3QWAA

Crystal structure of saccharomyces cerevisiae zeta-crystallin-like quinone oxidoreductase zta1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
331
structure length
331
Chain Sequence
TIPEQQKVILIDEIGGYDVIKYEDYPVPSISEEELLIKNKYTGVNYIESYFRKGIYPCEKPYVLGREASGTVVAKGKGVTNFEVGDQVAYISNSTFAQYSKISSQGPVMKLPKGTSDEELKLYAAGLLQVLTALSFTNEAYHVKKGDYVLLFAAAGGVGLILNQLLKMKGAHTIAVASTDEKLKIAKEYGAEYLINASKEDILRQVLKFTNGKGVDASFDSVGKDTFEISLAALKRKGVFVSFGNASGLIPPFSITRLSPKNITLVRPQLYGYIADPEEWKYYSDEFFGLVNSKKLNIKIYKTYPLRDYRTAAADIESRKTVGKLVLEIPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable quinone oxidoreductase
publication title Structural insights into the cofactor-assisted substrate recognition of yeast quinone oxidoreductase Zta1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 113
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2011-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qwaA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3qwaA01
1HEUA 2ZB3A 4A10A 2WJPA 3JYNA 1TT7A 2HLPA 2B5VA 5LDHA 1GY8A 2OP1A 2VWPA 1MC5A 2P4HX 3KXDA 3ZCXA 3NYWA 5A02A 4PG7A 4GL4A 5BNTA 4RDIA 5FYDA 1TA4A 3N58A 1BXGB 3GVXA 2C5EA 3UW3A 3ZWWA 1KIFA 1GD1O 1Q0HA 3L4BA 2BI8A 4IZIA 3I6IA 5AVOA 3L4BC 4Y9DA 3U9LA 3UFXA 1PJTA 4CM9D 5TNXA 2CSUA 4DVJA 1YL5A 2AEMA 3K6JA 1QYWA 2O3SA 2NU6A 3AM3A 1RJWA 3D1LA 3INGA 3A1NA 1E1NA 1TEHA 2BKAA 2O50A 1JVBA 1GEGA 2DBQA 3AI3A 2VZ8A 1T4DA 4NG5A 3GVHA 2DFDA 4GH5A 3WMXA 4CM6A 5DOVA 4KDEA 2EKLA 3TOZA 1YBVA 1GTMA 2FR1A 2WM3A 1SNYA 2YW9A 1E1KA 4RPJA 3HB5X 5C3MA 1LLUA 4PZDA 4LMPA 4D45A 3K2BA 3OSUA 3HN7A 4CR7A 4IXTA 2GGSA 4CV0A 3PK0A 5EJ2A 2J6IA 4XGKA 1DFHA 4J6FA 1NFFA 4GKVA 5K9ZA 3WSWA 1AHIA 1X0VA 3Q1LA 3PRJA 1JQBA 1GYQA 1LRLA 1X15A 1ZKMA 2O2SA 1ZXBA 5DF1A 4QSMA 1T2CA 1PQUA 4WLFA 2Q1WA 2QYSA 3DEYX 2D59A 2PKRA 1PU2A 2Q45A 2V6MA 2IODA 1VKOA 3GGGA 4UVDA 3DOJA 2GR9A 1UP6A 4E13A 1HRDA 1X7DA 2BFPA 4ITUA 1UAYA 4K6FA 3PWKA 3RUHA 1LDNA 2VYND 2ILTA 4CM4A 2HCTA 3RUFA 4DC0A 5JBIA 1PL8A 3KTDA 3RUCA 2Y0EA 4R9SA 2YQ4A 1P3DA 4OOFA 2A9FA 1UP4A 4NK5A 5EINA 4EZBA 4ZQBA 1F14A 1Y1PA 4JNKA 4FC6A 5ENVA 3LK7A 2RH4A 1HZJA 1E92A 4MKXA 5DCWA 1KVQA 3GAZA 2O3JA 2DKNA 1DSSG 1AXEA 1NASA 2GRAA 1P33A 1PZGA 4DBZA 4ESOA 5JYEA 4L8VA 3LDHA 4GQAA 3WNVA 1NHWA 3K92A 1GZ6A 1YB5A 5IZ4A 5IN5A 1BHSA 1FDWA 3DO5A 1NAIA 2AE2A 4JBHA 4XQGA 4E0BA 4CMHA 3GN2A 1EDOA 1IOLA 3ONDA 4PFJA 1NYTA 1W6UA 1ULSA 1Y8RA 3ANLA 4YJDA 4ZQHA 4YJFA 4Z9FA 4NHEA 1HKUA 3NT5A 1WDKA 4IJUA 3UCFA 4DMLA 4PGFA 4D79A 2QX7A 2VZ9A 4YJGA 1SEPA 3DHNA 1JWBB 3RSHA 1DIHA 1HETA 1EUZA 1AUPA 4YB8A 4G81A 2Y99A 3ROPA 4S3MA 1PGJA 2Z5LA 3HHPA 2O3UA 4O59O 3Q6IA 4B3IA 3GHHA 3PHLA 2GSDA 1XCBA 2JD1A 3QWHA 2G76A 4U5QA 3Q9NA 1VC2A 2X0RA 4PLHA 1ZJYA 4W7IA 4BVAA 2C54A 2UUPA 2X0JA 3GPIA 1PL6A 3NX4A 4L4SA 4MP8A 3EMKA 4FGWA 3GR6A 1H0KA 3F9IA 3LU1A 1QV7A 1O95A 2VHZA 2IZ0A 3KLPX 1FK8A 4HFRA 2HU2A 1MFZA 3I4FA 2OUIA 2X1HA 1E77A 4QFDA 4Q9NA 4CMAA 4ZRMA 1UP7A 3E9MA 3H2ZA 4E31A 4ZD6A 2EJWA 4HFJA 3K30A 4RPKA 5HTOA 2C5AA 3H9QA 4WCFB 3GZ4A 2CMDA 1HDXA 4D3DA 2PY6A 4BQPA 3UCEA 2G17A 3GAFA 5ILOA 2CZCA 2C2YA 2W98A 3DOOA 3E1KA 4BO8A 3D5TA 4PLVA 1A9YA 1U9JA 2VUSA 3GK3A 2FHSA 4M1QA 4XYMA 3FR8A 4KTTE 5JC8A 2DU8A 4BKPA 3RJ9A 3C1AA 4J9UE 4EEXA 1E1MA 2JFFA 2P91A 4Z0HO 4BO4A 3HDYA 1QMGA 1P1IA 2ZIZA 1YOVA 4NIMA 3OQBA 5FI3A 4RVHA 4D46A 4U7WA 4INAA 2P9GA 1LDMA 3NEPX 3QJ5A 4I5FA 1MP0A 4ALLA 2RBEA 3CPSA 4BO2A 3Q11A 4IINA 5IG2A 2I76A 5JFOA 1GYPA 5ICSA 1HDOA 2Z1NA 3A06A 2AQIA 3KYDB 2O3TA 2FOIA 3AJRA 5JMWA 4XJTA 1TI7A 1ZW1A 5ES3A 2Q50A 1YDEA 4PLYA 1MB4A 1HDRA 1NQ5A 2X9GA 4BUCA 2Y0CA 1F17A 1UH5A 1HLPA 1B3BA 1D4FA 3NGXA 1GV0A 3WBFA 3D7LA 2V7PA 4LRSB 3FNHA 4JBIA 3CUKA 2EKQA 4BMVA 3DFZA 3HN2A 1R4NA 3S8MA 4PG5A 5JCJA 4P8RA 3DOCA 4F46A 2YFHA 4E2WA 5THKA 4YTEA 1GQQA 4JJFA 1PQWA 1H5QA 1FF9A 1K2WA 1PZEA 2HAEA 3AI2A 3EZYA 4RQUA 4BNHA 3BA1A 3JQFA 3GY0A 3HFGA 1P45A 5EQFA 2ZTUA 3RJ5A 4E2XA 1ID1A 2Z95A 5I9NA 1B8PA 3B20A 3JQFC 1CQIA 3DZIA 5K1SA 4OQYA 4OOEA 1PJCA 1NM5A 3R3JA 4GAEA 3VTZA 3ZWNA 4WLOA 1GQYA 1LC3A 3E6AA 4J4HA 4DLLA 2AE1A 4GSKA 3OHSX 4ZHSA 3L6DA 4YJHB 4XWYA 2ZJ0A 5HWSA 1ML3A 5CDGA 4QO8A 4WLVA 4EI2A 1Y6JA 3DXFA 4IQ8A 4DQUA 1O94A 4R5MA 4FDAA 1LTHR 2NADA 3GVPA 3BYZA 1GUYA 1RYEA 4XRGA 4L74A 1ADBA 4IXWA 4J4TA 4B4VA 3OETA 5G0SA 1ZSYA 4XR9A 1KBZA 4KMSA 2BELA 3C7DB 5EL0A 4J1SA 2X0IA 3CZMA 5IDXA 2P68A 3QLJA 3TL3A 3AFNA 3WIEA 1X14A 2CDCA 4N5MA 4JJIA 1C1DA 1PR3A 4MKRA 1KYQA 4M54A 1ENOA 3UH1A 1K3TA 3DBLA 2Y1GA 1ZK0A 5CEJA 2Q99A 4M87A 4CMGA 3KV3O 4URFA 4HNHA 4UEOA 2NVUA 1DLJA 4IJWA 2EXXA 5L4LA 3HDJA 2P9CA 4FQ8A 5TQVA 1HDZA 2Q2QA 3TRIA 4EUFA 3PZRA 2DBVO 1Z7BA 4BGVA 4BV9A 3D0OA 1IYZA 4I9UA 3BIOA 3PYXA 5COQA 4KOAA 4ND1A 4YA6A 1WVGA 1OZAA 2FMUA 2DTXA 1YBMA 4E6PA 2VRCD 3PHJA 4ZGWA 5CPFA 3WICA 4EJ6A 1ENYA 4ND3A 2LDXA 3CIFA 4JN6B 4D42A 2AG5A 2D5AA 3L9WA 4MDHA 4LGVA 3JYLA 4H3VA 3IKTA 5IJZA 1VL0A 1WAMA 1T2DA 1U7TA 2DAPA 2UUOA 2W2KB 3U4HA 2GDZA 3FPLA 3O8QB 4U6QA 4CLDA 3PQFA 1ZCJA 3ZGYA 2FRDA 1I36A 1ZXLA 1O89A 5L4NA 1ZMTA 2YJZA 3ETGA 1KOLA 2WWRA 3AY3A 3HJAA 1PWZA 4Z0TA 5A9SA 2JL1A 3G17A 5DULA 3LQFA 3UAGA 1U1IA 2D2IA 4L9RA 4QXMA 1U2GA 1XSEA 1U4SA 2QG4A 3AUTA 2HO5A 2VZ0A 2DLDA 2DBRA 4BNLA 3PDJA 3VZQA 4E2ZA 4JROA 3GDGA 1NPDA 2OHXA 1A9ZA 2D1YA 4XRRA 4A03A 2YQ5A 3CMMA 3GZNA 3M1LA 1N9GA 2I6TA 3ZW8A 4RPGA 3T4EA 3PLNA 3QIVA 5K6AA 3C85A 1XU7A 2HQ1A 1X0XA 4DLAA 1LDBA 2EV9A 4AJIA 1DEHA 2PKQO 5K6AC 1C1XB 3PYMA 3HZZA 3IC5A 2RAFA 3MTJA 4RPHA 3IQDB 1VPDA 4YYZA 2GN9A 6ADHA 4CUZA 3EK2A 2BLLA 3DBVO 1BW9B 4IIUA 1LQUA 2AA3A 3PWSA 1E3IA 3KHUA 3RKUA 3UGKA 1HYEA 3GHYA 4XYGA 2JAHA 2YZ7A 1YJQA 3FI9A 2ZQYA 3F6YA 1I32A 4Y98A 4TKLA 1HLDA 2BFMA 4L75A 2E48A 4YACA 1OC2A 1ORRA 2NVBA 3IP3A 2RHCA 2Q1TA 5DOZA 2D0IA 3FSRA 3ICCA 4IS3A 5A3JA 2HMSA 2P5YA 3IOYA 5EMHA 2B4RO 2VWGA 3RKRA 1ZJZA 1LLDA 2WD7B 3LT1A 3O4RA 2PD4A 1G0OA 3G3EA 5JO9A 3JCZA 1KY4A 2ZYGA 2JD0A 4N5NA 4QQRA 3KLMX 3MTGA 5G0TA 3ZNQA 2A35A 1JTVA 1GR0A 3UVEA 2BRUA 2GN4A 5JDIC 4TRMA 3WMWA 4M86A 4E21A 1Q1NA 5EN4A 4AJPA 5COAA 2W8ZA 1TT5B 1SPXA 4NJOA 4YRAA 3JQAB 3CINA 1EVIA 4R3NA 3BMNB 4LISA 4TSKA 2NLOA 1I3LA 3UKOA 3V2UA 1E7YA 2YUTA 4HKTA 1IB6A 3GUYA 4OSPA 2VCYA 3MZ0A 4J1QA 1SB8A 3QWBA 1B8UA 2X23A 3ZHZA 4I5GA 1R4MA 1MG5A 3HDQA 5AYVA 3C1OA 3IS3A 4QTZA 3VPGA 2Q49A 1FDTA 3T7EA 1IY8A 3IJPA 1XHLA 2PZKA 5A1TA 1I01A 4R1NA 4ND4A 1UXIA 3H9UA 4UULA 5F1OA 4M49A 3SXPA 3NT4A 2I65A 5CFZA 1Z45A 3JQ8B 3WGZA 4CM8A 5BNFA 1YDWA 4ZQFA 3PHIA 1QYVA 4HFMA 5U9CA 2YV2A 3FD8A 1I30A 4Q3DA 4RVUA 3MWDB 3EUWA 2V6FA 5A5EA 2QQ5A 1BMDA 3WG9A 5L40A 3WGOA 2G82A 1WMAA 3BMQA 3DDNA 3JQ6A 1GV1A 3FNEA 1PGNA 1R0LA 5JMPA 4DLBA 1H93A 4HFNA 1SC6A 3AUUA 4MP6A 4GSLA 5CG1A 1E3WB 3AY6A 5TLSA 2HMUA 1V35A 5KWEA 2F1KA 1LLCA 5JLAA 1DJNA 2VOEA 5G4LA 2WYWA 1CWUA 1XR3A 5F3RA 3Q2KA 2I9PA 2R6JA 2EP7A 3H5NA 4WLUA 1D1TA 3LF1A 4Y6SA 1UZMA 4NU5A 3SC6A 1ZK3A 9LDTA 4WASA 4E5YA 2EERA 4BKUA 4IDCA 2C7VA 2VHVA 4BB5A 3LC7O 4CMKA 2DFVA 3ADOA 4ZU3A 3ZHBA 2JCVA 4EJ0A 4I5EA 4TZTA 3VH2A 5EIOA 1WZEA 1B14A 4CLEA 3H7AA 1J6UA 2PZJA 5G0VA 4U6SA 4R1TA 3PJEA 4QUKA 5DBGA 1R12A 3TNLA 2W2LD 1LJ8A 3AY7A 3D3EA 3H9GA 3K73O 3KRTA 4IMRA 5KJEA 5A04A 2BD0A 2FSVA 3F5QA 2IZZA 4Q3CA 5H83A 1E7WA 3EVNA 1V6AA 3WGHA 4A26A 4BNVA 1E0DA 3ENNA 5ITVA 3EGOA 1UXHA 4BKOA 4CV1A 3AWDA 4G65A 1IULA 3K8ZA 3HSKA 4BNNA 1V0JA 3KSZO 4FFPA 3V2HA 4A0SA 1N7HA 1X1TA 4J7XA 1MLDA 1L1FA 1BG6A 1Q0LA 4O5OA 3TFQA 1PGQA 5AXCA 3H5AA 5TS3A 3S2GA 4BNJA 4MIOA 3JD0A 1WXDA 4CM5A 5HRUA 2IXAA 3LVFO 1UXJA 3VZRA 3WJ7A 1NP3A 7ADHA 2YHIA 4BB6A 4L73A 3WJAA 3WQSB 3ZV5A 4PRLA 3ZU3A 1UR5A 3FHLA 3GVIA 4KUEA 2NU8A 3BHIA 2JHFA 2Y1EA 3OP4A 1M6WA 3IMFA 1LRKA 2PGJA 4R68A 3BHJA 4D43A 1H6CA 4BO5A 3GNTA 3JQBA 4R3WA 1E7SA 4RO0A 1WLYA 3JQ9A 1HYGA 3JQBC 4DPMA 1DC3A 3CMCO 1Q0QA 4RF5A 1DDOA 2NM0A 2X8LA 1ZH8A 3JQ9C 4F45A 4CM9A 2UYYA 3OEYA 2XXJA 4GWGA 5L53A 4OIMA 5GY7A 2HMWA 5JXWA 2XPCA 4UEKA 1M67A 2XOXA 1B7GO 3DBRB 2X5OA 1A27A 1P1RA 3H5RA 2OXIA 2EGGA 3RUDA 3VVBA 4IDBA 1M75A 3FNGA 3Q0EA 3U0BA 4EUEA 3WYBA 1DFIA 2VTEA 3NUGA 5BNIA 2J5RA 4Z6KA 1OFGA 3PHGA 5KOIA 4J2HA 1LSJA 1KEWA 1UDBA 3MOGA 4GX0A 4PG6A 4DXHA 2H6EA 4FJ0A 4LCJA 3W4JA 4WEQA 3JYQA 1N2SA 1SBYA 4B7XA 1PWXA 2OGUA 2B5WA 3GA0A 5IDQA 1T1SA 1G0NA 1GFSA 3H8VA 4GWKA 5B4UA 2ZB7A 2B36A 1HE4A 5DT9A 1C0PA 3JD2A 2BHLA 1NR7A 4IGFA 3RWBA 3HB4X 3H3FA 1BTOA 3ZNNA 3KEQA 3VOSA 3UF0A 2H1SA 1ZVMA 5LDGA 3B1FA 3WFIA 4YXFA 4ZICA 1O5IA 1L7DA 4OQZA 3PIIA 5C7IO 1H6DA 5THQA 2WDZA 4LN1A 5JDIA 2JD2A 5BR7A 3DBHB 3GNSA 2DUUA 4BMSA 4FFMA 4YPOA 3QY9A 1I3KA 3AOGA 5L9AA 1JKIA 3A14A 4RORA 1A4UA 4RL6A 3S2FA 4B4UA 4YT2A 5L7WA 1LXCA 1WMBA 3OECA 3RFTA 4RVSA 2HMTA 2CVQA 3V1UA 1XQ6A 1GUZA 2BGMA 2RHRA 3E82A 1BVUA 2GLXA 3PIDA 4ROSA 1PJ4A 2GF2A 3LT0A 1PX0A 3HQ4O 5A5FA 4FOOA 2RCYA 1XDWA 3D4NA 3JQAD 4AFNA 4K1LA 4Z3DA 4D0RA 4YEDA 4YAGA 1XGKA 3VZPA 5B4VA 3QVOA 5TGDA 3ENKA 1FJHA 2IZ1A 2I3AA 4II2A 4L4XA 4GMGA 3GMSA 4UVHA 1YVEI 1TXGA 2Q4EA 1NPYA 1H94A 3OH8A 3DBLB 3RFVA 4CV2A 4YVFA 1KVTA 1I2ZA 3GDFA 3LLSA 5KIAA 4PCVA 1NVGA 3GQVA 1YL6A 3NDIA 3I9MA 3W8DA 4BQRA 5MDHA 1M76A 4NBVA 4EBFA 4NJMB 4NQZA 4FFRA 1CERA 2X22A 4UUMA 4MOWA 1F06A 1JA9A 1Y81A 3U62A 4W9NA 2PZMA 1DBVO 3JD4A 3NKLA 4Y6PA 3IL2A 2WYUA 4GGPA 3QQPA 5IAAA 1EFKA 4FBGA 4J91A 4W9NC 4BGIA 1GPDG 3LC1O 3OFSA 4OHUA 3JQ7B 4CLOA 1IPFA 1OMOA 4JBGA 4GGOA 3GGPA 1R6DA 5JE8A 3QWIA 2B37A 1UJMA 5T8KA 3ZW9A 3GH3A 3EYWA 4CLRA 5IF3A 3KETA 3MJEA 3GRPA 4PZEA 1VKNA 5JW6A 2HRBA 4JXKA 5T8KC 4A2CA 2O4CA 3RFXA 3BMOA 5DBIA 2YDYA 2XAAA 2F00A 4I08A 1RPNA 2O7SA 1QORA 1SZJG 1MGOA 2BGLA 5A05A 3WDSA 1H9BA 5I7VA 1AGNA 3ZI0A 4CQMB 4Y67A 2X58A 1NXQA 1JVSA 3CXRA 1NHGA 4J90A 3JQGB 3PJFA 4OXNA 1E6WA 3DMYA 2PGLA 4PLZA 4MIEA 4WNIA 2GYYA 1PJBA 1AE1A 3DZFA 1OAAA 3JSAA 1I10A 3OIDA 2ZATA 3KUXA 4L0QA 4WK6A 1N7GA 1YWGO 1ZK1A 5TRTA 3QW2A 3KB6A 1J5PA 2VNSA 1ARZA 3ETDA 4WE3A 2VUUA 1T25A 1EBFA 4FPXA 5TC4A 3S1LA 1I3MA 3ZWYA 4DL9A 4XR4A 5TIIA 2ZYAA 4NBUA 2IXBA 4CPDA 4GI2A 1YKFA 1XA0A 2D5CA 5JAQA 1N1EA 4I1IA 5DBFA 1KVRA 3INTA 5DCYA 4NDNE 2O4UX 4LSWA 4OH1A 1Z74A 4W7HA 3IDSA 1PQPA 2ZTMA 2HK8A 4R4JA 2IYPA 1MXFA 4XB1A 3PQEA 1C0KA 3HFSA 1E3SA 1DIRA 3O03A 4XQ9A 3RU9A 1BXZA 4AICA 1V3VA 3DHYA 2NWQA 4OXKA 3VPHA 3DMTA 1E5LA 3N74A 4AVYA 5L3ZA 1QRRA 1BXGA 4CLHA 1R15A 4DIBA 3S55A 2BH9A 4NI5A 5C7LO 3D3WB 4WLEA 4IDDA 4MKZA 3DMTC 2BMAA 2P9EA 2C20A 3BMCB 3JQCA 4NBRA 3P19A 1O6ZA 2Q1SA 3FWZA 3UHAA 1SOVA 3PXXA 4PIVA 4DYDA 1C0IA 2FZEA 3U4DA 2FWMX 5CDUA 4ZVVA 2PTGA 3MJTA 3DFUA 1ONPA 3OJEA 2DPGA 1W8DA 3K5PA 2X4GA 3W4IA 1CJCA 4BNTA 1YB1A 3DZBA 4RDHA 1CYDA 2Y05A 5FF9A 5A3VA 4EJMA 3HG7A 2NUAA 5TX7A 2HJRA 3KBOA 2V6BA 3WS7A 3EY4A 2EWMA 4Q39A 5H82A 3VDRA 1HDGO 1QR6A 2VYVD 2UAGA 2EJVA 2FP4A 1RKXA 4E5KA 1P9LA 1PSDA 3HDHA 4QECA 3TWOA 3ASVA 4J0EA 3WWYA 5G4KB 1WPQA 2J3KA 2Y1DA 4LVUA 3VTFA 4OKIA 5T57A 5JAIA 2B0JA 4MVJI 5JCJD 1YONA 3TJRA 2I66A 4IDFA 4AL4A 1T2AA 2J3JA 3OJFA 1N1GA 3TZQA 4K28A 4ZN6A 4FC7A 1ADCA 5KJFA 5L51A 1JAXA 1ZUD1 2Z1MA 3TZCA 3DAPA 3JV7A 4MVJD 4NPCA 3BXXA 4GPD1 5JPIA 3TSCA 4C4OA 4CM7A 4DQXA 2EF1A 1T4BA 1J49A 3KYCB 1L7EA 2E37A 1GCOA 2UVDA 2VN8A 4WGGA 3PFWO 1LA2A 1VJ0A 5F1PA 2OBNA 3ABIA 4NFSA 1H9AA 3PLRA 2DTEA 1YQGA 1WZIA 4L76A 3WLEA 1IHXA 2A4KA 4GBJA 4KP7A 3B70A 1YXMA 4YAEA 3HE3A 1U8XX 3I9NA 1CDOA 1ISIA 1UDCA 4IDGA 5U1PA 2JKVA 4AJ1A 4UUOA 5A03A 3RC7A 2VT3A 4XGNA 2HRZA 2JJYA 2VRCA 5H81A 3ZDFA 5I7EA 5AXDA 2Y67A 4BNFA 4DMMA 2FN7A 2D8AA 5L4SA 3DC2A 2DTDA 4PRKA 3D64A 1LUAA 5CDYA 3VVCA 3GPDG 3VPFA 3WIDA 4YR9A 3KSDO 3PFFA 2J5KA 4IY1A 5IN4A 3GUCA 2YDXA 3L77A 1G6KA 1Y5RA 4CQLB 2O48X 5KCZA 3OBBA 2IEBA 4J9VA 5I9MA 5GZ6A 1R16A 3G1UA 4DRYA 4GLLA 2QRLA 4CLXA 4BKRA 1HDYA 1ZSNA 2AHRA 3IIEA 3SC4A 1A4IA 1LQTA 2PGDA 2Y68A 3NGLA 5TT0A 3B6ZA 3ULKA 3NTQA 3V1YA 1IE3A 2WMDA 3VH3A 2H5LA 4HXYA 2OMEA 5TT1A 1HYHA 4DGSA 3A4VA 3UCXA 4DQVA 3GNQA 4ALIA 2NQTA 2Q4BA 2TMDA 1R66A 4CR8A 1HXHA 4WKGA 1NNUA 3CTMA 3NTRA 3H9EO 1O8CA 3AOEA 2DVMA 5TSDA 1JW9B 5ER9A 4U0JA 4TRRA 1HWYA 1FDUA 5TJHA 3AOEC 2AG8A 2B69A 4S1VA 4TRJA 1Y8QB 5CDSA 5HS6A 1T26A 5JSFA 2VHXA 4DYVA 4OKNA 3S2IA 3MWEB 4Q3EA 4OXYA 4OYRA 2VT2A 1E7RA 1QG6A 3SJ7A 2PR2A 4KQWA 4CMJA 4A7PA 4HWKA 2X86A 4JIGA 1EEHA 4AJ2A 5DDIP 3W4KA 3W6ZA 1TB4A 4MJLA 1FDSA 3R0IA 5HA5A 5IFLA 5KNLA 4JGBA 1DC4A 4RF3A 3GFGA 1EUDA 1GAEO 4CQMD 4G2NA 4ZQEA 4WCFA 1ENPA 2QIOA 2AQKA 4J7CA 4YAJA 4TMFA 1RM3A 5CEFA 2ZCVA 1EE2A 2V65A 4WCFC 3GRKA 2I3GA 1K0UA 1YL7A 3FTNA 1Z75A 2G1UA 2P2SA 1T2EA 4AJHA 2E6UX 2FY8A 3DQPA 3BTSA 3WGGA 4E12A 1JWAB 3I3OA 2P4QA 2HSDA 4BNWA 4LVCA 2GZ2A 4E5NA 1DXYA 4MVJG 3WLFA 1HE2A 4RVGA 3QVXA 3TFOA 4UVIA 4BNIA 3UOGA 4WNCA 1YH3A 1I8TA 3JYOA 4IJVA 4J3FA 5KJ1A 3DL2A 4BNUA 1IL0A 2QZ9A 4W6ZA 5CDTA 3MJCA 1KS9A 3I5MA 1SCUA 4RF4A 3JQDA 3KYDA 1BWSA 2DBZA 2PWZA 4MIYA 3NDRA 3ST7A 1K6IA 4IUYA 1YGYA 3SVTA 2HK9A 3QVSA 2FR0A 1PEDA 3I1JA 4P4NA 3U4CA 1ISFA 2X9VA 4ALKA 4CJXA 5FWNA 1YE3A 1IPEA 1DJQA 4MVJH 5L45A 2C29D 1KEVA 4DIOA 1MG0A 1Q7CA 3ITDA 4ND5A 1H6BA 3PQDA 3RBXA 5KVQA 1GQ2A 5JY6A 3AM5A 4M55A 3C1TA 3SLGA 4DIFA 5KVSA 3OIGA 1E3LA 4J43A 1EVZA 3LSYA 4MINA 4IDEA 4YT5A 4E4YA 5KTKA 2GN6A 4CM3A 3L4SO 4LSMA 4XD2A 4BO0A 1OC4A 2E4AA 3WXBA 3L6OO 4WJZA 4CODB 4XCVA 1GPJA 2PV7A 4FJ2A 1KC3A 4ALJA 1WDMA 2RIRA 2FPGA 4I9NA 1DHRA 1CIVA 3I23A 4I5DA 1T2FA 4LW8A 4Q3AA 4WPGA 3COSA 1EMDA 3GVCA 4OMUA 4RPLA 2PZLA 4CM4B 1MA0A 3EAGA 4WOKA 4AJJA 4K6CA 1W0CA 2C2XA 4E5PA 3I9JA 1GUFA 8LDHA 1AN9A 3M1AA 1HL3A 3L0DA 3M2PA 1B3RA 4IPTA 4DBVO 1WWKA 2OP0A 3SJUA 1JLLA 1ADFA 2CD9A 1H6AA 1Y9EA 4B8ZA 3SX2A 3RBVA 1EVYA 1R0KA 2NSDA 5IDYA 1BSVA 1P77A 4TVOA 3WNQA 3X2EA 5A9RA 1CF2O 1ISHA 1KERA 1PGOA 5HS4A 3ZN2A 1RWBA 3I52A 4IZHA 2C7GA 4E3ZA 1I0ZA 5F5NA 1JAYA 1R37A 1LEHA 1XU9A 1B15A 2EW2A 4HP8A 2I99A 3BTOA 3W6UA 1Y8RB 4QX6A 2RH8A 3KO8A 4RCVA 4XZ3A 4YJFB 3I6QA 3ROKA 4KUHA 1E5QA 3E8XA 3NRCA 4B4OA 1LSUA 2SCUA 4RQTA 1VJ1A 3FF4A 4YJGB 4ALMA 1LU9A 3INRA 2W2LA 4N5LA 5A9TA 5A06A 4EITA 5J23A 5U4QA 4B8WA 3ZWPA 1VM6A 4J4BA 3L6EA 4WCDA 3ASUA 1EK6A 4G5HA 2OZPA 2AQ8A 5ENDA 4AJLA 2EEZA 4U0KA 1H2BA 4R54A 1ZBQA 3AU8A 3RASA 4BHTA 3HADA 3I9KA 1QXSA 3TL2A 3DONA 3CKYA 4TZKA 4XX0A 4BO6A 2H63A 2FSSA 3UN1A 1HE5A 1Q2XA 3AFMA 3C24A 5FFFA 2V6GA 1N5DA 1D7OA 5ITWA 1W4ZA 3LZ6A 1XG5A 1GADO 1SB9A 4XYLA 2PA3A 5AOVA 2VQ3A 1V3TA 4KQXA 2W2KA 2YV3A 5CG2A 4A73A 1QKIA 4FIZA 3ZU2A 2J3IA 5AXAA 3UXYA 3ZWBA 1VL8A 3O8QA 1EE9A 3WB9A 5T6BA 3ZU4A 5JS6A 1ADGA 4YWJA 2JFHA 2NTNA 4RVFA 3G0OA 4YDRA 5IXSA 3B1KA 1LNQA 4JP3A 1S7CA 4PLCA 1Z82A 1PL7A 3VC7A 4BO7A 4Q3BA 4WECA 4EGFA 5CP8A 2X7HA 3FBTA 4BKQA 3KM0A 4JX8A 1KEPA 5JCXA 3ADPA 2GNAA 2CDBA 1BVRA 1GCUA 5I9LA 7MDHA 1IZ0A 1ONOA 4EDFA 3GDOA 3GLQA 5GZ1A 3IP1A 3JQEA 6LDHA 2WD8A 1KVSA 1DOHA 4XQEA 2P5UA 3ZV6A 4FR5A 4NBWA 1PS9A 2VTDA 2VWHA 2ZTVA 1YOVB 2WTBA 3R3SA 3QE3A 5T67A 1PJSA 3H9JA 1NFQA 3MCVA 1QV6A 3BAZA 4JP2A 3SLKA 3OIFA 1JN0A 2C07A 5LC1A 2WEKA 2AMFA 4H16A 1SMKA 4BNZA 1W73A 1C1XA 1I5RA 3PZBA 1NR1A 5KKCA 2CVZA 3NV9A 1SO8A 4RZHA 3RD5A 2OBYA 1U28A 3TZKA 3VPXA 1M66A 4Z3KA 1DRVA 1BW9A 1NQTA 3ON5A 4YRBA 2BFAA 3SEFA 2ZB4A 2A94A 4CMIA 3NT2A 1P1JA 1F0YA 3BTUA 1B26A 1PR9A 5C7OO 1FMCA 4YAIA 3MJVA 4M89A 2QRJA 1PIWA 3F4LA 1V8BA 4WLNA 3PVZA 1ISJA 4IQ0A 1R4NB 4UVGA 2OORA 3LT4A 3OQ6A 4B3HA 1DRWA 3ZWXA 3BZUA 1ZSVA 2CVOA 1HE3A 4C7KA 3C3XA 4Y6RA 2GPTA 2W90A 1J0XO 3GN1A 3O26A 2DT5A 5CEEA 4IS2A 2CF5A 4PN3A 3DTTA 2Y1CA 1E7MA 4XA8A 1BGVA 1E3JA 2WD7A 4DC1A 4NU6A 1D1SA 2H9IA 4OO3A 4XGIA 2HDHA 4R16A 5B4TA 1B8VA 3U09A 1GL3A 2BF7A 4OL9A 2OOSA 2PD6A 4LK3A 1T1RA 1XELA 4NMHA 3H2SA 4H7PA 5IDWA 2Y93A 1TT5A 2VYNA 4HUJA 4PG4A 1U3TA 3JQAA 3DZGA 4OAQA 3S2EA 1ZNQO 3RU7A 3D5QA 4RF2A 1DIGA 3BMNA 1WDLA 2PNFA 3GMDA 2EIHA 4II3A 3MJSA 4YT8A 1XLTA 2JAPA 3W1VA 2IYOA 4TWRA 3ZU5A 3AUAA 4BOYA 3EDMA 2NTVA 4Y8VA 1HT0A 4UUNA 1MFPA 1DC6A 1XIVA 3W8FA 1NVTA 3PI7A 5JAMA 3OICA 2BFOA 1EK5A 2PD3A 2LDBA 4PLGA 4TROA 3U3XA 4ALNA 1LDGA 2GCGA 4MPDA 3MEQA 4HADA 4ND2A 4W4TA 2X6TA 3I83A 3ZNPA 1DO8A 1EDZA 1BXKA 1C1DB 1VL6A 5BQFA 3CE6A 4XDYA 3JTMA 1D3AA 4N7RA 5K0ZA 3QA9A 3E18A 1OBFO 3OM9A 4N54A 4U8GA 3WFJA 1P1KA 4R9RA 4AJ4A 2A92A 4F6CA 4D3SA 3JQ8A 4MVJE 3ZV3A 2CUKA 1KEUA 1VRWA 2D3TA 2QZZA 3WYCA 4J49A 1UDAA 4ZQGA 2NVUB 5C37A 1A71A 1QYXA 2C82A 4BGUA 4B4WA 2FPIA 3VKVA 1LDYA 2BI7A 4XDZA 3DWFA 2Y1OA 1ZFNA 2R00A 4RJTA 2Q46A 1LSSA 3OJOA 3OQ1A 1S6YA 4H15A 1VI2A 1NFRA 2R00C 3JD3A 4XYEA 3RIHA 4AG3A 4KWIA 3E9NA 3PP8A 3QWFA 1D8AA 4BMNA 1U7HA 3GC6A 2O23A 2O3QA 1UXKA 1YRLA 3FN4A 4MVJF 2UV8A 3RUAA 5I7FA 2J3HA 4B79A 4B7CA 4B7UA 1F8FA 2PH5A 4LRTB 1E3WA 5EPOA 4NNJA 4CR6A 1HZZA 4BNKA 1Z7EA 5DCUA 1N92A 1DB3A 3F47A 2GN8A 1K6XA 4RLHA 1HTBA 1RM0A 3MJ4A 3OF2A 5C5IA 1A7AA 1LLQA 2QYTA 3KZVA 4IBOA 4ONEA 4YAKA 4QT0A 3V1TC 2OFPA 1HF3A 4HNGA 2O3RA 1C14A 3DTYA 4PVCA 1ZZEA 4OJNA 1XQ1A 4FGSA 1ENZA 2GZ3A 1B2LA 1GEEA 3CEAA 2WE7A 3M2TA 4PLTA 2G5CA 3FNFA 3VPSA 3KEOA 5A9SB 1Q7GA 2I67A 5G0UA 4J2OA 1P44A 5FI5A 4IGEA 3LT2A 3P2YA 1NQAO 2C0CA 5KVCA 3PTZA 3LYLA 1PZHA 1QP8A 2PKQP 2EG9A 3F3SA 3TQHA 1E7QA 2OO5A 3GGOA 3L07A 1Q7BA 2PFGA 4OM8A 2J8ZA 3GT0A 1NWHA 3Q9UA 1CEQA 4IMPA 4Z9YA 2NU9A 3ZV4A 3ZWCA 2IEDA 1E3EA 5DNAA 3GZNB 2PH3A 3G79A 1JKFA 1JDJA 1N9GB 3ANMA 3QVWA 1UUFA 2O7QA 4AJOA 1JKJA 3T7CA 2B4TO 3E03A 1Y7TA 2JCXA 3TZHA 3E5RA 4FFOA 3V2GA 4F3YA 4OSOA 3AK4A 5ER6A 2Q1UA 3A28A 3CH6A 4E32A 1U3WA 3TN7A 1IUKA 3RVDA 1DIBA 2OL4A 4BO9A 1WNTA 3WGQA 3W8EA 5KJCA 2O2YA 1RM4A 2Y1FA 3GG2A 4ZRNA 3AM4A 2NVWA 3EC7A 3GEDA 3D4PA 4E2YA 2VHWA 1KVUA 3O38A 3OJ0A 4MVJM 1HSZA 1ZEMA 2HJSA 4O1MA 5BSEA 2HKIA 4RLSA 3E9QA 1PZFA 4BIIA 3VDQA 3NDJA 1NPTO 3PGJA 3DBRA 3FTPA 1IHYA 3PWZA 3WQQA 4LCEA 1JU9A 2EGHA 3OA2A 3WOHA 4HX5A 3ZZNA 4R1UA 3DZJA 4HV4A 3IKVA 1DPGA 4HBGA 3ZWOA 2ZYDA 4AJNA 3O9ZA 1U2DA 5AXBA 4KDFA 1K6JA 3VHRA 3VH1A 1LRJA 2VOJA 4KTVE 1VSUA 2UDPA 2BGKA 4RVDA 2XF8A 4XB2A 4Z0PA 5JO0A 2VYVA 3VAZA 3WR5A 4J16A 1QYCA 3KYBA 3RBZA 1B16A 1I2BA 4WEOA 1M2WA 3R1IA 4J1NA 1PJQA 2G0TA 2IRWA 4ZA2A 1ULUA 3PJDA 1CQJA 4P38A 1UXGA 1VE9A 1B0AA 4BGEA 5ILGA 2DC1A 4J1TA 5B37A 4FS3A 1IZ9A 4JLWA 5DP1A 3RC1A 5BSGA 1A7KA 5IXYA 1NAHA 3WGYA 1MX3A 2VWQA 4CUKA 2NU7A 4MVJA 1MV8A 1WW8A 5JYDA 5AQ1A 3PGXA 2AXQA 1R4MB 4XJSA 2JFGA 4WOJA 4P4GA 4D0SA 3ORFA 3SBOA 4C7JA 2FR8A 3I9OA 1ISMA 3DBHA 3JD1A 3VZSA 4N18A 5CAEA 3QHAA 3KOUA 3OA0A 4UVEA 3DZHA 1NWCA 2WSBA 4NFYA 2D4AA 1FDVA 4HY3A 3F1LA 3H6KA 4R69A 4CM8B 4ZJUA 5EQDA 1X7HA 4O63O 2R2GA 4PLFA 3IUSA 2EP5A 3WWZA 3AU9A 4ILKA 2FZWA 4XYBA 4E5MA 3FBGA 1X13A 3CSDA 2YY7A 3ANNA 3FCOA 1OI7A 3BMQB 1YJ8A 2QHXA 4XKJA 4PVDA 1FXSA 4K26A 5F21A 1UAGA 3TOXA 1NX6A 1WP4A 4ID9A 1HDCA 4BL5A 4DTIA 4XEHA 5B12A 5I8WA 4GVXA 1QYDA 1I33A 3UUWA 4TRNA 3WYEA 1YO6A 5L7TA 1Z6ZA 1YB4A 3DAGA 3K9QO 3QRWA 2NNLD 1PJ3A 1GDHA 3DAFA 2NV6A 3G1TA 3HUDA 3H3JA 2CDAA 2ZTLA 3PDUA 4YQZA 1E1LA 1KETA 3F5SA 1HSOA 1XWFA 4DWVA 1ONNA 3TDKA 5KKAA 1BDMA 2X9NA 3E48A 2Q2WA 3GEMA 5JDCA 5ICMA 4TQGA 4NJMA 2FPPA 4FFLA 1PTJA 4UUPA 5TJ9A 4MO2A 2XXBA 5JDCC 3WGTA 3OJLA 2DUWA 4IJKA 5I8ZA 3DR3A 1ZK2A 3RC2A 1LDEA 1EFLA 3NAQA 3WGIA 5I7SA 1Z73A 3V8BA 4B3JA 1N8KA 3JYPA 4BNYA 5KVVA 1X7GA 1C0LA 4IM7A 3JQ7A 4O0LA 3VKUA 5L95A 2Q2VA 3F1KA 4XIYA 3T4XA 4GX5A 2B83A 3MOIA 1Y5MA 3N7UA 3EVTA 5GZ3A 3F46A 3RROA 4L4RA 4A27A 9LDBA 4UAGA 3OEWA 4XIJA 1NQOA 4CL3A 2Y66A 4FOSA 3NTOA 2EW8A 1EUCA 1AHHA 1A72A 4FJ1A 2YHIB 3ONFA 5KJ6A 1SEVA 5ADHA 4CQMA 4YT4A 3PEFA 3U5TA 1DRUA 8ADHA 2WE8A 3RC9A 1YQXA 1YS4A 3QWAA 3BHMA 3JQGA 1MUUA 4D44A 2VUTA 1V9LA 4JK3A 4XQCA 4NZ9A 4KWHA 2EKPA 4BNXA 4PLWA 3WQRA 2YV1A 4J0FA 5EESA 3QVTA 1RYDA 4J7UA 3FRJA 3ZHYA 4P22A 2HK7A 3TPCA 4QO7A 4DUPA 3K2EA 2X0NA 1K89A 1QSGA 3DB2A 3ZWAA 1ZMOA 3WTCA 5MGBA 1DHTA 4YBZA 2DM6A 1X1EA 3HNPA 3LC2O 4R1SA 5HBRA 3X2FA 4CL8A 4R5HA 4UREA 1NBOA 4WUVA 3H65A 1PJ2A 5JAZA 3C7CB 1P31A 3L9XA 4Q3NA 1Y9AA 1P1HA 3TZ6A 1QLHA 1I24A 1RM5A 3ETEA 4DPLA 1R0SA 5JC1A 3OMLA 1YBAA 3B1JA 4O6VA 2GUGA 2J5QA 5T64A 4GMFA 3P7MA 4FW8A 4MP3A 1LBEA 5EERA 3VH4A 2ZQZA 4A5OA 1U8FO 2NTJA 4DPKA 3A9WA 4TVBA 1H2HA 2B35A 1DLIA 2QW8A 2YFQA 1GYRA 4CMIB 4NH4A 1K5HA 4YCAA 2ZKLA 1F8GA 4IIVA 3I4CA 4BNGA 1XEAA 4BS9A 3C8MA 4E33A 3DZKA 1C3VA 2POQX 4F6LA 2VRBA 1BRMA 1P0FA 1LI4A 2W4QA 2X5JO 3ZNOA 3QV1A 3D3WA 5G0WA 1PJLA 4CV3A 1TVEA 3ICPA 1QLJA 3KVOA 3BMCA 1NTOA 2GD1O 5LCXA 3ROQA 4FB5A 1CRWG 3C7AA 4YQYA 1U5CA 2AW5A 3Q2IA 4GX1A 1GZ4A 4QEDA 4FD3A 1SAYA 3K96A 1U3UA 1DAOA 1KC1A 4R01A 5B1YA 3AW9A 3P2OA 4MVJP 3R6DA 1V3UA 3U49A 3QP9A 2CY0A 4JJGA 4OGWA 2NACA 3AUSA 1M6HA 4BO3A 5CHEA 2E82A 3U4IA 5DN9A 5TF4A 4CMBA 5BSHA 4CM1A 1XYGA 3KSUA 2ZK7A 1LC0A 3P5SA 3NJ4A 1DFGA 5GMOA 3WSVA 1PS8A 2AEFA 4FCCA 1AXGA 3LLVA 3M6IA 5DZSA 1YQDA 3ZWMA 2PK3A 4YJHA 1O9BA 3ONEA 4EUHA 4GLOA 4AJEA 2VHYA 4RV9A 5JNLA 5G4KA 2NQ8A 1ZK4A 1G1AA 2IDZA 1EQUA 1UZNA 1UZLA 4JCOA 4PZCA 3IUPA 3GFBA 2DQ4A 1P74A 2AEJA 4AJKA 1BDBA 1U4OA 3Q3CA 2DPHA 1T24A 3PJGA 5COBA 4EEZA 3LF2A 1EBUA 2CFCA 4P4LA 1DIAA 4FFNA 2GASA 5F5LA 3ZWVA 3NJ8A 1I3NA 3FR7A 5CPBA 1P0CA 3KYCA 2JCYA 2HMVA 4IDAA 3UICA 4CMCA 4UEJA 1A5ZA 4DREA 4KUGA 3V5NA 3GEGA 1EVJA 2ET6A 2C59A 2YYYA 3I9LA 3RCBA 1O0SA 5FEUA 3EZLA 2PLAA 4YRDA 3WTBA 3K31A 3WBBA 1U5AA 4FN4A 1KY5A 4E30A 1DAPA 2CF6A 2GZ1A 2I5PO 4RZIA 4LMRA 4TKMA 2Y0DA 2Q3EA 4QFCA 4DA9A 5A4DA 5F1KA 1OOEA 3GF4A 2X5KO 2ZCUA 5T5QA 1EQ2A 3RQSA 4CLOB 2ZB8A 1E6EA 3DHEA 3F4BA 1I2CA 1CETA 4NR0A 4M8SA 2EHDA 4CLRB 4BO1A 3IJRA 4IQGA 2VNAA 5BSFA 2CNBA 4CMEA 3TF5A 4RGBA 1P1FA 3PPIA 2WYVA 1SOWA 4I8XA 4D7AA 5IZCA 4R51A 4D3FA 4GKBA 3E5MA 4CQLA 1ISGA 4CMEC 3BMOB 2IE0A 2AQHA 4EW6A 1TLTA 4FSHA 1ZIDA 5IZCC 3WX0A 5BT9A 1MXHA 3ZH2A 1PGPA 4I9HA 3QSGA 1VLLA 1VSVA 3ZHXA 5L7YA 1F12A 4BV8A 2YHUA 4EYEA 2QRKA 3ITKA 3IAHA 3FWNA 1PS0A 2ZJ1A 5JY1A 4GX2A 2GO1A 4Z9XA 3D4OA 4X54A 4W82A 3ROMA 3RUEA 1ZO8A 4JQCA 4CUJA 1E6UA 1LSOA 3RI3A 1NVMB 4K9DA 3EHEA 4GVLA 3BTVA 4D41A 1EZ4A 3PHHA 3GOHA 1GU7A 1GZ3A 3HWRA 1MC4A 3EW7A 5HM8A 4BNMA 2TMGA 1Y8QA 4NK4A 3RAJA 4NFHA 3H4VA 1LX6A 4R41A 1ZEJA 3GG9A 2JHGA 1U3VA 3STHA 2E49A 4PG8A 1VJTA 1DC5A 2HUNA 3RUIA 3PYLA 1J4AA 3CZRA 3G49A 4NBTA 4PLPA 1XKQA 4W99A 3FPCA 5DP2A 5G2OA 2GERA 4KZPA 2B4QA 3AI1A
chains in the Genus database with same CATH superfamily
3MCZA 3Q7QA 4LDNA 4KI7A 4ZEVA 3CLTD 4AT1A 4A10A 2WJPA 3IP6A 1J07A 3JYNA 3EEYA 3GGSA 1JIKA 1YSCA 1QH1B 1Z29A 2B5VA 3BM5A 1IEXA 4HAOA 2P4HX 4A8HA 4GBED 1SGWA 4PG7A 2A6PA 2F67A 3PUZA 4YPVA 4KW7A 3SXJA 3KIPA 4RDIA 2IOYA 2H48A 3H2HA 3LKZA 1GGVA 4MCIA 3RT7A 4EZEA 1Z5NA 5A4IS 2C5EA 4Z54A 3SMQA 2ZI7A 1U0FA 5EWMB 2I71A 4RTSA 4BB0A 3U13A 3PC4A 5E1MA 3HU1A 2OPHA 1KPHA 1Z6YA 3JQQA 1E3DA 1VI5A 3U9LA 3L1JA 4MGYR 4CKWB 1DAEA 3KNZA 4LKRA 1R3UA 3H3XA 3KS9A 2ZRNA 2GZRA 2O3SA 3VYUB 5DTRA 3WLRA 1RJWA 3USES 4K40A 1GGMA 4PSCA 1JVBA 1GEGA 2DBQA 3E81A 2VK4A 3F6PA 4X1KB 3ZJVA 1T4DA 4HDMB 1A2OA 2J9YB 4HTFA 4IKOA 4IVRA 2ERYA 3NETA 3WMXA 2EKLA 4MULA 4PZAA 3TOZA 3CFYA 2YMPA 4P54A 3D8UA 4DAEA 2FR1A 1L5WA 2O0JA 1MVLA 4QTXA 2F17A 2WKRA 3EZXA 3UFBA 4F6RB 4HGYA 4C0XA 1SNYA 2FW6A 5DYIA 3MC1A 1E1KA 1F5NA 1D6MA 3C5HA 3HB5X 5C3MA 1LLUA 4RJIA 2CE7A 3K0BA 4LMPA 3HVJA 1YHZA 3SIXA 3HN7A 3R8XA 2V97A 1GRCA 4CV0A 5EJ2A 4WXEA 1I6MA 2A86A 2P9YA 4XD7A 4HZUA 5K9ZA 1VLQA 2EBFX 3LYUA 3HB9A 4JLUA 3B8EA 2G72A 2AFHE 2H18A 2K87A 3Q3JB 1QP4A 3Q1LA 2PUAA 1UPCA 3MMSA 4RTQA 1LRLA 5EJGA 1X15A 1KS2A 4KNVA 1NC3A 1ZR4A 1GQSA 1M2JA 1H1DA 1T2CA 3CIOA 4S1TA 5AKGA 1KAHA 2XITA 1MIOB 5A4AA 4WLFA 2WWWA 3W7VA 2QYSA 3ZJYA 4ZO4A 4YJ2A 1QFYA 2D59A 1XZGA 2PKRA 4YRGA 4YGXB 3B1WA 3UNXA 4IIEA 3M6WA 1VQ1A 3KTAB 3OWHA 4YP5A 3V48A 2XCTB 3UA4A 4P0PB 4TN1A 2GR9A 5HG0A 4E13A 3S2YA 1FFXB 1HRDA 1DAFA 2I4NA 1XNJA 1ZD8A 1QFSA 1U90A 4PZPA 4C2UA 1XLUA 2VYND 3I8XA 1BCSB 1E4YA 1P2GA 2B92A 1SUIA 2VKTA 2W71A 1PL8A 3RUFA 3SHWA 1GNRA 4F84A 1HMYA 1YIAA 3Q4GA 2XBUA 3ROFA 1HNZB 1P3DA 3H2IA 3OD1A 4PO1A 1UP4A 4HH4A 5EINA 4IWNA 3AL3A 3W2GA 4ZQBA 1X7WB 3U1VA 4V1CI 1Y1PA 4FC6A 5ENVA 5CYOA 1S2DA 1AB6A 4HLUC 4MKXA 1NXSA 1RYNA 4HNVA 4Q3KA 2DKNA 3SHFA 1FYXA 2PGOA 4OHFA 1PZGA 3MCTA 1WTCA 4M8IA 5JYEA 1IVNA 2LPMA 3O2SB 4GQAA 6Q21A 1OX6A 5ALMA 3DV0A 4MA4A 4LZWA 5IN5A 5JWOA 1FDWA 4XQGA 2GEFA 2QPLA 1UPTA 2WA1A 3GN2A 1EDOA 3IOMA 4M1SA 4MS1A 1Q6YA 2HUPA 2LRHA 1ULSA 1Y8RA 3ANLA 3MWGA 4NL4H 3ZVKA 1DKPA 1UJ6A 4NHEA 2O8BB 1DKNA 1HKUA 1N2XA 4FLEA 1LLFA 4N6OA 4REMA 1JFTA 3KJEA 1Z68A 2JG3A 4D79A 1CZLA 3HK2A 2QLLA 2OXRA 5CCDA 1QQ7A 3B6EA 3DSRA 3RSHA 2JFZA 4UTXA 1EUZA 3KP1A 4MAFA 5IC4A 4YB8A 1FE8A 2V8BA 3AC0A 1WUYA 5IM5A 2O3UA 2TS1A 2YOFA 4ZAGA 1W1UA 2J3EA 4ZT5A 4MB2A 2ES4A 3GHHA 4B3IA 5BV0A 2JD1A 4ZI3A 1MRSA 1KZGB 3FVWA 3Q9NA 3KD2A 2X0RA 3DEIA 4KAXA 5LQUA 4L50A 1LZKA 4BJ3A 2ZVQX 3UJBA 5TQ2A 2UZIR 1PL6A 2XHEA 3PNVA 3SC3A 4L4SA 4HZGA 1AMNA 2C2HA 4CG0A 3DMRA 3JPWA 4UE3S 1T5OA 3GR6A 3MTIA 2VQFB 4RD4A 3EC1A 1IZ8A 2Q4DA 3RAFC 2HLNA 4DUYB 2JH8A 2WU4A 1J1UA 4OJMX 1QB7A 2YXBA 3IUBA 3CCBA 1ZC4A 1ISRA 4LEIA 1FK8A 4HG2A 4CTJA 4NNPA 3WYAA 3HA7A 1MFZA 3I4FA 5E4JA 2O2HA 4ZVLA 2OUIA 4LOKA 3PEWA 1NY5A 2X1HA 1S3IA 4EHLA 4M1OA 3WP0A 4CMAA 1K7FB 5KU1A 1XMPA 1LTKA 3NPAA 4HDNA 4IAOA 3ZE0B 4E31A 3R7NA 4A6PA 3K30A 2WNSA 1CS0A 1MD9A 1PT5A 2IHTA 1BWPA 2PX4A 3E3LA 4Q48A 3NHZA 4IOLA 2C5AA 5DRYA 1RI4A 4WCFB 1JEQB 3NCHA 5IT5A 3PQ2A 4D9NA 4ZFNA 2ZJYA 3FWKA 3I30X 3GCDA 5ARCA 1R5BA 4HI0E 4LE2A 4UM9B 4X00A 4XDGA 5EIWA 2OHGA 2WDPA 2H8GA 3ZK8A 5HOEA 4X90A 5IXJA 1FA9A 2WPDA 1Y1RA 3PHBE 4K3VA 3TUJC 5AVTA 4OAPA 3HYRA 1FB5A 4DLWA 2AFIB 4RSRA 4AY2A 1H3FA 2PPVA 1L7QA 1AKUA 3KD3A 5LP6C 3C1AA 3OZUA 5FTJA 5A4MS 4LDZA 4BO4A 4Z0HO 3I04A 2ZIZA 1YOVA 4QBKA 3V1KA 1BCRA 2ZIFA 3FCEA 1FU7A 3OQBA 5FI3A 1QCCA 4INAA 2P9GA 4ASUD 1CRPA 3QJ5A 4I5FA 1MP0A 5E2AA 2C4WA 3CPSA 1J5EB 1NIPA 3Q11A 3Q10A 4YASA 1N78A 1RC0A 2A67A 5HSGA 5IG2A 3T9CA 1SRRA 4G1UC 5IKPA 5ICSA 2AQIA 3CW9A 3KYDB 5K0FA 4D6XA 3HB7A 2VF8A 2DKOA 2GZHA 3L84A 4KPGA 1OFIA 5ES3A 4F85A 4KXWA 1N6IA 4PLYA 3ZVLA 5LIPA 1NW9B 1SC3A 1QGUA 3IELA 4UAVA 3HO6A 1T2NA 3GFPA 5JZVA 2GM5A 2Z9BA 4M38A 1Z8DA 3OX1A 1D4FA 3EJ6A 1GV0A 3D7LA 4F86A 1H2ZA 2JGIA 3I0MA 3T38A 3CUKA 2CHUA 2EKQA 2IZOA 3HN2A 4ARZA 1ZLXA 5ALXA 5JCJA 3GIDA 1KDPA 1LCIA 4E2WA 2HXSA 1PN3A 2JCBA 3JTEA 5ALGA 3D9QX 1RCTE 4KO8A 3EH1A 3NUQA 4JELA 5D01A 3BWXA 3SHTA 3BA1A 1T3HA 1DZIA 3JQFA 3GY0A 4OD0A 1G41A 1P45A 1DNPA 4KQIA 5EQFA 3RJ5A 4E2XA 3Q7EA 1PLJA 2Z95A 4HSGA 1ZVVA 3FVTA 2IS2A 1KGDA 2BLNA 4RK7A 3C45A 1M54A 1PFUA 4P93A 4TQ9A 1PJCA 2WTNA 3R3JA 4K2HA 2XHZA 4YO7A 5HQ3A 4LZZA 1YRQA 1LBQA 3HBLA 2CJWB 5JMTA 1DAIA 3N0VA 2JFYA 1JG7A 2ZJ0A 4XWYA 1ML3A 3WLPA 3A2KA 2JGNA 1QQ5A 2H16A 4NBLA 5CDGA 1E2GA 2PZFA 3P4YA 2Z98A 1QO7A 4QO8A 1NT2A 4EI2A 5B58C 4RTOA 4R5MA 2QE6A 1R0YA 4FDAA 2J45A 4IF6A 3VX3A 3DH0A 1LTHR 1THTA 1W19A 2W2OA 1DBSA 2P2GA 2FEOA 3FCCA 3GVPA 1NVEA 4QOGA 1TM7E 3BYZA 4Y9UA 5LN1A 1GUYA 2FSHA 3FKJA 4L74A 1GTRA 4H77A 2ABWA 4J4TA 3PNMA 4ZO8A 1PNOA 1ZSYA 4XR9A 1KBZA 1E2MA 4YRPA 3E5HA 2WUWE 4KMSA 3W5UA 5CA1A 1HNWB 3V3TA 2BEWB 3QITA 3L43A 3A31A 3DAYA 3IEMA 2E1RA 4M76B 2UVQA 3BWEA 4Q19A 4S2EA 2VJAA 4ER3A 5KKNB 1X14A 4JYZA 1XWWA 4M21A 3ZLTA 5GAJA 1FVFA 4TYPA 1C1DA 2PUHA 3E7XA 1SBIA 1VBFA 3FPKA 1PR3A 3U48A 3C3PA 1UMBA 4RENA 1HA3A 4AI6A 2CVFA 4D0LB 2ZI9A 3M6VA 2P7IA 3M49A 2BCGY 1IC6A 2RKBA 2ZTSA 1ZK0A 1MAWA 3KAQA 3QLTA 3ZG6A 5A5DA 2Q99A 5FBZA 3RVNA 2VDLB 4K9RA 4HNHA 1FLVA 2YWDA 4UEOA 5KDOA 2NVUA 2PQ2A 5DBHX 2XTJA 5HJ2A 3LGSA 2KMLA 1W34A 3B6MA 4XJXA 1NKVA 3SQDA 5TQVA 3UB3A 4EUFA 2FEKA 5C4GB 3PZRA 2YNMC 4CEHB 2ZJ5A 3WK6A 4BV9A 2P4SA 3SHQA 3GUUA 4B35A 4EG5A 4GM4A 4N41A 1M5UA 2CYBA 5JBNA 5BNZA 4BVEA 1U04A 4HVLA 2FMUA 4S1PA 2C77A 4LV6A 4EFMA 2PSHA 4X3OA 2IKSA 3REQB 5BSMA 2CLCX 4MRRA 1XZMA 2VBCA 1E6CA 4I36A 1BGWA 4JUFA 1O2DA 2LTAA 4UCFA 1I7DA 2BFEB 4K0KB 4IQ4A 2VXOA 4D42A 1RI2A 5JMOA 2D3WA 2D5AA 1VZ2A 4Q1AA 3LFHA 4BBPA 1QVVA 3L9WA 4H4CA 3VBEA 4LGVA 4DW8A 4JJZA 3JYLA 3L0CA 4QDXA 5FBRB 4X0EA 1EGQA 1UC9A 3QKRB 1R6TA 5IJZA 4M9RA 1T36B 1U7TA 2DAPA 2UUOA 2W2KB 4KXUA 3VSBA 4CQNA 2QRZA 1TUBB 2VVTA 1R0BA 1GPH1 2QU7A 5JUWA 2W0SA 2JK1A 2H7CA 2FRDA 4MUBA 4UBLA 3CLHA 3R7WA 2ZTHA 5AM1A 5FJIA 3ZD6A 5L4NA 1A88A 4RGVA 1ZMTA 3EZNA 5CBKA 4FZ5A 2ERXA 4ZV9A 1ZI8A 3HJAA 2W2PA 3WLNA 3DL0A 2JHAA 1RI1A 3AB7A 3M5CA 4Z0TA 3ESBA 1E0JA 1OILA 2JL1A 2ZIVB 2H2HA 3MJHA 3UAGA 1KE1A 4QXMA 3TRHA 1U2GA 3ZYZA 4COOA 1HPLA 3UJ3X 1Q16A 2PWYA 3C87A 3CT6A 4RJJA 4TSFD 2VZ0A 2JLUA 2DLDA 3HABA 5BSKA 1HURA 4OUDB 5LXTB 1U2PA 1QDEA 4JROA 1QCYA 4WXPA 1NPDA 2B0CA 3V32A 3OZTA 2VQEB 4C7OA 1PO7A 2RG7A 1H85A 1LK0A 2ZJ2A 1CX9B 2JGMA 3NHYA 4K81B 1T9GR 3CVJA 4C7VA 2R68A 1JQDA 3ZW8A 1Y7HA 4RY8A 3T4EA 3HCDA 2XUAA 3QVMA 2KB0A 2VBFA 1X0XA 2IXDA 5FHRA 2EV9A 2Y4OA 2YVAA 2PUGA 3QBVA 2WHRA 1AF7A 5JCOC 2PKQO 4C76A 1C1XB 3MS7A 4MV0A 2VK1A 3HZZA 5AVQA 7MHTA 4P34A 3AEQB 1I9GA 2D2XA 1JMKC 2QEQA 2IU4A 1VPDA 2XTNA 3ITNA 3O4IA 1Y9ZA 3AP2A 4JQOA 1W96A 4PCUA 1XMJA 4LDPA 1ACMA 2C3PA 2X41A 3EK2A 5ECYA 3DBVO 1CZUA 2FG7C 3TJMA 3ETHA 2FB9A 4P08A 4A0QA 4U2DA 1DKLA 1BN7A 1LQUA 2Y27A 3NHBA 4ND8A 3WZ2A 5IH3A 3RKUA 4ND6A 2XVZA 2Z56A 3MMXA 3AF1A 5GM2A 5CA0F 3KQMA 5LB4A 1U3GA 3GHYA 4XYGA 5JANA 3HO1A 3AVVA 1O58A 2D2VA 2HRRA 3HPQA 4OQ4A 2V54A 4AJ9A 4YPFA 4MVYA 5JXIA 3L4KA 4H1WA 1HLDA 4L75A 1U4NA 1C7FA 2V4ZA 1J2YA 1G20E 4JMLA 5E8RA 1FYEA 1ZICA 3PPXA 5ECGC 7YASA 3U4QB 3N2GA 1Z0AA 3C48A 1FTGA 1OXSC 1V2HE 3ICCA 5HBGA 4R71A 3E9RA 3EAFA 2HMSA 3U0VA 2P5YA 4PTLA 4CVNA 2P8JA 3IOYA 1TYBE 4U2EA 4ZPJA 3LT1A 4LX8A 2W2XA 5JO9A 4BFXA 5JDIA 1KY4A 5G0TA 3RYHB 4X93A 4FZJA 2A35A 3S27A 3EFEA 4G1VA 2X3UA 3K1TA 5EAIA 1KZHA 1AA6A 4HBZA 1XTUA 3WMWA 2BEUA 3H86A 4BX2A 2XB9A 1NVKA 4M86A 6AT1A 1UBFA 1Q21A 5D85A 3T1NA 2BRUC 4YRAA 1ZCFA 3JQAB 1XFDA 2P9TA 1T35A 3QYFA 2OFXA 5CT4A 4F1KA 3BMNB 3ANXA 3ASZA 5JD5A 1I3LA 2B6NA 1MOSA 2CUNA 3HBMA 4D44A 2FUKA 2WIJA 3ABOB 3V2UA 5KYWA 3HCOA 2FG6C 1SVSA 3BEOA 3L5OA 1IB6A 3LPLA 2FTKE 1U8TA 1WDTA 4P53A 1QP0A 4OHYA 3ECCA 2I62A 2EEPA 5BSRA 3D6MA 1KK3A 1XVUA 3PE3A 2BDTA 2WWHA 4WDRA 3ZHZA 1HNXB 3DLBA 3A1SA 3GLIA 2PDAA 1QP7A 2QQEA 1HX7A 1X7YB 1Y33E 3L2OB 3O75A 5BN5B 1A7JA 3VPGA 1FDTA 3BCRA 1OBOA 1L7MA 3REFA 2EBHX 2J6CA 3FGPA 3B85A 4R1NA 1Z83A 4ND4A 4GD3Q 5D84A 1R6VA 3RVLA 1P62B 2B4AA 4M49A 4KWEA 4IEEA 1NI4A 3DUFA 3NT4A 4KPFC 3SN6A 3JQ8B 4TMZA 1YR1A 4K05A 5TPZA 1FX1A 3V6LA 3MQ4A 1Q77A 4BVJA 1LNZA 3QLVA 2BV3A 3V3KA 4ZQFA 2FPIB 5FUYA 3M6UA 3OZFA 1MQAA 3UKJA 2PV0A 2AOTA 2QQ5A 5BUZA 5IAJA 1LVHA 2AXPA 4PEVA 3SQXA 3TI9A 2FRXA 3QXJA 5IKXA 4BAUA 3E1GA 2PYZA 3PX3A 4AP5A 1XT6A 1RI3A 1PGNA 4M0KA 4POAA 1R0LA 2IDJA 2IW1A 1JHRA 3HA3A 1H93A 2PBFA 1D9XA 2AN4A 3VFDA 4GSLA 1FW8A 2G8LA 1JJVA 1NUQA 1XTKA 1V35A 1Z2EA 1JNXX 2YTZA 5EE3A 1XU4A 1MR3F 2WYWA 4G0OA 4UNSA 5F3RA 2R6JA 2Z2YA 1Y37A 2JC3A 3UZUA 4HDCA 2H2WA 3CBQA 4G9EA 4EY3A 2J4DA 4DARA 4UNPA 1SUEA 1G7TA 1UZMA 3KUKA 1TQ8A 1ADYA 2EJTA 4I1RA 4LTDA 4M7WA 3SC6A 3W7BA 4F1WA 4I4LA 4QBIA 3KYJB 2J1LA 3NOXA 3TIFA 4DKXA 1WV0A 1UPAA 2EERA 4O4LB 2H9YA 3TIXB 1NV9A 1DKMA 3H1TA 1LKZA 2C7VA 2VHVA 2QVZX 3LC7O 1CCWA 1L3IA 1SBZA 2DFVA 4Q1VA 4ZU3A 3VNBA 4EJ0A 2QDKA 4I5EA 1BOOA 1LFDB 3KCQA 3UC5A 1AZSC 4CLEA 2IEZA 3LVBA 4TMWA 3H7AA 3HYCA 3EXEB 2OEPA 2IT1A 4XX1A 1FQKA 3M4YA 2GCNA 3VV2A 2OD7A 3SDSA 2GDJA 1RJDA 2W2LD 2UYCA 3K73O 2WWYA 2PUBA 2ZAYA 3KRTA 3CZ9A 1ZOIA 2XT9A 1Z6XA 4Q3CA 1HE8B 1E7WA 3A3OA 2PX0A 3ZH9B 1G17A 1Q0ZA 1QX4A 2O2JA 3LXXA 4BNVA 3VR5D 2RHLA 4BJHB 5ITVA 4ENWA 3W78A 1T4GA 1UXHA 1DU4A 1RP1A 4IFTA 3AWDA 4G65A 4BKOA 2PRJA 4CV1A 4BNNA 1FU8A 1IHPA 4XWTA 4A0SA 4DEYA 2CT8A 1JH9A 1OKKD 4A5SA 1MLDA 1BG6A 3L01A 4O5OA 1PGQA 3TLKA 3I92A 3H5AA 1VG0B 1YZFA 5TS3A 3ZE7A 2VAXA 1WXDA 2LBPA 4XFJA 4MRAA 3E9ZA 1JKJB 3LVFO 4LA4A 3HH8A 3ME5A 1NMEA 1U1EA 1NP3A 1TDJA 1VE5A 2V4UA 3MSXA 3O7WA 4G4JA 3I05A 4G4GA 1C41A 1DC7A 5T4HA 3WQSB 3FOBA 3ZU3A 1MJGA 4R1MA 1TK9A 2VC2B 3GVIA 4PO3X 5B36A 2H65A 5AESA 1P5RA 2ZI3A 3FDZA 3DO8A 4YREA 4BFLA 4N4AA 5FDFA 1ZUIA 2DH6A 3WGKA 1J9GA 1K92A 1IZ7A 1M6WA 2XMCA 4BXOB 2HBRA 5KYGA 3IMFA 1NJSA 1ZMRA 4BDSA 1AUVA 1OT5A 1Q50A 2PGJA 4FYVA 3KPJA 3LQ1A 1U9IA 4NDZA 1ULTA 4OGFA 1F0PA 1ZOLA 3AL2A 4RO0A 3QUBA 3JQ9A 1BNCA 1QG0A 1NULA 3DVLA 1GL6A 3FY4A 3JQBC 4L2IA 4DPMA 4MITA 2JI6A 4U7FA 4E5UA 1Q0QA 4LMBA 2C4KA 4RF5A 2ZYIA 1OLOA 2FFHA 5EWJB 4F45A 4XB6B 4G89A 5DNEA 5FBVB 1H42A 2XXJA 3DDUA 1ZGCA 3HJHA 4G1MB 4OBBA 4AZSA 5K8UA 5L53A 1EH5A 4KC0A 1BQEA 1EZZA 1NYQA 1M67A 1QZXA 1B7GO 3DBRB 2X5OA 4FKZA 2B34A 1A27A 1E1RD 4J0DA 1XYVA 2C61A 2J87A 5CFRA 1EWVA 4IDBA 4UU7A 5DGDA 1QVWA 2EARA 4R7ZA 5ESDA 1DTWB 1U0SY 4O4JA 1AURA 3E05A 4EUEA 4QNRA 3K9NA 4MYRA 2BSAA 3WYBA 1PX2A 2AJ8A 4AWXA 2PZAA 2GI4A 1WB9A 5MN5A 2HHHB 3L05A 2OYCA 5KOIA 1OFGA 4FHZA 3QUSA 3SZMA 1X7XA 2G71A 1WUTA 1KEWA 3M7IA 3KZ1E 3MOGA 4PG6A 3OEHD 1FNMA 4JA2A 5BN3A 2UUAB 1UT5A 3WQBA 2H00A 3H83A 4JODA 5FQNA 5KDDA 3F5MA 1KMNA 1WVIA 5CB4A 2DH5A 5ALZA 2JIZD 4S35A 4TVKA 1PWXA 2WQ6A 2B5WA 3GA0A 5IDQA 3EPHA 2TRSB 4Y2GA 1GFSA 2GAJA 2J9XB 2LR0A 2ZSUA 2WYIA 5FOSA 2B36A 4NE7A 3K0AA 5E2IA 3K72B 3AIKA 1HGXA 4QQKA 2DE0X 1WLSA 1EK1A 1KMCA 4IGFA 1XJQA 1NBAA 3NM5A 5AKYA 4ZDJA 5LPNA 1R64A 3HU5A 1L5RA 3KEQA 4H7DA 1MOQA 2H1SA 3BDIA 4MMXB 4JJ4A 4JLNA 3B1FA 1Z2OX 3FETA 4FYMA 1TK2A 2HNKA 3I2YX 3PNQA 1L5YA 2M6LA 4KH1A 2G70A 4OQZA 3AHFA 1FSPA 1NF8A 2Z08A 4FLFA 3PIIA 1H6DA 4H7KA 4TMYA 5FFNA 3HUUA 1ACJA 4LN1A 3OO1A 5BR7A 2IOHA 1E60A 2W48A 4W5WA 1CUIA 2UZAA 3DBHB 1K08A 2HU7A 4YPOA 1EX7A 2W8BA 1C3EA 1KAQA 2FUCA 3AOGA 1M83A 2UZ3A 3C8UA 3EIEA 4J0KA 5IC5A 1NF3A 5L7WA 1GU1A 1LPBB 1EGHA 4AW9A 5FBKA 2HCJB 2PG3A 1T4CB 1Z0UA 5LYJA 1A5AB 4EA6A 2DWQA 5H9WA 3NBFA 3DKPA 3ORYA 2O7RA 3KK0A 1N6LA 4PFSA 2HMTA 5DK4A 3V1UA 2RHRA 3E82A 5CT6A 3QVKA 4RJKA 2VI5A 3KKKA 3TX6A 4LNAA 2CCJA 2R6DA 3PBKA 4OXRA 1DX4A 4PCAA 1XZQA 4PGGA 3T7JA 4EW3A 5A5FA 5BMVA 4TLAA 1KO1A 3G8DA 3D4NA 3JQAD 3LQ2A 3UAYA 3WDMA 4EKIA 2FPWA 3NH9A 4YEDA 4YAGA 2ZZKA 3AXSA 4C01A 5B4VA 2X3YA 3EPPA 3QVOA 5TGDA 3RABA 3TIIA 4F0JA 3ENKA 2VQ6A 3M3DA 1E79D 4II2A 2NZ2A 5SICE 4JNCA 1I1NA 2PWPA 2EDCA 4GU5A 1L5OA 1GPLA 4C6RA 3UW1A 4E09A 4YCLA 4TX1A 1T9BA 2W2VA 4P3KA 4BJ5A 3DBLB 3RFVA 2GQ0A 3T9AA 1OJ7A 1AUQA 2CLHB 2G7ZA 4LY9A 3TEFA 3LLSA 3UPUA 1NVGA 1D6SA 3I01M 4UJ3A 1XL0A 1C4WA 3LY8A 1GG2A 5A6SB 4DSZA 1PWHA 3P9IA 1BWRA 1GXSA 3IULA 3ER8A 3W8DA 4IUDS 3FDIA 4Q9IA 1M76A 1W5TA 1C3XA 4PZYA 4RH3A 4NJMB 2BFNA 1GTSA 1K66A 1TO2E 2NAFA 4GBMA 3HVHA 4MOWA 3GUHA 3HA5A 1Y81A 3RYFB 1J7JA 4OQPA 4PYQA 4E7OA 3JD4A 3NKLA 1J2UA 4MS3A 4TYMA 4G24A 1XCPA 3CNBA 3DCNA 4UTNA 5IAAA 1Y6GA 4J91A 4W9NC 4BGIA 1OB2A 5BY2A 3KZKA 1OLUA 3GJ3A 3MD0A 3OFSA 1BEEA 3JQ7B 4XWKA 3PR3A 4FKMA 3UEOA 2WJ6A 5DNDA 4NP6A 3M6XA 4V38A 3GGPA 3SF8B 3ZJUA 2CBXA 2FVYA 4Q9JA 3RRXA 2QMUA 2B25A 1FUEA 2LKCA 1V96A 3GEHA 4M9UA 3WWPA 1VJCA 5F2KA 4NYIR 1L5SA 3KOOA 2FZ4A 4JXKA 5T8KC 3ESYA 2X1VA 1F4LA 3OPYI 1U7WA 2O4CA 3DVQX 3RFXA 4BFSA 4YBRA 3X1YA 3SZLA 1E9EA 3LBFA 2OECA 4DCSA 1CF9A 5BOSA 5EHNA 1CW2B 3MPOA 1RZRA 1QORA 1SZJG 4B17A 1MGOA 5E6SB 3UKDA 3WDSA 1H9BA 2LWIA 4CQMB 4HYYA 1YI0A 1KR5A 4F3CA 5HA5A 3W9YA 1NXQA 2JGJA 1M33A 3FNIA 3P9XA 4U2FA 4V3BA 1A8QA 1CNEA 2RE8A 1M2NA 2FSFA 1BWQA 3QFCA 4ZV7A 4DV2B 2R87A 4G8DA 1XK6A 3IUNA 3F7OA 3OD5A 2HW8A 4HH3C 4OXNA 3PF8A 3VOAA 1SVKA 2CXRA 2C00A 3O8BA 5J4YA 2PGLA 4RTNA 3C4JA 1E2BA 3VU1A 2B8WA 1M1NA 2RC5A 1SXGA 3BRQA 7ADHA 1PJBA 1AE1A 2A9VA 2IWHA 3DZFA 2WAAA 2HSWA 3JSAA 1I10A 2HV9A 2YWBA 2FN3A 5JVDB 1DKRA 3K1YA 2ZATA 2GZSA 5E9AA 4L0QA 1TEVA 1P17A 1U5BB 5TRTA 5IFKA 3UBMA 3KB6A 2X77A 3HV0A 2PN1A 3ITEA 2QD1A 1KQPA 1QZTA 4WE3A 3H11B 3BGIA 4FPXA 2COKA 5TC4A 4DUGD 1RQNA 1R27A 3A2LA 3D4LA 4XR4A 4ERXA 1C50A 4LHZA 3I9V1 3IAEA 1QHFA 3ANYB 1ZGZA 1N2CA 1K7CA 3HKEB 5H4HA 4D82A 5K45A 1XA0A 3KXIA 2HDNB 3FBWA 4MROA 2D5CA 3PXBA 2BTEA 2V7QD 1N1EA 4I1IA 5DBFA 1K27A 2JJ1A 3K0EA 2E9SA 1U0NA 4QKQA 2VNHA 3I2JA 5LIRA 1P7YA 2WT4A 1GUBA 1T6YA 3IB3A 1MPXA 4HNAA 3RRNA 5IHXA 3SOPA 1PQPA 1YR6A 3QF4A 3GFTA 1IDOA 2IYPA 2LNDA 1EGVB 1JBKA 5EPUA 1MXFA 3HP7A 1C0KA 3AETA 3HFSA 3M9XA 4NZNA 1FQJA 3KCNA 3FFXA 4GI5A 2C8KA 3RU9A 5FUMA 4X65B 2QMZA 4OXKA 2EQ5A 3N74A 3DPUA 3QFTA 3KQHA 3FCUB 4IVQA 2G6BA 1QRRA 5L3ZA 4DIBA 3S55A 2VG8A 2GZMA 4AECA 5BVHB 1CEXA 2PM8A 4G0QA 3ZBUA 2WILA 4EF4A 4Z4HA 2O2DA 3WAKA 2YXPX 4C4SA 16PKA 1SD5A 3JQCA 4YP0A 2I7XA 4LTMA 3UHAA 4F7WA 1RQXA 2ZQ5A 4DYDA 3IV6A 3H5IA 5CDUA 2NG1A 1P0PA 1R0ZA 1R8SA 4MV7A 1Q0UA 4OLAA 1YCHA 2R86A 1JAZA 2DPGA 5ALWA 4A8TA 2X4GA 5IVHA 5HHTA 2JGFA 3PCRB 4DDMA 5A3VA 1UC8A 4GT1A 2H4WA 3SOZA 3HG7A 2P5TB 3GH1A 3OO0A 2NX2A 2ID9A 3QOYA 3F97A 2F9LA 1CJMA 1UWVA 3TQSA 4BE4A 1E94E 1Z8HA 2MINA 5JI3E 1L9XA 3QV2A 3ABSB 4Q39A 3RRZA 5LU9A 1ZISA 1HDGO 3T5PA 1QR6A 4YJ3B 4EKYA 1W4LA 5HE8A 3U26A 3SFZA 3PQ7A 4UCQA 4ZO6A 2VYVD 3VX4A 5EJ4A 3EVBA 2FP4A 4QYWA 2ONKA 4E5KA 4X9XA 1P9LA 1PSDA 3HDHA 2ICAA 1GPWB 4J0EA 3PPVA 4LNUB 2H3EA 4QIHA 4NKRA 3UC9A 4D9GA 1R0WA 2J3KA 1B6SA 3DXXA 1M1YE 3WIBA 2IYEA 4OKIA 2WJJA 5BXQC 5K03A 3KT0A 4MB6A 5B1DA 4ZJZA 5JAIA 1FJXA 1ZL2A 1YONA 2RHJA 5FEMA 1RXSA 1A95A 1M6VB 1SKMA 2BEJA 2I3DA 2IUUA 1Y1TA 5M3BA 3RK0A 3UPDA 3UK7A 4ZN6A 5K6RA 2QLFA 2Z1MA 3HKDB 4LY3A 4TV8A 1US8A 1OBCA 3TZCA 5BR4A 2SNIE 3BXXA 5JPIA 3KJQA 3PNPA 4B6EA 3CG0A 1J49A 2FPUA 2JLBA 2ECOA 4X8HA 1GCOA 2UVDA 2ZG6A 4KLCA 5TGTA 1L1RA 3KQOA 3PFWO 3C6ZA 4XQ0A 2IH5A 4JYCA 1FLNA 2ZSFA 2D4HA 2I1WA 5F1PA 2VJCA 3WLEA 1H9AA 1WPRA 1YQGA 4Y6OA 4F8JA 2A4KA 1SXJC 3CB4A 3HKCA 2GJAA 3BCHA 4MI6A 4WW0A 2BW0A 2MR6A 4UBJA 4QODA 1WUHS 3B70A 4IGAA 3ZK9A 3HE3A 2OGTA 3I9NA 1ISIA 3DGEC 4N9WA 4KE7A 5U1PA 5AHOA 2ZBFA 1JKMA 3LXMA 3RC7A 1H3NA 3IAFA 2CK3A 4XGNA 2JJYA 3C14C 4PO8A 5I47A 3NWOA 1GVNB 4XM1A 3BAFA 4LF5B 5KHLB 1ZOSA 1SFRA 3CLUC 1Z62A 2DTDA 2JJ8A 5JZMA 3OE7D 1XNGA 3ZY3A 1XCMA 3K5HA 4OYHA 4D4GA 5CDYA 4IVNA 4ZYZA 3GPDG 1Y98A 4HAYA 4L7VA 4YR9A 2ZJZA 3OMWA 1MTZA 1KTIA 1PR5A 4M0FA 1G8AA 1G9XA 3KXPA 1WXQA 1Z0DA 2VDJA 2N47A 2J5KA 1AKNA 3CF0A 3BUSA 3KSDO 2K2QB 3N8NA 4BVBA 3YASA 3TTWA 6ABPA 1RYZA 2NMVA 2XYRA 3TUZC 1E32A 2OK8A 1KDOA 3KWJA 4G4SO 5IMSA 4GLLA 4UU1A 2VHCA 2H1VA 4HEJA 2J46A 2E21A 1HDYA 1ZSNA 3A04A 5DM70 5LDDC 3QX3A 4KHZA 4HSEA 1WHTA 2E7ZA 4JDUA 3VNRA 2ZJ8A 1EAYA 4ZMSA 1WBDA 1OFHA 2YNMD 1SBTA 4AG6A 4DBLC 5TT0A 3V1YA 4Q7LA 2JARA 3FMFA 3SS8A 2WMDA 3NLLA 2I1VB 2G36A 1HYHA 5M5BA 2H59A 2RI1A 3A4VA 3K0SA 4F92B 3GNQA 5EY5B 1MTOA 2G40A 3NDBB 4M6WB 2NO4A 4Q5IA 4DSOA 2PA0A 3CBGA 4C5BA 1PEYA 3IVMA 1WXWA 1NUPA 3REGA 3CTMA 3C5VA 4Y18A 4I9GA 5ERXA 2D6FA 3LQ4A 3P32A 3FHCB 5GONB 3HR7A 2R8OA 4MB0A 4P80A 2GM3A 4TLBA 2DVMA 2E3JA 5FXMA 4ZEXA 4W5QA 5F64A 3J7TA 4MCAA 4QOEA 5BQ3A 3BJMA 5F12A 1A8UA 4S1VA 1KJIA 4CE6A 1Y8QB 3WNDA 5CDSA 2DSNA 4N7BA 4K88A 5JSFA 2VHXA 4Z53A 1SIWA 1IK6A 1EFRD 2ZGVA 3A4NA 3KVRA 4KLRA 2DUJA 3ROTA 3MWEB 2EKZA 3NRJA 4REOA 4OYRA 4K9OA 2RI0A 4UCXA 2I2FA 2WJ3A 5ANRB 4CMJA 2DEUA 4A7PA 3B13B 4HWKA 4JBYA 1KI6B 3IUMA 4AJ2A 4EYSA 3BFXA 3W4KA 3G7UA 1IJKA 1U0BB 5C34B 1DC4A 2ATCA 1WXEA 3GFGA 1EUDA 4I3GA 4P32A 3JATA 2C5LA 4CQMD 4DCJA 1N8TA 3K1AB 3D0QA 4ZQEA 3TLMA 4F7DA 4YAJA 2WIKA 3KDSE 4YC7A 2GNOA 2HN9A 4C78A 2Q9BA 1UBEA 3D8RA 4IYRA 2GFIA 3M9WA 5E1DA 5KYNA 1QDLB 4IHJA 1U7OA 3VHLB 1UJNA 5INTA 3N70A 4GUAA 3RAEC 1ZINA 2X3FA 3S8EA 2XF2A 2YWFA 3L8YA 3S0JA 3R20A 2G1UA 1T2EA 1XROA 2E6UX 2V9CA 3BTSA 1LQ2A 3BWYA 3AV3A 4Q7QA 2JEYA 2BFDA 5AIBA 3FIUA 5IEJA 2A7XA 1KH3A 2WICA 4E12A 3UBTA 3V7NA 3I3OA 2P4QA 5DN6A 4BNWA 1N0HA 4HWRA 2C9CA 2HA3A 2QVXX 3ND6A 2GZ2A 2HA7A 4LVCA 2ZUTA 3UFXB 1XZ8A 1L1QA 1SHLA 1U81A 4MVJG 2PQ6A 2PFKA 1O96A 1SVLA 4L6AA 4UVIA 1YS1X 1OY1A 3T5TA 1I8TA 2CDRA 4IJVA 2BN4A 5CH5A 3BN3A 3HGTA 4KE9A 3TIGA 3D7MA 1TMKA 4JGIA 5H9VA 4W6ZA 1KS9A 3WY9A 1SCUA 1HBJA 1TJ5A 4NMMA 3JQDA 5DJ5A 2DBZA 1J97A 2ACVA 3OHPA 1DE0A 4RIHA 2I7TA 1NDQA 1Z0ZA 3LLUA 4IUYA 4U3JA 1NL3A 1QK3A 4MQEB 1A8SA 3QVSA 5ETJA 2FR0A 1JAHA 1CUSA 4ANFA 1BA3A 5F7JA 1L4HA 3K8QA 1ISFA 2X9VA 4NYIQ 1G55A 4ALKA 4EX7A 4LJRA 1Z4OA 3GUVA 3CGWA 4M9QA 4MVJH 5FWNA 1NJ2A 1KJJA 1YB2A 3T1OA 4GZ6A 1KEVA 2A4MA 3QBEA 5LXTF 2NO6A 4B09A 1IIRA 3O3MB 5LM3A 2W2NA 1H6BA 3QEJA 4JC8A 1GRVA 5KVQA 2V45A 1GQ2A 4PYNA 1DC8A 4B32A 4DIFA 3C1TA 3SLGA 5JY6A 1PG5A 5KU7A 3O95A 1JR6A 3F5DA 1E3LA 2XGOA 3LSYA 3D31A 1GJRA 4P3OA 3L4SO 1CB0A 2IHVA 1NXXA 3DULA 4LSMA 1JPVA 4M9XA 4BO0A 2WQ7A 3WMGA 3T0IA 2E4AA 3FOFC 2I91A 2Q9UA 5BV2P 1UL1X 3OKCA 2FPSA 3BQMB 5E8JA 4HT3B 4XCVA 1KOGA 3KR1A 2MTBA 1QQAA 4Q66C 3JWGA 4DABA 3BXZA 1KC3A 1ZIYA 1F8XA 1QGOA 1Z6PA 4AZVA 2GPAA 2WINI 3GJQA 4MAAA 3BICA 4YONB 4ZVPA 2XNHA 1MC1A 1DHRA 1AQJA 5HCIA 2VA8A 1T2FA 5KHOC 1Y3CE 2O05A 4WPGA 5TMPA 5FOQA 4I8IA 3IQFA 4RPLA 4FBLA 4CHTA 2J9FB 1GKUB 3EAGA 4AIIA 4AJJA 1JQ3A 4IEFB 1UWCA 3UGTA 2ZIWB 1CUAA 2AMVA 4U63A 1YZQA 4V1CB 3BSFA 1B3RA 3EE6A 4ZZ0A 4Y2QA 1H23A 1O6CA 3OTQA 4DBVO 3A6DA 3UK1A 2ZJ4A 4W5JA 1M3SA 3FJ1A 3N2KB 4B8ZA 3P8ZA 2OHHA 3OWOA 1FY2A 3RBVA 3EIFA 1IY2A 4I6GA 3N05A 4G26A 1V16B 2YXDA 4UTVA 5A9RA 1Q17A 1APBA 1KERA 1CDEA 1PGOA 4G3XA 4NONA 4WRRA 3ZN2A 5HS4A 1QIMA 5F9MA 2ROQA 4B2IA 3IOEA 1EPUA 1MOPA 1XU9A 5ITWA 3HCNA 3RTDA 2F9FA 5C5CA 4L22A 3F73A 4MW0A 1K75A 4QX6A 1QONA 2QUBA 2XTZA 3AEUA 2CXNA 3KO8A 4UW9A 5IEBA 1Z4PX 5L3QA 3MCUA 3KT8A 4QM6A 3NRCA 3I2FA 3GLGB 4B4OA 4KHPB 1LSUA 4MLCA 3IUYA 2FZKA 3FF4A 2Q3BA 3WGJA 4ALMA 1M1ZA 4QTYA 4JT2A 2XQFA 1KJYA 1M34B 1GAWA 2OENG 2ZS8A 4KWCA 3VO8A 3VSDA 2HQRA 1SK8A 2DFLA 2NPFA 2CNDA 2GBLC 4OL0A 3AI7A 3ZWPA 3ZQ4A 3TAHA 5H5JA 2QR2A 4WCDA 2H0QA 2JFWA 2OZPA 1OZFA 4AJLA 1AK2A 2FCAA 3NVMB 1MZVA 1WMSA 1JFVA 1ZM7A 1ZX1A 3AU8A 4JMPA 3T1HB 3KJHA 4BHTA 1CVIA 1P0QA 1QXSA 3ACDA 3I9KA 4J6EA 4TZKA 3TLAA 1P4SA 4BO6A 6REQB 3FH0A 1HE5A 1NZDA 1Q2XA 4PN7A 3CZCA 2ODBA 2V6GA 1N5DA 5MF6A 2OLJA 3JAKA 1W4ZA 3ZBPA 4NU0A 3TTTA 5KOHA 1YAHA