4LZOA 2CD7A 1G19A 2QK4A 2PQ2A 2ZTHA 2C2MA 2PANA 3U6KA 2AG1A 4RPCA 1CB7A 1OU0A 2WIDA 4BNZA 5HX7A 5EMJA 1KVRA 1UBTS 2VP3A 4UCFA 1ULTA 2JIQA 4U8GA 1TM7E 4Q82A 1Y7HA 2ZBPA 1ZS9A 2WWGA 3ASYA 4RGQA 2FGKA 3SHQA 3WKDA 4MVCA 1XHLA 2FWBA 4QBFA 4U7GA 5AOBA 3ZXYA 4F04A 4COKA 3IKVA 5EWLA 5ESDA 4JJ6A 1MC1A 3PC7A 1FQKA 3H8SA 1TMOA 3G9QA 3U61B 2O8CB 1L4LA 1ZI6A 2BJHA 2QSZA 2BM8A 2WU4A 1MU0A 3M82A 3EGEA 2VJQA 4GPAA 4M0KA 1VPEA 2ZXFA 3WRXC 1S89A 3TFOA 3OQIB 5MN4A 1QHYA 1SKQA 1PFYA 1S6YA 3THYA 3TGWA 2CLDX 5J4LA 3VKWA 1VL6A 2OZKA 3ET5A 4UEJA 4U2BA 1W1IA 2GTPA 3OHSX 4CM1A 4KPEC 1OH6A 5E1DA 1E1YA 3AJAA 3P2YA 4LS3A 3AVWA 1W7AA 3U1VA 3CWZA 1SZJG 2AOTB 4HDRB 4WUVA 2F3PA 4EOGA 4ZDIA 4PBRA 2NT3A 5BR7A 4ENSA 2GH1A 1DOZA 2IOQA 3NFYA 3RYCA 4RTKA 2VA9A 4QQFA 1ZESA 4UTOA 2XADA 1XWWA 1S8OA 3BMCA 3DF7A 2DM6A 1XEAA 3GDHA 2OXIA 4YY3B 3HVUA 1Y3BE 4GLOA 4Y0VA 3VVMA 3CQ9A 4R8RA 4Z1OA 1L4BA 4LC0A 4D2IA 2PKQO 2NPFA 3BF7A 3Q7TA 1M2OA 2Q6LA 3CF2A 3FRHA 3T1VA 4CTKA 2M9MA 1PDOA 3IE1A 1G7SA 1UP7A 2H0RA 5JSZB 1FRQA 1E2GA 1BU8A 2JIDA 5JPCA 2B1QA 3JARB 4R9RA 2DLNA 4U6QA 1OBFO 3B52X 3DEZA 3S5UA 4ZZ1A 2OHFA 1TNDA 3IR6A 4LZZA 1MDFA 1Q7TA 3SJUA 1TVKB 2REBA 4GNRA 3VVBA 4P4SA 2IEZA 4GW3A 1W4ZA 2WPNA 1TYBE 3QP9A 4IUCS 4LDNA 3RVRA 4CM6A 4ETWA 1B23P 1ZH8A 3BDAA 2JGEA 5JSKA 3PUXA 4US0R 1ESMA 4BB0A 4ZMSA 3LPDA 4IKOA 1V7PC 4CIAA 5JAPA 1MZPA 1TAQA 3Q9NA 4BFTA 3VZDA 1FFHA 3EDRA 3HVJA 1XJCA 5EL0A 3TMYA 3QX8A 3O83A 1DBVO 2CUZA 3C97A 1FP1D 5EY5B 1HL3A 2A35A 3R5HA 3I45A 1SUDA 3DMFA 4BKRA 1XPUA 2PUCA 2F17A 3GJXC 2PWPA 1SBZA 3W04A 5IJ9B 5IJZA 1PAUA 1J2UA 4F45A 3LHFA 3QEOA 3K16A 4N18A 4EQZA 5CU7A 1T0BA 1MNQA 4DM4A 3MFYA 2VO1A 1ZD9A 4H0NA 1R9NA 3V1UA 1FPMA 1UWKA 1WDTA 2VSXA 3O38A 4G1MB 4P32A 5FI0B 2WIFA 1PT5A 2PRKA 3AUJB 3AR6A 4G81A 3HB0A 4Z4FA 3AF1A 4IVRA 3VH3A 4I6EA 1HC7A 2NO7A 3NEYA 3F46A 4EX6A 3PUWA 1AHHA 4MCIA 4YJ2B 5CYOA 5F35A 3RSGA 1NN5A 1PWZA 1V11A 5B1SA 5HRAA 2JFQA 5EJGA 3QVGA 4YMVA 1P2TA 2PCLA 3K7EA 3ULKA 3I61A 2JFXA 4WZAA 4ALNA 1KH3A 1NBOA 3HVIA 2O9JA 3WP0A 4MUHA 5L95A 4KV9A 2OO5C 2RDMA 4M6WB 3I6BA 3H2JA 3RHSA 1PEYA 4K9LA 5LYJF 1I7NA 3W6OA 1NW9B 2QTLA 4ZYTA 3SYMA 4N3GA 3G2LA 5TQ2B 3EIWA 2RIPA 4G1VA 4PHHA 1WO8A 1SY7A 3GMIA 1CFZA 3VZCA 4C6RA 3K3PA 4KL8S 4DN6A 4DNXA 4C1BA 1XVIA 4R68A 3DOOA 1FK8A 4B6QA 1N2IA 4I08A 3PF8A 1DXYA 4L51A 3WHLA 4AQDA 2BFAA 3KJZA 4IQGA 3QY9A 3AI1A 4JJZA 3QYPA 3VU1A 4Q9IA 4G09A 3AY7A 5JWRA 2FSUA 2ZBDA 3F1LA 3FCXA 3KSZO 4PM4A 1H6AA 1YTLA 2Q2VA 4Y6LA 5CFNA 1L5RA 1MABA 4WJKB 3SOZA 2D3WA 1TFUA 1CUYA 3D0KA 1FFXB 3AJEA 5FLXA 3WNZA 4U9HS 4RVDA 5JEDA 5BVHB 3IALA 4GOMD 5T6MA 5DO9A 3V8BA 5LDHA 1PYOA 2P69A 2REXB 3ZGNA 3DOFA 5KJ1A 3ITNA 2O7SA 1RRFA 3L4JA 4HGPA 1CY0A 2PGOA 1SM4A 2ZPUA 2MOKA 4KRXA 2GLTA 1CR2A 1VRCA 5BQXA 4YUAA 1QCYA 4WECA 2B4TO 1M5RA 4E15A 1ZJWA 1IONA 4WLVA 2VJOA 5JPIA 1ND5A 4AZVA 3SC4A 4BLSA 2ZM5A 5JR3A 4IXTA 2QN1A 4CPDA 2OSBA 1CY1A 3IFSA 1C8KA 3CLRC 1PG0A 2W70A 2PE5A 4Z86A 5EHGA 1DUVG 2DBZA 3OJCA 4PLZA 4KWEA 1NWCA 1TZ2A 1YOBA 3EVAA 3ZOZA 5AHXA 4EIWA 1QHNA 3VOBA 5F2OA 3E03A 3GR6A 3BL8A 4HLUA 1QIKA 2NU9A 4OCZA 4TYNA 1ADGA 3BMOA 1GEGA 3IP3A 3KQOA 4QGFA 1IXSB 2ZIWB 3ORSA 4LW8A 3LUBA 3M3PA 5TJHA 1W30A 4D7AA 4GLFA 2RFLA 4ZOEA 1MOZA 1AM4D 4TRNA 3ZVRA 5BWNA 2OM6A 4TMTA 3AZOA 1T9AA 5TT1A 2GARA 4OSEA 4RVFA 1YACA 4D6YA 5ALZA 4BFLA 2VDNB 3ESXA 3WYAA 2CV2A 1L5NA 4Q4HA 4H1WA 2EL7A 5AK4A 4AZSA 4ZT4A 1UBHS 3IEXA 1W88A 1TADA 1P0IA 2PH1A 4JSTA 3SGLA 1RWXA 3DQPA 2OBXA 4RFSA 1NPYA 2P0EA 3QUCA 4E1BA 1O54A 4O25A 2KJQA 5KYWA 5JNRA 5CCXA 1PEKE 3HYRA 3R6WA 4DUZB 1H0KA 2PVSA 1VGRA 5DJ5A 3QEAZ 3R5TA 1YU9A 2D06A 2XUIA 1BW9B 2PA3A 3ZDCA 3PR3A 1DMSA 1U3FA 1KIAA 1NRXA 1O03A 1YR8A 4LZJA 2AJBA 5G0SA 5BSTA 4MYDA 1QGYA 2IYWA 1A9XB 2OGZA 1JHQA 2V7UA 4KODA 4L9RA 3WDMA 1XMSA 3SZMA 5AR1A 1XF9A 1CP2A 1Q12A 2O0MA 1NVXQ 1UBNA 1G64A 2ZKLA 3NX4A 1VE7A 4HVTA 4ZCIA 2Q45A 5INTA 1B73A 1CJTC 3CZ4A 3IILA 1KP9A 2RH9B 5EC8A 1KI9A 4P84A 5C4MA 3IO5A 4FEEA 3TTSA 3FE2A 3ZW9A 4IIXA 1RAHA 4XFKA 4ZI7F 4NCAA 3TIFA 1ZCZA 2J9XB 3P0HA 1TFRA 4LZAA 1GL7A 1NJGA 2FPXA 3DVSX 4NESA 4B3RB 1X94A 3DV0B 4KFUA 2IX3A 1U02A 2OHVA 3QTTA 1T5LA 1T5SA 2AW5A 3AC0A 3JASA 3Q12A 1H5UA 3PPWA 2WK1A 3KKZA 2WU8A 1R8JA 5HM8A 1J8MF 3Q7EA 4GX1A 4XFJA 3LHSA 5C81A 3T5CA 1A5ZA 1CPYA 2G9RA 4CUJA 1YI8A 4J9VA 5HTOA 5K8TA 1CIJA 4G26A 4ZQGA 1A82A 1PL0A 3P27A 1GTJ1 4YXFA 2DTDA 3K15A 1JU9A 4CL8A 4OHOA 4QUKA 3RWMB 3REGA 1SCIA 1PJTA 1KMQA 5CPBA 2IJGX 2I62A 4PCAA 3RYFB 4HZIA 2C0CA 1LI5A 3QV1A 4MIKA 3QA9A 4KVFA 4RTSA 3T4UA 4Q34A 3HGQA 1VLMA 5DLEA 1C0LA 4QWMA 4ZVSA 1WP9A 2A33A 2K5UA 3VV2A 2QNBA 1NMQA 1EQUA 4UNQA 3QKSA 2EJBA 3M6FA 4Q4DA 4LFCB 4ZQIA 1X7ZB 3NM4A 5FJJA 1CX9B 1ZOLA 3D7SA 4FKMA 1AHIA 1QVWA 4HDQB 4ZEMA 3VRHA 5K0SA 4GXQA 3B1XA 3A9UA 3DOJA 1WUJS 3T52A 2NVUA 4D96A 5THXA 4L9AA 4C7OB 1CQWA 2E2WA 1MNAA 3G79A 1KR5A 1PJLA 1SQGA 2C29D 2LV8A 4PAGA 4TYMA 1EGVB 4ALMA 3OD1A 3R3UA 3ZIAA 2FPMA 4HRXA 4TZTA 4R8VA 5A4KA 1Y3CE 2OGSA 1DEOA 2BSAA 2QRVA 4J0QA 3MRXA 1WXIA 2VTKA 4OLHA 2H5IA 3VR6A 3A7DA 2Q5IA 2QRLA 1PJZA 3GEMA 4ZQHA 1PRYA 1YJ5A 3PGKA 5JD4A 4HCJA 4BJ6A 2BONA 1JLLA 3WQSB 5LMNB 3D6AA 3R7AA 1DJOA 1YR3A 4OVKA 4YREA 3RU2A 5KNCD 4YALA 4CVNA 5JC8A 4QJ5A 3UK7A 5CEJA 5C5IA 2V58A 3Q3JB 1N2CA 1Q16A 3U3ZA 4PLFA 3RUDA 3D4LA 4HHEA 1AZTA 4NCJA 5ALMA 3S81A 4GP7A 3JQ9A 3NETA 1EDOA 3RJZA 3TW8A 4G63A 3LKBA 1PT9A 3RTEA 3IQHX 2QAGC 2J0EA 4UUMA 2VAPA 1LK7A 4QD3A 1QZ3A 4JMLA 5DCWA 1OKKD 3I5MA 2F8SA 3DT9A 3BCRA 3KLPX 1E1RD 4Z51A 4RA6A 5TEVA 3WZ2A 2E7ZA 1K7XB 5HKBA 1EIZA 3DTVB 3AR5A 4BXOA 3DAHA 2R11A 1JR3E 5F4ZA 4PZUA 2LNDA 2J3HA 3X0DA 3GIWA 5JQWA 2J5QA 5CB4A 1AQUA 3D8NA 3AHGA 4J9UE 1GNSA 4ALLA 4A10A 4C03A 3UPUA 3IR5A 5CPFA 3C1TA 3FJYA 4DMLA 1QNFA 2YZ7A 4Y2TA 1DMRA 4C0AC 2D59A 3PSHA 3I09A 1P1RA 5G3YA 3I4FA 1KQNA 3N2GB 4K9OA 5KOHB 4EX7A 1EK0A 2J9FA 2CXHA 2R8YA 3NBMA 3ZJTA 1VXRA 2BFCA 2XNHA 1U3GA 1K3UB 2P67A 4X54A 4GC5A 1JEDA 1PK8A 1O9GA 4IDDA 2YQ5A 4F56A 1UM9A 1OXXK 3ABOB 3WMGA 1UMCB 4E46A 1EHYA 3E53A 5JY1A 3SBDA 2YFQA 3D9QX 4E4TA 2UXDB 1N8NA 3JRWA 3OQNA 1WZNA 2XMPA 4QQNA 2IYAA 1P7PA 2ZITA 2VHTA 2XUPA 1QIIA 3AV3A 1DCKA 2I1LA 1CQJA 1VFPA 1BE8A 1ZITA 2LDBA 1DAIA 2WF7A 3BSFA 3L93A 4G56A 4KN9S 4EEXA 2QUBA 3GLHE 3KPUA 1T2UA 2GD2A 4B0PA 3HU5A 2XD4A 2W6IA 1V45E 1L4HA 5G53C 3ZI7A 3FPJA 1DJLA 1C5KA 2H48A 4F7WA 1GAWA 2AFHB 1Q1NA 1T8SA 3J7TA 2M98A 1WY5A 2ZQZA 1J97A 4HX5A 5ANRB 2Y1DA 5L7YA 2ES4A 2ZS7A 4J0GA 5CJPA 1E89A 1SHKA 2OP1A 1CF9A 4J4HA 4EUSA 4QASA 3H5VA 4ZCPA 4GL2A 1IXYA 4TT3D 3WO0A 3GN1A 2R66A 4B5KA 1RSZA 3ZU5A 3MAGA 3DFIA 3KEMA 5CXQA 5DHAA 1NTOA 1G9SA 4YAIA 4L74A 2JPDA 1ZFNA 5GAJA 4DCMA 1T8WA 4EJSB 3TJRA 4DPLA 5C7LO 1GRCA 2G9QA 4AJEA 2O57A 1X3SA 4P82A 3VR3A 1U2EA 2YWGA 3IAFA 5B6JA 4D3FA 4O2LA 3TCNA 2H7YA 1QP4A 1G5RA 2ATVA 1KYYA 1IU9A 3QQ5A 3N5CA 4K6MA 5K0EA 2L17A 4ND5A 4NWIA 1SCDA 1DX4A 1FW8A 1VIVA 1BD3A 2WVAA 2C4UA 2O3UA 2W8BA 2ZRQA 5FOXA 3WSWA 3L4KA 1E9VA 4TZ6A 2HGSA 4CU5A 2NQ2C 1MW8X 3SZUA 2ZSEA 1D6NA 3ZVNA 2OAP1 3KFVA 3REOA 1CZHA 1WLSA 2ERYA 1FSGA 4HWPA 3OM9A 4BQEA 2ESRA 1Y6QA 5HDQA 2HLNA 2JHFA 3TQQA 4M2LA 421PA 4G4SP 3TYXA 3U60B 1ZVJA 1RR6A 2J1LA 4GICA 1ZK1A 3K6JA 3MPUA 4Q9HA 4RVUA 3L77A 5ELLA 4Q9LA 4RHCA 1QV9A 3BAFA 4ZCLA 3GGGA 2WAOA 3A1DA 5AUOB 2XMRA 3K8YA 5FAKA 2JJMA 1I4WA 3KR9A 4Q12A 3L9WA 4IRUB 3G2OA 4Y30A 5ERXA 5MGNA 1US8A 1T8UA 3FYDA 4AJ1A 4OU4A 2H51A 2KE5A 3UMJA 4C76A 4XD7D 4MULA 3ES9A 4MIYA 3B60A 1TT5A 4IDBA 3S1LA 4D81A 1FUIA 1QYDA 4OATA 4FVTA 4YN3A 5EJ6A 3FFXA 2ZCVA 4FHZA 1DC8A 3TI7A 1NP3A 2NW6A 3T0IA 3UV3A 1C9NA 2G4VA 3H6HA 2PWZA 4PLYA 5K3AA 1TQ8A 5JH7F 3KT0A 3U16A 1U6IA 1RABA 2XOKA 2FPGA 2NXJA 4YJ3B 5T5QA 3ZY6A 3ZZMA 2ABWA 2EYUA 2QV7A 3M83A 2VG8A 1QH1B 3DYVA 4PZ9A 1E2MA 4XDGA 5KNBA 3AKCA 4AKTA 4V24A 4IOKA 2CFIA 1FL9A 2H8KA 2G06A 3CX4A 4PRYA 1ZLXA 4GMDA 1UK9A 2ZI9A 2V7QA 4Z9BA 5LM3A 3C4VA 4PG7A 4NZYA 2BZ0A 1ST2A 1XYVA 4QNMA 3EEFA 3T34A 1HWYA 1UFKA 5AXAA 2GEBA 2HA0A 5CK4A 4B3TB 2ERCA 4XWKA 1NOIA 1PWEA 1YVDA 4WASA 4IICA 3SKVA 1SIOA 3M2TA 1U7DA 3D31A 2V7GA 2VP5A 2GO7A 4D92A 5EE9A 4KQ9A 4I1YA 3ER8A 4XX0A 5BN4B 1Z5VA 2WM2A 4PN7A 4PZAA 5FNVA 3O3NB 4L9SA 3E7DA 3MMZA 3OFVA 5DK4A 4XOUA 1KQGA 3IMGA 3HYLA 2A4KA 2C03A 3P32A 2I2FA 3A1FA 2ZRFA 3KL2A 5DFAA 1KQOA 1IBMB 1XTUA 3RIEA 3O03A 5J5AA 4DJEC 3P0FA 3TZHA 4WCVA 4Z3DA 4IXDA 3BX1A 3KOMA 1R0LA 1EP9A 1DLIA 1Z08A 2C88A 2WWXA 3UG6A 4UAVA 2BEUA 3ZDRA 1XJWA 4D4IA 5KX5A 2RKOA 5J4HA 2W2LD 2A3NA 1SVLA 2PD4A 4P3PA 1ZU5A 2H29A 1YDMA 4XASA 2A9PA 2V6GA 4NENB 1NXVA 1CR4A 3IDQA 1PTJA 1YBHA 4P5DA 2CEAA 1J23A 4MW0A 5AMXA 5HK8A 3M1LA 3L7KA 1AMUA 2KBEA 4D3YA 2H7XA 4XGQA 1HDYA 3JQRA 4BNVA 5M29A 4FR5A 1UT8A 3SX4A 3ZZTA 1Z33A 4G5OA 2V7BA 4Z1MD 4ZYVA 1RIFA 2AX4A 1IOLA 1D6SA 4PCUA 1B3RA 1FMJA 2DBQA 3AI2A 3GEIA 3MINA 4Y2QA 5EMKA 4CMEA 1XE3A 1F3LA 4LHEA 4OB8A 4RD2A 2XUFA 3JD4A 4C04A 2KPOA 6GPBA 1R64A 5D6OA 2CWDA 2KWIA 4UVIA 5TMEA 1IM8A 2AZDA 3EGDA 4HEA6 4V03A 4MQEB 4DCTA 3W5CA 2WV9A 2QY9A 1BTOA 2EYQA 3K0CA 4WESB 1UJMA 2GI4A 3TRJA 3ZU2A 2GKGA 3U4QB 1RPNA 1P7WA 2PVCA 3FGZA 1S2MA 3H1EA 4MJ7A 3AFNA 4FGKA 4L7VA 4QYIB 3UEOA 3HA7A 3THXA 4FFBB 4KYUA 5BQOA 4ZOQI 2H1WA 2W6OA 5I7SA 2XJ9A 5E3JA 5TS3A 2ZATA 4PAQA 5LKAA 1LVUA 1X8JA 3S2GA 1ZGJA 2OHJA 1F5NA 4NXNB 3W5AA 4JB8A 4P83A 1G0NA 1MOPA 3EMVA 1N57A 2EHJA 4YYEA 4EHLA 5ALNA 3O8BA 1P81A 2IF2A 5FA8A 4LSMA 2V5VA 1XRNA 2NM0A 1IMJA 3I2JA 5CTAA 2XTNA 1K6IA 2DTXA 4B2PA 3NEAA 2NPIA 2QJOA 1NKSA 1U3VA 2PZLA 1NXTA 2BHSA 1LDGA 3C3DA 3UAGA 4G1FA 1YQDA 3C3EA 3Q7IA 4OHCA 3RAGA 5DM1A 1T3ZA 2J3IA 1W2WB 5E7QA 5H7XA 2IPAB 2P2ZA 2W6CX 4P7JA 3W7BA 4ND3A 2C2XA 3U0BA 3U39A 4S35A 1THTA 2D0PB 3OKFA 3ICPA 3KBOA 4LAFA 3TVDA 5JV5A 1YKFA 3N6VA 3PDUA 2FSPA 1ZSYA 2UZ1A 3N2LA 3AJDA 3D1JA 1EHIA 5JANA 2VCEA 4IEFB 5IS2A 2EEPA 2NTJA 4BASA 3M9WA 3RAFC 2QBYA 4EA7A 3BWVA 3JATB 4M8NE 2QKYA 2HEIA 4JH0A 4KDEA 3SQMA 4AWBA 3OX2A 4UNIA 1L3BA 3HM2A 3VR4D 2BM0A 1GCUA 2XQIA 4XTRA 1IY2A 1XTVA 1G8JA 2JRCA 2I6FA 3FFBA 3KB1A 4LRWA 5E4FA 1TTHA 3ZTWA 1NVKA 1HNXB 3FKSA 2R48A 5U4XA 3MUNA 2AVNA 1HI9A 1AQLA 3GJQA 1OAKA 1I8TA 1LNZA 2VK8A 2B1JA 4IFEA 1Z0FA 2JGIA 2PFSA 3V8RA 1AZWA 1R9JA 2COKA 3IIIA 4RU1A 3HP1A 4UPDA 3RIMA 1BXZA 4FYHA 1IEVA 4ZAYA 2EIXA 4OXRA 3ZQ6A 4OY3A 3L8ZA 5I51A 2FFBA 5JYBA 4TV8A 2PUJA 2WINI 3A0UA 3L02A 3L7AA 5GVRA 3DAYA 4CMCA 2NQTA 4LDQA 3VPXA 3EEIA 3FMFA 1QE3A 2BJWA 2NUTB 3HL0A 1AN9A 4J1NA 2P2SA 5A9SB 2PH5A 3SZLA 1KZ9A 3W78A 5JYEA 2J7PA 2C54A 2XRFA 3LY8A 2FMFA 5L8VA 2IHNA 3GARA 3BXGA 3A3OA 1CJVC 3LHKA 4JUBA 5DHRA 1ESZA 3ISTA 1QFXA 2ORVA 3W3AA 5KYGA 1T9ZA 3KQTA 3OZGA 5AO9A 4DDUA 5A4FS 4BGDA 6ADHA 1PBTA 2ORED 5G0VA 4B87A 3LC0A 4F85A 4ZVRA 1EFKA 1SXJE 1GGFA 1YVUA 2YASA 4WPGA 5D5PA 1YRBA 4K6HA 2OTCA 1AQNA 1MG5A 1FCJA 1DADA 2ZI5A 4TTJA 4XYGA 3W8NA 1U3DA 4AJJA 4FK8A 1VCMA 3GRKA 4R16A 1KC1A 1M2HA 3ADCA 1R12A 3SBXA 3C85A 4TQAA 4XPIA 1BG6A 3FPGA 3MK31 2OY0A 5AW0A 1IRIA 3PGMA 3NGMA 4C43A 4EA6A 5A5VA 2C92A 1ZH0A 1K8RA 1DG9A 1JT2A 3TW0A 2IU3A 3FR7A 5IAOA 3OCYA 3Q3HA 5DOZA 3OIDA 4KQKA 5FTWA 4ZRMA 3WRYA 2EU8A 3U44A 1L4YA 3H9QA 4PGAA 3GFBA 3H2BA 1E2UA 1M7GA 2HU5A 3ZXUB 2Z4RA 3EPPA 3VTKA 3KKOA 4E5VA 1DCTA 3ZTTA 4FMDB 1AHNA 2RH8A 4BFUA 4BU0A 4MUIA 1ZGBA 1E6EA 2AMVA 2HFKA 2EVWX 4NJMB 1LC0A 2PPVA 5ITZA 2UZIR 2F43B 2CJXA 4IS2A 3H1FA 5IDXA 3GEBA 1X42A 2I3DA 4Q03A 4B6JA 1EXDA 1TKAA 5TPWB 2Q5FA 2YRXA 3P1JA 4MPTA 4ZOAA 4OI0A 1ES9A 1W4LA 1EDBA 1IE3A 3C8UA 1NQUA 2I8CA 3H97A 4H60A 3D54D 3ZGXA 4EF6A 3L0CA 3C48A 4KYIB 2WJ4A 2JAXA 2VDKB 4N7BA 2GDZA 3GPLA 2GN4A 1EVKA 4G0OA 3Q8LA 4URUR 4W82A 3AH8A 1B26A 3EVBA 3KIPA 2Q2OA 3D6VA 3DMYA 3UJAA 1P80A 3CRW1 2I54A 2BMWA 2QR3A 4HMPA 3S2IA 1O89A 3EGWA 1F4PA 3AERB 4DEYA 1IY1A 3O82A 2BKAA 2EJUA 5CAEA 4OHKA 2VJPA 3FETA 1FMLA 1L1EA 3K30A 5U9CA 2XKJE 4S2UA 3BGVA 1W0JD 3FGOA 1SN7A 5K3OA 1VRWA 2ODQA 3USZA 1NJFA 4DARA 1FFCA 1MW9X 2FLVA 2IPOA 4MROA 1WE2A 1B2RA 1IBRA 1MDBA 1P4JA 2DWCA 2YV1A 1G2IA 1C7EA 2C5SA 1MEEA 4MW1A 3BGWA 1OYOA 4M99A 3T0FA 1P7CA 1Y6JA 4RK5A 3U09A 3L7BA 1QK5A 3O3CA 4JT2A 4C01A 3CO5A 3O47A 1JBQA 2OC9A 3LOPA 2UZAA 4G5YA 5FFMA 4GZ6A 1II0A 1T2FA 4DIKA 1YB7A 2HCJB 4I4TB 4O63O 4XVHA 1XMVA 2JA1A 2W2MA 3PGA1 1YKGA 4CV1A 4TWZA 3T1OA 4ZQFA 5JVDA 1QCZA 4PFSA 4CLRB 1ZVKA 3A37A 4GEKA 4EEZA 2O0JA 3M0EA 2PX5A 3NBAA 3TTUA 5AI6A 1I01A 1U0GA 5FOSA 5BQPA 3GFTA 3FA2A 3F96A 3FSGA 1Z13A 3SYRA 1GXSA 1ZN9A 4BFSA 1KH1A 2LTAA 3PC8C 4TUYF 5BR4A 5LQNA 2CVOA 1RD4A 1U2QA 2PT6A 4MR7B 3GA7A 3O2JA 4DM7A 1QKJA 2YFHA 3HBFA 4MJLA 2ZYSA 2BLLA 4TWRA 4UXIA 5BVGA 4KR7A 3TLJA 1NW8A 1I6MA 1AXRA 1K2VN 2ASEA 2F90A 3IHWA 3Q6MA 4FP9A 3A28A 2WSYB 2DF8A 1N34B 4XWTA 2GGSA 4A03A 1N5RA 5IVDA 1X39A 2IYVA 2EQBA 1L4KA 2NZJA 2VWQA 4LOAA 5K0BA 2GEUA 3ROGA 3QLVC 5DK6A 4BNLA 2YUIA 4U39A 2ARKA 1JAXA 4B6PA 1Z63A 1C1YA 1FNCA 1G7TA 1LNSA 1NW4A 2Y93A 1A8PA 3CNBA 1XL0A 2RHOA 2V96A 3L8FA 3NHBA 3WXMA 4JSYA 1OYVA 2UVPB 5AJWA 3PTLA 5L3VA 4NYIR 2IU0A 2NZ8A 3HCNA 2WD9A 1AIPA 1VKJA 3JQAB 1Y4SA 3KFLA 4HN2A 4M0FA 4X1IB 1KAOA 3TUJC 3WQHA 5FUMA 5H59A 3IIEA 3D4IA 5BSMA 5EXEA 1SCUB 4BKOA 4R3NA 1Q91A 3I53A 3N0RA 3P0RA 4KQEA 4CG1A 2K7ZA 4WBNA 1K8ZB 4JL5A 4ZT6A 1TU3A 1ZK3A 4YT5A 5ITVA 5A02A 5DXFA 1CG6A 4MUNA 2WYWA 3ZHBA 1N2JA 2FAXA 3K6SB 4ZEWA 2YVAA 2IL1A 3RSSA 4EZEA 1FFAA 1V25A 2QX4A 3LVQE 5H83A 2VSOA 5KYUA 2JVJA 2L2QA 2XA1A 4A16A 1S2LA 4OXNA 1JR3A 3BIWA 4PX3A 1P8AA 3VAZA 3IPAA 1TU4A 4POAA 4NYMQ 5BR1A 2ID7A 1IUNA 3RFVA 3TX2A 3FTDA 4YCAA 2IUFA 1Q3TA 2A9QA 2OESA 2YWFA 5F5NA 3U17A 1DIAA 2CNOA 2IPMA 5F1PA 2B3DA 1U9JA 2ZW9A 3CSDA 3DXFA 3INTA 3O91A 2Z5LA 4PLHA 5GV8A 4JI1B 3IP9A 2MSWA 4AECA 4EYQA 5LL6P 2O2XA 3QFFA 4UHKA 5CNJA 5HW0A 3NTXA 3M81A 4P4TA 2A4MA 1P6UA 2FZ5A 2MYTA 1I7DA 1R8SA 3PUKA 5EIAA 3IGFA 4RS3A 4DVJA 4P7FA 2XDQA 4TV9B 1TTTA 1KYIA 1NYLA 2QL6A 3G2QA 4ZMBA 1HEIA 1Z2CA 1ECGA 2Y99A 3B6JA 4ZANA 5TT0A 1OT3A 3HO8A 3EEOA 3OLZA 4NMMA 3KZKA 3I04A 4L07A 1O9BA 5GJBA 3L9XA 1N6KA 1WOYA 2BM9A 1Z29A 3GLHA 1NSFA 3O4FA 5J2UF 1FFYA 4V3CA 1GT6A 2F1HA 4CTNA 4KIUA 5FHRA 1J0AA 4HTFB 1BHO1 1G2QA 4WOJA 4YLGA 3UHOA 2P9FA 2I2CA 5L3SA 2I6XA 4KHZA 1HE5A 1E1QD 2NO4A 3OT5A 4PLWA 1PD0A 3B53X 2ISSD 2YL2A 5DGXA 4A4DA 4A0GA 4G0VA 4RF3A 1RVDA 3VOAA 2DCMA 1YR1A 3MPOA 5AXDA 1JYFA 3ESCA 4P7GA 4QDOA 4E5MA 4H35A 4ASUA 4EKIA 3NIDB 1E6UA 1PZXA 5CNKA 1OH5A 1E98A 3SQDA 4A0SA 1NATA 5FBZA 3QWBA 3E5NA 4YMUA 4JLSA 3VNVA 2ZT8A 2CW5A 2PJZA 3WX0A 1E9AA 3OFKA 1ISPA 1H0HA 2VPQA 2W6NA 2YHSA 5F51A 1JHPA 5JQGB 2LVBA 3OPYB 5AJZA 3UT5B 3OQJA 3FDJA 5HKOA 3F8SA 3U4GA 1Q7CA 1N1MA 4RHUA 3A25A 3LY7A 4E3WA 3A6HA 5HFJA 4ZHQB 4KI7A 4JP8A 4CMHA 3ZVMA 1QRTA 3EX7C 1QIDA 2XMQA 5CVVA 3PFBA 3PUVA 1VLVA 1ZNQO 3MS2A 5DM4A 3CN9A 3FOFC 3U7EB 1W8IA 2RGUA 2GHQA 3ZGVA 3LWDA 5CX1B 2ZCJA 3LI2A 3KWMA 3BD9A 2HHJA 1P44A 3BSSA 4R8LA 1JTFA 3ESAA 4CBVA 5K8CA 3NALA 4LECA 4OM7A 1ISJA 1A50B 3W4IA 2BEWB 2BMDA 3PWTA 4M7PA 4CLXA 1M74A 2F3UA 4G86A 4FGSA 3ZV6A 4IQ0A 2DUNA 2CLOB 1ZIXA 2WKWA 1N7IA 2J6HA 1MMFB 2VDWB 3P2IA 1VI6A 4IDHA 3GT3A 1CY8A 5FP0A 4D74A 4CQLB 2Y92A 4HB2A 3CXRA 4YA6A 3WGVA 4PYIA 4Z8YA 1V2HE 2R2GA 2JLZA 5FT9A 2A0FA 2RBGA 4WNAB 4QSHA 4W1RA 2N0SA 1KAEA 3VZSA 4M3NA 4RKRA 5DSZA 3PFCA 3RDPA 5AHOA 2WMNB 4G5SA 3KKMA 1QIEA 2CLLB 4FYKA 4NFHA 1VKZA 1WUIS 3HXLA 4KH1A 2VTBB 3SYLA 5CBPB 4KPGA 3V48A 1Z35A 1A9SA 1PUIA 1P0MA 1S01A 2DBVO 5EIOA 3SXUA 3E48A 3ONWA 3GFGA 1NR7A 3HC7A 5IK2A 3VTAA 3UKDA 1YGYA 3H1AA 3WLJA 2IGTA 1A4XA 4QNNA 1RPAA 5EXDA 2GBCA 2PGJA 2FZCA 1GGMA 1QDUA 3DHVA 1CULC 1U0NA 2ORYA 5BNZA 2CCKA 2I65A 1ZK2A 4W9MC 1ORTA 1YAHA 2FEAA 3RS2A 2Q6TA 2MINA 3MCAA 3MLBA 5KTTA 1EQAA 1AGXA 1TGYA 3L84A 5HFAA 3A1TA 4WJZA 2VJMA 4U0KA 3NPAA 3UJBA 4TMFA 4P5EA 4JAVC 4NZPA 2P1ZA 3DEJA 4I50F 1EDEA 3GP8A 2SKCA 1QLJA 3E9NA 1SA0B 1C50A 1WJGA 3MQ2A 4OJTA 1TZKA 3ZCPA 3DLAA 1CYEA 1EFAA 3KKPA 3RRXA 1KRHA 4KDFA 3VO9A 1E2EA 1C2YA 1JGTA 4YAJA 4HNQA 5A5FA 5L3QA 1F2TB 4JU9A 2EF1A 2HX1A 3B20A 1XTJA 4HBGA 4HZUB 2WLSA 4YB8A 3KQWA 4JC8A 3O7MA 3ZDXB 2AR0A 4P0QB 2X0FA 3LC2O 4H16A 1T2EA 4ITUA 2GAIA 2R6R1 1QGDA 5E95A 4ML3A 3T5TA 2PQ6A 3W9YA 3CVOA 1P60A 3HCCA 1VIDA 4TWAA 1LBTA 2DWOA 2HSZA 4GEGA 5JD3A 3TAUA 4F46A 1O96B 5GMOA 5CA1F 2AYZA 3SF0A 4DG9A 1JVNA 5HZGA 5L53A 4JXJA 1UOOA 2AJLI 4EJ2A 4CUZA 3HN2A 3TW6A 1XNGA 3Q15C 2F62A 3ZHUA 1WXDA 5CFOA 3KP1A 2PXCA 1L5GB 3FPBA 4RQAA 2YS7A 1BX0A 3CE9A 3C5HA 2W2QA 4D46A 4MQ4A 2IK8A 4EL0A 4JY7A 2PZ8A 2FW8A 3AEUA 3L07A 3PD1A 2FRDA 3PQ2A 5FWYB 3LX6A 3T7KA 5K9ZA 3WRVA 1A5AB 4Y2YA 5I9MA 2BFFA 4KBFA 3RC9A 2E21A 1NI4A 1N4DA 3NBZC 4URYR 3RFUA 3RSOA 4IDAA 3I0NA 2G1KA 4ZK2A 1A88A 1Z68A 2NT4A 1KOGA 4F8JA 4IO1A 3DFZA 3VMFA 3CISA 1Y1KE 2WHEA 2EW1A 2WWHA 5JYCA 5ARBA 3U9SA 1Y37A 1RYFA 1ZICA 1C1XB 3NT4A 1N2XA 2CC2A 3WOVA 3FF1A 4IGFA 4B6GA 5JNWA 4PLVA 1HNZB 1P0QA 1Q0ZA 3PWZA 4GSLA 5IX8A 1TEZA 1WSDA 2OAGA 3EAQA 2ROQA 3BA6A 3R6TA 3H2HA 4MV0A 1GT91 4EZIA 1ML4A 3ZNOA 2X5NA 1R0ZA 1T5OA 3NQ41 4IWNA 3T3PB 4Z3OA 1BD4A 3BXZA 2E4YA 4XD2A 1ZIPA 2W2NA 3H86A 5FBLB 4YIKA 2QR5A 1SQ0A 3CG0A 2E1PA 3LLCA 1OAAA 2ATIA 2VF7A 1LBHA 3L4SO 2CNLA 4UNPA 2PKQP 4F84A 3GA0A 2GPTA 4RJIA 2PJRA 5HKAA 1PK7A 4D45A 2WSBA 4PC1A 4X3CA 2YHIB 3OIFA 2B6NA 3BHJA 5AJUA 1XZ8A 1HLGA 1TQ2A 2F4NA 3HEMA 3EFOA 4H9GA 1T1SA 4HEQA 5JG7A 2O06A 4Q66C 2HJHA 4TSFA 4HNVA 4NPCA 1W9MA 3QA3E 4TMKA 2XQJA 4ARUA 2YJTD 5L6LB 3L7JA 4WI1A 1J24A 2PSSA 5HDBB 4IIJB 4U1RA 3FM9A 2QLLA 5H4GA 1Y6GA 4ENWA 3N28A 2XQFA 5F7OA 4Y6SA 1YCGA 2OCLA 2IUEA 5CB6A 1UXOA 2GJSA 1FFWA 1RJFA 1YZ3A 2GZ2A 3D8HA 5CEEA 3S44A 2OQRA 5JD6A 2GHTA 5D85A 1L4FA 1NUUA 2V6MA 3AW8A 3C6XA 1Z5GA 4H1UA 4FW8A 4UE6A 8OHMA 2H7VA 5DYNA 4EG3A 5F78A 5AVZA 4O4LB 4FSHA 4UBNA 4LEIA 4NXMB 3LQKA 3EF1A 1ISSA 2H2WA 2W93A 3UB3A 2HMWA 4GPZA 3GK3A 3AF5A 3BPSA 3LH5A 3DA8A 4YRGA 3V46A 2VJBA 1V8PA 3U7QB 4GM1A 3CG4A 1Y8CA 2RGBA 3DFMA 1XZFA 3ADOA 3DDSA 3M5DA 4QVKA 4KUGA 3KT3A 3E8XA 2YJ3A 3PKIA 1NURA 1SD1A 5TC4A 1M10A 4KXLA 3CB4A 3WLKX 5AD1A 5JBQA 2X4IA 3MGKA 4WLUA 3GFVA 2VJYA 3H3FA 1Z88A 2YFKA 4JOQA 3T3HA 5IKPA 2BUAA 3IBFA 3LX8A 2BE7A 5JRZA 1KFEB 1M2VB 4HT3B 1SC6A 2A86A 4BN4A 4JYAB 5B7NA 3GUZA 1P1FA 3LC7O 2WTAA 3SWWA 1L4UA 1QP7A 2CBGA 1M75A 5KDOA 1MAVA 1KRWA 4LG1A 1SXJA 2FOXA 2Q2QA 4BE4A 4JCOA 2IC5A 3DONA 4OLBA 3FMVA 3G2NA 3EOAI 3D4BA 4G2NA 3LGSA 4YWJA 4MVJE 5IW8A 4TVSA 4UTNA 3CUWA 4XLTA 5E9WA 2N47A 1BYUA 3DVLA 4YCLA 4JEIA 2I1VB 3GRUA 1Y7IA 1R4NA 3D43A 1GLNA 3T3DA 3EG9B 5J1SB 1AUPA 3DE2X 3T1TA 4AJPA 3L6OO 1M67A 3OQVA 4QFDA 2PTHA 3DWEX 4DQ0A 1W34A 2QMYA 2AEFA 4EFMA 4TSRA 1R27A 3GEEA 4IDOA 3AHFA 2CUTA 3MNFA 1I4LD 2D8AA 3NOOA 4TTVA 1KJYA 4EHFA 5JZOA 2V6JA 3LUFA 4F5ZA 1J0EA 1C4XA 2O5VA 5IKEA 3K05A 3K4QA 1OFUX 1B43A 1N3IA 2CLHB 3KLOA 3Q2OA 4RD3A 4WIAA 1LLDA 1LBEA 3LT4A 5F3WB 3DOHA 1W0KA 2WILA 2VR1A 3HKDA 1HQDA 1M5UA 2PBRA 3S3TA 5EWLB 3S4YA 4B76A 4HNUA 5I48A 2BDUA 3HSKA 1NT2A 1C7IA 3L0DA 2Q8PA 2WA1A 3NXKA 1H1TA 2GCOB 3K0EA 4M9RA 3NHPA <