3QWAA

Crystal structure of saccharomyces cerevisiae zeta-crystallin-like quinone oxidoreductase zta1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
331
structure length
331
Chain Sequence
TIPEQQKVILIDEIGGYDVIKYEDYPVPSISEEELLIKNKYTGVNYIESYFRKGIYPCEKPYVLGREASGTVVAKGKGVTNFEVGDQVAYISNSTFAQYSKISSQGPVMKLPKGTSDEELKLYAAGLLQVLTALSFTNEAYHVKKGDYVLLFAAAGGVGLILNQLLKMKGAHTIAVASTDEKLKIAKEYGAEYLINASKEDILRQVLKFTNGKGVDASFDSVGKDTFEISLAALKRKGVFVSFGNASGLIPPFSITRLSPKNITLVRPQLYGYIADPEEWKYYSDEFFGLVNSKKLNIKIYKTYPLRDYRTAAADIESRKTVGKLVLEIPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable quinone oxidoreductase
publication title Structural insights into the cofactor-assisted substrate recognition of yeast quinone oxidoreductase Zta1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 113
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2011-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qwaA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3qwaA01
3Q2IA 4R1SA 3KHUA 2IDZA 3IMFA 1OFGA 2FSVA 5JPIA 1A72A 4Y6PA 4BV9A 2EWMA 4EI2A 4E5PA 1HYHA 4NFYA 1P0CA 1OMOA 5JCXA 2GSDA 2B5WA 3DZGA 4YT4A 2GZ2A 1BHSA 2ZYGA 1ZEJA 1BVRA 1T4BA 2O3JA 1Y8QA 2ZJ0A 2XAAA 1H6DA 5AXCA 1EUCA 2AE2A 3ZCXA 5L40A 4I9UA 3WBBA 3PZBA 2YHIA 1AE1A 4YJDA 2NU8A 4BKUA 4CV1A 3KM0A 1PS9A 2X9VA 5FYDA 3JQAB 3UF0A 3O9ZA 4XIYA 2D59A 3PYXA 3ROKA 4KP7A 1HRDA 4Q3BA 4ONEA 4MVJE 2YDXA 2HJSA 2LDXA 3JQDA 4TQGA 3VH4A 2VCYA 3C3XA 4TVOA 1PS8A 1EQ2A 3RI3A 1BGVA 4JN6B 3WR5A 4LMPA 1ADCA 1ENZA 3GGOA 2Y1GA 2AQIA 1J0XO 4Z0PA 5JAMA 3DBVO 3I4FA 1PQWA 2P9GA 1UH5A 3AOEA 1IB6A 2VQ3A 4KWHA 2VYVD 2Y1DA 4ZRNA 1Y5MA 1QKIA 3M2PA 2Q50A 3F4LA 5A04A 4QSMA 5CEFA 4JP2A 1BRMA 4JBHA 5IFLA 1VC2A 2O23A 1QRRA 2DPHA 3WGTA 1ZJZA 1KC3A 3GVHA 4D7AA 3BTVA 4LCJA 4UUNA 5DF1A 4EZBA 5A06A 1EVZA 1BW9B 2EIHA 2HK7A 1BXZA 3JQ7B 3ROMA 1ONNA 2C20A 2J8ZA 3GRKA 3VH1A 5KVCA 1DJQA 1YKFA 4NBRA 1ZJYA 2VUTA 4NPCA 3OMLA 5JDIA 1IY8A 1I2CA 1F06A 1DDOA 3E82A 3PWZA 2H6EA 4XDYA 4GLOA 2E82A 4CR8A 2Q2VA 4E4YA 5KVQA 4CLDA 5JC1A 4GGOA 4EGFA 4QTZA 3QWFA 4OSOA 3IP1A 4HNGA 2AQKA 3CPSA 3HUDA 4CQLB 2PV7A 4NHEA 3I9JA 5LDHA 2C2XA 1CIVA 1T26A 2Z95A 4DIBA 1GQQA 2EKLA 1K6JA 3LF2A 4TRMA 1PJQA 1X14A 3FRJA 3I9OA 4B79A 2O2YA 1MV8A 3DBLB 4HUJA 4U5QA 3RAJA 2IXAA 5C3MA 1ONPA 3DMTC 3V2GA 4CLRA 4FPXA 4M55A 3ETEA 4BGEA 4RZHA 5G4KA 1U3VA 4RPKA 1ZXLA 5KIAA 3WMWA 4CMGA 3NTQA 3OQ6A 5CP8A 2OFPA 1Y8RB 3Q9UA 1OI7A 3CSDA 1VJ1A 1YE3A 2ILTA 5C7OO 2EW8A 2W90A 4JGBA 3P2OA 1LLCA 1E6EA 1XR3A 1B8UA 1O89A 1PWZA 1LQTA 1JAXA 1B2LA 1CQIA 3R6DA 2A35A 4C7JA 1XSEA 3QP9A 2H63A 5L7YA 2JJYA 3G3EA 1TT5A 4OIMA 4W99A 4ALIA 2UYYA 4J1TA 5ITWA 3GNQA 1DEHA 4DTIA 2UVDA 1K0UA 4IM7A 4E5NA 4TMFA 2OP0A 4XR9A 1PJSA 3MWDB 1ZKMA 2JD2A 5JLAA 5JMPA 4B3IA 1QYXA 1LEHA 4A0SA 1F14A 4TWRA 4BNGA 1ZSVA 1G0NA 1DRVA 1WMAA 2Q45A 3NJ4A 5T67A 2NACA 1PL8A 1GTMA 4YWJA 1AGNA 1GCOA 3ASUA 1CYDA 3CE6A 1LRLA 1Z74A 3D4PA 2FRDA 4RL6A 3RFTA 5IDWA 5IZ4A 3E9NA 1B14A 1XWFA 1OZAA 4BNWA 1ORRA 2C82A 4DGSA 1F0YA 3U09A 1O5IA 3GUCA 5KCZA 4BO1A 3WFJA 4WNCA 1O94A 1X1EA 1EDOA 2Q3EA 3IS3A 1A4UA 2GZ3A 2NVBA 4OYRA 4OQZA 3GGGA 3FTNA 3INGA 1GYRA 2D1YA 3O38A 2G17A 1P77A 3RCBA 4AJEA 2GASA 1N7HA 3QWAA 1OOEA 1LA2A 1RPNA 1VRWA 2QYSA 4RVGA 3ZWXA 4ND4A 2W4QA 1HE2A 5DBFA 3IJPA 3CTMA 4RVDA 2AQHA 4Z9YA 3VTFA 2BMAA 9LDBA 3ZWVA 3G1UA 1C1XB 3OIGA 3JQFC 2VT3A 1UZLA 4WLOA 1RM3A 3AFMA 3VDRA 4BO6A 4CV0A 1H9BA 2IXBA 4XKJA 4NH4A 4YJHB 4R9RA 4II3A 1UXHA 3BZUA 3FWNA 5DN9A 2P5UA 5IXYA 4WCFA 1I30A 3NDIA 4YJFB 3PRJA 2DFVA 1BDBA 4R1UA 3RBXA 4DVJA 2C59A 3ZWWA 2UAGA 4EITA 1XHLA 4O0LA 1CJCA 5JY6A 4W9NA 1ZCJA 5IDXA 3GMDA 4XGKA 1SO8A 1QV7A 1U7HA 1UDAA 1DAPA 2ZB8A 4IIVA 1DIHA 1RYEA 4YJGA 4MJLA 5L7WA 1WZEA 3GH3A 3PQDA 4M54A 5JDCC 3K73O 1H2BA 4HADA 5DZSA 2I99A 3BTUA 1JW9B 2VYVA 1YVEI 2BH9A 1MA0A 1HYGA 2DKNA 1WZIA 1HE5A 2RIRA 1QORA 1D1SA 1S6YA 1ENOA 3JD4A 2WD7B 3KVOA 4M86A 1AUPA 4XB2A 4B4VA 1ZH8A 5TRTA 5ADHA 5K0ZA 5GZ1A 4BKQA 4DRYA 3RKUA 1I33A 3DOCA 4FQ8A 4GMGA 5EJ2A 3ZHYA 2VWQA 1V0JA 3LVFO 5I8ZA 3FI9A 2BKAA 2VNAA 2I76A 1QLJA 4H7PA 3RROA 4NR0A 2V6FA 4OKIA 3WGHA 3RBZA 1UDCA 1GEGA 4CMIA 3U62A 1I10A 4B8WA 2B83A 2C54A 1NWCA 1VL0A 2TMDA 4EJ6A 4W82A 1RJWA 1LDNA 3DOJA 1PZGA 3JQCA 2HMSA 1PGNA 3PDJA 4PLWA 1WWKA 4Q3AA 2W2KB 3LT4A 1B8VA 1YXMA 4GQAA 4ZQFA 1HKUA 4BNXA 3Q6IA 1A4IA 1XQ1A 3RASA 3SLGA 2HDHA 1EE9A 3ZI0A 1RM5A 3L0DA 4F45A 1LU9A 4XA8A 4EYEA 3O03A 3TNLA 3WX0A 1XA0A 1GPJA 2ZB7A 3WG9A 4DPKA 1HXHA 2J3JA 3H5RA 1V8BA 4HP8A 4MP6A 2BHLA 3IIEA 1DFHA 4FGWA 5A9TA 3DBHB 2RAFA 2CSUA 3CINA 2B4QA 1YOVB 4B7XA 3H9UA 3KYDA 3L6EA 5T64A 4EUFA 5FF9A 1LUAA 2DBZA 1FMCA 1QV6A 2VUUA 4NBTA 1Q1NA 2PLAA 4BHTA 4EDFA 4R01A 4RLHA 1R15A 2P9CA 4OSPA 5JCJD 2PKQO 4P4LA 3G0OA 3V2UA 1K89A 4PLTA 4MVJA 4GAEA 1YL5A 3H2SA 3OH8A 3KB6A 3W8EA 1KY4A 4KUEA 4D3FA 2EKQA 1UAGA 1FJHA 2JCYA 5BQFA 2QW8A 3LSYA 3PXXA 3OEWA 1LBEA 2AW5A 2R2GA 3WQRA 2GYYA 4GX1A 3WTBA 4B4UA 5C5IA 4TZTA 1JVBA 2AQ8A 2V6MA 3NT5A 4N18A 1DXYA 3WNVA 1ZNQO 4OXNA 1UXGA 4W7IA 2NQTA 4YQZA 4PGFA 3A06A 5CDYA 1P33A 3DB2A 2UUOA 2VWGA 1BWSA 2X22A 5IZCC 4BO9A 3NTRA 2CUKA 1T1RA 4L0QA 1DIRA 2CVZA 4N7RA 5TNXA 5DNAA 1MGOA 3Q9NA 3WTCA 1N1GA 3RD5A 2B36A 3ZWBA 1DJNA 3LT1A 4XGIA 2CDAA 4FN4A 5AXBA 5JFOA 1ISGA 3JCZA 4BGVA 2XOXA 4PLFA 3AM4A 2C5AA 2WTBA 3IUPA 4FFLA 4D79A 4M1QA 4E2WA 3S1LA 1A5ZA 2OUIA 4WASA 5AOVA 3GPDG 4A10A 4LK3A 3QIVA 1C0LA 1WPQA 1E7SA 1U8XX 1E1NA 3RC9A 4NU5A 1LLDA 3PZRA 2VUSA 3GVPA 3JYQA 3R0IA 4IS2A 3S2GA 5L95A 1PU2A 3A9WA 1ZEMA 3RUEA 1MG5A 5COBA 2HK9A 5B37A 1M76A 1HDCA 3GVIA 5A1TA 2D3TA 3VDQA 3T7EA 4GVXA 4NQZA 2ZCVA 4R9SA 5HA5A 4BNKA 3NYWA 3BMQA 4YYZA 3OJOA 2NADA 2PNFA 4L4RA 5I7FA 3KTDA 3I1JA 1DB3A 1GYPA 3TOZA 1EK5A 1KERA 1LC3A 2IZZA 5F1OA 3LLVA 2DUUA 3WGGA 5C7LO 4YT5A 4TROA 3QV1A 3OBBA 2A9FA 3LC7O 1R0LA 5F21A 4QX6A 1GCUA 4ZN6A 3NGXA 4ZQGA 1ULUA 1HDYA 1YQDA 2YHUA 4CQMD 4DPMA 3HFGA 2X0JA 5EPOA 1ZMTA 4HNHA 3DR3A 5DBGA 5JO0A 3PEFA 1LQUA 4KUGA 1UXJA 2AXQA 4BMSA 4FDAA 1ENYA 3DAPA 3WGYA 4BNMA 4RCVA 2G76A 3K31A 1I5RA 5T6BA 4XQEA 1P74A 3H3JA 1NPTO 5A02A 4HX5A 3L4BC 4GX2A 1W0CA 1DC6A 3OM9A 1R12A 4QQRA 9LDTA 3F1LA 2BF7A 1BSVA 4IDCA 2UDPA 1IZ9A 3D4NA 1AXEA 4NBUA 4WCDA 3OP4A 2FPGA 3NV9A 3ZNQA 4DYVA 3VPGA 1XLTA 4I1IA 3JQ9C 1BVUA 2WYWA 3WYBA 4K6FA 3OIDA 4MVJM 5FFFA 4D45A 4JCOA 5KJCA 2D5AA 2JD0A 3Q2KA 2GERA 3ASVA 3F46A 2X8LA 2TMGA 2VOEA 3D0OA 5L45A 3FNEA 1FDUA 4DBVO 4J7XA 1TEHA 3NUGA 4M87A 4CLXA 1H9AA 2DLDA 2J5RA 4WEQA 4OMUA 4XX0A 3TN7A 5FEUA 2EG9A 1JKIA 5CEJA 1P1JA 5KOIA 4B4WA 3OECA 4PZCA 3A1NA 1DC3A 2PR2A 3GNTA 3KXDA 2YQ4A 1E3SA 4PIVA 1BXGA 3HADA 1YBMA 1H6CA 1FDTA 5TSDA 4NMHA 1YBAA 3O8QB 1N2SA 2CNBA 3FWZA 4DMLA 3GHYA 3S2IA 4DC0A 1B8PA 1CQJA 4AJIA 1LSOA 5ER6A 2Y0DA 4QXMA 4UREA 2GD1O 4OGWA 2C5EA 3W6ZA 2CD9A 3PPIA 3GG2A 3KLMX 3FBTA 3OETA 2GDZA 1PWXA 1YB5A 2VRCD 4O63O 1C1DB 3MJCA 5G4LA 5I9MA 4I8XA 3VZRA 2I66A 5C7IO 4E5KA 1IULA 3W4JA 1YWGO 3L77A 5JYDA 4L4XA 4HFMA 1SCUA 1Z7EA 3CEAA 3H65A 1E3WB 5A9RA 3COSA 3AUTA 1SBYA 2VWPA 3D3WB 5EERA 3I6QA 3WGZA 3DXFA 3BMCB 1U7TA 1ZK1A 4B7CA 3JQAA 2X9NA 1NAHA 4HFNA 3BTOA 3ROQA 4HV4A 2V65A 2AE1A 4N5MA 3RWBA 2GRAA 5THQA 2C2YA 3FR8A 1T2DA 4CM7A 1Z7BA 1GZ4A 2ZYAA 4ROSA 1HLPA 4LVCA 1ZVMA 4IQ0A 4EBFA 4FB5A 4JP3A 4MKXA 3R3JA 3DMTA 4XQ9A 2VN8A 4DL9A 2Q46A 4PG7A 5U4QA 1PS0A 4GMFA 4O1MA 4YRBA 3QW2A 3MJSA 1KEVA 2WYVA 4QFCA 1HDRA 2Y0CA 3QE3A 3FTPA 3AI2A 3ADOA 2X7HA 4Z0TA 5JY1A 3SXPA 1GUZA 2O48X 2CDBA 5COAA 3V1YA 3WGQA 3RSHA 1E3JA 3LZ6A 3ZWYA 5I7SA 7ADHA 1JA9A 2WMDA 3NEPX 1E7MA 2BFAA 2DBRA 3RFXA 3ZW9A 2B35A 4CODB 1GV1A 4IDBA 1ADFA 3IOYA 4AJ4A 4AFNA 3PHHA 2RH4A 4ALLA 2ZB3A 3H5NA 4I9NA 2BLLA 1C14A 1W8DA 3ADPA 1K2WA 1T1SA 3PJGA 4IMPA 3TZ6A 4AJPA 3JQ7A 1BW9A 4CR7A 2PD6A 1JAYA 1ISJA 1X0XA 3C24A 3UW3A 5DT9A 3WB9A 1WP4A 4XYBA 3WGIA 3MJTA 3ZGYA 3RJ9A 4IBOA 4UEJA 3WBFA 1NFRA 3ICPA 3I9LA 5B4TA 1I3NA 3M2TA 5BSFA 4MP3A 5TGDA 3N58A 1E3EA 4NK5A 1P31A 2Z1NA 3D1LA 3RU7A 4BOYA 3QVTA 1XIVA 3K92A 5EN4A 4MO2A 4EEXA 1HF3A 4WLFA 4WLEA 1GR0A 3HZZA 2H1SA 4CJXA 3ANNA 2WJPA 3JD0A 5A05A 2HRBA 4UVHA 4CQLA 4BMNA 4JROA 2DC1A 4BNFA 5HTOA 2OHXA 1B3RA 4PVDA 1PR3A 3HDQA 3AWDA 4MIYA 1SZJG 2JAPA 3QVSA 1P1HA 3CZMA 4L9RA 2HU2A 1U8FO 3NJ8A 1P9LA 3G17A 5DCUA 2OZPA 3DBLA 3ETDA 3W4KA 3C7AA 4WLUA 1P0FA 1IOLA 4L76A 4QT0A 4XQGA 4CQMA 1QMGA 3VHRA 4DMMA 3PJFA 2EP5A 1Q7CA 1UP7A 3WWYA 1CRWG 4L8VA 2EW2A 3JQBA 1BDMA 3H9EO 3RUHA 4Y8VA 5TJ9A 1HSOA 4L73A 4DA9A 1Y8RA 1U1IA 4Y98A 3TPCA 4WKGA 4MP8A 3LQFA 1YDWA 1K3TA 5JXWA 3DO5A 1S7CA 1JKFA 5TT0A 2X5KO 5TC4A 3PGJA 1QYDA 1NPYA 3UVEA 4CM5A 1P3DA 1PGPA 5CPFA 3ST7A 2I5PO 5H83A 1GU7A 3Q0EA 3UXYA 1B15A 3JQFA 4J0FA 3WS7A 3S2FA 1JWAB 1PR9A 3OJFA 4NG5A 3S55A 4JIGA 5GY7A 3HN2A 1RWBA 4BKOA 4PCVA 3QSGA 3HDHA 1ZZEA 2B37A 4A73A 3K96A 3QHAA 3W8DA 5KVVA 4ILKA 4DLBA 1NHGA 3K2BA 4DQVA 4D44A 3N74A 3ORFA 4XZ3A 4BUCA 4YT2A 5U9CA 1LDMA 2EGGA 1K5HA 3GPIA 3K30A 4NJMB 2PZMA 1IHXA 4IXWA 1U3WA 3ZW8A 1VSVA 3WLFA 2P68A 3W8FA 5JDCA 3DAGA 3PYMA 3NT4A 4D41A 3CKYA 4J1NA 3F6YA 4NDNE 3F3SA 4HKTA 4CUJA 2ZQYA 1PQPA 3IL2A 4GH5A 4E6PA 4ZA2A 4ZICA 2Y05A 2JL1A 4BO3A 1VI2A 1R37A 4EJ0A 2WYUA 3QJ5A 4BGIA 4E30A 1X7DA 2VHZA 1XYGA 1SNYA 3CIFA 3E48A 2YV1A 3HDYA 3WWZA 2O3SA 4KQXA 5DDIP 2VRCA 4GGPA 5JNLA 1VKNA 3S2EA 4U6SA 4BNHA 3H5AA 2H5LA 3ONEA 2YDYA 1VM6A 4GLLA 3TZKA 1BXKA 2NNLD 2C07A 4JLWA 1EDZA 4YTEA 3WMXA 3GNSA 3EHEA 5CDTA 3LDHA 4W6ZA 2O7QA 3VPXA 1PGQA 1GDHA 2I3AA 3D3EA 3VPHA 1NNUA 4DPLA 4F6CA 1GQ2A 4A27A 3NKLA 3PIIA 4NZ9A 4NFHA 3BHIA 3I9NA 4MVJD 1C1XA 1HDZA 3WGOA 1YH3A 4IDFA 4PG6A 1EBFA 2P2SA 4ZD6A 1X7GA 1DFGA 3JYLA 4JX8A 4PLVA 5U1PA 3T7CA 1U4OA 4FJ2A 4Z3KA 5AQ1A 3A4VA 4XCVA 1H5QA 5CDGA 1K6XA 4BL5A 4PLCA 4D0SA 4GKVA 1M66A 4OKNA 3ZU3A 2JD1A 5JAIA 1ADBA 3LK7A 4YJFA 3DZIA 4G81A 6LDHA 1KOLA 1T2FA 3LLSA 4BQRA 1UXIA 1SEVA 2DTDA 3BA1A 4NI5A 1EVIA 1N9GB 5KJFA 3QWIA 4Y6SA 4E13A 2O2SA 4KTTE 3DZHA 4QECA 4CMKA 5EQFA 1XEAA 1NQAO 2CY0A 3AI1A 1C0IA 1O9BA 4BO5A 1DRUA 2WDZA 4EUEA 5ITVA 3GDOA 3UH1A 2FSSA 2YYYA 1Q7GA 4B4OA 5CDSA 4ND1A 2V6BA 2NM0A 3DAFA 5KTKA 5G0WA 2WD7A 4I5DA 3NAQA 4CLOB 1RYDA 4MDHA 1YB1A 1NQOA 2J5KA 1IPFA 4M8SA 2OORA 3SBOA 2EGHA 1DRWA 1QYVA 3FNGA 3U4DA 3H4VA 4J6FA 3I4CA 2X0NA 4J1QA 4UEKA 4U0KA 2FPIA 2WWRA 2P9EA 4GX5A 3K6JA 1I3MA 1M2WA 5MGBA 4J43A 3ZZNA 5EQDA 4P22A 5LC1A 2X1HA 3ZWCA 4YRDA 4FIZA 1NHWA 4BGUA 2FP4A 4R1NA 5IZCA 2GN9A 4FOOA 3F47A 3H7AA 4CR6A 4KUHA 1IUKA 5L53A 4P38A 4JJIA 5AXDA 1DIBA 3JQBC 2Z5LA 4LVUA 2EERA 1Z73A 2X0IA 4BV8A 3ZHBA 2DPGA 4R16A 4XRRA 1R4MB 1PGJA 3RUFA 1RKXA 2B4TO 4IDEA 3UHAA 2YFQA 1GADO 2B4RO 3DBHA 4ZQHA 2P5YA 1F8FA 5CG2A 1HWYA 1YOVA 1JDJA 3RU9A 1KBZA 4D42A 5HRUA 2OOSA 1NTOA 5L3ZA 4MKRA 2O3RA 3MCVA 4L75A 4BO8A 1VLLA 1LI4A 4G65A 4CM6A 3WOHA 5THKA 3RFVA 4B3HA 1NBOA 1XDWA 3PHIA 4WLNA 4WE3A 5BR7A 3NX4A 1J5PA 5IJZA 3QWHA 2NU7A 1MC4A 3CXRA 4C7KA 5T8KC 1PL7A 2AHRA 1WNTA 1FXSA 5CPBA 4J91A 5CG1A 3IJRA 4M49A 1Q7BA 4YEDA 5DBIA 3IUSA 5L4SA 2BGMA 1T25A 3F9IA 3GC6A 3JD3A 3JQEA 3NTOA 4J0EA 4XJSA 3ZH2A 2QIOA 2X4GA 3AUUA 3AY6A 3GRPA 4E32A 3WLEA 4BNJA 4YR9A 3ZWAA 1JWBB 4UAGA 1IL0A 1E92A 4P4GA 3WYEA 3FHLA 3PYLA 3P19A 1P1IA 3EYWA 1DLIA 3DZFA 1U9JA 1YO6A 2E48A 2F1KA 3DL2A 3DHYA 5L4LA 1A9ZA 3OICA 4C4OA 4OJNA 1H2HA 2BGLA 1A9YA 5KJ6A 4UEOA 4OL9A 2PKRA 4LW8A 2WSBA 1P44A 4GKBA 4F46A 1XELA 4E2YA 4RPGA 1HTBA 5IDYA 1YB4A 2VRBA 4BQPA 4HFRA 3L4BA 5GZ6A 2IYPA 6ADHA 1SB8A 3C1AA 1KEPA 3WSVA 4O59O 3VH3A 3P7MA 4N54A 4RF5A 4WK6A 3ZV4A 2NVUB 1PL6A 1LRKA 1NYTA 4RO0A 1IHYA 1PZEA 3JQ9A 4PRLA 3GF4A 4UUPA 2IE0A 2O4UX 5FWNA 3JQGA 2OL4A 4MVJG 4IPTA 1VL8A 2HMUA 4WECA 1I32A 4OH1A 4AJ2A 1UP4A 3PHGA 4F6LA 4CM4B 1N5DA 3LC2O 4OQYA 4Z9XA 4OXKA 1N92A 3GA0A 3I6IA 1DBVO 1EQUA 2PH5A 4FR5A 3L6DA 3ZV6A 2CVQA 3QWBA 1E5LA 1NP3A 5HM8A 2VHWA 3E18A 3QA9A 4IS3A 3BMNB 5DOZA 5TX7A 1CERA 1E7WA 1VL6A 1X7HA 4BNNA 1LXCA 4MPDA 5L51A 1XG5A 1HSZA 3OJ0A 1DHTA 4A7PA 2I9PA 3FSRA 1GAEO 4K28A 1E3IA 4FJ0A 1RM4A 1KC1A 1E7QA 3GG9A 3CZRA 4IZIA 3UCFA 4R3WA 1G6KA 3TL2A 4CPDA 5C37A 3AY7A 4R68A 2E37A 4OOEA 3JQAD 1A27A 1A71A 3GMSA 4YACA 3DOOA 3PHJA 5JS6A 1T24A 3C85A 4R1TA 3DZKA 1NVTA 1L7EA 2I3GA 4I9HA 3DZJA 4CUZA 3PJDA 2Q2WA 2FZWA 1MG0A 2GN6A 1X15A 1PJBA 5K1SA 3KSDO 3X2FA 2CDCA 4CMCA 1DIGA 2R6JA 3HSKA 4NU6A 5HBRA 3SX2A 3GT0A 3N7UA 5CFZA 4TRJA 1LX6A 2OMEA 2FY8A 2W8ZA 2YUTA 1BTOA 1PIWA 2RHCA 2FWMX 3BXXA 4YJGB 3QVXA 5ICSA 1K6IA 1R6DA 4WEOA 5B1YA 3TWOA 4GL4A 1T2EA 3PJEA 1XCBA 1D3AA 3OA2A 3I5MA 2NLOA 4I5EA 4LN1A 3FPLA 4XYEA 2CVOA 4YRAA 3PVZA 1KETA 1ENPA 3IKVA 1T2AA 4TRRA 3KEQA 5JMWA 3GFGA 1HEUA 4U6QA 4XYMA 2X5OA 1VJTA 3MWEB 3G49A 2PY6A 4NNJA 2QZ9A 2WE8A 3GHHA 4FS3A 2D0IA 1U3TA 3L9WA 3PP8A 1LSJA 1SAYA 2EJVA 1ZMOA 4CMIB 1LJ8A 4TZKA 1WAMA 2IEBA 4U7WA 1Y9AA 3JYOA 3O8QA 4PRKA 4KDEA 4PZEA 2X6TA 2O3TA 1PJ4A 3L4SO 2D4AA 3IC5A 3R1IA 3AK4A 3U4IA 4OXYA 2BFMA 1D7OA 1HDGO 3AOGA 5A3VA 1JTVA 3PK0A 2HSDA 2Y66A 3JQ6A 4XR4A 1Y5RA 3PTZA 1C1DA 4G2NA 1ZK0A 2UV8A 2G1UA 4W7HA 2FHSA 3INRA 4JBGA 5CAEA 3C1OA 1LLQA 1HLDA 1KVTA 2DU8A 4RDHA 2PTGA 5I8WA 1E3WA 2J3HA 3AU9A 3RVDA 3AW9A 1JLLA 2E6UX 3E5MA 1SOVA 3D3WA 1ISFA 3EDMA 4E5MA 5BNIA 3HN7A 3C1TA 2GO1A 3PI7A 4FFNA 1PSDA 3KSZO 5IF3A 4LMRA 3TQHA 4Z0HO 1R4NB 2J3KA 2C7GA 2RBEA 2D2IA 4L74A 3G1TA 5G0TA 3SJUA 3GK3A 1MP0A 4GPD1 1FK8A 1Z6ZA 4PG4A 4PLPA 3OHSX 1I8TA 1F8GA 1D1TA 2E4AA 4BNUA 2QRLA 3RJ5A 1I2BA 3DBRB 3RUAA 2VYNA 3ZHXA 4EW6A 2PWZA 3WSWA 2HK8A 2VHVA 3D5TA 5TQVA 1E0DA 1TA4A 1KVUA 4CM8B 5JC8A 4PZDA 3CMMA 4MINA 4JJFA 5ILGA 5EL0A 4CV2A 1Q0QA 4DQXA 4LSMA 5ENDA 4JJGA 4J49A 4YA6A 4DC1A 1GD1O 3VPSA 3K2EA 1ZK3A 4LISA 2AEJA 3E6AA 3KSUA 5JSFA 3JTMA 3K9QO 3GDGA 4LCEA 4BB6A 4K6CA 3GUYA 1NWHA 1W73A 3VVBA 4ZQBA 2IYOA 3PQEA 3PHLA 2Y1OA 4BNTA 4RGBA 4BO0A 1VKOA 2YQ5A 4RJTA 1IPEA 2R00A 1MUUA 1Z45A 4IJKA 4P4NA 1MLDA 3D4OA 1DC5A 2DTXA 3GEDA 4E0BA 4XD2A 3SEFA 2JFFA 4R5MA 1KYQA 3KRTA 4J7CA 5K6AC 3DDNA 3OIFA 3UCEA 4EJMA 4YAJA 4TVBA 1U5AA 4RVFA 4J4BA 5ES3A 4CLEA 4WLVA 4M89A 4A2CA 2Q99A 2X86A 2IZ0A 5HS4A 3BTSA 1H93A 4KWIA 4PN3A 1E6WA 3U0BA 3E5RA 4J7UA 1LNQA 3EC7A 1LSSA 3PLRA 1HE4A 1YL6A 2UUPA 1ONOA 4OHUA 4GVLA 4CM9A 1Y1PA 1WW8A 2VOJA 1YJ8A 4QO7A 1JN0A 1G1AA 5L4NA 2BD0A 1DIAA 1DPGA 3PWSA 4TRNA 3TDKA 1X1TA 4MVJP 1ZFNA 3H2ZA 4KMSA 1U28A 3W4IA 4FFPA 4IY1A 3GR6A 4FC7A 1O8CA 1LDEA 4J9UE 2Q1WA 4DLAA 4XQCA 1XQ6A 2YV2A 3AJRA 5G0UA 3FBGA 3KYCB 2VHXA 4XDZA 5G0VA 4P8RA 3IDSA 4IMRA 3TL3A 1NVGA 2GPTA 5JE8A 3AI3A 1ARZA 3QVOA 4RV9A 4XEHA 3EK2A 3ZU4A 2PK3A 1WDLA 2HUNA 1GEEA 4IJVA 3HE3A 4INAA 3LYLA 2Y0EA 5MDHA 3GLQA 4AG3A 4WGGA 2X9GA 1E5QA 2HAEA 1J6UA 1EFLA 1I01A 1X13A 2ET6A 2HRZA 4CL8A 2FMUA 1GL3A 3KO8A 3JQ8B 5ICMA 2DFDA 3VZPA 2WE7A 1H6AA 1UR5A 2VZ9A 1YRLA 3PLNA 1GQYA 3WIDA 2PZJA 2IRWA 4DREA 4LRTB 3OQBA 1M75A 4NBWA 1SB9A 4YQYA 1GPDG 3QRWA 1HZJA 1R0SA 2VHYA 3U5TA 1YQXA 4BNVA 2OGUA 4NJMA 2XF8A 4MOWA 3GZ4A 3I3OA 4CM1A 5JAQA 1G0OA 1W6UA 4YCAA 3JYPA 5KVSA 1ID1A 3G79A 1E7YA 1JKJA 1DHRA 1UZNA 2OBYA 1FDWA 4FD3A 5TT1A 3WQSB 2O3QA 3H9GA 4GX0A 2P91A 3O26A 1TT7A 1E1MA 4D3DA 4J2OA 3WFIA 4YAIA 1OC4A 3B20A 3GY0A 1VJ0A 5CEEA 3A28A 5H82A 5G0SA 3S8MA 2OP1A 5A9SB 1NR7A 1Y7TA 5AYVA 2BRUA 1ISIA 2Q1UA 5TF4A 1HT0A 2BI8A 2VT2A 3FF4A 2Q2QA 1ZK2A 3GGPA 3NRCA 3GZNB 3NDJA 1WDKA 3EUWA 4K26A 1XGKA 2YW9A 3VH2A 3W6UA 1I2ZA 2HO5A 2AMFA 3BYZA 4II2A 5JYEA 1SOWA 1O6ZA 4CMEC 5DP1A 4Q9NA 3UFXA 3C8MA 3MEQA 3IKTA 3VAZA 1T4DA 4A26A 4FFOA 3V8BA 2VTEA 1ZXBA 3UN1A 3PWKA 7MDHA 3OSUA 2NWQA 1U2GA 1ZIDA 3EGOA 3F4BA 4CMHA 4R54A 2BGKA 1QYCA 3TZCA 2NV6A 5F1KA 4H16A 3GAZA 3P2YA 3LT2A 2RCYA 4QEDA 4E5YA 3B70A 5ER9A 3E03A 2WEKA 2J6IA 2NSDA 3EW7A 3TOXA 4Q3CA 3ZWOA 5A5FA 1M6HA 1NVMB 3GEGA 2R00C 2XXJA 1EZ4A 1YGYA 2JCVA 1PZHA 3WXBA 3WNQA 1QP8A 1HE3A 1N9GA 4QFDA 1J49A 3CH6A 4ND3A 4CUKA 1JU9A 4IIUA 5T8KA 2O50A 5B4VA 1VE9A 4UVDA 1P1KA 4BKRA 2ZB4A 4DXHA 1KEUA 4MVJF 3ENNA 1I3LA 1NPDA 4AJ1A 4E2ZA 2W2LA 2V7PA 1TI7A 4BS9A 1W4ZA 4ZGWA 1C3VA 2FZEA 2Q4EA 4E3ZA 2PH3A 3L6OO 4CLOA 1SMKA 3KZVA 5GZ3A 3AU8A 4IJWA 1Q0HA 4Y9DA 4D3SA 4IUYA 3RC2A 3JD2A 4PVCA 2ZTVA 1MXHA 5G2OA 1N1EA 4E21A 3WQQA 1V9LA 4AJKA 5IXSA 2QG4A 1L7DA 4I5FA 3BMOB 1DC4A 1EK6A 5KKAA 3WDSA 5IG2A 1LSUA 2A92A 3DQPA 4FFMA 4ZU3A 3VZSA 1HZZA 4HWKA 2Q4BA 5AVOA 3F5QA 2CF5A 2ZK7A 3AM3A 3ZN2A 4DWVA 5COQA 4KOAA 2IODA 1Y9EA 2BFOA 3UICA 3DZBA 5K9ZA 4IZHA 1R4MA 5DULA 3FPCA 3ZHZA 3EY4A 3I83A 4PLHA 2V6GA 4A03A 1B3BA 2OBNA 2HMTA 4FJ1A 4XYLA 4URFA 3D64A 2ZKLA 3OA0A 1EVYA 3H6KA 4TSKA 1Y8QB 3FNFA 5FI5A 2BELA 3V5NA 3PFFA 4S1VA 1ZSNA 1NR1A 3E8XA 3ZV5A 3I9KA 3HNPA 2QQ5A 3HWRA 4YB8A 4LSWA 2DUWA 2YHIB 1DSSG 2ZCUA 4O5OA 2JFGA 4YJHA 2JAHA 1O0SA 4KDFA 4R3NA 2Y99A 1HETA 3JYNA 4WOKA 4D43A 1HL3A 4IINA 4CQMB 2X0RA 3VKVA 2EJWA 1BMDA 3EVNA 4B8ZA 4E33A 3KETA 2ZYDA 4JBIA 4PLYA 3RUDA 2PZKA 3GN1A 4K9DA 1A7KA 4D46A 1V3VA 2PZLA 4CMBA 3UGKA 1NAIA 1YL7A 2ZTMA 3CMCO 2Y93A 3L07A 3RUIA 2NUAA 1E3LA 4PG8A 1U3UA 2YJZA 4AICA 1UAYA 1V35A 2CF6A 1GYQA 5A03A 3OF2A 4DUPA 1Q0LA 4IDAA 2PFGA 2GZ1A 2VNSA 1ML3A 3B1JA 3DHEA 5CDUA 3U9LA 4R4JA 2X23A 4JK3A 3E9QA 3E9MA 4GWKA 2QZZA 4BB5A 3KBOA 2I67A 2EEZA 1D4FA 4LRSB 3ZU5A 2O3UA 3VPFA 4WOJA 2CMDA 2ZIZA 1KY5A 3MTJA 1DOHA 4KQWA 2AG8A 2QRKA 2C29D 1P1FA 3KOUA 1NFFA 3PIDA 2FR1A 4RPJA 3TFOA 1Z75A 5GMOA 1LLUA 4I08A 5IN5A 1J4AA 1ISMA 1H0KA 1NXQA 3QVWA 2GNAA 4NIMA 4E12A 4HFJA 4FCCA 3H3FA 2NVUA 2Y67A 1UJMA 1EE2A 4UVEA 4QUKA 4AL4A 2W2KA 4BNZA 2WM3A 4DBZA 3RUCA 3W1VA 3AY3A 2XXBA 3T4EA 2Q1SA 1ZSYA 3ONFA 2JFHA 2Z1MA 4MIOA 4XJTA 4CM4A 4DIOA 1GUYA 4CV3A 3JSAA 4QO8A 4RF2A 4HBGA 3M1AA 4J1SA 1N7GA 2AEMA 3DMYA 3ROPA 4PG5A 5TLSA 1NQTA 3BMNA 1NQ5A 2G82A 4AJOA 2I6TA 3ONDA 1QSGA 2JKVA 1U2DA 1N8KA 4ALNA 2B5VA 3V2HA 4J16A 1I0ZA 3D7LA 3ICCA 5EMHA 3T4XA 3P5SA 2YFHA 1WXDA 2C7VA 3R3SA 5ENVA 2F00A 4CLRB 1MX3A 4NK4A 1EBUA 3LC1O 2QHXA 5EINA 4J90A 4YPOA 4GI2A 5G4KB 2OXIA 4K1LA 1FDVA 5HS6A 1B7GO 4ALJA 1B16A 1HDOA 1U4SA 3AOEC 1CDOA 5TS3A 3EAGA 3TSCA 1OC2A 1AHIA 4UUOA 5HWSA 3ANLA 1GV0A 1MFZA 4J4TA 3WICA 3ETGA 4YXFA 1IZ0A 1P45A 1R0KA 1D8AA 4RVUA 1I3KA 4XYGA 2VYND 4BNYA 2Y1FA 1A7AA 4ND5A 5IN4A 2X58A 3RBVA 3STHA 1KS9A 3BAZA 4U0JA 2DM6A 3EZYA 5DCWA 1VPDA 3PQFA 4EUHA 1TT5B 1UUFA 2FPPA 4YVFA 5A4DA 1R16A 1WLYA 2PGDA 1MXFA 5JDIC 3FD8A 4R69A 2A4KA 3U4HA 3ULKA 4YDRA 1GUFA 4ID9A 4Y67A 4BVAA 3A14A 3F5SA 5I9LA 3DFUA 4RF4A 2DTEA 1EEHA 1EUDA 5LDGA 2OO5A 5I9NA 2JHFA 3NT2A 2P4QA 4ND2A 5IDQA 2XPCA 5FI3A 3DHNA 3OQ1A 1WDMA 3D5QA 3VZQA 3VOSA 5F5NA 1YDEA 5A3JA 3KEOA 5IAAA 2YZ7A 4MKZA 4IQGA 3SLKA 1ZW1A 4OAQA 2GCGA 1T2CA 3B6ZA 3Q3CA 3DWFA 4IDDA 2NTJA 3SVTA 1PJ2A 2A94A 1PJTA 1DFIA 2Y1EA 3ENKA 5JW6A 4CM9D 3RIHA 4JQCA 1F17A 2E49A 1QYWA 4MVJH 1OAAA 3HJAA 3K5PA 5F5LA 3TF5A 4X54A 2EXXA 4O6VA 1GZ3A 4LGVA 1ISHA 4MVJI 4FSHA 5K6AA 3U4CA 2AA3A 2VTDA 5KWEA 1U5CA 3HDJA 5F1PA 2ZTUA 4ZJUA 4RPHA 1QXSA 3VVCA 1P1RA 4GSLA 4R5HA 2D8AA 3GAFA 3OJEA 4TKMA 3AFNA 4GBJA 5ILOA 1R4NA 1GFSA 4J9VA 8LDHA 2HJRA 3V1TC 3BHJA 4WCFB 2IZ1A 4RZIA 2AEFA 4EEZA 4FFRA 1XU7A 4F3YA 4RVHA 2GN8A 5BNFA 3WJ7A 2DT5A 3DBRA 5EIOA 1X0VA 1EUZA 3HB5X 3ANMA 3PDUA 3WIEA 2ZQZA 2X5JO 5L9AA 1UDBA 1SC6A 4IDGA 3DTYA 1YJQA 4NFSA 3B1KA 3OEYA 4RQUA 3DONA 3F1KA 3JD1A 4CM8A 2H9IA 4AJNA 3BIOA 5DOVA 1SEPA 3VC7A 1SPXA 3B1FA 4H3VA 5T5QA 4Y6RA 3SC6A 3GFBA 4UVGA 1Y6JA 3IQDB 4GWGA 2EKPA 5KNLA 3GQVA 2BFPA 4AVYA 3GN2A 1LTHR 5F3RA 1E7RA 1KVQA 2JHGA 4CMAA 5JAZA 1IE3A 2ZTLA 4BKPA 4IXTA 1NASA 4BO7A 1PX0A 2FR0A 1AN9A 4DYDA 2HKIA 3GDFA 1NM5A 1EFKA 5B4UA 4Q39A 3AM5A 2SCUA 2POQX 1TXGA 1XKQA 2DBVO 1H6BA 2C0CA 1UXKA 3FR7A 3M6IA 2ZATA 5J23A 2RH8A 5I7VA 2VZ0A 1KIFA 3JQGB 2RHRA 4JNKA 2NVWA 1JVSA 1ZBQA 2B0JA 1ULSA 3I52A 3UAGA 1YS4A 3KUXA 4N5NA 3H8VA 3ZU2A 3RKRA 3ABIA 5TJHA 4Z6KA 1MFPA 4CLHA 2DVMA 2GLXA 5L7TA 4R41A 1MB4A 4OOFA 1HDXA 2NU6A 2Y68A 4J2HA 4XGNA 1I36A 3M1LA 4D0RA 1KVRA 2EV9A 1ZUD1 3KYDB 2FR8A 4XWYA 2D5CA 2NTNA 3NDRA 4PLZA 4WCFC 5BSHA 4ZHSA 1B0AA 2DAPA 3ON5A 4FC6A 3C7CB 1XU9A 1UZMA 4OO3A 4CM3A 4YAGA 1DAOA 1CWUA 3UCXA 4RF3A 3LT0A 3PGXA 3SJ7A 3BMCA 4W9NC 3LU1A 3BHMA 3HQ4O 4Z9FA 1ZK4A 1YQGA 4ZVVA 1E6UA 4WPGA 3QY9A 2QRJA 3RQSA 1LDGA 1GY8A 1PJCA 2QYTA 3O4RA 1Z82A 4DIFA 3U49A 3KYCA 3V1UA 4IJUA 5T57A 3MJ4A 4PFJA 4ALMA 3ZNOA 4ZQEA 3MJVA 3IAHA 3TFQA 1ADGA 3RC1A 1CF2O 4CMEA 4YT8A 5A5EA 5KJEA 3WJAA 2Y1CA 4H15A 5DCYA 3U3XA 2AG5A 1V3TA 4B3JA 3ZNNA 4Q3DA 3RC7A 4J4HA 4NBVA 3ZNPA 5AXAA 2GGSA 8ADHA 3FN4A 2QX7A 3KV3O 5KKCA 3UUWA 2VZ8A 3OJLA 2NQ8A 5CHEA 3TZQA 1QG6A 3MZ0A 4BNLA 1GZ6A 2EP7A 1EVJA 4TKLA 3JQ8A 3HG7A 1NX6A 3MOGA 5BT9A 1BG6A 3WYCA 4J3FA 3PFWO 4PLGA 1TLTA 1UP6A 2W2LD 3ZWNA 2HMWA 1WMBA 1ZO8A 1KEWA 1CEQA 2G0TA 4W4TA 5BSGA 2I65A 2HQ1A 3INTA 4BO2A 4RORA 4FBGA 2DQ4A 2EF1A 3AUAA 1LC0A 1YBVA 1PQUA 3NGLA 2HMVA 5H81A 4KTVE 4FOSA 3ZWPA 4N5LA 2GUGA 3MJEA 3TZHA 1B26A 5BSEA 3GVXA 5B12A 1M6WA 2PGJA 4I5GA 4Q3EA 3ZWMA 3Q11A 4L4SA 3MTGA 4S3MA 3EMKA 1QLHA 2HLPA 1PGOA 1R66A 3EVTA 4U8GA 4IQ8A 3I23A 3E1KA 3LF1A 3HFSA 2GN4A 4BMVA 3KLPX 1PTJA 2PD4A 3TJRA 4BO4A 4UUMA 1PZFA 4NJOA 5A9SA 4E2XA 2YV3A 1LRJA 3QQPA 4KZPA 2BI7A 1RM0A 3DC2A 2W98A 4OM8A 3GVCA 4YAKA 3UOGA 2B69A 2JCXA 5JO9A 5TIIA 1AXGA 5DP2A 3BMQB 3FCOA 3L9XA 3GZNA 4YAEA 2IEDA 4XB1A 4G5HA 4RQTA 4CL3A 4FGSA 3MOIA 4ITUA 4Z3DA 4FW8A 1C0KA 3GOHA 4B7UA 1O95A 1Y81A 4Q3NA 2NU9A 2DBQA 4WNIA 4HY3A 5JCJA 1LDYA 1M67A 3I9MA 2CFCA 2O7SA 1NFQA 2FN7A 3OFSA 2J3IA 5BNTA 1FF9A 5I7EA 1V3UA 4UULA 3CUKA 4RDIA 3ZV3A 1E77A 4XIJA 1YONA 2J5QA 4RLSA 2CZCA 4UVIA 4JXKA 3TRIA 3H9JA 4WUVA 4XRGA 4WJZA 2G5CA 4RPLA 1HYEA 3X2EA 3Q1LA 3EZLA 3QLJA 1JQBA 1OBFO 1PJLA 1L1FA 1CETA 2PA3A 3KYBA 1C0PA 1V6AA 3JV7A 1TVEA 2GF2A 3IP3A 3FNHA 1E1KA 4RVSA 4MIEA 3K8ZA 4E31A 1F12A 5JBIA 1DLJA 1PEDA 4ESOA 3AUSA 1LDBA 1MC5A 3ITDA 1PJ3A 4CMJA 4GSKA 4AJHA 3C7DB 4ZRMA 3VTZA 1I24A 2NTVA 4AJJA 1E1LA 3GEMA 5KJ1A 2HCTA 3H9QA 4IGFA 1EMDA 2FOIA 2P4HX 1DO8A 2VWHA 2EHDA 2PKQP 4IGEA 2O4CA 3ITKA 1VSUA 1WVGA 3DEYX 3HB4X 3SC4A 1AHHA 1IYZA 3VKUA 1Q2XA 1H94A 1TB4A 4DLLA 4BNIA 2PGLA 3UKOA 1BXGB 2ZJ1A 2Q49A 3BMOA 4A5OA 4AJLA 4R51A 2YY7A 4HXYA 2GR9A 2WD8A 3ZDFA 4DQUA 5LCXA 3DTTA 4ALKA 3DFZA 4YBZA 1FDSA 1KVSA 2Q1TA 4BIIA 2PD3A 2LDBA 5EESA 3HHPA 1QR6A
chains in the Genus database with same CATH superfamily
3JAMA 1GGMA 1TYZA 1C3OB 1OFGA 1H8HD 1DEKA 1O94D 3DWEX 4IFBA 3T34A 2B7CA 4Y6PA 3BZBA 1CDEA 3ZY2A 4ITRC 3GLGB 1P0CA 1W1UA 1OMOA 2EKZA 2RI1A 2GSDA 4JUCA 5TPWA 5B58T 4YT4A 1MORA 2GZ2A 3DKPA 3FUWA 4UOZA 2VPYA 4JT2A 3EH1A 4OJYA 5EIHA 4U39A 2QB5A 6YASA 1QH1B 2IXTA 5F23A 2RGRA 2JFQA 2V1XA 4HNUA 5I7WA 4I9UA 1K63A 3HVJA 4KG7A 1E0JA 3K1TA 1IDN1 4LDRA 1SHZA 3WBBA 3RYIA 1AE1A 3B9RA 2NU8A 1PLJA 4D56A 1OYOA 2X9VA 4JZKA 3JQAB 5TXGA 3UF0A 3QH4A 3PYXA 2VF4X 3LDGA 4KP7A 2WJVA 3WWCA 2AYZA 4IXNA 4J8PA 3A0RB 4AZTA 5DGHA 1IY2A 3ZWKA 4MVJE 5DEIA 3Q6MA 1E5DA 1OIXA 2GAOA 2YDXA 2PEZA 2DWOA 4FYYA 1RPTA 1E4EA 2R1TB 2G0AA 3VU8A 4ATNA 4ZI7F 2C8KA 5K03A 2H8GA 4TVOA 2JAOA 5ALLA 1UKAA 3DF9A 1FNNA 1BGVA 3WR5A 1K08A 2VPXA 5AK4A 1ADCA 3TKYA 1Z0UA 2Y1GA 4JWKA 1UZAA 5E2BA 4TZ6A 1KMCA 3CNOA 1QHGA 4GKKB 5H16A 4UBLA 2BAGA 2GO7A 5T4EA 3WADA 4HEJA 3GU3A 4IRMA 6GPBA 5IW8A 1H4TA 1PQWA 5F73A 3EIQA 2BEWB 2D7CA 4IJQA 5DHSA 1OTXA 1LI7A 4DCMA 5I5EA 3QTTA 4MV9A 4QBGB 1BS9A 1WSBA 1RFLA 3OE7D 4NYIR 1E2KA 1C4WA 2Q50A 4FVTA 1QGUB 1T8RA 5SYAA 4QSMA 1IOVA 1E3TA 3RK4A 1E9RA 1L5RA 3CF6R 5DHQA 1BRMA 1HDIA 2BKEA 3ND8A 4JBHA 1C7IA 1KAMA 1VC2A 5IFLA 2O07A 2IPNA 5ANRB 2ZJ7A 4G84A 4GNKA 3GVHA 1Z8DA 2XRMA 1U0TA 3I28A 4IHAA 1FE8A 4QBIA 5DF1A 5J4LA 3R9XB 5A06A 4C7BA 1KI9A 2EIHA 2HK7A 1OLXA 3OZTA 3SZOA 2OC9A 1ONNA 3GRKA 1SCAA 4AQYB 1WZNA 3RS9A 4AP9A 4UMEA 4ZMSA 1ZMRA 3RYHB 4BFXA 1MZPA 4LQLA 1WHTA 3OMLA 4NPCA 1XL0A 4DMHA 3VR4A 3K8OE 5MN5A 4EKIA 1I2CA 1F06A 3I4LA 1N5MA 1AQYA 1W4AA 1K97A 3BH0A 1T91A 2P7IA 4L27A 1KMQA 1FSZA 5GONB 2AN1A 4AY3A 1GT6A 3S28A 2RE8A 4YP1A 4YONB 2R6AA 2Q29A 1TQ2A 5HZHA 3QF4B 1NN1A 4KRXA 4NWIA 1R6UA 3A7EA 3CTPA 5KVQA 3ZCUA 5KWIA 1TVMA 4EGFA 2CUTA 4QTZA 3QWFA 3GLKA 3JW8A 3DWIA 1KBOA 1BFKA 3RKSA 3BKXA 3OZBA 1YCGA 5DNDA 3RVBA 3KOZA 4G97A 5BQ5A 5E7JA 2Z95A 4S1WA 5EE3A 4B6OA 2YNMA 4D9NA 4DIBA 5B1EA 3TGPA 1X8JA 4JJEA 2XLCA 2EKLA 3LF2A 2ZE6A 1I6KA 2V7QA 5SY6A 1XZBA 3O47A 1PJQA 3F8SA 1GG9A 3NHMA 5GVSA 5KHOC 3FRJA 4KV7A 4C0QC 4B79A 1L8OA 5F3DA 3DBLB 1FTQA 3CC8A 1CNEA 3OQIA 4U5QA 5C3MA 3J81k 1XNQB 3VR3D 1R3UA 2EX1A 1NLZA 4LZOA 1KZ7B 4BBAA 1RYBA 3P0FA 5KSOA 3IVMA 4HN4B 3ETEA 4BGEA 4DJAA 1U3VA 2BZ0A 4FWIB 5JJCA 5DPMA 5G53C 1L7XA 1XEXA 2GN2A 3IO5A 3L1UA 3M4YA 1CDDA 4DCCA 1GVHA 3OQ6A 1CUEA 3I39X 3NPAA 3KCQA 1Z6PA 3LIPA 2WHEA 3A6KA 2IUEA 4G23A 4L85A 1HLFA 5PGMA 1K92A 4FS8A 2ST1A 1GNRA 1QFSA 2IU6A 2NV2B 3CSDA 3K0KA 2V59A 5FUYA 2H7XA 3SZUA 4H1VA 5EJGA 3T95A 2ZAGA 2QJTA 1O6GA 1T34A 2W90A 2HBYA 4W5HA 1P2UA 1AS0A 2FNAA 2VTBA 3F0TA 4XUGB 3Q5EA 1W1IA 4Q24A 3UWSA 1CQIA 2FVXA 2VJDA 4KKXB 3QP9A 3NMUF 1NQWA 5I4KA 3LS2A 1G59A 2K5UA 4P35A 2JJYA 5L7YA 4Z51A 1TT5A 3WRXC 1OLUA 1DWUA 3IALA 3K2QA 4RZ2A 4ALIA 7ABPA 5ITWA 5JZBA 3UNXA 4RA6B 1ZN9A 3UWOA 2E1PA 1DEHA 3P20A 3ZYCA 1RYNA 1I94B 2UVDA 4IM7A 3WLRA 3NAGA 1N8TA 3O8OB 1GAJA 2Z2YA 1KA9H 4YGYA 5EPEA 4QOGA 1A95A 1II9A 4UHHA 3JPWA 4B3IA 1QYXA 4BQFA 1PKXA 4TWRA 3RSZA 4UQLA 2OVFA 4F2HA 1RRVA 3TD9A 2WICA 2O8CB 3RRJA 5KSYA 2OV6A 1W6RA 5AESA 2Q45A 2CE7A 2OOKA 3OTQA 1SCIA 5JECA 1NF9A 1JQDA 5JJIA 4YV2A 1A76A 2WB4A 1UPTA 4X97A 4YJ3F 2CW5A 4WHMA 3N0VA 3Q5GA 4EHFA 3ASUA 1QH8B 4AZ3B 4E94A 1U80A 1Z74A 3FOCA 4G89A 4U7JA 3AV3A 1JMVA 1B14A 2AD5A 1WL8A 3QXGA 4ZHQA 2I33A 4FLFA 4XM2A 4DGSA 1F0YA 3C16C 5JJKA 3E8SA 5KCZA 1IXSB 1DKPA 1NOJA 3OUZA 4O2AF 4BO1A 4EP1A 2C9BA 3DBIA 1H8HA 1O94A 4FSXA 1CUSA 1EDOA 1QAQA 4OYYA 1FQKA 1KQFA 1G8AA 2NNWB 3EZ9A 3QBTA 2H51A 5HIJA 3VHQA 4WNAB 2FQQA 4A1FA 1Z28A 7MHTA 1CVRA 3TSWA 4U7TB 2DHDA 5D86A 2JF0A 1QX3A 1TVCA 3O38A 4WI1A 5IHPA 1M6VB 4AJEA 1N7HA 1M2JA 5AHWA 1LA2A 1IY0A 2ODTX 3L6BA 3EPKA 1L7MA 2W4QA 4ZOBA 4TGLA 2AKAB 2QUJA 3EC1A 3T0GA 3S8YA 2QZPA 1T5DX 3LUBA 4RY8A 3VR5H 1XRMA 4HVLA 2ZSHA 4YRPA 5JHHB 3R7WA 2ZYTX 3OIGA 4A0GA 1YR1A 3KJQA 2WA2A 1GRVA 1LY1A 2X4IA 4YO7A 121PA 3I5UA 1QO0D 3QEKA 4BKMA 3HCOA 2C4VA 3VDRA 1ND5A 3Q7SA 1KIAA 4YJHB 4F8EA 2GPWA 5FWAA 2IX3A 4TKVB 4B6PA 4Y1RB 1UBMS 1VMDA 1RWWA 2IY7A 4IILA 4R9RA 1UXHA 3KSBC 3L4JA 3PF8A 3UO8B 4G5FA 4YMIA 5IXYA 2HSJA 5JOQA 4AYTA 3FROA 2WKRA 1BHQ1 1U1EA 3ADBA 1IVNA 2Q9BA 2VJMA 2VT6A 3B9QA 4OFXA 2PXXA 5LBUA 1M6YA 1DVRA 4LGCA 1BDBA 3TB6A 2WG2A 2C59A 4EITA 1MJHA 1E8NA 4O0LA 1CJCA 3VJMA 4PSDA 4MLZA 2QD1A 4CG1A 1DAPA 2QP3A 5E0KB 1U90A 1JDBB 2COUA 4MJLA 2AFHA 2ATEA 3ZK9A 3UQZA 4Z53A 1W5AA 3GH3A 4FN5A 1XCMA 3KWLA 4RQBA 5JDCC 3K73O 4PX5A 3WLAA 1U9ZA 4FI3C 4ND8A 4IV0A 3V7NA 5LXTF 3OE7A 4HDRB 1NDUA 4DOMA 3KXKA 2GVZC 3D81A 2R11A 2DKNA 3ONNA 2CBGA 3B1ZA 5JQWA 2O9JA 3FMIA 1MIOB 4B43A 2IA5A 2JGKA 4O2BF 5K0ZA 4JUIA 4LTMA 1AUPA 4M86A 4XB2A 1DQRA 4J0QA 4BRSA 4LEIA 3FH0A 1I33A 4UARA 1TIBA 3IGFA 3HB1A 1X42A 1KGDA 3UHJA 2HM7A 5D51S 1K98A 3PFBA 3OLYA 1O5OA 2VF8A 2WJ6A 2VJKA 2H2FA 3FI9A 1GRQA 4HAVA 5I8ZA 4BNLA 4HATA 5A5DA 5I4CA 4P58A 5FI1B 2P3QA 1IBMB 4NBKA 4QU0A 3WK9A 4X1IB 1L5HB 1UDCA 2K2WA 2XYGA 3U62A 1I10A 4O4IA 2QI9F 4Q3KA 1NWCA 3TOVA 1CBUA 1HDEA 2PSHA 1RJWA 4REMA 4WXMA 2YJTD 1PZGA 2GBFA 2HMSA 2HQBA 3CX8A 3F6BX 4Y2VA 1Z17A 5CVCA 4AZVA 3MTAA 2VXBA 1WWKA 4W9MC 2V1UA 4EMBA 1FW6A 4BNXA 3BGSA 3AFHA 1A4IA 2C0PA 3K7EA 3DP7A 3K6KA 1HA3A 3KV1A 2EWVA 3W5VA 1I1HA 2RC5A 4D1YA 5BT8A 2WMOB 5E9WA 2V0CA 1LU9A 5JPCA 4EYEA 3JARB 3KDAA 3FM9A 4QGFA 2NAFA 1WLSA 1JR6A 1L7BA 2I6UA 2ZB7A 3ZE9A 1A4XA 1V8BA 1BQ3A 5DISB 2WK1A 4R40A 4BDSA 2BHLA 1DFHA 1E9CA 2AJCA 2OG1A 3F7NA 4HSEA 3IV9A 3QVLA 3TR0A 5IC6A 4Y9SA 1H2XA 4B7XA 3GLFA 1JRLA 2GHQA 4X6LA 1VPWA 3SSMA 4EY4A 1QV6A 3GPCA 3A32A 4NBTA 1W49A 5EZ6B 2UZ1A 3O2NA 3UMGA 3VR3A 1S9DA 4RLHA 1Q0PA 1XZDA 3D2AA 4R7ZA 2PKQO 5DO9A 2BEUB 3BX1A 4KXXA 1LGYA 4KHZA 1SXJA 1Z39A 4V0QA 4ENQA 2I4LA 4ARCA 1X2BA 2W00A 3N70A 3NCHA 3SYRA 4F9FA 3H2KA 3CX7A 4RANA 5ULLA 2EKQA 1FJHA 3AEYA 2OENG 3LSYA 3L4KA 4JLOA 3RGWS 3TJZA 2O8FA 3QEBZ 4MV3A 2O54A 2IU0A 1U9YA 1K7XB 2C2KA 3KPUA 2GYYA 2ZEJA 3I9V1 4GX1A 4OHXA 1YI1A 3WTBA 2B20A 3ZVNA 2H4YA 2PEYA 3L8EA 1AK2A 1QGDA 3E7FA 4KNWA 4NAHA 2OYCA 1JVBA 2V6MA 2MU1A 5CT9A 2RHGB 3A9RA 4K88A 1ZNQO 2RGWA 3C3EA 3I2FA 5FD8A 1FUUA 5A4MS 2FYTA 2O8NA 2R8YA 3MJRA 4I9FA 2V9CA 4JOCA 3QFHA 4MZXA 4YQZA 3SJBA 4PGFA 2FRDC 3PFIA 4E1BA 4S24A 4XLZA 4NKRA 3D8NA 1OWLA 3IAM1 1YKGA 2Q62A 3QOWA 2A5LA 1CUZA 3N2GB 1GPH1 3ICOA 4TTIA 5CCBA 5DNUA 5CJ2A 4LFAB 4L0QA 2CUKA 5DYIA 5DNAA 2ZW9A 2DECA 2C2ZA 3AXTA 4FCTA 1A82A 3LT1A 3ABRB 4TTSA 3UYKA 3RTAA 4LYHA 4FN4A 5KTNA 2J33A 2PIDA 2AFIB 1QS0B 2AS0A 2JANA 2PUTA 4DCOA 2PMDA 3D8RA 4BGVA 3QKSB 2QW0X 1N5OX 4Y7DA 1QIGA 2WTBA 1JTFA 4FFLA 4KRGA 1C8BA 2XMZA 1A5ZA 4WASA 4KFCA 5AOVA 3WDLA 4LE1A 4DJJA 1UWLA 5CVVA 2GM4A 1JEJA 2QVXX 4CCYB 1U2RA 1UFRA 3ND6A 1QZTA 2FSIA 4KQFA 1U8XX 2B0CA 1E1NA 4V1CI 4DDMA 1EA7A 2LP4Y 3H1PA 3PZRA 4I4LA 2DPYA 3S2GA 3ZDRA 4W1PA 4BATA 4LYFA 2OXTA 4EGCB 2BFBA 3QLTA 2P2ZA 3LUAA 3DPSA 4OB6A 2M6KA 2WMNB 2B7BA 1A9RA 5B6JA 3T1NA 2Z9DA 3CUTA 5G3ZA 1DXQA 1TQDA 1K7CA 1Q0RA 3GVIA 3ITNA 2D3TA 3UMFA 4WY2A 2JG3A 1X7YA 4GVXA 2HBRA 1GTJ1 4FKBA 4RCZA 5HA5A 3NYWA 3NBFA 1ESNA 4YYZA 3SF0A 2PL3A 1RLUA 5GM2A 2PNFA 2XX3A 2ZWAA 1J9GA 3O8NA 2OAGA 4ZVRA 4UPVA 1X1RA 3MERA 3M1IA 1KERA 1LVUA 1LC3A 2IZZA 3AUFA 4YFVA 2AR9A 1KI8A 1TK9A 1IN6A 5C7LO 5I45A 1A0OA 1EG7A 3EXHA 2V74B 2RGUA 4EPWA 4WOCA 4I4TA 3UXMA 1QO0A 2JK1A 2ZBUA 2I4IA 2VYQA 2YBDA 3W90A 5DYGA 4ZQGA 2YJGA 1PR6A 3HL4A 2GCOA 2H11A 4L8YA 2X0JA 2FH5B 5CURA 5EPOA 3GLSA 1Q0TA 5A62A 1H85A 3DCYA 1QBGA 1WMFA 5ESDA 3WLOA 5KOHB 4P9NA 2GBLC 1NI3A 1JGTA 4RKWA 5E6RB 1ENYA 4IF6A 5KQLA 1Y9DA 4BV2A 4CBVA 1OCEA 2GMWA 5ELLA 4HNAB 3T41A 5BMVB 5AW7A 2JI7A 2XA9A 4KQ6A 4E09A 5T6BA 4DCSA 1NQXA 3H3JA 2CXNA 3TTTA 5C4IA 3L4BC 1W0CA 3QX3A 2QLTA 3PUYA 2J9RA 1K2VN 2P8SA 4YASA 2NZJA 3N1UA 2JGLA 3WWPA 3NBXX 1JXQA 2UDPA 3GBVA 3VR1A 3P9YA 4WCDA 1TEXA 1GN8A 2R8BA 4DYVA 1NJSA 4M4SA 5BW4A 1U9CA 2AOXA 3ZKWA 3WYBA 3L1VA 1QKJA 2GEKA 3K0CC 1ND6A 2RHWA 2O5VA 2XTZA 3TZBA 1PVOA 2ONZA 3LUPA 2IBMA 1MAWA 1U7WA 4PAQA 1UIMA 1VDMA 2WLSA 4O4HB 5AJTA 1YIAA 2ZSDA 4B7ZA 1L8LA 2VOEA 5AFSA 2HMAA 5FOSA 5E3IA 3N2EA 1VDZA 2R9VA 3D0OA 4ARVA 4G3XA 5K0NA 5L45A 3CW2A 3FNEA 3UXEA 2GXUA 4YCSA 5ECGC 3DF7A 3NUGA 4M87A 4B09A 4CLXA 4MQMA 1C3LA 3MT8A 4XX0A 2J5RA 3KTOA 3P45A 1FFXB 3L46A 2EG9A 1JKIA 2X8JB 1ZN2A 2Q4TA 4Y1EA 5CEJA 2BKVA 3A4NA 2BM8A 2P90A 2VPWA 4RULA 3OECA 3UYLA 3A1NA 3OCCA 1TCAA 4PIVA 3K0EA 2XKKA 3C6BA 2WSIA 3KPYA 3MHTA 6CHYA 1H6CA 4Q6WA 5IFKA 1DE0A 3IDAA 9MHTA 3WVNA 4RXTA 2R85A 1V7CA 3S2IA 4HAZA 2E2WA 1DAMA 1BIFA 5ER6A 1Z47A 3EULA 4UREA 1WXIA 4YJ2A 4CT4B 3CZ5A 3CVYA 3A58B 4RTOA 3KT6A 3V1MA 5LB4A 1M34B 3LO5A 3OETA 4BUZA 4O63O 4F8YA 3EWSA 1C1DB 2QEQA 3MJCA 1Y8CA 3R0JA 1WTCA 4P08A 1FFAA 3I05A 5I9MA 1WETA 3CX3A 2O1SA 2I66A 4E5KA 4JOSA 4PU0A 3W4JA 3CNBA 3AR4A 3L77A 4ETIA 4L4XA 3RT1A 1S1MA 3QKTA 4UHDA 1B93A 3E15A 1JR2A 3FXAA 1T1GA 3NDPA 4QJ5A 5DYNA 2O5RA 5BRNA 2XW6A 3THRA 3MSXA 4PONA 4BTEA 2PJUA 2XE8A 5BQXA 3GLUA 5EERA 4HG2A 5EJ8A 2WJHA 2IYFA 3LPDA 3ZY6A 3CNNA 1AKYA 3EVZA 3PQ4A 4WSOA 3ZDXB 1YF3A 4B84A 4B47A 1NW7A 5JS2A 5CA1A 2OV3A 4L28A 3UJPA 4Q4AB 2ZRQA 1Z25A 3KB1A 1SKUA 4RLFA 4C01A 3H19A 1MAVA 3QTLA 4FHFA 4ZZ1A 3ROQA 5AOCA 1WD5A 4N5MA 5DGXA 3PGMA 2GN0A 2N3ZA 4OFWA 1T2DA 3MPOA 1FPMA 2ZYAA 4ROSA 3S29A 1RZ3A 5CDFE 2BEKA 1D2CA 4OMCA 1NBHA 1ZVMA 2OTCA 1SHKA 4P7KA 3DTVB 1WO8A 4OJMX 2VN8A 4PY2A 5CB4F 1DBWA 4PG7A 5U4QA 3GUVA 1JG3A 4GMFA 4ZO7A 3ZY4A 3QW2A 2YC4C 4B81A 1NW8A 3L43A 1Z8HA 1F2TA 3MJSA 2WYVA 3DFMA 3FPKA 3HLYA 3QE3A 1IWOA 4O29A 4EG1A 4QYSA 3CS3A 5TGZA 1VL5A 4FMDB 4DABA 3U4QA 1DDIA 3COYA 5EGNA 2X0DA 2WTAA 4H7KA 1NW3A 3V34A 4I55F 2OQVA 1IUOA 2WMDA 3FNRA 3DPUA 1E7MA 2BFAA 3LVBA 2BFDA 3L2OB 3LQKA 4HB0A 1RRPA 3BL8A 1P4GA 2FN8A 2ZR7A 3BRWD 2CXPA 1ADFA 4BC0A 3E70C 4QNMA 4AFNA 2HDWA 3DL0A 4RV5A 2VP0A 3CO0S 2A78A 2ZB3A 3H5NA 3G9QA 4I9NA 2POCA 4JJ6A 4PGMA 2FW9A 2ROQA 1C14A 3SD7A 3PJGA 3A1CA 2BJHA 3JQ7A 2XNDA 4HVAA 4PANA 2DGDA 2DWQA 1X0XA 3WB9A 4TS3A 1NDHA 3WRXA 4AMBA 2HA0A 1KU6A 1YC2A 2FDRA 4LHZA 4XYBA 2B1QA 1L5GB 4AI6A 2VAXA 4L95C 1BAPA 4UEJA 3ICPA 3P9QA 3WBFA 1G8JA 3D2BA 3F7TA 3GEBA 3ZKAA 4YY3B 2Q5IA 5B4TA 1I3NA 1CD5A 5AHXA 1JLRA 1XCJA 5BSFA 3T3OA 2FMFA 3H05A 3K94A 4J0CA 4MYUA 5F76A 4ENUA 3DMPA 3ZZMA 4NK5A 1ZRNA 5DTMA 1LW7A 2Z5VA 5K3FA 2DF8A 3QVTA 1XIVA 4MLCA 1OIWA 1S2NA 2V8OA 2DR2A 4WLEA 4FHEA 1MC8A 1Q1GA 2L82A 2H1SA 4OP2A 2YOFA 4ZAWA 5B2EA 3SN6A 1GO2A 1CB0A 1ZH6A 2XCLA 5A05A 2HRBA 3UJAA 4CEHA 4JROA 4MR8A 5IT9A 1GRNA 4OHRA 4DA8A 3HDQA 3AWDA 4RAOA 3UBTA 1FTWA 4ABTA 1XQWA 2MT9A 2AZMA 5AKJA 2W6JA 1M2GA 2YMPA 3SHTA 3TW8B 2QU8A 3NJ8A 4RKEA 1XZHA 4KL8S 1E3QA 1RWKA 4ALMA 2HR1A 1ACMA 1B42A 1I6MA 4F1WA 4BLRA 1P0FA 4GP7A 4XDGA 2CB9A 2C4NA 3NIWA 1DS6A 3VHRA 1P8AA 2YWHA 3IX7A 5DRTA 1MO2A 3EZ2A 3WWYA 4EW1A 2VO1A 3VYSB 4C43A 3O8RA 2YZGA 2EW2A 3CG0A 3JQBA 1BDMA 2HDNB 4OUDA 1HSOA 5LL6P 3JYHA 2IX9A 4G0NA 5HHTA 3WAJA 1FFBA 2AEEA 3DO5A 2QG9A 5AKLA 1HFJA 2W6NA 1I3OA 2AG6A 1PT8A 4EB0A 4X65B 1QX4A 4MZDA 5CIWA 4DSTA 3ST7A 4C88A 5DX0A 4QYIB 3QYFA 5AO9A 2E4WA 4A0QA 2BUCA 1AZTA 1N6OA 4J0FA 2JFBA 2HV8A 4TMYA 3K9FC 3CF4G 1JWAB 3OJFA 3VXKA 2AZXA 4BKOA 1TAGA 1KQ3A 1TYEB 3G7NA 2G7ZA 8MHTA 3HDHA 4A73A 3S3TA 1HX7A 5F4BA 3W8DA 2B1RA 2JLAA 3ROTA 4ILKA 2X5XA 5IMSA 1UOPA 4X7PA 4TS9A 3LBFA 4ZCSA 2O59A 4OSEA 3CURA 1LDMA 3MWDA 5DASA 1BE6A 1B0PA 3GPIA 1KSJA 5DLDA 2PZMA 1Z6GA 4IXWA 3V97A 1NBMD 2C3OA 2NO6A 4NS4A 1U3WA 2R751 3ZW8A 5KZMB 1QIJA 5JDCA 3DAGA 5JVDB 1M2NA 4D41A 4CUJA 4JKYA 1YCHA 4ZA2A 5LYJB 1UJNA 4NBSA 2GS9A 2JL1A 4YALA 4BO3A 1JJ7A 1HV8A 2UVPA 3W2IA 3IVCA 3TZLA 1U28C 2I7CA 1Z29A 3VPCA 1SVNA 2WFZA 3UQYS 4BGIA 1KI6B 2X13A 5AVJA 5LQRA 2WWWA 3NBQA 4DY6A 2H0AA 2WKSA 1CVIA 2NSYA 2RB4A 4RY2A 4DBLE 2PPVA 3V9AA 3LBYA 4XCQA 4N8EA 3ZJUA 4GGPA 4Y6OA 4COOA 2VBCA 5JNLA 1VKNA 4EHDA 3H5AA 4XM1A 3B1XA 3D6JA 3N0WA 3ND9A 3PD7A 3R5HA 4P36A 5B3JA 4H6PA 3TZKA 5EUBA 1AIPA 1YZFA 5ITZA 4DRXA 2PUHA 3ZPXA 3P52A 5LZ9A 4KWCA 1XTJA 1L4MA 4D9CA 1UBKS 4HB4A 2Z0MA 1J22A 1EFDN 3HZHA 3MA0A 1WIWA 1AQNA 3UFXB 3TX2A 3VPHA 4QOHA 3U1TA 4DPLA 4F6CA 1WV1A 1GQ2A 3GROA 1L5KA 4L3OA 4GE0A 5DFAA 4EPYA 4NFHA 3DLCA 4MYRA 3BHIA 4GYKA 3WZ2A 1CFJA 1HDZA 4ZOLF 4I1RA 1S0UA 2R6FA 4ZFNA 2PX4A 2BE7A 3I12A 1G18A 4ZKDA 3O4JA 2DR3A 3T7CA 1WQ1R 2R6CA 1U4OA 3LIIA 1OU4A 3OOEA 2XUKA 3TYXA 5AQ1A 2QUAA 1MB3A 3AHFA 5CDGA 2ZUBA 1RE1A 5EMNA 4BL5A 4D0SA 4GKVA 1M66A 2A9KA 2BIFA 3FSGD 2JD1A 2QXUA 1BMTA 5CGQB 3DCNA 3LK7A 1NE2A 4JLVA 4YJFA 4G81A 1WKVA 1T2FA 3SQNA 1EK0A 1TRKA 4EQZA 4UBNA 4NI5A 1EVIA 2OY0A 4EHHA 5KJFA 4Y6SA 1NATA 1QH9A 2O2SA 5DE3A 4CW7A 1C3EA 3A9CA 4OJKA 5EQFA 3RVKA 1XEAA 1WF6A 4JLBA 1Z12A 2J30A 4EUEA 2WDZA 1OXMA 1NL3A 3UH1A 2FSSA 2YYYA 3PFKA 4GWLA 5CDSA 1XVAA 1UAAA 4MJXA 1YDHA 2V97A 3DAFA 3FMVA 1E2HA 4WERA 3GJXC 1S2MA 3BRWA 1W0JD 2AUTA 4I5DA 4JR2A 1IRXA 3HA2A 1WHSB 2PZFA 2P40A 2IS2A 2WIFA 2FK7A 3R9WA 4P7FA 1QP0A 3FE2A 5MFZA 3N7AA 3U4DA 4DUGD 1RQPA 3H4VA 4EJSB 5CCEA 4J1QA 1J09A 1H5NA 1Y1RA 2AN3A 2X0NA 2XDYA 2HOQA 3D6NB 5C34B 1E5TA 1PFGA 4ZCRA 2QTBA 2GEDA 2XGOA 3F6RA 1X77A 2O2XA 1I0LA 4GX5A 5GV7A 1NXOA 3QBDA 4D9BA 5MGBA 2WIAA 5JRDS 1Z4OA 4P22A 3AC0A 3W77A 2XTJA 2X1HA 4H7HA 4FIZA 1JAHA 3M6FA 4BZPA 2NP6A 2FP4A 3W2FA 3OPXA 1T8WA 3E58A 4JP5A 4F7WA 3ZDCA 3T9AA 4AROA 4R2XA 4E5DA 4EVRA 2LCIA 5AXDA 3IBTA 5I9IA 4ZT4A 1A9XA 2Z5LA 1W4LA 3RT9A 2EERA 2FZGA 4ROTA 1L1QA 2X0IA 4JOBA 5IP5A 1R9JA 1R5NA 3A9SA 2DPGA 1SKAA 4D96A 5JWRA 3JSXA 1PGJA 2BM0A 1Z5WA 1W5SA 1K9SA 1PWEA 1RKXA 3RUFA 1UJCA 2HRQA 2PXHA 2YTZA 2Y1KA 3BCSA 3DHWC 5IEBA 4DMCA 4ZQHA 3O4IA 4LF7B 1VL1A 3IIJA 3RU9A 4D42A 2HFKA 1NVKA 3MCVA 2Q0QA 4BO8A 1VLLA 2RHTA 2VL7A 4CM6A 5JSHA 3UAYA 5J4HA 5IS2A 1A1VA 4N12A 4TTAA 1ZVQA 1VGRA 1XDWA 4HQKA 1LF0A 4CKXA 2FOXA 3CKLA 4WLNA 1U04A 2XGMA 3QWHA 4LWOA 3SE0A 2W2PA 3C5CA 3CXRA 3G2HA 3T3NA 2I2XB 2AHRA 1WNTA 3G7UA 5GJVC 3KR1A 3L8DA 5BSWA 2HF7A 4G9EA 3FTEA 1NURA 5CG1A 3IJRA 3OWXA 3AZOA 1WXWA 4FINA 1E9EA 5EJ7A 2IUFA 1KYZA 2B61A 1J0DA 3F9IA 1Z2AA 4XJSA 1EE1A 3C14C 2QIOA 3L1KA 2WW8A 3FBWA 1GGHA 3ZWDA 2CLMB 3QUBA 4BLWA 4EKYA 3EY9A 4R8KA 2OCPA 4MV4A 1M8JA 2ZE5A 4LIPD 3WKEA 1JG4A 4EVQA 3NP7A 3RLFA 1JHMA 5CMLA 2EZUA 3ZWAA 4UAGA 3MXOA 3QFTA 3WYEA 1AKWA 2ISQA 3FHLA 3L5KA 3AEUB 3QOFA 1IN7A 1XXLA 3TTUA 3PJRA 1P1IA 2GM3A 3DZFA 3WHLA 2E48A 2F1KA 3IQXA 4OBEA 4UE3S 4CNQA 5HYVA 3ZCSA 2FW1A 1XAIA 1DCKA 3HYLA 1A9ZA 3OICA 4PZPA 2QT0A 3R5TA 4OJNA 5IM5A 1SVUA 5BWCA 2ZWOA 1VYUA 2V5AA 3T1VA 1RQLA 2GBLA 3D6VA 4OHCA 5EOVA 4OL9A 3MHPA 4LKOA 2D0PB 4AP6A 2JLWA 1P44A 3NHZA 4BMZA 4RPGA 1C7EA 4KIJA 4E15A 3DMNA 1JFFA 1NLFA 4HFRA 3L4BA 1NBMA 1OFUA 5GZ6A 3P4YA 1SB8A 3C1AA 1KEPA 1WB6A 3RS3A 3WSVA 1MZVA 4EPVA 3TLGB 1OZFA 3MRSA 3GGDA 2XMQA 4LY6A 4NFLA 2VSYA 2LWIA 1XRRA 3JVIA 3O93A 3IRVA 4LXQA 3MMPA 1PZEA 4Q7QA 3C3YA 3CLKA 3URMA 4UUPA 3J7AC 5JARA 4QU9A 3FTCA 1VJDA 4B80A 4MVJG 3DA8A 2OLJA 1VL8A 5JXJA 1PNOA 2GVDC 4WW0A 2WF6A 5DK6A 4C89A 4Z8XA 1N5DA 4F6LA 1IM8A 2OZKA 1N92A 3GA0A 4Z9XA 3ZX4A 5C8VA 1EQUA 1NNSA 1XO1A 3HYSA 3IIMA 2PH5A 2GKGA 4FR5A 2XJ4A 4QELA 3QWBA 4JVNA 5AKHA 2AJDA 3HCDA 1K66A 3AL2A 2QD2A 1XHEA 3FNIA 2VHWA 4UUQA 4W1QA 5GOZA 3E18A 3QA9A 4IS3A 5TX7A 1Q0ZA 1CERA 1US8B 1VL6A 4MO9A 3WHIA 4BNNA 4DXDA 1LXCA 2IS4A 2O05A 4MPDA 2PUCA 2FSUA 1HOXA 2ZTSA 2OBBA 3DPIA 3QA3E 3OJ0A 2L69A 3DMGA 1F8YA 3M6UA 5ALJA 2I9PA 2Y92A 4KGDA 4TXLA 5CT4A 3VYRB 3WP0A 1E7QA 5FTMA 3GG9A 4IZIA 3LWNA 5BO5A 1OV6A 1WZ2A 4RHCA 4X1KA 1G6KA 2B78A 1JALA 2QTAA 2P30A 3UV3A 4YCMA 2QRZA 5CIQA 4CPDA 2N1MA 1U0HC 5C37A 5ALRA 3PEEA 1NE7A 1AD2A 4G67A 3HBAA 2MTBA 2V4MA 2E37A 4G1UC 4OOEA 521PA 1A27A 2WOJA 2IHZA 1XOIA 1TLFA 3PHJA 1T24A 1P5RA 3D7RA 3FSGA 3VBEA 3D3NA 1NULA 1WB4A 4H6WA 3L7OA 4HEA1 4RESA 1DAFA 5J2UF 4UUBA 5K1SA 2CNOA 3KSDO 4V0SA 4KN6A 1BA2A 1GVNB 4NU6A 4Q4LA 1QFMA 3HU1A 3QBVA 3HUEA 3L1HA 4HXEB 4PZLA 4XSHA 1I1NA 3ZHTA 3DHVA 4O3FA 1KKMA 3E27A 3RTEA 1LX6A 3T12A 1AKNA 4UXJA 4GSYA 2W8ZA 4DLRA 2Y77A 3OPQA 4B2YA 5I4BA 3MXTA 4YCJA 2XVAA 1PIWA 2BTQB 1I7PA 2VK4A 4C7OB 1PT7A 5ICSA 1NT4A 5HIAA 1X9HA 2CFRA 1FMLA 3Q8KA 5FH9A 4A8TA 1N5LA 2HGZA 3D54D 1OA1A 2JHPA 4ML3A 1T3GA 1WSWA 3B6MA 2HJVA 2Z2XA 4WEOA 3QLUC 5JSKA 2MR6A 4AS3A 3L8GA 4B48A 2NLOA 3KJHA 5HJ5A 3PHBE 1RKBA 3RYFA 2F7SA 4JZYA 2XNJA 3R5XA 3WLKX 3KR0A 1QIMA 2AGVA 2ECOA 2GZDA 1WUJS 3DZDA 2KJQA 5KDLA 1ENPA 4CKEB 3AERB 3KEQA 3RVQA 2D62A 5IT0A 5FLKA 1JECA 1NXPA 4HUQA 1A5BB 2X5OA 4EB6A 3MWEB 3G49A 4XSVA 1JFTA 3AVUA 2QZ9A 3GHHA 1QH0A 4EZIA 3ZDQA 5KTMA 2CXRA 1LSJA 4AUMA 2EJVA 2FWNA 1U2DC 3O74A 4EQ6A 3WBJA 4TZKA 4J16C 4DWJA 4U7WA 3FF1A 3JYOA 5L3SB 2C95A 1L0BA 2PX0A 4CDRA 1AUXA 3ABZA 4W1RA 2J0VA 2OZLA 3UKDA 4DJDC 3LUDA 4E88A 2X6TA 5HZKA 3IB6A 2O3TA 1PJ4A 2X42A 2F43A 3TCXB 2D4AA 3R3YA 4OAPA 2ZAYA 4R2HA 4OGLA 1W36B 3ZXIA 1XNRB 5D84A 2QPLA 3AK4A 4N7BA 1VE3A 1W0KD 4HRXA 2ZXFA 4OXYA 3X1YA 2KX7A 1PJZA 1TM2A 2BFMA 1D7OA 5KYUB 3QVVA 5AR1A 2GARA 3NNDA 2HSDA 2XYVA 2Y66A 3JQ6A 1Y5RA 2RCNA 1ODJA 2OCAA 2VLIA 1CJBA 1G8PA 3CH7A 4XR4A 1NF8A 2UV8A 4IUCS 2G1UA 1R3DA 4EY5A 1MC1A 3CUUA 4B35A 4DUYB 1EWYA 2FHSA 5GPBA 2YY5A 3DEJA 3INRA 4P7GA 1WV0A 3TRJA 4FYVA 4P4SB 2W9XA 4OQMA 1LTKA 1HQCA 4X45A 2EATA 4OD0A 2VI5A 2ZI9A 5ELXA 1E3WA 2YHAA 3MFYA 1DKNA 1E2IA 2MWMA 5BYBA 5C5EA 1JLLA 3RHTA 1SOVA 1G8GA 2R44A 1HNNA 3C1TA 5IVPA 3IAFA 1OFTA 4RKYA 4EGQA 3KS9A 1YTLA 1MV5A 3A9TA 4RZXA 2J3KA 2JIPA 2RBEA 2LR0A 4K0RA 4CL0A 3G1TA 5G0TA 2WUWE 2GWRA 2B5OA 3ZX5A 3SJUA 4A9AA 4C76A 4KIFA 5H4HA 4GPD1 4G1BA 4MCIA 4ER6A 3G1WA 4QVIA 1Q6ZA 3TRDA 3ZE7A 2V7GA 1NI5A 1DUSA 2JCSA 5H4GA 1X8XA 3I42A 1VHJA 3W6PA 2W6OA 3RUAA 4JXZA 3ZHXA 4DEXA 2PWZA 3RTGA 421PA 3GT3A 2Q9AA 1Z0AA 1V8DA 3ZS8A 1MOPA 1FRVA 2MIIA 1L5NA 5LD2C 5TQVA 1E0DA 1TA4A 2FQYA 3PGKA 4UNNA 5B57C 3OFVA 4PINA 3IOBA 4NAVA 3HY3A 3PA8A 1XRQA 3MQFA 3Q7EA 4JJFA 3PSHA 4GYJA 1IN8A 5ILGA 5IVIA 3ZG6A 4CV2A 1Q0QA 5B58C 3PNKA 4C4SA 5FLXA 3UOAB 3EXIB 4CIWA 3MGKA 4XQ0A 4D9HA 1NUPA 2EFHB 4LWZA 1ZK3A 1VBNA 5IAEA 4I5IA 1MQ9A 3JTMA 3GDGA 4BB6A 2D0DA 2QAIA 2Z6AA 1W73A 2HIAA 1RWNA 1GXSA 3N2NA 4MDFA 4RJIA 5CVJA 3PQEA 5KTSA 3OTGA 2Y1OA 4A8JB 2W42A 2GZMA 4BO0A 3B5JA 2YQ5A 2EJBA 2OPBA 4Y2UA 4I2VA 4F9EA 2FETA 2RHMA 5B7NA 1MUUA 4CG2A 4IJKA 1I4DD 4QOEA 2RHLA 3LQQA 1DC5A 2DTXA 3GEDA 4JV5B 3P97A 4XD2A 2RAPA 2UYHA 1E2FA 3RSSA 2JFFA 2J0SA 1PRYA 3NU1A 3OE1A 2V98A 2VLBA 1CB7A 3UCEA 2PVCA 4YAJA 2HPZA 2NO0A 4RVFA 3ZZUA 4J4BA 5ES3A 5CXQA 4N1AA 1E4OA 3J80A 1GN9A 2MYUA 3RRNA 4A2CA 2N0SA 3ELWA 3AHHA 3R0VA 4QPNA 1AMNA 3HP7A 1K8YB 5ESXA 1M72A 1XQXA 4LF6B 1XQYA 2WR8A 4KWIA 2OD2A 4PN3A 1E6WA 3U0BA 3LLUA 3FZGA 1OGYA 1LNQA 4J7UA 1LSSA 1ZMXA 4WFKA 2H3EA 3LZDA 4PAMA 2FXIA 5DNCA 2VHJA 1BVHA 5KINB 1HEIA 4RIFA 2APJA 3FKQA 3K0AB 1B41A 1TYBE 2QVCA 3I09A 3MWGA 4TTRA 1CFZA 2FMKA 4TV9B 3O1LA 4G5YA 4AZ0B 4D8WA 3AM1A 4DA7A 2JHAA 1TJYA 2QQGA 2AK2A 4K1XA 1W9MA 5F7XA 2V7EA 1U28A 3OPYI 2A5GA 1RZVA 1TUGA 4IY1A 4JJAA 3E7PA 1QZXA 3U7FB 3GXBA 1LDEA 3PUKA 3GYGA 1NNEA 2Q1WA 3EAFA 4MTLA 4R2IA 3E5NA 4PYIA 2A1UB 1ADJA 3FCYA 4GBMA 4XQCA 5G0UA 4GICA 3RVRA 1TECE 3FBGA 4NH0A 3PQ3A 1TIPA 1A9QA 4XDZA 4CQJA 4B17A 3C3CA 5G1OA 2X6RA 3ET4A 3IDSA 4HQ6A 1O77A 3E2IA 4QXAA 4D4HA 1NVGA 2R6DA 2QMYA 2ZE7A 3BWMA 4BLQA 3A1WA 3T9BA 4ARUA 4Z7NB 4QAQA 4EUSA 5HUQA 4BPBA 1EWQA 4ZI2A 1YSCA 2BC9A 2WQ7A 1BYUA 3NPMA 4Q1VA 1YRQA 2ZVQX 3EK2A 3KE8A 2PQ6A 4M9CA 1NSFA 1WDLA 2HUNA 3FVTA 4EI9A 1E9DA 4I6EA 1OR8A 5FUVA 4IJVA 4O2RA 3LL4A 2I34A 4Q7EA 2Y0EA 2HSEA 1ZW6A 2IP2A 2P2GA 1XTKA 4AG3A 4ZC1A 1T8UA 3IERA 2CL0X 5BPHA 2FZKA 2VAPA 1J6UA 2ET6A