2VN8A

Crystal structure of human reticulon 4 interacting protein 1 in complex with nadph
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
358
structure length
358
Chain Sequence
LYFQSMAWVIDKYGKNEVLRFTQNMMMPIIHYPNEVIVKVHAASVNPIDVNMRSGYGATALNMKRDPLHVKIKGEEFPLTLGRDVSGVVMECGLDVKYFKPGDEVWAAVPPWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAINKVGGLNDKNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVCSQDASELVRKLGADDVIDYKSGSVEEQLKSLKPFDFILDNVGGSTETWAPDFLKKWSGATYVTLVTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRWAFFMASGPCLDDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGKTVINVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor inhibitor
molecule keywords RETICULON-4-INTERACTING PROTEIN 1
publication title Crystal Structure of Human Reticulon 4 Interacting Protein 1 in Complex with Nadph
rcsb
source organism Homo sapiens
total genus 120
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vn8A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2vn8A01
2EXXA 4LN1A 1LDEA 4BV9A 1E5LA 4EJ6A 1UH5A 3ENKA 4O1MA 5COQA 1NQTA 2LDBA 1ZXBA 5L40A 3JQ9A 4WOKA 2HUNA 2DBQA 1DRVA 1LI4A 4IBOA 3IP3A 4KP7A 4BO5A 3WDSA 3M6IA 4PG6A 1J49A 1X14A 1PS8A 1CYDA 2J5KA 3G1TA 5TNXA 5FI3A 3L07A 4J9VA 5COBA 5FF9A 4DPLA 1NHWA 1YB5A 2X9NA 3GDFA 3QVTA 2H6EA 1X1TA 3JQCA 1UDAA 2HRZA 4IJKA 3FF4A 5GZ6A 1OC4A 5A9RA 1ULSA 5AXDA 4H16A 4RLSA 3GDGA 4FDAA 4J16A 4QT0A 4XR9A 4BGVA 1PZGA 3LT1A 5CDTA 2QW8A 2A4KA 3S2FA 1B16A 4IGEA 2YV1A 1PGOA 3F4LA 5G0WA 4ALJA 3OJEA 5AQ1A 2Q4EA 3IUPA 3HB4X 1CEQA 3BMOB 1DAPA 2J3HA 5DOVA 1LC0A 1NWHA 1UZLA 4E2XA 4HXYA 1Y6JA 4BUCA 4TMFA 1IL0A 1U5AA 4FBGA 4BO2A 5L3ZA 2ZYDA 3AOGA 4DMLA 3O4RA 1PS9A 1Z7EA 5DP2A 1Y9AA 3FWZA 1GV1A 4DL9A 1N92A 2A35A 3EZYA 3SLKA 4F45A 1QYWA 2W2LA 4R1SA 1NHGA 1E6UA 4FB5A 3V1TC 2EGHA 4L0QA 4L4SA 4TKLA 2VRCA 4FFMA 4J0FA 1U5CA 4I08A 1F0YA 5THKA 1M75A 1FMCA 1DIGA 1QR6A 4DIBA 3PFWO 5FFFA 1ISGA 1ZIDA 4J9UE 2VHVA 1HETA 1E7QA 3KYCA 3EY4A 4B3JA 3L0DA 4HWKA 1I3KA 1GD1O 2E82A 5KJ1A 1RM4A 1I3NA 1IPEA 3ZNPA 2OXIA 1WLYA 5CPBA 3E18A 1ZK0A 1IY8A 3RKUA 4U0JA 4JK3A 4OH1A 1LDMA 3JYNA 1NFFA 2C07A 3JD3A 1E92A 2Y1FA 4OXKA 3OQBA 3DXFA 4RZIA 3I9LA 3T4XA 2WDZA 3GG2A 1H5QA 1WDMA 5F1OA 4FGSA 3SX2A 1FXSA 3GGOA 4XGIA 4YRDA 2R00C 4JJIA 3RUHA 3WG9A 2I65A 3GH3A 1HLPA 3RC2A 4BMNA 3NTQA 3TZCA 1K89A 3ZNQA 1Q2XA 3F4BA 4TWRA 1HE4A 3MJ4A 5CP8A 1K6JA 3Q2KA 1Z6ZA 1YKFA 4NBRA 1CWUA 4FJ0A 4J4TA 4PN3A 4AJOA 3WFIA 3OEYA 1ZZEA 4AJEA 1NX6A 4UVDA 1SO8A 4BNMA 2E6UX 1KS9A 4XIJA 2PZMA 4YA6A 2Q46A 4BKRA 3ZU3A 1NQAO 5CDUA 2Y0EA 1E7RA 3L77A 1AE1A 1T26A 3GUYA 4CM9A 4R01A 2C54A 5I9LA 1JWAB 4EYEA 3A14A 2G17A 2HJRA 2YV2A 3G79A 1LU9A 3U5TA 4BNTA 4D0SA 4D43A 4XQ9A 2VYNA 5LCXA 1KBZA 3ROMA 1E6EA 4N5LA 4CR6A 3AUAA 1B3RA 2B36A 3GGPA 4E2YA 4PLZA 4OSPA 1XU9A 2EV9A 3RC7A 3V1YA 4AFNA 4J49A 3ON5A 4IJWA 1KEVA 1Y5MA 3BAZA 2H9IA 4YAIA 4PLPA 1GUFA 4GLLA 1K6XA 5DT9A 4EUHA 3OEWA 3VVCA 4EJMA 1O95A 1YL7A 1HRDA 3UN1A 2Q4BA 1GCOA 4L8VA 4PG4A 2EKLA 1A71A 5I8ZA 4IQ0A 4K9DA 1U1IA 2GPTA 3VH2A 3F1KA 2D4AA 1HL3A 4OL9A 3ROQA 3QV1A 4BO9A 1YE3A 3AFMA 4R9RA 4PG5A 4YQZA 2BRUA 4E31A 4XYBA 4CJXA 1I5RA 1ZFNA 2AEMA 4PLCA 4PLFA 1R12A 1ONPA 1JWBB 4BNFA 3L4BC 1DFIA 3HDQA 4NBWA 1C14A 4RL6A 3DAPA 3M2PA 1FF9A 3N58A 5TSDA 3PHGA 4YJFA 2JCVA 2Q1SA 3LC1O 1DSSG 4XQCA 3PYLA 1A4UA 1EDZA 4QEDA 9LDTA 3FTPA 1EK6A 3IP1A 4B4UA 1SCUA 3GMSA 3KXDA 4MVJE 2VHWA 2JCYA 4WASA 1PR3A 1ENYA 4CM1A 5B4VA 2Q1WA 3HB5X 3QWBA 4Q3BA 3TQHA 4CLXA 1CETA 3NT2A 3QSGA 1XLTA 2ZATA 3N74A 4NZ9A 2EKQA 5A3VA 1KY5A 3M2TA 4W7IA 4BO3A 5TJHA 3W1VA 3ASUA 3CZMA 1WW8A 4Z0PA 1SB9A 4RDHA 3PXXA 4Q3EA 1P1KA 1EUCA 1CIVA 2O3JA 4IDDA 1RYEA 2GASA 4ILKA 3JYOA 1DC3A 4M54A 1NXQA 3JYQA 4OO3A 3WB9A 4DPKA 4LSWA 1B8UA 1E3WA 4HX5A 1BG6A 2IXAA 1DHTA 3F1LA 2X9GA 1ADFA 4E21A 5JAIA 1VM6A 3HG7A 3KYDB 3GQVA 2JAPA 3GPIA 1SB8A 2G5CA 3DWFA 2EP7A 2ZJ0A 5BSFA 2HLPA 4XQEA 4XR4A 3WGGA 1NPTO 1CERA 4Q3NA 5DULA 2EW8A 2XOXA 5JBIA 5G0UA 4Z9FA 3GHYA 1PGQA 4ALIA 3JD4A 2QQ5A 5COAA 4CQMB 3VDQA 3ZWBA 4BMVA 3MOIA 3V8BA 5ITVA 1DO8A 1BXKA 3CE6A 3C85A 3E82A 1A7AA 1ADBA 3PVZA 3OIFA 3HE3A 4I5FA 1HYEA 1H6DA 4FJ2A 4J4HA 3U3XA 5C7OO 3S2EA 2C59A 2D0IA 2C5EA 4CQLB 3CPSA 4W9NA 5FEUA 4JQCA 4YT5A 8LDHA 3WJAA 4CLHA 1GPDG 1R66A 4W4TA 5KIAA 3V2GA 4J1NA 5F1KA 2PKQP 3GVIA 3AM3A 4HFNA 3EW7A 4C7JA 5C7IO 1Q0QA 4DTIA 1FK8A 4RVGA 5CPFA 2YDXA 2P4HX 2BH9A 5F1PA 2B5VA 2AQHA 4IIVA 4J90A 5JDIC 2VOJA 2YY7A 4OKNA 1Y1PA 1LRJA 2PNFA 3S2IA 1H0KA 4ITUA 1LBEA 2XAAA 4TZKA 4O63O 3JQDA 3U4HA 2PGJA 3Q2IA 3ANMA 2P9EA 3RJ5A 5BSEA 1O0SA 1EEHA 1HXHA 3ICCA 4CR8A 5HBRA 1P1JA 3E9MA 2EKPA 5J23A 3GN1A 5ES3A 1C0KA 3DDNA 4OGWA 3GAZA 5HS6A 3VAZA 3TL3A 2AQKA 2UYYA 3B70A 3ZV6A 2GSDA 2O3QA 3WLFA 1M67A 2NSDA 3D5TA 3AJRA 1VI2A 3JQ8A 5A03A 4BKOA 3VZQA 2IRWA 2AE1A 2A9FA 1VE9A 1I30A 4MVJP 1EE2A 3L6OO 4BNXA 3NEPX 3AY6A 5L7TA 1U8FO 2WEKA 3D3WB 5EL0A 8ADHA 5JC8A 3RUFA 3EVNA 2D3TA 5CHEA 1LDBA 3IJPA 5TT1A 4DIOA 3EYWA 4NK5A 1R0SA 2D59A 4JBHA 1HTBA 3WYEA 3QHAA 4XDYA 5K0ZA 4HUJA 5JO9A 5EMHA 3JQFC 4AL4A 4DMMA 1JQBA 5JFOA 5G4LA 1NQOA 4U8GA 2FRDA 3B1KA 5DDIP 1Q7GA 3HFSA 4GGPA 3SJUA 2JFGA 3PQEA 1U9JA 4RF3A 4B7UA 3LF1A 4GGOA 4K6CA 4CM8A 3SC6A 3UCXA 1P31A 3IIEA 1KVRA 2C0CA 3CZRA 3QVSA 4RF5A 1V3VA 3JQ6A 1LQUA 4IS3A 3TZHA 3I83A 4LRSB 1YB4A 3OA2A 1CQJA 5C7LO 1U3WA 5F5LA 5TGDA 1SZJG 3H8VA 3I4FA 2FPIA 2WJPA 5IDWA 5JCJA 1QLHA 2HMUA 3VPFA 4CV1A 1IZ0A 3JQAD 1U4OA 1OI7A 3FNFA 4YJHB 1TA4A 4OXNA 4IDFA 1C0LA 2O4UX 1BVUA 1B3BA 3OECA 3EGOA 4ZVVA 3ZHZA 1EQUA 1ZKMA 3ZZNA 3O8QA 3EVTA 4IJVA 4ALLA 3OF2A 3SBOA 4Z9XA 5A9TA 2ZQYA 4ALMA 4OHUA 2VHYA 4BB5A 1D7OA 1U28A 2CF5A 1ISJA 3TPCA 2VUTA 2FSVA 4Y9DA 4F6CA 4MJLA 2Z1NA 1DLIA 5A5FA 3K2EA 1DJNA 5U1PA 2X4GA 3Q0EA 1F8FA 1KEWA 5HS4A 5IDQA 1JAYA 2B4RO 2OZPA 3K73O 3BIOA 2NTVA 4U5QA 3FBGA 3NGXA 1N1EA 3NKLA 4JIGA 2Y93A 1CRWG 2ILTA 4D3SA 5BR7A 4J1QA 1YGYA 1T1RA 1PJ3A 3R3SA 1BGVA 3NTOA 1ZW1A 2B37A 2YHUA 4TKMA 1R4MB 4BO4A 4FD3A 5AOVA 2VRBA 4INAA 1XKQA 4RJTA 4GX0A 3I4CA 2AEFA 1LLCA 2BFPA 4YT8A 3PI7A 4JJGA 5I7SA 3AUTA 2Q99A 2BGKA 2R00A 4JP3A 2X58A 4YR9A 1JTVA 2NTNA 3QP9A 4BO6A 1DPGA 2VWHA 2ZB4A 1B8PA 5DF1A 4HFMA 3C8MA 2WYUA 4W6ZA 3H7AA 1D1TA 2PH3A 5CG2A 1P44A 2PH5A 1R15A 3QVXA 1GAEO 5K6AC 3AOEC 3EC7A 4BB6A 3UGKA 2X6TA 4UUPA 1ARZA 3RUEA 3Q11A 4XA8A 3HUDA 2WMDA 1Z7BA 4A7PA 2VT2A 3RC9A 3LT2A 4RF2A 3I3OA 4XGKA 3FSRA 2AQ8A 3ADPA 1EQ2A 1O9BA 3W8EA 3K8ZA 3KYDA 3U49A 4NFHA 4W7HA 4A26A 1ENZA 5CFZA 3WMXA 4RLHA 3HZZA 3WGYA 1E7YA 3VZPA 4IQ8A 1GQYA 1JN0A 1ZO8A 1ZK1A 3I9MA 2Y68A 3NYWA 3PQDA 2IE0A 3HHPA 4XCVA 4BQPA 4Y6PA 3T7CA 1X7GA 1PSDA 4EITA 4NHEA 2W4QA 2WSBA 3H65A 4M49A 3ZWXA 4HNGA 3R6DA 5JNLA 1HYGA 4J7CA 4D42A 1ZEJA 4TQGA 1NPYA 3PZRA 1SNYA 3E8XA 4DA9A 2W98A 4AJPA 2PWZA 1DOHA 3LZ6A 3SLGA 1YL6A 4FCCA 2YDYA 2QYSA 1FDWA 5G0SA 4L75A 4W9NC 1PJTA 1VL6A 4PRLA 4YJGB 3SXPA 2POQX 4QFCA 1A9YA 2PZJA 4UAGA 4IZIA 3GRPA 2HSDA 4HFRA 1IOLA 1QYVA 3WGOA 5G0TA 3HFGA 4EW6A 3MTGA 4XYEA 4Z0TA 3OMLA 3MJTA 4R5MA 2FZEA 3DZKA 3WYCA 4M8SA 1WMBA 4OM8A 4MVJH 1LEHA 4BGUA 3BYZA 2EW2A 4YAEA 5L4NA 2Y1GA 1KC1A 3A4VA 3PPIA 4YYZA 2Q50A 3GAFA 1F14A 3CINA 4NK4A 4NBTA 3LSYA 5F3RA 1A9ZA 2Q2QA 1U3VA 5EERA 2GCGA 4ND4A 4J0EA 3DFZA 4CLRB 4YTEA 3IJRA 4XX0A 3DHYA 4UVEA 4E33A 5JW6A 2NQ8A 4HV4A 3WYBA 2HKIA 4CUKA 2JAHA 3I9OA 1DIRA 3PYXA 4YWJA 1G1AA 4BNYA 3OQ1A 5JC1A 3NT5A 4BNJA 2P5UA 3KYBA 3AI3A 2GN9A 1YWGO 2ET6A 4GX2A 4R9SA 4E32A 4D7AA 4QTZA 1PZEA 1M76A 4AJKA 5BT9A 5I9MA 1XWFA 1VKNA 3LLVA 4XYMA 1EBFA 3U62A 2J3KA 4DBZA 2NVBA 2AQIA 1LC3A 1F06A 3ULKA 3K30A 4XGNA 4K28A 3UICA 3WIEA 3ASVA 1E3JA 4C7KA 5L9AA 1E3WB 3D3WA 3U0BA 3GFGA 4B8WA 1Z45A 4JLWA 1RM3A 2X5JO 4LVUA 2VHXA 4KUGA 1PWXA 3FCOA 4XRRA 1X0XA 2I3GA 5IDXA 4GSKA 1HDGO 5LC1A 1GEEA 1P1FA 2X5OA 1NVGA 3VTZA 4B4VA 2B4QA 2E4AA 2RBEA 5DCYA 2UDPA 3DMTC 1E5QA 1OOEA 3IOYA 3UVEA 5A3JA 4CR7A 2ZJ1A 1LLQA 3OA0A 4EEZA 1VL8A 5JS6A 4E5NA 2UAGA 3PYMA 4NI5A 1EE9A 2FY8A 4PLGA 4XB2A 4IDEA 7ADHA 1LQTA 3FBTA 4FIZA 3PDJA 2AHRA 1SPXA 1WZIA 1WDKA 2QYTA 4UEOA 2VTDA 2HRBA 2B69A 4MKXA 4R3WA 4R16A 3R1IA 1W8DA 4U0KA 2ZTMA 4H15A 4XKJA 1GUZA 1RKXA 3DR3A 4YJHA 1MB4A 2C2YA 1X13A 2DLDA 2HQ1A 3WICA 4G2NA 4B3IA 1NR7A 3DTYA 4WCFC 1A5ZA 4MVJA 4WCDA 4RVUA 2GN4A 3STHA 3LQFA 3AY7A 2HCTA 3PK0A 5GZ1A 4MKRA 5MGBA 4MP3A 5U9CA 9LDBA 4R54A 1Q0LA 1SEVA 4WUVA 3FR7A 1PQUA 2X0RA 3H3FA 1CDOA 3RC1A 3ZW8A 3BMNB 1PJCA 4A10A 3QWFA 4GKBA 3JYLA 4HFJA 3ANLA 3QWHA 2AXQA 3JV7A 5ER9A 1N7GA 5JDIA 1NFRA 5FI5A 4ALNA 1Q1NA 2UV8A 4YEDA 4LW8A 4CMJA 2FPPA 2DUUA 2W8ZA 5L4SA 3NDRA 3RUCA 3WR5A 1J5PA 4YXFA 1EVIA 2AG5A 1DHRA 2EIHA 3MCVA 3VPHA 3I23A 4RORA 1PR9A 4OAQA 4B7CA 4DREA 4Y67A 4FOSA 2Y0CA 3AFNA 1JDJA 3JQ8B 3DOOA 4NR0A 5C37A 5IDYA 1I10A 1D8AA 2VYVA 3I6IA 1R4MA 1O94A 3K9QO 1ZMTA 3F46A 3L9XA 4F6LA 3A1NA 5EQFA 3VC7A 4ZRNA 4CMEC 3ADOA 3OJLA 3ZWAA 2PZLA 2JHFA 4MDHA 4BIIA 3OJ0A 1XEAA 2X86A 4OQZA 3WNVA 3GVXA 3CXRA 4RPLA 5I9NA 3CIFA 2PLAA 4WNIA 4B3HA 5K1SA 4B7XA 4MIYA 1LTHR 4RCVA 3GZNB 4Y6SA 5JO0A 2CVQA 1R0KA 4WLNA 5TQVA 3WIDA 4O6VA 3VZRA 3DL2A 1HZZA 3KB6A 1J6UA 3VKVA 3PDUA 2NTJA 4DQXA 5JY1A 4OOEA 2GNAA 1ZMOA 1I2ZA 3HDYA 3JQFA 4IXWA 2FP4A 2FOIA 1UJMA 3ZU2A 4EUEA 4CM8B 1HKUA 2AEJA 1YQDA 1TB4A 2OHXA 3WNQA 3HQ4O 4AJIA 3CSDA 2NLOA 3RWBA 3LT4A 2JKVA 4AJ2A 5BNIA 3D7LA 4XDZA 1NNUA 1JKJA 2BELA 3AU8A 2YZ7A 3TOXA 3G3EA 3FNEA 4JROA 4UEJA 3IL2A 3ZV4A 3WTBA 3ZH2A 3VPSA 1NTOA 2IZZA 3E9NA 2OFPA 3HSKA 4P38A 4D79A 3HDJA 3DZGA 2Q3EA 4XZ3A 2WE8A 1LDYA 4BGEA 3OQ6A 1LXCA 4Q3CA 3ETEA 1Y8QB 1T4DA 3O8QB 4WCFB 2DVMA 2GLXA 3P19A 5EJ2A 5JYEA 3RFTA 5T8KC 4LCEA 3ORFA 4F3YA 4ND5A 4XJSA 1YBAA 3ZHXA 3RASA 3ZWVA 1QYDA 3RU7A 4HADA 5ILOA 1RM5A 1YVEI 4ND1A 4QO8A 3RFXA 2CMDA 5KKCA 1NR1A 2NU8A 1GU7A 3LC2O 1BDBA 3QJ5A 3WFJA 4FFOA 1T24A 4AICA 3C7CB 4XQGA 4CM4B 4RVFA 1MC4A 4XEHA 4YJGA 3G1UA 3BTOA 2E48A 3R3JA 4O0LA 5JDCC 2OUIA 3ROKA 3WSVA 1NWCA 3DZJA 4I5EA 4ESOA 3TDKA 1E1LA 3W6UA 2GF2A 1P1HA 3F5QA 3C7AA 3HN2A 1O6ZA 5HM8A 2NU9A 3WQSB 2F1KA 1J4AA 2Q2WA 1B0AA 4IIUA 2DBVO 3RVDA 2NU7A 1FDVA 3GFBA 4NDNE 3Q6IA 4BNWA 2TMDA 2HDHA 1OC2A 5DOZA 1DIAA 4N7RA 2JL1A 1AUPA 1YQXA 3BHIA 4IJUA 3PFFA 4OYRA 1CF2O 3A9WA 4JCOA 3A06A 2DPHA 5JSFA 1QYXA 1N8KA 3OM9A 1I01A 1VJ1A 4NIMA 3IMFA 5DCUA 3RAJA 4MINA 3EAGA 2O7QA 4TROA 4CLRA 3DZBA 1H2HA 1V3TA 3INGA 4KOAA 2QHXA 2C7VA 3BA1A 4LMPA 1DAOA 1R37A 2B35A 4ZU3A 1LDNA 2ZKLA 4BMSA 1KVSA 3OP4A 3WBBA 3X2EA 2Z5LA 2DT5A 2PZKA 2EJVA 1XU7A 4E13A 4FFLA 4RPJA 3KSDO 4OSOA 4I9NA 1SAYA 4FFPA 5A4DA 4YRBA 3D4PA 3JQGB 1BW9B 4ND2A 5K6AA 3AOEA 2B83A 1P3DA 4CPDA 1E7MA 1YBMA 1PU2A 2ZB3A 1H93A 1N7HA 1U7TA 3DBHB 3H9JA 1E3IA 3MOGA 1TT7A 2PD6A 3UKOA 4MVJG 3JCZA 4BO7A 1C3VA 3DOCA 1Y5RA 5A9SA 3ONEA 4TSKA 2ZYAA 1BRMA 4L4XA 1JKFA 4UUOA 4WNCA 4I5GA 1EZ4A 2QZ9A 4A27A 2H5LA 3ZI0A 1V8BA 1DRWA 3OH8A 1BMDA 2XPCA 4ROSA 5FWNA 1LLDA 5DP1A 2P5YA 2X0IA 1KVQA 4MO2A 1LNQA 1JVSA 1EBUA 2ZTVA 1Y81A 4G65A 4DQVA 3RKRA 4BNLA 2FN7A 3RBZA 3B1JA 4PIVA 1N1GA 1RYDA 4BL5A 1CJCA 3H9GA 5A05A 1ZSVA 1IPFA 5KTKA 3L6EA 1LSSA 2WYWA 1UP4A 2BI8A 4BV8A 1D3AA 3RSHA 1JLLA 1PGJA 4DQUA 4G5HA 1DXYA 1DB3A 3FI9A 2OORA 5F5NA 1MG5A 1UAGA 1P1IA 1QYCA 2YQ4A 1I2CA 1GZ3A 1Z82A 2VN8A 3HDHA 2YHIA 2D5CA 4RPHA 1HF3A 3UOGA 2VWPA 2PY6A 4KQWA 2Y1DA 1O5IA 3U4IA 1I32A 2X9VA 4UEKA 1ZK3A 4MIOA 5JAZA 1GYPA 3ABIA 1DIHA 4FJ1A 3ZWWA 1W4ZA 4J4BA 3GVPA 4R68A 3BMNA 5AXCA 5KCZA 4WEQA 5L7YA 5U4QA 1KC3A 2BF7A 4CUJA 1LUAA 1I0ZA 1ADCA 4TVBA 4WOJA 4J2OA 4DC0A 2QIOA 4OMUA 1NAHA 3KSZO 3PHHA 2FSSA 2WD8A 3DMYA 3ZDFA 4JNKA 3ZHYA 2YYYA 1S7CA 2VNAA 2X0NA 3AK4A 1U7HA 1VSVA 3H5NA 1ZJZA 2C5AA 3RUAA 4II3A 3C7DB 4ZQEA 2DFDA 4NFYA 3PJFA 4R1UA 1V6AA 1I3LA 2J3IA 3GR6A 2RCYA 3PTZA 3ZWPA 2J3JA 4CV0A 3KVOA 2ZYGA 4P8RA 5A06A 1ENPA 1MUUA 2BLLA 4ZD6A 1TVEA 2EP5A 3MJEA 4M89A 4YJDA 1GCUA 2WD7B 1C0PA 4CL3A 4BNUA 3GVCA 1ULUA 2VQ3A 3ETGA 4QUKA 4BO8A 2GD1O 4IM7A 3PQFA 4D44A 3VH4A 2PA3A 1IYZA 3D5QA 4Z9YA 5T5QA 4EGFA 4UUMA 5KVSA 3GY0A 1PJ2A 3CMMA 4DLLA 1Q0HA 3UF0A 2GZ3A 3DZFA 1MFZA 2Y66A 1M6WA 3NTRA 3PIIA 2HMSA 3GZNA 5AXAA 3VH3A 3HNPA 4LSMA 4LGVA 2GN6A 2FMUA 1G0NA 1UAYA 3D4NA 3QQPA 1Q7CA 4YBZA 4QO7A 3TZ6A 1DRUA 1GR0A 1P1RA 4EI2A 1L7EA 4Q3DA 1IB6A 3A28A 3MTJA 4BNHA 3DMTA 1HZJA 4B4OA 3COSA 2EG9A 4YAJA 4PG8A 3Q9NA 1TXGA 3UFXA 3PGXA 5IF3A 3DBLA 2V65A 4IXTA 1ISMA 6ADHA 2V6FA 1BXZA 5ICSA 3K92A 3AM4A 5IG2A 3ROPA 3WJ7A 1P0CA 4IDGA 4UVGA 3ETDA 4IPTA 4E5PA 2E37A 4KTTE 1UXIA 2VWQA 4K1LA 5CEJA 4N5NA 4WE3A 3UAGA 2O50A 1VJ0A 1GEGA 2DUWA 3I9KA 3MJSA 4MPDA 3HADA 1ZBQA 3RFVA 3W8FA 3I1JA 1PJQA 1AHHA 1B14A 1Y8QA 4JBGA 4YT2A 4IGFA 4WCFA 5DN9A 1DC5A 4QQRA 2X1HA 1GQ2A 1E0DA 3DB2A 4DGSA 2BKAA 3EZLA 2W2KB 1QG6A 4BS9A 3AWDA 2R2GA 4PZEA 3KZVA 4CMBA 4CLEA 1KETA 4MVJF 4RO0A 3VPGA 4NU5A 3L6DA 4GX1A 3KRTA 1PJSA 2RHRA 3TN7A 4DVJA 2CDCA 3PP8A 4CQMD 1EDOA 2I3AA 1YBVA 1H2BA 3U9LA 1L1FA 1KYQA 4J2HA 1PGNA 1EK5A 3QRWA 1IZ9A 3MZ0A 1UXJA 3WGQA 1ZNQO 3MJCA 4CM4A 3H9UA 2IZ1A 2O23A 4I8XA 1NYTA 4UULA 4J91A 3LK7A 4OQYA 3K96A 5ER6A 3D4OA 2VOEA 1R6DA 3EHEA 3I5MA 1QXSA 1OAAA 1P33A 2VT3A 4X54A 5T57A 2A92A 3TZKA 4RZHA 2O2SA 2VWGA 5JY6A 1YONA 2C82A 3TSCA 5GZ3A 3CUKA 1D1SA 2D1YA 3I9JA 3I52A 1L7DA 3WXBA 2BD0A 2D8AA 2GN8A 3P2YA 3PWZA 3UCEA 5ADHA 2HJSA 1E3EA 1VLLA 2FZWA 2LDXA 3WX0A 2I67A 3NAQA 1HDZA 1K2WA 3IUSA 3LU1A 1F8GA 2Y1OA 2CVOA 1IUKA 4CMEA 1DC4A 4D0RA 2VTEA 3PWSA 3WSWA 1LRLA 3SVTA 1BWSA 1M66A 2RAFA 3PLRA 2CDAA 4FPXA 3OIGA 4DRYA 1MP0A 1O89A 1A7KA 1X0VA 4NMHA 2NVWA 2ZB8A 1WNTA 1VKOA 3IDSA 3U4DA 4DC1A 4P4LA 1B7GO 1QKIA 5L51A 4ALKA 2HK9A 1GPJA 1Y8RB 3KSUA 4DIFA 1ZXLA 2NUAA 5TX7A 2RH4A 1U2GA 4MIEA 4TRRA 1HDYA 1HEUA 3JQGA 5KWEA 3ZW9A 1V35A 3AUSA 5AXBA 3BMQB 1M6HA 1BW9A 1EVZA 2VZ0A 2YW9A 3KM0A 1PJLA 2X7HA 2YFHA 4TZTA 1WZEA 5CDSA 3FNGA 3JD2A 3DBHA 3U09A 1GYRA 5IJZA 5L7WA 1ADGA 4FC7A 3ST7A 3AUUA 4IQGA 4NBVA 4BNKA 3JTMA 5TRTA 4XRGA 3T4EA 4ID9A 5A5EA 2I99A 1PTJA 1SOWA 1T1SA 2ZTLA 3IKVA 1G0OA 3JD0A 5T64A 3NGLA 3ITKA 2HO5A 4BO0A 1JVBA 1A4IA 1KVUA 1YB1A 3JQAA 4W99A 1I33A 1QV7A 2WTBA 3DAFA 3EMKA 2VZ9A 3PJEA 3GT0A 5I8WA 4N5MA 2Q1UA 4DLBA 3WGIA 2IZ0A 4M86A 3UHAA 4PLHA 4URFA 5DBIA 3OIDA 3FRJA 3H9EO 4DBVO 2D5AA 3C1AA 3CEAA 1EFLA 4IZHA 3UH1A 5T8KA 4II2A 1H6AA 2OL4A 3OJOA 3IKTA 3O38A 4NNJA 4L9RA 4PVDA 4XWYA 3GHHA 4WPGA 4GWKA 3WGZA 4M55A 4H7PA 4M1QA 1GL3A 2DKNA 2OGUA 4UREA 1W73A 2PV7A 3T7EA 1BHSA 1XR3A 2AA3A 2FWMX 4E5MA 5ENVA 3C3XA 3JQEA 4IY1A 1I3MA 3ZU4A 3GG9A 2QRLA 3PJGA 5JDCA 4KDFA 3HWRA 5EPOA 3UW3A 3H4VA 1PL6A 1A72A 4CLOB 3KLMX 3WGHA 4EZBA 2G76A 4TRMA 3GEGA 3JQBC 3L4SO 4A73A 2O3TA 2W2LD 4O5OA 4BNGA 3W6ZA 4CM6A 3RI3A 4E0BA 5KVQA 2YQ5A 1ENOA 4RVSA 3W4JA 1I36A 1NP3A 2VRCD 4FW8A 4ZHSA 1AN9A 4S1VA 5KNLA 1WMAA 3RU9A 2ZTUA 3FWNA 2O3UA 3GMDA 1HLDA 2YJZA 1GY8A 4YCAA 4CODB 1CQIA 3UXYA 2CD9A 4GVLA 1R16A 1TT5B 2XF8A 1LSOA 1HDCA 3KUXA 2Y05A 3NV9A 4BKUA 3PRJA 4Q9NA 1HSZA 3GN2A 5I7FA 3ZN2A 4R51A 3AM5A 1MG0A 4HY3A 5T67A 3P5SA 2GERA 3IQDB 3C1TA 1P0FA 4RQTA 3UCFA 4RPKA 3GNTA 1K0UA 4DYVA 3F47A 2VUUA 2DTDA 2WD7A 4CLDA 4BGIA 2SCUA 2Y1CA 3PJDA 3IAHA 2AE2A 5AYVA 2RIRA 2NACA 2XXBA 2R6JA 4D46A 2DBZA 1EUDA 3F9IA 3VHRA 1DFGA 2DM6A 1ML3A 1UDBA 2P9GA 4IDBA 4R1TA 2O3RA 4GSLA 4NH4A 4RVHA 4IMPA 1C0IA 5A9SB 1E77A 4FFNA 4GAEA 3B1FA 4YPOA 1Z74A 4J1SA 3WTCA 1XQ6A 3MWEB 3WQRA 5TJ9A 4PZCA 2CF6A 2IYPA 3H5RA 3MWDB 2YV3A 2IDZA 4DXHA 3ZHBA 1H6CA 3BTSA 4CMHA 3WMWA 1LRKA 1N9GB 4GX5A 4P22A 4U6SA 3TRIA 4QECA 1GYQA 2AW5A 1VJTA 4IS2A 4ZICA 4D41A 3ZWOA 4N54A 3H2ZA 3ZWMA 1H6BA 5IXSA 2DBRA 1YDEA 3S1LA 1QORA 4WK6A 4CM9D 2O7SA 4J3FA 3DHNA 3OHSX 1P77A 4FGWA 5K9ZA 4MP8A 2OO5A 3C1OA 2VYND 4UVHA 1ZH8A 4LVCA 2YHIB 3RJ9A 1GQQA 3VOSA 3V5NA 1FDTA 2GR9A 3GVHA 3D1LA 1NFQA 2W2KA 1HDXA 3SJ7A 1GV0A 5JAQA 1X1EA 1E1MA 4E12A 3S8MA 1LDGA 1T2AA 4WKGA 4R5HA 4ZRMA 4EJ0A 1BSVA 2Q45A 1HDOA 3B20A 4KWHA 3LF2A 3E5RA 3P2OA 3I6QA 3KLPX 2W90A 3O9ZA 3IC5A 4AJNA 3H6KA 4EEXA 1VRWA 2CUKA 3ONDA 3PHIA 3PGJA 5IXYA 2JHGA 3KTDA 3BTUA 2EWMA 4OXYA 1MFPA 2P9CA 4OKIA 1JA9A 5B4UA 3RUIA 2DTXA 5LDHA 1F12A 3E48A 3QW2A 1AHIA 4I9UA 1F17A 4J7XA 2JD1A 1X7DA 4AJHA 4TRNA 4AVYA 2AG8A 4AG3A 2X5KO 2FPGA 4PGFA 3AI2A 1AGNA 2VUSA 3RROA 4BVAA 2JCXA 1E6WA 4D45A 3KBOA 1R4NB 3K5PA 5HTOA 2O4CA 1UXHA 4HP8A 4D3FA 5DNAA 3VVBA 5H82A 2DQ4A 3ZCXA 2B4TO 4ZQBA 2EF1A 1V0JA 4CM7A 1MA0A 3W8DA 1PGPA 4OIMA 4DPMA 1EVYA 2EJWA 3GZ4A 5ICMA 3RQSA 3N7UA 4EBFA 3DOJA 1DEHA 5EESA 5JMPA 3MEQA 2VHZA 3SC4A 1TLTA 3KOUA 2HMTA 2EGGA 1J0XO 1Y8RA 3GNQA 3TFQA 5ITWA 1X7HA 3TF5A 4GQAA 5BSHA 2PFGA 2GO1A 4U7WA 3BMQA 3DBLB 4IINA 4MOWA 5FYDA 3RBVA 3DEYX 2GZ1A 2C20A 4AJ1A 2QX7A 5KVVA 1YOVB 4EUFA 1NAIA 4YACA 1U8XX 4JBIA 1EVJA 5TS3A 3ZU5A 3NT4A 4CMGA 5IAAA 3RIHA 5A1TA 1YJ8A 3O03A 1G6KA 2OOSA 2PGDA 3F3SA 2ZCUA 1XQ1A 2QRJA 2WE7A 4YDRA 3U4CA 2VCYA 1HE3A 3BZUA 4CMCA 5IN5A 3E6AA 7MDHA 1XYGA 4JX8A 4YVFA 4NFSA 3RCBA 2GUGA 5TC4A 4KTVE 3H3JA 2ZIZA 5G0VA 2CVZA 3JD1A 4ZQHA 5JXWA 3WGTA 2I76A 2PKRA 3E1KA 2AMFA 5IZCC 3G49A 5HA5A 3P7MA 1QLJA 4G81A 1LA2A 4ND3A 1LLUA 1DC6A 1SOVA 4NG5A 3W4KA 4HNHA 1B2LA 4B8ZA 1E1NA 1P9LA 3AY3A 3NJ4A 4CMIA 4XJTA 2YUTA 3BMCA 5TLSA 4S3MA 4JJFA 1HT0A 3BTVA 3HJAA 4CUZA 3EDMA 3PLNA 2IEBA 3ITDA 1ZSNA 1C1XB 3GPDG 3LDHA 3JSAA 1H9BA 1T2CA 2UVDA 5IN4A 4P4NA 2J5RA 1DDOA 2PK3A 2PR2A 5B4TA 2IODA 1H9AA 5CEFA 4R3NA 3KEOA 4LCJA 4WLOA 1E3SA 3GOHA 3S55A 4IDAA 3GDOA 1XCBA 5HRUA 2RH8A 3D0OA 3TFOA 4CLOA 1PX0A 1ISIA 1GZ6A 2I66A 4Y8VA 5B37A 2G0TA 3S2GA 2DPGA 5JAMA 3OICA 1VSUA 5THQA 1AXEA 1UR5A 2QZZA 4R1NA 2Y0DA 3EUWA 5C3MA 2Q2VA 4NJMA 4PLYA 1R0LA 1HE2A 5ENDA 4U6QA 5I7VA 1HWYA 5H81A 1QSGA 1Y9EA 3QY9A 3JQ7A 2BFOA 2HMVA 3ONFA 4O59O 1T25A 2RHCA 4YRAA 1ONOA 4QXMA 1FDSA 4TVOA 1E7SA 2DAPA 5AVOA 1TT5A 3DBVO 3V1UA 1HSOA 4KQXA 3QA9A 1M2WA 4BNNA 1TI7A 3TOZA 4QFDA 1VL0A 1PQPA 1XGKA 5G4KB 1ID1A 2CY0A 2G82A 2O2YA 4WLUA 2V6GA 2ZQZA 3Q1LA 1B15A 1BXGA 1FDUA 4GPD1 2HAEA 4I1IA 1XELA 3DBRB 4FOOA 4JP2A 2HK7A 1C1DB 4Z3KA 3PHLA 2I5PO 1FJHA 3DHEA 1T4BA 1GADO 4NU6A 1PWZA 2GGSA 3WLEA 1IE3A 2JFFA 3KV3O 4NQZA 5EQDA 1PQWA 5B1YA 3JQ9C 2DC1A 2OP1A 4LRTB 4C4OA 1DBVO 2OBYA 3WWZA 4WLFA 2JD0A 2Q49A 5A04A 1KERA 5BNFA 4GLOA 3JQAB 3OBBA 4PG7A 5C5IA 3WOHA 5TIIA 4MP6A 3LT0A 3PWKA 1A27A 1V3UA 2X0JA 5G2OA 3K6JA 4E5YA 4K6FA 2NM0A 2H63A 1HDRA 4ZA2A 3V2UA 2XXJA 2H1SA 1SEPA 4MVJM 5KKAA 1VPDA 3H9QA 4MKZA 3VPXA 4L74A 4DUPA 3CMCO 1N9GA 2O48X 3Q9UA 1PIWA 3QIVA 1UXGA 1KVTA 4RGBA 5L95A 2GZ2A 2TMGA 3NDJA 4E2ZA 1I24A 1U4SA 2HMWA 3LC7O 1MXFA 3INTA 4XB1A 2Z95A 1WWKA 3RD5A 3GEMA 2Y67A 3ENNA 1HYHA 1O8CA 4GVXA 3WS7A 5JCJD 4BO1A 3BHMA 4CL8A 2CSUA 1UDCA 2G1UA 4ONEA 1DFHA 3BMOA 1W6UA 4TRJA 3DZIA 1S6YA 4UVIA 3INRA 4EDFA 4QX6A 3QVOA 3VTFA 4LISA 2B0JA 1B8VA 4GL4A 4NPCA 3JQBA 1GDHA 3OJFA 4FN4A 2E49A 3ZV5A 1W0CA 5CAEA 3EK2A 1NM5A 4B4WA 1NASA 2HK8A 2NV6A 3OETA 4KDEA 4BOYA 3SEFA 3DQPA 1GFSA 4CV3A 2O3SA 2C7GA 4GH5A 2Q1TA 3F5SA 3JYPA 4WJZA 3ZNOA 1K5HA 4J7UA 3QWIA 3OSUA 1PZFA 4Q3AA 1QMGA 1BTOA 4PLWA 2GDZA 3GNSA 5DCWA 4ZN6A 3OFSA 2PTGA 5DZSA 3CH6A 1I2BA 2OP0A 2QRKA 2ZCVA 3ANNA 1KOLA 1UP6A 3H2SA 1JKIA 3HN7A 4IDCA 4AJLA 1XHLA 4GKVA 1R4NA 2NVUB 4A5OA 1YO6A 1WPQA 3ICPA 1ONNA 4Z0HO 2BHLA 4L76A 4NBUA 4ZQGA 1UZMA 2J6IA 1ZK4A 2UUOA 3ZWNA 2P4QA 3DFUA 1EUZA 4E4YA 3GRKA 1P45A 4XYLA 3FD8A 4DYDA 3GLQA 4J43A 1KY4A 1WVGA 3Q3CA 4E3ZA 4AJ4A 3QLJA 5GMOA 3VDRA 4FR5A 5JCXA 3GA0A 4WLVA 5LDGA 4RVDA 1NBOA 3FR8A 3WWYA 2JJYA 3WBFA 1U2DA 4FQ8A 5BNTA 3RBXA 4RPGA 4PLTA 3F6YA 1E1KA 1DLJA 2GRAA 5TF4A 1YS4A 5BQFA 2DU8A 1MXHA 4CMAA 1PZHA 4PZDA 4AJJA 1ZVMA 3C24A 2DTEA 1AXGA 2IXBA 1YJQA 4UUNA 1LSUA 1PL8A 2DFVA 4N18A 4D3DA 3E03A 3DO5A 2NADA 4LMRA 1UP7A 1B26A 1PL7A 1SMKA 1YOVA 2BGMA 4XYGA 3E5MA 3FNHA 1KIFA 4Y98A 1RM0A 4BNIA 1RWBA 4FSHA 3AU9A 3NUGA 1GUYA 1EMDA 1WDLA 1RPNA 4JN6B 4WECA 5F21A 5JPIA 5L45A 3TNLA 3BHJA 4GI2A 3IS3A 3PEFA 3TL2A 4GWGA 1XDWA 4BKQA 2F00A 1RJWA 3PIDA 4FC6A 1IHYA 1QP8A 4FS3A 1WAMA 1DIBA 4KZPA 4DLAA 5KOIA 4A0SA 2Y1EA 3CKYA 4NJOA 3M1AA 5L53A 2FR8A 2P2SA 2QG4A 2CZCA 3DZHA 2B5WA 2NQTA 3V2HA 4ZJUA 1SC6A 1LJ8A 3R0IA 2J8ZA 5JYDA 2NWQA 4P4GA 3GUCA 4J6FA 3VKUA 3O26A 3GEDA 1N2SA 2A94A 4PVCA 3GK3A 4LK3A 6LDHA 4PCVA 1N5DA 2C2XA 3H5AA 1C1XA 1JU9A 1NPDA 2WM3A 4CMKA 4R69A 3K31A 4PFJA 1U3TA 2EEZA 1EFKA 3FHLA 4CV2A 4E5KA 5KJFA 4OJNA 4PRKA 3UUWA 1UXKA 1NVTA 3CTMA 3GF4A 1Y7TA 2D2IA 1XSEA 1ZEMA 1GTMA 1YDWA 4R4JA 1PJBA 3G0OA 3KYCB 2IEDA 1OZAA 3GC6A 4E30A 1BVRA 5H83A 3QVWA 4H3VA 3NX4A 5T6BA 4Z6KA 1QV6A 1YH3A 3BXXA 3FPCA 4J1TA 4KWIA 3KEQA 3QE3A 1K6IA 3KHUA 4CM3A 4YAGA 2P91A 3FTNA 4GMGA 2PD4A 1ZJYA 3QWAA 4I9HA 4KMSA 4JXKA 3X2FA 1XA0A 3D64A 1NVMB 3K2BA 5IFLA 3L9WA 1YQGA 5KVCA 5EINA 4IMRA 1NQ5A 4HKTA 2P68A 3FPLA 2NNLD 1ZUD1 5JMWA 5G4KA 2Z1MA 1TEHA 2WWRA 1Q7BA 3RUDA 3DONA 4F46A 2VNSA 4A2CA 4JGBA 5HWSA 4HBGA 1KEPA 5CDGA 4BNZA 4I5DA 3LYLA 4M87A 4XIYA 3DBRA 3WQQA 1C1DA 3KO8A 4IUYA 5EN4A 1Z73A 3ZGYA 3AW9A 4E6PA 1E3LA 4GBJA 1Z75A 3ZNNA 4BNVA 1JAXA 5TT0A 1PS0A 2EERA 4QSMA 5IZ4A 1T2EA 1MC5A 5CDYA 5L4LA 1E7WA 2ZB7A 4RDIA 2OBNA 1OBFO 1UZNA 3FN4A 2JFHA 1ZCJA 2X23A 5KJ6A 5DBGA 4W82A 5EIOA 3VZSA 4BKPA 4YT4A 5MDHA 4YB8A 1ZSYA 5CEEA 4B79A 5A02A 3D3EA 3G17A 1PEDA 4PLVA 1LSJA 1JW9B 2BI7A 2IYOA 1P74A 2CNBA 1DJQA 4RV9A 4ZQFA 5IZCA 4CMIB 4WEOA 3BMCB 1ZK2A 1V9LA 4RQUA 2BFAA 3PZBA 3TWOA 5B12A 4BQRA 1QRRA 1IHXA 4KUHA 1IULA 3AI1A 4L73A 5BSGA 2PKQO 4OOFA 1YRLA 4MVJI 2PGLA 2BGLA 1XG5A 4CQMA 3TJRA 2CFCA 1UUFA 2FR0A 4GMFA 1SBYA 2I6TA 4ZGWA 5JLAA 5JE8A 3VH1A 3GGGA 1ORRA 3DC2A 2V7PA 4WLEA 5ILGA 4Y6RA 1GZ4A 4BHTA 3M1LA 3TZQA 2FHSA 1PJ4A 1T2FA 2CDBA 2EHDA 1YL5A 2OMEA 4YAKA 4MVJD 1WXDA 2Y99A 1BDMA 1H94A 4Q39A 4DWVA 1ISHA 4NJMB 1MGOA 3NJ8A 4CQLA 4YQYA 3LVFO 5KJEA 1MLDA 1X15A 1I8TA 4XD2A 3ZV3A 3DTTA 3E9QA 4FFRA 4R41A 4CM5A 2X8LA 5DBFA 3ZWCA 3JQ7B 3DAGA 3NRCA 3L4BA 3MJVA 2BFMA 2V6MA 2J5QA 4YJFB 1D4FA 2UUPA 2YFQA 3KETA 5KJCA 2GYYA 4K26A 2NU6A 1KEUA 1XIVA 2X22A 2C29D 4KUEA 1VC2A 1LX6A 4Z3DA 1OFGA 2HU2A 2ZK7A 1MX3A 2PD3A 1U3UA 1K3TA 1YXMA 5I7EA 1WP4A 2NVUA 4E2WA 3I9NA 4L4RA 1MV8A 3LLSA 4WGGA 1BXGB 2WYVA 2VZ8A 1OMOA 2V6BA 5GY7A 3ZWYA 2BMAA 1ISFA 3NDIA 2JD2A 4RF4A 4A03A 3PHJA 2FR1A 1T2DA 2VYVD 2I9PA 5CG1A 3B6ZA 1HE5A 3W4IA
chains in the Genus database with same CATH superfamily
2EXXA 1HG0A 5JARA 2J09A 1JDBB 3BB4A 4BV9A 2HD4A 4EJ6A 2ECFA 3TW4A 1I2DA 1UH5A 1ACLA 2GEBA 4HYYA 3TXYA 4AYTA 5COQA 3GW8A 1NQTA 2QIPA 3D8TA 4Z8XA 4HUQA 3IUBA 4OLFA 2WSIA 4UTNA 3IDAA 1Z7GA 2PUTA 2YMLA 4MI3A 3IP3A 4KP7A 1ZD3A 3FNRA 3H5LA 1R5BA 3WDSA 3FCAA 1FJ2A 3RKSA 1GFIA 1T1JA 1O0CA 2N42A 4PG6A 5IBRA 1J49A 4MAFA 1WPXA 1X14A 4RGVA 1PS8A 3IP5A 2DSNA 2R44A 2J5KA 4QGHA 2JGMA 3L07A 5COBA 4MVWA 5D3MA 5SZKB 2QRGA 3T61A 1VA4A 1U2PA 2X9LA 3FCUB 5JBQA 1U63A 4PYKA 4TV9B 2DKFA 2F67A 4G0OA 3L5KA 5EKSA 1X1TA 4D9BA 3V6MA 3OQNA 3CX6A 2FZVA 5E4JA 1UKCA 3VYUB 3KQWA 5IS2A 2IY9A 2HRZA 3MELA 1QNLA 2AOUA 5FWAA 4CKBB 5KOJB 5BSTA 5K7SA 3GDGA 3RTBA 4LZJA 1YCGA 4KN5A 2QW8A 1FYEA 1IAQA 4FHCA 3S2FA 4J2TA 4UNQA 4AXXA 4M6WA 4V39A 3F4LA 1NJ5A 5G0WA 1R6TA 1L5FA 4H1UA 3ZGXA 2PT5A 3QUTA 1I3CA 2RHWA 2Q4EA 1EFRD 2ZWMA 3CEJA 2V54A 5DNYB 1CEQA 1WCXA 4X94A 3AZQA 3LXRA 1SKQA 3O1HB 2WTUA 3AIOA 4I2VA 1EAMA 4ZXPA 5TR9A 5LYJF 1E89A 1QH8B 1Y7HA 4LXQA 1RWNA 1T6YA 3SAJA 1D4AA 2OD2A 3PTLA 4BLRA 4BO2A 2C4WA 2XHEA 4F4HA 3AVTA 2O5RA 2J07A 2ORYA 1DBSA 2ONCA 1AC5A 3LP8A 4LTMA 3AOGA 4ZDKA 4A8JC 3O4RA 4PBRA 1NG9A 3A2KA 1O77A 1XTTA 3DEIA 5D7BA 1ODJA 2ZJ2A 4URHA 1KE2A 1NHGA 1XNJA 1DP4A 1L5WA 3ETHA 2EGHA 3MRTA 4E88A 2WF5A 4GKKB 2C83A 2PGNA 1PR4A 1X87A 4XM0A 3G9TA 2XITA 2O2EA 1O1YA 2VRCA 4FFMA 1IC6A 1SU7A 1X80B 3FTQA 2XIQA 1F0YA 2R48A 3HYTA 1KYZA 5THKA 1I9CA 1FMCA 2AI2A 3CVWA 4TV8F 4DIBA 3ZOKA 3OC6A 4PIMA 5FFFA 4CU5A 1RAIA 1ZIDA 2QENA 4BLVA 1MZPA 1E63A 1IOVA 3MIZA 1E7QA 3OIWA 2ZIXB 1VJCA 2ZDQA 2RHMA 1QWSA 3LDGA 4YJ3A 3KYCA 5KYGA 1UT6A 2GYVA 4B3JA 1J00A 4RSGA 1K7SN 2BGUA 1D6NA 3L0DA 4HWKA 3PE4A 3MUNA 5KJ1A 1AQ6A 1I3NA 4AS2A 4EP1A 4EHJA 1IPEA 4FXOA 4MGEA 5JYBA 2MSDB 4QT4A 1WLYA 1ZK0A 1IY8A 2QTVA 5A4FS 4U0JA 4DJEC 3H5IA 2XHZA 4JK3A 2XWJI 3U39A 2R5FA 4FT2A 4H7DA 3MVEA 4BN4A 2VRWA 2RI6A 2JGIA 2WWWA 5KC9A 2C07A 4K9PA 1XA3A 3LDUA 1E92A 3EOAI 1M1YA 1R6XA 2W6MA 5D84A 3TE6A 3DXFA 5IANA 3V7NA 4G0WA 5CT5A 1G98A 1I51A 3GBSA 4LDJA 2CLFB 3G23A 2O8DB 1MD9A 1TW3A 1IQ0A 1GA6A 3GG2A 3TLGA 2IDJA 2WAMA 4HH1A 1WSWA 5HHTA 1JR3D 3RVSA 3SX2A 2ZU6A 2WFLB 3Q8MA 1G9SA 2OEPA 3RUHA 3QLEA 3UJ7A 3WGMA 3FPEA 3GH3A 1LBQA 1M2HA 2ECKA 3RC2A 4C0LA 1VP9A 3FTFA 1G5RA 4LNHA 2COUA 3NV7A 5GGYA 4EG0A 1X86B 4UMDA 1PRYA 1Q2XA 4TWRA 1JAHA 2B1GA 5C8YB 1HE4A 1HGXA 2B8NA 2ZULA 3EFHA 5FPKA 5AJTA 3A9TA 3CRNA 2DCUA 3NBFA 1Z6ZA 3W5SA 3IIIA 4HAZA 5TPWB 1DZIA 1XU4A 1KI4A 2QT0A 3AGQA 4ARZB 4L8GA 4TN5A 4FMDB 3OEYA 4LAFA 3TIIA 5HX7A 4FM9A 3VKFA 2ZBRA 2GLUA 4BNMA 4AUEA 4FYKA 4LZLA 1KS9A 5K0TA 2PZMA 2Q0QA 4BKRA 2PRYA 2X9QA 4MVCA 3DFIA 1SCIA 5CDUA 2FLWA 2RH5A 1VXRA 3CW8X 3GUYA 2HQRA 3RVNA 3V42A 3E81A 4B3TB 1JHAA 4R01A 3BGVA 4KXUA 4AIIA 1T9GS 1GDTA 5E7MA 4PHTA 2G17A 3G79A 2PRIA 5EQTA 3TCXB 3QVGA 1RAEA 3S28A 2ORED 1DL5A 3L7MA 2GMWA 4Q00A 4UAUA 4Y9UA 3ZUGA 4F2PA 4ZCIA 3OCUA 1E6EA 2XZTA 3AUAA 3N2LA 4CR6A 1Z28A 2MSEB 1QZTA 3R40A 3GGPA 5MFPA 3GAAA 3FSGD 4YO7A 4OSPA 1XU9A 3ZJUA 3PF9A 4N03A 3Q88A 2XNKA 2Q3FA 2R8EA 3HVUA 3ON5A 3REQA 1UIMA 1VMIA 5BWBA 1Y5MA 4QJBA 3VHXB 3EDRA 3M9LA 4L4YA 4PLPA 4R71A 1GUFA 5BXQC 3AR5A 3PC3A 4OA5A 1NUAA 1LS1A 5JR3A 1T8SA 3VVCA 1JMVA 4DLTA 1HFJA 1O95A 3GO4A 2JLWA 1YL7A 2HPZA 4LE0A 1HRDA 3UN1A 1GCOA 2IVZA 4L8VA 4PG4A 4IQ0A 1ZKDA 3IGFA 5AM0A 4W1QA 4NKRA 4L5JA 4RXUA 2JLXA 4Q9LA 2IHYA 4V0LA 1OLUA 1WB6A 2GN0A 2QM7A 2AI1A 4M1TA 3ZYZA 4OL9A 1B0PA 1W0JA 3RARA 3L0BA 2B25A 3OLYA 4HQ6A 4CIVA 2FSUA 3UHPA 4PG5A 3A6LA 2Q8PA 3WNBA 3SKVA 1E5VA 4DG5A 4B35A 4PLFA 4WESA 1YCFA 3LY7A 1IRXA 1R12A 1ONPA 3DVRX 3K2QA 2AI3A 2GNOA 1AKWA 1NIJA 4XPIA 5ESWA 1YRYE 2BFEA 3M4JA 1DFIA 4M0MA 3L7IA 3O3OB 3O4FA 4NBWA 4LE1A 4PGAA 5E6RA 3M2PA 1FF9A 3IRVA 4LVNA 2BLNA 2O0MA 4MUHA 2J59A 5EKUA 4ERXA 3LUAA 4F8JA 3ADBA 3EIFA 3IPCA 4PRYA 1J5XA 3PHGA 1R4AA 5TSDA 4K88A 2Q1SA 4OQPA 1AKRA 3P9IA 3LCVB 5EA2A 2VJDA 3FDFA 2FETA 1A4UA 1POWA 1EXDA 4ESHA 2FX3A 4X8MA 2ZRCA 3IP1A 1SCUA 3KXDA 3WYNA 5BVHB 1X8LA 5IFKA 4QU9A 4OX9Y 1PR3A 4GU5A 4RKRA 1C8KA 1GG2A 2HRRA 4GO1A 4PU0A 4CLXA 1XYYA 3B1VA 3D54D 3G68A 2CL7X 2CB0A 1CUSA 1FRVA 1DG9A 3G8BA 1STOA 1MZVA 4JX9A 3N75A 4Q1CA 3O4JA 4XVCA 5FQOA 4F85A 2F43B 3EUEA 3OZAA 2SKCA 1N33B 3NALA 3M2TA 4G85A 4B4DA 4H7KA 1I7NA 2F9LA 4BB0A 2FPXA 4PHCA 1KZHA 3LRPA 3CZMA 4O4IF 5C18A 2FN3A 5FTNA 5KUTA 4IV0A 1Z4LA 1DCFA 1FBTA 1SB9A 4PZLA 1LJLA 3EB9A 4U2KA 1J42A 4P84A 2KMLA 3R41A 1Q15A 2IU6A 4GECA 5J4VA 5A4IS 5I7HA 3RWMB 2GASA 5FD8A 2R9VA 5BSGA 2GS9A 3U3KA 4WKNA 3WB9A 4DCSA 4DPKA 3WAJA 4IDHA 1BMQA 3UXMA 4HX5A 1QIEA 1BG6A 2IXAA 4FCTA 1GTG1 1TL7C 2Y4NA 3RHZA 4ISCA 3UJDA 1SXJC 3O1LA 3K9WA 2P6PA 1XJCA 4IJMA 1ZPDA 1IJBA 4V0OA 4E21A 5K3EA 1M1NA 3HG7A 3C43A 1FTWA 4X1IA 5BP7A 2OHVA 4MKHA 4RZ3A 4B3MB 1H85A 3GLHB 2Y1KA 3WGGA 2E2WA 2YC4C 1CERA 1X8XA 4Q3NA 1ZGJA 3WIBA 4HB3A 1X1SA 2Y0BA 5LLSA 4BLOA 4ETWA 3OQVA 4GMDA 4ZOQI 5KWSA 3VVLA 2REOA 1YR1A 1V95A 4RSMA 5G0UA 4CKBA 5KOJA 2P2GA 3KVNA 2GXSA 2QQ5A 3C4JA 4RHTA 4CQMB 2NPFA 3V8BA 1J8QA 3WKEA 3LIPA 5CW2A 2Q5QA 1Y4UA 5AVSA 1T43A 3QVJA 4X6XA 3CE6A 1M7GA 3K4PA 3W3ZB 3OCJA 3E82A 1A7AA 4MUNA 4FX5A 3K4QA 5CH5A 2ORIA 3PVZA 4BP9A 2WJZB 2RFLA 4ZT5A 1A97A 1TZCA 3OIFA 1WULS 3HE3A 3NHLA 1OD6A 3BJEA 2ASEA 3U48A 4ECEA 1KQFA 2IELA 3IB3A 4I5FA 1OIWA 4M1WA 5KTRA 1RWKA 1GHTA 3PX3A 1J20A 1ATZA 4H6PA 3W6PA 4F5WA 2DLCX 3SBDA 3Q15C 2C59A 3IBCA 2N9UA 4WFKA 3TEFA 4F86A 4W9NA 3DSRA 1E3TA 2CJXA 4LYEA 3WJAA 1C9NA 1ZWKA 4JCCA 3CM0A 3OLXA 4OG2A 1ZI6A 2MYPA 4J1NA 4ND8B 1E2LA 3G2NA 4P2GA 2WU8A 4ZVRA 3T5GA 5JFTA 3I5AA 2OHHA 4HFNA 1FIUA 4C7JA 1TAUA 4LHEA 1GA4A 1QQ7A 1Q0QA 1X80A 2CT8A 2J45A 5IPFA 1MEJA 1QOZA 3KFXA 4KLNA 5CT9A 2F9FA 2RONA 3OFKA 2ID9A 2MSNA 4O2RA 1SFRA 2WKPA 1O97C 3OWXA 3NIBA 5F1PA 1P2GA 3RJZA 2NV0A 3ND6A 2ATXA 3LLCA 4WACA 3TINA 3ORHA 4KQIA 4EHFA 4OKNA 5B2FA 3M6MD 4CTKA 1PN3A 3FDIA 3S2IA 3FAKA 4PHFA 1QHEA 3N9IA 4TT3A 3PC6A 4Y6QA 1JBQA 1DOZA 1G2IA 2P9EA 3NPAA 2A59A 2H85A 2ZR9A 2BHTA 1UDXA 3WVNA 1U8AA 2WAOA 1L4EA 1MQAA 3LO5A 3HGTA 4C21A 5AVTA 1IBLB 1EA5A 2QN7A 1LFDB 4KQGA 5P21A 4B5LA 4EHBA 4FYMA 2FU5C 2GK4A 2JJMA 5HKOA 2FZ5A 1IXKA 3BB3A 5JD5A 1OFIA 1CHNA 2OQ2A 2AQKA 3B70A 3SICE 3RNOA 5FTJA 2GSDA 2O3QA 2DHEA 3ABZA 3CGWA 4PBSA 3WLFA 3CH7A 2NSDA 4ZC8A 1J0AA 4C03A 1L4NA 4OCZA 1MEOA 3ITEA 2VK4A 3DVAB 3IKJA 1EX6A 1I1OA 2O8DA 2C0PA 2A9FA 2XB6A 2I33A 4OUKX 2GXAA 4AMZA 3ADKA 2XXAB 3NEPX 1SXGA 1HYBA 1U8FO 1M72A 2CHVA 2X5XA 2AK2A 3D3WB 3F2VA 4HZIA 5EL0A 2QZPA 3COWA 3RUFA 3EVNA 1AZWA 3X1DA 3X0DA 3B6JA 3IRUA 2RHLA 3NNSA 4JZKA 5JVDF 4ZVTA 3UMBA 3UWOA 3S81A 2YXPX 4DIOA 3OZWA 1RXUA 1Y9JA 1M83A 5C8YA 3WNCA 3EYWA 3I6YA 4YREA 4MRSA 4JBHA 1XTIA 3T0GA 3QHAA 3AV0B 1C3JA 2XOKD 3FGNA 5TPWA 4HUJA 5AK0A 5JO9A 4D9EA 3NJRA 5C1BA 2ZKIA 4Y2SA 2NPOA 1US8B 1VDZA 1W9HA 4S1NA 3SHTA 4AL4A 4ARZA 3IVGA 1TC1A 4A0GA 2ZCJA 3TSAA 3RPEA 3TPZA 1J99A 3PR2B 2QLNA 1Q7GA 1G60A 2ZAIA 3B9QA 3HFSA 1LQ2A 3WY9A 4RWZA 3X1KA 2Z8YA 2B3DA 1JR3E 3QYPA 4RF3A 1S96A 1X7WB 4K6CA 4TLDA 3UJ3X 4CM8A 3URKA 1C7ZA 1P31A 4QQKA 3IIEA 1KVRA 5FBZA 2BDEA 1RWPA 3BFXA 3CZRA 3O9VA 4K3VA 4C4AA 3QVSA 2I91A 1N5IA 4ER5A 4LRSB 4IWXA 1X92A 1SXHA 3OA2A 4JLDA 1ECBA 5LSAA 3VKHA 4LJSA 2WJPA 3L7KA 5TY0A 1C8LA 1KIMA 5D00A 5HMLA 3X1XA 3VPFA 4CV1A 5JSUA 1IZ0A 3IOEA 3JQAD 4WOBA 3FNFA 4D0NA 5H9WA 1N57A 1SWVA 2GK3A 2CN1A 4OXNA 2IP4A 2ZYSA 3OECA 4WZBB 4J0HA 3VHXA 3U4QA 3VHLB 4RM3A 4MB0A 1BGXT 3CSSA 2AYZA 3O8QA 3FB4A 4IJVA 4GL2A 2QXTA 2XNSA 1P8JA 3SBOA 2P1RA 4AUKA 2ZQYA 4BE4A 1OYWA 4OHUA 1KDRA 5AVQA 3N8DA 5JCOA 5KSPA 1KI7A 1U28A 1ZL2A 1ISJA 1UK6A 1AK9A 1CUIA 1XROA 2FSVA 2JDIA 1GOTA 1NYQA 2VUTA 2YRFA 3EVBA 2M9MA 4K9NA 4Y9DA 4EJSB 4F6CA 4R2MA 1OLSB 1V3QE 3QUAA 2ZQ5A 3HU2A 4QHYA 2IZOA 1F8FA 4BFLA 1E4EB 3MTEA 3LUGA 3RIMA 4I4CA 2JLBA 2TRSB 4N3GA 4E4TA 3BH7A 4W9MC 4EI8A 3LCMA 2LTAA 4FU0A 4DQKA 4D81A 4L8FA 4PX9A 5LQNA 5GJBA 4DDVA 5EEGA 2G70A 3W5IA 1Q74A 3FBGA 1USIA 1QRDA 1XRPA 4NZOA 3TKLA 1IN4A 4DRXB 4DMRA 1F9AA 1N1EA 5B3LA 4OHZA 4JIGA 4KQEA 1U9YA 2Y93A 4F7WA 1KJIA 3QFFA 3HXPA 3D7MA 3SF8B 3QXJA 4ZYXA 3VO1A 2FF7A 3IEPA 1ZW1A 2B37A 3M6WA 5HGXA 1KFKB 4EAQA 3C3DA 4EGAA 5HQ3A 2Z6AA 3N07A 5EVJA 2FQQA 1R4MB 2O1SA 5C8DA 1XMPA 2UVPB 2O0JA 1Z5WA 2ZSHA 3KZMA 4GS5A 2VNIA 1DS6A 3H1PA 2GJ8A 1C0EA 1OPRA 1XKQA 2HLNA 4ZYYA 5FL7A 2AEFA 1CXZA 4YT8A 4AECA 2HOQA 4C0JA 1BE0A 3R7FA 5I7SA 3AUTA 5EE3A 5BUQA 3UAXA 1CK4A 1V11B 3E70C 2XRMA 3O8RA 1W1IA 3OKAA 2YICA 3DV0A 4DAOA 3FWPA 2PR7A 2ZB4A 4EFKA 2AOVA 1SUDA 4GPBA 3C8MA 1PZMA 2FMIA 4G07A 5CG2A 3ESYA 3DTVA 4GYYA 2PNJA 2PH5A 1R15A 4ZCRA 5KOYA 4RKQA 2XVXA 3N86A 1NTRA 1QV9A 2XDAA 4MDYA 4AYWA 3NR2A 1J0CA 4UUPA 1DE0A 3H0EA 2FPWA 2XT0A 1EESA 2VJAA 3HJBA 1I9GA 3QEKA 3KDAA 3NBMA 1AKEA 4P98A 4TT8A 5REQA 4JT9A 3LQ4A 4WOCA 1H66A 2VT2A 5EIWA 1XZPA 4D80A 1RHKA 3RIGA 5DI3B 4KV7A 3E8MA 1Q1AA 1UBKS 1CR2A 4F5ZA 1UC5B 2OECA 3W8EA 2PBRA 5JI2E 1HYQA 5F5XA 4NFHA 1NUSA 3GLHA 1VLVA 2GA9A 4LZNA 3AUXA 1RJ9A 5DW0A 3W2GA 1E7YA 3L2OB 4PS1A 2Q1XA 1JN0A 1OA1A 4LZZA 2XUGA 1D4OA 3I9MA 2YBEA 4HTAA 2Y68A 4IFIA 4OJMX 4ZVMA 5HKAA 5JCPA 3HHPA 2J3EA 1EEXB 1GAWA 2Y1LA 4LJLA 1XD2B 4YLEA 4AO7A 5DYTA 4BQPA 4EFLA 1PSDA 1G8FA 1K3FA 1M34B 4NHEA 2VRNA 4DE5A 2ZUEA 4M49A 2AUNA 4FZJA 4OKSA 3R6DA 2QPOA 5JNLA 1ZEJA 4DQLA 4TQGA 1NPYA 1MT3A 1SNYA 3PL1A 1YZ3A 2VZLA 3E8XA 4OJQA 3EXIB 2FWPA 3TI9A 3GH1A 1ECJA 3LZ6A 4P92A 3K9BA 3UANA 3RYIB 2FMXA 3CZ4A 5EZ5A 4C7MA 1FDWA 3FJOA 5G0SA 5A4KA 4OU5A 1PJTA 1ADYA 1CJMA 2ZS8A 2C04A 1JLKA 1U02A 2H54A 4C9BA 1Z22A 4ZAWA 2EZ4A 1XMIA 3EOZA 4D96A 2X8JA 3DW1X 2P3LA 4KPFC 2GX6A 5J5CA 1GQFA 2DJ5A 5CLIA 1NY5A 3UAZA 2V9ZA 4D0LB 5JRDS 3FMVA 4Y2HA 1JFSA 3WGOA 2DYKA 3A9RA 1E2FA 3C3CA 4TWIA 5G0TA 4ND8A 5LD2C 1D2RA 3ISTA 4ZEWA 1F51E 3HI4A 4G0VA 1H9CA 4QLOA 2WUGA 3PUWA 5LBIA 1ODKA 1WZUA 5JS7A 2JW5A 3QFSA 4JC5A 3IO3A 4R5MA 5DYWA 2GUWA 1EGMB 1SZCA 1CLUA 4OM8A 3ZD8A 4DF3A 3CFYA 4MVJH 1LEHA 4G4IA 1OIVA 3U7JA 3ZBUA 2ZE8A 4PAGA 4H7IA 2ZUCA 5DN6A 1KC1A 3PPIA 4B45A 4YYZA 1F14A 2OQIA 4M4SA 1E5XA 5IC6A 5BQPA 1TIBA 3BSSA 2OV4A 3LSYA 4XTCS 1L5LA 4F38A 1SCJA 5EERA 1YKGA 2GCGA 3KXIA 3R8XA 3HBNA 4O4JA 1DJMA 3DFZA 4II7A 3IJRA 2ACEA 2QTCA 4INPA 6ABPA 2GVNA 4GLFA 2LV8A 3MFQA 3HTXA 3WYBA 1J8DA 3GD5A 1BDJA 3I9OA 4B46A 4DDUA 1DT3A 4BNYA 4N0EA 1YC5A 2F1HA 3IKLA 3AI3A 3ONNA 4KODA 5KYVA 4LF9B 1FRQA 1SBTA 2YV4A 4R9SA 2OZLB 4I7EA 3SX0A 3K0AB 1EUCB 3E53A 4JBNA 3ER6A 5I9MA 5BT9A 3DVAA 4IIGA 4RW0A 3RFCA 2OXRA 2GM9A 4XYMA 4AJ9A 3U62A 2J3KA 3DL4A 3KSMA 3QW4B 1UC8A 3PEEA 1F06A 1SY7A 2XXAA 3K30A 3UICA 3ASVA 1E3JA 2Y27A 3D3WA 1SUSA 3O93A 4DAEA 1YZTA 3EN0A 4FHEA 1PT7A 1N5JA 3KWFA 2HCBA 2CXSA 1YHZA 1Z45A 1ZHOA 2XKAA 5DGCA 4YLGA 3ZXUB 2VHXA 3RH0A 4KUGA 1PSWA 3FCOA 2ZI5A 3B53X 4NZPA 4YQEA 4EFMA 4Q4HB 1YA8A 3HBFA 3LXMA 2X5OA 4FI3C 3WXMA 1NVGA 3UAOA 1GAJA 4HNAB 5B3JC 1ODLA 3DLTA 1EP3B 1Y82A 2HRQA 1C1HA 5GIPE 4PPNA 4BY9E 3IPYA 5DCYA 2UDPA 4P4SB 2M1ZA 2VBFA 4QUHA 1OOEA 5A3JA 4EDHA 1Z4NA 2EZUA 1TDJA 2WSLA 2H2IA 2VATA 4NJEB 3BJZA 2P2ZA 5AWFC 3SQXA 1KPGA 1VL8A 1X7WA 3W8RA 3P0EA 4E5NA 2WJHA 1PW5A 4N40A 4OATA 1EE9A 1TMKA 1U7XA 2FY8A 3KQMA 2G07A 1DKNA 3M5PA 1TKRA 4X71A 4WVFA 4X8LA 1YZQA 4LYDA 3FYHA 3PDJA 3PT9A 4MNTA 1WZIA 4CL0A 3MM4A 2EDAA 3MF4A 4JELA 3WP0A 2DRIA 2G88A 2IY7A 2B69A 4MKXA 2D2EA 5D3QA 4UPVA 3AZPA 4FYIA 1GLVA 3WLSA 1UDRA 5MN5A 1UOPA 1FX0A 2ZTMA 2G63A 3DEKA 2OCYC 2BP7B 3DR3A 4KLRA 4QU8A 2YMPA 4MZXA 3WICA 2I6GA 3CCBA 1OGIA 3IUJA 1YI1A 4WZBA 3U0VA 4ECAA 3NS7A 4U39A 1KO4A 3KHTA 2FX5A 4RVUA 5TPZA 3EPJA 3LQYA 4PYIA 3LQFA 1FP7A 4RKWA 1TPZA 4S04A 4D8XA 1E6KA 3QK7A 4MKRA 1A1SA 3QUSA 4NPAA 5GZ1A 5K0SA 4FR2A 8GPBA 1TU3A 121PA 2Z8ZA 5AOAA 2Q3DA 6YASA 3RS8A 1SEVA 1ZWLA 4TLAA 3WGUA 5I51A 1JKXA 1PQUA 1SQ0A 3C3WA 2X0RA 1E60A 3A4TA 1L8OA 4MVXA 4EJSA 3RC1A 3ZZUA 4MJXA 3ZW8A 4EL0A 2QVGA 4A10A 5E3HA 3BT7A 3AF3A 3IHTA 3QKTA 2AVDA 4GKBA 4TSFD 5CR9A 3VNRA 4REMA 2DR2A 3ANLA 3CN7A 3ZLVA 2HSWA 3FUVA 2HUPA 3KJFA 4ZEMA 3CVYA 1BKSB 1E4EA 1HEIA 5ER9A 2OGWA 3OHMA 3JALA 5AW8A 2ZRHA 1X74A 4KSCA 1WUYA 4ALNA 1Q1NA 4OFZA 4YEDA 5GVRA 3HCFA 4JGGA 2OG2A 4AZWA 4CMJA 1GIAA 5A3RA 4DRXA 2XMZA 3GPCA 3BN3A 1S3FA 4OK3A 4PSDA 3VPBA 2I2XB 1P91A 1DHRA 3MCVA 1UMKA 1EWKA 3SF8A 4ADSG 1GNQA 3S40A 1R9MA 4RMGA 4B7CA 3DS8A 4AP5A 4Y67A 4B6SA 4FOSA 4DREA 2COEA 2AX3A 3JQ8B 3K15A 4MS1A 1Q1GA 4POOA 1DXOA 1KO5A 2VYVA 1N0UA 2IYLD 1R4MA 3K9LA 2WB2A 2UVPA 1O94A 4LX8A 2FWAA 3KJXA 4F2WA 2EKZA 4GMHA 3L9XA 4OPMA 5LYYA 4EELA 4F6LA 3KD2A 3UATA 3ZWAA 1T8UA 1ZUNB 2PZLA 3P0RA 3R5TA 2JHFA 4EX6A 5KNBA 1OB2A 1QOPB 3V4LA 4NYIQ 2NN3C 3DOEA 3WNVA 5TGTA 3F3KA 5I9NA 2HRDA 4HNQA 4N3CA 3CIFA 4KXQA 1KOFA 2JBAB 2ZSUA 4JJ6A 4PC1A 3IURA 1V11A 3WO0A 4B7XA 5K1SA 3WKDA 1WF3A 4MMZB 4DSUA 3DXXA 4PCLA 5JO0A 1R0KA 2J7PA 3DL2A 4F93B 4E03A 1BKDR 3PDUA 2NTJA 3ZPXA 1JEAA 4NX2A 3EWIA 4FLFA 4RZQA 1N3YA 3UK1A 1E9FA 4IXWA 8ABPA 1JYFA 5JAOA 1UJMA 2RB4A 3HYSA 4EUEA 2QNBA 3H05A 1Q77A 5EP4A 3OEED 3GFVA 3KXKA 4FI3F 4AY4A 3CH4B 1XYVA 3GBPA 1MTOA 2CE7A 5BOVA 4AJ2A 1OB5A 1P7PA 1F1JA 2QT9A 3EA0A 4XDZA 4LHZA 5DI3A 3TOXA 3AU8A 4URZR 3FNEA 2FPIB 1WMFA 1G3IA 1CC1S 3WTBA 2H18A 2IZZA 3CKKA 3D6FA 3MLEA 3ZH9B 4JOBA 2OFPA 5G1NA 3UOAB 3CLVA 3GIWA 5ERGB 4HAXA 4EUKA 5C2JB 3D7SA 3DZGA 4TTPA 4YJ2B 1TMGE 2IPNA 3F8WA 4RHFA 4HRAA 4RFSA 4XZ3A 2WE8A 1LDYA 3UKDA 3VUFA 4CG0A 2CFRA 5B55A 1JMKC 1T4DA 4WCFB 1OJLA 2GLXA 1I7QB 2WWYA 4XVQA 4H3SA 2RHGB 5T8KC 4ZQCB 4F3YA 3CLUC 4OIFA 5HF9A 3ORSA 4E1AA 4XJSA 5CBPB 3WGVA 3RASA 1OXVA 3HA5A 3ZJYA 5JEDA 3QNUA 1U65A 4RY0A 1YVEI 1HQKA 3EXIA 4AWBA 3KZCA 2CMDA 3AUYA 4AN0A 2F90A 3JVEA 1LWOA 1KNXA 1GRNA 1K66A 1F1BA 1N8NA 2X4IA 5IVIA 2ODBA 4C29A 5JNRA 4I99A 3WFJA 2ZZKA 4V0ME 5EHZA 4L5IA 4X6LA 3WYGA 4KR3A 3PGMA 4L1KA 4CM4B 3VGPA 3SFTA 2HBQA 2QJRA 1GG9A 3EGEA 4BX0A 2WINI 4RK4A 3UJBA 1JB1A 5F35A 1FP4B 2C4VA 4I5EA 4CF4A 5AVZA 5JHHB 2KPOA 3HH8A 3QMMA 2WMNB 3IODA 4ER0A 3ZGVA 1C1YA 3I2YX 2F1KA 3WQSB 3U7RA 1GU0A 4MQMA 3LBFA 1MOSA 3DL7A 3PFKA 3RVDA 1TECE 5C5EA 4PC6A 1GPMA 4KQ2A 4DB4A 3Q6IA 4P4TA 2TMDA 1MC8A 5HIIA 5DOZA 4Y6OA 1YMUA 3SIPA 2NXWA 2JL1A 2XRFA 3PPXA 2ZPAA 4U1RA 4AKSA 5KBYA 1YQXA 2C8VA 3B6EA 1DQYA 1DKQA 1RHQA 1WQ3A 2YXBA 4IJUA 4JCOA 3T0IA 5ERYA 3T9EA 1PCXA 2I22A 4B33A 1IIBA 3PKIA 2X19A 1KO1A 4EWLA 5AVUA 4HQFA 4LWOA 4K87A 1VLHA 3OM9A 4HQKA 3RAJA 3IMFA 4COKA 4QPCA 5FFNA 1M0WA 4IVPA 5B2ZA 2XNJA 3D7KA 5EXTA 5FUMA 3INGA 2QHXA 4DTCA 2AS0A 3UXEA 4FBMA 1PK7A 2V1UA 5KKNB 3C41J 4R9VA 3AO0B 1LW7A 2OCPA 1XHFA 1Q1BA 2GBPA 2WM2A 4HB4A 4YDHB 3WBBA 1QTIA 3HZRA 2DT5A 5BQXA 2BR5A 1XU7A 2HTEA 7MDHA 2OZLA 3JAKB 3LHDA 2JJ2A 5ALVA 3E0QA 4OSOA 1JIUA 2EZ8A 3LUBA 5A4DA 3K0AA 2NUAB 4DEXA 2QUKA 3R0VA 2L17A 3AH8A 3WL6A 2IPMA 1FE8A 3JQGB 4JEMA 1W4LA 1G291 1K7XB 2FG6C 5AW5A 3KQUA 1Q19A 3FM9A 1EWRA 2PSDA 3SYRA 5K6AA 4EMTA 2B83A 1P3DA 1EM8B 1GL9B 2Y9PB 5AI6A 3UV6A 4MTCA 3MXOA 4GW3A 4US1R 1H93A 1N7HA 3HB0A 4OQ4A 4Q4LA 2PUGA 2NTYC 3MOGA 4NYJQ 3K71B 2RJNA 2PL3A 4DR7B 5EZYB 4CT0A 1M73E 3UKOA 4IIBA 1TADA 2IHJA 3JCZA 3VO2A 1GNSA 4Q4HA 1JQAA 2AMVA 1JHMA 1Y5RA 3EF0A 4WXMA 2R8PA 5A9SA 4I81A 4R8RA 3UJAA 5KTYA 4V0KA 3CX8A 5AQEA 4UUOA 2OT3B 3IJEB 2C3PA 2QZ9A 3O5AA 4A27A 4P4SA 3KVYA 2POCA 3CNOA 3OE4A 4HR7A 4JWTA 1DRWA 3TZLA 3R7NA 2A9KA 4RY9A 4BQOA 1LNQA 3UNXA 1JVSA 3WZMA 4BMDA 4KSBA 1TKAA 5C4MA 2FW7A 4RHEA 4ZVOA 3MWDA 5K8CA 2ES4A 5IBQA 4YRGA 4HQ0A 5IAOA 4GGMX 1RPZA 3B1JA 1KY3A 2XYQA 4LNUB 4PIVA 1G3MA 4KO8A 5AHOA 3VTFA 4ABYA 4WBNB 4BBAA 5J3JA 1CJCA 3H9GA 3CRVA 2MWMA 3GRZA 1RACA 1LSSA 2A9JA 1IOWA 2WVGA 2XUIA 3DP9A 3G88A 3GUVA 3HYNA 4CEJB 1DQNA 3FLAA 2R8ZA 2BP7A 3RSHA 2OO5C 1PGJA 2QAGB 2YJGA 2DUJA 3OT5A 4C06A 1W29A 3A6GA 1I7PA 4MV0A 1DB3A 4LJ9A 4FK8A 1KZ9A 3W7VA 4MQ5A 5IBPA 1XPOA 5BQ3A 1MG5A 3F6BX 2WWFA 4OA8A 1XMJA 1QYCA 3QKUA 3KR9A 3HDHA 2YHIA 5FUVA 4BMOB 1HF3A 2J85A 3GIDA 2OO3A 3A8TA 3SY8A 1N3LA 1GCAA 3UT5B 4BQNA 1O5IA 3U4IA 3V55A 2O14A 3BSYA 4CDNA 1CHDA 3GJXC 1GYPA 2OSBA 4GOMD 4IO1A 4MIOA 1DIHA 1EFPB 4FJ1A 4JP8A 1W4ZA 2FMHA 2V9CA 5CK4A 5KCZA 4HQOA 4WEQA 5CRIA 1GSHA 2ISCA 1KC3A 1V5WA 2BF7A 3EXAA 1FDOA 4X85A 3NBYC 1RZ3A 2LW7A 4CI9A 2DH5A 2KLHA 3E3LA 1I4TD 1FFXA 1MGPA 3DEFA 4DC0A 4D25A 3A6EA 5TQ2B 1TEXA 1Q50A 1W0KD 4JNKA 1L7RA 2ACVA 3G9UA 2VNAA 2RC6A 3HA2A 1U7HA 1SC3A 3LI2A 2GWHA 1P2VA 2C5AA 3C7DB 2DFDA 1JSZA 1IONA 1R6AA 1XL1A 1R0BA 3GR6A 2RCYA 4RHXA 1V4BA 4F92B 1R8QA 2DHRA 1E2MA 3GYGA 3TXAA 2YWGA 1LK5A 2ZYGA 1XLUA 4HO1X 5B1SA 5A06A 1SQ6A 1WHSB 4BE9A 4PM4A 3KJHA 4P0PB 1M8GA 1TVEA 3IDFA 3RAPR 1BE6A 2A9RA 1GCUA 4OYLA 2WD7B 3RK0A 4CL3A 4EPWA 2JVIA 4BNUA 1YR7A 3BL8A 3V7FA 5A2GA 3KEFA 3NIFB 2JAOA 4EGFA 4Z9YA 1JEDA 1ZUNA 4IG4A 3UK2A 4QGSA 3GY0A 1KEKA 4IHJF 2C9ZA 2JFYA 3KL4A 4RD6A 4UCXA 4X7MA 5IC4A 3B9RA 2JCBA 3ZTYA 2JBAA 4RWEA 4AX8A 2WYHA 1WEHA 3W4JA 1IWOA 2VG8A 1JDUA 3LDAA 1WV1A 2HMSA 3NTRA 2JATA 3PIIA 4IOJA 2FEAA 3VH3A 3LMKA 4W5TA 1ICIA 1OLXA 2X1VA 3QU9A 3MMSA 3UA3A 2FMUA 2FMFA 4LOKA 1YFJA 5AJWA 1U04A 2OAEA 2ZYUX 2PYDA 1N3IA 2GFHA 1GR0A 2OV1A 2X1MA 4EI2A 3H2BA 3T9DA 4Z4QA 4C30A 4Q3DA 4ZDJA 3R4VA 4BNHA 3DMTA 5HEKA 5FO0A 2XCQA 4B4OA 2IXGA 3V4OA 4GBGA 3R75A 4UMFA 4D5GA 1TXGA 4URYR 4BEWA 3DBLA 5KYKA 1BXZA 1WSDA 4LUCA 4NNPA 1Z8HA 3C3PA 5CCXA 1NIPA 3NHJA 2XNDD 4G97A 4KN6A 3ROPA 3AEQA 4EA8A 1EXVA 2Z5FA 1SKYB 1IXRC 1GTZA 2ODNA 2X2OA 4MW7A 1WKVA 4HGRA 2I7CA 2IUYA 2VWQA 1E9BA 5AKGA 2VA8A 4N49A 3G2QA 2O50A 3FCCA 4K6GA 3QE0A 3TBHA 2DUWA 1DXQA 3I9KA 4YJ2A 2ACKA 4CTMA 4HH3C 4BTVA 3PFGA 3VV2A 4CIAA 5AI9A 3W8FA 3I1JA 1E20A 1PJQA 1T3TA 3GU3A 1B14A 2J30A 3DDOA 3LDFA 4P9NA 4GIBA 4PO9A 3DO8A 4WCFA 5DN9A 4US2R 4I1YA 4R81A 2X1HA 1E0DA 2PLWA 2BKAA 3EZLA 4YHBA 4JLVA 1QG6A 1XP5A 4LJ5A 4Z3OA 5CBPA 1A98A 3ZGNA 4KXYA 2PEYA 3PGA1 3L6DA 4GX1A 4QWMA 1YZUA 2IYSA 2MIIA 3MGGA 2RHRA 3TN7A 1TZKA 2G8NA 4CQMD 3AL0C 4G1CA 5GADl 1NUPA 3VVMA 3T7DA 4QPNA 5BQOA 1QO9A 3KEGA 4JUFA 1IZ9A 2G4VA 5ARCA 2LCFA 3VR4H 4CM4A 3T4PA 2WU4A 3V7UA 4RJIA 1COWA 5ALXA 4I8XA 1U5BB 1GQRA 2WWIA 3LK7A 4P54A 2ZIGA 4Y0NA 4Q47A 1Y4DE 3D4OA 2VOEA 2A14A 4OD0A 2YWFA 2VYCA 1QXSA 3G02A 2IU4A 4CZ2A 5T57A 3OEHD 5T7BA 2O0HA 3BIXA 2O2SA 2I2WA 1BJKA 2V4ZA 4PW0A 2P77A 1M2GA 2OBFA 2VPXA 3CUKA 3QFRA 4TM7A 1KDYA 1D1SA 4X00A 3DMFA 3EWSA 1DV1A 3PWZA 1AQJA 2FZWA 1VLLA 2LDXA 2R8OA 4LOIA 1O9GA 1ADJA 4NHOA 2I67A 3A6DA 3MTBA 4PC3A 1RKUA 3BXFA 1FQJA 2FN9A 5EIBD 1KFCB 3NATA 3MD0A 3NHAA 4CMEA 1UIRA 2ICAA 4HATA 4L95C 5GJVC 1XMQB 3C4QA 5DN6D 4GXTA 3WSWA 1P9OA 1M66A 3PLRA 4CKXA 4AKHA 1F2TB 4EL5A 4FPXA 5CCBA 1XVUA 3CV3A 1O89A 1Z5ZA 4OAOA 4UBJA 4C5CA 5JRZA 4MV8A 1EXMA 2NVWA 2ZB8A 4U7PB 4DC1A 4ROTA 2FSPA 3W06A 5FLXA 4KK3A 1B7GO 4XSHA 4Q9HA 2FPKA 1YZHA 6REQB 4QA9A 3JAKA 2UYCA 1JNYA 1T5TA 1ZXLA 2NUAA 3K1TA 1G5PA 2OXTA 2XMDA 4TRRA 4G8JA 5CT4A 3F8TA 4WL0A 5AKZA 3JQGA 3CZAA 1ZBDA 5EMMA 3K1YA 5AXBA 3KM0A 2YW9A 1VJGA 4YUZA 2VQSA 2X40A 4DFDA 2AW3A 4WKBA 4ER3A 2O8EA 3ROEA 3ZKWA 1ACMA 4TZTA 4DA8A 3LBHA 4ZT7A 2AC7A 5FEMA 3ST7A 3E9RA 3PC8C 1B8NA 4NBVA 2BMFA 3JTMA 5EIAA 5EZYA 3TSWA 3IAFA 2PA0A 4GD3Q 4KVFA 5CM8B 3O7WA 5A5EA 1U0FA 2F1IA 3CLKA 2H4YA 2QT1A 1PTJA 2OFFA 1P4JA 5AW6A 3R8FA 2PPLA 2ZDHA 4N4AA 2IDKA 5FTLA 5HJ5A 2C96A 2A1UB 1VE7A 2HO5A 1I80A 2H5IA 4BO0A 4DILA 2Y8EA 2OFOA 1JVBA 4CHTA 3KTOA 2H5EA 3EGXB 4M60A 3FB1A 3FYTA 4ND7A 3PJEA 2NVOA 3DAFA 3NCHA 1CG6A 1TYZA 4M37A 4NPHA 3GT0A 4HTFB 3W1WA 5CTAA 4N5MA 1YIAA 4GZ3A 4IDPA 4PLHA 3ZLBA 1QVZA 1O5TA 3IIKA 4MCAA 4DBVO 2WA1A 2D5AA 1R9NA 1V25A 1M7HA 1EFLA 1UMBB 2WHQA 5EWJB 4GOJA 4D97A 1V39A 2FPMA 1VFNA 4LNUA 1VHDA 1P9WA 4N5IX 4NBSA 1NVA