3TWOA

The crystal structure of cad from helicobacter pylori complexed with nadp(h)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
347
structure length
347
Chain Sequence
MRVQSKGFAIFSKDEHFKPHDFSRHAVGPRDVLIDILYAGICHSDIHSAYSEWKEGIYPMIPGHEIAGIIKEVGKGVKKFKIGDVVGVGCFVNSCKACKPCKEHQEQFCTKVVFTYDCLDSFHDNEPHMGGYSNNIVVDENYVISVDKNAPLEKVAPLLCAGITTYSPLKFSKVTKGTKVGVAGFGGLGSMAVKYAVAMGAEVSVFARNEHKKQDALSMGVKHFYTDPKQCKEELDFIISTIPTHYDLKDYLKLLTYNGDLALVGLPPVEVAPVLSVFDFIHLGNRKVYGSLIGGIKETQEMVDFSIKHNIYPEIDLILGKDIDTAYHNLTHGKAKFRYVIDMKKSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Mannitol dehydrogenase
publication title Unusual NADPH conformation in the crystal structure of a cinnamyl alcohol dehydrogenase from Helicobacter pylori in complex with NADP(H) and substrate docking analysis
pubmed doi rcsb
source organism Helicobacter pylori
total genus 104
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.1.1.195: Cinnamyl-alcohol dehydrogenase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3twoA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3twoA01
2F00A 4J6FA 2VYVD 5G4LA 5F1KA 3LSYA 3ZGYA 4BO9A 1PGQA 4YEDA 5ITVA 4AICA 2JD2A 3PP8A 1Z45A 4CMGA 1P31A 1AE1A 3AFMA 1PJQA 1NHGA 3IS3A 2CVOA 4EITA 2OHXA 3I9OA 4IINA 1E3IA 1GEEA 3ST7A 1BHSA 4MVJP 4N5MA 5GMOA 4CM6A 3WR5A 4GGOA 1XQ6A 4LMPA 3JYNA 3FWNA 3GRKA 5IAAA 2R00A 3WSVA 3P2YA 4IJWA 4JP3A 3VH1A 5JW6A 3FNEA 5BNTA 2VZ8A 3KYDB 4XYMA 4DYDA 3PWSA 1JDJA 1HZJA 4N5LA 1NXQA 1U4OA 5KJCA 1ZBQA 5TRTA 3WXBA 3BXXA 3Q0EA 1U4SA 4JP2A 4Q39A 4YB8A 3B1KA 1FF9A 5JPIA 4CR7A 1W4ZA 2PD6A 3ZWOA 3DFZA 4LSMA 3DBLA 5I7VA 1XU9A 1XKQA 3RQSA 2DPHA 3JSAA 3PYMA 5TGDA 1MUUA 4PZCA 1T4BA 4B7CA 5CDYA 1FXSA 4Y6RA 1I10A 1LRLA 3ETGA 1UZMA 3GMDA 1HE4A 1I2CA 1U3VA 5G0UA 3V2HA 2ZATA 2GERA 5G4KA 1HWYA 5C5IA 3G1UA 3F5QA 1SPXA 5JMPA 3PTZA 4LCEA 3QIVA 1BDMA 1R4NA 1I33A 3TL3A 3AU8A 3NT4A 4O1MA 1U3TA 4BNUA 3JQ7B 2PD3A 5EL0A 1T24A 3QP9A 1E77A 1HDZA 3BMOA 1O8CA 4R54A 1LBEA 1EVYA 2G0TA 2Y1CA 4FR5A 3R3SA 2W8ZA 2WM3A 4J4BA 4D42A 1TEHA 3BYZA 2PY6A 4OOEA 3K9QO 1NVTA 2YYYA 5DCWA 5G0TA 1EK6A 3C7DB 4AVYA 1GZ4A 3DZIA 2AA3A 4RQTA 4XQGA 3K2EA 3H65A 3QWBA 1LNQA 1BVUA 4HWKA 3D3WA 4UUMA 1G1AA 3FRJA 2XXJA 2I67A 4MIOA 3MTGA 3VZPA 4P4GA 4YAGA 4WCFB 4BUCA 5JS6A 3RKUA 3K5PA 2Z1NA 4EGFA 4J7CA 2W2LA 4CMHA 4W9NA 1PJSA 5MDHA 1P74A 3UUWA 3G49A 3PHGA 1NVMB 2E48A 4IDAA 5G0WA 4Z9XA 5DULA 1E3EA 1KY5A 1UP7A 3DZKA 4E21A 3S2EA 3PZRA 2B4QA 4HFRA 4LVCA 4UVEA 2NTNA 3ZWWA 5C7IO 2ZTVA 4FC7A 2J3HA 1JVBA 1YXMA 1KVSA 3HHPA 1NVGA 4MVJD 4R5HA 1G0NA 4DMMA 4IIUA 1QYDA 4Z6KA 5TIIA 1NYTA 1GQYA 2HMWA 3KEQA 1PQUA 3M2TA 2NNLD 1NWCA 2HKIA 4XZ3A 1HT0A 3E48A 2VHVA 3VZRA 2VHYA 2GO1A 4WKGA 4RZHA 1HDYA 3EUWA 2X7HA 4CV1A 4WJZA 3GFBA 1XU7A 4C7KA 5JAZA 5DF1A 2WE7A 1NFQA 5CDTA 3GH3A 5JCXA 1PZHA 5EIOA 4W6ZA 3F1KA 4WEQA 1DDOA 4CPDA 2Q46A 3HADA 4IDBA 1PZEA 4XGKA 3W4IA 5CP8A 1P1IA 3G3EA 3FHLA 3PVZA 1HDOA 5KKCA 3QV1A 3ZWMA 4DQXA 5IJZA 5L45A 2NACA 3FNFA 3WB9A 2X8LA 1H6CA 1ADGA 2VT2A 4L4RA 3RASA 3WLEA 1HKUA 2O4UX 5IZCC 4Y8VA 2VRCD 1E7MA 2JAPA 4DRYA 1H6AA 3OBBA 2J6IA 2WEKA 4ALJA 5L51A 4BNGA 4QEDA 2IYPA 1LEHA 4E31A 3AUTA 3IKTA 3JQAB 4HFMA 1DRWA 1PJBA 2GN9A 3L0DA 1O95A 3OA0A 1OZAA 2I65A 3AY3A 4QQRA 4Q3BA 1YQDA 3ULKA 4YRDA 5CHEA 2FWMX 3TL2A 4IQ0A 4CUZA 3I9MA 4IDDA 3GY0A 3OMLA 4LK3A 2DBRA 2BFMA 3NTQA 3M1LA 4FW8A 5DBGA 1GU7A 4R68A 4GLOA 3D7LA 2VHWA 3DOJA 4H7PA 4JLWA 3GHHA 4C7JA 3B70A 4URFA 2GN8A 2B4TO 5CEEA 2VUSA 1YH3A 5I8ZA 4HBGA 5JCJA 1OBFO 1ZK3A 4CMEA 2HO5A 3QVTA 5FWNA 1RM4A 4BO1A 1ONNA 3QJ5A 4GKVA 1ZIDA 1Y9AA 2UAGA 4E3ZA 3OQBA 3ADOA 3DZGA 2FRDA 3PDUA 3PK0A 2UYYA 1LLQA 4AJKA 3NT5A 4XD2A 5JDCC 4YA6A 2NADA 3ZV3A 3QVOA 5JAMA 3ONEA 3INTA 1PJ3A 4RV9A 4RCVA 5ES3A 2HK8A 3UFXA 1L7EA 2EG9A 5IXYA 1SB8A 2DU8A 3FNHA 1UAYA 4IDGA 3LT4A 2VRBA 1FK8A 3I9KA 4YXFA 4Q3DA 1H93A 1JU9A 2CDBA 4ILKA 1MB4A 1U2GA 1GYPA 2E82A 3OEWA 2HSDA 4D43A 4F46A 4NU6A 1GZ6A 1XELA 4JBGA 1X0XA 1C0IA 4WOKA 2HAEA 3KSZO 4I5DA 4NMHA 4RO0A 1O89A 3N74A 4ND3A 1HSOA 3AFNA 4YAEA 4BNYA 5DP1A 3AOEA 3KXDA 3AWDA 5BSEA 1PL7A 3U4HA 3KZVA 4ZQHA 4E32A 4CV3A 2ZYDA 4ND2A 4NJMB 2X9GA 4MVJE 4ALNA 4AJPA 1TB4A 5IDWA 3RU7A 3A9WA 4LVUA 3SEFA 3WGYA 4CLRA 4FN4A 3DHYA 1GYRA 3KV3O 2ZB7A 3GAFA 3NV9A 4ROSA 4FC6A 3CTMA 4JX8A 3JTMA 3IQDB 4CLXA 2BLLA 1Z7EA 3PRJA 3D1LA 2ZYGA 2P5YA 4NK4A 3PEFA 2GD1O 3CUKA 4FFPA 2VUUA 2B36A 3L9WA 5A03A 2GYYA 3VKVA 2PTGA 3I1JA 5ICSA 5KVSA 3LT2A 4PLPA 4J90A 4B7XA 2BFOA 4E2WA 1P33A 2D2IA 2I99A 1T2FA 2YDYA 4L73A 2AHRA 5TLSA 3R3JA 2XXBA 4YJHA 4Q3CA 2WDZA 4CM7A 4BS9A 3ZHBA 1EDOA 2PGDA 4UREA 2Q4EA 3K6JA 5U4QA 4ALIA 1TT5B 4FIZA 4B3HA 1O0SA 1PQWA 3F6YA 3GUCA 3JQCA 1YDEA 4WLUA 4EW6A 2RHCA 2AQ8A 1E5QA 1ENPA 5ADHA 1YS4A 2QW8A 2H1SA 3I6IA 5BR7A 4UULA 1ZSNA 1K6JA 1N9GB 2D59A 4Q9NA 2G1UA 4CLDA 1ONOA 2C0CA 4U6QA 1XDWA 3DC2A 1PR9A 4M89A 4PG4A 1I3LA 1YJ8A 4U7WA 5A3VA 5LCXA 3TFQA 1YVEI 1NPTO 2EERA 3EDMA 2D3TA 2P4QA 3WIEA 3D0OA 4GWGA 3VPSA 3DONA 4N5NA 4J1SA 3RFTA 5K0ZA 3ZHYA 3I3OA 1GUFA 2DBVO 3ZH2A 3U49A 1P77A 3WGZA 1MG0A 3EHEA 3OH8A 2X0RA 3GN1A 1RM0A 1JKJA 3PLNA 3SJUA 1B8VA 4CM8B 3C7AA 4EUHA 2JCYA 3OICA 3U4DA 3LZ6A 3LF2A 4D44A 2BI8A 2D4AA 4CQMB 3D5QA 1D8AA 5JDIA 2D5CA 2Q99A 3IAHA 1PL6A 5JSFA 1XA0A 2C2YA 4BKPA 1YJQA 2NLOA 4CM3A 1X7DA 4Z3KA 5TSDA 2GLXA 4TSKA 1UP6A 5F1PA 2EWMA 1O94A 1SO8A 1QKIA 1YBAA 1BXKA 1B7GO 3V2GA 2X9NA 3GEGA 4DTIA 1ZMTA 4EI2A 1CDOA 4TVBA 5JFOA 1UXGA 2BGLA 4D0SA 3DAGA 4J4HA 4OQYA 1UP4A 3HNPA 2AQHA 2WMDA 2NU8A 3RWBA 3WGIA 2P9GA 4K6CA 4GBJA 3O8QB 2WE8A 2NQTA 3DZHA 2HMSA 3KSDO 4IM7A 4P4LA 4UVDA 3BIOA 5DN9A 5AXCA 1NBOA 5B12A 3WFIA 6ADHA 3GDGA 3VOSA 2QG4A 2J8ZA 3NDIA 4TRNA 3A4VA 4XGIA 4OGWA 3CH6A 1B2LA 2NV6A 1BGVA 4JN6B 4YCAA 1YBMA 4PLTA 1K3TA 4M55A 5A06A 2WSBA 5DP2A 1ZK4A 4XR9A 2B83A 4QTZA 1V0JA 1YRLA 4BB5A 4KZPA 1Y81A 2UDPA 2CNBA 4NU5A 1JLLA 3GVXA 2BGMA 4DREA 4CUJA 1LX6A 2IZZA 5FFFA 4PLCA 3OIGA 3QVWA 4BV8A 1EQUA 4LISA 2JFGA 1QSGA 2YHIB 1N2SA 2QHXA 3T7CA 4W7HA 4J1NA 3S2GA 2EKLA 1PGNA 1SC6A 1BVRA 2FZWA 1JA9A 2A9FA 3ICPA 1Y8QB 1JKFA 5JAQA 1G6KA 2VZ9A 3VZSA 2OOSA 3ON5A 2PKQP 1V8BA 3I9NA 4E30A 2VOEA 3BTOA 1U7TA 1EZ4A 1YB1A 2OP1A 1DSSG 1MGOA 3UH1A 1H2BA 2FPIA 1KOLA 3L9XA 1HZZA 4OL9A 1A5ZA 2AEFA 1QR6A 2Q50A 2GSDA 4B79A 3HDQA 5BT9A 1PL8A 1PZFA 3ZCXA 4EEZA 2G17A 4HV4A 1E7RA 1Z6ZA 4YTEA 1HDXA 1SNYA 3H7AA 3JQ9C 1DRUA 3WG9A 4R1SA 1VJ1A 4ID9A 1R0SA 3JQDA 4TROA 4J9VA 1ISIA 1YB5A 5TX7A 1MXHA 4GKBA 3RJ5A 5C7OO 4R1TA 4NJOA 4J1QA 4KDEA 1DIRA 2GR9A 4Z0TA 1E3JA 4TRRA 3VHRA 1VE9A 2X1HA 1IZ0A 2C29D 4PG8A 2ZJ1A 4HNHA 4CQLA 1PJ2A 4W7IA 2WD7A 4CJXA 1S7CA 4QUKA 5TT0A 3ZW8A 4UUNA 1T2EA 4L74A 3JD2A 3IP1A 5DBIA 3GZNA 4ALMA 1V35A 2NQ8A 3WQQA 3AY6A 5H81A 4WNCA 5KJ1A 2NVWA 1ZCJA 3DBLB 3JQBC 1H5QA 1YDWA 2WYUA 4XDZA 3FSRA 3GDOA 3H9EO 4BKQA 1J6UA 2Q1TA 2WYVA 5JBIA 5AXBA 3KHUA 5EESA 3R0IA 4K6FA 1LC0A 3PJGA 1HRDA 1U1IA 4MVJA 3LYLA 5G4KB 2CF6A 3CIFA 3IP3A 3U9LA 2IEDA 5L4LA 4XX0A 1EBUA 3A14A 1ONPA 1MXFA 1ZXBA 3C1OA 3PZBA 3LQFA 2EIHA 5DT9A 3ZU2A 1HL3A 2C54A 4JK3A 4QT0A 3W1VA 1RM3A 7ADHA 2HRZA 1HSZA 4K1LA 1K0UA 3BMOB 2FPPA 3U4CA 1R4MB 1PGPA 3L4SO 5HBRA 3FI9A 1I24A 3O4RA 2IE0A 3KYCA 3UCEA 3UVEA 2DBQA 2Y0DA 2ZQZA 1DC5A 3MWDB 2BFPA 2HMVA 4MP8A 3W4KA 4CLHA 3OP4A 3VH4A 1DAOA 3WQSB 3ZNNA 5KJ6A 2VYNA 1P3DA 4CL8A 1EVJA 2H6EA 3D3WB 1IULA 4A73A 1FDSA 2NUAA 5DCUA 5BSGA 1GD1O 3B1JA 3WGTA 4D0RA 1IHXA 5F1OA 3GGPA 4DC1A 5F5LA 1ZMOA 1SOVA 5JXWA 1P0FA 3JQFA 3DHEA 1DLIA 4W99A 2VRCA 3TRIA 3OEYA 3GPDG 4RVUA 2QYTA 4NBWA 2VWPA 3TWOA 4ITUA 4CMAA 1CQIA 3JD3A 4Y67A 3T4XA 2BF7A 3LC2O 1X1EA 2PR2A 2O2SA 5HTOA 4S3MA 5K9ZA 3K73O 1Y6JA 5ER6A 3FWZA 2IDZA 4R41A 4DBZA 3H8VA 1Q0LA 1ZJYA 4MJLA 9LDTA 1PS8A 3ENKA 2DT5A 2HUNA 3PWKA 4RLHA 4WLEA 4QFDA 1Q7CA 4YBZA 4R01A 3P5SA 4XQ9A 4YDRA 1HLPA 1MV8A 1EDZA 4Z3DA 2ZB8A 1YO6A 4J2HA 3ZWYA 4KWHA 2VUTA 1I3KA 1K5HA 3F4LA 1HYEA 2I3GA 2FR8A 1JKIA 4INAA 4IQGA 3VTFA 1E7YA 2X6TA 5F5NA 2XF8A 2DUWA 2QRKA 2BI7A 4RVSA 1JQBA 1BWSA 3H2SA 4NFHA 3JQAD 4I9HA 3ZWCA 3RFXA 4U0JA 3LU1A 5KJFA 1NX6A 3UCXA 2ZKLA 5TC4A 4BGEA 1P0CA 1CETA 1YL7A 1CQJA 1PJTA 4ALLA 5JC8A 4CMJA 5IF3A 2DLDA 1KVTA 3HUDA 3WQRA 3ZU3A 2JD1A 4CM9A 2NVUA 3EMKA 5T8KA 1U7HA 4BO2A 4HX5A 4E2XA 3C24A 3GVCA 3TZHA 1WNTA 3FBTA 5HS6A 3WGQA 3AOGA 5T57A 5TS3A 1HYGA 4BGIA 2EV9A 4FFOA 4FFMA 4BO7A 1EUCA 3JYLA 3DBHA 3WWZA 5A9SA 2Y05A 2BELA 4O0LA 2C2XA 1VI2A 4LRTB 5TF4A 5EQFA 4CL3A 4CMIA 4OXKA 3VPHA 1AGNA 1LRKA 1H94A 2PZKA 4ND4A 5BQFA 4MPDA 2Q1UA 2VTDA 1ZEJA 3K31A 4ZHSA 5CG2A 3ONDA 3V2UA 1GPDG 5U9CA 1T2CA 1V3UA 3CMCO 4XB2A 4WCFC 2JAHA 1QMGA 4R1NA 2Y1EA 3FCOA 2DM6A 3JQ8A 5TJ9A 1W8DA 1B0AA 3S2FA 4XGNA 4PGFA 1LSUA 2EW8A 1GFSA 1XWFA 4U0KA 4B8ZA 1NQOA 2NU6A 3TZQA 4YWJA 4XWYA 1A9ZA 1GV1A 5JC1A 1PIWA 1VPDA 2W4QA 4IS2A 2Q4BA 5DOVA 1NPDA 3PGJA 3QSGA 1KVUA 2ZJ0A 5JE8A 1HE5A 4K28A 3SX2A 1AXGA 1L1FA 2F1KA 4LCJA 4QO7A 4M54A 1E1KA 1N92A 4FJ0A 4XEHA 4GMFA 4KMSA 1UZLA 1R4MA 1E6UA 1TA4A 3FF4A 1ISJA 4MKZA 4GX0A 1VRWA 2PNFA 3INGA 4B4OA 1PZGA 1ISHA 4Q3NA 1UJMA 4PZDA 2P4HX 2VNAA 4XYBA 5T6BA 3C8MA 3PIDA 4BIIA 2D1YA 5AQ1A 4NH4A 1KBZA 3RC7A 5K6AA 5L7TA 2EJVA 3S2IA 5B1YA 5I8WA 1P1HA 3GLQA 5KOIA 5ENDA 2CFCA 3MTJA 1CIVA 2AQIA 4IMRA 4CLRB 4CMEC 4DBVO 2NSDA 3ZHXA 3E82A 1M2WA 3ROPA 1HEUA 3NJ8A 5H83A 1QYWA 1N7HA 3GG9A 4G2NA 4UEOA 1T25A 1U5AA 4DUPA 4ZGWA 1BG6A 5HM8A 1NPYA 1C0KA 3VVCA 3GGGA 3GT0A 1RJWA 1E92A 3EYWA 4XKJA 2V7PA 1O9BA 1ZZEA 4I5GA 3CEAA 1KVQA 4BNJA 1KEUA 1DBVO 3DL2A 3F5SA 2CSUA 4NBTA 1M67A 1R37A 4YJHB 2X5OA 4D46A 1JAYA 1N1GA 3Q3CA 3E5MA 4AJOA 1ZO8A 4YAKA 1E6WA 1N8KA 3JD0A 1DEHA 2P91A 4CR8A 1ZW1A 4ZJUA 1XHLA 4BL5A 2EXXA 2GASA 2Q2QA 4GWKA 4EEXA 3GEMA 2GN4A 3C85A 2QIOA 4ALKA 3JQEA 3GN2A 3NGXA 4R69A 1Y8RA 3IIEA 3VH2A 1DC3A 4CQMD 3FNGA 3H5AA 3IUPA 2I76A 3KVOA 1UR5A 4MIYA 3PYXA 4YRAA 2OL4A 3D4PA 3FR8A 3IUSA 4HP8A 1M76A 3E18A 5B4TA 1X14A 4TKMA 3ZV5A 1QYVA 1UUFA 3E9MA 1LDMA 1ZK0A 4FFNA 3DBRA 1SCUA 3DBVO 3TN7A 1EK5A 3D4OA 1SAYA 3HFSA 5JY1A 3RI3A 4FSHA 1DFIA 2FR0A 1CERA 1DC4A 2J3KA 2Y93A 4TKLA 2CVQA 4AJLA 5CEFA 4LGVA 3ITKA 1I36A 4NFYA 2VT3A 1DIBA 1U5CA 1QG6A 3OF2A 5FI3A 4J0FA 1CEQA 2PZLA 1EFKA 1GL3A 5A5EA 4E5NA 1I2BA 3GAZA 1T2AA 3V8BA 3HWRA 1ZJZA 3IOYA 4J91A 1A7AA 1W6UA 3UN1A 1XCBA 4WASA 3H6KA 3V1YA 4AJEA 1VJTA 4IDFA 1RWBA 3F3SA 5ENVA 2GZ1A 2WJPA 4NBRA 2ZB3A 3GNTA 2GNAA 1IYZA 1P1RA 5JYEA 3TPCA 4BKRA 2C7GA 5CFZA 3C7CB 1DPGA 2XPCA 2ZB4A 3OJEA 4RF3A 4JCOA 2Q1WA 2I6TA 5AXDA 3D3EA 4CODB 3GNQA 3WDSA 1NM5A 2EKPA 3LC7O 3OQ6A 4PG6A 3GDFA 3KLMX 3ANNA 3CMMA 3B20A 2FR1A 4IJVA 1GTMA 4K9DA 1N1EA 2G82A 2GUGA 2HK9A 3GF4A 3PHJA 4F3YA 2OUIA 2HJRA 5EJ2A 3QY9A 2ZCVA 4P38A 2FSVA 2C7VA 3JYPA 3QW2A 5DCYA 4JJIA 3ONFA 3IJRA 5L3ZA 2ZYAA 2AE1A 2VWHA 4EJ0A 3PXXA 2J3IA 3S1LA 3AI1A 3IKVA 1BDBA 2H9IA 3FD8A 3DOCA 3WX0A 5BSFA 5GZ3A 3CPSA 4I9NA 3ZWPA 2EGHA 3EZLA 4CR6A 1OI7A 1IUKA 5TNXA 1YL6A 2PLAA 3PHHA 3QHAA 5LDGA 3Q2IA 3AY7A 4XJSA 4DIOA 3RUDA 5GY7A 3WNVA 1VKNA 3G0OA 3KYBA 4PLZA 3JQ6A 4E4YA 4JJGA 3H3JA 2B5VA 3MJSA 5KTKA 3M6IA 2FY8A 5THKA 1PS9A 2Y1OA 3ZU5A 2JFFA 4JROA 1NQ5A 4M8SA 3AM5A 3TOZA 4WLVA 3UOGA 3TSCA 2NVBA 4RDIA 5KWEA 3NT2A 4IXTA 4OSPA 2UV8A 4FBGA 4ONEA 1CJCA 4ND5A 2HU2A 3U09A 1QORA 2X86A 4FD3A 3PQEA 3VTZA 4J3FA 3U4IA 3DAPA 1AUPA 4NBVA 4FFRA 4YPOA 3EAGA 3PYLA 1G0OA 5IZCA 1E1NA 3TQHA 1LSJA 1ADFA 1KEPA 1A9YA 1DB3A 3AUUA 4WK6A 3GG2A 4GGPA 1NAIA 3QVXA 1R0KA 2E37A 3PIIA 4HFJA 4NK5A 3WTBA 2O3RA 3BZUA 1LSSA 2AE2A 1ZK1A 4CQLB 4AFNA 5EPOA 1HYHA 4XB1A 2WD7B 2ET6A 4IJUA 4FDAA 1ZVMA 4CM5A 3HE3A 4A26A 2UUOA 1Y5MA 3BMCB 1E5LA 3O26A 4ZVVA 1Q7BA 4YQZA 3DB2A 3GZNB 1H6DA 4M87A 4RF2A 2OFPA 1C1XA 4GH5A 4KTVE 5A04A 4HXYA 2YFHA 3K92A 1A72A 2VN8A 4XYLA 4WLOA 3LLVA 3BAZA 1GEGA 2EP5A 3QLJA 3PQFA 4D3FA 3G17A 3I83A 2NTVA 3Q9NA 4L75A 3WICA 3ORFA 5T5QA 3SVTA 4PLHA 5CPFA 1H2HA 2EF1A 3RBXA 1ADBA 1WW8A 3FTPA 4E0BA 4HUJA 3ZW9A 4QFCA 1YOVA 3BA1A 1B8UA 3WBFA 3W6ZA 1ENYA 4GAEA 4CMCA 1SOWA 4W4TA 1F8GA 1TLTA 4QECA 4J7XA 2W2LD 3L4BC 5JNLA 1PTJA 2ZTMA 4DA9A 3GEDA 1NASA 4WGGA 5JDCA 4KWIA 4UVHA 3BHMA 3ZWXA 1NNUA 4FFLA 2VTEA 3KYCB 1T1RA 2Y1FA 3DTTA 3NKLA 1FDVA 3C1TA 4IIVA 1IE3A 3P2OA 3QWAA 1DJNA 1YQGA 4F45A 4X54A 4WCDA 4DGSA 2NU7A 3DMTA 1GZ3A 1P1KA 2VYVA 3PWZA 5TQVA 4B3IA 4EYEA 3P7MA 5IZ4A 2OXIA 3BMQA 1LDNA 4OAQA 1KERA 1SBYA 2B37A 3V1TC 2E4AA 2HQ1A 1C1DA 4TZTA 4BNNA 1ULSA 1O5IA 2X5KO 4DQUA 2QYSA 2OP0A 5AVOA 5I9MA 3W8DA 1MP0A 4DC0A 3WGHA 1CF2O 5LC1A 3AUSA 2YZ7A 3WNQA 4CUKA 4R3NA 4YVFA 2P2SA 3K30A 4PCVA 4MO2A 2AEMA 1GR0A 4RVHA 4TRJA 4ZQEA 1RKXA 5KVCA 2CDCA 1ENZA 3IMFA 1C0PA 2B69A 3ZZNA 4BMVA 4ZQBA 3HB4X 4OOFA 3LLSA 1MG5A 3GUYA 3WJAA 4B4WA 5GZ6A 4Y6SA 2RH4A 3N7UA 1K6XA 4JNKA 5A05A 3WIDA 5JMWA 2WD8A 1A7KA 2DC1A 4NZ9A 3EK2A 4AL4A 2EHDA 2V65A 3GC6A 4CV0A 4WEOA 4DPKA 4UEJA 2O2YA 2BHLA 3IJPA 3PFWO 2C59A 3GA0A 4CLOA 3RKRA 1Z75A 4AJ2A 4UAGA 1U8FO 2O3QA 1DFHA 4BNFA 1U3WA 4M86A 4WPGA 4DPMA 3L6OO 2VQ3A 3TZCA 1VL0A 3ETDA 4BO4A 4YR9A 5JO0A 3AW9A 1LQTA 1WPQA 5ITWA 4L8VA 1WXDA 1UZNA 2CZCA 3S55A 4XQEA 5COBA 4TZKA 2UVDA 3RROA 1FDWA 2OMEA 4LSWA 1C14A 4XRGA 4G81A 4J0EA 5KKAA 1FDUA 1I5RA 2JCXA 2NVUB 4JBIA 1A71A 1PSDA 1LDBA 1D3AA 4KTTE 1P45A 1KIFA 5DDIP 3SC6A 1DAPA 3H3FA 2Y99A 2DAPA 4PVDA 2PKQO 2HDHA 1BXGA 4D45A 4FGWA 1YL5A 1T4DA 1UXIA 4D41A 1MC5A 1L7DA 4OO3A 4HY3A 5JCJD 2Q2WA 4YAJA 4GX5A 5KNLA 4LMRA 3NTRA 3RUCA 3DBHB 1V6AA 5KVVA 4RPLA 5A9SB 3VPGA 2YV2A 3RAJA 3UF0A 2VWQA 1V9LA 3I4FA 4J1TA 3WOHA 2IODA 1UXKA 1I3NA 1XSEA 4CMIB 3BMCA 3OIFA 4IBOA 2QQ5A 3JD4A 3W8EA 1XG5A 1R15A 3JQGA 2B5WA 3ADPA 3FPLA 5COQA 4DYVA 4GX2A 2PGJA 3QWIA 3C3XA 3H9QA 2Y68A 1D4FA 1UH5A 1EUDA 4BO6A 2FHSA 3VH3A 5ICMA 1Q1NA 1NFFA 3JQ8B 4CMBA 5EERA 3U0BA 2HMTA 2FP4A 2QRLA 5AOVA 3BTSA 4O6VA 4YYZA 4BGVA 5L53A 4MP3A 1W0CA 2HMUA 1PJ4A 2DBZA 2GF2A 3ZWBA 4DXHA 5T8KC 5DZSA 3T7EA 3WYCA 4XCVA 3DZFA 4WUVA 3B6ZA 2YDXA 1GYQA 2FOIA 1LLCA 4Y6PA 3UICA 3PI7A 2WWRA 3UKOA 2VCYA 1JWAB 4J2OA 5JO9A 4YT2A 4ZQFA 2R00C 4S1VA 2PZJA 1CWUA 3EVTA 3NTOA 3COSA 2Q45A 2CDAA 4ZA2A 4DQVA 3E8XA 4KOAA 3PJEA 3U62A 2J5RA 1Q0QA 4L9RA 2JJYA 2X0IA 1D1SA 3QWHA 3FBGA 1LUAA 4J49A 3ZV4A 1DOHA 1EVIA 3ZNOA 1F0YA 7MDHA 4L76A 1ML3A 4BNKA 4RVFA 4PZEA 2PD4A 3DOOA 3GPIA 2D8AA 4A5OA 2O48X 1AN9A 2BH9A 2PV7A 3W8FA 4XA8A 1ULUA 4XQCA 4NNJA 3ZN2A 2VWGA 3ASUA 2Y66A 5EMHA 2P9EA 2JD0A 2P5UA 4ZN6A 2LDBA 1PU2A 4L0QA 1R16A 2Z95A 3KTDA 5L4NA 5FI5A 1GUYA 2Y0EA 5TJHA 3L07A 3OETA 1YE3A 1DJQA 1C3VA 1T26A 1GADO 4BGUA 4DPLA 4NQZA 1RYEA 2TMGA 3RUHA 1MFPA 2O23A 2X0NA 1QYXA 3NUGA 3F46A 1ZH8A 3FN4A 4JJFA 2FPGA 3Q1LA 4KUGA 1YBVA 3FPCA 4E5KA 4MKXA 4TQGA 4UEKA 1QP8A 2OGUA 3VPXA 4CM4A 3EC7A 3ITDA 1VSUA 3KO8A 1GAEO 3RFVA 4P8RA 2FN7A 2HK7A 1KEVA 2PGLA 2JL1A 3JQ9A 4Q3AA 1HETA 1X7HA 5HA5A 4YAIA 1JVSA 1R12A 2OBNA 4JBHA 5B37A 3TF5A 4N54A 1ISGA 2Q49A 2OORA 4ESOA 3RBVA 4QXMA 3ANMA 3PJDA 3QQPA 1OFGA 1WDKA 4BV9A 1DC6A 1GCOA 2P9CA 4PN3A 4NBUA 2C5AA 3E9QA 3VDRA 1XR3A 1Y8RB 4B3JA 5BSHA 3HJAA 4GLLA 1RPNA 4W9NC 1ZKMA 4DLBA 3QE3A 4O59O 2O7QA 3NAQA 3VC7A 1ZSYA 1JWBB 3ZWAA 4YJGA 1GQQA 1I01A 1WDMA 4BB6A 2C82A 3DBRB 3IL2A 4G65A 2VOJA 2ILTA 1J0XO 5K1SA 2DFVA 2J5KA 3DZJA 4MVJF 3R6DA 3WSWA 1W73A 1JN0A 2IXAA 3GVHA 4BOYA 3PDJA 4FJ1A 4PIVA 3GOHA 2WYWA 2V6MA 4GSLA 3KETA 4MVJM 4AJIA 4LW8A 3WS7A 3DR3A 8ADHA 4EDFA 2BMAA 1PGJA 4H16A 3F47A 2X23A 3AI2A 1NAHA 1P1JA 1QV6A 2VHZA 3HDYA 3PJFA 2XOXA 4DLAA 3HB5X 5ILOA 4RORA 5FYDA 1M6WA 2EEZA 3C1AA 1VM6A 4UUPA 5L95A 4RL6A 1DIGA 3JV7A 5JY6A 2X9VA 1BMDA 4LRSB 4R9SA 2IEBA 2IYOA 4TWRA 3DTYA 4Z9FA 2PH5A 2AEJA 2IRWA 5JLAA 3WMXA 1TT7A 4D79A 1ISFA 4BMSA 3SLGA 4I1IA 2DKNA 3W4JA 3GMSA 4PLVA 4DLLA 3NYWA 3WLFA 5LDHA 1YKFA 4E13A 3LT1A 4U6SA 4PVCA 3NX4A 2FZEA 1TXGA 2G5CA 1KC1A 1HDGO 2YY7A 1HE3A 5I7EA 4YT5A 2G76A 1IY8A 3EZYA 1LLUA 4A10A 1NQTA 2DUUA 4PLWA 2OZPA 3TJRA 2Q2VA 1LSOA 5THQA 3SLKA 3HN2A 3MJTA 1UDAA 1HF3A 1PQPA 4J4TA 3ROQA 4NI5A 4YRBA 5A9RA 5J23A 1H0KA 3EY4A 2W98A 4PLFA 1VSVA 3RSHA 1H6BA 2ZCUA 3HDHA 4YQYA 4MVJG 3KRTA 4L4SA 1C0LA 3SXPA 5JYDA 1HTBA 3NJ4A 4BVAA 1MC4A 3GZ4A 1O6ZA 4ZD6A 1RYDA 2ZIZA 1KYQA 4Z0HO 2CMDA 3WYEA 3DAFA 5C7LO 1B16A 5EN4A 2ZQYA 1E7WA 1GPJA 4I5FA 3TNLA 4RJTA 2ZTLA 1OC2A 1I2ZA 4RVGA 3EVNA 2JKVA 2RCYA 4GL4A 4TVOA 4J43A 4E12A 5A4DA 5T64A 4BHTA 5C37A 4PG7A 4YACA 2DTDA 4JGBA 4A2CA 1PR3A 2SCUA 2JHFA 4EJ6A 3ZWVA 3OA2A 2BD0A 3PHLA 1DXYA 5F3RA 1DIAA 3K96A 2A35A 4AJJA 1E3WA 3RIHA 1LA2A 3ZDFA 2QX7A 4B8WA 4TMFA 3DMYA 4I5EA 3FR7A 3MOGA 1Y5RA 2AMFA 3HSKA 2JFHA 4HADA 5FF9A 1DHTA 4GVLA 4BNZA 1B14A 1ZXLA 4IXWA 2GCGA 4RPGA 4ZU3A 2R2GA 1DO8A 1H9AA 2ZTUA 1Y9EA 3CXRA 4XYGA 4E2ZA 4HNGA 1I0ZA 3AOEC 5ER9A 4WLNA 1ZEMA 3AU9A 1BRMA 1QXSA 1XQ1A 3E1KA 3KLPX 4IY1A 4MIEA 4PRLA 4MP6A 4EBFA 2W2KA 2VZ0A 1C1XB 3OFSA 3AK4A 3CZMA 3TFOA 1N5DA 1X7GA 1F12A 3Q6IA 5BNIA 1QV7A 4RDHA 1LLDA 3JCZA 4RVDA 2VHXA 3L77A 1BTOA 3T4EA 1XLTA 2H63A 3INRA 2X58A 5EINA 3M1AA 4DIFA 1UDCA 4CV2A 4KP7A 4P4NA 2DTEA 1S6YA 1U9JA 1BW9A 4KQWA 3EW7A 3NGLA 4WCFA 1LDEA 1E3LA 4QSMA 3GK3A 4C4OA 2VYND 3UAGA 1PWZA 3H5NA 3L6EA 1J4AA 3KB6A 1GUZA 2DTXA 2AW5A 3RUEA 1YOVB 3ZI0A 2PKRA 4R4JA 2EKQA 2RBEA 4ZQGA 3H9JA 2J5QA 5IN4A 5KIAA 3PQDA 1LDYA 3RVDA 4CM1A 2POQX 2YQ5A 3VPFA 2B0JA 1IOLA 4MVJI 5G2OA 4MINA 3WGGA 5COAA 3I4CA 4IZIA 4CLEA 4BO0A 1VLLA 4BNWA 3IC5A 3A06A 4OQZA 3AM3A 3RC9A 1GY8A 2Q3EA 3RBZA 5HS4A 2NWQA 1K2WA 3FTNA 2D0IA 2EGGA 3KYDA 3BMQB 1ZFNA 3E5RA 5IDXA 1K89A 4BNHA 1C1DB 3UGKA 3PHIA 4BNIA 4J16A 4BKUA 3D4NA 2A94A 3BTVA 2DFDA 3KBOA 2YV3A 3OJFA 1LC3A 1QYCA 1QLJA 2QZZA 3TOXA 5I7FA 2RAFA 2CUKA 4E5MA 3A28A 1HXHA 1J5PA 5IN5A 1DLJA 4FQ8A 4NR0A 4E5YA 2X0JA 3BMNB 1ISMA 1NQAO 1ZSVA 3LF1A 5A1TA 1EUZA 2HJSA 1LI4A 3SJ7A 3GRPA 1AHHA 3LT0A 4OXNA 5I9NA 2XAAA 2Y1DA 5JDIC 1Z73A 2O3UA 5B4VA 1WP4A 3RUFA 1LQUA 3DQPA 2Y0CA 3NDRA 3E9NA 3JQ7A 3ZV6A 3DXFA 5A3JA 3HQ4O 2GGSA 2Y1GA 2NM0A 4BKOA 1E0DA 4RGBA 4CM9D 4CLOB 1NTOA 1SB9A 2O3SA 2WTBA 3BHIA 5L40A 1ADCA 1E7SA 3ZNQA 5A02A 5CG1A 1SEPA 3DEYX 1NR1A 4DIBA 3GVPA 3ZU4A 3DMTC 2I3AA 4OMUA 4PLYA 3OIDA 4RZIA 5B4UA 1OC4A 4A27A 1I32A 3A1NA 1LU9A 3HDJA 2YHUA 4BNXA 3KSUA 5KVQA 1MX3A 2PK3A 3ROMA 4I9UA 1WLYA 3D5TA 3DO5A 5IDYA 3JYQA 3WTCA 1ARZA 4FOOA 4XJTA 3Q9UA 4OM8A 1B15A 4R5MA 2IZ0A 2JHGA 4AJ4A 1LXCA 4Z0PA 3ENNA 1I30A 1EQ2A 1ZNQO 1X1TA 4WECA 5L7YA 4NPCA 1Z74A 4I08A 1YB4A 1MFZA 1BXGB 2OBYA 3N58A 2FMUA 1AHIA 1LJ8A 1X13A 1WAMA 4A03A 4YJFB 1DIHA 5CDUA 1B8PA 1XYGA 2P68A 3EGOA 4ZRMA 4KUHA 4ND1A 4OXYA 1U8XX 2GZ2A 4R9RA 4F6LA 1TVEA 2GDZA 4RLSA 5CAEA 3I9JA 2AXQA 3TZKA 2BFAA 1JW9B 1MLDA 2YW9A 4PG5A 5L4SA 1PJLA 2X22A 2A92A 3JQGB 4UVIA 1U3UA 1WDLA 1ENOA 2PFGA 3I9LA 1QRRA 4FCCA 4J7UA 4JQCA 3QWFA 2A4KA 1HDCA 1H9BA 1M66A 2D5AA 4O5OA 1K6IA 4TRMA 2CVZA 4EJMA 3V1UA 2TMDA 1ID1A 4W82A 3I6QA 4XR4A 5C3MA 3GQVA 4RPHA 4ZRNA 1JTVA 3CE6A 4BQPA 4E5PA 1R6DA 4KDFA 1EFLA 3X2FA 4B7UA 1OAAA 3MJVA 1EEHA 4D3SA 2AQKA 3STHA 5L7WA 3TZ6A 3UHAA 1WWKA 1A4IA 3KUXA 2IXBA 3R1IA 3PLRA 1A27A 5AXAA 1ZK2A 1BXZA 1ZUD1 4N18A 1Q2XA 3JD1A 3WYBA 1BSVA 3HN7A 4FOSA 4OH1A 2CD9A 3JYOA 1NFRA 1B26A 4OKIA 1U28A 3SC4A 3RCBA 4IGFA 4XIJA 1NHWA 4AJHA 4WNIA 1X15A 4JIGA 4IDEA 4RPJA 2O50A 5DBFA 4BNVA 3MZ0A 3JQAA 1PJCA 4YT8A 1LDGA 1N7GA 1YGYA 1E6EA 1KEWA 4GI2A 4IGEA 1P44A 1M6HA 4EZBA 3DFUA 3O38A 1B3RA 3BTUA 3CZRA 3KEOA 4OJNA 4YJDA 2JCVA 2BGKA 4FJ2A 4B4VA 6LDHA 4UUOA 3WMWA 2VNSA 1U2DA 1WMAA 1FDTA 5DNAA 3BHJA 4BO5A 5AYVA 1F14A 3MOIA 1A4UA 3VZQA 4R51A 1R66A 3ZHZA 3D64A 1M75A 4OIMA 3AUAA 4OHUA 1FJHA 1KETA 1DHRA 2UUPA 5U1PA 5CDSA 4RF4A 1EE9A 3ICCA 3U5TA 1FMCA 3M2PA 3BMNA 1PX0A 4GVXA 5TT1A 9LDBA 3DWFA 1IZ9A 4XYEA 2YJZA 3RD5A 1MA0A 3LK7A 5IDQA 1PS0A 2X5JO 4R16A 4D7AA 2BRUA 4IQ8A 4CM4B 3G79A 2Z1MA 1R0LA 1WVGA 5JAIA 4RF5A 5HWSA 4XDYA 2O3JA 1KS9A 1GCUA 3LVFO 1E1MA 1F8FA 3PPIA 1LRJA 5KJEA 1GV0A 3F4BA 4QO8A 3RJ9A 3G1TA 1WZEA 3MCVA 4AJNA 1KVRA 1YONA 4MKRA 4NHEA 4M1QA 4HFNA 4NG5A 1GDHA 3QRWA 2EJWA 1RM5A 4FS3A 1NR7A 4GMGA 2C07A 1SZJG 3DHNA 4P22A 3VDQA 3ANLA 2R6JA 3GR6A 4U8GA 2O7SA 5CDGA 1TI7A 1DRVA 3AJRA 3NEPX 4IUYA 4J9UE 1T1SA 2PA3A 3JQFC 1OOEA 2GRAA 3IDSA 4JXKA 2X4GA 1OMOA 4EUEA 3P19A 1V3VA 2C5EA 4IDCA 4E2YA 1F17A 1IPEA 4YJGB 4I8XA 3SBOA 3E6AA 4NJMA 1B3BA 4II3A 3OJ0A 4AJ1A 3V5NA 4E6PA 1E3SA 3I52A 1D1TA 3ETEA 2HCTA 3GVIA 5G0SA 1HLDA 2DVMA 4HKTA 2DPGA 4GX1A 4YJFA 3RU9A 1EVZA 2LDXA 4DWVA 1SEVA 4N7RA 8LDHA 1XIVA 3O9ZA 4BMNA 3HG7A 3VVBA 1I3MA 4Q3EA 3UW3A 4RPKA 4FGSA 4DVJA 3LDHA 4WLFA 1VC2A 3F9IA 4Y9DA 3CSDA 4F6CA 2V6BA 2ZK7A 3CKYA 3I23A 4DMLA 1E1LA 4IS3A 4BNLA 4K26A 2YQ4A 3L4BA 3Q2KA 3ROKA 3WWYA 4LN1A 1EE2A 5T67A 4B4UA 5CEJA 4R3WA 2O3TA 3OJOA 1HE2A 3OSUA 1JAXA 5CPBA 4Y98A 2OO5A 3VAZA 1TT5A 1YQXA 1IHYA 4YT4A 2I66A 3W6UA 3ASVA 3OJLA 5MGBA 4BO3A 2I5PO 3RC1A 4RQUA 1E7QA 4BNMA 3HFGA 2FSSA 4IZHA 3OHSX 4IPTA 1EMDA 4BNTA 1N9GA 3RUAA 1UXJA 3QA9A 4IJKA 3B1FA 3DDNA 2O4CA 1IPFA 2IZ1A 3H2ZA 1V3TA 5DOZA 5FEUA 1J49A 3ZNPA 1WMBA 3MJCA 4PLGA 2I9PA 2E6UX 2NU9A 2E49A 3RC2A 4H15A 2EW2A 4FB5A 1KC3A 2YFQA 1Y1PA 3GGOA 4KQXA 3WJ7A 2EP7A 4PFJA 2Y67A 4XIYA 1R4NB 4PRKA 5G0VA 4CM8A 5ILGA 2V6FA 2PH3A 5I9LA 3F1LA 3ABIA 1XEAA 1CYDA 1UAGA 4UVGA 2W90A 3Q11A 4WOJA 3MEQA 4CQMA 4XRRA 2B35A 2HRBA 3NDJA 4OKNA 5IFLA 2AG8A 2QRJA 4OSOA 3ZWNA 1VL6A 1Y7TA 1VL8A 1PEDA 1NWHA 3MJ4A 3WBBA 2CF5A 3GHYA 5I7SA 2BKAA 2GPTA 3OECA 1P9LA 3O03A 5IXSA 3KM0A 1Q7GA 5A5FA 1D7OA 1VJ0A 1AXEA 3TDKA 3L6DA 5F21A 2PWZA 3CINA 4MOWA 3K2BA 4IMPA 3WGOA 2J3JA 3UXYA 4FPXA 4GSKA 3NRCA 1IB6A 4GQAA 1T2DA 1CRWG 1I8TA 2YV1A 3MWEB 3O8QA 1IL0A 1HDRA 5KCZA 2AG5A 5A9TA 2Z5LA 4U5QA 5BNFA 2RH8A 2HLPA 5IG2A 3GNSA 1Z82A 1KY4A 4R1UA 2DQ4A 2B4RO 3GFGA 2RIRA 1E3WB 1ORRA 1XGKA 2GN6A 2C20A 4H3VA 3X2EA 4AG3A 3OQ1A 4CMKA 4G5HA 1VKOA 3LC1O 3S8MA 3HZZA 4EUFA 3AM4A 1NP3A 4E33A 2V6GA 4MDHA 5GZ1A 4A0SA 1QLHA 4II2A 5L9AA 4DL9A 1Z7BA 3AI3A 4MVJH 5EQDA 4GPD1 5H82A 3VKUA 4O63O 4NFSA 5HRUA 2PZMA 1PGOA 1GQ2A 3I5MA 3H9UA 4QX6A 1P1FA 4NDNE 1EBFA 1X0VA 4A7PA 2QZ9A 2NTJA 4KUEA 4ZICA 1F06A 5K6AC 1PWXA 3PGXA 1LTHR 1SMKA 2W2KB 1DFGA 2YHIA 1Q0HA 2H5LA 3H5RA 3U3XA 1YWGO 3UCFA 3WFJA 3H4VA 4OYRA 4L4XA 1UXHA 2GZ3A 3E03A 4WE3A 3QVSA 4M49A 4BQRA 3OM9A 3MJEA 3PFFA 2YUTA 1Y8QA 4Z9YA 3RUIA 3JQBA 4NIMA 1WZIA 4D3DA 4BO8A 1BW9B 1UDBA 3DZBA 3K8ZA 2Q1SA 3KOUA 2CY0A 3H9GA 2RHRA
chains in the Genus database with same CATH superfamily
1SU8A 4FFSA 5EFZA 4M7OA 4IXMA 4J6FA 1E2DA 4KQ9A 3QV2A 1I4WA 3T5CA 1US8A 1WXHA 2CLEB 4M3NA 5DRTA 2JGKA 3SZRA 4JOSA 5ALQA 3IILA 1U9YA 1PGQA 4JYCA 3ES9A 2R8EA 2VC2B 4FBMA 1K7XB 3ZVLA 2LZ0A 5AESA 2IH5A 4KRFA 3PP8A 1K06A 3NDPA 1Z45A 2J3QA 1P31A 4D96A 3BIJA 1RPJA 4B0OA 1NHGA 3IS3A 5LM3A 2CVOA 1V45E 1FP4B 4W5RA 1N9KA 2PPVA 3C6KA 3I9OA 3FZYA 2VEDA 3R6TA 2REOA 1VP9A 4IINA 3SM9A 1ZUHA 4FEEA 3ZTYA 5I4BA 3EPLA 4BE4A 4N5MA 5GMOA 3VYTB 3C43A 3SXJA 3WR5A 4ENVA 7MHTA 4BRZA 5HR5A 1RAEA 4I1SA 2C77A 3JYNA 2V98A 4U2GA 5CGQB 5IAAA 1EA7A 3P2YA 5TQ2B 1P7VA 4JP3A 4RFLA 3RLIA 1RWNA 3PQ6A 3FTFA 1BJRE 2FZ5A 3L92A 4LF9B 4OX9B 1R6BX 1HZJA 1OGIA 3NHZA 5HF5A 5LYJF 1NXQA 1PI3A 3RKRA 1R0ZA 3B5IA 2C58A 3E84A 3EUAA 4AKHA 1MB0A 2SICE 4OM7A 1ZL2A 4OUDB 5D86A 4ZK2A 2JRLA 3ML1A 2RH5A 1K86A 3LL4A 5TR9A 5CB0A 3ER8A 3IVXA 2W8BB 4Q39A 1ZBDA 3A2LA 4EY5A 3WYGA 3WO1A 4ZFNA 5JPIA 3VKWA 1C3OA 2XH8A 3H5LA 3JAWA 4JELA 4CR7A 3LX5A 3ZWOA 1ILEA 3AR9A 3GLFE 4LSMA 4WW0A 2DFLA 3MTIA 1XU9A 3DNPA 1XKQA 3IESA 1L7RA 3LX4A 1DCTA 1BGXT 2BFDA 1EUYA 3GDWA 1EWVA 3WSTA 3A1UA 3A11A 1HE4A 1I2CA 2A33A 1U3VA 5G0UA 1B6GA 4ER5A 4H7KA 1U8ZA 3KC2A 4L5BA 3TJZA 1E0KA 4M0MA 4C4SA 3RYIB 1XZPA 5IEBA 1GUDA 3RYCA 5JMPA 4CFSA 3PTZA 5DEOA 2W11A 1BDMA 4MHSA 4AQDA 3NT4A 4LDAA 3QEMB 1O8BA 2IIVA 1XQYA 1ZDMA 1WUYA 4KXXA 1U3TA 4BNUA 1M6NA 3DTVB 1T0JB 1U90A 4FDVA 4B3FX 4G25A 4YS6A 3DDOA 2OCYC 2ZT5A 4B4KA 1QH1B 3OVMA 3K0SA 5KTRA 5LJIA 1HDZA 3BMOA 1O8CA 2ONKA 3RS0A 1SZCA 2FHPA 2G0TA 3KUUA 4KE6A 4FR5A 3ZD9A 2H4HA 2O8FA 1R2QA 2Z9DA 4NE2A 1WLSA 4UMVA 5BWMA 1Z4JA 4WZAB 5C8DA 2Z6UA 4I2NA 4Q1VA 3VNVA 3AEQA 3T5MA 2PY6A 2JFUA 5DCWA 5G1OA 5G0TA 3CBQA 3DFFA 3N2LA 4F3RA 2ZM6B 3OCVA 1GZ4A 3VC3A 1RDFA 3JZMA 2QA5A 3H87A 1RR6A 2Q1YA 1JPJA 5EI5A 1KJ9A 3H65A 1SIWA 1CUVA 1U3FA 3QWBA 1LNQA 1BVUA 1EX6A 2WFLB 3Q2OA 4KZKA 4O4LF 4UUMA 2P5SA 3NU1A 5CLIA 1G1AA 4ZI7F 2I67A 2RGWA 4MIOA 1JYEA 4YASA 1KH3A 5JS6A 4BUCA 2MYPA 1RT9A 1I0LA 2MDTA 2OCXA 4YUXA 4F9EA 3RKUA 3K5PA 2HYIC 4LNUB 3SQOA 1V26A 5IJAA 1AIPA 4Y2PA 2W2LA 4EGFA 1OWLA 4W9NA 5CA0A 1VKZA 3RRYA 1N0IA 2CLOB 1Z47A 4LOLA 3S2SA 1Q1GA 1WXQA 1ZI8A 2PYDA 2JGDA 4J76A 5BV0A 3N2KA 1BYIA 4HFRA 3KAQA 3UPTA 3IE1A 4OMCA 3ZWWA 4FC7A 4GXTA 1JVBA 1MF7A 1YXMA 1V43A 4N48A 4MWTA 1QYIA 3HHPA 3QVGA 2HNBA 4O4IA 3W9UA 4DLXA 4RKRA 5HMLA 1QYDA 1L2TA 2HMWA 3IR7A 3KWJA 1C9EA 1MIHA 1IY1A 5H80A 5IAKA 4EA9A 2B8NA 4RQAA 4JUAA 1HT0A 5K2MA 3E48A 4JMLA 2VHVA 5G02A 3SEQA 2VHYA 1KZ6A 2R6FA 4RZHA 5HOEA 1QRSA 3LP6A 1YMUA 1J25A 2P40A 5L6LB 1KDYA 2QTBA 3NFYA 3UG7A 5CMLA 1HNZB 1PUXA 4KDRA 1Z13A 4BMYA 3GFBA 1MC8A 3DFKA 4HZGA 5JAZA 1ZRNA 4G85A 1W1WA 1L7QA 4DLTA 2J6CA 4I50A 4DWWA 2A58A 2IYQA 3FYTA 4W6ZA 2W43A 1G20B 3AESA 1ZH2A 2ANCA 1N6RA 1QIIA 2CMFA 1DDOA 2I2AA 3DT9A 4FZ3A 5K8UA 3DUWA 2QPOA 1N0UA 2B4YA 4CETA 1B74A 1P1IA 3PVZA 1HDOA 2Q5OA 3NEYA 1LH0A 3G5TA 4WBSA 1M9NA 4B84A 3HGTA 4G0QA 5L45A 1ECBA 4GXNA 3CFYA 1DXQA 2DF8A 2FSFA 4XPZA 4CI9A 4LE2A 1H6CA 3ZJUA 4FWIB 4IV0A 3P2KA 1Y8AA 4CEJB 3AFIA 4HLCA 4ZIRB 3AR6A 1E6LA 2AI1A 2PO7A 4I4TB 1KKMA 1H6AA 1YCFA 4ALJA 3BM5A 2JIQA 1TQDA 4QEDA 3K0CC 5KTPA 3ERCA 5KPDA 5ITZA 3LM8A 5FO0A 2EWVA 2O7RA 1ZNYA 3TJMA 3ZEIA 4MYSA 4B17A 1J21A 2FQ1A 1RW4A 2PUWA 1YDFA 2HADA 4BX3A 1RI4A 1Q6YA 2I65A 1M34B 3O31A 3OURA 2NVOA 4BX8A 1HG0A 4Q3BA 1NUSA 1YQDA 3ULKA 1OX6A 5AI9A 1ODJA 5K01A 2Y9MB 4FNOA 4Y18A 4C01A 3FVTA 5F76A 2FWMX 1SG9A 2H07A 3C3JA 3CF4G 4IDDA 4L6CA 1A7JA 3ONVA 4LK3A 2ZBDA 2DBRA 4RH3A 5EHQA 1X8JA 2ESRA 5TEWA 4RIFA 3WNZA 4BE9A 4B73A 2BE9A 1NXTA 2XHEA 4H59A 4G5OA 3V6LA 4JLWA 3PFIA 3QNUA 5EXSA 4EKIA 2EKBA 4TWIA 4C7JA 4URFA 1UADA 1Q1AA 5CDHA 1V1JA 5I8ZA 4OGFA 3IIIA 5JCJA 5H9WA 5CM9C 4C2UA 3QVTA 1NNLA 4GKVA 2OBXA 1RI3A 2WTMA 1OLXB 3BSWA 3OQBA 3ADOA 4E3ZA 3PDUA 5TGZA 4LSZA 1SUBA 2CC2A 4DCCA 4E5VA 5JNVA 3N0XA 4BVGA 4EI7A 2PUBA 4QE3A 3G7NA 1XTVA 3L49A 4JI7B 1GCAA 1MOZA 4HATA 4EKGA 5FA5A 4L3OA 3ZV3A 1BX3A 1SXJC 3V3KA 2XMDA 4EYGA 1QJ4A 4DCOA 3L8MA 5CA0F 4LQLA 1UJNA 5KC9A 4RJ2A 2QRPA 3LP5A 2BTQB 4RCVA 5IYZB 1L7EA 1ORVA 4UEWA 4ESVA 1UAYA 2DPLA 2C4VA 5EFOA 1BD4A 3IV7A 3LT4A 4ARAA 3I9KA 4L8WB 4ZP1A 1WZ2A 1YACA 1H93A 1KR2A 2G7ZA 1F8UA 2J08A 4HOYA 4MW1A 4PSUA 1U2GA 3VV2A 4KPYA 2JAQA 2G80A 1PVOA 2XAUA 3K0FA 1U3GA 3GUZA 4O4IF 4UBOA 1XELA 5THXA 3WA7A 3GLIA 1X0XA 5HIMA 4BUZA 2HAEA 3KSZO 3TPFA 2PQ6A 3AQIA 5D6NA 4JOBA 3F8SA 1L8XA 3AOEA 2FK8A 4M99A 5DTMA 3CZPA 4RZ2A 4COOA 4DILA 5BSEA 4FIDA 2XTJA 4ZQHA 5K20A 1IIBA 2QL5A 1E1CB 2UVQA 1OWNA 2B7LA 2ZYDA 3EWNA 3MM4A 3NHFA 4KSYA 5F23A 3TLBA 3COYA 3LC0A 5IDWA 1QC5A 4JJ8A 2P3LA 4LVUA 4NPHA 3WGYA 4FN4A 4AZSA 3C1UA 5DNDA 1GYRA 1XTUA 3KPUA 3RNLA 3UANA 2ZJBA 3FTEA 4JLVA 4G07A 4FHDA 1BDIA 3NV9A 3FJ1A 4CLXA 1SU6A 4RSMA 3IQDB 4B2PA 4R9VA 2BHNA 4DV3B 1IJEA 1QHIA 3BIXA 3OZCA 3RTAA 5EUCA 4BLOA 4E3WA 2ZYGA 5BOSB 4WD3A 5BQXA 5C80A 5LQRA 1JXMA 4Q7JB 1TDJA 2GD1O 2A1UA 4D26A 3N8KA 2B36A 3SF8B 2JK1A 3KB1A 1N0WA 2F9LA 1C30A 4X6UA 3VKVA 4IVNA 2PTGA 3I1JA 1KAOA 1TMKA 3KBBA 5KVSA 3WL3A 1XZJA 5DLDA 5C3UA 4E2WA 3W9BA 2QTWB 3OUZA 4C7OA 1PR6A 3NALA 4Z4GA 2HB6A 1GUBA 5C32A 2WDZA 3GRYA 1KAHA 4KPFC 4NCKA 4HLQB 3LQ2A 2VAPA 2Q4EA 1TZBA 3CUVA 1N6PA 4G67A 1TT5B 5U4QA 1VIMA 4OQPA 4ALIA 4FIZA 1O0SA 1U81A 1IN1A 3X1WA 2Y1LA 3R6GA 1JA1A 2WSSD 3GUCA 1SD1A 3GWZA 3TDMA 2WU4A 4HNTA 4WLUA 2RHCA 2BCGY 2AQ8A 1VSBA 2HXSA 5E7JA 1ENPA 1JLRA 2GBGA 3AV0B 1T36A 2QW8A 3L3BA 5JCZA 5KNDH 1A9PA 1OXKB 3UMMA 1XAGA 3N0RA 2EW1A 4UULA 5BR7A 3L8YA 4R83A 1N9GB 4KPUB 2O2HA 1EJBA 2B61A 4KWEA 5FBLB 1SELA 2G1UA 2VZLA 3SG0A 4CLDA 3W2EA 1XDWA 1E2GA 1K3UB 5E6SA 2GK7A 1BDHA 1I3LA 3UZUA 3R09A 1YJ8A 3L0BA 3NUZA 4YV0A 3WIOA 5LCXA 3TFQA 1I94B 1MX9A 2FUG6 1VTKA 1NPTO 1TJ5A 2BEVA 2PQ0A 3BSSA 3OCJA 1OA1A 4GZ6A 3QIAA 2NU9B 3WIEA 3D0OA 4RIIA 2VP6A 3GNLA 1XMIA 3ZI7A 1NYLA 4N5NA 2PYZA 2GWHA 2I1WA 3UENA 3QUTA 3ZHYA 3I3OA 1GUFA 3U49A 1FCJA 1JQKA 1NXVA 2X0RA 2AR7A 3SJUA 1Y3IA 4J1TC 3FOBA 4JLMA 3MJDA 3ILXA 1QWSA 4EUHA 4GYWA 2GVZC 2FXVA 4MPPA 3LF2A 4QLBA 2C92A 2CB0A 2D4AA 3W06A 2HQSA 3EZFA 1SKMA 3AF4A 2D5CA 4RD6A 3F67A 3UTDA 4L0CA 4HR7A 2QVZX 4NTZA 4ZV4A 2JIOA 4P5EA 4CM3A 4Z3KA 3WHKA 5EVJA 1OWMA 2VPZA 5TSDA 2ZBRA 3OZGA 1H0SA 1RMQA 5KWJA 1UP6A 1YNOA 1J20A 3U16A 1GM5A 2GRJA 2EWMA 1O94A 3LYHA 4JJ4A 1YZVA 1X19A 1ZUIA 2AOWA 1QKIA 4EFKA 1B7GO 4BQIA 1GILA 1YS7A 4EI2A 4JD5A 4CHTA 3NHPA 1C8LA 2XQKA 5JFOA 1NBMD 2IYVA 3QY0A 4UXIA 3RSQA 1SUIA 1OW3B 1UP4A 1F6WA 2DWOA 2KM1A 2E4YA 3HNPA 3RWBA 3WJ2A 5EE1A 3WGIA 3LQ4A 4WCVA 2P9GA 1QP7A 1Y4SA 1F38A 2WV7A 2NQTA 2QN3A 3DZHA 4IM7A 4G5XA 1MB9A 2EJUA 4KQEA 1QF7A 3ZHOA 3PHCA 1M2EA 1NBOA 2RKBA 1MGPA 5HM6A 3L7NA 4K6OA 3C6ZA 2HHJA 1HR0B 4TRNA 1P19A 2G09A 1H22A 2GFQA 2OV2A 5CH3A 4DDKA 4EF5A 2PRKA 3BD8A 5EJ7A 1ZESA 2X3UA 3HY6A 2EHJA 1E0JA 1CBUA 1F0NA 3I28A 3KR9A 4JN6B 3N39C 4NOLA 2WOJA 4PLTA 3TOVA 4C0LA 3OFJA 3NIDB 8MHTA 2WSBA 2ENUA 1ZK4A 3FPGA 4W1RA 1OFIA 3KAKA 1MHTA 3ZIUA 5K05A 2XSZD 1MNQA 5HE8A 1T13A 4NU5A 1JLLA 3GVXA 4AF7A 3G0BA 1PG0A 2FWPA 5FNZA 1LX6A 3RVQA 4EB6A 4ZZ3A 5K8LA 4PLCA 1QOPB 2C1XA 2VDQB 3QVWA 5JZOA 2CHQA 1EQUA 3AB3A 4HWOA 4ASUD 5LVAA 1FIUA 5LU9A 1Z9BA 4RTLA 2DHQA 2JFGA 2PMCA 4ZKEA 1XU4A 1CUAA 3EQ8A 5KVAA 1ZLXA 2AX4A 4M76B 2QHXA 1ZOIA 3T7CA 2HSEA 1R8SA 4LY3A 5DIZA 3C8DA 2AJDA 4BC1A 1XLVA 3OESA 2FZWA 1JA9A 2OXTA 1P2BA 2W6PA 2XWPA 3ICPA 4K81B 3LBFA 5DEIA 2LIPA 2BI4A 5JAQA 5SYAA 3T4UA 3QPCA 3VZSA 5LB4A 2OOSA 2QJOA 1JAIA 4IWNA 2DGDA 4E30A 4F5WA 4ENRA 5KC8A 3CG0A 3CX8A 3VU3A 5FWXA 3ZGNA 4OP2A 1Y6QA 3KV1A 1FVFA 1NQVA 2OP1A 3R3YA 4TLEA 2OFOA 5J58A 4P1ZA 4YIHA 2PEZA 3AEXA 1HZZA 2GSWA 2QM3A 4OL9A 2HIGA 2AEFA 2SKDA 1ZYUA 5ECDA 5EXEA 1SPBS 3V55A 1RAFA 3ORRA 2XMBA 3EZXA 3T7DA 5FTKA 3TMAA 1SXHA 2C2WA 3I8XA 4AZ3A 4B79A 1T9KA 2GJ8A 2IYRA 1LBQA 4N03A 2JVKA 3EDOA 2A5JA 3GLGE 1UQRA 2RHGB 2C95A 3KAPA 1N5IA 3ZCXA 2NXCA 1HG1A 4HV4A 3HJBA 1DXOA 1Z6ZA 3LX8A 4PPYA 1UAAA 2SKEA 4BBJA 2Y76A 1QIKA 4PPNA 1DRUA 1P72A 5ALDA 3GRUA 1VJ1A 3AV3A 3O8CA 4B5KA 4TROA 3KG2A 2RI1A 1ISIA 3LAWA 3AJ8A 2IIPA 3CNQS 4Q4DA 3RJ5A 4WVLA 4QULA 5P8WA 3ZIAA 1AO0A 4KDEA 3SFZA 4P4UA 2R44A 2GR9A 4Z0TA 4H1UA 4TYMA 2IOQA 1VE9A 2X1HA 2B3DA 1EA5A 3M6AA 4XPIB 3BRWA 1TK9A 4JJKA 1L5GB 4YONB 4CQLA 1RI5A 3SSOA 1Q7RA 1PJ2A 3NRJA 4PCAA 2WD7A 2ZPAA 4W7IA 1R9MA 3RRBA 1ZCZA 4QUDA 1AA6A 5AW1A 4A0GA 1XFDA 3GLHA 3B38A 5DBIA 2JBAA 1BS1A 3O2NA 4ISBA 5JAUA 1IJBA 1V9CA 3WQQA 4CCYA 4WNCA 5LSAA 5EE3A 1EFCA 2AG1A 2ZR9A 3JQBC 1H5QA 4AWAA 2WYUA 4Q12A 4R1LA 5B3AA 3FSRA 2CLDX 3BREA 4DRZA 1T9AA 4K2HA 4GI1A 3WP0A 4FB4A 4MVJA 1E2NA 1LNSA 4FFBA 2PSDA 1S01A 2CF6A 3IP3A 3NAMA 2NU6B 3IT3A 1KMQA 3CKKA 1EBUA 5ERGB 5AUNB 3EGDA 3GJ5A 4OYYA 5HRAA 2QSUA 3LUFA 4BFWA 5BN3B 4NH0A 1UWVA 2B1IA 2A5DA 1QG0A 1QYRA 5LD2C 2X2EA 2CVHA 3NYQA 1R6TA 3OM1A 3ZU2A 4OLAA 1C81A 1EG2A 2C54A 3H2JA 4JK3A 4LRUA 3W6PA 1JECA 1RM3A 5LR6A 3ZKWB 7ADHA 2D1TA 1SC9A 2ZRIA 2CVFA 1K0UA 3M0EA 4I55A 5I4IA 1HFJA 2ZIEA 3ANTA 4HD8A 1R4MB 4XUEA 3RTCA 3SC2A 2XJ9A 3U4CA 1HKHA 2ONCA 1LW7A 3I61A 3EBOA 3SHVA 5AOAA 2IE0A 3L1VA 4PNHA 1P60A 3HDVA 2HYDA 1G5TA 1Y7IA 5K7SA 4AQ7A 2Y0DA 3W4KA 1NSTA 3EDRA 1DX6A 4DLRA 4ZMRA 4LXTA 1DAOA 1K7CA 4IKEA 4GZ3A 2E5WA 3F5DA 2O2CA 1P3DA 1VCNA 1EVJA 1BX0A 1M0WA 2YUIA 3AEUB 4A73A 3ABOB 1KRWA 4CHGA 1N5KA 3WGTA 4D0RA 1IHXA 1Z37A 3RVLA 4IJ5A 1W7AA 5AK5A 3WAJA 1SOVA 1EFVA 2PL5A 1T5DX 3BK1A 4V02A 1SUDA 4DVGA 5HCNA 2YMMA 4B3RB 2L18A 4H6WA 5JZ9A 3GPDG 4OJMX 3RDPA 3TWOA 1SOUA 1CQIA 1APBA 4OLBA 1NW9B 3BWDD 3K4HA 1QDLB 1A9OA 1W29A 2PR2A 2Z2YA 3COWA 4YBRA 4H3SA 4S3MA 4YREA 1I3CA 1JHZA 4DANA 5FDFA 3K73O 4WKPA 4J75A 3H1FA 3W6NA 2GEKA 2P3QA 4C43A 2ZB2A 4KN9S 2Y27A 3V8EA 4UCQA 5FCDA 5AKZA 4DBZA 2F3RA 2FZVA 5BWOA 2PRYA 1RXVA 3W5IA 3BH7A 3KZXA 1YUNA 1WV1A 1VIDA 1YU6A 2ONYA 4RLHA 2V4MA 1Q7CA 1V8ZA 3AYXB 4YBZA 4R01A 2PANA 2CV0A 3WLPA 1HLPA 1YJCA 4O4HA 4XWAA 1TU0A 1ZGGA 1XJQA 3R5FA 4J2HA 1ZISA 3ZWYA 1HPLA 2C5SA 2DH6A 3DOIA 3Q41A 1IPHA 4NE9A 4OJKA 3HKDA 4WY8A 1DT5A 1YD7A 1I3KA 1K5HA 2K2WA 4QPPA 4EUSA 3IRUA 2BM9A 1JKIA 4INAA 2GZMA 4KR3A 3WWPA 2X6TA 2PRSA 3WHPA 3PUWA 2DUWA 2C99A 2EX0A 3BJEA 4EHBA 5JTUA 4CEIB 5D8DA 1GU0A 4AN1A 4O8CA 5TQ0A 2Q7OE 3KOOA 3G23A 3H2SA 3JQAD 4GG1A 4I9HA 5CNJA 1MW9X 3T94A 3LUHA 4OK5A 1D6MA 1GGHA 3PQCA 5I3CA 5KNBH 2X7XA 4X8HA 3MW8A 3UCXA 1KFEB 1TM3E 2ZKLA 5TC4A 4N9QA 3THRA 4I8IA 4KE7A 3NAGA 3WDLA 3O90A 1XI2A 2CLFB 4RTQA 5FJIA 2JGJA 4YCJA 3BK7A 5JC8A 3LDFA 3I04M 3QXSA 1XTIA 3CKMA 1UPTA 2WF8A 3E58A 5REQB 2Q4RA 2ZWPA 4G8CA 3D7RA 3A3OA 3HUDA 3CYFA 4PTLA 3A2NA 3WQRA 1E79D 4LRQA 4OLHA 2JD1A 4FSXA 2NVUA 5K0CA 2HC9A 2I4LA 2JDIA 5K8IA 4B8YA 4LXHA 3EYAA 1SCUB 2GM9A 4B2LA 2PS0A 1WUTA 3C6XA 4Y9RA 5DHTA 5JJBA 2RHOA 2EIXA 4U7GA 1RWXA 4DMUB 2JI9A 4NJEB 5CT4A 4PGHA 5E7QA 1WKCA 2EV9A 2P6NA 4A16A 5FPHA 3JYLA 3LVRE 3QX9A 1KU6A 2ZE7A 3F6RA 5FAXA 3WWZA 3M4ZA 4D3ZA 1FSPA 2V55B 5F98A 1MIOA 2H52A 3A6DA 4Q34A 1VI2A 2BWJA 2PWYA 3VO1A 5KQSA 3L0CA 5GINE 4CL3A 3R24A 4PZPA 1JSCA 5TPZD 2QD3A 4OXKA 1LRKA 1OROA 1Q1ZA 1NMQA 2QX6A 2PZKA 4E22A 1A9XA 1JAHA 3MGAA 3Q88A 3R5XA 4MPDA 1P0QA 4H0FA 2J7PD 1ODFA 3M9XA 4LBVA 2R5NA 4I46A 1IG0A 2R79A 4RAOA 3ET5A 4EVSA 3UT5B 1Z6GA 2CXUA 4I55F 5LOVA 1GPDG 5U9CA 5GOTA 4LJ8A 2IF0A 2VQSA 3Q98A 3V00A 1RQNA 1PG2A 4RZUA 3RADC 1EFAA 1P6UA 4LDNA 3JQ8A 3QUSA 4FQ5A 4MO9A 4B6EA 5JZBA 4DR4B 3S2FA 1Z62A 4PGFA 3OE7A 2QUZA 1GFSA 5D01A 5FOSA 4BIMA 2VH5R 5FB3A 3FG9A 1U2SA 1XF9A 3RT7A 2J3MA 2NV0A 1P9RA 3I37X 2L82A 4YWJA 5HOQA 5EWJA 1A9ZA 3NONA 1MR3F 4FFWA 2W4QA 3T3IA 1T5TA 1KJJA 1NPDA 1PEYA 1GT6A 3K9CA 5JE8A 2HJHA 1A5AB 2HBRA 2GZSA 3A0RB 4LOAA 3PITA 2GAOA 1JE0A 3P9KA 4JXXA 2P8SA 3KU1A 4FJ0A 3IKLA 1E6UA 3DL4A 2JIDA 3SYTA 3UFXB 3LUKA 5FNVB 4C3ZA 1YQWA 1WS6A 1Z5UA 2OB1A 2K4MA 1ISSA 1SIOA 2NX2A 2ZEJA 3AF3A 1DQPA 3QF4B 2UUBB 1UKZA 4X97A 4DCMA 1ISHA 3AUYA 2WBLC 4ZAYA 1HEIA 4Q3NA 1Y3FE 3VNRA 3U3DA 5KUTA 5LBUA 3L7BA 4CKWB 5I7HA 3RS2A 3KOXA 3R0ZA 4GM4A 1B1CA 3C8MA 2VL7A 5DXFA 3M6VA 2D1YA 3UYLA 1HGXA 5J1TB 3ZHQA 1NOIA 4AMVA 4X24A 2N1BA 2EJVA 2CDRA 5B1YA 5A4KA 3FDJA 5FUWA 4QUAA 4TKVA 2JIBA 1AUQA 5ENDA 5BMVB 5KOIA 5BSWA 2J4DA 1G20E 4JOCA 1CR0A 4NQRA 2JFVA 3B13B 2OECA 4GRAA 4P35A 4WDRA 3WLIA 4CLRB 5J2UB 3B7WA 2BEWA 2W37A 1KSGA 5KWVA 3ROPA 4N9WA 1HEUA 5FORA 1VYUA 1MO6A 5TPWA 4XJVA 1K8YB 1W4AA 5EZYB 5H83A 1RBZA 4G2NA 3DGFC 3ZHUA 1T25A 1KI4A 4P34A 3NHJA 4QELA 3KVNA 1DU4A 3CLKA 3EASA 3P9ZA 3PQ3A 4HJXA 1YR7A 4KYTA 1RMTA 4TV9B 3TNJA 4AUMA 2JJ1D 1DRJA 1Z38A 2G5TA 1TC2A 1U7XA 3OZSA 1KFBB 1SQ5A 1IOZA 1RJWA 2XUHA 3GJRA 3REOA 2Y4OA 3EYWA 4E11A 1ZM7A 1L3CA 2Y2VA 3ANYB 1O9BA 1XEWY 4BLPA 2ZRJA 3RAEC 3MB5A 1Y7LA 2C8LA 2JVJA 2JNWA 1XLUA 3E5HA 3QXCA 4FWTA 4YJHB 2HSZA 4ETMA 2O52A 2WYOA 1FTWA 1N1GA 4QGBA 4AJOA 1ZO8A 2ZR0A 2PDAA 1BCSA 1M34E 5L3SB 4AF8A 4EMSA 3KPYA 5IPFA 4LZLA 3GEMA 5JU6A 5LPNA 2GPWA 3GIDA 2QGNA 2XI4A 3KVYA 3CW2A 4TQUS 5E8RA 3QKRB 3JWGA 1XYYA 4M8NE 3DSRA 4RHXA 5ELLA 4N1AA 4D4MA 2ONJA 4RHCA 2BR3A 1DC3A 3VH2A 4CQMD 3FNGA 5KTSA 1QFJA 2I4IA 2HREA 2WJIA 3IUPA 3KD3A 3NMUF 2I76A 1DKQA 5DYTA 1YR6A 4DFDA 1H2XA 2HV9A 2XD9A 1QFYA 3PYXA 4YRAA 4OI0A 1SBNE 3FZNA 3Q5EA 3ND7A 4KLAA 5CU7A 5FP0A 5ALWA 4HP8A 1PFYA 4B9AA 1M76A 5AIAA 3E18A 1J8MF 2BGIA 4EPWA 1VHLA 1QV9A 3TTSA 2L69A 3ZV5A 1IXZA 1L4MA 3A6KA 5BN5A 5KWSA 3U6KA 3AETA 1UQTA 1ZK0A 3JWEA 3HU5A 4L7VA 2P9FA 5LOVF 2F7SA 4J0IA 3I72A 3E3LA 4URYR 1LPOA 2Q5IA 3O3OB 1N5MA 4JLAA 4OHRA 5A6SB 1S1MA 3G2HA 1SAYA 4Q9AA 3WVNA 4Z4CA 1NV9A 3AKDA 1O5TA 2VDKB 4MUHA 4W5JA 3HO8A 4Q4AB 2FR0A 1XQ9A 1IK4A 1DC4A 2J3KA 2I34A 4Y2RA 2CVQA 2QP4A 3AZPA 4B47A 4FYKA 3L8ZA 3HCOA 3FUWA 3UMSA 1RTKA 4NV3A 2VT3A 3IUEA 1L9KA 4MVCA 1Q95A 2OO3A 4HNRA 1CEQA 1H4QA 2PZLA 1EM6A 4KPEC 2WIFA 4E5NA 2NSJA 1AUVA 1L4NA 4AXBA 4DMCA 3ELDA 5C1DA 3OT5A 2IXDA 3OIWA 1A7AA 1SD2A 1XBTA 3EXG2 3A1EA 1AQUA 4FDTA 4WBNF 5JSUA 4Z9BA 3I0NA 3TKAA 3M4JA 4LFBB 1XRSB 2NU7B 3Q3JB 4GMHA 3F3SA 5ENVA 4H2DA 5CM8B 3A1TA 4FZJA 4EO9A 2AG0A 2OWEA 2XWQA 3I1FA 1F3OA 1MAWA 1GTL1 4OQDA 4BKRA 1Q74A 2OXRA 1FTSA 3C7CB 4RF3A 1JEEA 2CEAA 1SG0A 4DKXA 2Q1WA 3V1LA 1NBWB 1ZGHA 2I6TA 4G41A 1XKXA 3J7AC 1OBOA 3ITNA 3T3EA 4CODB 1GZ5A 2H59A 4G89A 3CF0A 5H68A 1ESZA 3OQ6A 2FG5A 2H11A 3TZBA 2JH3A 2E4XA 3LBNA 4BZPA 2WMOB 4AAYA 3UT0A 4K9DA 1GTMA 2QTHA 1N1EA 3NZEA 4Q66C 2HK9A 4EQZA 4F3YA 2PUTA 1BWQA 3VI3B 4BVHA 3RYTC 5EJ2A 3ZDBA 2O59A 3CUTA 3A1DA 1TYZA 1EWRA 1PSWA 2ZCVA 1XRNA 1HYBA 3GFPA 3BWEA 3JYPA 4H9GA 4QFMA 4RESA 5G40A 3TW8B 4ERNA 1EIWA 2A3RA 4PSAA 1V48A 2O0KA 1XXHB 2RKOA 4DAEA 2BKXA 2E1RA 4DR3B 4K3UA 3U7HB 2WNSA 1MC1A 2VWHA 2H0RA 4MKFA 4F8EA 4JEHA 3LWNA 1HRKA 3S1LA 3LG2A 4IKPA 2CXOA 2IQ5A 4QUGA 5BV7A 2G9UA 4URVR 3RU2A 2AV6A 4LJYA 5HZGA 4AYWA 5HJ5A 4DSZA 1ABEA 3ZWPA 4EF4A 4K8RB 5EVCA 5J9FA 3VSAA 5LMNB 3E2PA 4FMBB 1II8A 1YL6A 2DWQA 2RSLA 1GXSB 3F0TA 2PLAA 3BWXA 3PHHA 3WADA 3WIBA 4EDHA 4R0NA 4WXMA 1PE0A 3AY7A 4QJ5A 4LKRA 3VX4A 2BFNA 1OZHA 2XGOA 2YRWA 4WZ6A 3HXMA 1HURA 1KI3A 4PLZA 1ODCA 4L15A 5LMCA 4E4YA 3GLFA 1IDOA 3BRSA 3H3JA 1B8NA 2B5VA 3MF4A 1KMHB 2FY8A 2Y1OA 4I9GA 3L7OA 4JROA 4M8SA 3AM5A 3C3WA 4HPWA 1RRPA 4OB7A 3TOZA 1ADYA 4AC9A 2OSVA 2A1TR 4UBMA 3ZHCA 1DI0A 4DZRA 2Z8XA 1AKQA 2H4JA 2V1UA 5TVGA 3RVMA 3TSCA 3TLEA 1P75A 1JG2A 3NT2A 4D4GA 4EGJA 4LHZA 4FBGA 1T8TA 3IO5A 3PC8C 1E98A 2XODA 1CJCA 2PGXA 4ONEA 4ZDIA 3S3TA 4LVNA 1Y6FA 3RYHB 3DJYA 3A9SA 1XEFA 2B7BA 1KI6A 4JLKA 3RJMA 4J3FA 2LUOA 1UM9A 2RGXA 1AUPA 2AZ4A 2P2CA 1VXOA 1I7NA 3PYLA 3O8LA 4TMVA 5CB4B 5IZCA 1E1NA 3WLSA 4RTNA 3TQHA 2DB3A 3G0GA 1A9YA 1R8QA 3K09A 1MRNA 1M8PA 3TTXA 3ZD6A 2JGRA 2QDKA 1XXLA 3GG2A 1JQ3A 4GGPA 4ICIA 1NAIA 2RHDA 1HBJA 1R0KA 4HFJA 1D04A 4A6DA 3OQNA 1Z33A 1CHNA 4MQ5A 2BGNA 2A0YA 1PT6A 4KBFA 4HXGA 3STXA 2Z58A 4HEA1 4AFNA 5DBEX 2G6BA 2RKWA 1L5NA 4XB1A 1VKHA 2BGTA 4FDAA 4NZMA 4US0R 4YQEA 4CM5A 5F78A 1YVDA 3IT1A 1LK5A 1I9GA 3B3AA 3F7MA 1Y5MA 2HPAA 3OLCX 4ZVVA 3D7SA 4YQZA 3V97A 3EFEA 4CN8A 2BKVA 1KMNA 3IAS6 1W5FA 2D7CA 1JI3A 4GH5A 4YMWA 3VSEA 4HXYA 2A14A 4WOCA 4U6NA 2LGJA 1QIHA 2YFHA 3LY9A 1PK8A 6YASA 3VR5A 3LT5A 1DMRA 3P9PA 5KAPA 4BB9A 1W46A 3DVLA 1H8ED 3BAZA 3H4MA 3LQYA 3QLJA 4FMPA 1E20A 3RU3A 4CRWB 3RVSA 3CF6R 2XUPA 4QXAA 4L75A 3ORFA 1HZZC 4XX0B 5AO9A 2RGCA 5A0TA 1QOZA 3SZLA 1WE2A 1H2HA 2EF1A 1K7YA 2O0MA 2PKYX 1KQPA 3FTPA 3ZOZA 1YVRA 5KDDA 2ATCA 4FYPA 3BD6A 1GQOA 4KXUA 1ORWA 2C7PA 4JVMA 4AP5A 1C50A 1H65A 2V4UA 1GGJA 4WKOA 1CZNA 3BN3A 4XCXA 1TO6A 1Z6AA 3IHKA 3DHVA 4KO4S 4TLLB 3SS9X 2JK0A 3QKIA 4NEGA 3T3MB 4UVHA 1OLOA 3ZWXA 3SKVA 2CXPA 1T1RA 4D9JA 1EB9A 2AJCA 3BIFA 3TSOA 2VPYA 2WKWA 1TYDE 2GF0A 3TO5A 4JJAA 2YWCA 1IE3A 2QLMA 3QWAA 1DJNA 1JIUA 1MQ8B 1OTXA 3CB2A 3DYVA 1DQRA 4NICA 5KHAA 3SOPA 4DGSA 1P1KA 3OF3A 4ITRC 5TQVA 4N47A 4B2IA 3SR4A 2BBTA 1OLUB 2OFXA 2OMKA 2VAVA 3C8HA 3DCYA 1TKBA 3G8CA 3BMQA 4Q3KA 4ZOCA 3SX4A 4OAQA 1OXMA 4GP9A 4HF7A 3RSCA 3V1TC 4D1YA 1V37A 2HQ1A 1AKMA 1QMPA 2B0CA 1QTQA 2C4MA 2JCGA 2XY4A 4DQUA 3ZCPA 1E2IA 1BCRB 1PYDA 3ESRA 5I9MA 1MNAA 1MP0A 1WU7A 1AX9A 1RLIA 3AO0B 2OXEA 3WGHA 5E6UB 4CL0A 3AUSA 3ORSA 1L7MA 1P29A 2FF7A 2YZ7A 3EXHB 4R8SA 2F3UA 4YVFA 2P2SA 3B1XA 3EMVA 3K30A 4NFLA 3EEIA 4J0HA 1G8SA 1YVUA 1GR0A 4RVHA 2E1PA 8GPBA 2AIRA 2W2TA 2W6JA 3C5WP 3DB1A 5G3ZA 1RKXA 3NC0C 1SBIA 3SBXA 4ZAFA 1ENZA 2AYYA 4A15A 3P2EA 4L5YA 5CT6A 3OT1A 2J9FB 4ZQBA 4KO3S 2FJUA 1DXHA 3I6ZA 3D7MA 2YNMA 4JHLA 3WJAA 1OB5A 1U4NA 2L17A 1K4YA 4CKEB 4WJLA 4JNKA 5BQOA 1X1BA 3WIDA 4EABA 4CW7A 3IBFA 5JMWA 1CQWA 1XX6A 2OAEA 3KK0A 4H7EA 1WOYA 1NW8A 3EK2A 1N3YA 1UMKA 2G9NA 3MIZA 2D3WA 4RPIA 2O2YA 4WEOA 4P4TA 3A25A 4ZCTA 4LTNA 4MJ3A 5IKPA 2PL9A 1NG1A 3QF7A 5JSQA 3GA0A 1W85B 2ZJZA 3ETCA 3TTUA 3NAZA 4CLOA 5EJ9A 1VKRA 2H1CA 1FQKA 1YB6A 4U8HA 3DDHA 3JATB 4QTYA 3MCUA 1L5WA 3C3BA 2C2BA 4WPGA 5ALXA 3SR0A 4BLRA 2O06A 1MV5A 4KR9A 4BZQA 1TIKA 4OXXA 3IODA 3RHSA 1WUKS 2OCGA 1X1AA 2VF7A 3LECA 2VQ3A 4R8KA 3RK0A 3CRQA 3TZCA 4E1AA 4GF5A 1W2HA 1CT9A 1K6MA 4UD6A 1NOKA 3AW9A 4QYTA 2O8CB 1LQTA 5IBRA 1WBJB 4L8VA 2Y0BA 1TZKA 1XDZA 2GPYA 5BQ5A 3RROA 1FDWA 2OMEA 3I2HA 3O8DA 4LSWA 1C14A 1E69A 2HM7A 1GZ7A 3SZGA 1FNDA 2YCBA 2JCXA 3C3PA 4JBIA 1D3AA 1ZD9A 1P45A 2XQGA 1YGPA 1XMVA 3EH1A 3UA3A 2DAPA 4N5DA 4PVDA 5E9WA 2HDHA 1BXGA 1VG1A 3O9VA 1UXIA 1YIDA 5HQ3B 1XZMA 3FDZB 3ISTA 2HF9A 4UTVA 3EVEA 4DMHA 1EP3B 2Q2WA 3TTWA 5KNLA 1JQ5A 5FPSA 4MUBA 1V6AA 4EHAA 4RD4A 3KKKA 5A9SB 3VPGA 4BV3A 3B1ZA 1JF8A 2YV2A 4V1CA 3UF0A 3O83A 2YVQA 1Q1BA 1I4LD 2VAWA 1AS3A 3JPWA 4M98A 4GM0A 4KW7A 3REQB 4CMIB 1I3NA 2A0FA 2XMZA 3QKTA 2C4TA 3A2MA 3BMCA 3FNIA 2ZBVA 3JD4A 1XG5A 1TYCA 3K9BA 3DPUA 3JQGA 3ADPA 2V5AA 3MAJA 4ZEVA 3E2MA 3RFFA 2PGJA 2EKDA 3C3XA 4LXUA 2Y68A 3K6RA 5CURA 1DCMA 2BHTA 1EUDA 4BO6A 1QDEA 2W2XA 4BVJA 3VH3A 5IC4A 4N6GA 4MX8A 1Q1NA 1XLWA 1PR5A 1NFFA 4LFAB 1CZHA 3V8QA 3G2PA 4KGZA 4R81A 3ZI4A 2CW5A 3MJRA 4GR4A 2GESA 5C8YA 3OZVA 3SSAA 2QRLA 1E4YA 1OWPA 4HDAA 5HJ2A 2ILVA 2ORIA 2PZBA 2PXHA 3WB0A 3BTSA 4YFVA 5GQSA 2JEYA 1PW5A 4RMIA 1Z36A 3HABA 2HMUA 1PJ4A 2DBZA 3JR7A 1H1LA 2H92A 4OQLA 5ARCA 2VCHA 4DXHA 2P41A 1C0EA 2VKQA 1SN7A 4LHXA 3T7EA 3U80A 1UL1X 1C7QA 4D5EA 2PT6A 4G0VA 2RB5A 1ZCAA 4D9CA 2OGZA 3EDCA 1AGPA 1TQ8A 4U2DA 4WZZA 4GP6A 4I14A 1T1IA 3UKOA 3E3MA 2ODQA 1N9ZA 1JWAB 3KEMA 5FLKA 1Z8DA 4XWTA 4ZQFA 2C9OA 4S1VA 2PZJA 2J6BA 1J97A 4P81A 5GONB 1FA9A 1MJNA 1IAQA 3EVTA 3WBJA 2ID8A 4F8JA 2CDAA 2G36A 3FGNA 3IAFA 4ZA2A 4CT4B 1EDEA 2WJJA 1NC3A 3E8XA 3Q8XB 1GA6A 5K3FB 3ZCVA 2WQ6A 2HA5A 4O29A 3PJEA 5DLQC 3U62A 2ORED 4WKCA 3D6HA 1Q0QA 4EG6A