3TWOA

The crystal structure of cad from helicobacter pylori complexed with nadp(h)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
347
structure length
347
Chain Sequence
b'MRVQSKGFAIFSKDEHFKPHDFSRHAVGPRDVLIDILYAGICHSDIHSAYSEWKEGIYPMIPGHEIAGIIKEVGKGVKKFKIGDVVGVGCFVNSCKACKPCKEHQEQFCTKVVFTYDCLDSFHDNEPHMGGYSNNIVVDENYVISVDKNAPLEKVAPLLCAGITTYSPLKFSKVTKGTKVGVAGFGGLGSMAVKYAVAMGAEVSVFARNEHKKQDALSMGVKHFYTDPKQCKEELDFIISTIPTHYDLKDYLKLLTYNGDLALVGLPPVEVAPVLSVFDFIHLGNRKVYGSLIGGIKETQEMVDFSIKHNIYPEIDLILGKDIDTAYHNLTHGKAKFRYVIDMKKSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannitol dehydrogenase
publication title Unusual NADPH conformation in the crystal structure of a cinnamyl alcohol dehydrogenase from Helicobacter pylori in complex with NADP(H) and substrate docking analysis
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 104
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.1.1.195: Cinnamyl-alcohol dehydrogenase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3twoA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3twoA01
3MTGA 4DIBA 1IE3A 4MVJD 1T2EA 3GGPA 2FY8A 1JKJA 1JWAB 1UP6A 2QRKA 3O26A 2TMGA 2BFOA 3PHJA 2VUUA 4BNFA 1JKFA 1K6IA 3F46A 3Q3CA 2HRBA 2NVWA 4HKTA 2EG9A 1YDEA 5F1OA 3UOGA 1N92A 4FBGA 4IS3A 1B8PA 2WYUA 1GQQA 1U9JA 3P5SA 4J43A 1V35A 4B4VA 4RDHA 3HFGA 1ISHA 1XQ1A 1A71A 3WOHA 1JTVA 3OJEA 4M8SA 4BVAA 4LVCA 3OF2A 5HBRA 3WSWA 2NU9A 1WDLA 1YL6A 1I2CA 3ANMA 2WMDA 3M1AA 2CMDA 4NH4A 2GERA 3W8DA 3H9EO 5LDHA 1T2FA 1PU2A 4DPKA 1IB6A 3GZNB 3VKVA 4KMSA 1H6BA 4BNNA 4E3ZA 3JYQA 2VUSA 3WGGA 2GN9A 4J0FA 1DSSG 4K6FA 2OP1A 3TZKA 3PYMA 3AUUA 1AN9A 4FGWA 3W4KA 2VHWA 1M66A 1CETA 4Q3DA 4ND2A 4GSKA 1U4OA 2A35A 3FNHA 1FF9A 2HRZA 4EEXA 3BMOA 2IEDA 1Z73A 2O3RA 1IL0A 1S7CA 4URFA 1Y6JA 2Q50A 2J8ZA 1LXCA 4W9NC 3U9LA 2O48X 4JK3A 1ISGA 5CG2A 3DWFA 1ZK0A 5JO0A 4AJ1A 2IEBA 4EUHA 2P9GA 5TS3A 5JDIA 3QWAA 2P68A 4TKLA 3GAFA 5JY1A 3L9WA 1V9LA 2JCYA 3HDQA 4GX1A 1SC6A 1VPDA 1P33A 1ZSNA 1GQYA 3O9ZA 1U3UA 3DMTC 3F47A 2WDZA 4JP3A 1I3LA 4UEOA 1T2DA 3RUDA 1PS9A 2JJYA 1KIFA 4IGEA 1ONPA 3TQHA 3UGKA 5IZCA 1E6UA 2PH3A 3ASVA 1ULSA 2ZKLA 3GVIA 3M6IA 2OGUA 2PKQO 4ZQGA 2EJWA 2WSBA 4PVDA 3ROQA 1X0VA 3T7EA 4BGIA 1YRLA 3L6EA 2VRCD 1A27A 1R6DA 4YRDA 3W6ZA 2QRLA 4NG5A 4MIOA 4Z0PA 1K3TA 4PLWA 3PHGA 4RVSA 3NT4A 2ZCUA 4L4RA 4WK6A 5B37A 4ALJA 2DPGA 3TPCA 3C7AA 4RZIA 1V0JA 1O0SA 4Q3EA 3JD3A 3WNQA 4IIUA 3DDNA 3D0OA 2X1HA 2J5RA 3DZJA 3BMCA 4AJNA 1N1EA 2E82A 2HK8A 1OFGA 2OO5A 4DMMA 1E7YA 2NWQA 2ZB8A 2B69A 4JJFA 3VDRA 2Y66A 4AJEA 4OQZA 4CLOA 4XX0A 4J7CA 1E3JA 4MVJG 1NBOA 1BWSA 2J3JA 3KSZO 4FSHA 5T57A 3JQ7A 4WLVA 1B3RA 1KVQA 3DOOA 2NVBA 4CQMD 5BSEA 3TDKA 1FXSA 2EERA 2Q4EA 4U6QA 4GGOA 5L7WA 3ZWBA 2DKNA 3K5PA 2C5EA 5JBIA 4RF5A 4GI2A 2FPGA 4HADA 3HQ4O 3I9NA 4Q3NA 4CMEA 4DC1A 5KVSA 1AXEA 4JNKA 3WYCA 3JQ9C 4GAEA 1UP4A 3I6IA 4GGPA 3ONEA 5ILOA 3R0IA 2ZTMA 4YJHA 1CQJA 4ND4A 5JS6A 1NHWA 1UXIA 3S2FA 3FNEA 1DRUA 1E5LA 1YB4A 3AM4A 1YB5A 3P7MA 4HUJA 4J4BA 1YVEI 1ZMOA 3HE3A 3LSYA 4KOAA 1MB4A 2HAEA 4LCEA 3WQSB 2GD1O 2HDHA 4FC7A 1BHSA 1PS8A 1VLLA 2FPIA 2O3QA 3RVDA 5I8WA 2GUGA 4RVFA 2EF1A 3JQ8B 3DBRB 3JD4A 1O95A 3LDHA 3AY7A 3ZU3A 4CV0A 3QY9A 1AXGA 4R9SA 4UVDA 1M2WA 1K0UA 4M55A 1Q7BA 4BO0A 2NTVA 3RUAA 4Q3BA 4WNCA 4Y6PA 1U4SA 2D5AA 4IDEA 4U6SA 4AJJA 2DM6A 3DHYA 3BTSA 4U8GA 5BSHA 4YAGA 1R4NB 4RO0A 3FI9A 4H16A 2B4QA 4BNXA 3WIDA 4DLBA 1UDAA 3WIEA 4PLVA 2D3TA 3OIGA 4H3VA 1VM6A 4OXNA 2Y0EA 4B3IA 3EVNA 2Q2QA 2P2SA 3AOEC 2ZYGA 3LF1A 1NYTA 1P0CA 3BMQB 4RVDA 1HT0A 4ZVVA 5IXSA 3CPSA 4UUPA 1E5QA 2JCVA 3EHEA 4IJWA 3WMXA 2AG5A 4KQWA 1NPDA 1HDZA 3WFJA 1DC4A 2VNSA 4O1MA 5CFZA 2Q1UA 1ZJYA 3DAFA 4AICA 1LDBA 1MP0A 4OIMA 4XWYA 4CM9A 1TI7A 1LJ8A 1WLYA 3NAQA 3NTRA 4P8RA 5T64A 3UCFA 1C1DA 1PJ4A 2O3UA 2YW9A 1DIHA 3VOSA 5JDIC 3MCVA 1QSGA 5L4LA 3G17A 3ZNNA 1X1TA 1YL7A 1LA2A 1DJNA 1H6CA 5HS4A 3L0DA 2P5UA 3C3XA 3ZDFA 4N5LA 3MTJA 2HLPA 3N7UA 3MWDB 3BTVA 3RUIA 3I9LA 3FNFA 1PGJA 3N58A 1KVSA 1UAGA 4W6ZA 3NGLA 4MP8A 4BIIA 1JAXA 3IMFA 4DQXA 1VL0A 5BSGA 2DC1A 5JCJA 1YE3A 1I3NA 3OJOA 4EJ0A 1G6KA 1HDGO 5TSDA 2JD0A 3A9WA 1YOVB 2EKLA 1K5HA 1XEAA 2WE8A 5ITVA 1O89A 1O5IA 2P9CA 4ALMA 4JCOA 3DL2A 4I9NA 3WGOA 5KCZA 1PGQA 3D5TA 1ENYA 1WWKA 4UUOA 3TN7A 4HFJA 3EC7A 3RAJA 4IJUA 3JYNA 2E6UX 3PRJA 3QWHA 1YXMA 4ZQFA 1ONNA 4H15A 2X8LA 4WEOA 3Q2IA 3GVXA 4O59O 2Y1FA 1VSUA 2AA3A 4IMPA 2FR0A 2ZIZA 1OZAA 1P1JA 5COBA 3C7CB 3C7DB 4BKOA 1KEUA 4AL4A 3FHLA 4NR0A 2B4RO 1GFSA 3MJCA 3IOYA 1ZK3A 4PZDA 3OIFA 3S1LA 1LSJA 4ESOA 1Y9EA 5TIIA 4FJ0A 1WXDA 4A0SA 4KUEA 4ALIA 4TRRA 3FR8A 3KETA 3DEYX 3KYCA 4LGVA 4WLUA 2Y0CA 1GTMA 2WYVA 5AOVA 5FFFA 3WTBA 2YQ4A 1T25A 1CERA 4CL3A 1AUPA 4MIEA 1FDUA 3UH1A 2H5LA 1VKOA 2WM3A 3JQDA 4RV9A 3S8MA 1H2BA 4E12A 1PGOA 2Q1WA 1I01A 1HWYA 2DBZA 1GUYA 3EVTA 1E1KA 5L3ZA 4XYLA 5EIOA 1GQ2A 1BXGB 4AJ2A 1Y9AA 5DCWA 4OKIA 4A27A 5JCXA 4BNTA 1X1EA 2RHCA 4KWHA 4IDAA 1LC3A 3I6QA 3ZWYA 1N8KA 4FD3A 5JYEA 5KJCA 3X2EA 4I9UA 4PLPA 4CV1A 3VH3A 2I67A 1X7DA 4GX2A 1P1FA 4NBRA 4BNMA 4XGIA 3LU1A 3W4IA 4CMIA 4IDBA 2C7GA 2PTGA 4IJKA 4Z3KA 4OAQA 2Q2WA 3GR6A 3GGOA 3O03A 2VHZA 4PRKA 4JROA 3WX0A 4ZN6A 1R4MB 1AGNA 3EY4A 2C0CA 3FTPA 4XYEA 4BO8A 5DP1A 5IDYA 5LCXA 2EW2A 9LDBA 1YQDA 3A1NA 4RLSA 2EHDA 5KTKA 3JCZA 3L4BA 2W4QA 2A4KA 2NADA 3WGIA 2LDXA 1NXQA 5DF1A 1LSUA 3OIDA 1VL6A 3DHNA 2VYVA 1NR1A 3IL2A 1MC5A 4NMHA 1ENOA 3OEYA 2CSUA 3ZH2A 5THKA 2DU8A 1IPEA 1DEHA 2VCYA 3O8QB 4Z0HO 5FWNA 1E7SA 1YS4A 3SJUA 3PQEA 3GA0A 2IDZA 2BMAA 5AQ1A 2HMVA 4EGFA 3JQFC 2QYSA 4XIJA 4BNJA 1LLDA 4C4OA 3ETEA 1ONOA 4A2CA 5G0VA 4IGFA 3RBVA 1DRVA 2H9IA 4FN4A 3GZNA 5I7SA 4BS9A 2P91A 3H5NA 4ZHSA 4PGFA 7MDHA 2Q46A 2CZCA 3PGXA 1ML3A 2RH4A 4AVYA 5A1TA 3QV1A 3D3EA 4MVJA 4E2XA 4RPHA 5IFLA 1E7QA 2HK7A 1HE5A 1PZEA 2VRBA 4D46A 1P31A 4HY3A 3MOIA 3AU9A 2DLDA 1Q7CA 1GYQA 2DBQA 4UVGA 5DBIA 2YZ7A 1N1GA 4IY1A 3TWOA 2EKPA 5KIAA 3GPIA 1SNYA 2WTBA 1DFIA 2EJVA 3AFMA 4XGNA 1T4DA 3SX2A 5I9NA 5TF4A 2VHXA 3UFXA 3BZUA 3PDJA 1DIRA 3V2HA 1VRWA 4ND3A 3K8ZA 2V6MA 3RUFA 4DQUA 1LX6A 4MVJI 3I9OA 1EVYA 4FGSA 3ICPA 4FOOA 1G0NA 1KY5A 4D44A 1E1LA 1GUFA 3AUSA 5EERA 3GY0A 3ULKA 1KERA 1BVUA 4QO7A 4A73A 1OBFO 4CMHA 3JD2A 2CD9A 3KM0A 3E6AA 5CEJA 3OFSA 3UVEA 1ADCA 1HYEA 2JHGA 1ZW1A 3EAGA 3MJTA 4E5PA 4NBTA 2WD8A 4PLCA 3S2IA 3W8EA 2GDZA 4I8XA 5K6AC 3HSKA 3GH3A 2QRJA 4A7PA 1P45A 2Y0DA 4ND1A 2G17A 5TX7A 3CE6A 3KLMX 3E9QA 2EP7A 1YL5A 1QYDA 3FRJA 3VVCA 4YAEA 4DXHA 3NYWA 4OGWA 2OBNA 3TZHA 4R4JA 3TL3A 2QX7A 3SXPA 5I7VA 3CZRA 1EK6A 1N9GA 2YV1A 1JVSA 3ICCA 1C1DB 2BD0A 1T2AA 4ZD6A 4GWKA 2C54A 1T1SA 4YT2A 1Q7GA 2PKQP 3NT2A 4I5FA 2C82A 3OEWA 2Z1MA 3FN4A 4D0SA 2PGJA 2GN6A 1BG6A 4CL8A 9LDTA 2VOJA 3OECA 1LDGA 1R0KA 4WE3A 1EK5A 4BHTA 3EDMA 4OMUA 1CRWG 2CDBA 4BNGA 2X5JO 4TRNA 3C24A 3T4EA 3V5NA 5I7FA 3E82A 3F5QA 5ADHA 3R1IA 4X54A 1SB9A 1YONA 3H4VA 3AOGA 3ITKA 2O4UX 1ZEJA 2DBVO 1ZSVA 3HADA 2QW8A 4R54A 4YTEA 3RJ5A 3D4OA 2VRCA 4AFNA 2HSDA 2C7VA 3PP8A 3RUEA 3N74A 3SC4A 1HXHA 3GG2A 2X0RA 2EW8A 3GG9A 5JXWA 1RM0A 2UDPA 1SZJG 5CPFA 5AXCA 4WNIA 2QZZA 3GGGA 1PSDA 3FR7A 3GDOA 3ORFA 1J0XO 1Q0LA 3DMYA 3QA9A 4MINA 1RJWA 3NJ4A 2O4CA 3W8FA 3BHJA 4GLOA 3HN2A 2PGDA 2ZTLA 2PWZA 3RKUA 4BKRA 1N7GA 3PQDA 4XEHA 3U3XA 3HFSA 3PTZA 1ZO8A 2NU8A 4PG6A 3EGOA 2X0NA 3DBRA 5CEEA 1A5ZA 1MUUA 4GLLA 1XIVA 4MDHA 4BO7A 3PQFA 1SAYA 4HX5A 1QYXA 2OUIA 3INTA 5CEFA 4RF3A 1U3VA 2E4AA 1GYRA 4J2HA 4YCAA 3VZQA 4CQMA 4BKUA 2X7HA 2J6IA 2O50A 4FW8A 2HMSA 4IZHA 4I08A 5CPBA 1Z75A 3LLVA 2XXBA 1IPFA 1A4UA 1R4NA 4BO4A 4FR5A 4OYRA 3RSHA 3RFVA 5ITWA 1HDXA 4GKVA 3E8XA 3AU8A 2YFHA 5JAIA 2X86A 1JAYA 4J4HA 5G4LA 4QEDA 1E3WA 4YAJA 2BKAA 3PWSA 4DBVO 5JYDA 3DBLB 2YHUA 5CHEA 5JC1A 1JLLA 5K1SA 5DBGA 1NQTA 3BMQA 3PIDA 2VWHA 4UEKA 4CLHA 4WJZA 3E1KA 2HK9A 1LEHA 3UUWA 4D7AA 2J3IA 5JNLA 3M1LA 5DCUA 2BF7A 3E9MA 3DFUA 1EUDA 2X23A 1PJCA 3DO5A 3H5AA 4PCVA 4YBZA 1VL8A 1LLUA 1HDRA 2FZWA 4XJSA 1YQXA 4O6VA 5CDGA 4U0JA 3C1OA 3GN2A 4G65A 2GN8A 1N2SA 3BHIA 4MVJF 4ILKA 3DZGA 3RBXA 4GVLA 3LF2A 3PZRA 2A92A 4R9RA 2V6FA 4M86A 1MG0A 4L75A 1BTOA 1UXJA 3ANNA 1UXGA 4DYVA 3JYOA 3RUHA 1ISMA 4QO8A 2IRWA 3BIOA 4CR6A 4DGSA 1XLTA 3B1FA 3Q9NA 3HB5X 4BKPA 5K0ZA 3K2BA 3LLSA 1SEVA 1VJ1A 1SB8A 4NZ9A 3GMDA 1DFHA 4EJMA 5CG1A 4BKQA 5L7TA 2BHLA 1KVTA 1EUZA 3FF4A 4Q3CA 1OI7A 2VQ3A 2NLOA 5JDCC 2E49A 4DLAA 4XCVA 4LRTB 1R0LA 3WMWA 3WSVA 3GT0A 5TC4A 3GNQA 4XD2A 4PG4A 1QV7A 1X14A 1NQ5A 1ZMTA 3NX4A 5DOZA 4NI5A 5G2OA 4BNYA 5C7IO 4TKMA 2R6JA 4WCFA 1QKIA 1E1MA 1YOVA 5I7EA 2Y1EA 3NDIA 4DRYA 3NDRA 3HZZA 1LRKA 2ZB3A 3U49A 1IZ9A 4CM4B 1I32A 3CIFA 3OJ0A 4HBGA 2OORA 4CLXA 4PLFA 2PV7A 1QXSA 2B83A 3QLJA 2B5WA 1E6EA 2Q99A 3F3SA 3B6ZA 4XA8A 1VJ0A 3F4LA 2AEJA 4OOFA 1XU7A 1WP4A 2JHFA 2ZYDA 1GAEO 3RKRA 4OKNA 4RPKA 4YRAA 4KQXA 1O9BA 3PYLA 4C7JA 3RC7A 3GUCA 3FTNA 5ILGA 1OMOA 1R15A 2D59A 1DHRA 4ALLA 1RM5A 1IYZA 1BW9A 1XHLA 4IUYA 3SJ7A 2Z1NA 5T8KC 3F6YA 3HUDA 4BNLA 1EVZA 4WEQA 1ENZA 3K6JA 5IDWA 1B15A 4FJ1A 1BGVA 4PG5A 2BFPA 3RWBA 1D1TA 1NQAO 5KVQA 5U1PA 3F1KA 3K96A 2FOIA 2ET6A 3QQPA 3H2ZA 3ZWPA 1BXGA 1E3LA 1DBVO 3L07A 1FMCA 3IP1A 3G3EA 3V2UA 5FEUA 3PIIA 5G0SA 2CVQA 3INGA 2X6TA 5BT9A 1MX3A 4P4GA 5H81A 4EJ6A 2R00A 3L6OO 4J2OA 3OH8A 1UP7A 5ENDA 3W4JA 1YKFA 3DZIA 1FK8A 1EQUA 3QVSA 3TNLA 1N7HA 1TXGA 3AM3A 4RORA 4BNZA 1CWUA 2PA3A 2ZQZA 3PLRA 1X7GA 3WQQA 1R4MA 3JD0A 3QRWA 4TVBA 2OL4A 4BB6A 1PQPA 1MXHA 5CP8A 2D4AA 1N9GB 3PFFA 5BNFA 2JCXA 1OAAA 3HDJA 1UXHA 4LN1A 5A02A 2UVDA 2A94A 2JAHA 2CVZA 4ZRMA 4FIZA 4M1QA 4HFNA 2YDYA 3NKLA 5FI3A 4ZJUA 1NX6A 3WICA 3V2GA 1SEPA 3ZWMA 4BNVA 4W82A 2I65A 4WPGA 3TF5A 4CR7A 3ST7A 5EMHA 1U2GA 3IDSA 4FFOA 4B7CA 1V3VA 2GRAA 3ETDA 4NFSA 1KY4A 2GLXA 4KDFA 4PG7A 3ZZNA 3O8QA 4LISA 3WS7A 3G79A 5F3RA 5MGBA 3GVCA 4CLDA 3LC2O 1TT5B 6LDHA 4OSOA 3STHA 4FCCA 2AE1A 4PRLA 3CINA 3DR3A 3UN1A 2X5KO 3WQRA 4LK3A 4B4UA 1AHIA 2JD2A 2DUWA 1R0SA 1RYEA 1GL3A 2D1YA 4D45A 5F1PA 4BO6A 3H3JA 1HYHA 3E03A 3PVZA 3RBZA 3ROKA 2EP5A 1I10A 5JW6A 2AXQA 1C0LA 2WYWA 1B7GO 3KRTA 3D4NA 4K26A 4EW6A 3CMMA 3HHPA 2FR8A 2NU6A 3GOHA 1U7TA 1X7HA 1LC0A 3OA2A 3VKUA 4IIVA 1TEHA 4CV2A 5T67A 4KTVE 3G1UA 4PZEA 3IIEA 4YJGB 1F12A 1ID1A 2PR2A 4XQCA 1A7AA 3WLFA 4BL5A 4RDIA 4CM8B 5B4UA 2PY6A 4BO2A 2IXAA 2NVUA 4YQZA 2OZPA 2CUKA 3GF4A 4XB1A 3D64A 4NJOA 4BUCA 5A4DA 1L7DA 1Z82A 2QQ5A 3P2OA 2CFCA 3CEAA 5K9ZA 2IODA 4CQMB 3ZW8A 2YYYA 2NU7A 1PQUA 4IDCA 1GU7A 4UEJA 3IAHA 4KUHA 5EESA 3KLPX 4R3NA 4NQZA 4J1TA 1H94A 4I5EA 2YHIB 4QFDA 4XYBA 4N18A 3VAZA 3D4PA 3W1VA 3JYLA 2VHYA 1SBYA 3DBHB 3H9GA 2EEZA 5GMOA 1IHYA 4BO9A 4AJHA 2Y67A 1JQBA 4B7XA 4FFNA 1RWBA 2B0JA 4IJVA 4II2A 2NUAA 3HDYA 4UUNA 1E3WB 2B5VA 4RVUA 1R66A 2W98A 4DIOA 3QP9A 1ADFA 1HKUA 1PL6A 3OHSX 1B16A 3U62A 2ZJ0A 4Q39A 5TRTA 3SVTA 3FPCA 3I4FA 3ZWCA 1JVBA 4O0LA 4I5DA 4E13A 4NU5A 3IKVA 1K2WA 4YJFB 4MOWA 3F9IA 4CMBA 1PWZA 4CUZA 4JX8A 4BGUA 4EI2A 1ZXBA 2FZEA 4NIMA 2BI7A 3E5RA 1GD1O 1LDEA 4GMGA 1E6WA 1WZEA 3VDQA 1I3MA 4RPJA 4Z3DA 1VC2A 6ADHA 3QVOA 4Z9YA 2PNFA 2VTDA 5CAEA 3OICA 2GR9A 1PZFA 5DOVA 4ZQBA 4AJLA 1J49A 4LW8A 2YY7A 1C3VA 1DOHA 3JQ6A 3R3SA 4J7XA 2PK3A 3RJ9A 1QLHA 3P2YA 1ISFA 2BELA 2EXXA 4DL9A 2JFHA 2GNAA 4GX0A 4FS3A 5IZCC 1I30A 5L53A 3K30A 3I5MA 2AQ8A 3JQAD 4PLGA 3DOJA 4QTZA 3S2GA 2J3HA 3GUYA 3ADOA 4E2ZA 2R00C 3UKOA 4WCFB 4XDZA 1H5QA 4AJIA 4L74A 1DJQA 1YWGO 1H6AA 1PJSA 1HRDA 3DXFA 2WD7A 4NJMB 4UAGA 5A9SB 1B8VA 3WTCA 4PN3A 1P77A 1ZBQA 1J6UA 1RYDA 2O2SA 2Q45A 5TLSA 4A5OA 1AHHA 4U0KA 4WLFA 3BA1A 3SLKA 4JIGA 4WLNA 1HE2A 2ZYAA 3VPSA 1GCUA 4RPLA 1F8FA 3ZV5A 1H6DA 5THQA 1EZ4A 1PJBA 4FJ2A 4NFHA 2QIOA 1P74A 3PYXA 4BO1A 1DIAA 3EZLA 1EVIA 1P1RA 2JFFA 1ZZEA 2H1SA 3UW3A 1IHXA 4BMNA 2IE0A 1F0YA 4IZIA 3SC6A 1S6YA 4Q9NA 1YBAA 4Z6KA 3GVHA 4YT4A 3DZFA 5F21A 3GC6A 1KEPA 2V6BA 3NTOA 1L7EA 3ZHXA 1BW9B 1LQTA 1WPQA 4E32A 2HMUA 3OA0A 4A10A 3PJGA 1SOWA 2RCYA 3MOGA 4QX6A 3BTUA 1YJQA 3EW7A 4WOKA 1FDSA 4E5YA 1GCOA 1NP3A 3H3FA 2AEMA 2BRUA 4CMEC 1E92A 4TZKA 2C29D 1EFLA 4OQYA 3KEOA 4P4LA 3CMCO 2BGLA 3GNSA 1XGKA 1IY8A 3NJ8A 1P1IA 2QYTA 4OOEA 4Z0TA 5G0TA 3VH1A 1F06A 3X2FA 4J1QA 3LVFO 4YAKA 4J6FA 1YDWA 3U0BA 1WDMA 4LRSB 5HRUA 3DBLA 1CYDA 3GRPA 2B37A 4BV8A 3DOCA 4R1UA 4YYZA 3TZ6A 1DPGA 3TFQA 3WFIA 1Q2XA 1KETA 2FPPA 1XWFA 4RF2A 2GF2A 1PQWA 5TT1A 2DQ4A 3V8BA 2G0TA 3JSAA 3E18A 4J9UE 2C20A 2FMUA 2RHRA 2IZ0A 5KWEA 4L0QA 3ZV4A 3WNVA 5IJZA 5DULA 3PDUA 1DLJA 4ND5A 5DP2A 2RBEA 4AJ4A 1C0IA 4BNKA 2VNAA 2POQX 4BNIA 2ZB7A 3RQSA 2J3KA 2PD4A 1DRWA 4TRJA 3KOUA 3WGYA 2AQHA 5ICSA 1VI2A 4XQGA 3VPGA 3BAZA 2AW5A 1U5CA 3JD1A 1OOEA 4KDEA 2O3SA 1V3TA 4CJXA 1HL3A 3OBBA 5T5QA 3L6DA 2Y68A 5TJHA 4ALNA 3DAPA 2SCUA 3COSA 2IZZA 4GMFA 5KKAA 1GEGA 3ZCXA 3RROA 2I3GA 1KEVA 4MVJH 5AXDA 1RM4A 3WJ7A 2VHVA 1UZLA 1EE2A 3FPLA 3JV7A 3ONDA 4N7RA 1PL8A 4E33A 5IDXA 4AG3A 1Y81A 4J16A 2D2IA 2X9VA 4GQAA 4CM4A 5CDUA 1GPJA 5IXYA 2XPCA 1DHTA 3ITDA 2HKIA 4BGEA 1ARZA 4UVEA 5BSFA 1PR3A 3GVPA 4HWKA 2Y93A 3TOXA 4ZA2A 1UJMA 5IZ4A 4XYMA 2WE7A 1XR3A 2AG8A 2ZK7A 5TGDA 1SCUA 4WLOA 4DPMA 3MZ0A 3E5MA 4QT0A 4MP6A 1K6XA 1BDMA 5C37A 3U4HA 4FFRA 1B3BA 2FSVA 2V6GA 2NVUB 3T4XA 3ABIA 4MVJM 2IYPA 4ZICA 1Q0QA 1XKQA 1T2CA 1NVGA 1QYVA 2GSDA 1Y5MA 2PZKA 3F4BA 3L4SO 3VH2A 5BNIA 4QFCA 2I66A 4C7KA 5G0UA 3RU7A 3VH4A 2FSSA 2FR1A 3A28A 3HB4X 5F5NA 1QMGA 5DDIP 4D43A 4UVHA 2GZ3A 1PJ2A 4B4OA 3HN7A 1BMDA 3RASA 5JMWA 5IF3A 3ON5A 1PIWA 4DPLA 4YB8A 1F8GA 4BNHA 5T6BA 4LSWA 1ADBA 4FC6A 2O23A 3O4RA 2D0IA 2EGHA 4EUEA 4J1NA 2Q4BA 3AI3A 3KTDA 3KYBA 4K6CA 1G1AA 1XSEA 3JQCA 3I83A 2PKRA 3RC9A 3WGTA 2H6EA 4FPXA 2NTJA 4IM7A 4IXTA 4NU6A 4NHEA 4K1LA 3TL2A 1A7KA 4L4XA 4P22A 2NV6A 3FWZA 2FP4A 3ONFA 3WBFA 4E2YA 1MC4A 1LLQA 5GZ3A 2ZTVA 2VYND 2YQ5A 1YQGA 1BXKA 2OOSA 4DWVA 2DTEA 3P19A 3PHHA 4CR8A 1ZXLA 4CQLB 3PLNA 2BH9A 4OXYA 1HE4A 3GPDG 5H82A 1ADGA 1GV1A 1LDMA 3UCEA 4Y98A 2E37A 2OHXA 5KJ1A 3EK2A 3HWRA 3VPFA 5DZSA 3RCBA 3WLEA 3NGXA 1JW9B 4GL4A 1HETA 1T1RA 2X4GA 7ADHA 3KXDA 2W2KB 3CKYA 2ZJ1A 3GFGA 1TB4A 1Z7EA 1JDJA 1LU9A 2I3AA 5G4KB 3VPXA 3HJAA 1Z6ZA 2C59A 1TT5A 4R41A 4YXFA 1NASA 3LT2A 2WD7B 3JQBA 3B1KA 1H9AA 2OXIA 3RC1A 3TZQA 2UUPA 3SEFA 2X9GA 3KYDB 1LDYA 3VTZA 1Z45A 2JL1A 5A05A 1K6JA 3JTMA 1ENPA 4CM5A 5EQFA 1JU9A 3ENNA 3DMTA 2EGGA 3L4BC 3D5QA 3AY3A 5A04A 5C7OO 1Y7TA 2B4TO 1MV8A 1U7HA 2BGMA 5A06A 4GPD1 4YJGA 4MJLA 3GQVA 5U9CA 4R3WA 5KVCA 4CM8A 4Y67A 4DBZA 3DFZA 1TVEA 1NPTO 2LDBA 3KZVA 1Y8RB 1I24A 3U4DA 1YB1A 3CXRA 4D3FA 1MFPA 4CMAA 4E0BA 3ZWWA 3PFWO 5JAMA 3G1TA 1DLIA 3RI3A 3ZHYA 1D7OA 5LC1A 2VN8A 3DTTA 3I9MA 1DO8A 4XJTA 1R37A 2WJPA 2YHIA 3LC7O 5KVVA 2ZQYA 1H2HA 4JLWA 3DBHA 3VHRA 5BQFA 1P0FA 2I5PO 2Y1GA 3Q9UA 5AYVA 2DPHA 1YH3A 1X0XA 3VTFA 3OSUA 2GZ1A 3H2SA 1K89A 1PGNA 4J90A 3AFNA 5EINA 4DIFA 4CMKA 2EKQA 4IXWA 3GHHA 3ZWAA 1KOLA 1ZCJA 3AI2A 4OXKA 2C2XA 3FWNA 3MJ4A 3PHIA 1WZIA 4YJFA 5H83A 4IINA 3IC5A 3BYZA 1ZK1A 2X0IA 4IQGA 5AXAA 4E5NA 2CNBA 1Q1NA 4IS2A 5LDGA 2Z5LA 5ER6A 2P5YA 1WMAA 3QW2A 1YBMA 4XRGA 2CVOA 4DVJA 1V8BA 1CIVA 2XF8A 3QVWA 4PG8A 2Q1SA 3PI7A 5I9MA 1T4BA 1U3TA 5JE8A 3AY6A 3C1TA 3JQ9A 5JO9A 3ROPA 2DFVA 5B4VA 5IN4A 1FDWA 4RL6A 2GN4A 1XU9A 4D3SA 4YAIA 3GEMA 1X15A 5AXBA 2UV8A 1KS9A 1I0ZA 1PJTA 1T24A 2NQ8A 5G0WA 4YT5A 3F1LA 4BV9A 2FHSA 2PZLA 4FFLA 1YO6A 1GADO 4R68A 1R12A 4PFJA 3Q2KA 2C5AA 4MKRA 3WGHA 1B2LA 4R51A 1B0AA 4BQPA 2RH8A 3R3JA 2X22A 3QWFA 4ALKA 5DNAA 4RJTA 3HG7A 2TMDA 3PXXA 1I8TA 1EUCA 3TFOA 4ZRNA 5CDSA 4NJMA 2QHXA 3WR5A 5A9SA 1HTBA 1A9YA 4KP7A 1ZIDA 2UAGA 1GZ4A 4CM6A 3I23A 1UR5A 4NNJA 2W8ZA 4DMLA 5DN9A 1E3IA 2NTNA 1KVUA 3V1UA 1HDOA 3DZKA 3C1AA 3KEQA 4G2NA 4TVOA 3SBOA 1UXKA 3WYBA 5TJ9A 1NR7A 4BMSA 2JFGA 1EBFA 3ASUA 1UDBA 2WWRA 3AI1A 4R5MA 4Z9FA 4EYEA 1VKNA 4O63O 2PGLA 4MP3A 4PLZA 3QWIA 1M6HA 3GDFA 1LQUA 1PR9A 4E4YA 3HDHA 3BMNB 4WCDA 4MKXA 4J4TA 5JAZA 2Y1OA 4IMRA 3H6KA 3ZGYA 4AJKA 3QSGA 4F3YA 2P4HX 3AOEA 1TLTA 2EWMA 4J1SA 4JJIA 3D1LA 4B79A 2B36A 3WBBA 2IYOA 2V7PA 1C0PA 1NQOA 2OMEA 3GK3A 4CMJA 1DC5A 2YUTA 4QQRA 5I9LA 4M49A 3V1YA 4EZBA 5C3MA 4R16A 4OH1A 1M6WA 3JQAA 1ZK2A 5CDTA 1NPYA 3WDSA 3JQBC 4INAA 1XCBA 1YGYA 2VZ9A 4WECA 3Q6IA 1QRRA 1FDVA 3SLGA 3A4VA 3FNGA 3IJPA 2Y1DA 4RQTA 1HSZA 4BNUA 4WLEA 1MGOA 1GEEA 3MJVA 1JKIA 4GWGA 1GDHA 4S1VA 1BSVA 1DDOA 1C0KA 4CMGA 3D3WB 1CEQA 5L45A 1PJ3A 3QJ5A 4IQ8A 5I8ZA 4CODB 4LCJA 5U4QA 4B8ZA 3O38A 1H9BA 3BXXA 4OL9A 5CDYA 1D8AA 1P1HA 4CUKA 1VSVA 2PD6A 2QZ9A 3FBGA 4RZHA 4B3HA 3ZU2A 3PEFA 1M75A 2DTXA 2AEFA 4BMVA 5FYDA 3I9KA 1EDOA 1C14A 2VTEA 3NDJA 4E5KA 5L95A 1O94A 2R2GA 1GPDG 4E31A 2HJSA 2PFGA 5KJFA 1KYQA 4P4NA 1QP8A 2C2YA 2VUTA 4R1NA 4B4WA 4F6LA 3C85A 4PZCA 3C8MA 1E1NA 3GEDA 3I4CA 2J5QA 1PEDA 5JFOA 3WG9A 3VPHA 3ADPA 2JKVA 3OQ6A 2GYYA 3U4CA 8LDHA 1U28A 5BNTA 4ROSA 1XA0A 5ICMA 3CTMA 4XZ3A 1JWBB 3KVOA 1HE3A 1NAHA 3QHAA 4JQCA 4OJNA 1FDTA 1QLJA 4TSKA 5EPOA 3WB9A 3ZU5A 2PH5A 1N5DA 4ZQEA 3B70A 5DT9A 1RPNA 3GZ4A 3OETA 4NFYA 4E30A 5A5EA 2GPTA 4W7HA 2VWPA 3EUWA 3KUXA 3NTQA 3DTYA 4A03A 4GBJA 1KC1A 3ZWXA 1MFZA 1IOLA 3H7AA 3DB2A 5F5LA 3GHYA 5MDHA 1CDOA 4B7UA 1P44A 2G1UA 1ZH8A 5ER9A 1DAOA 4J49A 2YV3A 1ZUD1 2NSDA 1F17A 2NACA 3AWDA 1U8XX 2FN7A 2AE2A 2X58A 1Y1PA 3LQFA 3Q0EA 3LYLA 4YJDA 3H65A 4MO2A 4XDYA 2XXJA 3KO8A 4I5GA 4YR9A 5AVOA 4NBUA 1SPXA 2Y05A 2JD1A 2W2LD 5B12A 3K31A 1UAYA 1EQ2A 3D7LA 3CH6A 1FJHA 4YT8A 1PL7A 3TOZA 5HM8A 2GASA 2PLAA 4JJGA 2A9FA 4RVGA 1I33A 1WDKA 1BDBA 4GX5A 5JC8A 4HXYA 1LNQA 4WCFC 3PHLA 3ZWOA 1ZFNA 3GEGA 3OMLA 1XELA 3MJEA 3IQDB 4FDAA 5ENVA 2HO5A 3KBOA 4OHUA 4XQEA 5EQDA 1UUFA 1WVGA 4XRRA 1GZ6A 1W8DA 2Q1TA 3ZNOA 4MKZA 3FCOA 4O5OA 4WGGA 1NFFA 3FD8A 4YACA 1DXYA 4RLHA 4B3JA 2RAFA 2PD3A 3KSUA 4LSMA 1ULUA 5L9AA 1U8FO 4GVXA 3OM9A 1U3WA 4KTTE 3T7CA 3I9JA 3GFBA 5EJ2A 3ZV6A 3ZW9A 3JQFA 4EUFA 2HQ1A 2O2YA 1PZGA 3VZSA 2PZJA 3LK7A 4K9DA 2ZCVA 4DC0A 3NEPX 1RM3A 4D3DA 1W73A 4PVCA 4R1SA 3AJRA 4MVJE 4BNWA 1PTJA 4CQLA 1C1XA 2DBRA 3KHUA 4CUJA 4N5NA 2IXBA 2VWGA 3FSRA 3QVTA 1Y8QA 4QECA 5KOIA 5TQVA 3OP4A 2UUOA 4QXMA 3PGJA 1IULA 4RGBA 4B8WA 4BQRA 1ZSYA 4CMCA 3HNPA 1SMKA 3PJEA 3DHEA 1KEWA 4KZPA 3JQGA 2W2KA 5C7LO 5HA5A 5A5FA 1O6ZA 4CPDA 2W90A 1P9LA 4FQ8A 1XQ6A 5G4KA 2VZ8A 4HFRA 1PWXA 1MXFA 5DCYA 1T26A 4W4TA 3GAZA 5B4TA 3RIHA 1V3UA 4PLHA 4JBGA 5EL0A 1SO8A 3EMKA 4FFPA 1D1SA 4R69A 3LT4A 5BR7A 4LMPA 4DLLA 2JAPA 2I76A 1HSOA 4GSLA 2NNLD 3KYDA 3NT5A 4JGBA 3ZNPA 4I9HA 1EEHA 4YPOA 1E77A 1G0OA 1E7RA 4CM3A 5A03A 4YDRA 1EMDA 4JN6B 4ITUA 3U5TA 1LSOA 1W6UA 2VYNA 1MA0A 3V1TC 3UCXA 1PGPA 1KC3A 1NFRA 2UYYA 4H7PA 4N54A 4U5QA 2HMWA 1D4FA 3K9QO 3INRA 1M67A 4J3FA 3BTOA 4LMRA 4F45A 1GZ3A 2O7QA 3A14A 1I36A 5L7YA 1L1FA 4BGVA 5L40A 1B26A 1H0KA 3WGQA 2VZ0A 4PLYA 5K6AA 4HFMA 5FF9A 1HEUA 4I1IA 4NDNE 2HUNA 1GUZA 1Y8RA 3FBTA 3PWZA 2ZB4A 2O3TA 2DTDA 3Q1LA 2Q49A 1EDZA 2DT5A 3I52A 4XR4A 4YQYA 4Q3AA 1A72A 1QYWA 3DZBA 3BMOB 5IAAA 4RCVA 4IBOA 3JQAB 4CM1A 4QUKA 5COAA 1HZZA 5HS6A 1M76A 4Y9DA 1ISJA 3DC2A 1CQIA 4R1TA 4NK5A 3IUSA 2X0JA 3G0OA 2Q3EA 1F14A 4XGKA 4EBFA 4ZGWA 2YFQA 3DBVO 2OFPA 4IPTA 4MIYA 4W7IA 4XYGA 2FRDA 4WOJA 4J7UA 4L9RA 3VZPA 2YJZA 1UH5A 5IDQA 2RIRA 5HWSA 3CSDA 1BRMA 4RVHA 2WEKA 1NWHA 1U2DA 4U7WA 1HDCA 1BVRA 2Q2VA 4W99A 2O7SA 3U09A 4WUVA 3I1JA 1OC4A 1DIBA 2CDAA 3OQ1A 1DFGA 3L9XA 4J91A 2AQIA 1EVJA 1WAMA 1NVTA 1SOVA 4BOYA 1LI4A 1IZ0A 3H5RA 4YEDA 1LUAA 2G5CA 2O3JA 1GV0A 4CLEA 4Y6SA 4UVIA 1YBVA 3R6DA 1LSSA 3S2EA 4D79A 1BXZA 1DAPA 3S55A 4DQVA 4N5MA 4PIVA 3K2EA 4CLRA 5JLAA 4LVUA 1QR6A 1DIGA 3ZWVA 2P4QA 3E9NA 3ENKA 1ZKMA 4RPGA 5HTOA 4GH5A 4E6PA 3IS3A 4IDGA 1GR0A 4R01A 3ZI0A 3BHMA 2I6TA 4D41A 3BMCB 3WGZA 1LBEA 2ILTA 4EEZA 1YJ8A 4EDFA 1I3KA 3VZRA 5A9RA 3RFXA 1E7MA 2G76A 3AW9A 3GMSA 3UAGA 5FI5A 4CLOB 3KV3O 1P3DA 1B14A 1ZNQO 1ZK4A 4BO5A 3ZNQA 4XR9A 1H93A 3G49A 3JQ7B 5JMPA 1XG5A 2P9EA 4K28A 2DVMA 3PPIA 5GZ6A 3H9UA 3LT0A 2QG4A 4Z9XA 2J5KA 1LRLA 1V6AA 2CF5A 2F1KA 4L4SA 3AM5A 4DUPA 4HV4A 5TT0A 4IDDA 3TZCA 5IN5A 2ZTUA 2HMTA 8ADHA 1E3EA 3KSDO 1CF2O 4XKJA 1HDYA 3M2PA 3ZWNA 3ZHBA 3WXBA 1JA9A 2EIHA 3BMNA 5TNXA 1ORRA 4YJHB 1HYGA 3IP3A 5IG2A 5DBFA 1J4AA 3I3OA 3U4IA 1LDNA 1WW8A 4DYDA 2DFDA 1I2BA 2DUUA 4NK4A 3H9QA 4TRMA 4TZTA 1JN0A 2BFMA 2HCTA 2I9PA 5ES3A 4TQGA 2IZ1A 1QG6A 3GNTA 1HLDA 1A4IA 3QE3A 5KJEA 1UZNA 4E2WA 1E3SA 4G81A 1D3AA 4CM7A 2AMFA 1PX0A 4CM9D 1UDCA 4XB2A 1LTHR 2X5OA 1U5AA 4L76A 1NVMB 4QSMA 5L4NA 4Y8VA 1MG5A 3JYPA 1I5RA 2GO1A 3CUKA 3RFTA 4F6CA 1DC6A 1PS0A 1GY8A 4AJOA 4Y6RA 1A9ZA 3B1JA 3ZV3A 3B20A 2CF6A 3D3WA 5A9TA 5KKCA 4JBIA 3ZU4A 2Y99A 3RC2A 3AUTA 1QV6A 1AE1A 4CV3A 3E48A 4P38A 5GZ1A 1VJTA 2ZATA 2HJRA 3LZ6A 4MVJP 1I2ZA 5JDCA 5L51A 2GCGA 5JCJD 4WASA 4KWIA 4D42A 1R16A 1ZVMA 2OP0A 3WWZA 1B8UA 1KVRA 4II3A 4M89A 2AQKA 4JP2A 1RKXA 2BGKA 3PZBA 3VVBA 2FWMX 1OC2A 3OQBA 3IUPA 5COQA 4YRBA 3DQPA 3DAGA 3NV9A 1C1XB 3W6UA 4S3MA 3K73O 4WKGA 4UUMA 5JY6A 4NPCA 5B1YA 1Y8QB 1XDWA 1GYPA 3AK4A 3ETGA 1Z7BA 4AJPA 1HLPA 4ZU3A 1PZHA 1W4ZA 1NNUA 2VT2A 3JQGB 1QYCA 2H63A 4G5HA 1P1KA 4YA6A 2Z95A 3QVXA 1U1IA 3UICA 5GY7A 4NBWA 4YVFA 3PK0A 3A06A 4RF4A 1NAIA 1HF3A 3GDGA 1Y5RA 2G82A 4F46A 4L73A 3OJLA 1EBUA 3DONA 3QIVA 4PLTA 1KBZA 4W9NA 4ZQHA 3KB6A 4D0RA 4GKBA 1EE9A 3TJRA 2F00A 4FOSA 2CDCA 4HNGA 1DC3A 2X9NA 1MLDA 1ZJZA 2AHRA 3EYWA 4FFMA 5JAQA 1HZJA 3H8VA 5T8KA 5A3VA 3MEQA 4E21A 2EV9A 4JBHA 4MPDA 3EZYA 5KNLA 2YDXA 3K92A 2PZMA 1LLCA 1XYGA 2C07A 4XIYA 2NQTA 5C5IA 1O8CA 2OBYA 3JQEA 3GN1A 2Y1CA 3PJFA 2VT3A 1NWCA 2VOEA 3MJSA 4OSPA 1DB3A 3LC1O 1Z74A 2NM0A 4ID9A 1NTOA 2XOXA 2GZ2A 4E5MA 2E48A 1W0CA 3WJAA 3GLQA 4OO3A 5J23A 1WMBA 5KJ6A 4TROA 3OJFA 4DA9A 1EFKA 1NM5A 2D8AA 4TMFA 3GRKA 3ANLA 3IJRA 4YWJA 3MWEB 3ZHZA 4BB5A 3RD5A 1IUKA 1E7WA 2DAPA 1VE9A 3JQ8A 1E0DA 3DZHA 3KYCB 3ROMA 5JSFA 2XAAA 1ISIA 4M87A 4J0EA 1PJLA 4XQ9A 4OM8A 3L77A 4A26A 3WWYA 2BLLA 2VYVD 3CZMA 2D5CA 4HNHA 4R5HA 4HP8A 5EN4A 3UF0A 3PJDA 3QWBA 2VWQA 5L4SA 3UHAA 3IKTA 2B35A 2GGSA 3M2TA 4NBVA 4J9VA 1NHGA 3F5SA 1UZMA 4JXKA 1X13A 3TRIA 1ZEMA 4KUGA 1WNTA 4DTIA 2CY0A 3TSCA 3ZN2A 5A3JA 4UULA 4EITA 1CJCA 1TA4A 2BFAA 4TWRA 3AUAA 5JPIA 3RUCA 3NRCA 4RQUA 4BO3A 5F1KA 3UXYA 1TT7A 3Q11A 4M54A 4CMIB 2YV2A 4IQ0A 2BI8A 3VC7A 2HU2A 3NUGA 4FB5A 1LRJA 3WYEA 3RU9A 4CLRB 3LT1A 1PJQA 1Q0HA 2I99A 3PWKA 4UREA 3H9JA 2W2LA 4DREA 1QORA 2V65A 1NFQA 4IDFA 4L8VA 4ONEA 1J5PA
chains in the Genus database with same CATH superfamily
4B7ZA 1FZTA 1FP2A 3ZBQA 4FDLA 5KYTA 2HHHB 1MVLA 1T2EA 3DUWA 3OFKA 3EPHA 2FY8A 5C51B 3K32A 3FY4A 3I45A 2VR1A 3RS7A 3IT1A 3PJRA 1OPXA 2R97A 5F51A 1FTWA 3FDFA 3MMZA 5DHSA 3IPCA 4NCNA 1G1MA 2BFOA 2MR5A 3PHJA 4TWAA 1Y3BE 4NMWA 4MQLA 2LW7A 1GL9B 5B7NA 3GFFA 2DPMA 4G56A 2AN4A 2Y0PA 4L6AA 2VCEA 2D3WA 4OYHA 4YCBA 2D1SA 4MX8A 2XEDA 2X0KA 3EOAI 1C3JA 1DO0A 5F1OA 1T8RA 2VKQA 1OHHA 4S1PA 2SECE 2IPMA 2AJCA 2ETXA 4MUAA 4IS3A 2OPHA 2WYUA 1GQQA 1RJGA 2OLJA 4J43A 4B4VA 1HT1E 2XDQB 4XLZA 1O9GA 4MRMB 1ISHA 1P7CA 1A71A 1XQ1A 2GRJA 3PB3A 3USZA 3WOHA 4BFTA 4ZI7A 5BN5A 1N2HA 5DBOA 4CETA 1WDLA 2Q9CA 3FVQA 1Q44A 4LXYA 2UZ1A 2GPNA 1CR2A 1GU0A 1SBHA 1Z8FA 2GERA 1I7QB 1U7XA 3G9UA 1EFTA 4QDJA 1E1RD 2ZW9A 3WYFA 5CFNA 1H6BA 5C1PA 3JATB 4D9IA 1U1GA 4LJ9A 3LBHA 1B6GA 3X1DA 3FJ1A 1DSSG 2PJUA 2XGSA 3G0HA 4BEVA 2CLOB 3L06A 2NSLA 1LK7A 3WB1A 4B3BA 1YK1A 2QUHA 4FD2A 4LQ4A 1A8QA 2EDAA 2G1AA 3EZ7A 1XVIA 2VAPA 1M66A 4CKCB 1CETA 2KE5A 4KBYA 4Q3DA 4N49A 1LWOA 4JYPA 1X19A 4OHCA 1FF9A 2X76A 5EJ9A 3VNUA 2YN0A 3BMOA 3GO4A 4AUEA 1H2XA 4K9PA 3L0IB 5DLYA 1P6XA 5DBEX 1AQJA 2VJDA 1IL0A 1S7CA 2VLIA 5DXJA 3ZE2B 3ISJA 1CDEA 4RABA 1X1SA 3H1FA 4GSYA 4M46A 3U9LA 4Q4CA 5LOVA 5KQRA 2IYXA 3GL9A 4K6MA 2BKEA 4EUHA 2P9GA 5JDIA 3Q41A 4GG1A 3R74A 3DULA 4GPAA 4FXPA 2ISQA 5AW7A 3GAFA 3L9WA 4BLOA 1ECCA 1G19A 2PWYA 4LYEA 5FOXA 2JCYA 4V03A 3WRYC 2GZDA 4GX1A 5C8DA 4GR4A 1SC6A 1NXWA 3B3FA 4Y0NA 2ZUSA 3O9ZA 3DMTC 3ZHTA 3F47A 1YV9A 2J45A 4C4RA 1WL8A 1YI8A 5F2KA 1T2DA 2IHJA 1YF3A 3M6MD 3HY3A 4EJSC 3LHKA 1SZPA 4C43A 4FE3A 1OH5A 3UGKA 3ZDCA 5CB0A 1L5FA 1JA0A 3JAKB 4H2DA 2PH3A 3OWOA 5AKJA 1LPAB 4ZQGA 1TF2A 3EW9A 4W63A 2DY0A 5LMNB 4RKQA 4TTPA 3ROQA 2H9YA 3MLBA 3T7EA 1YULA 5JVDB 3K0AA 1A27A 5LFAA 2IXFA 1VOTA 3HB1A 4MS3B 2EL9A 4BCCA 4WBSA 2JJ2A 3BHNA 2GXSA 2F17A 4MIOA 4NG5A 3RE1A 3K7EA 1RC0A 4N0QA 3PHGA 3SPXA 5AK0A 2G4CA 2I4RA 3I92A 4RVSA 3SOPA 5FTMA 4F71A 5L53A 1ATZA 4L4RA 2DPGA 1SG9A 3OZSA 5EFOA 1YZVA 1XRNA 3PVSA 4PBSA 4G2TA 4PX5A 2XODA 1V0JA 3ZCUA 2MTBA 5BQ3A 4OPMA 2QEQA 4X00A 3IPXA 5EQTA 4IIUA 2Q8NA 3WNQA 2YW2A 5E3HA 5KNBD 4HN9A 2HY7A 2J5RA 3BMCA 4JFAA 4KI0A 1GRRA 4Y1EA 1MX5A 4AX4A 4X62B 2NO5A 3HRHA 1H1LB 3OLQA 2IDJA 1KO5A 3K05A 4AU1A 2QDXA 1ODKA 4BJ5A 2FG7C 3DT8A 3F3KA 4U7FA 4A1FA 4E2FA 3ONVA 4CLOA 1EUQA 4HRXA 1E3JA 4QL3A 5EHZA 4YRKA 3B7WA 3BXGA 2J3JA 3EXEA 3KSZO 4LYAA 3QX7A 3WAJA 3B6IA 1VI5A 3N3BC 5JQGB 2NTYC 1E9CA 1KVQA 4KXLA 4UFOA 1TC1A 3QITA 3C6KA 3CSSA 3BXPA 4IZOA 3TDKA 1XZBA 4ZCQA 3VKGA 3AR7A 3D8HA 3ZWBA 2C5EA 5EG5A 4RF5A 1M33A 1KI6B 4UBMA 4Q3NA 2JLSA 5ELXA 2ZUVA 3ESDA 4CMEA 3QMPA 1VE6A 1TMOA 1JJIA 1T4CB 3PQ8A 1L5VA 5AI4A 4YHHB 2PMFA 1V5WA 1Z4JA 5JNSA 2ODAA 4L57A 5FH9A 4LG1A 4L0CA 2CK3A 5B6PA 3CCBA 4FB4A 1G2IA 1R5NA 2J85A 1Z3IX 4LZJA 3STWA 3DPIA 3ONEA 4L9WA 2ZTMA 3RSCA 5FADA 1XRRA 2RDMA 2BCGY 1XPOA 2EFJA 3T4PA 1NHWA 1GTJ1 1UXIA 3ZYZA 3I01A 5LQKA 1E5LA 4J4BA 3C97A 2JI4A 2XUFA 3LSYA 4UHHA 3R7LA 2CJWA 4EABA 1MAUA 1L7MA 3PCRB 4C06A 4M1WA 3QKSA 4RJ2A 2OB2A 3FNBA 2QZSA 5K0JA 4ENUA 1VLLA 2O3QA 3P9IA 4RVFA 5JPCA 4N3GA 4KLNA 1VQ1A 3DBRB 3TRFA 4IVNA 2GBPA 3ZU3A 1NF8A 1IWBB 1WXIA 1K0UA 4WKPA 3RARA 4O1HA 1ZAYA 3RUAA 1Y9DA 1IN6A 2W6CX 2FWIA 5GV8A 3L41A 1ZWLA 4A2QA 1DQYA 4C78A 5B1DA 3ONNA 1MAVA 2ZJBA 5JRZA 1UFVA 1CK4A 3IHLA 3FE2A 3DHYA 1T36B 2PL1A 2O8BB 4LOJA 1LPBB 1R4NB 2A9JA 2X15A 5A4MS 4RO0A 3ICWA 4U4AA 4ZKEA 2B4QA 4YQEA 1GGEA 1SQFA 2WF9A 3GZJA 3K9WA 3SQMA 4OB8A 1NJ1A 1XVUA 1MW9X 1U0GA 4H3VA 4RIEA 4DWJA 4ZIRB 5EVJA 2VS1A 4JI1B 1FSGA 1KF0A 2G09A 1Y4DE 3EVNA 1IHPA 3HMQA 5ALGA 1G5IA 4JJ4A 3AOEC 5B3JC 1P0CA 4EPWA 1HT0A 1KAOA 1KZGB 3GBVA 1NJ6A 4K6GA 3SZMA 4BWGA 3GP5A 1JLHA 2GETA 1F3LA 3U2QA 2NGRA 3UUEA 6GPBA 2AG5A 2C3PA 4MUJA 1AKTA 1GAJA 1HBJA 3TR5A 5AW2A 5HFAA 1A7UA 1SRRA 1TYEB 4DR4B 3PEUA 3II6X 4CKBA 2X5NA 3WFJA 2VNSA 2PZAA 2O20A 3BCHA 4O1MA 5JXHA 3HWSA 5BUSA 3H99A 3MCWA 1PNRA 3SSNA 3RT1A 1LDBA 3ZI7A 1QF7A 4OIMA 1GGVA 2LE0A 1B8OA 3FSJX 2ENWA 1MRNA 5IAKA 3A1CA 4QG7A 1RAAA 2P7HA 1H42A 2VTBB 5T64A 1E69A 1FW8A 3SYNA 3TRDA 2O3UA 3RRBA 1IM2A 3FZEA 1QSGA 5ALRA 5HQJA 3ZNNA 3IILA 1PUJA 1LA2A 5IT4A 4W6QA 1E0KA 2P65A 3L0DA 2P5UA 5ICCA 3QOYA 3ZDFA 4N5LA 4GPEA 3A2LA 3BFPA 2HLPA 1OBHA 4E22A 1GZHB 3HKCA 1F2VA 3H5WA 3MWDB 4J0KA 1D1QA 4DKXA 2FF7A 1PGJA 3I0ZA 5BN5B 1KVSA 1UAGA 2HLHA 2BEJA 2Q62A 3IMFA 3M6FA 3BFJA 5IWCA 2IPLA 1SN7A 2YIJA 1RZRA 2DC1A 3KR0A 4D80A 1YE3A 2BISA 3HDTA 2VDVE 1ZQ1A 4W1PA 3R6WA 3LFHA 1I3NA 3O2QB 1OWOA 5KAMA 1HDGO 4TSRA 5P21A 1TZKA 5KTMA 2JD0A 1YOVB 1VE3A 4EFDA 1EX6A 1F4LA 2G7MC 5ITVA 1N3LA 1TZ2A 4OUKX 4ALMA 2PRYA 3DL2A 2NSYA 3WGOA 1KE2A 1PGQA 1EEXB 2NIPA 2QYOA 3PXBA 5DYWA 1WWKA 4UUOA 1XJCA 4JEUA 4E1BA 1LWNA 1J8QA 3DCYA 2ANCA 3CPJB 3QWHA 2NYVA 5FOTA 4DSOA 4V0SA 1Q1EA 3IAAA 4I3GA 4PC1A 4RA6A 1U28C 1HI9A 3ICOA 3HBMA 3R44A 3HV2A 4NS4A 1XROA 1OZAA 3JVIA 4H0NA 3DV0A 4LZZA 1KEUA 4OD0A 1M6NA 3MJCA 4MUEA 2DFTA 2H4XA 3KJXA 4C4ZA 1WMFA 3QVLA 4PZDA 1YTLA 1GLVA 4U2CA 2VF7A 2PH7A 3BRWA 3OTWA 1ECLA 3R7DA 3FYCA 1GL6A 3REGA 4A0SA 4CM4B 5B3LA 4ZT7A 3I42A 1MEOA 3PTLA 2WF7A 4F1WA 3KETA 5ERGB 3ZX5A 2Y0CA 1GTMA 1QR2A 1DDGA 2W9XA 3O3CA 4KNVA 5CBKA 3CBQA 3L01A 1UWKA 2G71A 1ZP6A 4MIEA 3RF6A 3Q3HA 3SQLA 5F98A 2YWEA 2H5LA 3LC0A 3FVRA 3IXQA 3L7OA 3S8MA 1BE1A 1VJGA 1PGOA 4WVFA 3KQYA 2Q1WA 3A26A 2P6RA 3KD2A 4F3TA 2MSLA 1E1KA 1I4TD 1QGUB 3OOWA 3IJEB 1RQRA 5EIOA 3U40A 2VDQB 4AF8A 2QBYB 5DCWA 2ZTSA 4MEJA 1UZAA 4OKIA 3DOIA 3U17A 1X1EA 3K2QA 5DVZA 4IDAA 4D25A 3I6QA 3EIQA 5FTWA 2OHIA 4C20A 5KJCA 5I4KA 1MW8X 2KBFA 2QLMA 1ESCA 5H1YA 3R7FA 3VH3A 4UMEA 4HTAA 4GX2A 1P1FA 2A0YA 4K8OA 3G2PA 3LG2A 3K0AB 2IE8A 4UC0A 3LU1A 1N0IA 1EXDA 2PTGA 2ICAA 2Q2WA 3ZTWA 2XA1A 4IDNA 2VHZA 4MQ5A 4TMXA 2Q27A 1KGDA 2QN8A 3WX0A 4BQQA 3EY4A 1ZM3A 2A5JA 5J40A 3I2YX 2XB2A 4XYEA 4DNFA 1KRWA 1OB2A 5LCXA 2EW2A 5EIBC 5DYNA 3V4FA 1FS5A 2P1ZA 4X3OA 3VM6A 3RAFC 1CUJA 2EHDA 2HD4A 1WD5A 2RGBA 3BQ9A 5KTKA 3CLTD 4GLBA 1J06A 3JCZA 1R8QA 3E9RA 1E4YA 2R65A 3LH5A 3RIXA 4QJBA 3HCAA 4RHFA 2W4QA 3MCAA 4TMTA 2NADA 3W5IA 1QG2A 1OGIA 1DWQA 1UT8A 3WGIA 2CNNA 1NXQA 1QAQA 3AFHA 3G23A 1QPBA 2YV5A 1SOAA 1XTSA 2VYVA 1QPGA 3DHNA 1CRLA 4KSCA 3S7TA 2Y3IA 4BYGA 2GVZC 1Z0KA 1SVMA 3ZH2A 3TLCA 1VYHA 1OVGA 4G9GA 4P83A 4MWTA 2HF2A 3R24A 1IPEA 1ELOA 2YUIA 2AH5A 3X2SA 4O4JA 1ODCA 3FTDA 2VCYA 3G2IA 2SHKA 4I3FA 5CM9C 1U04A 2BDTA 4Z0HO 1E7SA 4KR9A 1PZXA 4DR5B 5K05A 2WP8J 4D6YA 5IU6A 3JQFC 2XGMA 3R20A 3KWLA 4XIJA 3U1TA 5BRJA 1M6YA 1DT3A 1LLDA 3VSCA 4NCHA 4IGFA 2N3ZA 5HE8A 1DRVA 1MEJA 1SBZA 1IBCA 3I0MA 1M8PA 4R9UC 4P81A 3AVXA 5BT8A 2Q46A 2WQZA 3IQFA 2H0QA 4YRMA 5LJIA 3FKQA 1SOUA 1ZDMA 2F3RA 1TAHA 2PSJA 4IJ6A 1AQ6A 3E23A 3UA4A 3ILSA 4MVJA 4E2XA 4MV5A 1M8GA 1JX6A 1E7QA 3FB4A 3I0NA 2JGRA 1PVVA 1DJLA 1MC1A 1KARA 1OY1A 2HL6A 2CJWB 3A6LA 3QPDA 4V2IA 5EIFA 1GPUA 1U3DA 1IIBA 3Q8KA 1OR8A 3QKSB 2RKBA 3O75A 1JIVA 2RGUA 4PYNA 5EIWA 2HBQA 2RAUA 4UVGA 3B7PA 2ZTHA 3DP9A 1ECFA 1RE0A 2EKPA 1TK2A 2NZJA 2YVLA 2YYZA 3FAKA 4HAVA 1SNYA 1DFIA 1M0WA 3ZGOA 1T4DA 1NSYA 1UMBA 2VFAA 5FBRB 3SX2A 4P53A 9ABPA 6PFKA 1WXQA 1XL0A 3V2HA 1KNXA 2AEEA 2D0OB 4ND3A 3I34X 5LN1A 3PEYA 1E8NA 1F8XA 2R6AA 3T7JA 4DG5A 2ZAMA 1LX6A 4C14A 5KUTA 1NY6A 3O8OB 5AK3A 3LTEA 4FGSA 4CN9A 2OHVA 3ICPA 2PX3A 4LBYA 5JD4A 1G0NA 5KKNB 2AD5A 3OZBA 3UV6A 1XVLA 1JIJA 4Z0NA 2F59A 1G2PA 3TLJA 1DKOA 4XQ0A 1TQHA 5KQSA 3B53X 4A73A 4CMHA 3NFRA 2CD9A 3KM0A 5CEJA 4XWAA 3UVEA 3E9ZA 2JHGA 4E5PA 1ZW1A 3MJTA 3JXEA 3ZZMA 3MLAA 4A6PA 2WD8A 3O5AA 2F7SA 4PLCA 1TX4B 3LP6A 3UWKA 4ETMA 5ALNA 3S3TA 2GDZA 3IB6A 4N5IX 3MUEA 4O4HA 4O1IA 1RKUA 5IS2A 2UXBB 4MJ7A 3DL7A 3VFDA 2QRJA 3SIXA 3LGAA 1LD3A 4ND1A 2A0WA 2G17A 1BOFA 2Q5LA 1SKYE 4EM6A 4RNCA 3NAMA 2WVAA 2ZE6A 1Y5IA 2H4ZA 4FGJA 4EOGA 4BCDA 5TEWA 1XJQA 1HZZC 4W5NA 3GDWA 1VBKA 2OBNA 4TL7A 4LOIA 1IB0A 3F6RA 3GARA 5LYJF 4OLAA 4M0DA 1W0KD 3SXPA 4F4FA 1B1AA 2C78A 2JLCA 4D9MA 1P0IA 3L0OA 4UU7A 4C0QC 5I7VA 4HQ6A 4YCDA 1EK6A 3AVUA 1JVSA 3ICCA 5DNWA 2UVPB 2BD0A 4GXTA 1T2AA 1XX6A 4ZD6A 4B6QA 4R6XA 4GWKA 4IOJA 2FRDC 1F0KA 3LPNA 1MOQA 1OB5A 3NT2A 5HYVA 3THYA 4ICIA 3SZRA 4D0SA 5DTEA 4ZAFA 4NVRA 2GA8A 2AJTA 2I3BA 4B5LA 1QTQA 3HKCB 4CL8A 5FBLB 4EY8A 3GEBA 3OKCA 2VOJA 3N28A 5F78A 3WKAA 3QI7A 1EK5A 1II0A 1W47A 1V25A 1CRWG 2CDBA 2VF4X 5D00A 1SVUA 3P0HA 1DCMA 3RYFA 2X5JO 2AZXA 1O57A 2VP9A 3C24A 3GUZA 1GUBA 4TRNA 1DCFA 1ORVA 2XVYA 1O9HA 1NVBA 3HEAA 3F5QA 2G88A 1MENA 3R0QA 2Y9PB 4X54A 4AJ9A 4FYVA 1SB9A 4RW0A 3KQPA 3ODPA 3LYHA 4V0KA 3HRIA 1FRZA 2O4UX 3BJRA 1AF4A 2VRCA 3HA7A 4LQLA 2C7VA 4D1YA 1QM5A 4YFYA 3SZLA 1IPHA 3GG9A 1JPNA 1RM0A 1WXWA 2A8YA 3RABA 3LDGA 2XZTA 5CPFA 1J2YA 3LX4A 1TCCA 3S2YA 2QZZA 4M9UA 3CG4A 1P2TA 4YMTA 3QEMA 1EESA 4Q7LA 2GH1A 2FKNA 2IV2X 3HKDA 3W7BA 1PSDA 2F9LA 3FR7A 4RA6B 5JCOA 4CU5A 4GBMA 3ORFA 4LYHA 1Q0LA 3FCCA 1HT2E 1PN3A 3W8FA 1RIIA 3M0EA 4Q03A 1KOFA 2OESA 5AVKA 3QXCA 2ZTLA 5ALHA 5IYZA 1KY3A 5AW0A 1K8QA 4CFZA 3S81A 5I5EA 2GX6A 3PQDA 1SCNE 2X8JA 3CR8A 3B2QA 3HFSA 2BEUB 2ZSKA 4ZCMA 1V11A 1AQIA 1VYUA 5EIHA 1L5YA 3T38A 4PG6A 4O8CA 4H3KB 5ICEA 1VB3A 1UM8A 2OCGA 2QN7A 2X0NA 2CFTA 5GPBA 5CEEA 4IVRA 2GKSA 1EP3B 4GLLA 4FP9A 4R0NA 3N5KA 3SMQA 3ML1A 3F98A 3AJ9A 3N39C 4MKHA 5DGHA 2FWBA 2JARA 2P8JA 3AF0A 4YCAA 4EPVA 2J3EA 3U3OA 1P75A 4P0QB 1GQFA 3OQIB 3CF4G 2X7HA 4IZHA 4CEHA 1MMFB 2HMSA 3QFRA 4I08A 5FO0A 3S5JA 5CPBA 4N41A 1RTTA 3OJWA 1N2CA 1MB0A 4ZU6X 5BWNA 1M83A 3GLIA 2QMQA 1G291 3IEUA 3TDNA 1NN3A 1FL9A 1OXUA 3N2ZB 3TL6A 3VX4A 2WNHA 3D7NA 4TWBA 1EVQA 3M4ZA 1HDXA 2DLNA 3SKVA 4BX9A 5ITWA 2YFHA 1IOVA 1JAYA 2IP4A 2X86A 3CJRA 3FWPA 4BB0A 5CB4F 5HILA 3A6KA 5K3OA 3GZTB 3IV7A 2BKAA 1ETUA 1EE1A 2NXCA 1Y4UA 4EF4A 4U2KA 4ISBA 5JC1A 4AN0A 1JLLA 5DBGA 3HDGA 2VWHA 5E7IA 4UEKA 4U3JA 4EG1A 1WHSA 3U7HB 3ICQB 1GSIA 3UUWA 2G36A 3KG2A 3DO5A 2Y6VA 3H5AA 3KXIA 4KXQA 4XJSA 2FZWA 1QU2A 3U4QA 2FW6A 2RFLA 4O6VA 1CY7A 1SC9A 2X3FA 3C1OA 4G65A 2GN8A 3BBPA 1DNPA 4P5PA 1LQ2A 3WQBA 4FYJA 4ILKA 5EEHA 1U7UA 3GEEA 1KFEB 3DZGA 5EUMA 3VSAA 1NXTA 1EJBA 1OXMA 3ABOB 2VXYA 1OIXA 3RBXA 2A1UA 1TAUA 1K7CA 2BC9A 2PRZA 2RJOA 4PAWA 4R05A 1MG0A 1QQAA 1UXGA 4FM9A 2XE7A 4Q4JA 2F3TA 3JYOA 1ISMA 3S28A 2QA5A 3PHBE 5KTTA 1XLTA 3KQNA 1JDBC 2HU7A 4TYQA 4BKPA 2EX0A 1I13A 2FEPA 1UMKA 3GMDA 3Q5EA 1V5FA 1W59A 2GHQA 4NZ9A 3RHTA 3UBMA 3B60A 4JENA 5CG1A 2Q4OA 4BKQA 3EDCA 2LKDA 5L7TA 5LA6B 1EUZA 3FF4A 3D0QA 3ELUA 4KXWA 1FW6A 2M6LA 4QJ4A 4PO9A 2BJWA 2G9ZA 3EVCA 3PBKA 4LRTB 4PZ0A 5HJ7A 1R0LA 3SDBA 3WMWA 4F9GA 4CG1A 3T1QA 1X86B 1XMSA 3NEYA 5G2OA 2W48A 1FX0A 3F5FA 5CDFA 4X94A 3G1WA 3QX3A 5C7IO 1GUAA 2KPOA 5HKLA 1EI9A 2H11A 1XD2A 1V1RA 2Y1EA 3L0SA 4DRYA 3AVTA 4LTMA 3HZZA 3I64A 2FK8A 2ZB3A 5FWAA 4X65B 1IZ9A 1V8ZA 1KQ3A 1SUWA 3CIFA 1NI3A 1NATA 3OJ0A 5IC5A 3TTSA 1K4MA 1OAKA 2NZXA 2OORA 3UYLA 4AG6A 1M8JA 2CDRA 2E89A 4P9NA 1GN8A 3NM6B 3CO5A 3QXJA 1GILA 3QLJA 2B5WA 2Q99A 4KIGA 4UHCA 5CVVA 1PEKE 3B6ZA 4BJ1A 3U60B 1PW5A 1VSBA 5F12A 4OFWA 3DUFA 5IC4A 1S5PA 5KZMB 1SCUB 5JVDF 1USIA 4YX9A 4OJMX 5IBCA 3RIMA 4CCWA 3VZBA 1ORHA 1T1JA 1U0OC 2BKXA 4QAJA 2LP4Y 4YALA 3LBYA 4OKNA 2OCBA 1UMBB 5E7JA 2KX7A 4RPKA 1MRZA 4NZOA 2XWBF 4M3NA 3G2LA 1QANA 3VAYA 2WV7A 2OV2A 1VSQA 1SH7A 4C7JA 4QPDA 1XEXA 2O6LA 1DHRA 3OF3A 3UGJA 3ZS9A 1U94A 1RM5A 2XVAA 2FMKA 4G84A 3TW4A 3LHFA 5JS1A 1XHLA 3IOCA 3QVMA 3MAAC 4QDTA 3SJ7A 5T8KC 3HUDA 3MT8A 3W5SA 1AKMA 4HDRB 1ENZA 1ZJ4A 3S7ZA 4HGNA 1DBIA 1CSEE 3RRXA 3TLBA 3ZBPA 5MGNA 2BFPA 3LFTA 5JHGB 1EFVA 1D1TA 5DGDA 5FP0A 5U1PA 4H31A 4B71A 2FOIA 2ET6A 1D2MA 3H2ZA 3QQPA 1BXGA 3DMPA 3ZCQA 3SYTA 1E3LA 3KKLA 1FMCA 1D2EA 1FNDA 3G3EA 5K0TA 5C53B 1A8PA 1LNZA 3ZDBA 4O4HB 4Q16A 4QSHA 5A3SA 5JQGF 1AUXA 2X6TA 2XOKD 1AKWA 2V54A 4P4GA 4N8SA 5BT9A 5SY9A 4ZT6A 4EJ6A 4F5WA 5ADWA 1XCMA 4AIIA 2BI4A 4CEIA 2RG1A 3OHPA 4E11A 1EQUA 2QN1A 1Y1SA 2QJRA 4ZO7A 3QVSA 5LOVB 2WA1A 2H07A 3ANXA 4PS0A 1U3GA 1CWUA 4RORA 2NUBA 4BNZA 2PA3A 2I2FA 2WA2A 3AL2A 3WQQA 1R4MA 4EHBA 1FZQA 1TF5A 1ONBA 2OHJA 2CKDA 4ND6A 3SD7A 4I1YA 3NIDB 4HK4A 4M7WA 4UHDA 3BWEA 2GM9A 1NW9B 2JCXA 3EXHB 1LVUA 3SQNA 1UXHA 5A02A 2XCLA 2A94A 2CWDA 2CVZA 4ZRMA 3VO9A 3GJYA 4HFNA 2HPAA 3NKLA 5FI3A 2VEOA 3THYB 1YJCA 1X7YA 2C2KA 2QW1A 4JDUA 5CT4A 2R6R1 5SV2A 1M54A 1JB9A 3V2GA 4B43A 4L95C 5K8TA 2AUNA 2REQA 2YNMD 4BNVA 4C7VA 4GD3Q 4WPGA 3TF5A 5EMHA 3OTQA 1W0JA 1WEKA 2CCGA 1G2QA 5GJWC 4B7CA 4F60A 5E9JA 4A8JB 1V3VA 2GRAA 3C16C 6Q21A 3RYFB 1IG3A 1WXXA 4KDFA 1MT0A 1L5SA 2BMVA 4MA4A 3AO0B 5DI3A 3O8QA 3TINA 2FETA 4LISA 5HMLA 1DKPA 3WS7A 5CFLA 3G79A 2B3TA 3BK1A 4EEKA 1T29A 2RGYA 4K9KA 3RW9A 4RY9A 3V00A 4UHJA 5B58T 2VK4A 3A36A 2R5NA 3FRHA 3LBIA 5HKOA 4XSHA 2VP2A 3EEOA 2IYUA 5IDVA 5K3AA 1Y8ZA 4TLDA 1N33B 4U00A 3V80A 1IOZA 1CY6A 1YB2A 5G3ZA 2YWRA 1TJ4A 1AHIA 2JD2A 2HRDA 1JFSA 1GL3A 3QEMB 3GUHA 3EXG2 4PHHA 1GAQA 1X8KA 3ECCA 3QVGA 3H3JA 4G8BA 1JFFA 5KAPA 3RBZA 1D07A 3P2IA 2WSMA 1S3GA 5TPWA 4K6OA 3WGKA 4O3MA 3ER8A 1C0LA 4TV9F 1SXHA 3KRTA 3D4NA 2ZROA 2OFOA 2ZUUA 3AHEA 5IYZB 1P0QA 4KXMA 1E1DA 2FR8A 2ZU0C 3RTAA 2C3OA 2XBUA 3OA2A 1AV7A 4IIVA 3TJZA 2X8JB 3FGOA 1BRTA 2WWYA 4QGBA 4Y2GA 1V11B 3D3NA 2P2DA 5CK4A 1F12A 2PR2A 3U81A 3WOVA 5JUWA 1ZPDA 2Z3VA 1Z8NA 4IEFB 3F3YA 2XYGA 3BS4A 2JA1A 3MFQA 4MK4A 4O2AA 5HOEA 4RBNA 3V8EA 2O2IA 1Y5LA 3GF4A 4QHSA 4NJOA 4XB1A 1KSHA 5CXXA 1L7DA 2QQ5A 5D3KA 1L3CA 2C4KA 2H16A 2ATEA 1GARA 4Z9BA 5EPUA 4ZV7A 3RANA 3V7WA 3GQBA 4GMKA 5EESA 1PK8A 1N36B 4NY1A 4R3NA 4F4UA 5H4GA 2MU1A 2YMMA 4EG3A 1L5ZA 2YHIB 3RS2A 1JLRA 2WYIA 4BUJA 5A1TA 4OF4A 5H68A 2VHYA 2G83A 3LPAA 2EEZA 4BO9A 4FWTA 1O3YA 3D8NA 4D8WA 2IHNA 5F9FA 3I6ZA 1QHNA 4II2A 1JHYA 2OZLA 4OM7A 1X38A 3C5CA 1OLXB 1CPYA 2B5VA 4JQYA 4TSFA 5T3YA 4G0OA 4BC1A 1AB5A 3KSMA 2W98A 1OLOA 3BA6A 1JLLB 2RHGB 3IJ5A 5C34B 4YJ2A 4HH3C 3GCGA 1W5AA 1KJIA 2HWUA 3OHSX 2IHZA 4AZ0A 3ET5A 3VNVA 3U31A 1W1WA 4Q39A 5TRTA 4EKYA 3ZWCA 2FQYA 3O8NA 1H2AS 1X8XA 4QXPA 4EGSA 1SHJA 2DSTA 7ABPA 4M53A 1SIUA 2PMKA 2XLBA 3EVZA 1IEXA 2FPMA 2RI0A 4JX8A 2CXOA 1C9NA 2FZEA 3GLHE 1D8TA 2C31A 3IQZA 3OZ7A 4JHLA 4CCAA 2JH8A 1JDUA 3JYHA 3UAYA 4RANA 3E5RA 2YICA 1GD1O 3LKZA 3DVSX 2Q1YA 5AKEA 1YZTA 4N6OA 1GSHA 3WQHA 1I3MA 3I3SR 3NJRA 3PSAA 4BC0A 3PIRA 4MEBA 4PBRA 4Y1RB 4E88A 2JIQA 1VC2A 5J1SB 1YI0A 4E1VA 1GSAA 1U7DA 3QJGA 4DIUA 3UXHA 4XD7A 3BXFA 3OICA 1LBIA 2GR9A 5DOVA 5D1NA 3B8EA 1VKHA 1C3VA 3GFPA 3WBJA 4X97A 3U13A 4J7XA 4P98A 3RJ9A 3TI7A 4C4YA 1QGOA 2ECQA 2JFHA 3M9XA 4YXWD 2GNAA 3T1NA 1D2GA 3BH0A 5IZCC 2WRZA 3T35A 1TEVA 2GBFA 3P2EA 2QMYA 5EWLB 2RKOA 3K30A 2C7OA 2IQIA 1JAZA 1YJXA 2AQ8A 1IN4A 2ZYIA 4KYVA 4MW7A 3RTEA 3VJRA 1FX0B 3DOJA 2VHUA 3S2GA 2J3HA 3A6HA 3ADOA 2R00C 1HEYA 4XDZA 1H5QA 1XD2B 3KJEA 4RSMA 1DJQA 1CUAA 4MPPA 3STXA 5JTTA 4DV6B 5FIUA 3DXFA 1H5NA 3WTCA 4PQGA 1LJUA 2OO7A 3GYBA 2DZDA 1ZBQA 1BD3A 4AZSA 4C1NA 3AQIA 3UAXA 2O0MA 2LXNA 3CF6R 3R4VA 2O2SA 5FTJA 5JJIA 2Q2OA 4WZ6A 5TLSA 1RI3A 1IEWA 2VVTA 3QKIA 4JIGA 2XTMA 2ZYAA 3VPSA 2H5JA 4Z4IA 2JFXA 1NRWA 1PJBA 3NALA 4GPZA 4UMDA 3DUFB 5K45A 4BECA 1DO2A 4BO1A 2Q1XA 3CW8X 3KZKA 2QE7D 3QXSA 3EZLA 3TZLA 5IX8A 1S02A 1NZJA 1ZZEA 3G2MA 3QE0A 1V1MA 5FKJA 1F0YA 4GOLD 4IZIA 1TVCA 3WKCA 3SC6A 4EG8A 4K87A 1DX4A 1P61B 2QTHA 2EQBA 4RC9A 4NV3A 5K0FA 1RRVA 2RONA 2PMEA 2FZLA 4ZC8A 5F21A 3TG2A 3LW8A 2IBTA 4WWHA 3NTOA 2V6BA 4D8UA 1L7EA 4GKAA 3VNAA 1A04A 1A50B 1Z06A 1O94D 2MSDB 2XY4A 3NIBA 2Y6UA 1N5LA 1WPQA 2ZE5A 1XZHA 2JDIA 3IAM6 5L6MB 3PJGA 1JHQA 4QNNA 4C0WA 1D5WA 1CV2A 2WG0A 3IPAA 4YI3A 3SX0A 4M9XA 3VJKA 5K6TA 1K3FA 4WOKA 4E5YA 1EFVB 1Z2CA 4BEWA 1N2IA 3KT6A 3BCRA 4ZYWA 3H3FA 4AD8A 3QVKA 4TZKA 4C6TA 3ZDQA 4P4LA 1FYWA 2ZZMA 1ZHOA 1QCCA 3GNSA 4RAQA 4EGCB 1XGKA 1IY8A 2QYTA 3A6EA 2B6HA 2WJ3A 3NHUA 1E1QA 1WVMA 3EFEA 2WR8A 4J1QA 5AKLA 3RJTA 3GROA 4WACA 3VSBA 5HK9A 1JG2A 1LFAA 3F4KA 2FDCA 2B37A 4BV8A 4R1UA 2REXB 3E58A 1BU5A 5PGMA 2Q5EA 2FNAA 5FCDA 3TFQA 3WFIA 4DLUA 4UJ5A 2FPPA 3KQTA 3W79A 1XWFA 3WE7A 5DU2A 1Q14A 5M04A 3M6AA 3K5HA 3QKUA 3BG5A 2ZRQA 4IL5A 4D82A 4J9UE 3E18A 3EBPA 4E5UA 2RHRA 1L4GA 1T3LA 2HN9A 2H1IA 3PGMA 5GIOE 1EUYA 5MFZA 1XZLA 4MGKR 2O0LA 3PCTA 4ND5A 2VZEA 4QBFA 1JQKA 2FEMA 2OR3A 4Z86A 1B41A 5FLYA 4HEA1 3SF8A 4BXOA 1QO9A 2CEAA 4N3NA 4B09A 3KZ1E 5HUJA 2REQB 2ROQA 2CNWA 3OEED 2CXNA 1ZQ9A 4KSYA 3WL7A 5JCPA 1Y82A 1QAMA 2PGIA 3I61A 2GKOA 3K0FB 3KOUA 5CIQA 4Q9IA 2GJAA 1I6KA 5DLPA 2F2TA 3H04A 3S4YA 4LXHA 1VI2A 4XQGA 4WY5A 5C8YB 1E94E 3TCKA 2AC7A 1KDZA 1OVMA 1U5CA 3JD1A 5CB4A 1OOEA 1BHJA 4LRYA 4KDEA 1SBNE 1V3TA 2QOEA 4UBNA 5HIKA 3OBBA 1BEZA 2Y68A 4Q1BA 5BW6B 5B1HA 3HRKA 5EE0A 1NLMA 3Q9LA 5TJHA 1QP7A 3TW8A 1GEGA 3RROA 4I81A 1AO3A 2GWRA 2I3GA 4YP9A 1YUMA 1BGXT 1AZTA 4MVJH 5AXDA 4KYTA 2J9RA 4FCWA 5CH5A 1E2BA 2PSDA 5EXSA 4ATNA 4N7RA 1ETHA 4RH0A 4IDQA 1FU8A 1PL8A 2ZRIA 4HGQA 4ZWNA 3UJ9A 4BVKA 2PCJA 1JZQA 3D7RA 3N2EA 5JD3A 1U2PA 4M7OA 4B48A 1DGQA 2IYYA 1FSZA 1GPJA 2XPCA 2WKSA 4MNTA 3VX3A 3EULA 1X39A 3TE7A 4EPTA 5D01A 4DXAA 1MTOA 4KAXA 5JS8A 4DV0B 5D3MA 5IZ4A 1X3SA 3TOXA 1BCRA 1FXWA 1IAQA 4Q3KA 1OASA 1XZNA 1XR3A 3FTEA 1ZOLA 3DCNA 2AFHA 1MPXA 2OXEA 2XEXA 2ZANA 3HR4A 4H7DA 4CBVA 1DG3A 1QIDA 3ACDA 4MP6A 5JQWA 2RI1A 4RTNA 2J30A 5C37A 3U4HA 4JU8A 4YO7A 4XE5A 1WU7A 1ZNZA 2FSVA 3R8XA 3ABIA 1G5HA 4ZYLA 3BSWA 1XKQA 3WL5A 4DDKA 4US2R 4CUZA 5LKAA 1NVGA 1WXEA 2PZKA 3F4BA 3L4SO 3TKAA 4B87A 5KB3A 3E9CA 1SQ0A 1FFEA 3KELA 3VU3A 4DCUA 4UFPA 1L7OA 2I66A 4M7RA 4Q1FA 2QXTA 2CLEB 2GHRA 2O7NA 2V6IA 1QMGA 1VJ5A 4FT2A 4HRYA 4TMYA 2PG3A 1SXPA 2BKVA 2H7XA 5H4HA 3AB3A 2FW0A 1UOPA 4CI9A 4FLEA 2C9OA 4PR3A 1KAMA 1G3QA 2VKTA 3ON5A 4YB8A 4BNHA 2HA6A 4OXRA 5KI6A 3A6FA 2IHUA 3A9CA 3AR6A 4LSWA 1BHO1 4EH1A 1XDGA 1U6KA 2OQVA 4IH1A 1KNQA 4QA9A 2W6PA 5D3ZA 2EGHA 4EUEA 3M4JA 1T5SA 3PT9A 4NP6A 4Y3UA 3AI3A 3KTDA 4M36A 1K7YA 3UK7A 5LDDC 4BFLA 3EN0A 1VFPA 1D0IA 1PUIA 1SIWA 5ALIA 3RC9A 3L1KA 5EIXA 4KVFA 2W2VA 3AVQA 2JI8A 1TK9A 3EF0A 4HH4A 5F35A 3WGTA 4G0XA 4IM7A 1K8ZB 4IXTA 1KR2A 1X80A 1K68A 3BJZA 4QDXA 1MJGM 2P9HA 3HXKA 5EIAA 4C9BA 2PVCA 1BFUA 1FFDA 1DINA 1PK7A 3O3OB 5K6RA 1TVKB 3I2GA 1MC4A 3MQFA 1KS2A 2YQ5A 2NUTB 3KDAA 1ANKA 3T5BA 5FWXB 4I4CA 3HJNA 1W48A 2OOSA 1THGA 1RXIA 5E9WA 2RH9B 1YMQA 3FMPB 4NENA 2F67A 3PC6A 1ZXLA 2Z83A 3IO3A 3RKSA 4CQLB 5H82A 4RA9A 1TMKA 5BNWA 1I4DD 1ADGA 1J39A 1YVUA 3K1AA 3L2OB 3L93A 1ZD1A 2IPAB 4XPIA 4Y98A 4KV9A 5K0CA 3H0CA 4B80A 2JHCA 3ZXIA 4C76A 3WV4A 3EK2A 3G89A 5CJ2A 4EP1A 2BRUC 4OJKA 4EKIA 5KOHA 3NGXA 1NUPA 3HXPA 2XE4A 4OMDA 2RHWA 3T5DA 2CXHA 7ADHA 3PXGA 1ZWKA 3CKYA 1JQLB 4QC2A 4DLYA 3OD5A 3EMVA 3T0GA 3UMYA 3GFGA 5L8VA 3K5WA 3PEWA 1SPBS 3HJAA 4PHGA 3VPBA 2ZIXA 4FYMA 1F9AA 4YXFA 2YBDA 1ATIA 3LVQE 2Z8YA 3TECE 1ZESA 2QROA 4H3SA 4WSOA 2Q21A 3JWPA 4JI7B 2J5XA 1JMYA 4NWIA 1DG1G 1R9GA 2M98A 4J75A 2X9GA 4V3BA 5KYXB 3UV7A 2ZT7A 4WQMA 1ES9A 1LX7A 2R751 3K9LA 3W2GA 1VKRA 3VR6A 3M6LA 2Z5VA 4G36A 1NBHA 3H1AA 3QOWA 1OLUB 3ZKWB 4HNVA 1K6JA 3UZUA 1NJFA 3ZHOA 4P80A 1ENPA 1UBUS 2QUJA 1U9YA 3BDIA 2BWJA 4C6RA 2C95A 4R2XA 3DMTA 2EGGA 3C0KA 3L4BC 3AKYA 3RG2A 4D4IA 1PR0A 3KIPA 3UMJA 1V1MB 5C7OO 2NXNA 1APBA 3L7DA 1SHKA 2B1JA 4KQ1A 5FPHA 2BEWB 4AS1A 3NRBA 1U7HA 5JYCA 1E98A 4I4TF 4B6FA 1DKLA 3EXIA 5FULA 5KDOA 1D2NA 5DCLA 4R3WA 4U7TB 3VR4D 4GR9A 4CM8A 1Q1ZA 1FQOA 3DFZA 4ZJZA 1Q91A 1TVEA 3IIJA 1NPTO 3M9LA 4R1PA 1LVHA 4MR9B 4DB4A 1I24A 2GHTA 5D8DA 3U4DA 4DA6A 4DMFA 2PUAA 4UTXA 5DN6A 3PFWO 2LTAA 1MDBA 1XC7A 2I8CA 1HTTA 4Q1EA 3QENA 3WL3A 5LC1A 3B48A 5MN6A 2HNKA 4M1TA 1EXVA 1NVFA 4ANFA 1KE1A 4TTIA 2HWXA 4G37A 5A62A