3QWAA

Crystal structure of saccharomyces cerevisiae zeta-crystallin-like quinone oxidoreductase zta1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
331
structure length
331
Chain Sequence
b'TIPEQQKVILIDEIGGYDVIKYEDYPVPSISEEELLIKNKYTGVNYIESYFRKGIYPCEKPYVLGREASGTVVAKGKGVTNFEVGDQVAYISNSTFAQYSKISSQGPVMKLPKGTSDEELKLYAAGLLQVLTALSFTNEAYHVKKGDYVLLFAAAGGVGLILNQLLKMKGAHTIAVASTDEKLKIAKEYGAEYLINASKEDILRQVLKFTNGKGVDASFDSVGKDTFEISLAALKRKGVFVSFGNASGLIPPFSITRLSPKNITLVRPQLYGYIADPEEWKYYSDEFFGLVNSKKLNIKIYKTYPLRDYRTAAADIESRKTVGKLVLEIPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable quinone oxidoreductase
publication title Structural insights into the cofactor-assisted substrate recognition of yeast quinone oxidoreductase Zta1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 113
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2011-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qwaA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3qwaA01
3OP4A 5CFZA 2VTEA 3SX2A 1E0DA 3L9WA 4L76A 1HLDA 4J1NA 2D1YA 2WJPA 5BSFA 4LVUA 4CM8B 1VJ1A 4YJHA 3WGQA 2FZEA 4CM5A 1YOVA 9LDBA 5JY6A 1J6UA 2I6TA 4WUVA 4DVJA 1BDBA 1E77A 4YT2A 5C7OO 2CF5A 4J7CA 1HE2A 4GMGA 5I9MA 2BKAA 4RCVA 2DKNA 2VZ0A 2J6IA 3U4DA 1ISIA 1Q7BA 1LA2A 1UP7A 3CIFA 3MWDB 4XJTA 3K8ZA 3PVZA 3DBRB 4MP8A 3NTRA 3A4VA 1QYCA 4YWJA 3L6EA 2FPPA 5THQA 1HRDA 4L4XA 3BAZA 4DRYA 2O2YA 9LDTA 4J6FA 1HZZA 2O23A 3B1JA 1KVQA 4CM9D 5HM8A 5BSHA 3MEQA 1JKFA 3SLGA 3ZV6A 1C0KA 2EW2A 1K89A 4XYEA 3M1LA 1T4DA 5I8ZA 1EUCA 5JAQA 4M89A 1XIVA 2VN8A 3VPXA 2O3UA 2QHXA 1O6ZA 3A06A 1PU2A 1ADFA 5AQ1A 4DL9A 3WJAA 2FR8A 3HWRA 2PZMA 4NQZA 1GY8A 4RDIA 2W98A 5KCZA 1V0JA 3G0OA 4J0EA 3ZZNA 3R0IA 4W99A 3U0BA 4RZHA 1DFIA 4NH4A 2BLLA 2Q1SA 1U5CA 2A92A 2JAPA 4EEXA 1AUPA 1PJSA 3D3WA 5K1SA 1DHRA 4A2CA 1A4UA 4DTIA 5EQFA 3ZWOA 2NV6A 4NBTA 2V6BA 4Y9DA 1FXSA 3E8XA 4CPDA 4Z9XA 4NPCA 3ZI0A 2E82A 3ZNNA 3GLQA 4XQEA 4BHTA 4I8XA 1UDCA 3OQBA 4HX5A 3FHLA 1T26A 2WDZA 4EGFA 3KSZO 4TKLA 1LRLA 4BO7A 4P8RA 4QEDA 1CQIA 1KEVA 4CMIB 4RPLA 4B3HA 1P1JA 2ZQYA 4FDAA 4E0BA 3D4NA 3B20A 5AXAA 3H3FA 4AJOA 2VHZA 1PL7A 1ZZEA 2Y0DA 3G1TA 1O0SA 4MVJI 4EYEA 3ETDA 5T64A 2P4HX 1F0YA 2BFOA 4B4UA 4NU5A 4WJZA 1JKJA 2ZTVA 3W8FA 3E9NA 3Q3CA 4YACA 2JHFA 3AOEA 3AOEC 2CMDA 5J23A 1N7GA 2QIOA 5L53A 4PCVA 4L75A 1ZCJA 5L40A 3K92A 3QP9A 4FC6A 1OC2A 4I1IA 1DOHA 3I9LA 1Q0QA 3AOGA 1KYQA 3O9ZA 1R4MA 1DO8A 4Q39A 1YJ8A 1ZIDA 1RYDA 4OQZA 3ZCXA 2VTDA 2PLAA 1MXFA 4IIVA 1GYRA 3RFVA 4PLPA 4XYLA 4I5EA 1EEHA 2YQ5A 3PXXA 3TJRA 1ZXLA 2DT5A 4E5PA 2XAAA 4QFCA 4ZQGA 4CLHA 1ZMOA 4Q9NA 1MXHA 1ZK3A 4GPD1 4Q3BA 4WCDA 5DCYA 4AJ4A 3PWSA 2OMEA 1E7WA 1QLJA 3H5RA 5F5NA 2HKIA 5F3RA 1HSZA 1A71A 3IP1A 1P0CA 2Y0CA 2P9GA 3BMNA 1EZ4A 1P45A 1UZMA 3NJ8A 4R3NA 3IUSA 4IY1A 1M75A 4JP2A 3WBFA 1QRRA 4GBJA 5A9SB 1UXKA 2ZIZA 4GX1A 2AQKA 2EKLA 2NWQA 1H6DA 1IY8A 2W2KA 4RL6A 4J4TA 2GLXA 5JLAA 4QXMA 4LMRA 1TXGA 4YT5A 3JQFA 5I9NA 2O3TA 3JQFC 3RCBA 2A35A 4FD3A 4IDBA 5IZ4A 1ZNQO 1GPDG 1X7GA 2C20A 5JDCC 4WOJA 1TA4A 4HNGA 5AOVA 3HB5X 1U2GA 1XHLA 5IXYA 1H9AA 2FPIA 1GADO 4XQGA 2D3TA 1KERA 5L9AA 2C2XA 2LDBA 1E1MA 3DL2A 4DC1A 1Y8RB 1EFLA 1U3WA 2SCUA 1EBFA 1YQDA 3QVSA 4GWKA 5CG2A 3ZWWA 3BTSA 1JAXA 2DBZA 4YQZA 1UP6A 3WIDA 3LT4A 5L4LA 3FD8A 1OMOA 4A0SA 1U3TA 3DTYA 3Q9NA 5IDYA 3FI9A 1D1TA 1PJ2A 3INRA 4XRRA 4B8ZA 4AJPA 3U4IA 3HSKA 3TNLA 4PFJA 3VTFA 3C3XA 4AJ1A 4YTEA 4YT8A 1RKXA 4OXKA 3HDQA 1B3RA 4KTVE 2EERA 5BNIA 5TC4A 2EJVA 4N5LA 3WGZA 2Q2VA 5F1KA 2X5JO 2NVWA 3F47A 1E7YA 1GQ2A 4J1TA 3IS3A 3GEDA 3L4SO 2DC1A 4W9NA 4W9NC 2NU7A 4FFRA 3C24A 5I9LA 1E7MA 4AJNA 3S55A 1T2AA 4DYDA 2G82A 3E9QA 1OBFO 5I7SA 4TKMA 1CF2O 5HA5A 1NPYA 1XEAA 1TEHA 5T6BA 1BWSA 4MJLA 5LC1A 1BXGB 3WGTA 4KUGA 1BHSA 1HTBA 4KTTE 3ADPA 1X1TA 1PQWA 2G17A 2PZKA 1NM5A 4J0FA 4NNJA 4J1SA 3C85A 4CLDA 2O48X 4E5MA 2GN9A 1VC2A 2NACA 5G0TA 3RKRA 4IS2A 4E2WA 1T1RA 1NR1A 3S2FA 3L6OO 4GX0A 3LC2O 4BGUA 3KETA 3TZ6A 2BELA 5JXWA 2XXBA 4BNKA 1O8CA 5A9TA 4UAGA 4UUPA 2CDBA 3SJUA 5IJZA 2D59A 3RFXA 1N9GB 1PGQA 4XIYA 3UCEA 2I9PA 3BHMA 1GCOA 1IB6A 1XU7A 2YY7A 4IJUA 5MGBA 1SBYA 5CEFA 2B4QA 2VUTA 4W7IA 5HWSA 2JHGA 3HE3A 4QO7A 3WQRA 3GDFA 3M6IA 4PLVA 2O50A 3JQEA 3LF2A 3E82A 4BO2A 3ANMA 1J0XO 3KEQA 3HN2A 3JQBA 3JQBC 3JQGA 1VLLA 2X9NA 1RM0A 5JAMA 4ALKA 3M1AA 4CLOA 3DFZA 1Z6ZA 1QSGA 3FNGA 3AM3A 5DBGA 2PKQP 3LLSA 4K9DA 1DC4A 4IZHA 5G0UA 4CQMA 3AM5A 4CM6A 4GQAA 3DBLB 3S1LA 2EWMA 5IFLA 3I9JA 3K96A 4QQRA 4R9RA 3ICPA 4Q3DA 3WGGA 2ZKLA 3HUDA 2HJSA 3ANLA 1R15A 3OFSA 3JSAA 1T24A 4FFOA 4CM4A 2O4UX 4BMNA 5EJ2A 5JYEA 4UEKA 4K28A 5DN9A 2C2YA 1ENOA 4MVJD 5A04A 4NFHA 3RKUA 2E37A 3KYCB 3HN7A 1NPTO 2AEJA 1RPNA 4LMPA 4ND4A 3UHAA 3OJ0A 4MIEA 1C0PA 1MG0A 3RUIA 4LSWA 3RC9A 5I7VA 1DFHA 3RASA 4GLLA 3F4BA 3MOGA 2PD6A 1R37A 3RUCA 1DLIA 2YV3A 2POQX 2AEFA 4O59O 1PGNA 5GZ3A 2WD8A 4JNKA 5TIIA 4OKNA 4BQRA 1B0AA 1EDOA 5KJEA 1YRLA 3WS7A 3OJOA 4PG7A 3GZ4A 3VKUA 1LLCA 5A1TA 4CQLA 1A9YA 4WOKA 2AE2A 4CUKA 3GK3A 1NX6A 1P0FA 1JU9A 4E31A 1V9LA 2DAPA 4EZBA 1HE5A 3NTOA 5T57A 1TT7A 3D64A 3ZNPA 1GTMA 1LDGA 2GN6A 3RUDA 1H6CA 2OZPA 1DRVA 2J8ZA 5FI5A 1F8FA 1I3KA 5FYDA 2EF1A 5TRTA 2QZ9A 1U8FO 3PK0A 1I3LA 4YR9A 4XQCA 4ZQHA 3FPLA 4I5FA 4OO3A 4K1LA 2Q99A 3NGXA 1PS0A 4U0JA 2VWPA 5TS3A 4BO3A 3PEFA 5COBA 3B70A 2QYSA 2VRCD 3AU9A 3DZJA 4IDDA 1R0KA 4MVJH 3RC2A 4GI2A 4B8WA 1MA0A 4BO4A 1GCUA 3OQ1A 1Z7BA 3AI3A 3AU8A 3AM4A 1ZH8A 2OFPA 5JMWA 4ALLA 3O26A 1H2HA 1E5QA 4PVDA 2PWZA 2Z1NA 4TVOA 5JCXA 5JNLA 4GLOA 3JQ8B 1GDHA 1ORRA 2EG9A 2Y1CA 3R1IA 3S2IA 3W4KA 5BNTA 1U4OA 3H5NA 3INGA 1R12A 1G6KA 3BMOA 3H9GA 3WGHA 5ILOA 5A05A 3A1NA 5AXDA 4M49A 4L74A 2VHYA 3IIEA 3G1UA 4YJFB 4Q3AA 4RF3A 3BA1A 4IDFA 4WLFA 3FNEA 5C5IA 3KZVA 2FZWA 4EJ0A 2Y93A 1L7DA 3DZIA 4HUJA 3GPIA 5THKA 2JAHA 2YHIA 3ZWBA 3OJLA 3OIGA 3PRJA 4BO8A 3NGLA 2YW9A 5IN5A 2LDXA 4IDGA 2ZCUA 4KP7A 1E7RA 1GYPA 1SEPA 2RCYA 1Q7GA 4IM7A 1PQPA 2J3IA 5HBRA 3ZWVA 2CNBA 4BIIA 4OHUA 1ONNA 2YDXA 3I9MA 2P2SA 2B5VA 1CERA 3DEYX 4JCOA 4R41A 2YQ4A 5JCJD 1SC6A 2X9VA 4D43A 4P4NA 4YJGB 4E21A 1KVRA 5CEJA 2NTVA 2BFAA 1NFFA 3RBZA 4PGFA 1LNQA 1OZAA 3JQAA 4GSLA 4CLEA 3DC2A 4UEJA 4WKGA 3PDJA 3GF4A 1H93A 1HDXA 1NWCA 3DOOA 2FPGA 2RHRA 4R68A 1TT5A 3NV9A 4D46A 4FN4A 3KLPX 4ALIA 3R3SA 1XR3A 5MDHA 4JXKA 1LRKA 3IUPA 1H6BA 1B2LA 2C59A 1DRWA 1RM5A 3I5MA 4D45A 4RLSA 4WLEA 2BH9A 3OECA 4Y6RA 1HYGA 5IDQA 3DO5A 2TMDA 3PHHA 1NYTA 3V1UA 4WK6A 3H6KA 4BO6A 1J49A 4JP3A 3KYBA 1B8UA 3DWFA 3ICCA 4OYRA 5CPFA 4DLLA 3V5NA 4Z9FA 5TSDA 3LT1A 5B4UA 4J7XA 3JD1A 3G79A 4UULA 3R6DA 3KOUA 4G65A 3ZHZA 4NBVA 3FNHA 4MOWA 4II3A 4TMFA 1SAYA 3NKLA 4TVBA 3ADOA 1QV6A 3W4JA 1P1KA 2X58A 3N74A 3O03A 3PFFA 4Y8VA 4HADA 2HMSA 3M2PA 1Q7CA 1XYGA 3GAFA 1F8GA 4PG5A 4ROSA 2D8AA 4XZ3A 2I76A 4TRRA 4BGEA 2X5KO 2Y1OA 4JN6B 4WECA 2YFQA 5EIOA 5IG2A 3VVBA 1XLTA 1JAYA 4H7PA 3GG2A 3KYDB 4R1TA 3ZU5A 1Z7EA 4H3VA 5GY7A 1C1XB 3AY6A 1YH3A 2O3QA 3EDMA 3CUKA 4IXTA 1TI7A 3EK2A 3I9NA 4PZDA 3E9MA 2C0CA 4B7XA 1P1RA 4CM8A 1JDJA 1D8AA 2VZ9A 2IEDA 2FR0A 3ONDA 1O95A 4Z6KA 3PZBA 3MTJA 4H16A 1LI4A 1ONOA 4F6CA 1HDRA 4Q3NA 4GX2A 4CMAA 2DBVO 3DBHB 4BO0A 4YRBA 1EFKA 4JROA 1I24A 2AQ8A 3TZHA 2P5YA 4MVJF 4EI2A 1QYXA 1W6UA 5DT9A 1I33A 1WZIA 3Q2IA 3KRTA 3FTNA 1O5IA 2X8LA 4Z3DA 1SZJG 1ISJA 2B35A 2IXAA 4HFNA 4RDHA 3S2GA 3K30A 4WPGA 3BHIA 3WX0A 1AXEA 4YAIA 3HB4X 1ZMTA 2WWRA 3GGOA 1ZSYA 1PZHA 4AJIA 1P1IA 2VNAA 3PQEA 3SC6A 1A72A 4EITA 3ENKA 2ZQZA 1GEGA 3WQSB 5TX7A 2B36A 4QT0A 4WE3A 1XQ6A 3EYWA 5CDUA 4IDCA 1BG6A 2CD9A 5EESA 4PLFA 3JQ9C 1A9ZA 3IDSA 5H82A 1XELA 4E6PA 1YONA 4JBIA 3F4LA 2D5AA 4ND3A 4ZQEA 3A9WA 3GDOA 4PLZA 1GUFA 2NNLD 4KDEA 3K6JA 4E3ZA 1UZNA 1PJ4A 2VNSA 2ET6A 1VRWA 2WD7B 1K5HA 3ITDA 4XGKA 3RUEA 4JJFA 1YL6A 3HFSA 2ZK7A 4K6FA 1Y9EA 2DUUA 4MIYA 5B1YA 2AE1A 4BUCA 5H83A 3EHEA 5TGDA 1ENPA 1NPDA 1Y1PA 2Y67A 3AW9A 1Q1NA 5EERA 4YEDA 4W6ZA 4BNNA 1F17A 4N54A 3RU7A 4LCJA 3FNFA 5CAEA 5JC8A 4PG4A 1D1SA 1LC0A 2NQTA 2J5QA 3HDHA 3QWAA 4JJIA 3JD0A 4TZKA 4CMIA 2PFGA 5DCUA 3WXBA 2WSBA 4R9SA 3ZNQA 3GRKA 4EUEA 3TZKA 2HSDA 4PLGA 1Z45A 1PJ3A 4HFMA 4HXYA 3WWZA 3ZWMA 2VUUA 3GVCA 4AJKA 3TPCA 2BGLA 2HMWA 3FWZA 4MKXA 3VH4A 3MJEA 4II2A 7MDHA 1G0NA 1C14A 2X7HA 2W90A 2DM6A 4K6CA 3CSDA 1P1HA 1IZ9A 4NFSA 4XB2A 4ND2A 3DZFA 1PZGA 4ID9A 1VPDA 4CM9A 4YA6A 1ZJYA 5IDWA 3L6DA 3D0OA 4FR5A 1P33A 1E3JA 1BRMA 2X0NA 3JCZA 3LU1A 1HDZA 5GZ6A 3T4EA 5ITWA 2Y68A 3WYBA 3RC1A 4Y67A 4DIFA 3NAQA 1SB9A 3TL3A 5B12A 1V6AA 3LC7O 2CF6A 4L9RA 3RQSA 1AHHA 1EVZA 2YHUA 3NTQA 4XRGA 3EVNA 3ZW8A 1E1NA 1PZEA 4EDFA 4ZGWA 2NSDA 2I67A 3QY9A 4B3JA 4KOAA 5C7IO 5K9ZA 1UR5A 3V1YA 1LQUA 2YV1A 4JBGA 5DBIA 1EE9A 3MCVA 3ORFA 1WLYA 3DAFA 5JE8A 3SVTA 3H3JA 3CTMA 3KO8A 3KLMX 1YWGO 2B5WA 1LSSA 1T4BA 3WGIA 3GOHA 3L9XA 3E5MA 3MJSA 1L7EA 5HRUA 1ZKMA 2OBYA 3BYZA 2HO5A 4DMLA 1PX0A 1YE3A 5A9SA 2O2SA 3IL2A 2FOIA 3GA0A 1MG5A 4GMFA 4D0SA 5A3VA 3JYPA 1EBUA 3L4BC 1BW9B 4D3FA 3WWYA 1NHWA 2GN8A 2ILTA 3AUTA 3BMQB 5FFFA 4OXYA 4BKPA 3LYLA 3F46A 2RBEA 1ISMA 4S3MA 1SO8A 3H9UA 5DOVA 3PQFA 4PLHA 4R5HA 4ZN6A 3FRJA 4PZCA 3SXPA 2PH5A 2HQ1A 1DJQA 3JD3A 4XGIA 1IZ0A 5COAA 4MPDA 3E18A 3MJTA 1GQQA 2Y66A 1B14A 3QW2A 1PQUA 1YXMA 4MIOA 2Y1FA 4NJMB 2IZZA 4R54A 4ZVVA 2ZB4A 4ND1A 1Y8RA 3FSRA 3RUFA 4CMHA 4D0RA 4L8VA 5ITVA 2WE8A 2CDAA 1XDWA 2UVDA 2GZ3A 4KWIA 4QUKA 4EJ6A 1VKNA 4IQ0A 1SEVA 2V65A 1N1GA 3GN1A 3TL2A 1QYVA 2Q45A 3ZWNA 2GASA 1LDMA 2ZTLA 4FGSA 2Y1EA 1YGYA 1GU7A 1D7OA 1MB4A 1I2CA 3CH6A 2FRDA 4CL8A 3GMDA 3LSYA 3ROPA 2AXQA 2O7QA 1YB5A 1YB1A 3GZNB 3ANNA 2PY6A 1UAGA 4F45A 3PWKA 1E6WA 1QP8A 1H0KA 2X23A 3JQCA 1YL5A 1Y8QB 3WNVA 3ZHBA 4ALNA 1M76A 1O94A 3BIOA 3AY3A 2C5AA 1H9BA 2O7SA 2X0IA 4B7CA 1E5LA 1CRWG 3DB2A 1HKUA 4A26A 4FS3A 2JD0A 4FIZA 1PS9A 3ULKA 1QORA 5IXSA 4CM7A 2PV7A 1V3VA 4UUNA 1RYEA 4R69A 3PYMA 3COSA 4J3FA 4DA9A 4YRDA 3DHEA 4M87A 1ZW1A 4ZD6A 5FF9A 5JDCA 4UUMA 5IZCA 5IZCC 4FJ1A 4GH5A 2I99A 1N8KA 5G4KB 3RVDA 4ZU3A 2CY0A 4E13A 3QWFA 1ZK1A 3OMLA 3BXXA 3WSWA 1BXGA 3M2TA 3VHRA 4D3SA 3ZU3A 1PSDA 2OXIA 5CDGA 2JCVA 4FPXA 5T67A 4IJWA 3WNQA 1GZ6A 1ML3A 2GERA 3HDYA 4CLRB 3SC4A 4DPLA 2HK7A 4PLCA 4CODB 1HWYA 2VHWA 2XOXA 3ZWXA 1U1IA 1R4NB 3H9EO 4J9VA 2DTEA 1VSUA 3MJCA 2R6JA 4FC7A 2E49A 1LX6A 1I10A 4BNFA 2Y1GA 1N9GA 4PLTA 4RPGA 3B6ZA 4FFNA 3RJ9A 2HK9A 1LJ8A 1PL6A 2HU2A 2J3HA 4L73A 1AHIA 2UAGA 4FJ0A 1B7GO 1H6AA 3DOJA 2G76A 1XGKA 2RH8A 4JQCA 3L0DA 4R4JA 4TSKA 4XDZA 3Q2KA 1FDWA 1ISFA 5CEEA 4FB5A 2E6UX 1IUKA 4ZQBA 1P3DA 4NI5A 1V3TA 2AQHA 2PKRA 3OEWA 4RO0A 1R6DA 3RBVA 1X7DA 1ZK2A 2VYNA 3DFUA 4U0KA 3BMNB 2NVUB 3U4HA 1QYDA 5A5FA 3E48A 4Y98A 1QYWA 4C4OA 5L45A 1NXQA 4BKRA 3ZV3A 3MJ4A 4ALJA 5JC1A 1NNUA 1NWHA 1UDBA 2WE7A 2Q1UA 2YYYA 1UZLA 2GYYA 2NTNA 4NBUA 1J5PA 2GDZA 4P22A 2VUSA 2A4KA 2HMVA 4IBOA 4PLYA 1XKQA 5JW6A 2FSSA 4RLHA 2RH4A 3I3OA 4E5YA 3C1TA 2GZ2A 2ZCVA 4MP6A 3VH3A 1GV0A 1BDMA 3RAJA 4J7UA 4HKTA 3H65A 4RPKA 1WZEA 1Y7TA 4J1QA 5ER6A 2Q2WA 3RBXA 1XA0A 4WCFB 3FCOA 4E12A 3EUWA 1Q0HA 3KYCA 1WMAA 4L4RA 1DC6A 3VPGA 1Y9AA 3W8DA 1U3VA 4LRTB 4BMVA 4R51A 4DPKA 3GNSA 3UAGA 1P1FA 3H5AA 1WDMA 3JQ7B 5FEUA 1IL0A 1WVGA 3P5SA 3BMCA 5FI3A 1K6IA 3SEFA 4URFA 2DTXA 3MJVA 2P4QA 1PJBA 3I6QA 2X1HA 4J2HA 4NG5A 4A27A 1DEHA 1HEUA 1MFPA 2FN7A 1VKOA 1UXGA 5HS6A 4QTZA 3IOYA 2W2LA 3TOZA 3UFXA 4U6SA 1P74A 2WYUA 3PHLA 5C7LO 1N92A 1RWBA 3ABIA 5L3ZA 2GN4A 3STHA 2X0JA 1B3BA 5DZSA 2FHSA 1NFQA 2NU8A 3FF4A 3WFJA 1E3EA 1YVEI 3K73O 3O4RA 2HRZA 4DXHA 3DAGA 3IJRA 1VSVA 1YL7A 5CPBA 2AG5A 2GZ1A 3EAGA 4CM1A 3OQ6A 3W8EA 3WMXA 3SJ7A 3GMSA 4D42A 2HMTA 1R0LA 1E3SA 1ZBQA 4CMGA 3EZYA 3I4CA 3DDNA 1ZXBA 3LT0A 2WMDA 1PR9A 1C0IA 4GL4A 1EVYA 4FGWA 1V8BA 2EW8A 2V7PA 4JIGA 1JA9A 2P9CA 3O38A 3H9QA 3P19A 1A5ZA 3NEPX 3O8QB 4GGPA 4AJ2A 3B1FA 3ASUA 2JD2A 2W8ZA 3AY7A 1W4ZA 3BZUA 4TZTA 1PZFA 3JQ8A 5BNFA 1U7HA 5JMPA 1NQAO 1NAIA 4KMSA 5GMOA 4PIVA 1ZJZA 4ZRNA 2UYYA 3E6AA 2W4QA 2CUKA 1HDCA 4AJLA 3HADA 2I66A 4BNJA 4CV1A 1VI2A 2BF7A 2VWQA 1C3VA 3FBTA 4YJFA 1N7HA 3OH8A 4IGEA 4C7KA 1C1DA 1E3WB 1YO6A 4AJHA 4BO5A 1B8VA 1DB3A 3QHAA 4XIJA 3FBGA 3TSCA 5C3MA 3Q6IA 2D5CA 5CDYA 3GDGA 1XWFA 4DC0A 4IDAA 5CG1A 2OGUA 1IPEA 5KVVA 4BNVA 4QO8A 1UH5A 1CYDA 4EUFA 3TZCA 1I5RA 1I2ZA 4U5QA 1GZ4A 1ULUA 2A94A 2X5OA 2YFHA 3H7AA 3NJ4A 2J3KA 3EY4A 3U09A 5JS6A 4XB1A 3D5QA 1KVUA 3ETGA 4G5HA 4DYVA 5BR7A 1N5DA 2O3JA 4NIMA 4NBRA 4RF4A 1DIGA 3ZWAA 4YB8A 2X6TA 4YJGA 1EQUA 4KUHA 4BMSA 4GVXA 4CMKA 3PTZA 1Y5RA 1MP0A 1NAHA 3GFGA 3JYOA 1KETA 1PWZA 5ILGA 4MVJG 4OQYA 3NT4A 3U49A 2VRCA 1GQYA 1EK6A 2J5KA 2QRJA 1X1EA 3PHJA 4GX5A 2NU6A 5KKAA 2OORA 2AW5A 1T2CA 3DZKA 1D4FA 1T2EA 4RVDA 4WLUA 4LSMA 1M6WA 2I65A 1BXKA 1GZ3A 2JFGA 1RM3A 2Y1DA 4HFRA 3EVTA 2AA3A 3KVOA 3RI3A 1KVSA 3MWEB 2VQ3A 2JD1A 3U4CA 4CV0A 3VOSA 1JVSA 1KEWA 1RM4A 1BVRA 4BNLA 1CWUA 3KM0A 4TRJA 1LDNA 2D4AA 1LLQA 5CDTA 4YCAA 1QKIA 2WM3A 3IP3A 4TRNA 3GG9A 4I9UA 1P9LA 3JV7A 1FF9A 1KEPA 2PD4A 5A9RA 4E2XA 4KUEA 5L4NA 2ZB8A 1NP3A 2QRKA 2BFPA 3PZRA 2IODA 1Z73A 5TJHA 3WGOA 1X14A 5DP2A 4HWKA 4MO2A 1R66A 2OP1A 2QYTA 5G0VA 1ADCA 3WJ7A 1CDOA 3BHJA 4BQPA 3HNPA 4W82A 5F1PA 4KQXA 1HZJA 1VL0A 3I52A 3VZPA 5I8WA 4F6LA 5I7EA 1YJQA 4F3YA 2XF8A 4Z3KA 1KS9A 2EJWA 3AUAA 4R1NA 3L77A 3JQAD 4ILKA 1E1KA 4YJDA 5CP8A 4WGGA 4RVHA 1HLPA 3PFWO 4D41A 2PR2A 4CR6A 4D7AA 5JSFA 1HE4A 1DSSG 3FPCA 3RC7A 4M86A 3KYDA 1FK8A 1LSJA 3E5RA 3GQVA 4IS3A 1B15A 3W6ZA 4E32A 4E5NA 4E4YA 5L4SA 5F5LA 1C0LA 1E3IA 3HJAA 1SB8A 1BGVA 2DFDA 4NHEA 4MKRA 5L95A 1WAMA 4LN1A 3C1OA 1P44A 2O3SA 3RD5A 3ZN2A 3FN4A 4B4WA 5CDSA 1NQ5A 1MV8A 3ZV4A 2CVOA 3ZH2A 1T25A 3PYLA 1U4SA 4AG3A 1PGJA 5H81A 3ROMA 3UW3A 3DBHA 4DREA 4GGOA 2PTGA 2EGGA 5L51A 2RHCA 1X13A 3IJPA 3WOHA 1LUAA 4A5OA 3TZQA 2VZ8A 4GVLA 4RF2A 1SMKA 4DIBA 4FW8A 2HCTA 4NK4A 5LDHA 2JKVA 3QSGA 1NHGA 2V6FA 4YDRA 5JBIA 3U9LA 1OC4A 4DQXA 2OHXA 3DZGA 4BNIA 3QVTA 3AJRA 2ZJ1A 3ROQA 4OOFA 4DLAA 3AUUA 3D7LA 5JFOA 5TLSA 4M8SA 4ESOA 1YB4A 4Y6SA 1YBMA 3E03A 3A28A 4RVFA 3CXRA 3SLKA 4RPHA 2EEZA 1DIRA 1EE2A 1AXGA 3DHYA 1A7KA 4NMHA 2JCXA 4TRMA 3V2HA 1NQOA 5IF3A 4JK3A 3OEYA 2Z95A 2DQ4A 3Q1LA 4BKQA 1DAPA 4EBFA 4YT4A 4DUPA 4CUJA 3GN2A 3JQAB 1R16A 3G3EA 1DPGA 2V6GA 3NDJA 1HSOA 1P31A 2H63A 1Q2XA 4AFNA 4CV2A 4U6QA 3EZLA 1HDOA 2IDZA 2WD7A 2XPCA 1KEUA 4HBGA 3DMYA 4CMEC 2UDPA 1XU9A 3I9OA 1NBOA 5JDIA 5GZ1A 5JDIC 3PQDA 4D79A 1HYEA 1UXHA 2ZATA 3C7AA 1LRJA 1I01A 3DBRA 3UICA 4J49A 4CR8A 3C7CB 5ICMA 4FOOA 3K2BA 4DBZA 1Y6JA 2QG4A 4R16A 4BO1A 4XQ9A 5TJ9A 1SNYA 5AXBA 5KJFA 1P77A 3UGKA 2ZJ0A 2GPTA 4BKOA 2PGJA 2VYVA 1LDBA 4O6VA 1U5AA 2DLDA 2FMUA 5CHEA 4NK5A 1A27A 5ADHA 2PGDA 3UOGA 4DGSA 1QG6A 4J4HA 4JX8A 2XXJA 1AN9A 1I36A 2IEBA 2Z1MA 5G4LA 1DIAA 2ZB7A 2Q2QA 3RUAA 3P2YA 1V3UA 1LQTA 5K6AA 5K6AC 3HZZA 3JQ9A 2QW8A 3DBVO 1DIHA 1PJQA 4N5NA 3V8BA 3IC5A 4IMPA 3ZW9A 2I3AA 5T8KA 5T8KC 4KZPA 2EIHA 2CSUA 4AL4A 2DPGA 3D1LA 2J3JA 4XKJA 2UUOA 4B4OA 3H4VA 4DIOA 5DF1A 4X54A 5G0SA 4Z9YA 2Q4EA 2Z5LA 5EPOA 1EQ2A 4RPJA 1DDOA 4P4LA 3QWBA 1U3UA 2FY8A 4RGBA 4FBGA 4YPOA 3KSDO 3FR7A 4ONEA 2X4GA 4KWHA 3TFOA 3F5SA 4I9HA 1HF3A 1ZEJA 4XGNA 4OKIA 4N5MA 1KIFA 1PGPA 2IZ1A 1PJCA 2P9EA 4Y6PA 7ADHA 3QIVA 3GR6A 2Q49A 4A03A 3GGGA 4YYZA 3V1TC 4NU6A 4UVHA 4BGVA 5L7TA 2BD0A 1BXZA 5DBFA 6LDHA 2VOEA 3GVHA 3NT5A 4IXWA 5DP1A 3BTOA 1DIBA 4OSOA 1CJCA 1QV7A 1ZSVA 3SBOA 1PR3A 1GR0A 4YXFA 1BMDA 4BO9A 1UXIA 1M66A 1M67A 3OF2A 3R3JA 4Z0TA 5A3JA 2AHRA 3HFGA 1BW9A 5U4QA 3QWIA 4FFMA 3PHGA 3ASVA 4QFDA 3JD4A 3BMQA 4IGFA 3OICA 1DXYA 4BV9A 1U8XX 2B37A 2HAEA 5JO9A 1TB4A 2CDCA 2EKQA 4FFLA 3WYCA 4BNUA 4CMBA 1T2DA 2P5UA 1DJNA 2X22A 4MP3A 5JY1A 1B16A 2VCYA 3DZHA 4TWRA 3WB9A 4AJEA 2DPHA 2QRLA 1GL3A 1LTHR 4ZHSA 4JLWA 1YBVA 3VPFA 4NJMA 5KJ1A 3NRCA 3KHUA 3JQ6A 1BSVA 1HYHA 1LBEA 2QX7A 3ZHYA 3N58A 2I5PO 1A4IA 1KC1A 1OAAA 1B8PA 3PPIA 3UH1A 4N7RA 4YJHB 4IUYA 3PP8A 5IDXA 1YOVB 4HP8A 3G17A 4YVFA 4ND5A 2VT2A 3RIHA 1KBZA 1I8TA 2VHXA 3HG7A 1ISHA 3NX4A 3VDQA 2Q50A 1E6UA 2WYWA 3K9QO 3PIDA 3WR5A 3GZNA 1EVIA 2YUTA 3ETEA 4OIMA 4M1QA 4B3IA 1TVEA 5G2OA 3HQ4O 4XD2A 1Y8QA 2FR1A 1HXHA 1JTVA 4J16A 3L4BA 3CZMA 4HNHA 4R1UA 1GFSA 1I32A 1WNTA 3I1JA 4MVJE 1ZUD1 1ZK4A 2D2IA 2DUWA 3GEGA 2JL1A 1SPXA 3JQDA 1A7AA 5TT0A 1JN0A 1FMCA 2ZB3A 8LDHA 3TDKA 5G4KA 1GUZA 4XYBA 1BTOA 1IPFA 1LSOA 2DU8A 4HFJA 4K26A 4IQ8A 4CR7A 3ONEA 1NVTA 4ITUA 5AYVA 4XWYA 3HDJA 4BKUA 1NVMB 2B4TO 2H1SA 4XDYA 3GEMA 3AK4A 1QXSA 1QR6A 5JAZA 4CLRA 4MDHA 1WDLA 2UV8A 3GHYA 3EC7A 4EUHA 3ITKA 1R4NA 3LK7A 3OM9A 2YJZA 4BNYA 3D3WB 3QA9A 4LK3A 1D3AA 1MLDA 2B83A 2VWHA 2B69A 3OIDA 4S1VA 1E7QA 5AXCA 3LF1A 3MTGA 4YAEA 2PKQO 3WMWA 2VHVA 1QMGA 4PG6A 1CQJA 1EUDA 2CZCA 3NUGA 5BSGA 4YAGA 2QZZA 5JYDA 4ALMA 4BV8A 1X7HA 2FSVA 1IE3A 1Q0LA 3QVWA 2IRWA 1GYQA 2JJYA 4EW6A 3F1KA 1AE1A 2X0RA 3DXFA 4YQYA 1E92A 5JAIA 1LDYA 1W0CA 1OFGA 1DRUA 3KBOA 1CETA 1ZFNA 4KDFA 5F21A 2NVUA 2Y0EA 4CJXA 1FDSA 1VM6A 1JKIA 1E1LA 4OSPA 1OI7A 4E2ZA 2VOJA 1ISGA 1O9BA 1VJ0A 3H2SA 2GCGA 3JD2A 4R5MA 5JPIA 4DQVA 3ZU4A 2NU9A 2HUNA 3F3SA 2IYOA 3I9KA 3V2UA 3UN1A 4MKZA 2C54A 2NTJA 5DCWA 4MINA 1GAEO 3F5QA 5KKCA 4IINA 3A14A 4FQ8A 1GV1A 4N18A 3ZHXA 2GUGA 2VT3A 4BS9A 1EVJA 3ZGYA 1Z74A 4Z0PA 4L4SA 5KVCA 1PTJA 4B79A 4BNHA 2OUIA 3IQDB 3T7CA 4EJMA 1G1AA 2F1KA 3HHPA 3UUWA 4WCFA 1R4MB 4WCFC 5A03A 2IXBA 5KNLA 3I23A 4GKBA 3NDRA 4J43A 3VC7A 4PG8A 2HRBA 3WLEA 2GF2A 5TQVA 2AQIA 3E1KA 3K2EA 5KVQA 3OIFA 2DBQA 2H6EA 1Y5MA 4IQGA 3G49A 4H15A 2Q4BA 1PWXA 3U5TA 2HDHA 1LU9A 3JQ7A 4UUOA 4WLOA 2NVBA 2AEMA 5ENDA 1KOLA 3GUCA 1HETA 3IKVA 4J2OA 1PS8A 3QVXA 1UDAA 3MOIA 5G0WA 3TWOA 1I2BA 1T2FA 3ZDFA 4M55A 4CLXA 1ADGA 3AI2A 1ZEMA 2DFVA 3OA2A 1H2BA 3QWHA 4NDNE 4U8GA 2DTDA 2X86A 5A02A 2ZYGA 3CE6A 3DHNA 1W73A 2VYND 2E48A 3N7UA 3ONFA 4CV3A 5B4TA 4CMCA 3VVCA 4PRKA 1LC3A 4O63O 4FJ2A 2GRAA 2JFFA 2CVZA 1WW8A 1WMBA 3H2ZA 2W2KB 2H5LA 4BNXA 2RIRA 1MC5A 4PRLA 3TQHA 3DBLA 1GPJA 2PA3A 4L0QA 3WLFA 4OH1A 1DC3A 1S6YA 4BVAA 2IZ0A 1ENYA 3BTUA 3FWNA 4U7WA 4MVJP 4NR0A 3B1KA 4CUZA 4GSKA 2HLPA 3I83A 5EN4A 1KC3A 4DBVO 3GNQA 4LGVA 4LCEA 4UEOA 3WGYA 3CZRA 4J91A 3ZWPA 1KY4A 1M6HA 1U7TA 2HK8A 3FR8A 5BT9A 4LW8A 4WEQA 2WTBA 3OHSX 3WDSA 5A4DA 2Y99A 4NFYA 4OXNA 1PIWA 5ER9A 1IOLA 3GNTA 1SOVA 3P7MA 2NQ8A 1ZSNA 3O8QA 1F12A 1YS4A 3GVPA 3RWBA 3F6YA 4OAQA 4R1SA 3CMCO 5L7YA 1WXDA 3D5TA 1WDKA 4QSMA 3AWDA 3K5PA 1MFZA 3VZQA 4E5KA 2AMFA 2YDYA 4P4GA 4WNIA 2Q1TA 1VL8A 1H5QA 2C07A 3H8VA 3PWZA 4LRSB 1EDZA 3WG9A 3LLVA 3F1LA 3KSUA 3ZV5A 2DVMA 2W2LD 3CEAA 1HDYA 5DDIP 3FTPA 4OOEA 5AVOA 2O4CA 1XQ1A 2EKPA 2Y05A 4GAEA 4NJOA 4TROA 1E3LA 2WEKA 2X9GA 3UCFA 2C82A 8ADHA 5IAAA 1DBVO 1PJLA 2FWMX 3QQPA 1KY5A 2NM0A 3GVIA 4JGBA 1E3WA 1WP4A 4XX0A 4M54A 5LCXA 4D44A 2PD3A 3QLJA 4YAJA 4CQMD 3PLNA 3W6UA 2G0TA 3BTVA 4OL9A 4RF5A 3EMKA 5FWNA 3NDIA 4BGIA 4F46A 1FDVA 2NLOA 3QVOA 4WLNA 1WWKA 4O0LA 4UREA 1X0VA 3OA0A 4IPTA 4OM8A 1CEQA 5U1PA 5BQFA 4XR4A 4O1MA 3D3EA 3MZ0A 3VZRA 1JWAB 3DMTA 2GNAA 3DMTC 3IKTA 4B4VA 1IHYA 2ZYAA 3D4PA 2IYPA 4B7UA 4Q3CA 1JLLA 4XR9A 4FOSA 3GUYA 1F14A 4RQTA 3AUSA 2Q46A 4MVJA 1YDEA 4XYGA 3UVEA 1R0SA 1LXCA 4A10A 1IULA 1HDGO 3LQFA 4I08A 4R3WA 4XYMA 5A5EA 4XEHA 3GAZA 3CKYA 3PDUA 3PYXA 1J4AA 5KJCA 4BL5A 2IE0A 2CVQA 1DFGA 2Q1WA 4CL3A 3DAPA 1DLJA 2GD1O 3W4IA 5DOZA 2Q3EA 3DTTA 3CINA 2GGSA 1B26A 3BMCB 3IMFA 4PN3A 3VPHA 3GRPA 1I3MA 1YQGA 4PZEA 1UAYA 4IDEA 5TF4A 5EL0A 4BOYA 4UVDA 4Q3EA 3EW7A 2EV9A 5ICSA 3UKOA 3JQGB 2F00A 3CPSA 5EMHA 3VH1A 3QJ5A 1E7SA 4CLOB 5JO0A 2P68A 3PJGA 3DZBA 2GSDA 2JCYA 3GT0A 2TMGA 1X0XA 3OBBA 5KWEA 2FP4A 3OETA 3AFMA 1O89A 1EMDA 4CQMB 3WYEA 3KXDA 3P2OA 2PK3A 2WYVA 1K6XA 4FFPA 5K0ZA 4I9NA 1MGOA 3AFNA 3JYQA 3PLRA 4HY3A 3C1AA 2GR9A 3CMMA 3PIIA 1DC5A 1XG5A 5DNAA 4DWVA 3PGXA 4BNGA 3VKVA 2C7GA 2NUAA 4CM4B 3WQQA 2BMAA 2OO5A 2OL4A 3RROA 2ZTUA 4LVCA 1SCUA 2V6MA 3WIEA 4DPMA 4CM3A 1JW9B 2BI8A 4BNMA 3QE3A 3GGPA 1AGNA 3F9IA 4NZ9A 5LDGA 4J9UE 1HL3A 1ZO8A 2YV2A 1LLDA 1UP4A 3DR3A 3DONA 3ROKA 1VL6A 3VTZA 1FDUA 1EK5A 4XCVA 3X2FA 3WSVA 4AICA 3U3XA 3C8MA 1Y81A 4I5GA 4DLBA 5TNXA 4DMMA 2PGLA 1G0OA 2OP0A 2C5EA 3NYWA 4R01A 1XCBA 1FJHA 1PGOA 3GHHA 1YBAA 2ZYDA 2BHLA 4CQLB 2OOSA 1OOEA 5KIAA 3H9JA 4LISA 4I5DA 1F06A 3GVXA 4E2YA 3OSUA 3RFTA 3U62A 2NADA 3I4FA 4GKVA 5HS4A 2BGMA 3GFBA 1RJWA 1H94A 3L07A 3ENNA 3GPDG 1C1DB 3AI1A 3K31A 3LT2A 1NR7A 4ZRMA 1GD1O 3KTDA 3JYLA 4RVSA 1U9JA 4IJVA 5L7WA 3RUHA 1UXJA 4D3DA 1V35A 1N2SA 4YBZA 3VZSA 1CIVA 4E30A 4G81A 4QECA 1MC4A 1YQXA 3ST7A 1VJTA 2B4RO 1GUYA 4KQWA 1W8DA 1K6JA 2B0JA 3S2EA 4CMJA 1IHXA 5JCJA 1SOWA 2QQ5A 1C1XA 2EP5A 3ZU2A 4MVJM 5ENVA 1K2WA 2YZ7A 1NTOA 5HTOA 2C7VA 2G1UA 1JQBA 4FCCA 5B4VA 4WEOA 1LSUA 3V2GA 1ONPA 2EXXA 3RSHA 3IAHA 4Z0HO 2PH3A 2PZLA 3ON5A 4RV9A 1M2WA 4ZJUA 2PZJA 2BI7A 3LVFO 3BMOB 4RVUA 2E4AA 4UVGA 4ZA2A 4TQGA 3WFIA 4IMRA 5EINA 3UXYA 4IJKA 2VRBA 3TOXA 5A06A 3LZ6A 4PVCA 1T1SA 2AG8A 2EP7A 3VPSA 1PEDA 2VWGA 3OJFA 2G5CA 4BNZA 1VE9A 4IZIA 3WICA 4ZICA 4RVGA 4OJNA 6ADHA 1JWBB 2BRUA 3LC1O 1BVUA 2YHIB 1ADBA 3Q0EA 3PHIA 1IYZA 4A73A 2RAFA 2ZTMA 5BSEA 4W4TA 4PLWA 3PJDA 2HJRA 2R00A 3LDHA 2R00C 4C7JA 5TT1A 2OBNA 2BGKA 1EUZA 3GC6A 3QV1A 3DQPA 1TLTA 3UCXA 5IN4A 2C29D 1ZVMA 3I6IA 2P91A 1UUFA 3OJEA 3WTBA 3ZWYA 1Z75A 2O3RA 2D0IA 1DHTA 4INAA 4WASA 3X2EA 3GY0A 4E33A 4EEZA 1WPQA 2BFMA 4JJGA 2I3GA 1HE3A 1U28A 5I7FA 4FSHA 4NBWA 4XA8A 1YDWA 3Q9UA 3QRWA 4AVYA 3KUXA 3W1VA 4IIUA 4ZQFA 4BB6A 5T5QA 4HV4A 4BNTA 4J4BA 4XJSA 4BB5A 3VH2A 3JTMA 3T4XA 5DULA 3KB6A 3WBBA 3INTA 4A7PA 2HMUA 4WLVA 1E6EA 1TT5B 1Z82A 4CMEA 4BNWA 1HT0A 3NT2A 1L1FA 3VAZA 4YAKA 4QX6A 1XSEA 1MX3A 3KEOA 3DOCA 5KVSA 4WNCA 2H9IA 4RZIA 3T7EA 5COQA 1ULSA 3UF0A 3D4OA 2GO1A 3GH3A 5KTKA 1NVGA 4RORA 1X15A 4OGWA 1GEEA 1I3NA 2J5RA 5KOIA 2UUPA 5U9CA 3VDRA 1NFRA 1LEHA 1PL8A 1S7CA 5EQDA 1MUUA 3TRIA 3C7DB 4O5OA 2PNFA 3TF5A 4GWGA 2VYVD 3WTCA 3PJEA 3PI7A 1I30A 3RJ5A 2A9FA 4JBHA 4G2NA 4UVEA 1N1EA 1DAOA 2EHDA 4YRAA 1U2DA 4P38A 1ENZA 1NASA 1JVBA 1K0UA 5KJ6A 2CFCA 3ZWCA 4OMUA 3KV3O 1LLUA 2EGHA 1ARZA 1FDTA 1K3TA 5ES3A 1UJMA 5F1OA 1PJTA 4RQUA 1ID1A 3ZNOA 2JFHA 4RJTA 3RU9A 5B37A 3JYNA 1QLHA 3EGOA 3TFQA 2DBRA 4AJJA 1I0ZA 1LDEA 1ZK0A 4J90A 4DQUA 4W7HA 5C37A 3S8MA 1YKFA 3PJFA 3Q11A 3PGJA 3TN7A 2R2GA 1NQTA 1KVTA 4UVIA
chains in the Genus database with same CATH superfamily
2YWRA 3C6KA 5I9IA 5MGNA 3ZLVA 4R7ZA 5B58C 2PSDA 3FZYA 1E0DA 3GLKA 4LDNA 1HLDA 5CU7A 3VKFA 2QNBA 3BSSA 3IAAA 2QVLA 1NVDA 1L7QA 4J1NA 2F1IA 4QUAA 4AKIA 5F64A 5BSFA 1SZPA 5DW3A 1F6WA 1TW3A 4FGJA 4GUDA 1SCBA 3WGQA 4A2QA 3KFXA 2PZFA 2JGEA 5LZ5A 3X1XA 9LDBA 5JY6A 1PDWA 2RI6A 4OTZA 3TSYA 4P93A 1E77A 3IKMB 5L3VA 1I7SB 1YB2A 1PD1A 2I2WA 2EF0A 3RGWS 1HE2A 3PCTA 4GMGA 5DB4A 3UENA 3M3PA 2BKAA 3IULA 3U4DA 1RC0A 4EARA 1KH1A 2XT6A 1PK7A 1UP7A 5A4MS 3K71B 1JZQA 2QMHA 4JP1A 1BFKA 1QBKC 3WV4A 3E7FA 3V1KA 3RTDA 1QYCA 4LF5B 4UD2A 4QFMA 3K7EA 3RLIA 1OASA 2YOGA 2QUIA 4L4XA 3IYLW 3BAZA 3PNKA 4KEAA 2VSYA 1I4TD 4TM8A 2XX3A 4S0ZA 9LDTA 4J6FA 1WZNA 3CR8A 1Z5VA 1HZZA 2O23A 3HRKA 2V45A 3KT0A 3LPMA 4BVHA 3MEQA 2VIIA 4MJ7A 1JKFA 4ROTA 1V1RB 1R10A 1L2TA 5HEKA 2EW2A 4PHTA 2GJAA 4L2IB 3ZV6A 3LVQE 4NZZA 5AESA 1QG2A 5JJLA 4ZYUA 5JAQA 2P79A 5BORA 1XIVA 1IN7A 3AETA 3VR6A 3A06A 4KN8A 1A9TA 1ADFA 3DFMA 5DTMA 2ZRHA 4DL9A 3ECAA 1QZZA 2PZMA 3GLFE 3ONWA 1GY8A 4ZANA 1Q1GA 2XODA 5I9TA 4PN7A 4BXOA 3T7TA 1S4QA 5SY6A 4H7FA 3D7NA 1JG6A 3QIAA 2XRZA 3U0BA 1JFLA 1DFIA 4NH4A 2BLLA 5K4AA 3F7MA 4EEXA 4W9MC 3N2ZB 4L6CA 4EGSA 5EC8A 4BV3A 4DM3A 2AOUA 4I2VA 3VMMA 2OBFA 1N0IA 4UTXA 1TZBA 1P81A 1W4AA 2NV6A 4R8RA 3NHFA 3N8GA 5KQPA 3JS5A 3KZOA 4NATA 4C06A 3WK8A 3H9BA 1VP3A 1CUCA 1U1EA 4O1HA 5KTOA 3CRZA 5FBWB 3ZI0A 4AY6A 1RXYA 1JMYA 4ZV7A 3ZNNA 4BHTA 4RTNA 1GRCA 3OQBA 4HX5A 1E2PA 3SXUA 1T26A 4LV8B 2EARA 1XQWA 2CBXA 2IYRA 3FAZA 4H77A 3F9RA 1QFSA 5HMLA 5CAEB 3W78A 4KI7A 3GWGA 4E51A 3T3OA 2FEMA 2B34A 4X6XA 4HT3B 1QE0A 3F0TA 1KEVA 3UXMA 1WZCA 2UXDB 4E0BA 3TD2A 2GFHA 1BIFA 2ZS9A 1V7QA 1NNI1 3H3FA 2VHZA 2IHKA 1PL7A 4R84A 1W5BA 1ZZEA 1CQPA 5JR3A 1RFLA 1CTQA 1UADA 5T64A 1XAIA 3VR3A 4E03A 2GDJA 4OF4A 1Y89A 3H5WA 4TXHA 3QBJA 4NU5A 5IDVA 1E2EA 1JKJA 5EP3A 1H4VB 4NBNA 2JHFA 1M33A 1J0EA 1QFMA 2VP6A 3AOEA 3AXSA 1P0QA 4RKWA 1BN6A 3UMBA 3W9YA 5J23A 4DCVA 4GZMA 5L53A 2IHZA 4TWAA 4J07A 1SBZA 1ZCJA 1Y1RA 2GQ0A 3K92A 4FC6A 4D9IA 1LGYA 1E0SA 4RHXA 1KH3A 4FYIA 5ALSA 4DY4A 3MRTA 3QG1A 3OPYI 3KQHA 5HDBB 1DO8A 3JAKB 5HZGA 2YMLA 4MUGA 4OQZA 3C5VA 4ZKEA 1MEOA 1CJKC 4IIVA 1GYRA 3R2JA 5EJ6A 5EZQA 4ZAWA 3D3JA 4CTMA 4OB7A 2IPNA 3C3WA 1AZSC 1N2HA 2C0PA 4D0LB 3EVGA 4DUGD 3KJIA 5EQJB 1ZXLA 2DT5A 4RCYA 5AI9A 1P2VA 1Z5GA 5G02A 3TAHA 4E5PA 1Q7EA 3TEJA 4MRMB 4Q9NA 3CH7A 4WXMA 2OPHA 3L3BA 2IJGX 4AJ4A 4J29A 5K0SA 2J85A 1H2AS 3E5NA 3RPEA 4ZEVA 5F3RA 1XK7A 3FFXA 3IP1A 1TKBA 4LGCA 3CBGA 5BVGA 3F6SA 1FVOA 2XEDA 3BMNA 5CGZA 1BZYA 2JNWA 1FJ2A 3BXHA 1Z5OA 4IY1A 5IBCA 4UU7A 2HFJA 1HEIA 4H4EA 1CD5A 2SKCA 3B9PA 5GJCA 3CKKA 4G26A 4GX1A 4PAOA 2PYZA 3W2IA 1H6DA 2VXBA 4TTSA 1G7RA 4LWPA 3LI2A 2OAP1 2O2GA 2I6FA 1PNVA 2GLXA 4O8ZA 3A2LA 5FCDA 4LYEA 4Q1AA 1II8A 2HSEA 4LMRA 4TYMA 3EEYA 5IRCD 5B6JA 2B8JA 3IQGX 4R6WA 5GV7A 1M72A 3G2OA 1Y63A 4GBMA 5I9NA 1JHVA 3JQFC 4YAOA 1NT4A 2AH5A 2FWNA 4WNAA 2A35A 4IDBA 2CGEA 1ZNQO 1GPDG 4MGEA 2C20A 4CW7A 1C8LA 3RHFA 1F9EA 4WOJA 2EX4A 5FWYB 3SHVA 5B3JC 1Z8NA 4HNGA 4XXHA 1UMKA 1YD7A 1SHZA 2NSJA 4Q9DA 4ZXPA 4B6JA 5IXYA 3NM5A 1VDMA 4LHSA 2E5WA 4AMBA 5L9AA 2PZ8A 2VSXA 3A3YA 1ZCAA 2JGIA 3CLRD 4TQAA 1YCDA 4ITVA 1RWWA 1EFLA 5FI0B 1TD9A 5K8CA 1N33B 4K9MA 2SCUA 1EBFA 1YQDA 2Y6UA 3HUFA 1PD0A 2OMKA 3MLBA 4Q7EA 1ORHA 1HM5A 2FOXA 2WUGA 2WF8A 1RT9A 1QOZA 2XYHA 4LCBA 5IT0A 2NVOA 3STTA 4EUSA 3LT4A 5C2JB 1XTPA 1UFVA 1X1CA 3ZE2B 3CF0A 1U0OC 5CFOA 13PKA 1E59A 3LBIA 3Q9NA 3QX3A 2BHSA 2DPMA 4NYMQ 4B8ZA 2FLWA 4XRRA 4AJPA 2AJLI 3HSKA 1LS6A 2XUFA 4EHJA 4ZVKA 4PFJA 4KIFA 1EE1A 1PAUA 4ETMA 3KUDA 3JW8A 4OXKA 4TXMA 5K0JA 2GPWA 3OOHA 1HGXA 4QGBA 5TC4A 3PGMA 1U5BA 4WMLA 5F1KA 4G37A 2X5JO 5AM2A 1YZKA 4B17A 4ER3A 1JU4A 1VLMA 3F47A 3MOSA 1GRRA 1DBRA 4C6TB 1DKMA 4RS4A 5F12A 3SFVA 3BK2A 3O9MA 3QZUA 3ACCA 3RYHA 2HL6A 3MTBA 2POCA 1NVUQ 4W9NA 4BLOA 3SR0A 3KXIA 4X95A 2PX5A 3NWEA 1HKHA 2FWAA 1E7MA 4X8MA 5BRJA 1OXMA 1FTQA 2H7CA 1T2AA 1NP7A 4NY1A 5H16A 1ZQ1A 4DT1A 1J06A 1QGZA 4XPIA 2ZDHA 1PZXA 2DQSA 3F5FA 1NPYA 2K2QB 3LQ4A 1TEHA 5HA5A 1M34A 3K4HA 2EBFX 1TQ8A 2C00A 2GUWA 5BRNA 4QXOA 5AVZA 3GCGA 4DCCA 2IU3A 4RTLA 2HYIC 1WCIA 2PZKA 5CURA 4J0FA 5KYYB 3EF1A 5JT1A 2VK4A 4J1SA 5H5JA 1KGSA 4E5MA 4DV3B 3DEHA 1VC2A 4Q7KA 4RMGA 5G0TA 3PSHA 5CB6A 3L7KA 3NGMA 1O9HA 1V5FA 5FR1A 1Y0BA 2QKYA 1EXMA 2NO7A 1NR1A 4LOHA 5FP0A 5AW6A 5CYOA 1N9KA 2W37A 4UUQA 4CIYA 2IYUA 1EFTA 2BELA 2XXBA 3OQJA 5G1PA 4BNKA 1ZVJA 4UAGA 2GPYA 4LOAA 4UUPA 3SJUA 4ETIA 5IJZA 3LG2A 3RFXA 3KSBC 3LC0A 1VKJA 1Q19A 1QH1B 2J0QA 1JQ5A 1N9GB 1M83A 4V02A 4XVUA 3DGEC 5KNCH 1V25A 3I09A 3GLHA 1PWHA 2YC2C 3AQ4A 3EWNA 3GRVA 1K0FA 1RTKA 2FZLA 4MA0A 4C6RA 4JAVC 4M7PA 4OD0A 4EL0A 5KOJB 2B4QA 2VUTA 3OT5A 1YSCA 4W7IA 3THWB 5AMXA 2C98A 1AGPA 4ARUA 3HE3A 2HY7A 3WQRA 1X94A 3BBPA 3JQEA 3LF2A 2BKUA 4D82A 4EB6A 5JH7F 1DI0A 1J0XO 1G20B 2C2HA 2XZPA 3ANMA 3DKVA 3JQBC 3KEQA 2C83A 1XXHA 3JVVA 2V9CA 1T6XA 2ZFUA 4A8JB 3AEKB 1RM0A 4JV5B 1T9CA 1THTA 3C3KA 2X77A 3HKCB 5IJXA 5SZKB 4ALKA 4MWCA 4YDSA 4M1EA 2QU8A 5DBGA 2UZ0A 3CF4G 4U7GA 1YHZA 2AWOA 5DHSA 2IEIA 1ONSA 2PKQP 3LLSA 3TXYA 2FE1A 4TTVA 1S9HA 2R6GA 3KSMA 1IBKB 4CQMA 1L6RA 2X0KA 4RZSA 5LB4A 4YV7A 3EUFA 2D6FA 3LECA 3OPXA 3I9JA 5IFLA 2QTWB 4X64B 3IP6A 3AH8A 1L5RA 3NZEA 4B46A 3G89A 4RE6A 1EK1A 1UWKA 2N9UA 2XBUA 1R15A 3KJQA 3OESA 4FFOA 1TCVA 4CM4A 2O4UX 3ENQA 3SQDA 2YH2A 1Z4OA 2I3BA 4AMGA 1L8QA 1P72A 2HSGA 1ENOA 3AR2A 4MVJD 3UMMA 4F3TA 4NFHA 7MHTA 1N2XA 1TF5A 2AEJA 2WZBA 1GKLA 1VPEA 2VJQA 5KSZA 3QNUA 3LOPA 1JBKA 3UHAA 1SVLA 3PUYA 1C0PA 2WKPA 3VDNB 4DG9A 3KE9A 3U44A 1NY6A 3HVUA 1GQRA 1LS1A 2YOFA 1DFHA 2C4MA 1PG5A 3D9QX 4XFJA 3CNLA 3WRXA 2DWQA 1FW8A 3PA8A 4X00A 1NL3A 4MWEA 4JNKA 4WXRA 1QIDA 3A26A 3QU7A 1LVUA 4KDRA 1CVIA 3T7IA 4BQRA 3V4OA 3TQFA 4O2BF 1A5TA 1PJAA 4EF6A 5IX8A 3OJOA 4ZDJA 5SY9A 4MDEA 3GZ4A 4QT4A 1LLCA 1Z7WA 1J90A 2RG7A 1JQAA 5DHAA 1HUQA 1LZLA 5D01A 4GI5A 2RDMA 3FUCA 5M34A 2AE2A 4Q7LA 4JSTA 4YRRA 1NX6A 1KR2A 3MRVA 4F3CA 3DBOB 1JU9A 3PDCA 1N34B 1K5DA 1C4OA 1L0BA 2DAPA 1HE5A 4F3KA 3DLTA 2WF6A 2WNIA 1TF2A 4IFEA 1ZOOA 4M36A 4WZBE 2P1ZA 3O8LA 2JPDA 2NU8B 3R0XA 4KU4A 3F97A 4ZO9A 4W5OA 2V5VA 3EEQA 3ZNPA 2WU1A 2OQVA 4B6OA 4QNRA 3T7DA 2GN6A 4RYLA 3NBUA 4C7VA 3SF8B 1GGKA 4BTLA 2F67A 2Y2UA 4CEHA 3IAM1 2H18A 4GOMD 2EF1A 2IZ7A 5GVRA 2RHMA 4CNQA 1QH8B 3DDWA 3RG8A 1I3LA 1DL5A 4YR9A 4U7PB 2M6LA 1V8DA 4DIMA 2JI6A 5EUMA 5JALA 4OO3A 3SNHA 1OCEA 4K1LA 2Q99A 2PMCA 1JDVA 1OWOA 3LPAA 5TS2A 4CU2A 1CZOA 4MA4A 4HDNB 4ZT4A 2VWPA 4MUAA 3VU9B 1DAHA 1LJUA 3PEFA 2X0FA 4Q6WA 5JJ5A 3NBZC 4GC5A 4B8WA 4FK8A 3KXLA 1NI4A 3EEIA 4JS0A 4Z1MA 3UUEA 1GCUA 3T3MB 3EIUA 2BR5A 1JLLB 3C4VA 4ALLA 1ZJ5A 2J9YB 4MRPA 3TZBA 3U3RA 2MSDB 2ODPA 2VUHB 2PL3A 4GLOA 5JNLA 4FT2A 1IDOA 1JSRA 4O4IA 3TKYA 3WL5A 1CCWA 3UANA 2IHVA 4EJSC 3QM1A 5AW0A 4AG6A 2Y1CA 4Q4CA 1U4OA 1RJDA 2VUIB 3AVQA 1G6KA 2QENA 5JHGB 4FHGA 1FLDA 3A1NA 4BX9A 4QG3A 3JATA 4MUNA 1MB2A 5HE9A 3A6PC 2GM9A 3VU3A 1WSWA 2XVAA 3K0BA 4YJFB 2XDQA 3OE4A 1CVLA 4IDFA 4M9CA 5CLLA 5T4EA 1A88A 2HNBA 2JZNA 5DIFA 3EDQA 1N6LA 2FPUA 3L1HA 3NUZA 5HKLA 3ZGNA 5C8XA 1VHJA 2GBIA 2QMZA 4CEJB 3DZIA 1A1VA 4DRXA 1JXAA 2QIPA 4M0FA 2P1DA 1P7YA 3EFBA 4DIKA 3JWGA 2JAHA 4TQ9A 2IPLA 3M83A 3QKRA 5EEHA 2WF7A 3ZWBA 4DY6A 4NECA 2VBCA 1I7LA 4JMPA 1E1RA 4B3RB 4CF4A 2QAGA 3LY9A 2ADMA 3DTVA 1JHDA 2A7QA 2CUZA 2YW9A 3FYSA 4IDGA 4R0VA 4XTCS 4P83A 3K0HA 5JSQA 3NEJA 5FA8A 3D8BA 2P67A 4K2HA 1FFXB 1F4VA 3HVJA 4DJDC 1ODLA 2Q6LA 1DBPA 1Q15A 2J3IA 3QEMB 5LQKA 2V7BA 4OHUA 4FXOA 2VQFB 2P2SA 2N46A 2B5VA 3EIFA 3PCRB 1K4MA 4JI3B 3DS8A 4TGLA 2WPNA 2GK6A 3DEYX 3GDHA 3KPJA 3CH4B 1ZL0A 5BN3B 5HJ5A 2X9VA 3T61A 1PYOA 1TQ6A 4D43A 2HA4A 2IYSA 4QVGA 3UAXA 4E21A 1UIMA 2O8DB 1PE0A 2NTVA 4CLEA 1OZAA 3JQAA 3HO6A 2I2XB 3KOXA 4V03A 4ZOLA 1CNMA 1RBYA 3PDJA 1MEEA 4L3WA 1IBCA 1ZN2A 5ALQA 2QWXA 3QVLA 3RSOA 2RHRA 4R68A 1V39A 4UE2A 3NV9A 5A5DA 5KVAA 4QXAA 5MDHA 1GG5A 1LRKA 3D4IA 3MT8A 5HIJA 1H6BA 5EP4A 1I6WA 1Z0ZA 1ZKDA 3OQOA 1N2ZA 4D45A 4AYXA 1XZHA 4Y6RA 1AMOA 4PO9A 2CYBA 3DO5A 1LTKA 2TMDA 3EBLA 3FFWA 3PHHA 4Y2RA 3KJNA 1E3MA 1NYTA 1DJLA 3A1FA 1Q22A 2R7LA 2NMVA 4BO6A 4JP3A 2FG6C 3B78A 3KYBA 4CCYB 3DWFA 3ICCA 4HX2A 1V26A 4KBYA 1GUBA 1GA6A 2TECE 4C0KA 4DLLA 1SIUA 1TJPB 2FW6A 3BRWA 4Z9FA 2XCUA 3LT1A 3M89A 4I6GA 3GLVA 5FPYA 3LWZA 3JD1A 5TSDA 5B4UA 5F98A 1FS4A 3MWFA 4FYMA 4LJRA 4URHA 4UULA 3IBYA 4UTVA 1VXRA 3GFSA 4MCJA 4ZAVA 1XAJA 3A6DA 1CQXA 2J45A 3QYFA 4JLDA 5KOHB 2XW6A 2A1TS 4II3A 4GS5A 4OHWA 1BWQA 4JJ6A 4AN1A 3NKLA 2YBDA 2BGUA 3ADOA 3T0GA 4KXFB 3N74A 4GW3A 5JNSA 3DEFA 4HADA 2HMSA 3HEBA 3LPNA 3NS7A 2YWCA 5D5HA 5K5EA 4JGGA 4XZ3A 1JHRA 3KR0A 1E79A 1IM8A 1O8BA 1U7DA 1UKAA 2QSYA 3C6MA 2ZE6A 3IIIA 4O4HF 3D6AA 5CA1F 2WQ6A 1G16A 2ISCA 2Q21A 2LUOA 2BJHA 5REQA 2JGMA 3QELB 1G5HA 2EP8A 2G40A 3D3QA 4TS3A 5HGJA 3U80A 2ZT7A 3WAGA 4H7PA 4WGFA 3OX4A 2M32A 3PC6A 2X4DA 3S68A 3GG2A 3KYDB 5AICA 3CLHA 2X1LA 1C1XB 5JD5A 3NFRA 1ZIPA 1YH3A 2O3QA 4HO1X 4ZI7B 2YNMA 2R6FA 2YXNA 4BAUA 2AJCA 6NULA 4A4DA 2C0CA 4QTUB 1H8HD 3W3AA 2QK4A 1JDJA 1KDTA 3NM4A 3ONDA 3AMVA 3FSEA 3MTJA 1XDBA 5IVKA 1ONOA 3OEHA 4WXEA 1YE5A 5JAOA 3FYDA 1T4MA 1X70A 4EW3A 5DI3A 5EJMA 4CMAA 2DBVO 2ST1A 2ZIVB 4C89A 4F5EA 5BV7A 3DBHB 4KVZA 4FDMA 4P2GA 2YOHA 3SIRA 4X71A 1XTIA 3G2KA 1EFKA 2BTQB 1CY2A 1ODCA 1P6XA 1I24A 3DEZA 4Q05A 4LZAA 4AXXA 1BROA 1MO4A 1MORA 3V7YA 3WYNA 3T6KA 2Y0BA 5DH9A 1W6UA 3AJ9A 5HMMA 3S2ZA 1I33A 2C31A 1RQXA 2EJCA 3CT6A 3EF3A 1DE0A 5HZMA 2OCBA 2Q27A 3ESQA 2C61A 3OFVA 4U2EA 1ISJA 3KT6A 5LN1A 3CWCA 2ZM6B 5A3RA 3GL9A 1I4WA 1W1UA 1XTRA 3H2YA 1TAHA 4YCDA 2C4NA 3RAPR 3AIIA 1QIMA 2RARA 1U7ZA 2YV4A 2MWMA 5C46F 1ODKA 4AJIA 4L4YA 3CNQS 3G13A 3YASA 2ACKA 3V4PB 2Q3LA 3DMGA 5DHQA 3W77A 1DG3A 2JIRA 2Z4SA 1A72A 1QO9A 1RI1A 3DHVA 4X90A 4NZPA 5B58T 5KHLB 3OJCA 1EFRD 1MVNA 3N0XA 4QT0A 1DC7A 3BCSA 3SS9X 2E5LB 4ACBA 2PMEA 5EMNA 3BT7A 1H1LB 1U0HC 1NUSA 3KXPA 3ONNA 3N2LA 1ADYA 1Q0SA 2I7CA 4JLOA 4E6PA 3QI2A 3GLIA 1Z25A 2IITA 1GILA 3LDAA 1QVRA 3NHLA 2N1MA 2ZJ7A 3A9WA 3GDOA 4QEKA 4ZT3A 1GUFA 3AVXA 2DYKA 1ATIA 4KDEA 1Y33E 4UTNA 3W9SA 1JLRA 3C48A 3FUUA 5IT9A 1UZNA 2VNSA 1JNYA 3OX1A 1VRWA 3MJRA 1OAKA 1K5HA 1P60A 4XGKA 3W2FA 3B5JA 1QAQA 4JJFA 3NH6A 3TMAA 2QM8A 5DHFA 1C81A 1Y9EA 1M2FA 1CDZA 3KDPA 2Q3CA 3QFRA 4MIYA 3V97A 1VG1A 3RW9A 1L7OA 4JY7A 3EHEA 5DNYB 4MYRA 3UHPA 2PRIA 2Y67A 2HQSA 1D2CA 1DXQA 2A5YB 3AW9A 2GZSA 3ZDBA 2XDWA 4PO3X 4Q9LA 4W6ZA 1ZJ4A 4B5LA 2REXB 2WG0A 3H9CA 1UMCB 1P6UA 3KFVA 4R8MA 3I6BA 3VR5H 1LC0A 2GMWA 2NQTA 3FW1A 3QWAA 1P4RA 4IFBA 1HQDA 1QKJA 1JYFA 1SU4A 1E1QA 3FCUB 3PFGA 2WSBA 4R9SA 4RPIA 4RIFA 3WXBA 3R8FA 2HSDA 4PLGA 1RKQA 4S1PA 4UMDA 2MT9A 4HFMA 1FYXA 4NZYA 3I62A 3T1NA 1I4DD 3AONB 4HXYA 5JPCA 2ROQA 3HCCA 4H9GA 3GVCA 4KQCA 4Y6LA 4L51A 3IQWA 3NWJA 2JFXA 3RFCA 4AJKA 1K5PA 3KQPA 1CEXA 3MJEA 2N3ZA 4II2A 1GSOA 1OA1A 4ED9A 2DM6A 2JEYA 1H0RA 3GRAA 1G66A 3NC0C 1REQB 4I50F 2KB0A 5GM2A 2LZ0A 2WR8A 1AQNA 4L27A 4B3MB 1Y7PA 1GVNB 5BSMA 4BFWA 2HF7A 4ND2A 1QIKA 1PZGA 3AV3A 2Z2XA 1X39A 4CM9A 5AM5A 4HNTA 3HA5A 2H2IA 1NNSA 4JBYA 4WWHA 4DA7A 4EM6A 3EZ6A 5H02A 4B4KA 1E3JA 2HBYA 3CCFA 4WY2A 2J08A 3VBEA 2EL9A 5JCPA 2HA5A 3WYBA 2WWHA 1R9GA 2VJLA 4Y67A 3BCHA 1EJ2A 3ZGVA 2V3CC 1E5VA 2JGNA 3E3LA 3ES9A 3TL3A 2RAUA 3LC7O 4KHZA 2CF6A 1PQ4A 3OJWA 5BV8A 2Z43A 1FTNA 1ZS9A 3NTQA 3L8EA 1IEWA 2DR3A 3K5HA 3OFNA 3TYXA 1MENA 1E1NA 4FZRA 2H65A 4PFQA 3H8JA 1FYEA 3VNQA 4EDFA 3ELYA 2NSDA 2I67A 3HJFA 3BRSA 3E2MA 2IV7A 4KOAA 3BK1A 3PUKA 3VDMA 4B40A 1UFKA 2CD7A 4AW9A 1Y3BE 1RYYA 3NHKA 4WN9A 3F6RA 3IP5A 5DBIA 5FWAA 3U3KA 4RZ2A 2PSFA 3ORFA 2IZOA 5JE8A 1NW4A 4KDCA 4WZAA 1YVDA 1W5EA 2JHAA 3L7LA 2B5WA 2MR6A 3DMFA 3U37A 5IYZF 3C6ZA 1W76A 3NTUA 2WTEA 3I6YA 1AB6A 1X8LA 2NXEA 1WB9A 3L9XA 3FVVA 3Q7EA 4Q48A 2B8WA 1NQVA 3LHFA 3ILSA 1W46A 1PSZA 3C3EA 4IJ5A 1HQYE 3BYZA 3OPVA 4WKOA 1UK8A 4FTWA 1YE3A 2O6HA 5G3YA 3LXXA 1SKMA 3HB0A 1JR4A 1FMLA 4HI0E 1QQBA 1QTRA 1T9BA 1QVWA 3WWYA 1NHWA 4LF9B 2GN8A 2WD9A 1MAHA 4AMZA 5FFFA 4OXYA 5GOZA 1E1CB 5CNKA 3F46A 1EM6A 1Z5ZA 1ISMA 1SO8A 2FUG6 4EF4A 3FTQA 1E96A 1R0ZA 2GCOB 3BIJA 1UBRS 2BFBA 1ZQ9A 4DLUA 5AQEA 3SXPA 2BI4A 2CEAA 2PH5A 2ZM5A 4GM1A 1ZM9A 3RS2A 1IZ0A 4NC9A 3ZJ5A 4JI8B 1XD9A 2WINI 5COAA 2CLEB 3E18A 4PRZA 5L3QA 3FYHA 1XJ0A 1WDTA 1PQUA 4KK3A 1GPNA 1SJ9A 4MIOA 2IZZA 4R54A 5DYNA 2AHOA 4D4HA 4ZOEA 1T5IA 2Q2NA 4BLVA 3Q7IA 2UVDA 5B36A 4NYJQ 3HKBA 4EJ6A 4GNRA 3DDCA 2AI2A 3UATA 3C8ZA 2V65A 3V34A 5JMTA 3MTQA 4JH0A 2FE4A 5LQUA 2Y9MB 1NYQA 1UOOA 1J8QA 4QOFA 4E1VA 4E15A 2Y1EA 1YGYA 5LM3A 2M6SA 4KCGA 2W6ID 1UMBB 3U9SA 3AHGA 2XAUA 3FVWA 1NBMD 3GMDA 2RJ3A 4QASA 4B09A 3FTCA 3GPBA 3ROPA 4MW6A 4W9RA 4MW5A 5AKHA 3D6FA 4QATA 2OZKA 4D3ZA 2PY6A 3CVVA 3SYTA 1ZICA 1QOQB 1M1YB 1AT1A 3G2IA 3HB7A 1K08A 3C6BA 3QEJA 4L5JA 3F73A 4ZZIA 4GEGA 4ETNA 4Z86A 1IK4A 3ROXA 1M76A 5C35A 4R2XA 2WTUA 1CY1A 3AEUB 5AVVA 5KYKA 2O7SA 1E2KA 4Q02A 1WULS 1SXHA 4M83A 4UE6A 5HE8A 4C4AA 1N3BA 3GMIA 4YASA 2QZSA 4FS3A 2PX2A 3V8NA 3I0MA 3KJFA 4FIZA 1WBDA 3HJCA 4GSYA 3ULKA 1VZ2A 1NVAA 4FE7A 4CM7A 1W36C 1YVRA 3FYTA 4LHWA 4UUNA 4L95C 3ICEA 1PHPA 3DDZX 3PYMA 2RGCA 2AR7A 4B76A 4DA9A 2Q9UA 4ENRA 3DEJA 4KGXA 3EG9A 1M6YA 4HEQA 5JD3A 1KBOA 4GH5A 2I99A 1N8KA 3HWWA 2C3UA 4ZU3A 5G4KB 2CY0A 3C45A 3SNKA 2IU4A 4BZPA 5JJBA 1C3JA 2MINB 1C80A 3QWFA 3AVUA 1GFIA 3KCQA 1N25A 1NX9A 3OEED 2EX0A 3Q15C 2RHLA 2RH5A 1BXGA 3M2TA 2PL1A 1EAYA 2IX9A 5IULC 1H05A 5CDGA 2ZANA 2J3MA 4QUHA 5HILA 4ZVRA 3S1AA 3A9VA 4IJWA 4D9EA 2IY7A 3K70D 3ZIUA 2P35A 3E7XA 3OPQA 2X8JA 1HWYA 4WSOA 4BLUA 2HU8A 2O14A 1R4NB 3AZQA 3H9EO 3MJCA 4PBSA 2PSHA 4TXNA 2D62A 2BCJQ 1W9MA 3S6JA 2Q3MA 5DM60 3N1UA 2M1XA 1I10A 3DP7A 4TMVA 1GGJA 1L5VA 3N28A 4HR7A 3L6RA 4PLTA 1S3SA 2MHCA 1A3CA 4UTOA 3H1BA 4A6XA 3RJ9A 1QHHB 4AX8A 1NN1A 2J3HA 2RKWA 1XVVA 1AHIA 2XITA 3V6MA 1KP3A 5CYPA 4KMRA 2HWUA 2UAGA 4YMVA 1M8GA 3EXFA 5C31A 1E6LA 1HYBA 3RNOA 2AI1A 3U4AA 3O91A 5CEEA 2YS7A 3PQ3A 5ITZB 4I7EA 3DUFB 2OKGA 1KZ6A 2G9ZA 3QKTA 4NI5A 3PA6A 2PKRA 3OEWA 4G4SP 1XMSA 2NZUG 3FYUA 4XM2A 4EMTA 3OLQA 5EJ7A 2AK3A 3DFUA 4OGGA 4BY9E 3CF4A 4ZIRA 2XGGA 2LWIA 1CFJA 3EXHC 2O8VA 1PR1A 3KAKA 3NHUA 3AXTA 1NW3A 3GBVA 4OUDA 3NNDA 5AI5A 3ZV3A 1NNUA 1YFJA 1G38A 4JUBA 1JEYA 4G3XA 2YYYA 3AESB 4TZ6A 4Y7CA 2W70A 3RK4A 1N6HA 1J5PA 3BX1A 1V45E 4P22A 3W8RA 2HMVA 1ZMBA 2H4HA 3AZPA 4R3UC 3DLHA 3WKDA 4L6AA 2JVJA 3TOVA 4RLHA 3X1DA 4PHGA 2WTAA 1XD2B 4MP6A 4F7DA 3OC0A 1GV0A 2XMZA 3RAJA 4C0XA 3K9WA 1JJIA 4RPKA 2I03A 4EF5A 1VE3A 2Q2WA 1S2LA 3RBXA 1ZXXA 3LUKA 3TM5A 2INGX 3IPXA 1PZNA 3BDIA 3EUWA 3DGFC 1Q0HA 3KYCA 1YJ5A 2R1UA 3VC1A 1LY1A 1VHDA 1OPXA 2FPIB 3W8DA 4LZNA 4X1KA 3ZY6A 3K70B 1NXXA 3EH2A 4M8LA 4A6EA 2ZIAA 1W7AA 2HA7A 2PANA 3GNSA 1YKSA 3R4CA 1P1FA 1XLWA 2WJYA 4IFTA 1KZYC 4J8PA 2I91A 5FEUA 4BQOA 1IL0A 2EATA 3RRMA 5IU6A 1ZU4A 1VLQA 5GAJA 2GJ4A 5E38A 3M1YA 1KU6A 3SEFA 4URFA 1EFVA 3QGMA 3B82A 3EULA 2IOQA 2WU4A 3I6QA 2NO9A 4U2BA 1E3QA 2R62A 4J2HA 1DEHA 1FYDA 4NG5A 3QFSA 1T36A 2Y1WA 4PC1A 2QUAA 2F7SA 4QTZA 4UC0A 1WU7A 1XBTA 3IPLA 4GR9A 1Y4ZA 4B44A 1Q0UA 2W4MA 4PE5B 3BE6A 3E8MA 4MI9A 1U0RA 3A9SA 2JZOA 1YV9A 4IILA 4KW7A 4GVPA 4MQ4A 5IVHA 1CUXA 3KB2A 4F0JA 3F6EX 2X0JA 3DCJA 1LLFA 3O75A 1NFQA 4EY5A 3DMRA 1G2OA 3OZFA 4U2CA 4LFBB 5ALUA 1Z6GA 2HGSA 3G9TA 5EA2A 4AKSA 2VF7A 4DXHA 4LQDA 3SEQA 1YR1A 4CKZA 3SICE 2WHYA 2AG5A 2WWFA 4MI1A 3OQ6A 3UAOA 2XECA 2AKYA 1RAEA 1QP7A 1A82A 4XDGA 3NMUF 5AIBA 4DSTA 4LYYA 2HMTA 5DKFA 4A9AA 2QD3A 4M37A 2VJYA 4MQLA 3DDNA 3VSAA 1ZXBA 1PNQA 2R1ZA 2RCNA 3LT0A 4CF3A 2YHSA 1Y8CA 2Z3WA 4A3SA 1I4LD 4FGWA 1MIHA 2EW8A 4RK7A 2BJWA 1JA9A 2R66A 3SIWA 3ZCSA 2VLIA 1YS9A 4R1QA 4GGPA 1NKTA 4RD1A 2LR0A 2MOKA 4KQGA 2O52A 1VCOA 4JYBA 2WKSA 4RLQA 1MPXA 2W8ZA 4HVTA 3W5JA 1W4ZA 5TQ2A 5HQ3B 2H2FA 2JIPA 3U4QA 3JQ8A 1A8QA 5BNFA 1N4AA 4YR7A 1U7HA 1GRVA 1ESCA 3PXBA 1IC6A 2GCIA 4KMSA 3I04A 1GARA 4F4UA 2ZJFA 1GTL1 1XDUA 2PGNA 5IW8A 2CUKA 2P62A 1QJ4A 3A6GA 3GLGB 5I01A 4BNJA 1MAAA 1ORWA 3S28A 3QENA 3ZQ4A 2BF7A 4A8PA 4PO1A 1C3VA 2QDKA 1PW7A 3GJ3A 4NCNA 1TVKB 2A67A 4PR3A 4UNIA 4XPZA 1OPRA 2F1JA 1CHNA 3SEZA 3ZE1B 3F5MA 4Y1RA 3X1YA 1X38A 5J4VA 3TQQA 3LH5A 5C8DA 1YO6A 1GU1A 1FVHA 4BO5A 4IICA 1AVTA 1M2OA 2Z2ZA 4BASA 5C3MA 2PQ2A 2BZSA 1NZDA 1DUIA 2B30A 3GDGA 1SM4A 4RS3A 4DF3A 1XWFA 4QRHA 3CVJA 4WBSA 1VA5A 1OXSC 1ECCA 1QC5B 2GX6A 1BEEA 4IDAA 3RO7A 1U94A 4D9KA 2ILVA 4RKYA 1L8LA 4Q19A 1IPEA 4AS3A 5AVKA 1QRAA 5KYXB 1UH5A 1XKXA 3R0VA 4DJAA 1L8AA 2ZIXB 3PHCA 1I5RA 4LZPA 1R6TA 3H42B 4YUAA 5BNZA 1XAHA 4U5QA 4J0HA 3BULA 2YWGA 4LSZA 5DGIA 4BFVA 3RAFC 5IUNC 2TYSB 2UVPB 4QNMA 4ARZB 3C0KA 4V0QA 4ECEA 3S3TA 1TQHA 3AG6A 4JVSB 3WLIA 1SXJA 2KLHA 2JJ2A 4ZVMA 4LYJA 1KVUA 1KMIY 1WHSB 3ETGA 4MQFA 1J7JA 4RPCA 2I9KA 4HS4A 3HI4A 4RF4A 1I6MA 3K1TA 3FHTA 3NP7A 3ZWAA 4KWCA 5M29A 1G3RA 4YJGA 4KUHA 4TV9F 5CMLA 2OO5C 2CJXA 5ECGC 3WK7A 3PTZA 4DVGA 1JE0A 1Y5RA 3QEKA 4ZC8A 1MP0A 1NAHA 3PC4A 3U49A 5ILGA 3SZLA 5DBOA 2BBWA 1TA9A 2VRCA 3S81A 4OQ4A 2J5KA 2QRJA 4M88A 1X1EA 2BEUA 3R5HA 4JR0A 3AKDA 4OB8A 4YLEA 5DT2A 1SH7A 2OORA 2AW5A 4A8TA 1J1UA 3N2IA 1GO2A 1D4FA 3FFBA 2JLXA 3NC4A 3H2BA 2G4VA 3OFKA 5EFOA 1M6WA 1N5RA 2BFNA 2ZI5A 1BXKA 3OZRA 4C29A 2Y1DA 2GPNA 3LGSA 1YBHA 3NHMA 3KVOA 3NHSA 4HB0A 1FU7A 2XB6A 3MWEB 3QLUA 2VQ3A 4G0PA 4U7TB 2JD1A 3K0SA 2JF0A 4KRYA 2W2TA 3OCVA 3TNFA 4WK0B 4B6GA 3DE4X 4Z2AA 3VHLB 2PJRA 3KM0A 4TRJA 5C8YF 5JBNA 2W58A 4QREA 2D4AA 3O4JA 1LLQA 3W5BA 2VTBB 3TLGA 3M49A 4YCAA 1IXSB 3W7AA 1KTVA 3S70A 2O7RA 1A2KC 4ETWA 5BOSA 3JV7A 5HIKA 5I4KA 1QLWA 4E2XA 1WU8A 5L4NA 5ELLA 1VJ5A 2BFPA 2HJ9A 2FP4B 3F2VA 3BXGA 1PP4A 5AHXA 1S89A 2OP1A 2WG1A 4NYIQ 1AS3A 4Y2SA 5ESXA 2BV3A 1KRHA 1Y82A 4Q9IA 3Q85A 4DADA 3H4MA 2WJAA 2NZYA 4G4GA 4QD3A 2W6OA 3TXAA 5IJ9A 2G9VA 1MOZA 2IHBA 2LE0A 4PTYA 3UQYS 4JLBA 2IS6A 1JDBC 1QYRA 1YZFA 4WD3A 4I0WB 2CUNA 3D7SA 3FPEA 4EO9A 1Z35A 4R1NA 3PQ6A 5ICFA 3ND8A 4YJDA 4HVLA 1WQ3A 4D7AA 1HLPA 1LCIA 3OY7A 2PR2A 4CR6A 4RANA 3L8FA 5C34B 2R6AA 1XN1A 4NH0A 4E32A 1U2ZA 3E5RA 4YPFA 1ICEA 5JRJA 4E5NA 2E0IA 3LW8A 4JSRA 1P5HA 3I58A 3Q3VA 5C1BA 2Q1XA 3T1HB 1C0LA 1NJ6A 2FX2A 1E3IA 5EWLB 5FLXA 3RADC 1BU8A 1PK9A 2DFDA 2C5LA 5E4FA 2CVFA 1WAMA 3VHQA 4CRWB 1EGQA 5D8DA 2EFEB 2IP1A 5HZHA 2NP7A 5IT4A 3EWSA 3W9UA 1NQ5A 4NCHA 4H3KB 1B8NA 1TO2E 1G9SA 4W1QA 1C8BA 3S27A 2XVZA 3NALA 4G2TA 1SUAA 2JKYA 5IKOA 1PGJA 5H81A 1HDIA 4AG3A 3CRVA 3RH0A 1JG3A 3ZE8A 3MF4A 4ANFA 1SURA 5BN5B 2EGGA 2OQ2A 4I3FA 1J1IA 1X13A 4BB9A 1C7JA 1XTUA 4GM0A 4A5OA 4F9EA 1JB1A 4GVLA 3DV0B 1SMKA 3UMFA 3HBNA 1UIRA 4FW8A 1WUIS 1G5FA 2HCTA 4BC1A 4YNBA 3G6WA 4X1OA 3P0HA 1IXKA 1NHGA 1VJDA 3T34A 4YDRA 4QHSA 2R48A 3BL6A 5TMDA 3EUEA 4RLFA 2QZJA 4QLAA 4DQXA 3DT6A 2OHXA 3NOXA 5EPEA 1W5FA 2WYOA 4PQGA 5AIAA 1TJ5A 4FW9A 1QVVA 3DMNA 4FYVA 3DLBA 5C51B 4KAFA 5TLSA 1OVGA 3M6XA 4X3PA 4X85A 1TJ3A 4EQ6A 1NG9A 2ZE7A 4ESOA 3K8OE 3TIGA 2DY1A 2QR5A 2BP7B 4PNHA 3SLKA 5C18A 3CEPB 3TIVA 3D0KA 4DDWA 2EEZA 1KKLA 5FTNA 3Q87B 2R6DA 5IAJA 1L3IA 4N5HX 1DQSA 1HOXA 3S2UA 2BR4A 5LZ9A 1VLHA 2P6UA 1L7NA 3C3JA 1L5SA 4F06A 4YT4A 4LE0A 1WX1A 1MF7A 1M5RA 1NUHA 3UMRA 3NDJA 2P3SA 2V6GA 1HSOA 1DIOB 3F71A 3B53X 3FKSD 3GAMA 5EE5B 2H63A 5FJJA 1Q2XA 3DZ8A 3IBGA 3N87A 3GZJA 2WD7A 4M8KA 4CIWA 4LDPA 2PJDA 4PWZA 4QU8A 3PGKA 1XU9A 1RPJA 3R44A 1Z2NX 1C30B 2CL6X 2QBYA 3GLUA 2AFIE 3FNIA 2EDAA 4V0LA 3W3ZB 1QQ6A 2OY0A 3RIGA 1JMVA 3C7AA 1LRJA 3IMCA 4RK6A 5CYGA 3EHDA 3K9BA 3DBRA 2QNIA 3BRCA 5BYJA 5KS2A 4QGFA 3CR3C 1XCMA 3K2BA 2HD4A 1P3JA 3TQSA 3VFDA