3TWOA

The crystal structure of cad from helicobacter pylori complexed with nadp(h)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
347
structure length
347
Chain Sequence
b'MRVQSKGFAIFSKDEHFKPHDFSRHAVGPRDVLIDILYAGICHSDIHSAYSEWKEGIYPMIPGHEIAGIIKEVGKGVKKFKIGDVVGVGCFVNSCKACKPCKEHQEQFCTKVVFTYDCLDSFHDNEPHMGGYSNNIVVDENYVISVDKNAPLEKVAPLLCAGITTYSPLKFSKVTKGTKVGVAGFGGLGSMAVKYAVAMGAEVSVFARNEHKKQDALSMGVKHFYTDPKQCKEELDFIISTIPTHYDLKDYLKLLTYNGDLALVGLPPVEVAPVLSVFDFIHLGNRKVYGSLIGGIKETQEMVDFSIKHNIYPEIDLILGKDIDTAYHNLTHGKAKFRYVIDMKKSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannitol dehydrogenase
molecule tags Oxidoreductase
source organism Helicobacter pylori
publication title Unusual NADPH conformation in the crystal structure of a cinnamyl alcohol dehydrogenase from Helicobacter pylori in complex with NADP(H) and substrate docking analysis
pubmed doi rcsb
total genus 104
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.1.1.195: Cinnamyl-alcohol dehydrogenase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3twoA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3twoA01
1P1IA 4KP7A 4CL8A 3GDGA 4I9UA 3E6AA 3NDJA 5TGDA 2QQ5A 4UUMA 4O63O 4RGBA 4NU6A 2X1HA 5JAZA 4A03A 3NT2A 5DDIP 3H2SA 1DRWA 4OQYA 2RCYA 4ZQFA 2CDBA 4JGBA 4B4UA 3F4BA 3JQBC 2OBNA 2CFCA 5HM8A 3KV3O 1U3VA 1H5QA 1YWGO 2D1YA 2ZYAA 2Y1EA 3EAGA 2B36A 4A2CA 1ISFA 3MTJA 4MOWA 5FFFA 2DUUA 4LVCA 1E1NA 1JKJA 4LVUA 4P4LA 4XQ9A 3PWZA 2Q1TA 1Q0QA 3BMOA 4FFLA 3S1LA 3TDKA 1SAYA 3D64A 3HDJA 4AJJA 4J1TA 4ZJUA 1Y8QB 5TIIA 3GN2A 9LDTA 3LSYA 4YT8A 5I7VA 4W6ZA 1MFPA 4RLHA 3ST7A 4IJUA 5IZCC 4FGSA 1NQAO 4J1SA 1NQTA 1QMGA 3DZFA 3DHEA 3RUCA 4D3FA 2D8AA 3ZV3A 5FEUA 1W8DA 1ONPA 2YV3A 4MVJH 4K6CA 5JMPA 1MP0A 4D42A 3DR3A 3BTVA 2W4QA 4GBJA 4X54A 1JQBA 2CVOA 2YYYA 4MP6A 1VKNA 4CM7A 1Y8RA 2JFGA 1LDGA 2OOSA 4E2WA 3ANMA 3OF2A 2P9CA 4MDHA 4NHEA 1W6UA 1UXHA 3ZWAA 4TQGA 1HKUA 4NBUA 2BFOA 1MA0A 1DOHA 2J3JA 4F6LA 1JKFA 1SOVA 3WIEA 3JQDA 1NR1A 2JFFA 1DJQA 1PS0A 3I9OA 4D45A 4BV9A 7MDHA 5I7SA 1EZ4A 4B3IA 4J6FA 4Q3AA 4NQZA 4QO8A 4Y8VA 2X22A 2WYUA 4WLUA 1HL3A 4EEXA 3F46A 4JNKA 1GFSA 1DPGA 3ZWWA 2J8ZA 3G1UA 4M49A 3RBZA 1PJSA 2V6MA 4FS3A 1NBOA 1B8VA 4IS3A 4CM4A 1M6WA 3VZQA 3UGKA 1KY5A 4K28A 2CD9A 3H65A 2I5PO 1IPFA 3N58A 4ND3A 3ZNOA 3V1YA 5JC8A 2A94A 2BFMA 3MJVA 2YUTA 3JQ6A 5JC1A 3VHRA 3RFVA 4IDGA 3ZHZA 2HQ1A 3KTDA 1DIBA 2NNLD 3NRCA 1J4AA 1RPNA 3RUEA 3Q3CA 4QFDA 4CM9D 3D3WB 3LC1O 4UUNA 2JCXA 4FN4A 4ALJA 1EQUA 3IS3A 3C7AA 3GEMA 3HADA 2Q4EA 2ZATA 3DZKA 1A9YA 1NYTA 3GHYA 4CQMD 4PGFA 1DFHA 4R16A 3B20A 3DAFA 3JQFA 3OHSX 3HDHA 4YA6A 4EDFA 1PQWA 4HFJA 4HUJA 4LSWA 4RPHA 2RH4A 1BTOA 1V3TA 2DBZA 2IYOA 1EEHA 3FPLA 3GT0A 4ZRNA 4CL3A 1DC4A 2PD3A 3TFQA 3PLNA 2PKQO 3H9QA 4CLOB 2B5VA 2FR1A 4KQXA 2O2YA 3AI2A 3INTA 4UVDA 3DBVO 1WDKA 1DC6A 1WW8A 1KY4A 2DTEA 4K6FA 3NTOA 3K2BA 4LISA 2NV6A 1CRWG 2BF7A 2B4TO 2X9VA 4I5EA 4NFYA 1IUKA 4NR0A 4NFSA 3TZ6A 3PJFA 2RHRA 3AOEA 4Z3KA 5TF4A 3B6ZA 3QV1A 4U0KA 3OECA 1EVJA 4KMSA 1UDCA 2DVMA 3H7AA 1IE3A 3KYCB 4WUVA 5A06A 1ZBQA 2CVZA 4JP2A 3BMCB 4JX8A 3T7EA 4PIVA 5EINA 4CQMB 2PA3A 2QRLA 3FNFA 4D41A 1UJMA 3LQFA 3K2EA 4CMEC 3I9JA 2NVBA 5CFZA 3ZV4A 5A9SA 2AA3A 4R5MA 5FYDA 1CDOA 2EP7A 1GAEO 3BHIA 4NZ9A 3JQAB 1PJ4A 4YQZA 4BV8A 5F1OA 2BELA 4R54A 4WLNA 5G4LA 3CH6A 3I6QA 3GFBA 4BUCA 1RM5A 1U5AA 3AUUA 4N18A 3GLQA 2I67A 1E6EA 5MGBA 2IEDA 4B3HA 4PLCA 3VZRA 2DPGA 3DZHA 3D5TA 3U0BA 1SZJG 1XWFA 2VWGA 3LT2A 3U49A 3OP4A 2W2LD 4CM8B 4DVJA 5KVSA 1O6ZA 1OAAA 3RU9A 5EJ2A 1ZSNA 1KC1A 1H0KA 3I23A 3I9MA 4M8SA 3GMDA 1GADO 4PLWA 4CMAA 4ALMA 3GA0A 3U3XA 1E3EA 1K5HA 4M87A 1I2BA 1Z7BA 4P38A 2C07A 1ZCJA 3KEOA 3PHHA 4BMVA 1ML3A 4KDEA 2H63A 1KVSA 2VYND 3ENNA 4RDHA 1U8FO 2PV7A 3AFMA 1F17A 2FRDA 2RHCA 3NV9A 4QXMA 3CIFA 4HP8A 1Z73A 1X1EA 3IKTA 2QYTA 5DBIA 5DP1A 3JQFC 4BVAA 4M55A 4E30A 1VRWA 4JIGA 2VWHA 4OXNA 3WTCA 4GWGA 4XDZA 1PTJA 1E6WA 2NWQA 1GUZA 4R1TA 2D5AA 1HRDA 3W4KA 4FIZA 1PL6A 4MKRA 3RCBA 4MVJF 4CUZA 3P19A 1PWXA 5JDIA 4CM4B 1S6YA 3OJEA 4JBIA 2VHZA 2WEKA 4DIOA 2EJWA 2BGLA 5I9MA 4DBVO 3L9WA 1DC3A 3VZPA 5I7FA 4YJFA 5A3VA 4N5LA 2OXIA 5G0SA 1GD1O 4L76A 4NJMA 4XR9A 2XAAA 3H9UA 2YFQA 3C8MA 1H6AA 1XGKA 1W73A 1XLTA 1HYHA 4YDRA 1LQTA 2P4HX 3FI9A 1U7TA 2P9EA 2EWMA 2HKIA 5TJHA 2O3SA 3QLJA 2HRBA 1JKIA 3UXYA 5L4SA 3H6KA 3PTZA 3JQGA 2X0RA 4I8XA 3KXDA 3NEPX 4OO3A 2R6JA 4BNUA 5IDXA 2Y0DA 1NWCA 3VTZA 4Q3NA 3R6DA 1UZLA 4E21A 1Q7GA 3D1LA 4CMGA 3OQ6A 1Y9EA 1DFIA 2GF2A 3ORFA 1A5ZA 2Y1DA 4E33A 1WLYA 2Q45A 1PSDA 2X7HA 3C1TA 1B3RA 1KEPA 3JD2A 4NK4A 5BNFA 3VAZA 2DBVO 1PJCA 2NLOA 3H9EO 4DTIA 4J2HA 4I9HA 1XDWA 3CINA 2AE2A 3PYMA 2X58A 1HLPA 2AQKA 3H3FA 4D7AA 3K9QO 3PQEA 2FOIA 3DBLA 3OJLA 4NMHA 2PFGA 3O8QB 1T2CA 4EBFA 4TRJA 3ASVA 2O3JA 3BTOA 5BSFA 5K9ZA 1X13A 1GZ4A 2O4CA 1NFFA 3GRPA 1T2FA 3CZRA 4MP8A 3WGQA 1IL0A 4FOSA 2DM6A 1YB5A 4CJXA 1RM0A 4YAKA 1JA9A 4MJLA 1OFGA 2WM3A 2FR8A 2OBYA 1WPQA 2X6TA 1UUFA 2A4KA 4BNMA 3RVDA 3WX0A 1X7DA 2Q49A 4RF5A 1QSGA 3NUGA 1NVTA 2P5YA 3IJPA 3H5RA 4GX5A 3F1KA 1E7MA 2VT2A 5JNLA 5G4KB 2BFAA 4FGWA 4KWIA 4RL6A 1ZSYA 5BT9A 4ID9A 3VPGA 2ZTVA 3JQAD 2DUWA 2GO1A 4NJMB 1HDOA 1BSVA 4J9VA 1B16A 3EMKA 4DIBA 3I4CA 1BW9B 4AJLA 1U3UA 4L8VA 2B0JA 4XZ3A 4J7XA 4ZU3A 4U6SA 1KETA 3GRKA 4CUJA 3UH1A 2VHWA 1P1KA 2BFPA 4D44A 3OM9A 1BDBA 4S3MA 3QHAA 2OGUA 2ZTMA 4DL9A 3BHMA 2O48X 4LCEA 1GUFA 2GCGA 2UDPA 4G2NA 3FBGA 3JQCA 4GX1A 1PX0A 2EW2A 2EKLA 5F1PA 5U9CA 3NGXA 1ISIA 4FSHA 4HXYA 5ENVA 1HE2A 5KOIA 1ZJZA 1E1KA 1X0XA 4DA9A 4ZHSA 1K6XA 5I7EA 3AOEC 4KZPA 3VH3A 1XCBA 1NFRA 1PGOA 1ZK4A 3AY6A 1KERA 1RM3A 3F6YA 3HJAA 3Q0EA 2IXBA 1AE1A 2PD4A 2JD1A 3NAQA 4QQRA 3OQ1A 5LC1A 4BGEA 1Y8QA 5JW6A 1SC6A 3L9XA 2IXAA 3SJUA 4B4VA 4FFRA 3CXRA 4YAJA 3KEQA 4E5YA 5AXBA 4BO9A 6LDHA 3AM3A 3VH2A 2R00A 1QYDA 1NWHA 2C59A 4MVJP 9LDBA 3BHJA 1QP8A 4BIIA 3NKLA 4FC6A 4QSMA 5G0UA 2UUOA 1PQPA 4XYGA 3ICCA 3AK4A 2XOXA 3K96A 1JU9A 5CHEA 1KEWA 4B7CA 4I5FA 1HTBA 4BGUA 2ZB7A 3KBOA 4CMEA 1C1XA 3KVOA 2ZB4A 2J3IA 4JJIA 4XGIA 1IHXA 1F06A 4PLFA 4QTZA 3RD5A 4J9UE 4B7XA 4BGVA 5IZCA 5FI5A 3ICPA 1E1MA 4G81A 3PIIA 4PLHA 4YACA 3Q1LA 1D8AA 3FTPA 4PG5A 1CWUA 4A5OA 1BWSA 2W2KB 3IP1A 3MJCA 1DEHA 2DLDA 2X0JA 2FSVA 1DRVA 1KVTA 2RBEA 5ER6A 5L95A 3L77A 4NDNE 3UFXA 4BNTA 5CDSA 1GUYA 3ANLA 3G0OA 4WCFB 5AXDA 1Y81A 5IDYA 4AJKA 2G0TA 3MJSA 1MXFA 4FPXA 3ZWPA 1LTHR 4A0SA 4AJOA 1E6UA 3WWYA 5L40A 1E7QA 3S2IA 1R66A 2ET6A 3L0DA 4CM3A 4GKBA 2Q2QA 1T1RA 3GOHA 4E5KA 5GY7A 1YQXA 3SXPA 3IMFA 3DHNA 3ON5A 4UUOA 1SEPA 4OXYA 1NHGA 4IQ8A 5BQFA 5KIAA 3L4BC 1Q7CA 1T26A 2ZIZA 3M1LA 1F8FA 4PN3A 1PJLA 2C7GA 1E5LA 5F5LA 1SCUA 2PY6A 3NJ4A 1Y1PA 1E1LA 3UCFA 4R3NA 4OGWA 1DIHA 3PDUA 4GH5A 4UEJA 3I4FA 1TT7A 4YTEA 2GZ3A 4D46A 4RPKA 4NG5A 3KSDO 4YJGA 2J5KA 2I3GA 2AQHA 5L7YA 4IMRA 5IDWA 5I9NA 2BH9A 5JPIA 3PIDA 2JKVA 4HADA 4H15A 3I6IA 3PHLA 4HFRA 4CQLA 2PLAA 5B4TA 2EP5A 2FMUA 1QYVA 2P2SA 2P68A 4IY1A 4F46A 4B79A 3PJEA 4I9NA 3K73O 4IDCA 1ZO8A 4YQYA 1LRKA 2ZB8A 3TPCA 2X5JO 3UOGA 1H94A 4C4OA 5A3JA 4C7KA 4CM6A 2G5CA 4KOAA 3NDRA 5BR7A 2Z1MA 3LC2O 1WMAA 1KYQA 1EFLA 1FJHA 4EW6A 1B8UA 4YCAA 3C1AA 4BNKA 3KETA 2I6TA 1QORA 4YAGA 2P5UA 3ITDA 3DBHB 3QIVA 4QFCA 1K2WA 5JLAA 1LDMA 1ULUA 3SC6A 4XRGA 3TF5A 4PG8A 3I3OA 2IZ1A 1PL8A 3SBOA 1I3LA 4CLDA 3JYPA 3HFGA 2NTVA 2CMDA 3D4NA 1YE3A 3JTMA 4GX2A 5H81A 4CUKA 1DRUA 3OJOA 1YL5A 1E7YA 1EMDA 3OEWA 1E92A 1HXHA 1HYGA 2ZYDA 1NAHA 4XA8A 4D3DA 2BLLA 1JWAB 2J3KA 2WD8A 4DYVA 5TT1A 2HAEA 4XB1A 4WLOA 4BO3A 4WCDA 1Z75A 3RASA 4BNLA 1NASA 1RWBA 5BNTA 3ZV5A 4YJGB 1IY8A 4HY3A 4IJKA 4DREA 4XKJA 1UDBA 5IF3A 3HHPA 1V8BA 1X7GA 3PEFA 3AOGA 3R3SA 4TZKA 3STHA 3PGXA 4QO7A 4A7PA 1I36A 4DIFA 1HZZA 1R4MB 1XYGA 1S7CA 1E0DA 1MFZA 1ZSVA 2BI7A 5CP8A 3PLRA 1OBFO 1GPJA 1M6HA 2ZJ1A 1JDJA 3ITKA 4JLWA 4BO6A 2VZ8A 1T1SA 1LU9A 4B4WA 1H9BA 1MV8A 5G0WA 5EMHA 1XKQA 4WK6A 5IZ4A 1H2BA 4M1QA 4XX0A 5JDCA 3ZWNA 4DQXA 3BIOA 4CLRB 3KRTA 4MKZA 1U3TA 2I76A 3WDSA 4WJZA 3ETGA 3JQAA 1HZJA 3F5QA 1EK5A 2E4AA 1P1HA 2ZK7A 1Q0LA 2Q4BA 3ADPA 1PGPA 4XYBA 2HO5A 3OMLA 4GGOA 1A7AA 1YO6A 3WJAA 2NU6A 4WECA 4FB5A 1M67A 3ONEA 3DBHA 3ZU2A 4ITUA 4GVLA 3KYCA 1ZUD1 3WYBA 4FOOA 2OHXA 4M54A 1BHSA 2EERA 2VNSA 1YDWA 3E1KA 2HMWA 2JAPA 4AJ1A 4F3YA 4EI2A 3NT5A 4IGEA 4MO2A 1T2AA 3GNQA 3ZWVA 1LSJA 1N9GB 2CNBA 2DBQA 3ENKA 2Q1WA 3U4IA 4LGVA 3IJRA 4BKQA 4IDDA 5L7TA 1IOLA 1PGJA 2XXBA 4JN6B 1CETA 1QR6A 4I1IA 1UP6A 1VL6A 4NIMA 1R6DA 1ZMOA 3ASUA 2Y67A 4MVJM 5T6BA 2GLXA 4FC7A 2WDZA 1K0UA 1XSEA 4R3WA 1ZEJA 2SCUA 1GQQA 1HWYA 3JYNA 4BO4A 3RSHA 1XIVA 2Y93A 4J4TA 3CZMA 1E7SA 4IGFA 5F21A 2FWMX 3RUDA 2NM0A 4P4GA 3HSKA 4TVBA 1RYEA 4KUGA 1Q7BA 1UP4A 2FPIA 4WCFA 5GZ1A 5EIOA 1I01A 1WDLA 2O3TA 3E9MA 3DZIA 4BNVA 4XJSA 4MIEA 5A04A 1P1FA 2PNFA 5TRTA 4EITA 2YW9A 2Q2VA 1MB4A 3E48A 2I65A 5T57A 2D2IA 2HDHA 4Y9DA 2Y0EA 4IPTA 2YFHA 3RJ5A 5T8KA 4LRSB 2JHGA 2GZ2A 4BNGA 3GVXA 3OETA 4OAQA 3QVSA 3DTYA 3AU8A 2VNAA 3PFWO 2JAHA 1DHTA 3E82A 4GQAA 2JCYA 1C0PA 4Y6RA 1TVEA 5DBFA 2NU8A 5JXWA 1R0LA 3ZNNA 3W8DA 2DFVA 3ABIA 3L07A 1WZIA 3ZWXA 1NR7A 2VT3A 1Z6ZA 3BMCA 1EBFA 4IJVA 3EC7A 1MXHA 2RAFA 2VQ3A 3O38A 1QV7A 3WYEA 1I3KA 4Y98A 4GSKA 4WE3A 2CF6A 3QW2A 1R15A 4J4HA 3Q6IA 2B5WA 2FP4A 3DC2A 3OEYA 1Q0HA 2AE1A 1P1RA 2G76A 2QW8A 4RCVA 3DZBA 4YT2A 4JP3A 4ALLA 4Y6PA 1DJNA 4KTTE 3ZI0A 1PJ3A 5TQVA 1UDAA 4AICA 4M86A 4R1NA 3O03A 1SBYA 4FFNA 3TZKA 4NK5A 3I5MA 3AUAA 3VPSA 1QV6A 2OFPA 2Y1GA 4C7JA 3QWFA 4J2OA 4WLEA 3WMXA 1JW9B 4RVUA 1XELA 3DZJA 5G2OA 5JCJD 5AXAA 2ZYGA 3JQ7B 3RROA 1Z74A 3ZWCA 5GZ6A 4YJHB 1UP7A 1ZK1A 3DOJA 1PL7A 2NUAA 1YH3A 3HQ4O 2O50A 2PR2A 4O5OA 4YAEA 4YAIA 4FJ0A 4ZN6A 5KJFA 5CPBA 4WPGA 5G0TA 2Q46A 3GUCA 2AG5A 1P33A 3NX4A 2J6IA 1EDOA 3FTNA 3PJGA 4U6QA 4ZGWA 4XB2A 1YDEA 3U9LA 3FWNA 4O0LA 3AU9A 4OKIA 3INGA 4ZVVA 3VDRA 2X4GA 1DXYA 1U3WA 4GMGA 1MC5A 1WWKA 3TWOA 4A10A 2HUNA 4KDFA 4WASA 2BKAA 1AHHA 2AXQA 1KEUA 1PS8A 2V65A 2ZCVA 2DPHA 3FSRA 1XHLA 3GVIA 4YJFB 2NTJA 4TROA 2ZQYA 4ZQEA 3QJ5A 2BMAA 4PG4A 1CERA 2B83A 3UW3A 1UXJA 3V5NA 2PKQP 2GPTA 4ALIA 4XEHA 4E6PA 1FDTA 1ZEMA 3LF2A 1SOWA 4GLOA 3GDOA 4IM7A 1LLUA 1U4SA 5KKAA 1DIAA 1FMCA 3GZNB 2VOJA 2O23A 5TX7A 1XU9A 4Q9NA 1C0KA 4DLAA 3RUAA 2HK7A 4CM1A 3JQ8B 1PGNA 4IIUA 5LCXA 5C7IO 4P22A 2JCVA 4ALNA 3JQ8A 4Y67A 1P74A 3O4RA 2FZEA 3OA2A 5I8ZA 5JCXA 3JQ7A 4WOJA 2V7PA 5EL0A 2O3UA 5CPFA 3WQRA 5JDCC 2O7QA 3JD3A 1VE9A 4GLLA 1B8PA 1UZMA 3B1FA 3GGGA 4Q3BA 5DP2A 4RPJA 4OOEA 3VPHA 3D3EA 1LLCA 4DBZA 3FNGA 1TB4A 3RC7A 3WBBA 4PZDA 2TMDA 3C85A 3WMWA 3F3SA 3CMMA 1UH5A 5ER9A 1QYWA 3RUIA 3GNSA 1ARZA 4CQLB 4PZCA 1C0IA 1I32A 3DWFA 4YT5A 3ZN2A 1ZXLA 1MGOA 5I8WA 4D3SA 5DZSA 2HMVA 3GHHA 5BNIA 5ICMA 3F5SA 2PGJA 1C1DA 5K0ZA 3SX2A 5IAAA 3GZ4A 4JBGA 1EE2A 2P4QA 1PZEA 2DTXA 3WJ7A 1QLHA 3TZCA 3UCEA 1ZMTA 1HDXA 1U2DA 4ESOA 4JQCA 1CEQA 2IEBA 3FN4A 3QWAA 2BGMA 1H6BA 2VCYA 3NDIA 5ILOA 4L9RA 4RORA 3QP9A 3WG9A 1P1JA 3OJFA 1LLDA 4GVXA 3LT0A 1PR9A 2BI8A 3F4LA 2LDBA 5CDGA 3WGHA 2VTDA 3AFNA 3C3XA 3D7LA 4W7HA 1H93A 1NVMB 1GCOA 1L7DA 2GGSA 4BKUA 2JL1A 3RWBA 1EUZA 3DFUA 2XPCA 3QWHA 4R01A 6ADHA 2Y66A 1R4NB 3K31A 5ES3A 1D1TA 4LK3A 3RKRA 3V1UA 4NBTA 3HZZA 5CG1A 1A72A 3EHEA 3GVCA 1C0LA 3ZNPA 2W8ZA 3KSZO 4J90A 3WNVA 3GG2A 1TT5B 4CLXA 5K6AC 3PHJA 3RU7A 1ISGA 3FRJA 1P77A 1YB4A 1PR3A 4IZIA 3ZDFA 2Q1SA 2QX7A 5GMOA 1ZK0A 2X5KO 3CKYA 2VZ9A 5GZ3A 5L3ZA 5ADHA 1T24A 3OA0A 3FWZA 4OMUA 3K5PA 1GZ3A 1TLTA 1Y5RA 3MWEB 4JK3A 1NPDA 1E3SA 2E6UX 3W8EA 3VKUA 4B4OA 3NJ8A 5KCZA 1RKXA 1JAYA 3ZNQA 3DONA 4WNIA 2C2XA 1ADCA 1ENOA 3K8ZA 3QE3A 4XD2A 5G4KA 3PHIA 2FPPA 4QX6A 3DHYA 5KNLA 4MVJI 3GY0A 2D0IA 4MVJG 5JYEA 3BTUA 1ULSA 3HB4X 4PVCA 2C5AA 2NSDA 2ZTUA 3PWKA 4GKVA 1N1EA 1MX3A 3GGOA 3C7DB 4BO1A 3GPDG 2NQTA 4HNHA 4EJ6A 1HDZA 4XYMA 1ZXBA 4BS9A 3V2GA 4PLVA 2CSUA 1GTMA 2D4AA 4DUPA 2H6EA 3BAZA 1R0SA 3EDMA 3GQVA 5DOZA 5AOVA 1NHWA 5KJEA 1J6UA 1GEEA 1UXIA 2FPGA 2NTNA 1GCUA 2IZZA 2PTGA 2PZLA 5FF9A 3TZHA 4RDIA 1C14A 2ILTA 3CMCO 2GN4A 1JLLA 1I8TA 1ADGA 4GX0A 5T5QA 4CQMA 4YR9A 8ADHA 1NPYA 2WTBA 1B15A 1U1IA 1BXGB 2ZQZA 2X86A 3D4PA 2DAPA 1J5PA 4OSPA 4U7WA 4BB6A 1IPEA 1A9ZA 3QSGA 5BSHA 3W1VA 4RZIA 4PRKA 3GDFA 1BW9A 1VJ1A 5COQA 1O0SA 3EW7A 4HBGA 2Q1UA 1UXGA 5C5IA 1L7EA 2WE7A 1OZAA 1ZK2A 1WXDA 5DCUA 2H1SA 2OORA 2WJPA 2VHXA 1SB9A 4L4XA 4TWRA 2QRJA 3ZGYA 1KVRA 3EY4A 2JJYA 3DMTC 4RF3A 3S2FA 1ADFA 1ZFNA 4Q39A 1VPDA 4O6VA 4XQGA 4CV1A 1CF2O 1DFGA 4IS2A 4CR8A 3TQHA 3WGGA 1LSSA 4W7IA 2ZCUA 4BNXA 1BVUA 1XG5A 5HTOA 4CM9A 4OQZA 1B26A 3DAGA 3GMSA 4DLBA 5CAEA 5EN4A 1ID1A 3JYQA 4NU5A 4J0FA 1PGQA 3VKVA 3O9ZA 1A27A 4ONEA 3P2OA 2EIHA 4J16A 3WSWA 1DC5A 3E9QA 2WD7B 5DNAA 2CDAA 2W2KA 2EKQA 3E8XA 3JQEA 4HFMA 4TMFA 2Y68A 3AUTA 1HDCA 2EHDA 2EGGA 2V6GA 1K3TA 5F1KA 4Z3DA 3GNTA 1D4FA 4HKTA 2ZJ0A 5B37A 1A4UA 1V0JA 4EEZA 2CF5A 3X2EA 1AGNA 1UXKA 2GD1O 3UKOA 2Q3EA 2VN8A 2WD7A 1P45A 2GDZA 2Y99A 4TRNA 1GZ6A 1U8XX 3UUWA 3PHGA 1DLIA 4NNJA 2YHIA 3I9KA 1EBUA 2YV1A 2AEFA 3QVXA 4B8ZA 4ND1A 3A4VA 1YQGA 2FHSA 3IUPA 3E03A 4JJFA 4PCVA 1EVYA 3JQBA 1F14A 3TNLA 3HDYA 3KOUA 4Z0TA 3RC9A 1NFQA 1OC2A 4JXKA 4I08A 4PLYA 3C1OA 1ZVMA 3LT4A 3HB5X 5TJ9A 4XYLA 2YZ7A 3GH3A 5B4UA 2JFHA 2PZJA 3V8BA 4DXHA 3PQFA 3Q9NA 3RJ9A 3WQSB 4L0QA 1LSOA 3JD1A 4CMKA 1A7KA 4ROSA 1TA4A 1MG5A 1MLDA 2DFDA 1GY8A 1HDYA 2Y1OA 2F00A 1ONNA 2C82A 1N7HA 1KEVA 4ND4A 4HX5A 1N5DA 3PJDA 5DT9A 4KUHA 3FNHA 5EQFA 1YS4A 4AJHA 4E4YA 3RIHA 3K6JA 4FBGA 1YRLA 1XQ6A 4UAGA 1QXSA 1T25A 3COSA 3I1JA 1N7GA 5F3RA 4MVJA 4WKGA 1LC3A 2ZKLA 3CPSA 4II3A 5MDHA 1QLJA 5HBRA 4UVIA 4RVFA 1U7HA 3U5TA 5JS6A 4TKLA 4I5DA 5CG2A 1G0NA 1I0ZA 1ZZEA 1LDNA 5TLSA 4IXTA 2D59A 4YXFA 3JCZA 4CLHA 4DMLA 2VUTA 2X5OA 2HK9A 1LNQA 4YPOA 4PLTA 4IBOA 4BO8A 3H2ZA 1GPDG 2A92A 3UHAA 5FI3A 2I66A 3BXXA 1VI2A 4J43A 3A14A 4ZD6A 4CV0A 2VYNA 2VYVD 3GF4A 1UAGA 2J5QA 4DWVA 4IDFA 3T7CA 2HLPA 2NADA 3V2HA 1TXGA 1K6JA 1FDSA 4Q3EA 5KKCA 4XQCA 2I9PA 1LXCA 3RAJA 4E32A 3EGOA 1AXEA 4AG3A 5JE8A 4W9NA 1CJCA 4INAA 1NPTO 3EZYA 1IULA 1ENYA 2HSDA 3KLMX 4ZQHA 1EVZA 1LBEA 3A06A 1YBMA 1FF9A 1C3VA 5JDIC 1PEDA 4NBWA 1DIRA 3GVPA 3NTQA 2GN6A 1NNUA 4IQ0A 3W8FA 4BO2A 3OICA 5THQA 4YRDA 4BNHA 5U1PA 2GRAA 4MVJD 2GN8A 3A9WA 2OL4A 3RUFA 1SNYA 1P0CA 3HDQA 2DT5A 2QZZA 2AEMA 3IKVA 2Y0CA 2BHLA 3H9GA 3SEFA 1X15A 3G3EA 3GFGA 1N9GA 4DPKA 1Q2XA 5IJZA 4MP3A 1YOVB 1TI7A 2PGDA 5C7LO 3ULKA 3GUYA 4YB8A 3N74A 3WGTA 4CMIA 5TC4A 3VH1A 2JD2A 3PQDA 2X9GA 2C2YA 3KHUA 1PJTA 1M75A 2QIOA 3PPIA 1FDVA 1PIWA 5A4DA 4OYRA 4ZQBA 3CUKA 4YVFA 3RFTA 3QRWA 2G1UA 3EZLA 3GAZA 1VSUA 4IIVA 3ZU3A 3LF1A 1KVQA 3CEAA 1H6CA 4J1QA 2OUIA 5HWSA 5JFOA 4R68A 1OC4A 2GASA 3X2FA 2FZWA 3ANNA 3OH8A 1M2WA 3TOZA 4CV2A 5CDTA 3ETDA 3JD4A 5THKA 5AQ1A 2H9IA 1ENPA 3AJRA 3HN7A 4IDBA 2HJRA 1O95A 4BL5A 1CIVA 3U4CA 5KVVA 3VPFA 4WLFA 4Z0PA 5HS4A 4FW8A 5COAA 1XA0A 2NU7A 5JO9A 4BOYA 2QZ9A 2NU9A 4BGIA 4CR6A 1SO8A 4EJMA 4MIOA 3P7MA 3V2UA 1NM5A 1O94A 1QYCA 4ZQGA 2E49A 1PWZA 1WVGA 4R9RA 4S1VA 2P9GA 3CE6A 4F6CA 2PD6A 3OIDA 1B3BA 2BD0A 3U62A 5L4NA 4RO0A 4PLZA 1YBVA 3CSDA 1YJQA 1JN0A 3D3WA 3JD0A 3WTBA 3DEYX 1ZKMA 1T2DA 1GV1A 1T2EA 3IQDB 1ORRA 3DBLB 5BSEA 5KJ6A 2ZB3A 1NAIA 3LVFO 3SC4A 3VVCA 3P2YA 1VKOA 2POQX 2PK3A 3H5NA 4ILKA 1BRMA 4MPDA 4RPLA 2X0NA 1QYXA 4FQ8A 4XGNA 2AEJA 4BNIA 1P0FA 5ITWA 5L4LA 5EERA 3R3JA 4TVOA 2I3AA 4H3VA 4R51A 1YGYA 4YBZA 3DOOA 5DOVA 5H83A 3UVEA 3BMQA 4E0BA 5C3MA 4BQPA 1UAYA 2CUKA 3ONFA 2IODA 1YB1A 4YRBA 2IDZA 5L51A 4TRMA 2H5LA 1E3LA 4PVDA 4CODB 2VWPA 4A26A 4CM8A 4LW8A 3ZZNA 1ISMA 4PLPA 3M1AA 2GR9A 3LDHA 3ONDA 4XWYA 3ZWYA 4BKRA 1OMOA 3TJRA 2J5RA 1ENZA 1WMBA 5I9LA 5T8KC 1H6DA 3H9JA 3I9NA 1ADBA 5ILGA 4BMSA 1Z82A 5A9TA 1ZJYA 3DDNA 1I3MA 4BKPA 4CV3A 1MUUA 1N2SA 4AVYA 4J91A 2FSSA 3WGYA 3ZCXA 4WCFC 3SLKA 1WP4A 3ZWBA 2CVQA 3AW9A 3JQ9A 5TT0A 1OOEA 2C0CA 1X14A 4Z6KA 3ZWOA 3VPXA 4Z9FA 4DMMA 1E3WA 1F12A 2O4UX 3M2PA 4WNCA 3ROQA 4ZICA 4KWHA 5IXYA 1J0XO 1V3VA 4E2ZA 4BNZA 3AM5A 4UEKA 1EVIA 1E5QA 4NPCA 4QUKA 3IP3A 1R12A 3H4VA 1WAMA 2VYVA 3K30A 3TRIA 1E7WA 1YQDA 4IZHA 4DPLA 1PJQA 2UVDA 3ZWMA 2W2LA 1HDGO 5H82A 5B4VA 3Q2KA 4CLEA 1CYDA 1AHIA 3P5SA 3RUHA 5B1YA 8LDHA 1BDMA 2YY7A 1LEHA 3IC5A 3BYZA 3MJ4A 3I52A 3QVWA 3DL2A 1QRRA 2Q99A 3AY3A 4KTVE 4W9NC 3DMYA 2OP1A 3TL3A 3NYWA 2Z5LA 4OL9A 2W90A 3GPIA 1NTOA 2DBRA 4K9DA 3C24A 3T4XA 4J4BA 2EF1A 3LK7A 4AJPA 4YYZA 4LCJA 5DCYA 5JAQA 5L7WA 1LA2A 1BXKA 1B2LA 3M2TA 4W4TA 3WLFA 2VUSA 3EVNA 1QKIA 4R69A 4E5NA 5DBGA 4OKNA 1H2HA 4UREA 3MZ0A 2NVUA 5IFLA 1HE3A 2OO5A 1CQJA 4MKXA 2HRZA 2PKRA 4FJ2A 3KLPX 4Y6SA 5KVQA 5A03A 4D0RA 3V1TC 1PS9A 5CEJA 1DBVO 4AJ2A 4CMCA 1DB3A 2PZMA 3ROMA 1LUAA 5AXCA 2UYYA 5K1SA 1LI4A 3IIEA 5ITVA 1KBZA 3D5QA 1A71A 4R41A 4OSOA 2IE0A 2IZ0A 3JV7A 3HUDA 2A9FA 3C7CB 2X0IA 2GNAA 3HWRA 4E2YA 1SMKA 2NVWA 3IDSA 1YKFA 1NQ5A 1EDZA 2WWRA 4XRRA 3W4IA 3ZV6A 1R4MA 3U4DA 3MEQA 3I9LA 4L4SA 3WLEA 2DKNA 3KB6A 3EUWA 1D7OA 5TS3A 4K26A 2EV9A 2XF8A 4J7CA 2PGLA 2PZKA 2AQIA 1FK8A 2Q50A 3QWBA 4L75A 3Q11A 1SEVA 2B4RO 3WB9A 3LLSA 4BO7A 3DO5A 4RVDA 2VUUA 2QRKA 5EESA 3PRJA 3RBVA 1GV0A 1ZW1A 1Y6JA 1DHRA 3MJTA 3OQBA 4ND2A 1YJ8A 5HA5A 1U9JA 1HDRA 2B4QA 3AI3A 2UUPA 5IN5A 1G0OA 3AI1A 1O5IA 2DTDA 5A5FA 5CDUA 4B3JA 2O3QA 1RYDA 3RKUA 4IXWA 3BMNA 2W98A 4UEOA 4FDAA 4YEDA 3L6OO 3BA1A 3GG9A 3KZVA 1DAPA 3GZNA 4R1SA 2Z1NA 1SB8A 1C1DB 1T4DA 1GDHA 3RC1A 4BNNA 4EUEA 2WYVA 4E12A 3PYXA 4WLVA 1NXQA 1U28A 1O9BA 1G6KA 3GVHA 4IINA 2C7VA 4DQUA 1EUCA 4I5GA 3G17A 2EW8A 3HN2A 5KTKA 3ZHBA 5TSDA 3WQQA 4RZHA 2DQ4A 4TSKA 3RBXA 4QEDA 3ZHYA 4E3ZA 4GPD1 1KVUA 4NBVA 3BTSA 1LRLA 4D43A 3BMOB 4J3FA 5A9SB 3N7UA 4TZTA 4FJ1A 1XR3A 4BQRA 3S2GA 2HCTA 1M76A 1IB6A 4H7PA 3QQPA 1FDWA 2WSBA 4Z9XA 4BO0A 1L1FA 1PJBA 4OH1A 2WYWA 1Y7TA 4YRAA 3B70A 2C29D 2FY8A 5JO0A 3ZW9A 4FCCA 4XIJA 1GYQA 1R0KA 3PI7A 1PQUA 2IRWA 3DQPA 4II2A 1UR5A 5FWNA 4EUFA 3H5AA 5JSFA 4IDEA 1HE4A 4NJOA 4RVHA 3EVTA 2EEZA 4AJIA 4HFNA 5A1TA 1AXGA 3DMTA 3S55A 5CDYA 3AUSA 3JQ9C 4YJHA 3HG7A 4CPDA 2AQ8A 5KVCA 2VWQA 1EFKA 1IHYA 3WIDA 2R2GA 3T4EA 1HYEA 3PP8A 2F1KA 1Z7EA 1YONA 1DAOA 2YQ4A 4FR5A 1N8KA 3D0OA 1U4OA 1E77A 3AWDA 4XJTA 3G1TA 4AJEA 1V6AA 4BNFA 1I3NA 3ROKA 3W6ZA 2WE8A 2HMSA 3H8VA 2DU8A 5JCJA 4RLSA 5JY6A 3WICA 1GEGA 4WEOA 1TT5A 3Q2IA 1ZNQO 2GUGA 4MVJE 1R16A 1IZ0A 1ISHA 2EJVA 3BMNB 4UVGA 2YHIB 1RJWA 5AYVA 4CM5A 2X23A 3EYWA 1YXMA 2B37A 1N1GA 2CZCA 2OZPA 3TL2A 2PH5A 2YDXA 1XU7A 2C54A 1P31A 3NT4A 4MINA 1ONOA 1R4NA 3RC2A 2D3TA 2EG9A 1E7RA 1DIGA 3DXFA 3TSCA 3ZU5A 3GEGA 4OJNA 4HV4A 5JAIA 5J23A 4H16A 3INRA 3TZQA 3WWZA 3VDQA 3MWDB 4E5MA 1MG0A 1GQ2A 1O8CA 3ZU4A 3VVBA 5A02A 4DLLA 3L4BA 4P4NA 1E3JA 3I83A 3DOCA 1TEHA 3BMQB 5G0VA 4DRYA 4AJNA 1MC4A 2R00C 4LSMA 5EPOA 5HS6A 5CEEA 3PZRA 4DPMA 1LDEA 4XR4A 4R5HA 1LDYA 4U8GA 4EUHA 3FF4A 3LC7O 3JYOA 4CLRA 3UICA 4F45A 3OSUA 1GU7A 5BSGA 5ICSA 4W99A 2BGKA 3JYLA 4XIYA 2VRCA 5A9RA 4GL4A 3KYDA 4O1MA 3WXBA 2C20A 2GSDA 4E13A 3QVTA 3PFFA 4FFMA 1OI7A 2GERA 3U4HA 3UAGA 3WFJA 5KWEA 4IQGA 4R9SA 5DCWA 4WEQA 5COBA 5A05A 3WNQA 2HMUA 1BG6A 2XXJA 4XQEA 4N54A 2GYYA 5T64A 2YV2A 3OBBA 3FPCA 1DSSG 4G5HA 3VOSA 1DO8A 4HNGA 1KOLA 1K89A 1YL6A 3UF0A 1WDMA 2FN7A 4UVHA 3AM4A 2NACA 3WGZA 4CMJA 1JVBA 1LRJA 2E48A 4P8RA 1X1TA 4UUPA 1DLJA 1LDBA 1UZNA 1VJ0A 4ZRMA 3SLGA 3EK2A 1X0VA 5JBIA 4BMNA 3JSAA 1LJ8A 3B1KA 1EQ2A 4Z0HO 1P44A 4URFA 4JCOA 1B14A 1M66A 1DDOA 3GEDA 4AJ4A 3ZH2A 1ZH8A 5JAMA 4PG6A 1XEAA 3SVTA 5IXSA 1LX6A 1NVGA 4GAEA 4LN1A 4LMPA 3PZBA 4J7UA 1YVEI 4RPGA 4U0JA 3OIGA 4BHTA 4RJTA 1U2GA 1Y9AA 3L4SO 4XGKA 3KUXA 2G82A 3ETEA 1HSZA 1V9LA 2A35A 3K92A 2J3HA 3DFZA 1A4IA 3O26A 2VTEA 3HNPA 4GMFA 3RI3A 3ROPA 2FR0A 1HSOA 3TFOA 3PVZA 5HRUA 3WFIA 2NVUB 3FHLA 2YDYA 3VZSA 4AL4A 3IUSA 4JJGA 3S2EA 3WR5A 3F1LA 2OMEA 3ADOA 1WZEA 3WSVA 2VOEA 1I2CA 2JHFA 4UULA 1BXZA 1FDUA 1GYPA 3TOXA 3U09A 3LLVA 4E31A 3GR6A 3Q9UA 4BKOA 3CTMA 4QT0A 3LZ6A 5TNXA 1PZHA 3A1NA 3WGOA 1PJ2A 2VHYA 1F0YA 2QYSA 3MOGA 1YBAA 1VL8A 3IL2A 3E5MA 5IG2A 5KJ1A 4O59O 4D0SA 1P9LA 2PWZA 3LT1A 4IMPA 4PFJA 2V6FA 3QVOA 3WOHA 2O3RA 5AVOA 1Y8RB 2RIRA 4DYDA 1BGVA 1P3DA 1J49A 2YJZA 3AY7A 3OJ0A 1Q1NA 3FD8A 4NH4A 5CEFA 4BNYA 3ZHXA 4CLOA 1K6IA 3L6EA 3SJ7A 1GYRA 1F8GA 3G79A 4LMRA 4OIMA 2Z95A 1VJTA 1V3UA 2EXXA 4IJWA 3OFSA 3R0IA 3KYBA 3RFXA 1EK6A 1HEUA 4YJDA 1BXGA 4WGGA 5T67A 3FNEA 3MOIA 3VH4A 2P91A 3GK3A 2IYPA 1PU2A 4J0EA 2G17A 3UN1A 2Y1FA 4FFOA 1JWBB 4UVEA 4Q3CA 2VRBA 3PGJA 5A5EA 2PH3A 4KUEA 4Q3DA 4DGSA 1T4BA 1KC3A 1PZFA 4CMBA 2HU2A 1VL0A 3QWIA 4QECA 4YWJA 3GGPA 2GZ1A 4R1UA 2OP0A 4TRRA 4MIYA 5C7OO 4JBHA 2B69A 2CDCA 4RVGA 1ZIDA 3JQGB 3MCVA 3FR8A 4KQWA 4PG7A 1KS9A 1CQIA 1H9AA 3WBFA 2VRCD 4RF4A 5JMWA 7ADHA 2TMGA 1I24A 3W6UA 1YOVA 4OM8A 5ENDA 3WGIA 2HMTA 3PYLA 1VSVA 2X9NA 5U4QA 4EGFA 1IYZA 4A27A 4OXKA 3W4JA 2O2SA 1YL7A 4W82A 3DB2A 2X8LA 3GAFA 3B1JA 4BO5A 3RQSA 3VTFA 5DULA 2DC1A 4ND5A 4N7RA 1AN9A 3A28A 3OIFA 1AUPA 3PXXA 2NQ8A 3G49A 3F47A 3QY9A 1D3AA 4FFPA 4YT4A 4N5NA 4K1LA 1N92A 4J49A 4J1NA 2HJSA 1QG6A 2YHUA 3NGLA 1NQOA 4OHUA 1BVRA 4CMIB 4NI5A 4ZA2A 4BNJA 3LYLA 3VC7A 4BNWA 1ZK3A 4E5PA 1JTVA 1I30A 3M6IA 3E5RA 1R37A 4PRLA 3DAPA 2ZTLA 3O8QA 1W4ZA 1I2ZA 1VM6A 1Y5MA 4L73A 4B8WA 5IDQA 1VC2A 5L53A 1E3IA 4RF2A 5C37A 3NTRA 4GI2A 1U5CA 2Q2WA 3FCOA 1Z45A 1V35A 1ISJA 2WMDA 2V6BA 2VHVA 3LU1A 3PK0A 1NX6A 5L45A 1B7GO 4CMHA 4RV9A 4RQTA 3E9NA 4U5QA 2AG8A 1EE9A 3FR7A 4FD3A 5DF1A 1FXSA 2HK8A 1EUDA 1IZ9A 1JVSA 2O7SA 2E37A 4DC0A 4JROA 4DC1A 4AFNA 4TKMA 1HLDA 4GSLA 1BMDA 3KM0A 2YQ5A 1GL3A 3KYDB 4PLGA 1HT0A 3FBTA 3HFSA 3WS7A 4EZBA 5K6AA 1LSUA 3PDJA 1GQYA 1I33A 4L74A 1KIFA 4NBRA 4A73A 4XCVA 5L9AA 4N5MA 4RQUA 2AW5A 2CY0A 4LRTB 1D1SA 4XDYA 1XQ1A 4XYEA 4OOFA 3DBRB 3MJEA 3F9IA 4M89A 2JD0A 2BRUA 2RH8A 2B35A 4DQVA 5IN4A 4L4RA 2GN9A 4IDAA 3DZGA 4G65A 4PZEA 2AMFA 1X7HA 4EJ0A 5JYDA 5EQDA 1G1AA 5LDHA 1LQUA 5B12A 4D79A 3HE3A 3S8MA 1I10A 4E2XA 2QG4A 3D4OA 2I99A 3MTGA 4IUYA 3IOYA 2EGHA 4WOKA 1HETA 4B7UA 2LDXA 5DN9A 5KJCA 2UV8A 1W0CA 3KO8A 2UAGA 3QA9A 5F5NA 4NFHA 1HE5A 4R4JA 4EYEA 1JAXA 1LLQA 5JY1A 2D5CA 1B0AA 4ALKA 3WYCA 4HWKA 3ZW8A 2C5EA 2Y1CA 4GGPA 4Z9YA 1PZGA 1C1XB 1O89A 1GR0A 1I5RA 4GWKA 2Y05A 4CR7A 1RM4A 3GN1A 3E18A 3BZUA 3DTTA 3L6DA 1LC0A 1VLLA 2EKPA 3H3JA 4BB5A 3TN7A 1E3WB 3R1IA 3UCXA 3GC6A 4RVSA 1NP3A 1WNTA 1HF3A 3DBRA 3KSUA 2E82A 2AHRA 5LDGA 3IAHA 2QHXA 3PWSA 2VZ0A 1SPXA
chains in the Genus database with same CATH superfamily
1P1IA 2R79A 3K0CC 5BSTA 4CL8A 5J3JA 4I9UA 5CT4A 4EA8A 4GL2A 4QVKA 2ERCA 5TGDA 4BASA 4UUMA 4O63O 2P2NA 2GNOA 3FFWA 4NU6A 4WJLA 3K6SB 4KH1A 4A03A 2NPIA 1TOAA 4R84A 2R8EA 5DDIP 4OQYA 4UBLA 5M34A 3PC3A 2ROQA 4MW4A 2P7HA 3N6VA 1L0BA 4RK4A 4KWTA 4B4UA 1PCXA 2OBNA 3TSWA 2WWWA 1X1QA 1DEOA 5CFRA 5I9BA 3STYA 3HA2A 2D1YA 2Y1EA 4YRQA 1E5DA 3TLAA 4OQ4A 5EWJB 4YCSA 2YZKA 2HSGA 3DT9A 1BXRB 5BQOA 3ZS9A 5DI9A 4P4LA 1ODKA 4XQ9A 2Q1TA 3BMOA 4XLZA 3TDKA 4YV1A 2NO0A 1Q92A 1JE0A 1Z5WA 2QGNA 3JW8A 4ZJUA 3VYTB 5IJ9A 5TIIA 3GN2A 4UEQA 1ZD2P 2VPIA 2QA5A 2NZ8A 3K70D 1M10A 3LSYA 3P2JA 4X1YA 3WDLA 2XGGA 3DEHA 4AP6A 1OIVA 3GAMA 3IAFA 4FGSA 1NQTA 1GCIA 1E2HA 1CB0A 1QMGA 3B5JA 4Z2YA 1MW8X 1S96A 1YR3A 4D6PA 3ZJVA 1IBSA 3CF0A 1AS0A 4TQAA 3ZV3A 1EP3B 2YV3A 4X93A 3JWPA 4K6CA 5JMPA 1MP0A 4UTXA 3WYAA 3GLUA 3SVLA 3QEOA 3CNBA 2VZLA 4K03A 5A4KA 2IA5A 3MIZA 4YRMA 2Z56A 3V1KA 2QNRA 1OSNA 5F2EA 4X8HA 2FW9A 1GFIA 1Q20A 2OQIA 3B9RA 4E2WA 5HJ2A 2JFGA 2BFNA 3AERB 4IH9A 4MDHA 1A88A 1W6UA 4LZWA 1AK2A 1GJRA 1SBCA 4A82A 3OPYA 1GPLA 2C5BA 2JH8A 3RRZA 4AY5A 1XJQA 3DDCA 5HCIA 4ARCA 2P9BA 1JKFA 1YIAA 4V1CA 2PS9A 2PT9A 3JQDA 4GQBA 3EXEB 3D2LA 4R98A 2QN1A 4H9GA 1KF0A 4MCIA 4R1LA 1NSTA 4DOMA 1PS0A 2ZJAA 2HT1A 7MDHA 3C5HA 5I7SA 1UOPA 4Q3AA 5AI0A 3AHDA 1DAHA 1FMJA 1AVTA 1Z4MA 2DCMA 2J0UA 2MSCB 2BP7B 4C4XA 4EHHA 1MO2A 2ACWA 2F1OA 2PKEA 3E1GA 1PT8A 2JFPA 2ZYUX 4JNKA 1W4RA 4CKXA 4BFWA 1CUGA 2J59A 3PXDA 2NAPA 2ZBDA 1DPGA 3NOQA 1TK3A 3G1UA 4PX9A 5G1PA 3KTOA 3INYA 3RYFA 1NBOA 1NW6A 1U1FA 3PC2A 2FN4A 4CF3A 3FVTA 4OJMX 1JDUA 1M34E 1M6WA 4R81A 4UASA 4ESHA 2VEDA 5ECWA 3UGKA 4K28A 4FINA 3GLIA 1NSYA 3P2IA 3WV4A 2DMRA 3HJFA 2I5PO 2IIQA 1ICEA 2F67A 1DAFA 4JS0A 4ND3A 1BKDR 2P0EA 3QVGA 3S27A 3DXZA 4ZZ3A 2BFMA 1RQXA 2X8AA 3MJVA 1NP6A 4X71A 1AXRA 3VOTA 3ZBPA 2EBUA 3D6VA 3UB3A 2ZRQA 1ZX1A 3ZHZA 3AFOA 3UOWA 2HQ1A 2WWTA 3KTDA 2NNLD 2BHRA 2PLNA 3WK7A 3KAKA 3RVPA 5AJTA 5HMMA 1FYFA 3GRVA 3LKZA 5IAOA 1ZM4A 3D3WB 3LC1O 3EQ6A 1YDMA 4I6EA 1XXLA 1E1RA 4YRGA 2P2DA 5LWQA 1S2GA 1W5BA 1W34A 4FN4A 4ALJA 1GNVA 3HADA 3W2FA 1E3DA 1QS0A 2ZATA 3GHYA 3BIWA 4PGFA 1DFHA 3B20A 3JQFA 3UO8B 2WJWA 3PUJA 3OHSX 3Q0IA 1DZ3A 1VKHA 3Q7RA 5EZYB 4EDFA 4MR8B 3GZTB 3MWJA 3F49S 4K9MA 3KWJA 4LFAB 3Q88A 3DCIA 1P4AA 3FDXA 2IKSA 4S35A 3S44A 3FPLA 1EEHA 2OHFA 2Q0QA 1JA0A 2HCBA 2Z2ZA 2QN2A 4WD3A 1FSPA 1P9OA 3GOQA 4BMXA 4DSZA 1THGA 2B5VA 2FR1A 4MR8A 4EGQA 1GGEA 3B9PA 3R7LA 3TR6A 3X1KA 4DY4A 4N76A 4P0PB 1M0TA 3B38A 3BAFA 1ORVA 4UVDA 2ZXFA 3WE7A 2M32A 1W48A 1JQKA 5E9JA 4OP2A 2FSFA 2C0QA 3DOEA 3K2BA 3JRWA 4LISA 2YRWA 2NV6A 3K15A 3R3HA 2BF7A 1A82A 2B4TO 3RK4A 1H4SA 1JHDA 1XV5A 1O8BA 4H17A 2PT5A 3TZ6A 2JGIA 3HCNA 1WU7A 3AOEA 3CVOA 4KPFC 4HGYA 4ZMBA 4F2PA 5CB4F 3IIJA 3VNVA 4Z3KA 3F71A 3GLGE 5TF4A 2I7TA 3B6ZA 3QV1A 3ITNA 2LCQA 4BLOA 4E1AA 1ORWA 1GTSA 2XYQA 1RLTA 3OLZA 4KMSA 5C80A 3H7AA 2XOKA 3LYAA 4WUVA 2QJFA 3EPHA 1T35A 3QFCA 1V5GA 3BMCB 3OPXA 1QGYA 2ZSDA 4G5GA 3LSTA 5JYBA 2XYHA 5DGCA 5DSXA 2V4ZA 2PA3A 2Q2OA 3FNFA 4W1RA 2HPZA 3K2EA 5E1OA 2Z4SA 1RU3A 2AJBA 3I9JA 4L8FA 1XNRB 2DB3A 4KRYA 3NIGB 1VKRA 2GESA 2KBFA 3A2MA 1KO8A 1NIPA 3RU2A 2XGJA 5A9SA 4FQ5A 2AA3A 4MGHA 1JXQA 3FWKA 3IP9A 1KJZA 3KDAA 3EFEA 4L72A 4FGLA 1Y4SA 4YUAA 3E70C 1Y1LA 1GAWA 3BHIA 4Z4HA 2LUOA 5HMLA 2YNMC 2ZSJA 1MH1A 3SIRA 3MWDA 1B4DA 2OBLA 3ZYZA 4YQZA 1H2ZA 2OXFA 3I6QA 1JSCA 4F5EA 3KD2A 4MWOA 4BUCA 1U5AA 1UK9A 2AZ4A 2PM8A 1TDJA 3N2KA 4R1OA 3U4GA 2YIJA 1FDRA 3AUUA 3OKPA 3GLQA 1J1IA 3VYWA 4O2BB 1OLSB 2I67A 1E6EA 1ZM3A 3NR2A 4FYXA 4H0FA 4B3HA 2DPGA 4YIHA 4KO1S 2DY1A 5GGXA 5EXEA 2WHEA 1SZJG 1XWFA 4FFBA 5IP5A 3U0BA 1GDTA 3COZA 3NANA 1SCNE 3PFBA 1FPMA 3U49A 1AQLA 2W2LD 3A37A 4CM8B 1VPEA 2LW7A 1PFYA 5G02A 1L3CA 3HRHA 4BAGA 3QXSA 3EB9A 3OTQA 4PLWA 3T1NA 3U3XA 1I80A 2J0VA 3KPVA 4PXYA 5DEIA 1Z3IX 1AGXA 1LVUA 1TMOA 1K5HA 4LYJA 4M87A 1Z7BA 2IWHA 4QVIA 5BURA 1YHZA 3H87A 5TPWA 2PUBA 2HRQA 4MYHA 1XD2B 2SKCA 2ODBA 1ORDA 2PUJA 1ML3A 4KFTA 3A6FA 3GDHA 2VYND 2WM9B 3ENNA 4A8JC 1M7GA 1U8FO 4OGKA 5F5XA 3V97A 3HM2A 4AECA 4HNTA 2PV7A 1TPZA 3AFMA 1F17A 3B6IA 3NV9A 3HJBA 4QXMA 3LBFA 2VO1A 4UATA 2WWHA 2QYTA 2RK6A 3K5IA 3VNAA 4BVAA 3UAZA 1RYZA 5C8YF 1K3UB 4Q03A 4ZVSA 1ANKA 1WIWA 1FC0A 4ASUA 1GNPA 3KJGA 4QREA 4ZANA 5C52B 1WW3A 2GM4A 2PLWA 1NVVQ 1KMHA 1EM8A 3PUKA 5EZSA 3TOCA 4YV0A 5ISMA 1X86B 2OCDA 1RQ7A 1TU4A 1PTJA 3TRDA 3WLSA 4XVUA 1K97A 2D5AA 5E38A 2FXVA 3W4KA 4FIZA 4X1IB 2Z2KA 3U3RA 1WS6A 4ZTZB 3KB1A 3PG5A 1S6YA 3OJEA 4JXXA 2Z5VA 3M4NA 2CHVA 2VPYA 1KSGA 1AIPA 2HLNA 3QITA 4ZI2A 4BLVA 4JJ6A 2BKLA 3L9WA 4KGDA 4NHOA 1DC3A 4R1MA 1MQ9A 3OE7A 3DHVA 4NSNA 1N0IA 2F9FA 1BU8A 3UATA 3VZPA 4YJFA 1F4VA 2R25B 5CLJA 1U2GC 1GD1O 2P69A 1OX4A 1TUEA 4H18A 2QY6A 1BEZA 3C8MA 1XNJA 3K09C 2GAOA 1ODFA 1OFUA 1XLTA 2HOQA 5AD1A 3L18A 4YS6A 3B2QA 4EFNA 4F97A 5JSZA 1IQPA 2P4HX 2Z2IA 3F7MA 3LHDA 3BT7A 2P9EA 2EWMA 1UPFA 2JGDB 2O3SA 3QLJA 5EE0A 3EZGA 5CLFA 1JKIA 1YDHA 5K8JB 3H6KA 1QIMA 1NKSA 4OO3A 1BGXT 3V3KA 2J7PD 1VMKA 1I4OA 5IDXA 1L5WA 2R97A 3HU3A 1J8DA 1T13A 3JU3A 3LG2A 3RVNA 4HPJB 1BE1A 1U2SA 2W43A 4B2LA 3ET5A 1N3LA 2DUJA 5E6RA 5WRFA 4DRZA 5IHXA 1UZLA 1RABA 2RJOA 2Q3MA 1GQOA 5CLHA 4FZ5A 1KPHA 2RMKA 3QY0A 3RV4A 3OQ6A 4EB0A 3PC8A 5AKGA 1ZAKA 2GF2A 3AHJA 3ORFA 4OLFA 1T0JB 4LQCA 4E33A 1QFJA 2X7HA 2YTZA 1KEPA 3C1TA 3JD2A 3HVJA 5BNFA 2B3TA 3VAZA 2QRVB 1AF4A 1EXDA 2CDRA 2QTFA 3GJYA 3H9EO 3JZMA 4J2HA 4DTIA 1KOJA 3I76A 2ON6A 4LC0A 5GM2A 3PYMA 4DJEC 1EB8A 4DSOA 2PT7A 5G53C 5AVYA 2ZJFA 3D6UA 2HLDD 3K9QO 3QVLA 3CZAA 3OI7A 2ZBFA 4IR7A 3LGXA 3OVMA 3L1IA 2FOIA 4XTCS 4R7GA 1A5BB 1XTUA 3HACA 1ZXXA 1SVMA 3O8QB 1E79D 3RYHB 4EBFA 1LV7A 1RHRA 2AUMA 3ASVA 3TZBA 2RI1A 3V8PA 1X13A 2BMWA 5K9ZA 1NFFA 2EWVA 1IL0A 1ZLYA 4ZARA 1CS0A 2DM6A 4D1YA 3D6FA 3PRHA 5KQMA 4YAKA 3ICVA 4OQLA 1OAOC 4BBAA 1OFGA 4IRMA 2IQIA 3IHKA 2ZANA 4E5DA 1J0CA 1JR3A 1X7DA 3L02A 4QDOA 3K5WA 5F4ZA 2JLXA 3DKPA 4GX5A 4AY3A 4DZZA 4F04A 2HMYB 3F1KA 5G4KB 2ZI9A 4KWIA 4RL6A 3DE0X 1II0A 3FTCA 4N9QA 4QDKA 5KMGB 1K06A 4WXHA 2A0XA 2V7XA 3JQAD 4MQLA 4AIIA 1BSVA 2J7KA 3AUYA 3EASA 1B16A 3O4GA 1DARA 5IUNC 5CA1B 2QRQA 2W6CX 3HB7A 2OV4A 2VA8A 3I4CA 3B53X 2QROA 1GU1A 4JOCA 3IR5A 1U3UA 2ZSFA 4QASA 1BH2A 1XZJA 2L82A 4U6SA 3IMEA 3TR0A 1UQRA 1KETA 1F48A 3GRKA 4JLNA 5AI9A 3AW8A 3DYIA 2GCIA 1NG1A 2VHWA 3UH1A 4A8JB 1ESMA 1U11A 4JENA 1Z38A 3LCRA 1DTEA 2VJQA 4BVJA 3QHAA 1SQGA 3CX6A 3KKNA 3H83A 3FOBA 3V4VB 1LW7A 3BGIA 2ZWPA 4P7FA 2GCGA 2HHHB 2CJFA 1U0EA 1VE5A 2Q3FA 3EG9B 2UDPA 3OX4A 4LGYA 3DS8A 4G2NA 4UNRA 5KUTA 1H9CA 2FX3A 3JQCA 2L69A 1KE1A 2AW3A 4GX1A 3U7JA 4BU1A 3LUKA 4BWYA 2EKLA 4P3NA 1MO4A 4IDOA 3J7AC 4QNMA 2FYTA 1OXUA 3GZJA 3HCPA 2A7QA 3I2GA 1UBOS 5JAOA 2WHQA 4BRUA 3SCZA 3WBKA 3K9FC 4B6PA 1H8ED 2B8JA 1HKHA 4DA9A 3H4IA 3W0LB 3AF6A 1W25A 3KIPA 1FQWA 1IOZA 2X42A 4KZPA 5DXJA 1N6HA 4KVZA 1S5PA 2TS1A 3Q0EA 2PGNA 2VDOB 3R3XA 4YROA 2W6IA 4C4ZA 2IXBA 4DLZA 2VBIA 3L7DA 1Z5NA 4JUDX 4OGLA 4E46A 4IWYA 2Z8ZA 3G0GA 3EFBA 2XODA 3L9XA 4QJ3A 2H9AA 5LFAA 1ZUHA 2IXAA 3QPDA 5I45A 2PXXA 1T9ZA 4M9XA 4E5YA 4XM0A 5H5JA 3PX3A 2R00A 1PWYE 1ZD1A 4QOHA 2GA9A 4RA9A 4YV2A 2E5FA 4DWWA 1QYDA 5ULLA 1H1DA 1NWHA 1G3RA 2RBGA 2QZPA 2VQ6A 3BB1A 3BHJA 5IVKA 1GGHA 5KYKA 4QPDA 3H7IA 3PPYA 2YNMD 2J87A 3MYRA 5H4GA 2H1VA 1RYMA 4G5YA 5K3FB 1E4OA 1I2MA 2C2WA 2F43B 4H6XA 4XYGA 3A1TA 3UPTA 3AK4A 3PF8A 5ALXA 3K96A 2AD5A 3CRRA 4DLYA 2CCKA 4I5FA 1I1OA 2ZB7A 3SN6A 1ZOLA 2EZ8A 3T5MA 2J3IA 2JZNA 4B7XA 3FOEC 2I2WA 3AY0A 2JBWA 2P6RA 2QTVB 5B58T 2R85A 2VJOA 3Q1LA 3QGMA 1JTEA 1LFAA 3ESDA 3GUUA 3EVDA 2W2KB 2XB4A 4J1TC 3SSNA 1DEHA 1V25A 2DLDA 2PGIA 2FSVA 2X0JA 4GRIA 5LP1A 3C3EA 3GO4A 4M1KA 1KBOA 2ORVA 4B85A 1PEKE 1FP4A 1QF6A 1BFDA 1GUYA 3ANLA 4Y18A 5AXDA 2GPNA 2JLUA 3JAMA 4AJKA 4FNGA 2B8WA 3MJSA 2R87A 1O3YA 4Q4HA 2VT6A 1XEWX 1I3CA 1UBKS 2O0KA 1T34A 2E1RA 3VKFA 3LTNC 3C5VA 2WFMA 5DNEA 2HX1A 5L40A 3SSMA 1JG4A 2D7JA 3S2IA 1JT9A 4EG6A 1Z3CA 5CJJA 3E4DA 2EF0A 3TXYA 1J8YF 3MRVA 4K9RA 3E3LA 1JQAA 4D92A 3G1WA 5GY7A 4CCAA 2HBQA 5DNCA 3VSEA 3ON5A 2X41A 2PH1A 1PR5A 1KFKB 4UUOA 1SEPA 1KE2A 1NHGA 1NBWB 2GFIA 1YC2A 2H0RA 2XD9A 3GRUA 3QW4B 3RSSA 2IS6A 1Q7CA 1T26A 6NULA 2ZIZA 5AVJA 3T54A 3M1LA 3VYVA 2A30A 4DUYB 2QQEA 4PN3A 3T7SA 4JA2A 5EEHA 4GI1A 1N5LA 4I0WB 4MW0A 3TL6A 3LHSA 4LJ5A 1OVMA 1M34B 3DM5A 3KXKA 3Q85A 4P80A 4AMVA 1Y1PA 1UWCA 1E1LA 1PSZA 3LJKA 3T99A 5LXTB 2H07A 1MOPA 4GP9A 3UMSA 4YRJA 1VJ5A 5D85A 2PANA 3TCKA 3A6PC 4DR4B 4D46A 1MQ8B 3MWFA 1SXIA 2OBXA 4B3XA 1NUAA 1X7WA 3V1MA 1OFHA 1QHXA 4NG5A 1C7IA 2PRKA 3S0JA 2I3GA 3L4JA 3VR0A 4RLQA 5IDWA 2ZVDA 4GG1A 3PIDA 4HADA 3HZHA 2O06A 1ZD5A 2AYZA 2A1TS 3I6IA 1RPZA 2G88A 2PLAA 5B4TA 4EAQA 4OU4A 2EP5A 3SKVA 1BQEA 1D09A 1QYVA 3ZY2A 1QGDA 3UNXA 4I9NA 1E59A 3EZNA 3VJLA 1MX1A 4J6EA 3USCS 3HM9A 1ZO8A 3OZEA 4B43A 4YQYA 1HG0A 4G1MB 2X5JO 4UU0A 1H94A 5A3JA 2O1XA 2WHYA 3TBHA 4C7KA 1HFWA 5BR7A 3NDRA 4FCWA 2PJDA 2Z1MA 4TUYA 1KH3A 3AEYA 2JVIA 4Q1VA 4BZXA 5FA8A 2CMKA 4YCAA 5BQFA 3C1AA 5T6MA 1QORA 5EIXA 3I72A 3QIVA 4IZOA 5HF8A 2OEPA 3P20A 1ZNZA 1ZH2A 3D0RA 3SC6A 3VMMA 4PG8A 5CCEA 2ZYIA 2QRMA 1AA9A 1U8YA 2IZ1A 2JH9A 2X13A 3KAQA 2XJ9A 3NHUA 4HPWA 1TCUA 3FUUA 3JYPA 4MV0A 5DISB 3VNRA 3JTMA 1YE3A 2VDWB 1L3BA 3LPLA 1WXHA 4ZU6X 4Q82A 3OUUA 5FBLB 3CH4B 2QUJA 4C4TA 1HXHA 1HYGA 2XUOA 1SVIA 2D1TA 2HFKA 2ZYDA 3UAYA 3VISA 2BLLA 4ZRDA 4HLUA 2RIPA 4C7MA 2FPMA 2HAEA 4HH3C 4QHYA 1E2IA 1KSFX 1RWBA 4DYHA 2GLTA 3RVJA 5TPWB 3GJ7A 3U7RA 2VF5X 2RGDA 3AR6A 3EWAA 2BH2A 1RRVA 1XTSA 1UJ5A 4HY3A 2Q5FA 2CV0A 4EPWA 1AZLA 1N2XA 3PGA1 2H1WA 4XKJA 5LQNA 1V8BA 3OLCX 3HCDA 3RSQA 3N0WA 3PNQA 2AR7A 2VNHA 4A7PA 5BW5A 4NZZA 3JQQA 2O2EA 1WHSB 4JT8A 1ZIXA 2A4MA 2HH9A 3ABSB 4HC4A 4NBNA 1XYGA 3CF2A 4JI0B 1HPLA 1SR8A 4KREA 2BI7A 3K0KA 3S70A 1W36B 5DTRA 1KP3A 1OBFO 4LJ8A 1YA8A 4PO9A 5BUZA 1MEJA 2KX7A 4IIJF 3ZUGA 1XZCA 1QU2A 1N75A 3C3PA 1H9BA 5JBQA 1G3UA 1TC1A 3BFKA 3N75A 4RIIA 5EMHA 3RVMA 3UV3A 4WGFA 2AI2A 2DCUA 3OE7D 3SAJA 4B17A 1H2BA 4E09A 2Z0MA 4P3KA 4DIKA 5IZ4A 1YZUA 4JBXA 1I13A 3P5BA 1NF2A 3ZWNA 1OH8A 3ANTA 4MS3A 4YY3B 1EVEA 1CULC 2DECA 1C3JA 1PZXA 2HEGA 1DRKA 2R4TA 2VK2A 1QGOA 3BB4A 2I76A 2OO5C 4HQOA 4MKZA 4QPJC 5EWMA 5C0OE 2W70A 1GLVA 4QHSA 5GP1A 4ACBA 1ID8A 4IDNA 3HYCA 1U6JA 1YRHA 5FHQA 3SIPA 2IUYA 2J9RA 3HCAA 2ZK7A 2V59A 3JY6A 4EKNB 4G25A 4TOIA 4XYBA 3VV3A 3DPIA 1JZTA 2C8KA 4NFLA 1N3BA 1V7CA 2ZGVA 4IVNA 2C04A 2QMHA 3KQTA 4TTTS 3WJ1A 4RTSA 5IKEA 5FNVB 4FB5A 4RFSA 4X3CA 3PU6A 4EYGA 5FPKA 3VNUA 3IOMA 2P6OA 5AVRA 1AHPA 3NATA 5J5CA 4DDMA 1XP8A 4D8YA 3AM1A 3PNMA 3O3MB 4RD0A 1JEQB 1YDWA 4YCDA 1G7RA 2XMGA 4CG0A 2PUWA 5F7OA 1VIVA 2JAPA 2ZIXA 1KZGB 1W75A 1RFGE 3MJHA 4WNAB 3WYGA 4BTEA 4ZALA 4CN8A 4EI2A 4JOQA 4KX5A 4QUJA 3QBVA 1P4JA 4Z4GA 4MO2A 1T2AA 1NBHA 3GNQA 3U7IA 2H5IA 5KNCD 2PDAA 2BY4A 5LQAA 2IP4A 4DUGD 4U4AA 2QTNA 2IHTA 3SS7X 3WLRA 3H2IA 4JYCA 1PGJA 5HUHA 4NECA 1G8KA 1UPCA 4DLNA 5FT9A 4I1IA 3SQOA 4DT1B 1V4NA 3ELYA 3TLJA 1Z17A 1VLVA 2HA6A 2O2HA 4LDPA 4RIEA 1YR8A 1ZMOA 3IUEA 3MFYA 4MVJM 2C7QA 4D9CA 2ECQA 2GD6A 2JANA 1KSHA 2WDZA 1WQ1R 4RADA 3ACDA 1Q1ZA 3D6AA 2PRYA 1ZEJA 5K01A 2SCUA 4I2VA 4M22A 1GQQA 1HWYA 2WVJA 4BO4A 4C87A 1E9EA 2VPQA 3IMCA 4PFKA 5LDDC 2LCFA 3OZBA 2AJ8A 1MQAA 5DHUA 1TECE 3GUVA 1B74A 1DC8A 2BDEA 4IIXA 4NG4A 1V47A 2FWMX 3W8NA 3RUDA 2NM0A 4BC0A 3HSKA 5FIUA 1RYEA 4BV3A 1TO6A 1KDYA 2J45A 5GZ1A 1N2CB 2O3TA 1VG0B 1WDLA 3E9MA 3DZIA 4O4IB 4ZQIA 3BD9A 1FYVA 3OO1A 3FYTA 3PUXA 4LYHA 2PNFA 4XPIB 4KAJA 4Q34A 5TRTA 3T06B 4EITA 5IKMA 1TQ8A 3AT1A 1G3MA 4G0MA 2VRWA 1T9CA 2D2IA 3VYRB 2HDHA 1TO1E 3G6KA 2FK8A 2WSIA 2P90A 2ZIWB 2YFHA 2QN7A 2IOYA 5T8KA 5B3AA 3LUFA 2CUNA 4EPTA 2DQYA 2KM1A 4BV2A 3OETA 4OAQA 1SRRA 1VIMA 2Y4OA 3G9TA 1Z4KA 3QVSA 1AN0A 3DTYA 4MS4A 4F21A 2VNAA 3L0IB 3E82A 3IO3A 3M0EA 5IF9A 1ND6A 2F62A 4JGGA 2P9YA 3FSGA 1FNSA 1KK2A 1XAGA 2XQGA 3CN7A 4Y6RA 2NU8A 1XTTA 4F5DA 5DBFA 3KSMA 2OCAA 3KLBA 4EHJA 4BVHA 5JXWA 2AKEA 2VUHB 2VXOA 4AS1A 4AYXA 1OB2A 2FZ5A 3WK9A 3DLAA 1M0SA 2P9FA 3BDVA 1PFKA 1GPMA 3QOYA 3BMCA 1K9SA 1EBFA 4G89A 5BORA 4YMTA 2ZRAA 3INNA 1FFWA 1MXHA 3ESZA 1I3KA 1LWNA 3K0FB 3CKMA 2J33A 2R48A 4Y98A 3RHSA 3VAAA 5JAUA 1QP4A 2CF6A 3QW2A 1NR5A 4PAMA 4KN9S 2BT4A 4BP1A 4D9IA 3RVQA 1L4FA 2CLFB 3OEYA 2AE1A 1P1RA 4MWDA 4QELA 1H8EA 1TCCA 3DZBA 2HU8A 4UDNA 4YT2A 1IU9A 4JP3A 4WA8A 4QSHA 1VZ2A 5JD6A 3W6OA 1PJ3A 1BJKA 1UFRA 4HDNB 4B35A 4BFUA 1NXXA 3KCQA 3IEKA 4TTPA 4M86A 4R1NA 5K3SA 3O03A 2I1WA 4DMUB 1VPLA 1WB5A 2XCUA 4TMKA 1P7PA 4BDTA 4YRLA 5JD5A 3ZOKA 3L8YA 5LLTA 4U6NA 2W93A 1FU4A 2Z4TA 3ENQA 4DM4A 5LQRA 4AQDA 1Q0TA 3WK8A 4JLOA 5I7RA 3VPSA 1P6UA 2V7TA 2ZAOA 1P80A 2PHZA 3G6WA 4G6ZA 2Y1GA 4Q1AA 1R0RE 4C7JA 3ONNA 3AF5A 3QWFA 4J2OA 4J0IA 1JHRA 2NYRA 1IXSB 3WYNA 4G0YA 3HA5A 3EEQA 5CCXA 1Z74A 1VPVA 5GZ6A 1L5YA 2EKDA 2JCGA 2FPUA 4YJHB 3ZWCA 1XMOB 5GJBA 3TR5A 3LWDA 2CLOB 2VJMA 4COOA 3MINA 1OZHA 2O50A 2BBOA 2PR2A 4H35A 4HEJA 4OHWA 3VPBA 2J3DA 3ZOZA 2ZIVB 1VBFA 4U9HS 1P2SA 1IB0A 4WZ6A 2XUZA 1WLSA 3AC0A 3O2NA 4O2LA 1OX5A 4UHHA 2Q46A 2HF2A 3GUCA 5EC8A 5G0TA 5HUJA 1T15A 3UMMA 3UK7A 4IP0A 3NX4A 1SXPA 4XB2A 1QIDA 4RSMA 1F0KA 3PGKA 4BMYA 1IK4A 5DLPA 3U9LA 3FWNA 3DC7A 5K7SA 2BZ0A 2G0NA 2OE2A 3INGA 3O8NA 3RKSA 1VHDA 3NHSA 3CLVA 1KZ1A 1U3WA 3ORSA 1PFUA 4JDPA 3UKJA 4E5SA 3SR3A 5KSOA 4RSRA 4OHYA 4KDFA 1HK7A 3LOUA 4FNMA 1K5GA 4UHFA 3I4LA 4WASA 3STXA 1AHHA 1BWQA 1XALA 1L3IA 3IMKA 2AXQA 1NTRA 3LRXA 1TKAA 5EY5B 2Q28A 3P9SA 1PS8A 1USVA 1XZKA 3ANYB 4HUQA 3A2NA 4M1TA 4U3JB 2Z8YM 3FSRA 4RXTA 2Q8PA 2NTJA 4L51A 4EG7A 1QE5A 1ACLA 2I1VB 1CERA 4PG4A 4UEWA 4BLRA 1UXJA 1GN9A 2PKQP 2VDLB 2YZ2A 3FMGA 3TLEA 4ALIA 2GD2A 3SHVA 4DQKA 4EI7A 4YRNA 4E6PA 4GLOA 1VE6A 3GDOA 4RMHA 2ENWA 3WIOA 1XPUA 2WVAA 4YPVA 2O23A 1XU9A 4JITA 4M6WB 3RJZA 5EVCA 1R88A 3RREA 1DJOA 3S28A 1C0KA 2FN3A 3CGGA 2BGTA 4DLAA 3CVWA 4QYIA 4JB2A 5C1BA 1SUFA 2CBXA 3B2EA 1QC5A 3MNFA 3OD5A 4ER7A 3LKDA 1GDDA 2NT3A 2XNCA 2YVAA 3IV6A 1D07A 1RPJA 2H2WA 4OK3A 5BYAA 2ID9A 1UADA 5JHHB 1U1GA 1T5LA 2ZDHA 5LCXA 4ALNA 2YZNA 2JLQA 1X8KA 4FYPA 4Y67A 4ZC8A 1P74A 4OKSA 3ENZA 1EFDN 4ZAFA 1RKQA 3JQ7A 2V7PA 4H4CA 3D6TB 1XBTA 5EL0A 4YV7A 2CNOA 3FMFA 3F7TA 3LP8A 3WQRA 5AQEA 4Q9JA 5CFLA 5JATA 4GEKA 1HYQA 4MUEA 3H42B 3EARA 3GLRA 2QTMA 3RNOA 5FA5A 3TLMA 2WJYA 3VSAA 3B1FA 1CJKC 2B4AA 2F3SA 1MAUA 4EKYA 4NCBA 2G9NA 4I55B 1JEDA 3RC7A 2WF8A 1WPGA 1BHO1 5NLLA 2ZYVX 5CYPA 2CXQA 2P9ZA 1CLUA 3C85A 5JMOA 1TM4E 5ER9A 4LJRA 4PHCA 1WNFA 2HXGA 3CV3A 4IDHA 2HIMA 3GNSA 4RH3A 5AHOA 2A57A 3GD5A 3ER8A 2R7NA 1G21B 4IV8A 3VU9A 2D54A 2MSNA 1DJMA 1QHNA 1XNHA 1M2KA 1II8B 2QVBA 3OZFA 5ALPA 5AM4A 5ICMA 4UAJA 4LRYA 1TIPA 2PZGA 3R5TA 3RSCA 1BCRB 1IWPB 2OILA 5A7FA 4A8PA 3PDCA 2P4QA 3KOOA 2DTXA 1JILA 1I4EB 3AV0B 3WJ7A 3I04A 2ANCA 2PJRA 2M6KA 1RLIA 1X92A 4HEA1 1ZMTA 3LUCA 1NQVA 3P9YA 3G2PA 2YJ4A 4JQCA 1CEQA 1FJXA 2WWFA 4BCBA 2H4ZA 1UIMA 4GOMD 4YIKA 3QKUA 1C30B 3ZK8A 4GZLA 2EEPA 3DE3X 3HY6A 3AEQA 1NOIA 2V7EA 3GLTA 3OJFA 4GVXA 4ZIRA 1YQEA 2QT0A 1U7ZA 3FVWA 3F4LA 3QFRA 5CDGA 1KDVA 5GIPE 4C76A 2VTDA 4U7PB 3C3XA 1T8RA 2DRIA 3GJSA 5IVIA 1FNBA 3BQNB 1M5RA 5FUXA 1L7DA 4BKUA 3NWEA 2JL1A 1QF9A 1GNTA 4NYJQ 1N6PA 3EJ6A 3MS2A 3O47A 1BCSA 4FZJA 3K31A 4U39A 3MMPA 1WO8A 3QBTA 3QPAA 3SBDA 3TRHA 3W5CA 3SQWA 1GSIA 4AT1A 2OFXA 4K9SA 4MA4A 3RKRA 4H3HB 3V1UA 4QTYA 4OA8A 3JATA 1FU8A 4NBTA 3WIVA 1E3TA 4ZYZA 2WOJA 3LFUA 3KSZO 3U40A 2WU0A 3UMGA 3ZVLA 1TT5B 2YS7A 3R5FA 5K6AC 3PHJA 3ZXXA 4C4YA 2Q1SA 4EMUA 2QX7A 5GMOA 2VZ9A 4INPA 4GPTA 1SBQA 4XOUA 3M5DA 5L3ZA 2OFFA 4CF4A 5ADHA 1CUUA 2F90A 3OA0A 3UJ6A 4OMUA 1V26A 1TLTA 3OPVA 3PX2A 4OXXA 1TL7C 2YHBA 4G63A 4MV6A 3NBUA 4HNAB 1NPDA 4Y1EA 5IRCD 3C6KA 1P5FA 4OHKA 1OLUA 3NJ8A 3WWCA 2ICAA 3ZNQA 2A1IA 1JLSA 4QDTA 4TLEA 4BFYA 3OQMA 3RSGA 3ODGA 1REQA 1J70A 2UZ0A 1DKQA 1GPH1 2XE4A 1E9VA 2H54A 4C0KA 2PRJA 3RE1A 2IYRA 3R3YA 4Q18A 3ZCSA 4GXNA 5SZHB 1BWPA 1S4QA 3GY0A 1XF9A 1J56A 1QU3A 4O2BA 4PVCA 4G0VA 4LV6A 5KIAA 5MF6A 3LFHA 2ZTUA 4A5SA 1Q22A 2JA2A 3LCCA 2O6LA 4XJXA 1N1EA 4N1AA 1TRKA 5CFOA 5AKJA 3M5WA 2VJPA 1XEWY 2VQDA 3I8OA 4LRUA 3A6HA 1DTWA 1F7VA 4NOKA 3T3OA 3DEJA 1COWD 2CSUA 3OQJA 4DUPA 1RWOA 3FOWA 2PO5A 3QLEA 3LK6A 2OAGA 1G20A 3GQVA 4G9EA 5DOZA 4YAFA 3ROEA 2K2WA 3RSLA 5AOVA 4AZ3A 4BN0A 4F84A 5HKKA 5KJEA 1J6UA 1J20A 2FPGA 3WNCA 1EE1A 2PTGA 1B0ZA 3MTIA 4K1XA 2J6HA 3TKAA 1GRRA 3E9CA 4D26A 1Z5VA 1JLLA 1I8TA 1ADGA 2AJTA 4LHZA 4JJZA 4YR9A 1MNAA 5ARBA 4PYJA 1NPYA 1UIRA 1ZUNA 9GPBA 4KNYA 1VLHA 1LPAB 3D4PA 3BB3A 5EI5A 3VI4B 3FYDA 3HGMA 2VTKA 2GJSA 2B4KA 3LLMA 1IPEA 1HT1E 1UDXA 1VHWA 3QTBA 3VNBA 4BVBA 3DF7A 4MITA 1TAQA 1IXRC 1GTG1 1BVHA 5GJVC 4BAZA 2R5WA 1O0SA 3EW7A 2OECA 3BC1A 1HNNA 2P1ZA 3O6VA 4URZR 5COQA 1UKVY 5HQ3B 4H1HA 2G1PA 3O84A 4AWBA 2DWCA 1UXGA 1P4SA 4KSCA 1ZI8A 1ZK2A 5JZBA 5DCUA 4FHGA 1TQ6A 1L5VA 3E2IA 4J0DA 3UJPA 1SB9A 4ER6A 4ZP1A 5EYPB 3SC2B 1CQWA 1H2AS 3UAVA 3O21A 5FOQA 4PZZA 3NYIA 4UNNA 3SDZA 2OAEA 2P77A 5F23A 4OATA 4GBED 3EY4A 1X1DA 2JJYA 3DMTC 2E0IA 1O77A 1ADFA 1ZFNA 1DMRA 4O6VA 4KXWA 1EWRA 1LF0A 2FE1A 1MVLA 3DLIA 1JJBA 2EYQA 4IS2A 1DV1A 1FQOA 2Z1DA 2OB1A 3W2GA 1RRGA 4W7IA 1SXJC 3G9ZA 2ZCUA 4RA6B 4E4TA 3A10A 4ZQCB 1ESCA 5FD8A 4NH0A 3DAGA 4AKGA 5CAEA 2IUFA 5EN4A 1ID1A 1LQ2A 3JYQA 1Z36A 4NU5A 3RANA 3C6BA 1O5OA 3VKVA 3RG2A 2F3PA 3R5XA 1NJ2A 1A27A 4B32A 1DT3A 3PCXA 4IICA 3IV7A 4F5WA 4J16A 3WSWA 1J2JA 1U9IA 3JWEA 3VBEA 1DAKA 2VIIA 5JU6A 1G59A 1OXTA 2C2GA 2PPLA 5C46F 2CDAA 4HFMA 3JALA 4ID3A 1D4OA 4BU0A 5ALQA 5H9WA 1L7MA 2VKTA 2PLFA 4NABA 3Q3GE 1IEQA 1A7UA 3GNTA 3K7EA 4F4CA 4JP8A 1D4FA 1N4DA 1Y5LA 3L7AA 3FAZA 3MRSA 3MJFA 3K35A 5B37A 3SICE 4CCYA 3X2EA 1G291 4FBMA 4R0MA 1UXKA 2GD1O 2GI4A 2ZRHA 5CA1F 2Z8YA 4K46A 3TMYA 4DR3B 1AT1A 1TU3A 1Q17A 1V95A 3OCXA 4WAUA 1GZ6A 4YXWA 1P7CA 4BEJA 5BV2P 3ZVKA 1C8VB 3PHGA 5K3FA 5FV4A 1H4QA 3I9KA 3QVXA 4NV3A 1MHTA 2OC4A 3HBMA 3PENA 3NWBA 4W8GA 1P18A 3M6AA 4C7XA 5ADWA 1XD9A 2ECKA 3HYLA 5BRAA 1N5IA 5DWQA 4JJFA 2BFCB 2QBYB 1QHGA 1E9RA 2Q6VA 4CF6A 1JHZA 1W52X 2QP3A 2QUIA 3CJRA 1PT9A 3EH1A 5I5GA 3TIVA 3SEQA 3TNLA 3ZGOA 4OJKA 1UPXA 1JI3A 1NFQA 2QD5A 1OC2A 2HLHA 2XDQB 3OWXA 2GEBA 1WULS 2K6GA 4XFJA 4X95A 5IKOA 3UMBA 1Z0DA 1EBBA 2DR0A 5BQXA 3I45A 4KRFA 1MRNA 4C1BA 3CHYA 1JFRA 2IYFA 1UEXC 5DLYA 1HRKA 5TQ2A 4FKZA 1W5EA 4DXHA 3EEYA 4EB3A 5M7EA 3WQSB 4TZ0A 1A8IA 1TVKA 2QY9A 4BXOA 1A7KA 1XYVA 4NZYA 1MG5A 3C4QA 3MAJA 4IL5A 4MTCA 4X6UA 1LFDB 2F00A 2XZPA 5CB4B 1XOIA 4Y6QA 5J4HA 5AUOB 3D9QX 1Q95A 5CURA 1N7IA 1Q7EA 4KUHA 5DT9A 3FNHA 5EQFA 1YS4A 2PU5A 3P9NA 3P2EA 4QZVA 4R8MA 3K6JA 3CF4G 2PX5A 1N0VC 3R9IA 1E1QD 3R75A 4UAGA 4YQEA 1YS7A 4OU5A 1ZN9A 4WKNA 5EJEA 1R3DA 1MJ5A 5F3RA 1QB8A 4MVJA 3UUFA 4A0QA 1LC3A 2ZKLA 4DCOA 5MDHA 3IBFA 2ZG6A 1NE2A 1UKAA 3HLKA 4N8DA 4UVIA 1OWLA 4MI6A 3HL4A 3CPEA 2ZZKA 3T3NA 4BLSA 3NIFB 4TS3A 2CW5A 2XQIA 4TKLA 4I5DA 4L07A 1UK8A 1G0NA 4WVFA 5CG2A 1Y8ZA 5FR2A 4AKEA 1LDNA 3VGJA 3KDSE 2D59A 1IBRA 1QBGA 4G4GA 3BXGA 2VUTA 3U1TA 3VOAA 1L5NA 5KWJA 1B00A 1N0WA 5GONF 3K0SA 4IOKA 2A92A 2GN0A 2H3HA 3LDAA 1VI2A 1DE0A 3G7SA 3GL9A 4ZD6A 4CCWA 4CV0A 4XTRA 2X5NA 4UOZA 1Y6RA 2VYVD 1O6CA 2J5QA 3QEJA 4MROA 4K40A 4MWBA 2PKCA 3T7CA 4N01A 2HLPA 4ADSG 5AW4A 3PVSA 5FX2A 5IH3A 4MPJA 4BGDA 2HIHA 3GPLA 1FDSA 4XQCA 3K1AB 5KI6A 4E32A 5IUJC 4ES6A 3U4QA 3EY9A 2N47A 4BWGA 3EGOA 3AKDA 1CJCA 4LTMA 4EVRA 4XQ0A 2VAXA 1G8JA 3J81A 4YLGA 5C5DA 3KLMX 3ZHSA 4KK4A 1FF9A 3LGSA 1C3VA 1PT6A 2ASEA 5IDVA 1DIRA 1M8KA 1PFWA 3W5SA 4DHEA 1NNUA