3TWOA

The crystal structure of cad from helicobacter pylori complexed with nadp(h)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
347
structure length
347
Chain Sequence
MRVQSKGFAIFSKDEHFKPHDFSRHAVGPRDVLIDILYAGICHSDIHSAYSEWKEGIYPMIPGHEIAGIIKEVGKGVKKFKIGDVVGVGCFVNSCKACKPCKEHQEQFCTKVVFTYDCLDSFHDNEPHMGGYSNNIVVDENYVISVDKNAPLEKVAPLLCAGITTYSPLKFSKVTKGTKVGVAGFGGLGSMAVKYAVAMGAEVSVFARNEHKKQDALSMGVKHFYTDPKQCKEELDFIISTIPTHYDLKDYLKLLTYNGDLALVGLPPVEVAPVLSVFDFIHLGNRKVYGSLIGGIKETQEMVDFSIKHNIYPEIDLILGKDIDTAYHNLTHGKAKFRYVIDMKKSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannitol dehydrogenase
publication title Unusual NADPH conformation in the crystal structure of a cinnamyl alcohol dehydrogenase from Helicobacter pylori in complex with NADP(H) and substrate docking analysis
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 104
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.1.1.195: Cinnamyl-alcohol dehydrogenase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3twoA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3twoA01
4OO3A 2JJYA 1ONPA 2VT2A 4BO1A 1IOLA 3KHUA 5BQFA 3QLJA 4P22A 3OQ6A 1Y6JA 2VYNA 4CM9A 5IXYA 1QXSA 1Z7EA 2EEZA 2VRBA 3G79A 2J3HA 2HMSA 4FJ2A 3ONEA 1NX6A 3E8XA 3NEPX 5A5FA 5KNLA 2NTJA 3IKVA 1X13A 4TRNA 4N18A 2Y1GA 1JAXA 1AN9A 3QHAA 5AOVA 1DIHA 4FR5A 1CQIA 1I01A 3VH2A 5A1TA 2I65A 1KBZA 1DPGA 4LSMA 3OP4A 4FDAA 3E6AA 2X7HA 3FN4A 5AYVA 3M6IA 3D64A 3V1YA 4WLVA 2NU8A 4AJPA 4XEHA 3K92A 3FNFA 1QR6A 2GRAA 3PWZA 1NQ5A 1C1DA 3NYWA 2VWQA 4BO0A 3HN2A 3TZKA 2X5KO 3Q9NA 5AQ1A 4NBTA 2B35A 4LMPA 1N7HA 1TVEA 5EMHA 3AOEA 1MLDA 1IE3A 1R6DA 1BDMA 1MFPA 1UZMA 2DTXA 1V6AA 1H0KA 4J3FA 4D3SA 1I24A 2QRJA 3HDYA 1ZUD1 3GGPA 1WMAA 4JJGA 2O48X 3AFMA 2GD1O 1B2LA 3UVEA 2DC1A 3ETGA 4OGWA 3VPGA 3MJVA 3GRKA 3VTFA 4UVHA 3NDIA 3A14A 3PP8A 3U0BA 1I2CA 1T1SA 1F12A 3QRWA 3WBBA 4BGVA 4J49A 5IDXA 3IP1A 3R3JA 4O6VA 2JCYA 1HDCA 1HSOA 2RIRA 2GN6A 2PA3A 2CF5A 2HMVA 3UXYA 1XDWA 2V6BA 1NFRA 4UEKA 1E7SA 4MVJH 4QO8A 5T8KC 1AE1A 1I3LA 1UP7A 4CM8A 3OJ0A 3PHHA 3DMTC 4NJMA 3UCFA 5HTOA 4J1QA 4CMGA 4JP3A 3OHSX 5DN9A 1XELA 2DPHA 4DA9A 3E48A 1XLTA 5L95A 4GWKA 3HG7A 3FR8A 2FRDA 3B20A 1ML3A 4H15A 2O3RA 1PL7A 5I7FA 1U8FO 2GSDA 1XGKA 2X23A 5DF1A 2QG4A 4B3IA 4A10A 4J0EA 1GEEA 1Z7BA 1T4BA 2HJSA 1FJHA 3ZNQA 4TWRA 5GZ1A 2WTBA 1O0SA 4ALIA 1GYQA 1N7GA 4PLPA 5JO9A 5DCYA 1OOEA 3BMOB 3I9MA 1K6XA 4GH5A 2I67A 1PZGA 2Y0DA 3OIFA 3MWEB 1RYEA 3ETDA 1PS8A 4Z3DA 3JD4A 3DBVO 4ZN6A 3BA1A 3WS7A 3LYLA 3EUWA 3MTGA 3CKYA 1W73A 2OOSA 1J0XO 1T26A 2R2GA 1PWZA 1GU7A 1CJCA 5KJEA 4YJFB 3ICPA 7ADHA 5C37A 3QJ5A 3JQFA 1PR3A 2FN7A 4YA6A 4FIZA 3RUHA 4UVEA 2EW8A 2RBEA 1YGYA 1CETA 1EVJA 3I9KA 3GDGA 5AXBA 4AJIA 1P31A 3RUDA 3RC9A 4E5YA 2IZZA 3I83A 3RFTA 3INTA 4J2OA 1RM3A 3SEFA 5L7YA 2Y0CA 2X0IA 4DBVO 5DCWA 1Y9EA 1JTVA 1U5AA 2YHIA 4Q39A 2PD4A 3LLSA 3O26A 1RKXA 5B4UA 1QYDA 3DZGA 3ZH2A 1E6WA 3PWKA 1AGNA 3A9WA 4YJGA 3T7EA 3RI3A 3AOGA 4NFYA 1Y8RB 3MJ4A 4J4BA 9LDBA 3F1LA 1EVZA 4OXYA 4OSPA 1HZZA 3FTNA 5I9MA 1IULA 1DIAA 3TPCA 3NTOA 5COBA 3HJAA 3O8QB 4ID9A 2DT5A 3WIEA 4GMGA 4F46A 3TZCA 3QWHA 4CMJA 4FD3A 1CERA 4IMRA 4O0LA 1TXGA 2NTNA 1XU7A 2PH3A 3OQBA 3UF0A 1DJQA 3LSYA 3OM9A 4BNKA 2AQKA 4WEQA 3JQGA 3KEOA 3GEMA 2D2IA 4QEDA 3KOUA 1YBVA 2Y1EA 3A28A 2VTDA 1B8PA 1GEGA 1PGNA 3JQEA 4PLZA 1E77A 4Y6RA 5JFOA 2Q1WA 4IMPA 1EE2A 4BNIA 5T8KA 3ZW8A 3DMTA 4YWJA 3C1TA 5JMWA 3OH8A 1O9BA 4KTVE 5BSEA 2WD7B 4ROSA 4ALJA 2I99A 3GZNB 4IDEA 3EK2A 2AE1A 3MJEA 1P1FA 3UGKA 4ZD6A 1GUFA 1ZZEA 3D3WB 1XQ1A 1GL3A 1U4SA 1TB4A 1V3VA 2J3IA 3QSGA 2WMDA 1PGOA 1PJCA 4AJ2A 5GZ6A 5IDWA 4Z9YA 3M1LA 1A71A 2Z1NA 4PLTA 2R00C 5L53A 1OC4A 4CMEC 1NVMB 1BWSA 4G65A 1ZSVA 3P5SA 2OHXA 2WEKA 5TX7A 3VDRA 4BKOA 1MB4A 2VYND 5I7EA 2PKQP 3JQAA 3MZ0A 5HS6A 2JD0A 2BGKA 2GLXA 4K6FA 2BF7A 4CR6A 4A26A 4D0SA 4BQRA 2O4CA 4FSHA 3M2PA 1NVGA 3FPLA 1GPJA 3U4DA 4BNFA 5FI3A 5K6AC 4Q3BA 1H9AA 1S6YA 3PRJA 4XKJA 1H2BA 5DBIA 3ANLA 4D42A 4R51A 2VHXA 1NTOA 2VUUA 3VTZA 1KEWA 4DC0A 5KKCA 5I8ZA 4BO6A 4UEOA 4WEOA 5CG2A 3GMSA 4HBGA 3CUKA 1BDBA 4HKTA 1KVQA 3MEQA 4RV9A 3ZNNA 4WKGA 3H9EO 2QQ5A 4YT8A 4DPMA 1H94A 4XGIA 4BB6A 1NQAO 3B70A 1PJ4A 3O4RA 3AUSA 4MKRA 3INRA 4HFJA 5IJZA 2GYYA 2C54A 5CDYA 5KWEA 3NDRA 5ITWA 3BAZA 3GFGA 1Z74A 4A0SA 1JKFA 3D5TA 4MVJM 2HU2A 5ICSA 4E3ZA 3H9UA 1GFSA 4NG5A 1M6HA 3TOZA 2ZJ1A 1PGQA 2C5EA 2HKIA 1UXIA 5KOIA 1Q2XA 2ZYDA 1VM6A 2VQ3A 2PV7A 4PG6A 4LN1A 4MINA 1YVEI 3R1IA 3QP9A 4IDAA 4F6LA 5A9RA 2WE8A 3JQ8A 1UZNA 3OEWA 1TLTA 4PVCA 3DZKA 4TZKA 2I76A 1K6JA 3WYEA 1GAEO 3JQBC 1LSOA 2NV6A 5ILOA 3QIVA 4JIGA 3X2EA 3GLQA 4WCFC 3CTMA 4WJZA 4BO8A 1TT5A 3L4BA 2HMTA 2WYWA 3DAPA 3RU9A 2IE0A 2DUWA 1IPEA 2Z1MA 5B37A 3NTRA 4I5DA 2J3KA 4RVHA 5JLAA 1YDWA 4QT0A 1I2BA 2DTDA 2CVQA 4E13A 1ZXLA 4L0QA 1V9LA 5A02A 3PFFA 4FJ0A 2BRUA 2GZ2A 4GPD1 1DHTA 2X8LA 5BR7A 1EVIA 3ENKA 3RFVA 3OIGA 3KTDA 4LMRA 2BFOA 1LNQA 1DFIA 1HETA 4IIVA 1R12A 3OFSA 4QSMA 1EVYA 1PQWA 2ZTVA 2ZQZA 3AU8A 4NHEA 4WLFA 4D46A 1YBAA 2BH9A 1ISHA 2F1KA 3A1NA 4H16A 1ENPA 1OAAA 1E5QA 2UDPA 4XIJA 4FOOA 4MDHA 4CLOB 4ZU3A 1FMCA 2ZB8A 5A04A 4J1TA 4R1SA 2D8AA 1DLIA 5HS4A 3BTVA 3EZLA 3INGA 3F6YA 3CIFA 3JQ9C 1V0JA 4JQCA 2Q49A 3TRIA 1YE3A 2R00A 1UDCA 3A06A 3I52A 4YT5A 4NI5A 4J7CA 3QWAA 2JCXA 5THQA 3QVOA 4CMEA 5FF9A 3H4VA 1DC4A 1HDGO 3N7UA 2EXXA 4XQGA 4RPGA 4XGKA 4JROA 4NU6A 1M75A 2Q4BA 1UZLA 3WJAA 1VL6A 1AHHA 2P91A 2GN4A 3DL2A 1SZJG 4BO2A 4Q3AA 5U4QA 4JBHA 4PZDA 3ST7A 4OMUA 5DNAA 1A5ZA 4YTEA 2X86A 3W6UA 3CINA 3VPXA 3PXXA 4CJXA 5LC1A 4DQXA 3HFSA 4NPCA 3AM3A 1GY8A 1DB3A 2AMFA 1K5HA 1HDRA 2PTGA 3DBHB 4CODB 4DXHA 5CEFA 1N92A 3BTOA 4CR7A 1PL6A 3E18A 1AXEA 3PHIA 1QYCA 3IUSA 4Y98A 2FPIA 5G4KB 3W6ZA 4XGNA 4FGWA 1B14A 3TJRA 5L7TA 2AEFA 5IZCA 4QFDA 4C7JA 4Z9FA 1QYWA 3RJ5A 3VPSA 4AG3A 1N1EA 3KLPX 3KVOA 3AUTA 2E37A 4L76A 3GVIA 3P19A 4AL4A 5TJ9A 4JBGA 1MFZA 5EIOA 2G0TA 2HRBA 1DXYA 3AM5A 4O63O 2VWGA 1NAHA 1TI7A 3WJ7A 1CQJA 3U9LA 4DLBA 3UOGA 4EEZA 5I7VA 2QIOA 3WB9A 4GKBA 1LDBA 4AJNA 5G4LA 2B4TO 4A73A 3UHAA 1XWFA 1ENYA 4WLUA 5TS3A 4DYVA 5AVOA 3PFWO 2HK9A 1D4FA 1EUZA 1J49A 4KDEA 4MP8A 3ZU2A 5C7OO 4DL9A 1SCUA 1ZK2A 3JQBA 3PJGA 3I1JA 2IYOA 1Y8RA 4WCFA 1MC4A 1XR3A 3GAFA 3KSZO 2IZ0A 2NVUA 4R4JA 1ZSNA 5G0SA 5JAMA 4K9DA 1L7DA 1T2CA 2A92A 4BNZA 4UUNA 1IL0A 4UAGA 3O8QA 3KBOA 1IZ9A 2IEDA 1B3BA 4W7HA 1MUUA 3OJFA 3Q9UA 4CUZA 3TOXA 2VNAA 4JNKA 2PZMA 2Z5LA 1JW9B 1PGJA 4TRRA 2V6GA 4A27A 1IZ0A 1U9JA 3AW9A 3E03A 1DLJA 1QORA 3S1LA 3IC5A 1RYDA 4E33A 3PJFA 4OKIA 4FCCA 5CP8A 2BFPA 3WDSA 2H6EA 4ND2A 3H65A 3RASA 3V2HA 4HY3A 3IIEA 3L07A 1NASA 3DWFA 2EKPA 6ADHA 2NADA 2B36A 3EY4A 3H3JA 1CWUA 3D7LA 1VJ0A 3Q2IA 4I9NA 2H9IA 4OM8A 4F3YA 4IGFA 4IY1A 2YY7A 4R1UA 2C0CA 3ZI0A 3OQ1A 1ZK3A 4Q9NA 4DWVA 2OORA 1JKIA 1G6KA 3V1TC 2W2LA 4UREA 5DULA 4E32A 9LDTA 2WD7A 3BZUA 4J0FA 3JQ9A 1XG5A 4XQ9A 4AJLA 2OL4A 3JQAD 4IUYA 2DM6A 2CDAA 2Q1UA 4M86A 1T4DA 4RGBA 3AOEC 3TZQA 4BNVA 4RQUA 4BMNA 4RVFA 1QLHA 3LLVA 1B7GO 5JAZA 2CFCA 3RKRA 4BO3A 1E3WB 2DQ4A 2P9GA 5A03A 3GT0A 2GERA 3JQ7B 4KOAA 4B4VA 4IIUA 1BMDA 4E2WA 5KIAA 4FW8A 3BMNA 5A9SB 4E2YA 4BGEA 1E7MA 1AXGA 2C82A 4JK3A 1VJ1A 3I3OA 4HX5A 1UXJA 1A72A 4WGGA 2RH8A 2O3QA 1R4NB 3I9JA 4AJHA 2VUSA 4WECA 1BRMA 1WDMA 4BUCA 1X1TA 5DT9A 4JP2A 3UFXA 1E6UA 4YVFA 2HK8A 1LI4A 1XSEA 1GQYA 4EW6A 1JN0A 1E1LA 1LQTA 1PZFA 4OIMA 4BKPA 3BMQB 3WSVA 5IAAA 3V5NA 1GV0A 5JNLA 5KJCA 3GDOA 4BNUA 4ZQFA 2J5RA 2VOJA 1N1GA 3LQFA 3G3EA 5ILGA 4IINA 1ADGA 1JU9A 2X0JA 3CZRA 1PQUA 1HF3A 3WYBA 4W7IA 4E5PA 2JFHA 4XB1A 3M1AA 3UAGA 1ZH8A 5ES3A 3MJSA 1E7YA 1QMGA 4P4GA 4TKMA 1WDLA 2HAEA 1E7WA 1KOLA 3ZNPA 4BNYA 2HK7A 1R66A 2IODA 2P4QA 2NACA 3GRPA 4IDBA 4KQXA 1MV8A 3OJLA 3KYDB 1IB6A 1ZEJA 2H63A 2NNLD 3F5QA 2OBNA 3LC7O 2B37A 4PRLA 3L0DA 3VDQA 5I7SA 1X15A 1E92A 3JYLA 5G0VA 1YL7A 3DBRA 1M6WA 4JJFA 3IP3A 1ZNQO 5IFLA 2ZTMA 4HXYA 4PLCA 3ZWPA 1LLCA 3JYNA 1XIVA 3NTQA 4XR9A 4EYEA 4FFPA 1LDGA 2C07A 4J43A 3VVBA 2EP5A 3LK7A 1ZJYA 1Q1NA 1LX6A 3UCEA 5FEUA 2IZ1A 4ALLA 2JFFA 3C85A 4ND5A 4PLHA 1PTJA 3VZRA 4HNHA 1QV6A 5G0TA 4GX0A 3AK4A 3ENNA 2Z95A 3ANNA 3AUUA 4ZQGA 3U3XA 1LC0A 4LVUA 5K0ZA 1PJSA 5JAIA 5CEEA 1WVGA 2CF6A 1B8UA 4NBWA 3DBLA 4Z9XA 4J2HA 5ENVA 5JC8A 2PWZA 4PLGA 3F47A 4MVJA 3JQFC 1DAPA 3PWSA 1JA9A 1R0LA 5JCJA 1XA0A 4RVDA 3GZ4A 1U3VA 1Y81A 3JQDA 3S8MA 2WYUA 1GYPA 2X9VA 5ER9A 4M49A 4FOSA 3LT4A 4YAEA 4XYLA 1P9LA 4L74A 1M67A 3ORFA 2Q2VA 1PSDA 3H9QA 4XR4A 4PVDA 4RORA 4M87A 3FSRA 1HTBA 1UAGA 3QE3A 1A4UA 2P9CA 4UVIA 1Y8QB 2NLOA 3IL2A 1Z73A 3T7CA 4CLOA 4DQUA 3I9LA 4CQMD 1GUYA 2D59A 5I9LA 2BD0A 3VAZA 5JDIC 3S2EA 4CMKA 4R9RA 3I6IA 1GDHA 1TT7A 2JAPA 2C5AA 1LSJA 3LC1O 3VKVA 3M2TA 3ITKA 3BHJA 1ZIDA 3H2SA 2PGJA 1P0FA 3ZWXA 2C2YA 3HB4X 3Q6IA 2PR2A 1HE3A 3NV9A 5T6BA 3LT1A 5CFZA 5B12A 1Y5MA 4E4YA 4GAEA 4Z3KA 5JO0A 3NAQA 1DRUA 3BMCB 3E1KA 3FNHA 3V2UA 1WXDA 2EWMA 5DBGA 1ZK1A 3KUXA 2VCYA 3SLGA 4BQPA 1N9GA 1NVTA 1ZW1A 4FB5A 1GZ4A 4BO4A 2LDBA 1JVBA 1BSVA 1YB1A 1PIWA 2UAGA 3I23A 4FFRA 1P1HA 3AI3A 1K89A 1JDJA 2CSUA 2ZTUA 4LSWA 3UW3A 2VT3A 3TQHA 4IJUA 4Z0HO 3RBXA 1C0LA 4R1NA 2VWPA 3IUPA 4N5LA 2HLPA 3HSKA 5TC4A 4I08A 4EZBA 2YW9A 3GVPA 4BS9A 1I8TA 4ZRNA 3MCVA 2F00A 2VRCD 2YQ4A 3GUYA 2VHZA 3HDQA 2X5OA 4NFHA 1HXHA 2FR8A 4PLYA 5F1OA 4M8SA 5EN4A 1VPDA 2FPGA 2ZTLA 3FPCA 4Q3EA 4PG4A 4B3JA 4D0RA 1CF2O 2TMDA 2W90A 1IYZA 4CMIA 2VHYA 3ETEA 2AHRA 2ZCUA 5AXDA 3ONDA 1F06A 4NU5A 3VC7A 1BW9B 5L7WA 1H5QA 4BVAA 1DHRA 1D7OA 3W8EA 1T25A 3E9MA 3D4PA 3EMKA 4XCVA 1GZ3A 3P2OA 5H82A 2GR9A 1PQPA 3H3FA 1EZ4A 1R4MB 3WGHA 1LSUA 3MJCA 2Y67A 4NFSA 4H3VA 5GZ3A 1B8VA 3BHMA 3ON5A 4HFRA 1V8BA 1GV1A 4BOYA 4I9HA 5C7IO 1W8DA 1YL5A 4DYDA 1R16A 4OQYA 4P8RA 1C14A 1I10A 3AFNA 2AW5A 3D4NA 3HADA 3WXBA 1LU9A 3RKUA 1JWBB 3D1LA 4TMFA 4S3MA 1EFKA 3RWBA 4B8WA 3DHNA 4CQMB 4QTZA 1JAYA 3L6EA 1HL3A 1ADFA 2Q4EA 4I5FA 2C29D 5JSFA 4AJ4A 4LRSB 2DBQA 5TT0A 4LCJA 4J90A 3GR6A 1R15A 4IDGA 1U4OA 1QG6A 1W4ZA 1OFGA 1DIGA 2A4KA 4WPGA 1LLDA 4FS3A 3FD8A 4ZHSA 4NBRA 4NBVA 2QZ9A 3KLMX 2ZYGA 3WICA 3CXRA 1PS9A 1B26A 1NFQA 3I9OA 4CV2A 1U3WA 4GSLA 4HFNA 2JD2A 2O3TA 4BNLA 3X2FA 2YFQA 5ENDA 2Q46A 4FFOA 3JD1A 5IZ4A 4ALMA 5T64A 1C3VA 1R0KA 5TSDA 2PGLA 2WYVA 3WGGA 4GX2A 4J4TA 3RCBA 1UP6A 3DHEA 1EDOA 3ZHXA 5JDIA 1ZEMA 3OECA 4W4TA 1K3TA 2G17A 3QVSA 1SAYA 1V3TA 4FC6A 4RCVA 1PX0A 1B15A 2EP7A 1I5RA 4UUMA 5IN4A 4BKUA 1QSGA 1YJQA 1YOVB 5B1YA 3ABIA 3GAZA 3QQPA 3DHYA 5U9CA 2FZEA 3IS3A 3DTYA 4DMMA 2BGMA 2FWMX 4CLHA 3L4BC 5DOVA 4M54A 1LQUA 3JQ7A 5F1KA 4CLDA 2EKLA 1YJ8A 3ZHYA 5KJ1A 1W0CA 5JYEA 5KTKA 1XEAA 2FPPA 2HMWA 4FFMA 2PD6A 3L77A 4WLOA 1F14A 4MIOA 1WDKA 1X7GA 3C7AA 4R16A 3WGOA 3TL3A 4J91A 1V3UA 1T2FA 4MJLA 4CQLA 4CUKA 2VZ0A 3DOCA 2BHLA 4CLXA 1D1SA 5H81A 3H5AA 4G81A 4N5MA 2O3UA 3PK0A 3RROA 2FP4A 5JYDA 2J5QA 4CMHA 1PJ3A 4XWYA 1KY4A 4KMSA 5LDHA 5JXWA 1Z82A 4X54A 4CMCA 3NX4A 1IUKA 1OBFO 5IDQA 4G2NA 1BXGA 4E2XA 3JCZA 2HUNA 1Q0HA 4YPOA 4RLSA 4GI2A 3PQDA 2Y1DA 3KYCB 3RUFA 4ALNA 2HRZA 3CPSA 4Y67A 3ZDFA 3W4JA 8LDHA 1ZMOA 1TA4A 4NK4A 4CM9D 2XOXA 1HZJA 2TMGA 3EGOA 4YJHB 4NH4A 4RF5A 1FDTA 1X1EA 1ZXBA 2PZLA 3SXPA 4EITA 1MGOA 4BNGA 3FNGA 3PHGA 3PYLA 3GHHA 3R0IA 3WQQA 4B7XA 3IKTA 1Y9AA 3DZIA 3ROQA 4PRKA 4XZ3A 3WG9A 4HADA 4Y8VA 1AUPA 2IXAA 2GASA 2O50A 2BELA 2G1UA 3ZV4A 2J3JA 2GCGA 4MVJD 3KSUA 5AXAA 4BL5A 5JCJD 2WDZA 1I3MA 4BO9A 1RPNA 5JAQA 1NWCA 3LT0A 3HZZA 3NJ8A 4M89A 4OXKA 3D4OA 2B5VA 5TRTA 1DAOA 3C1OA 4N7RA 5COQA 4IJWA 2PGDA 5B4VA 1YB5A 1DEHA 4CV0A 3WMXA 4U6QA 4CR8A 2RHCA 2E49A 4YQYA 3IDSA 4IXWA 1HE5A 4XJSA 2AQIA 4D41A 1C0PA 1NHWA 4NR0A 5IZCC 4RO0A 2DUUA 1JVSA 1F8GA 4PCVA 2RAFA 2DU8A 5EERA 3PEFA 4BNTA 4DLAA 1FXSA 1P33A 1EQ2A 3H5RA 4J7UA 3NUGA 2C59A 4QFCA 1LRLA 1SBYA 1YO6A 1Z6ZA 4U5QA 3LU1A 5T57A 1CIVA 2HSDA 3I5MA 1GPDG 2P9EA 4DIFA 3SJ7A 1CDOA 1KVRA 4RVUA 1PL8A 4KWIA 3FWNA 3PGXA 4CM4B 3F1KA 2X58A 4OH1A 3GEDA 2X4GA 3N58A 2NVBA 3ROMA 1EUCA 4ZVVA 1KVSA 3BTUA 4Y6PA 2DAPA 2VTEA 4UVGA 2CDBA 1XU9A 2E48A 1M2WA 1DOHA 2EGGA 2IEBA 1RWBA 1HSZA 1NNUA 2YV1A 3GVCA 4DBZA 4BNJA 1O94A 2QYSA 4DVJA 5IXSA 1K0UA 3DMYA 3TZ6A 4N54A 3DAGA 2BI7A 4YEDA 4XYGA 4JBIA 3BMCA 4TVOA 4XA8A 3ZV3A 1H6DA 3PDUA 1F17A 2VHVA 3F5SA 2Y1OA 1I32A 1UXKA 2OBYA 1VKOA 3E9QA 4QX6A 5JS6A 2I3AA 3GG9A 2VN8A 2PZJA 4YAGA 3HQ4O 5BNFA 2OUIA 2WD8A 2HMUA 4RPJA 1FF9A 4RZHA 4WNIA 4YQZA 5JC1A 1X0XA 2W8ZA 4FFNA 3SC4A 4XRGA 1PJ2A 3G17A 5TGDA 3AWDA 1GR0A 2B69A 4IJKA 1E6EA 1ORRA 4OOFA 1LLQA 4U6SA 3Q0EA 5H83A 2RHRA 4OHUA 4MVJE 2ZJ0A 5IDYA 4RVSA 2FZWA 2OXIA 3TFQA 4J6FA 4PZEA 2Y0EA 1HYEA 3U4IA 4DRYA 4F6CA 2XPCA 3FBTA 4IDDA 3LZ6A 3KO8A 3MTJA 1ISGA 1LRKA 3GG2A 4BNHA 3GDFA 5L51A 2AQ8A 1YB4A 4GLOA 1C1DB 4XB2A 3PLRA 3STHA 5A06A 2JHFA 1NR1A 1ENZA 3ZWCA 1ZJZA 2V6MA 1EE9A 2JHGA 4L75A 3H9GA 3JD2A 2DTEA 4QQRA 3S2IA 4LW8A 4BMVA 3HWRA 2QRLA 1T2AA 4I5EA 5T5QA 4YRDA 4CMBA 4ND3A 2WJPA 4KTTE 3AM4A 3U4CA 3BMOA 3TDKA 1FDSA 2Y68A 3UCXA 1Q0QA 3NKLA 3E82A 3MOGA 3PQFA 4OQZA 2NUAA 4IDFA 3QVXA 1O5IA 3OEYA 1GZ6A 4QO7A 2XF8A 4EJMA 4NIMA 4HUJA 1DO8A 1UUFA 4XD2A 1UXHA 1KYQA 1UAYA 1VSVA 3KSDO 2B0JA 3WGTA 3ZWNA 2GDZA 3PDJA 4IZIA 3PHJA 5JBIA 4PG8A 1WPQA 4OYRA 1WNTA 2AEJA 1NXQA 3N74A 4YJFA 5TF4A 4EDFA 1EBFA 5DP1A 2YUTA 4MOWA 2R6JA 1JWAB 5KVSA 3DXFA 5HBRA 1RM5A 3GY0A 1U3TA 2IYPA 4WASA 3DR3A 5ICMA 1GQQA 2OMEA 3RJ9A 3DO5A 3WOHA 5EL0A 4YAIA 5FFFA 3PIIA 4A2CA 4BB5A 3K2EA 4CM8B 5GMOA 2VYVA 3EVNA 2GPTA 1A4IA 4NJMB 3RC7A 1FDUA 3KEQA 4MKXA 4DGSA 4DREA 3H5NA 3DB2A 2NSDA 3L9XA 4L4XA 3L6OO 1G1AA 1NHGA 1NPYA 4FFLA 1EQUA 1KEUA 3LF1A 2I66A 4XYEA 3GN1A 2EV9A 1ENOA 3ZWVA 1T2DA 4RPLA 1PEDA 3PQEA 1E1MA 4OXNA 2EGHA 2A94A 3G1TA 1U3UA 5EQDA 4C7KA 2Q3EA 4U8GA 1BTOA 3KV3O 2EKQA 1B16A 4WE3A 5CPBA 1A9ZA 3ZGYA 4JJIA 4NK5A 4RLHA 5JCXA 1S7CA 1YOVA 2Q1SA 4MVJF 3QY9A 3P2YA 4KQWA 5BNIA 3NJ4A 2Y99A 1VLLA 5BSGA 1X0VA 3GVXA 3ROPA 2AXQA 3NDJA 4OKNA 5TLSA 3JYOA 3EZYA 1D3AA 2O3SA 4RJTA 1YQDA 1ISMA 3IQDB 4JLWA 5KJ6A 3C7DB 3DEYX 1P0CA 5JY1A 1BVUA 1UXGA 3FWZA 4TVBA 4D45A 3JYQA 3L4SO 3LF2A 2WWRA 5CAEA 1HYGA 4O5OA 1HYHA 4MP6A 4QXMA 5COAA 3GVHA 2GGSA 3JD3A 2CVZA 3PPIA 3GZNA 1XKQA 3DFZA 3SVTA 3ZHZA 4EUFA 1HKUA 2ZATA 2YDYA 4L8VA 2I5PO 3C24A 3D3WA 2WM3A 3VZQA 3RU7A 3U5TA 4R3WA 5EQFA 3C8MA 3JTMA 2E82A 3BXXA 5L40A 2PKRA 2YHIB 4YAJA 3B1KA 1NBOA 4MVJP 1HEUA 4TZTA 4R9SA 3PJDA 4JN6B 3DZHA 1U2GA 4LISA 3CSDA 3H8VA 4NZ9A 3RUAA 4R01A 1GD1O 4YJHA 1U5CA 4GWGA 4W6ZA 2AG8A 3GOHA 3VZPA 1H6BA 2XXBA 4XX0A 4E30A 1XYGA 2G5CA 2Y1FA 1L1FA 4CLRB 2HQ1A 4PLWA 1X7HA 4NJOA 4BHTA 5MGBA 5TNXA 3UUWA 1PZEA 3F4BA 1P45A 1Q7CA 4LGVA 1HE4A 1LA2A 4DQVA 4TROA 3JQGB 1R37A 1KVTA 3TF5A 4MKZA 4GX5A 4IGEA 1VE9A 1T2EA 4BNNA 1QV7A 1G0NA 5K9ZA 5L9AA 3DONA 1U7TA 1MG0A 4WNCA 4P4LA 3HUDA 3QWIA 3IAHA 3EC7A 2C7VA 1KERA 3GNTA 2FR0A 2X1HA 1DSSG 4HV4A 4B4WA 3SJUA 4QUKA 3CEAA 1HDYA 3AY3A 3CZMA 4KUGA 3VPFA 4KDFA 5TJHA 3FHLA 3CMCO 1KVUA 3VVCA 4DUPA 5CDGA 1WLYA 4R3NA 5DOZA 4XYMA 4OAQA 2ZYAA 4EUHA 4PIVA 3UN1A 5F3RA 7MDHA 1P1RA 1NPTO 1NQOA 4BIIA 4MIEA 1SEPA 2W98A 5JE8A 1YBMA 3ASUA 1PJTA 3ZZNA 2FOIA 2D4AA 2QZZA 2X0NA 4UULA 4I5GA 4B3HA 2VZ8A 1WAMA 3FBGA 1ADCA 3ULKA 3ADPA 1IHYA 3JQAB 3QWBA 3I4CA 5U1PA 2I9PA 1BXZA 1J6UA 3GMDA 1FDWA 4EBFA 4ZQHA 4J9VA 3EW7A 3QV1A 2IDZA 3LVFO 1E3SA 1ISIA 5THKA 1A7AA 3ZWBA 4GSKA 3WGYA 4B79A 3IJRA 3MWDB 1XQ6A 4DC1A 2NU6A 3NGLA 4FBGA 4AJKA 1YDEA 4EJ6A 4YCAA 4AJ1A 2O4UX 4GKVA 2P68A 4NMHA 2I3GA 4BV9A 1QKIA 5TT1A 1NWHA 3ZU5A 2J6IA 1MX3A 3RUEA 3ROKA 1X7DA 2GUGA 3MOIA 1GCOA 3AI1A 4F45A 3O9ZA 3RVDA 3ADOA 3GQVA 4DPKA 3EAGA 4WOKA 5KVCA 1H93A 3RUIA 1AHIA 1ID1A 3WFJA 4Z0PA 5TQVA 3RBZA 4BNXA 4A7PA 1J4AA 4GVLA 4E0BA 2JCVA 2ILTA 4GL4A 1Z45A 4CV3A 2JKVA 2Y05A 2YDXA 4J4HA 1O8CA 4OL9A 1RM0A 5DZSA 4ZRMA 3RD5A 4DIOA 1RM4A 4H7PA 4CM7A 1QYVA 2DLDA 3VH4A 2J5KA 2PY6A 3ZWAA 4INAA 2DFDA 2H5LA 4PZCA 1UDAA 5CG1A 3JQ8B 1O6ZA 5A3VA 2PFGA 1DBVO 1QYXA 4L4SA 4WK6A 4WLEA 1KETA 1DIBA 5JDCA 2VNSA 1M66A 1A7KA 3DQPA 3DC2A 4YDRA 1ISFA 3E5RA 5F1PA 2Q99A 2UV8A 1TT5B 4TSKA 3PGJA 4R5HA 1PJBA 5HM8A 5IF3A 1NR7A 3AUAA 2NWQA 5KKAA 1I36A 3K6JA 1LXCA 2O3JA 3C7CB 3CH6A 3WWYA 2HDHA 5CEJA 4LVCA 2GZ3A 1Y1PA 3DBHA 2H1SA 1HDXA 3K8ZA 2DBRA 4B7UA 1EDZA 2BGLA 3WNQA 5L4NA 2VYVD 1EFLA 5G4KA 3G0OA 3OA2A 3R6DA 4BV8A 4UVDA 2CDCA 3AY7A 4NNJA 4D44A 1Q0LA 4E5KA 5BSFA 1LDNA 1DC3A 2GN8A 5KVQA 4R5MA 4RVGA 1OZAA 2B83A 1V35A 2JL1A 3JSAA 4EUEA 2G76A 3FRJA 4A5OA 3W4KA 1EK5A 2W2KB 3BTSA 1Z75A 2V65A 1Q7BA 5JW6A 4J1SA 3TSCA 5A3JA 2PNFA 1B0AA 4EGFA 2YFHA 2ZKLA 4XDZA 2EF1A 3U4HA 3GGGA 1DRVA 3L9WA 2AE2A 1YH3A 1XCBA 1ISJA 2RH4A 1CYDA 4W99A 5CDSA 4W82A 3ZHBA 2ZK7A 3WGQA 8ADHA 3KETA 3ICCA 1P3DA 1VL0A 1BHSA 5MDHA 4PFJA 2JAHA 5L3ZA 2QRKA 2Y1CA 3PVZA 1U28A 3PYMA 4K26A 4CM6A 2IRWA 4YRBA 4O59O 4Y6SA 5F21A 3UICA 4BGIA 5HRUA 4K1LA 1HE2A 5BNTA 1DIRA 3H7AA 5CHEA 4MP3A 1U2DA 1H6CA 1LC3A 1O89A 3HE3A 3ZWOA 2CUKA 1HRDA 1YRLA 2W2LD 3C3XA 1E3JA 1DC5A 3WBFA 1Y7TA 3VKUA 2P5UA 3DFUA 4HNGA 3SX2A 4BO7A 4J1NA 5G0UA 3B6ZA 3F46A 4HWKA 3RUCA 1YWGO 1IPFA 4ZJUA 5I8WA 1ONOA 1BGVA 1QP8A 1N8KA 3OBBA 4FC7A 3KRTA 2YZ7A 1NYTA 5ER6A 4BGUA 2GF2A 4KWHA 1LEHA 1SOVA 2D1YA 3WLFA 3JV7A 4WUVA 4D3FA 1F0YA 4R1TA 4ESOA 1NFFA 3O38A 3WIDA 5L45A 2HJRA 4IPTA 1LJ8A 2UUPA 4PLVA 5G2OA 3FI9A 4CV1A 4YBZA 4GQAA 3H6KA 1ZK0A 2BKAA 1E0DA 1ONNA 4GLLA 3K73O 2X22A 1R0SA 1SNYA 2YHUA 3JQ6A 5K6AA 1ZBQA 4B4OA 2NTVA 1E3WA 1W6UA 1YQGA 1DFHA 3IMFA 4YACA 4JX8A 4GMFA 3RAJA 5L4LA 2DFVA 3QVTA 3GF4A 1NPDA 4BMSA 1RJWA 2CZCA 3G1UA 1EBUA 5A9SA 3W1VA 1UH5A 1Y5RA 3WWZA 5C5IA 4WCFB 1T24A 4ND4A 4RPKA 4E21A 4KZPA 4G5HA 2C20A 4D43A 5I9NA 1VSUA 2NVUB 4EI2A 1E7QA 2HCTA 1R4NA 2Q50A 3GGOA 2I6TA 1OI7A 5B4TA 2Y93A 4CLRA 2X0RA 3CMMA 5KCZA 1VKNA 3VH1A 3T4XA 4IM7A 3Q2KA 3GPDG 3KZVA 4L9RA 5F5NA 3WTCA 2CVOA 2AEMA 2WE7A 3U62A 3BMQA 3B1FA 1PJLA 2GN9A 4JXKA 1MG5A 4QECA 1N5DA 4XDYA 3OF2A 2DVMA 1HDOA 1BVRA 2SCUA 1VC2A 1I3NA 1C1XB 1SO8A 3PI7A 3ZNOA 4E31A 3Q3CA 1WWKA 2YQ5A 4YT4A 2FSVA 4BNMA 4PN3A 4ITUA 3DDNA 2AQHA 1LBEA 3GFBA 4TRMA 3DAFA 4ZQBA 3KYDA 3FTPA 4Y9DA 1I2ZA 4BKRA 1UR5A 4LK3A 3ZWMA 3PTZA 3GA0A 1YS4A 3QWFA 4KUHA 3GHYA 3AU9A 4ND1A 1WZEA 3U49A 2VWHA 2UVDA 4W9NC 5ITVA 5T67A 3ZU3A 4CL8A 1DJNA 4M55A 2OGUA 4PG7A 1UP4A 2VHWA 4R54A 3K30A 5BT9A 1KY5A 3BHIA 2X9NA 3K31A 4R69A 4Z6KA 2DBZA 3BMNB 1MA0A 4TRJA 3LC2O 3GC6A 1X14A 2NQ8A 3A4VA 3D0OA 2UUOA 4MIYA 3RBVA 2EIHA 3HN7A 2X5JO 4FQ8A 2O23A 1PR9A 2NU7A 1NP3A 4GBJA 4AICA 3KM0A 4OJNA 3WYCA 1HWYA 1ULUA 6LDHA 4L73A 4P4NA 4E5MA 4IQ0A 4BNWA 4KP7A 3ZV5A 1K6IA 4JGBA 4AJJA 1M76A 4NBUA 4I9UA 4RF4A 3OJEA 1YXMA 1KEPA 1UDBA 2GO1A 1BG6A 1GQ2A 2O2SA 2LDXA 1SOWA 4B4UA 4O1MA 3MJTA 2YYYA 1LLUA 3DZJA 1UJMA 1Y8QA 3F4LA 4LRTB 1F8FA 4Q3NA 3ZU4A 5KJFA 4AJOA 2P2SA 2DKNA 4R41A 4E2ZA 3WQSB 1A9YA 4B7CA 2GNAA 4D3DA 4DTIA 2PH5A 1OMOA 1KS9A 3ZCXA 1L7EA 4PG5A 1PWXA 2ZQYA 3GNSA 4KUEA 4TKLA 4CM5A 1E1NA 4MPDA 4AFNA 4E12A 2X6TA 3IJPA 3PZBA 3LT2A 1CEQA 3EVTA 2NM0A 4EEXA 3DBRB 2PK3A 2QW8A 2QHXA 1XHLA 3QVWA 4RQTA 5IN5A 3TWOA 4YYZA 3FCOA 2FHSA 2FY8A 2O7SA 3E9NA 3TL2A 4S1VA 3S2FA 3D5QA 1PJQA 3WMWA 2CMDA 5C3MA 3HHPA 3WGIA 1MXFA 2CNBA 1MC5A 3PJEA 2OP1A 5EESA 3V8BA 4CLEA 3WSWA 4YT2A 3OMLA 1SMKA 5JY6A 1MXHA 1H2HA 1H6AA 4IQGA 3SBOA 1IY8A 1JQBA 3OA0A 1SC6A 3ASVA 4J16A 3B1JA 3OSUA 3RC1A 4CM3A 2ZB7A 2YJZA 3DBLB 1VJTA 1E1KA 3NT4A 1G0OA 4HP8A 4WCDA 1WZIA 3Q11A 1DDOA 2VZ9A 2D0IA 3F3SA 3WGZA 1FK8A 2FMUA 1I3KA 1HLDA 3OICA 1GUZA 1I30A 1TEHA 3OIDA 2FSSA 4GVXA 4RL6A 4R68A 4GGPA 1ZO8A 1EEHA 2XXJA 5FWNA 2VUTA 4RPHA 3L6DA 1BW9A 1K2WA 5DBFA 2B4QA 4CM1A 3UH1A 4XQCA 3GPIA 1P74A 2AG5A 2W2KA 4C4OA 3V2GA 4RDHA 3BYZA 5FYDA 4MVJG 1ZVMA 4CPDA 3TFOA 4W9NA 4L4RA 5J23A 4ILKA 1R4MA 2OFPA 2XAAA 2WSBA 2EHDA 1HLPA 5EJ2A 2V7PA 4E5NA 1NAIA 1U7HA 1VL8A 4FJ1A 3O03A 4A03A 1GCUA 1WP4A 4YAKA 2YV3A 1E3EA 4OSOA 3EHEA 4XYBA 1N2SA 4YR9A 5CDTA 1LSSA 1LDYA 5A9TA 1T1RA 2C2XA 2OP0A 5EINA 3TZHA 4CQMA 4DLLA 3FF4A 3OETA 3RSHA 1DC6A 2QYTA 1N9GB 3S55A 1JLLA 4DIBA 1Q7GA 3K2BA 4RF2A 4TQGA 1ADBA 2ZIZA 3EDMA 4MO2A 1GTMA 3GNQA 4HFMA 5HWSA 1QLJA 5KVVA 4II3A 2E4AA 1D8AA 3DOOA 3TN7A 3PIDA 1BXKA 3DOJA 1PS0A 3K9QO 4FN4A 2ZB4A 3KXDA 1KIFA 1PZHA 1WW8A 2X9GA 2DPGA 1J5PA 2GZ1A 1E3IA 1VRWA 2NQTA 2NU9A 4YB8A 2HO5A 4XQEA 1O95A 2V6FA 5A4DA 3VH3A 4IZHA 3DZFA 4NQZA 5L4SA 1DRWA 4OOEA 1P77A 2EG9A 3R3SA 3AI2A 3PLNA 4XRRA 1I33A 1LDEA 4PLFA 2ZB3A 3W4IA 1SB9A 4CMIB 5C7LO 1KC3A 2PZKA 3WFIA 1E7RA 4IS2A 5DCUA 2CD9A 2VOEA 4U7WA 3P7MA 2D5CA 1ZMTA 3BIOA 4DPLA 1KEVA 4ZQEA 2DBVO 3ZWWA 2OZPA 2BFAA 2VRCA 4N5NA 3CE6A 1H9BA 1A27A 4K6CA 1SB8A 1P1JA 2ET6A 1U1IA 1KC1A 2A9FA 5F5LA 3EYWA 3GK3A 4UUPA 5JPIA 4MVJI 1C0KA 4AVYA 2IXBA 3I6QA 3JQCA 4I1IA 5DDIP 2B4RO 4I8XA 3G49A 2BFMA 1WMBA 1C0IA 1HDZA 2ZCVA 3WLEA 4J9UE 5AXCA 5TIIA 4GGOA 1YONA 1GYRA 1B3RA 2Q2QA 1ZK4A 1YQXA 1JKJA 1EK6A 1SEVA 3K5PA 3QA9A 1NQTA 4J7XA 1EMDA 3VOSA 1D1TA 3WTBA 4IBOA 4BO5A 2A35A 4ZA2A 2P4HX 1LTHR 2Q1TA 4AJEA 1MP0A 1LDMA 2OO5A 3HFGA 5JMPA 3JD0A 2O2YA 1IHXA 3W8FA 3DZBA 3IOYA 2UYYA 4DMLA 1ZSYA 3GN2A 3ZN2A 3WR5A 1ARZA 1HT0A 2D5AA 3F9IA 3GH3A 1VI2A 1ZCJA 2B5WA 3RQSA 3JYPA 3WX0A 1FDVA 5IG2A 4IXTA 2FR1A 3SLKA 1P44A 3H9JA 1C1XA 4IJVA 4U0JA 3T4EA 4ZICA 2POQX 2Y66A 3E5MA 4ALKA 4P38A 2BMAA 1P1IA 3RFXA 3OJOA 4BKQA 3KYCA 3ANMA 3ONFA 1SPXA 3U09A 2NVWA 4RF3A 4GX1A 4YRAA 4D79A 2BLLA 4YJGB 1QRRA 3GUCA 3S2GA 2Q45A 4CMAA 5G0WA 3I9NA 4EJ0A 2AA3A 3NGXA 4WOJA 1PU2A 1E3LA 1YL6A 4FPXA 3DTTA 1LRJA 4IS3A 5JDCC 5CPFA 3WQRA 3NT2A 4YXFA 4UEJA 2EW2A 3PZRA 3ZV6A 3HB5X 4B8ZA 3ITDA 3HNPA 4RZIA 3VPHA 5CDUA 5HA5A 2JD1A 1DFGA 1U8XX 4IDCA 5A5EA 2C7GA 3AJRA 3I4FA 4XJTA 1ZFNA 3TNLA 1ZKMA 1ULSA 2CY0A 1I0ZA 3W8DA 3HDHA 4M1QA 4Z0TA 5LDGA 2G82A 4II2A 3H2ZA 3HDJA 5K1SA 3KB6A 3PHLA 1NM5A 4CUJA 1CRWG 4CQLB 4NDNE 3V1UA 3PYXA 3LDHA 5EPOA 4ZGWA 2EJWA 2O7QA 3ZW9A 3D3EA 2D3TA 1EUDA 3COSA 4FGSA 4D7AA 1YKFA 3WNVA 3AY6A 2YV2A 4UUOA 4WLNA 4LCEA 3KYBA 3SC6A 2J8ZA 4ONEA 3RIHA 2RCYA 5ADHA 2EJVA 1P1KA 5BSHA 4JCOA 2W4QA 4RDIA 4Q3CA 1PGPA 4Q3DA 4XIYA 4E6PA 4IQ8A 1BXGB 5FI5A 4URFA 2PD3A 3FNEA 2Q2WA 2PLAA 5LCXA 3UKOA 4CM4A 1GADO 2BI8A 3FR7A 3VHRA 4K28A 2E6UX 5DP2A 3C1AA 4YJDA 4U0KA 1E5LA 3RC2A 3NT5A 3K96A 3ZWYA 4PGFA 3VZSA 2QX7A 2JFGA 2PKQO 4CL3A 5A05A 3Q1LA 5GY7A 3NRCA 1LUAA 2P5YA 3QW2A 3GEGA 1OC2A 2EERA
chains in the Genus database with same CATH superfamily
1WXHA 3EF0A 1HYBA 2J85A 3WHLA 2AMYA 2P2DA 1HQCA 3NVKI 3GCZA 4P4UA 2AN9A 4RXMA 2X41A 4P22A 3JVIA 2VYNA 2QMUA 4ZP1A 3DAYA 3W6OA 1RKQA 2BMDA 2RGBA 3MCTA 4WFKA 1QQ7A 5B1IA 3CKLA 2C7QA 1Z7EA 2ZYUX 3E05A 3O93A 2QTFA 3WI7A 5EJIA 2ZBQA 1KPHA 4X63A 3E1SA 4LVOA 4MMYB 3ONEA 1EX6A 2PRJA 3E8XA 2G04A 2Y1WA 5KNLA 2NTJA 3IKVA 3D6MA 3DKKA 3Q3VA 2BBTA 4Z7QB 4DEVA 3TW0A 3JVUA 4N18A 1IB0A 2FU5C 1U9ZA 2V96A 3A1UA 3LSTA 4TRNA 2MCFA 1JAXA 1GNPA 3QHAA 4X93A 5AOVA 5A62A 1VLHA 4OQQA 2OBFA 1J2RA 1I01A 5A1TA 3SHQA 4DMRA 5BSWA 1DJPA 1N34B 3OP4A 1EU1A 4FDAA 4IGAA 3EDQA 1ZC3A 4NBKA 3M6IA 3PFCA 1TYZA 4JLMA 1U6IA 3V1YA 4JQYA 4RWZA 4WLVA 1V8ZA 3K92A 1GPNA 3PWZA 1TZBA 4NYJR 5BYJA 4BO0A 1R6TA 4JLSA 3TZKA 2QAIA 4EAAA 2X5KO 2OBMA 3P32A 4EG3A 4IIJB 1KORA 2GHTA 4H0NA 4NBTA 1JVNA 5EXPA 1N7HA 3SC2A 1XNGA 3AI7A 1TVKA 4ZAXA 3U56A 1S2NA 5KYVA 5JNTA 1BDMA 4IR7A 3IQIX 3RIGA 3RLFA 1UZMA 4B80A 2EWWA 2XYQA 4HH1A 5BYAA 1H0KA 1YFZA 3LLCA 4J3FA 1I24A 3HDYA 3LPDA 3RRZA 3ZQJA 1WMAA 2O48X 3K70C 2AJTA 1NMYA 4DMHA 1IAQA 2R0QC 1GNRA 3TTUA 2P11A 4H7JA 4OXRA 1XWWA 2WUGA 3HY6A 2PKXA 3GRKA 3L1JA 3VTFA 3NDIA 4NBSA 1ZBDA 3A1CA 2BM9A 5K3DA 4BFUA 2P90A 4EKEA 1E2KA 1I2CA 2C2GA 3LQRA 3FSGD 3G9UA 2HJGA 3PGVA 4MUNA 1F12A 3QRWA 1WG8A 2XHZA 2JAUA 1SZPA 1S8OA 2FW6A 3II6X 3FPBA 2E87A 3KR0A 2AKAB 4XM0A 2O7RA 4O6VA 5I7UA 1CUDA 1CHNA 4CDNA 1AXRA 4NPHA 5FPPA 3O74A 3OMXA 3JWJA 1K7YA 1ZGAA 3OX1A 4EHNA 3CZ4A 3EGIA 2HMVA 1WJGA 1JG1A 5CGZA 1W1UA 5HIIA 2V4UA 3UXYA 1YIDA 4M9RA 2JAQA 3B85A 3LQ1A 4BMYA 1DIOB 2V6BA 3H9BA 1UADA 5LL6P 5JSZB 1CUCA 3ELDA 4ER7A 3LBIA 5T8KC 1CUUA 1UP7A 4B6FA 1UFQA 3WMEA 4FQ7A 4A0HA 3NVMB 4NJMA 4BV2A 3LWNA 3UCFA 5HTOA 3SGLA 4JP3A 5DN9A 5FORA 1XELA 3T8YA 4ZKDA 2DPHA 3G8BA 3SWWA 3C8ZA 3AZQA 2JBAA 3UPTA 2VTBA 3LRXA 4GWKA 2IHJA 3VR5A 2CEKA 2FJ0A 4D81A 2FRDA 2ZTSA 4L8FA 4UXIA 1NN0A 1F6BA 3R20A 3A36A 4DIDA 1NIJA 1DBQA 1JR2A 3B1ZA 5JJ5A 1XGKA 2X23A 4UQOA 2B25A 1A8IA 4JP1A 4BVBA 2QG4A 3QYPA 3D4BA 3DFKA 3FJOA 3VR4A 4A10A 2ZQ5A 2BTEA 4FE7A 4P4TA 2HJSA 3OZVA 6PFKA 1C9EA 4TWRA 3WWEA 3WGVA 2WIJA 4YDSA 1JNXX 1O0SA 1V7QA 1WVIA 2LRHA 1K7FB 3A1FA 3ROZA 1E3DA 1GN9A 3HXKA 1J07A 4X7MA 5JO9A 1SVMA 2CL0X 1OOEA 3BMOB 1FL9A 1J1ZA 1K6XA 1N5MA 4GH5A 4RLFA 1LF0A 4KJXA 1J2UA 2I67A 4HZIA 5CNMA 2C5BA 2Q5CA 3RSLA 3VXKA 3L3BA 1IXYA 3CGGA 3GJ4A 1J8YF 1MO6A 1PS8A 3D6FA 1YR8A 4XVHA 3DBVO 5GJCA 4Z3DA 3RVNA 2PS0A 5SICE 1OLXB 4W63A 4JZKA 4US2R 3N2KA 1Y4ZA 3GGSA 4DJFC 5EG5A 6REQA 5LU9A 4IW3B 2QD4A 4IXNA 4DV7B 2GZDA 2LIPA 5AWFC 3ZE1B 2OESA 4EF4A 3NQ41 5AI5A 2D1SA 4Q9HA 4P3XA 3KQKA 5KNDH 3R6WA 2FN7A 3QLTA 1U1GA 5BT8A 2C2KA 1USKA 5KPJA 2QKYA 4JQSA 1IHDA 4P7JA 4GXNA 1ACMA 1YGYA 3DE2X 1EVJA 5H3HA 4AJIA 1UMBB 1UM9A 2XNCA 3I0NA 3IRVA 4NXNB 1NN5A 2CBZA 5BNWA 3N2IA 1U3FA 1ZJWA 3PV0A 3JU3A 2Z3ZA 4H17A 5T4BA 4X20B 1MQ8B 3WMFA 3GARA 1GT91 3FGNA 4J2OA 4AF8A 1VSQA 4R31A 5L7YA 2Y0CA 3SR0A 2FWBA 4ZC1A 3GEBA 2YHSA 1U2QA 4PC6A 5FLXA 2Z4SA 1RKXA 1FSSA 2QN9A 1QYDA 4DF3A 3ZH2A 5FUYA 2XB9A 3PWKA 3ZDDA 2BFBA 4DCNA 3WLLA 3PQ6A 3GCGA 3H5LA 5FOQA 5KTPA 5K1ZA 1WB6A 4XM2A 9LDBA 3F1LA 1RXWA 1EVZA 2QRMA 4L1KA 4OSPA 5H4GA 3K9HA 1Q16A 2XTNA 3C6BA 3DV0A 2ATXA 1MDBA 1IULA 4JHLA 1XD8A 4UASA 1M8FA 1R6UA 4NV1A 3ZZUA 3O8QB 2GNPA 1Z9BA 3GLRA 3OEED 4GM0A 5EKTA 4QPNA 2P9YA 5KNCD 3URMA 1KMQA 1W9MA 1SUPA 2EYUA 2IH2A 1FJGB 1TXGA 1XU7A 2WHXA 4LVNA 3TLBA 2PX8A 2WYHA 3UF0A 3QU2A 5AKXA 4A8TA 1K0FA 4J16C 1ECGA 1DP4A 4TWIA 2GPSA 1AQYA 4JJ8A 1ZIOA 4LYGA 3HACA 4EWLA 4H1HA 4B45A 1DBRA 1SK9A 4PWZA 4K0KB 1L4LA 1WB4A 2VH2A 4DBLE 2QAGC 2XSZA 1OLSB 1L5QA 1E77A 2LWIA 5CB4B 1CR2A 3IEUA 3HYLA 2OK7A 4R8VA 1FTYA 5JBNA 3TAHA 1HNXB 3BJIC 3L49A 4LG1A 1GGVA 3GQBA 2FJPA 2N75A 4REMA 2J7PD 4TMVA 1ZIPA 2WQ6A 2C4WA 1J33A 4ROSA 5AK5A 1TTPB 3ZGXA 1C3XA 1PFUA 1EUQA 4V1CI 1YA4A 1GP2A 2AE1A 1N6OA 2I7DA 1FP4B 2OO3A 4F5EA 1PQYA 5CNIA 2YXNA 2Z58A 4TQAA 1WHSB 1GL3A 1U4SA 1V3VA 1XQ1A 2CL7X 4UJ5A 1L5NA 5B3JC 4G5RA 3TXAA 1PJCA 1NBHA 2RHWA 3ODPA 3EZ2A 4FP9A 2AD5A 4DG9A 1FLVA 1Z0DA 1A71A 4PLTA 2ENUA 3GYBA 3BWBA 2A0FA 5L53A 3SYLA 4MQ4A 2A5FA 4ACBA 3B53X 3W90A 3DLHA 1NVMB 4ZT3A 1Z4PX 3QFHA 4R8LA 4CKCB 5ALHA 3U7GA 2OHXA 2WEKA 5TX7A 2AN5A 4BKOA 2PKQP 2QZPA 2YJ6A 3DMRA 2YR0A 3R77A 4KJZA 5BOVA 1Q57A 5ARDA 3SS7X 3UH0A 3RVLA 4Q66C 5C4IA 2BF7A 1VFNA 2JGEA 3TLYA 1MHTA 4BQRA 4IVNA 1T9BA 1D0VA 4FSHA 1YR9A 3FPLA 3U4DA 1R6AA 1H9AA 3QFTA 3PQ5A 3IEXA 4XKJA 2YV5A 4C88A 2QTNA 2FEPA 1XDZA 4BMDA 3ANLA 1XZDA 4PQYA 4MAMA 4R51A 4EI8A 1NTOA 4QZVA 1BQ3A 3FNRA 3IKLA 3VTZA 3C39A 5KKCA 1P9WA 3AUYA 3TTTA 2NG1A 2C00A 4MW9A 2FMXA 4Y6LA 2WWIA 4OVKA 3PPVA 5EEHA 3RS5A 4A8JA 4TPKA 4U3JB 3CLSC 1GPH1 1JR3E 3U40A 1VG8A 2JIQA 3GL9A 3I4LA 3IEPA 1O6CA 4V0ME 5IKPA 3L5KA 3NPAA 2RC5A 5EWLB 4BFTA 1R5NA 3PXEA 4YMHA 3NDBB 5C9ZA 5EJAA 2ES4A 2QQ5A 4XGIA 4BB6A 2H3HA 4BNDB 3CF4A 4TV9B 1E2JA 2PUAA 1BN6A 1WOMA 2C7OA 1PJ4A 1TKAA 2HQSA 2O1EA 1AK2A 3AUSA 3GRCA 4ITRC 3INRA 3SSMA 4BMXA 4EG1A 4AUNA 2GYYA 2JNWA 1XJ5A 1TEXA 3TINA 3K9WA 4GT1A 1UBNA 2PCLA 1Z16A 2ZBEA 3HP4A 3NNNA 4GXQA 1HBJA 3U48A 2G6TA 2D5IA 2Z2ZA 2HU2A 5ICSA 2XOKD 5K6RA 5K2OA 3DEJA 2IWRA 1DBSA 5FL3A 3SM3A 2RGAA 3TOZA 1YVDA 5AJUA 1WBJB 4KK3A 1UXIA 1F9EA 2HB6A 5BN3A 1Q2XA 1QDUA 4QJ3A 4RKWA 3WAGA 3EG5A 2PEZA 4LXTA 5K05A 4Y2SA 4CCYA 5A9RA 1YE8A 1J20A 4II7A 4DLNA 1LGYA 1ZN7A 3AJAA 2I76A 4F5DA 1KSGA 4RM3A 3TW6A 5JATA 3JX9A 3JQBC 1LSOA 2NV6A 2RJ3A 4KAXA 1XMPA 1OW3B 3QIVA 4OLJA 3PICA 5ILOA 3DR5A 3KHKA 2NZUG 2YRXA 3UPDA 5IAOA 1ZCAA 3TQIA 2XNDA 5JANA 2ALJA 1KO1A 2PLRA 1MQ9A 3KWMA 2B7BA 1KQNA 3UWDA 2CMHA 1IPEA 5EXEA 1GSHA 4ISCA 4X6LA 2J3KA 1K8XB 1PBNA 3CNOA 1JDTA 5JLAA 1NBME 1RI4A 1OX6A 1YDWA 3Q12A 4I50A 4MUXA 2EU8A 1NLFA 1UQUA 3C14C 3NC0C 1MW9X 3M70A 2BM1A 2N9UA 4MS4A 3DLBA 3CF0A 2GZ2A 4G5SA 1VJCA 2WKPA 2ZT8A 4MW7A 3DG9A 4QEKA 3TPFA 2A7QA 1Z25A 1EVIA 2ZFUA 3ENKA 4CNQA 4GI1A 3OIGA 4C2BA 3DDWA 5EC8A 2BFOA 3UMSA 1N8NA 3CCBA 3NG1A 1DFIA 1DZIA 2R4QA 3OFSA 4CGYA 1ZVKA 2Z83A 4YMSA 4AZVA 3ZIAD 2ZTVA 2ZQZA 2YIMA 4D46A 4QT4A 4QBGB 1W44A 4BXOB 1ISHA 4Q6WA 4EY6A 2F8TA 1ENPA 1M8PA 2CNNA 2UDPA 3EGDB 1ZNWA 4RFSA 3N7TA 1FNNA 5A04A 1ZJ4A 2OORC 3I8OA 1M1ZA 2C2HA 2D8AA 3NHYA 3Q98A 4ZT5A 5IMBA 3RVSA 1GNQA 3S2ZA 3QTBA 1AA9A 3E9YA 2Y4OA 3LNCA 3FYUC 2CE2X 3T34A 1J8MF 1A1SA 4JQCA 1K5PA 2QX6A 4JI6B 5AUNB 1GZSA 1YE3A 1E1RA 3B1YA 1PR1A 4ND8A 4QJ4A 5ALWA 3QWAA 4AC9A 4ARIA 3QVOA 3UZUA 2IP2A 3WHKA 4CMEA 1V1JA 1ANKA 1CLUA 3OPNA 3PC6A 2C61A 4MRPA 2ZKIA 3L84A 3RIEA 4DIEA 2GAIA 2MSWA 2RAUA 3BILA 3TQQA 3KQQA 1IBKB 1W0KD 4NU6A 3NIWA 4DUGA 1M75A 4B6GA 1Q7RA 1DQSA 4TLMB 1UZLA 5ARBA 1QUEA 5A7GA 2GN4A 1N2CE 3DDHA 5K8UA 2UYQA 2YWHA 3AONB 5J2TF 2OSBA 4CIXA 1AKNA 1NTRA 3O3NB 5BR8B 4LZPA 3SIRA 1RI3A 1R6VA 4JBHA 2Q0QA 4BFVA 4AM8A 3WISA 2Z4TA 1A5ZA 4OUDA 2YWJA 2X86A 5DNAA 3V1LA 3W6UA 2GWRA 4CG2A 1VCIA 4FWBA 4RAOA 4CJXA 4MW6A 2WI8A 2AXNA 5KIAA 1FNMA 3Q8MA 3MHPA 4NPCA 4MV4A 4GUAA 3SX4A 3IAEA 1O7JA 5JYCA 1KYZA 1S0UA 1DEOA 1FUKA 2JW5A 1KOFA 4RELA 5CR9A 5E8RA 4AD8A 1TE2A 2QN7A 3JR3A 4OHRA 4PTYA 1N92A 4BAUA 2GEUA 4XLTA 2OV3A 1SCKA 1VKZA 3BGWA 4CR7A 5E7IA 4RK4A 4M9XA 4DRXA 1TGYA 1RRGA 2CB9A 2G80A 4FGWA 1C8VB 1YZVA 1U7WA 4RCYA 4YLGA 1VRCA 2Z5FA 2YIVX 4C7JA 4D9JA 1OGJA 1XYYA 2IIBA 3V33A 4AG3A 3AERA 2ZETA 4HPXB 1ZL0A 2CDNA 1RC1A 5EE0A 5C4MA 3AUTA 4Q9DA 4L76A 4F9FA 3U17A 5AVVA 1I9GA 3CH4B 5SZJA 1URPA 4AL4A 2I03A 4BFWA 5KCMA 4FHGA 1Y6GA 2J9ZB 1CJTC 2WG0A 4O63O 1C7IA 3U3ZA 1BYUA 2Q5EA 4FFVA 3G0DA 3HVKA 3UOGA 1DVRA 1II8A 1FSZA 2XVXA 2NOAA 2DLNA 2FB9A 3WB9A 4CWAA 4AJNA 2B4TO 1YACA 2VDWA 1ENYA 1XWFA 3UHAA 4O4HF 4YLYA 3GOQA 3HWSA 2DR3A 4AXBA 3JWEA 1SZDA 1P0PA 4YMIA 4NY1A 1SKMA 1BGXT 4NVRA 3I1JA 1XDSA 2Q3HA 4WZAA 4WCFA 4JSYA 5AK6A 1JFFB 2IZ0A 2I0FA 4R4JA 5HPYB 1H2AS 1ZSNA 2PFKA 2F3UA 2LR0A 4KBGA 5HIKA 1MRZA 3ZHOA 4MQUA 4EKNB 2ZM5A 1QYRA 1XD2A 4YONB 5JZOA 1A7JA 3KBOA 2O2CA 3IMGA 1DX9A 1MUUA 2I6FA 3TEMA 2ZIEA 2YWGA 3AKCA 4OHXA 2VNAA 4DR4B 1PGJA 1IZ0A 3OLQA 3KLNA 3E03A 1Z4JA 4WNYA 2HA3A 1ORHA 4CKBA 1JMVA 1RYDA 3Q6MA 2DX7A 2FEKA 1IOZA 3PUHA 4FCCA 4WY8A 1NVUQ 3TDMA 4GSYA 1FFEA 3RASA 3H65A 2W6JD 1M1YB 2QP9X 5E0OA 1FVHA 3L07A 1NASA 3DWFA 4FLMA 4YRPA 6ADHA 1I5EA 4AZSA 1CWUA 5GOTA 4X1OA 1F8UA 1Z2NX 1RZ3A 2H9IA 3QELB 4QVIA 4IY1A 4R1UA 4BJ3A 2EG5A 4TXNA 5FULA 3N05A 5KNBH 4DV6B 5EMNA 2AI3A 3AQIA 2CC2A 4D4MA 3OQ1A 1ZK3A 3DXZA 1PWEA 1J1IA 2AOUB 4Q9NA 4WVLA 3RW9A 4FDTA 2UU9B 1JKIA 4IKOA 2ZRGA 1CRLA 2PIDA 3IUJA 2WINI 4FHEA 3UK6A 1ECLA 1PHPA 4AURA 2DFTA 9LDTA 2DHDA 4RIGA 2QM7A 4ZYYA 2BFFB 2AR7A 1XG5A 3CXUA 3OZ7A 4S2UA 4XGQA 2XT0A 4CEHB 3QKTA 2B98A 1NJSA 3JQAD 2ZE6A 4IUYA 4H31A 1JIXA 4LJKA 1UKYA 4NSNA 4Z4EA 3QE0A 2NZVG 3WOVA 2WJIA 3TZQA 4ZZ3A 1Y9ZA 1A88A 1J00A 1SD2A 4PZUA 1GPYA 4RVFA 5CH8A 1M72A 1OVMA 3LLVA 4A0FA 3R8XA 1G3IA 1E3WB 1EPUA 5G1OA 1JHUA 4QXOA 2P9GA 2OGZA 3CJRA 2V0CA 3OOWA 5IH3A 4BRSA 5DNVA 3L7MA 4WTOA 2BMVA 4IX9A 3JQ7B 4M1EA 4CTJA 4IIUA 4AY5A 4E2WA 4MJ3A 1XKLA 4FW8A 3RAPR 4TLAA 1L8QA 2QQ0A 3E0XA 1E7MA 3K15A 5ALPA 2C82A 2IW1A 2IUEA 3K35A 4BWYA 4DR5B 1UXJA 2O3QA 5CJ2A 3U4QB 4G25A 5AESA 4MITA 2OC9A 1C4WA 2O6HA 3E7WA 1QRAA 4LZOA 3V9AA 3ND6A 5DT9A 2ZUBA 3GLHA 4S12A 2WJWA 4TS3A 1BA3A 1ESNA 1AA6A 4FZ5A 1E79D 4YVFA 1RCFA 1BQEA 3H87A 1AT1A 3IAS1 3K8YA 4MPPA 5DHUA 1XSEA 2BP7A 5FWAA 1UEJA 1H1DA 4EW6A 1I6MA 4A2QA 5JT1A 2C8JA 2VYQA 1SA0B 5EIAA 2VDRB 6GPBA 4G1CA 1AMOA 1NJ5A 2B5OA 1JHRA 2BGIA 4UHHA 1Q17A 3KXLA 4PAMA 5DXJA 3FYSA 3ZGLA 1C3OA 5JNLA 5BW4A 2OAGA 1QQTA 2HV9A 1EJBA 1DRKA 2QUAA 2YOHA 3HDVA 3I0ZA 1P81A 3F5FA 3G3EA 3LQFA 5ILGA 3WIOA 1JU9A 1ULZA 2MINB 2SCUB 3AVQA 1JA0A 1PQUA 1VIMA 4L3VA 4ZEWA 4GC9A 1GQOA 3E84A 4W7IA 3VOBA 4RD4A 1TGVA 2C95A 2XUQA 4BP9A 4Z4FA 1PFYA 4ZGBA 4OBEA 4LWQA 3UAGA 1ZH8A 2QGNA 5ES3A 4EYSA 4YCDA 4HEQA 2HO4A 1AK9A 2YZ2A 3PVSA 4TKMA 1KOLA 3UBMA 4KQXA 1XCGB 3D3NA 5FEMA 2HHJA 4DQ0A 4DWOA 5JXHA 1ZEJA 1OJ7A 1HDEA 5AJYA 3OFVA 2JFQA 3V42A 4CDGA 3F5QA 4LF4B 4M1SA 1EUYA 5AOBA 3U7IA 2BSAA 3ZIUA 5FT9A 4DSAA 5I7SA 1E92A 1UODA 3W2TA 4LWZA 5TPZD 1U7PA 1WOYA 3PL5A 4NCKA 2P2NA 4XOUA 4EMTA 2MIIA 3GLIB 1FVFA 1QMPA 1MW8X 4HBZA 3SJCA 5AW3A 4EFKA 2WU1A 2ZTMA 1RQNA 3HXTA 4F2GA 4ZI3A 3SHWA 2RGNC 5HUJA 2AYYA 4RZ3A 1SVWA 4EYEA 1RHUA 2PNJA 1LDGA 2C07A 4B34A 1SKYE 2A9QA 2XGJA 1Z8DA 5JS7A 3QPCA 4H6WA 2ZBDA 5LOVA 1ZJYA 2H1CA 3AX6A 3UCEA 2ZSEA 3K5WA 5KYYB 5F4BA 1I94B 4ALLA 5I4IA 2XYRA 3C85A 4IZOA 2RGRA 3SE0A 2HD4A 1PTJA 2JARA 3KT8A 3UA4A 3VZRA 3DP9A 3CLKA 4GX0A 1ZRMA 1SG6A 3MA0A 2G0AA 4G5FA 4QHTA 2JIOA 4N48A 2WOOA 1VMIA 2PMDA 1KR5A 5ETJA 1GGEA 1LPSA 5G41A 3PLAE 5E7JA 2BFDB 1D4AA 2YKGA 5ENVA 2K2QB 4EB0A 4JBWA 2PWZA 2QZ4A 4PLGA 4TL9A 4Q12A 2OQIA 3KLBA 3JQFC 4MVJA 4QU9A 4Q4CA 2A67A 3KR1A 5JCJA 1XA0A 1Q91A 2WNHA 5KYNA 2ZJ2A 2FETA 2ERCA 1U3VA 1W6RA 3R0ZA 1ZS9A 5HUHA 5AICA 3QHQA 3FDFA 5IX8A 1CXZA 3ZDXB 2VHUA 3K0CA 3K1TA 4FOSA 4JB3A 4AMUA 3LT4A 1D8TA 2B3DA 3ORFA 1OILA 5LQCA 3LY5A 3AIOA 5CW1A 1PFWA 4M87A 5CRIA 2PUCA 1M1UA 4UUQA 4O2AB 1A4UA 2QN3A 1VB5A 3M6WA 2NLOA 1JWLA 2Q5IA 1LPOA 1ABFA 2JFBA 3EXG1 3OPMA 3QXCA 2P2CA 4WA8A 1H65A 3I9LA 4K2AA 1GUYA 1JHAA 1ORIA 2HRDA 4TS4A 3W1WA 4CQMD 2JJ8A 5K5EA 2QW1A 1ZNZA 3PUVA 3FA2A 4DLUA 1N7JA 5ELMA 4ENQA 1QHEA 1TT7A 2IUFA 4EF5A 1LSJA 5F23A 1U2ZA 1ZIDA 3LWZA 2EKZA 2UYGA 4OEHA 3ZWXA 2Y1LA 1EFRD 3HB4X 3IXMA 4P58A 5T6BA 5BVGB 1HK7A 3KTAB 4RABA 3RYCB 3MNFA 3LT1A 4O0MA 3OFND 2FQQA 4UTNA 4E4YA 2OV4A 1U6KA 1WULS 4I9FA 1OXSC 5CFOA 3BCUA 1Z62A 2ADOA 3FOBA 3JAWA 1W5AA 3NAQA 3RAGA 5JO0A 3BMCB 4N3CA 1E18A 3E1KA 2M6LA 3V2UA 1NC1A 1TF7A 2B4KA 3V7FA 3CLSD 4FB5A 4PX3A 1JVBA 3B3GA 5HKKA 1PIWA 2TS1A 2AFVA 3DEHA 2ONJA 2LKCA 1PYOA 4PBTA 2CSUA 1QYIA 2GLTA 2HDNB 4PSKA 2IYVA 2VT3A 4CQNA 1K3UB 1W88A 2BBWA 1Q12A 1U3DA 3EAFA 4EQ6B 1F1BA 4Z0HO 1UWCA 3QVVA 1ZVVA 5AUOB 3H6HA 2I7VA 1JAIA 2O8CA 5ALEA 4WVFA 3IUPA 3TLKA 5CDFE 3HSKA 3FOCA 5I4BA 5D6OA 1O6GA 221PA 3GVPA 3L7AA 4B75A 1I8TA 3JWPA 4DMKA 4WD3A 1FOEB 4MV9A 2F00A 2YQ4A 4CCWA 1XNRB 2F67A 2VHZA 2C8VA 2VPPA 3HDQA 3NEJA 4NFHA 5EN4A 2FPGA 2IHZA 2IU4A 1DT3A 4B3JA 2CNDA 1Q77A 2ZJ4A 5CCXA 1U2PA 5CH3A 3SZGA 3N0WA 1T3LA 5KQSA 3GPBA 2VHYA 4CMIA 1E9CA 4EFNA 5BXYA 2R1VA 2YFKA 3ONDA 2WJGA 4GECA 1F06A 3VC7A 3ZQ4A 1XALA 1MX1A 2FPXA 1Z5OA 4BVAA 4E22A 2GTHA 3W8EA 5KAPA 4EW2A 4BLWA 3E9MA 3N8DA 3WNBA 3EMKA 4HPJB 4E6EA 3CEPB 1UOEA 3R9XA 1PR0A 4C20A 1PQPA 1PFVA 3OWOA 4I55B 4F12A 3B52X 4NFSA 1RQGA 2C9OA 1Z17A 3H11B 2VDQB 1S3SA 1X19A 3QLVC 1F2UB 1W8DA 3RYIA 1AZWA 2RGCA 4DLSA 4OQYA 5CFRA 3INNA 2AW5A 5E2IA 1G5FA 3E3MA 2E4VA 3ABSB 3Q6NA 4N6NA 3RKUA 3RWBA 1T6YA 4CQMB 1C9MA 2X5NA 1TJ4A 1DAGA 2XZTA 3DC7A 5M04A 1WMFA 3LCCA 3B1XA 4FGUA 4LXUA 5I01A 1KIAA 2CFSA 4DDKA 2JH3A 2JI9A 1HGXA 4I5FA 4D6YA 3LY7A 1KJ9A 4Q21A 2JLWA 5TT0A 3CNNA 1X1CA 1QANA 2ZJOA 5K6TA 1CVRA 1Y1TA 3F2VA 4V0RA 2A4KA 3DOEA 1OFGA 3MWYW 1LLDA 2R7KA 4M9SA 4WPGA 3WHIA 4FZJA 3EEFA 3V80A 1ETHA 2QZ9A 4ZALA 3LECA 2PWAA 3NC4A 4DLVA 3I9OA 5F2OA 3A9VA 3AF6A 3IV6A 1I7DA 1K4YA 3AFGA 2ZWVA 1WUHS 4URUR 2JFYA 1GO2A 4QJIA 4XWWA 4EPRA 4QQNA 2ZULA 3U4AA 1L7OA 2GFQA 2NO0A 2P4EA 3BH6A 2XUKA 1OROA 1JFVA 5CLJA 3ZTWA 4ZOAA 1JJIA 5T64A 1JPNA 4JI2B 5TSDA 2FWJA 1ZRNA 4Z49A 1SD5A 5IARA 4J4TA 1UQTA 2E4YA 2QBYB 3DW1X 3EIFA 4NF2A 5JDIA 4X61A 1JMYA 3DHVA 2GKGA 3A4NA 1Z0AA 4OI4A 3QVSA 3T9EA 3BM5A 2VAXA 4FC6A 4TTAA 3VOAA 3AR8A 4OJTA 1Y1KE 2OZVA 4CCAA 9GPBA 1B4DA 1DINA 3BRSA 2R6DA 1DPFA 1L4NA 3NM5A 3TL6A 4KGDA 1KYXA 5DWDA 1Z5UA 2J3DA 1EFHA 3TOVA 1JR3D 1NU8A 1YJQA 2ZE5A 4Q1VA 4EKDA 3ABIA 3QQPA 4C6TA 2Y1KA 1SCJA 1N0HA 2HEGA 3DHYA 1FE8A 1L4EA 4MQ6A 4DMMA 5LA6F 4QDOA 1WQ4A 5K0SA 1PO7A 2BGMA 1IBCA 2FWMX 2JK0A 3T3HA 4CU2A 4PHCA 2B92A 1U0FA 1OTYA 1DUSA 2R8EA 2XTZA 3BIWA 1D7AA 1QCZA 3PGKA 4K9SA 3W34A 3ZHYA 4UPVA 1T1IA 5KJ1A 3LPAA 2R3SA 2PS1A 4LA4A 2FPPA 4XLZA 1JMKC 3QXSA 1TUGA 2J59A 3ADKA 3L77A 4EI9A 2OHHA 1CJVC 1WDKA 4H08A 4MCAA 1X7GA 3E4DA 3ZDRA 2ZANA 1C1HA 1FFSA 2PBFA 4J91A 3TL3A 1T2FA 2Y0BA 2PV0A 4CUKA 4KDCA 4HWRA 4CLXA 2RGWA 4UMDA 3MAGA 4A8HA 4I81A 1Q6ZA 1VBKA 1UFVA 5DE3A 2O07A 5DRTA 3PI6A 4PNHA 1QV9A 2JS7A 1NXPA 2WWXA 3TLCA 4CMHA 5LP6B 2QN8A 3KCNA 4XWYA 1J0EA 4DR7B 1SVKA 5HQJA 1W581 2RGXA 1VCOA 4PGMA 3AXSA 3DL7A 1CYEA 1ULTA 3AJEA 2VRNA 5A3RA 3MIIA 1NOIA 3NCHA 1KARA 3OIUA 3DDZX 4QOSA 5B2ZA 1AZSC 4KGXA 4CKWA 3HKEA 2IDKA 4E2FA 1NMSA 3GEIA 1IUKA 2XGGA 2V5UA 1NXXA 4ME6A 2GTPA 4H60A 1JDZA 1H1TA 2BHSA 2FG7C 2FZVA 2VDMB 3OURA 4G2NA 4Z54A 2HUNA 1XVVA 1Q0HA 1NRXA 4YPOA 5JQGA 3G89A 3PQDA 4POOA 4IFIA 1NBMD 3I2GA 3RUFA 4ALNA 4LTDA 3ZDFA 4A82A 2G9RA 2AMVA 2WV9A 1ZMOA 4QOEA 2AKEA 4CKZA 3O83A 3F49S 4RM2A 4NK4A 1UBTS 2PQ0A 1KK2A 4FZ3A 4CM9D 1HZJA 3OLWA 2JLBA 3WRYA 3RTEA 3CBGA 3KEFA 2PZLA 5MFPA 4X90A 1A9XB 1JQDA 3C5VA 1RBMA 1RCUA 4BNGA 5C53B 3GHHA 1DTWA 1RKUA 2B78A 5ALDA 1Y9AA 2HHHB 3DZCA 3CA8A 1CQXA 2LV8A 2OCLA 4G4JA 3KELA 3QNWA 3WG9A 5GIPE 3WAKA 2XUGA 1AUPA 2A9JA 3IDQA 4R8MA 4RANA 2JGAA 2PBRA 3B36A 3W9YA 2O50A 2BELA 4I4IA 4B6PA 5BWLA 2GCGA 5ECWA 2ORVA 4Q7KA 3UMGA 3TSYA 5ULLA 2WDZA 1L5OA 1QM5A 1RPNA 4M9CA 4C0JA 1L4YA 3RTBA 3HZZA 3NJ8A 4QTTB 5TPWB 4QUGA 3T7RA 1KK3A 4WY5A 4XIFA 1V37A 4N7RA 4DB2A 3EMVA 3R7AA 1GJRA 5LQDA 1PR6A 5L6LB 3W8NA 5IH7A 1P2TA 1YB5A 4EVRA 2RHDA 4U6QA 2RHCA 3IR6A 2E49A 2V1XA 3BL8A 4D4IA 3N39C 1OXTA 2XKJE 5EZSA 1HE5A 1XDBA 4HDAA 4XJSA 1W7AA 2IU0A 3O73A 1VTKA 2AWNA 4R2KA 2ZYHA 4RO0A 2B9VA 3H7IA 4DJ5X 2MSEB 3IMKA 1USUA 3OU2A 5JSHA 5EERA 3P4XA 2FUEA 1VBMA 3KQPA 3PEFA 1P33A 4NENA 4PNZA 3RPEA 1EQ2A 2HM7A 1FFAA 2PX6A 3DE0X 3GZTB 1FFBA 4FGKA 4PTZA 1Z2DA 4EB6B 1BE0A 1Y3BE 1SBYA 1YO6A 1L4BA 4AUKA 1AMNA 1CDEA 3ELWA 3FG9A 3MTIA 4IOLA 2OV8A 4BFYA 1J9ZA 3ZGOA 8AT1A 2R62A 3DYVA 3JWGA 2MMCA 3LRTA 3IOBA 1QKJA 5EZYB 1GPDG 2ERXA 4JLNA 4PO9A 4EFMA 2GD6A 3VR0A 3J81A 3A9UA 3DMFA 1IDOA 1CDOA 3FAZA 3WSTA 1P4JA 1TK2A 4KWIA 3EZ7A 2YWDA 4IIJA 3PGXA 2VF2A 4RMJA 4CM4B 2X58A 4DEXA 1TF5A 5IC6A 3GEDA 1KAOA 3ADBA 2EFDB 2X4GA 2NVBA 1J8VA 4ZVVA 1J2JA 4HYQA 4HX2A 5KX5B 1GZDA 4UVGA 2P7HA 4D8WA 1UBLS 1CUGA 2QX4A 4PU0A 1PI3A 4C7BA 1T5TA 2Q8PA 1RPTA 3PKIA 4YDQA 5B3AA 2VDPB 1RWBA 4CF4A 1YI8A 2QYSA 4DVJA 4FBMA 5IXSA 3TZ6A 4MSUA 2JIZD 1P7VA 4XYGA 3EXHC 2XCUA 3REQA 2WOJA 1KEEB 4TVOA 5HFNA 4C3VA 2VH5R 1GWNA 4YX9A 1SRRA 1B23P 2VHVA 4IXMA 1H66A 2P8SA 1V6SA 3FOFC 3TDNA 2BUBA 2OBYA 1PSZA 3BIXA 4BU0A 1TFRA 3V8MA 2NU6B 3DCNA 5KTSA 4BZQA 4BTVA 3E9QA 5JS6A 4JL5A 1ZVJA 4PM4A 4JYZA 5EMKA 1OKKD 2I3AA 1M9NA 1UPFA 2PZJA 2VN8A 2IEZA 3GG9A 3EWIA 4Q03A 2IE8A 1GFZA 2OUIA 5FBWB 3RK4A 4R9VA 4J0HA 4N6OA 1KKUA 2PUHA 4N3BA 1X0XA 1L5GB 4FFNA 1PJ2A 3QG5A 2RKOA 5TGDA 4IJKA 1GR0A 2VKQA 1E6EA 4C43A 3AY0A 4OOFA 5IYZA 2B6NA 4Y1RB 1FS5A 2WC1A 5H83A 2RHRA 2HXGA 4RSHA 2FW9A 4OHUA 3HS3A 4YAUA 1ODSA 3I6BA 1HQKA 1L8LA 1VRVA 4RVSA 3T0GA 1VXOA 2IC5A 2XQIA 4YROA 3CZAA 1GAWA 3T9BA 4RDCA 5GVSA 1M5UA 1HYEA 2PYIA 3NH9A 3QUQA 2ID8A 2XPCA 4GG1A 2OILA 4J0QA 4KO3S 4NBNA 3VR3D 4Y2QA 4BB0A 4P92A 3T7DA 1OA1A 1YR7A 5CCEA 3L0PA 1FPMA 1XMXA 4X5OA 2QUBA 2X0KA 3QJYA 5BSVA 1WUTA 1LFAA 4PZYA 4YJ2B 2QN1A 3AEYA 4FNMA 4GLOA 4PYNA 5ESDA 5H80A 2R9VA 3PNYA 1NR1A 3ND8A 1ENZA 3B12A 3G2MA 1HTWA 4NCXA 4F6RA 1V1RB 1W30A 3V34A 4EPYA 1JH9A 3U7JA 1K97A 2V6MA 4F5ZA 3O8CA 2JHGA 2ZJ3A 1N2CB 3H9GA 2DTEA 4LW8A 3Q3GE 3HWRA 2R2AA 3U44B 1T2AA 2OCAA 3DLTA 3IB3A 2NXJA 1J5XA 3EASA 3K9GA 1RWOA 4RHEA 4CN9A 4DZRA 5EFOA 3U4CA 2OGTA 3BMOA 1U8ZA 1P9OA 1RTKA 2GZHA 4MQ5A 2Y68A 3DD5A 3UCXA 4V1CA 1S1MA 2ZRLA 1H23A 1OH6A 1ONSA 3KPUA 5CLHA 1T5SA 3QVXA 2XCRB 3OZWA 1CY8A 1OSNA 2XF8A 1A4RA 4EHAA 4YASA 1MJGM 3BSWA 2X3FA 3QKSB 4CF5A 1T9HA 4MZDA 2JIBA 2WUVA 2ECQA 4XD2A 2J0QA 1N3YA 3IHKA 1ZJ6A 3N75A 2ZJYA 2A86A 4ZOEA 2GYUA 4IZIA 1DBWA 1H05A 1CZKA 4DSUA 2O2DA 1G8SA 4DSNA 4W5NA 1JIKA 4JKIA 4ZO6A 1UK6A 5TF4A 4EDFA 2AWOA 5DP1A 3W2EA 3PEVA 1G8JA 2F3RA 2AZMA 1IM5A 3GY0A 1LVHA 3ILYA 3Q85A 4N0QA 2DLCX 3D3JA 4WASA 2AFIE 3DR3A 5AKKA 2DY0A 4LZNA 5E4TA 5ES4B 2FH5B 1GQQA 4JBXA 4D4JA 4MVXA 1NKTA 3SBEA 1P29A 3FSGA 1YDFA 5FFFA 1P80A 4A2CA 5HCUA 5DPMA 1LJUA 1J7KA 4MWBA 1DCKA 5GMOA 4CIAA 3KTOA 2VYVA 3EVNA 2GPTA 4V0OA 4X20A 3RC7A 3AEUA 3KEQA 4DGSA 5LQKA 2LUOA 4J0JA 5KQMA 2ZGVA 1SURA 1GSIA 2D2VA 3L9XA 3RODA 4QE3A 4A6EA 2BGGA 1AM4D 4XIIA 3UIEA 2JLXA 4G01B 3ZPXA 1EQUA 1KEUA 3LF1A 1KMIY 2QT0A 1ENOA 2CXRA 2WHRA 4GMXA 1T2DA 4JUFA 5J58A 3G0HA 2V7TA 3UMJA 1Z2AA 2EGHA 1U2EA 1RKVA 2X2FA 3NB0A 3H5WA 2ACWA 4UTOA 4U8GA 5DSZA 1B16A 1I7PA 4GZMA 2ZRKA 5CPBA 5DV9A 4JD5A 2Y27A 1VKJA 1S7CA 4EG0A 1EG2A 2COKA 2ONYA 2D0OB 1NVBA 2ZWMA 2ZTHA 4KYTA 3DV2A 2Q6VA 3R9WA 3AHEA 3EQ9A 3NJ4A 2A8YA 5CGQB 3OZFA 4Y9SA 2YIDA 3GRFA 3HSYA 2ZS9A 4OY3A 2VJDA 3GVXA 1Q6YA 3LAWA 1A98A 4BJHB 2AXQA 3NDJA 2P3LA 1KDTA 2CLOB 5TLSA 3JYOA 3TM4A 3TTYA 1ELOA 4J0GA 1VZ2A 4GI7A 1OLSA 3A1DA 1WQ1R 1UXGA 2G88A 3F78A 1J0CA 4HNAB 1Z28A 3SI7A 5CB4A 2JAWA 3CVJA 3WK4A 2QE6A 1BHO1 3LF2A 1BS2A 1VI5A 2WWRA 3KD3A 1JHPA 3ZX4A 1HYGA 1XZNA 2RFLA 4OQMA 1HYHA 2YH2A 3GJQA 4MV8A 2UVPA 5ALUA 1CUBA 3TQSA 3PPIA 1GZ5A 3EZXA 3CJTA 2V3WA 4KKXB 1QX3A 1FP4A 3QVMA 1CRQA 1BAPA 3B6EA 4QPCA 4WN9B 3USES 5MGNA 2GYWA 1NRWA 1YRYE 1WHSA 2XGMA 3VZQA 4B33A 4B3FX 1SIOA 2G1AA 3U5TA 4TS1A 2E82A 2NPOA 5L40A 2PKRA 1C8BA 4MVJP 1D2HA 1HEUA 4B85A 2WZBA 1W93A 3CUEF 4JN6B 1RYBA 2VJLA 4LJ8A 4M0FA 1BEZA 1U2GA 1QGYA 1L3CA 2XWBF 4MUJA 4QASA 1VCHA 4FB4A 2YHAA 4CKCA 4YRTA 2QNIA 2REQB 2WJVA 3GRYA 3O91A 3FROA 3KB2A 2WUFA 3R6TA 2VEDA 3VR1A 1MNQA 1THMA 3SQNA 3KB8A 4X94A 1NW8A 4YJHA 1U5CA 1KR2A 3HCRA 4N3NA 4XDHA 5EHXA 3GOH<