2VN8A

Crystal structure of human reticulon 4 interacting protein 1 in complex with nadph
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
358
structure length
358
Chain Sequence
b'LYFQSMAWVIDKYGKNEVLRFTQNMMMPIIHYPNEVIVKVHAASVNPIDVNMRSGYGATALNMKRDPLHVKIKGEEFPLTLGRDVSGVVMECGLDVKYFKPGDEVWAAVPPWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAINKVGGLNDKNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVCSQDASELVRKLGADDVIDYKSGSVEEQLKSLKPFDFILDNVGGSTETWAPDFLKKWSGATYVTLVTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRWAFFMASGPCLDDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGKTVINVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RETICULON-4-INTERACTING PROTEIN 1
publication title Crystal Structure of Human Reticulon 4 Interacting Protein 1 in Complex with Nadph
rcsb
source organism Homo sapiens
molecule tags Receptor inhibitor
total genus 120
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vn8A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2vn8A01
5GZ3A 3LYLA 4OSPA 3GFBA 2HMUA 1V0JA 1V9LA 2NV6A 1X7GA 2VT3A 2C5AA 1DC5A 2OBYA 4UVDA 4NJMB 1EE2A 1H94A 4HBGA 2P9GA 4PLYA 1VL8A 5AYVA 1U3TA 4PG7A 4GLLA 3D5QA 1BW9B 3WMXA 1ZFNA 4LMRA 1D3AA 1PZGA 4EDFA 1MB4A 4NJMA 1GV0A 4WEOA 4GWKA 2BH9A 3GMSA 3H9GA 4NFHA 3SX2A 2CDCA 2Z1MA 1FDUA 4R1NA 3ZU3A 4AJ4A 4DUPA 4HNHA 4RV9A 3JQ7B 3AWDA 3MTJA 1EEHA 4KMSA 3BMNA 4OOFA 1K89A 4GKBA 2Q1WA 4MVJG 4XEHA 4ALMA 2OBNA 2AQ8A 2YQ5A 4CMKA 1H6AA 1PJLA 4QEDA 3ANLA 1I30A 3EK2A 5DBFA 5G4KA 3JQ7A 5BT9A 4BL5A 3BA1A 2HQ1A 4YRBA 5AQ1A 5IXSA 4D46A 3AOEC 4N7RA 2B5VA 1V8BA 3QE3A 3TJRA 2FWMX 3VH1A 3TZKA 2X4GA 2YFQA 4BGIA 1J5PA 3D4PA 4RVHA 1TT5B 4I5EA 4IY1A 1LXCA 2PGLA 4GBJA 4W7HA 3UKOA 1R37A 3T7CA 2I5PO 1AXEA 3H65A 2WYWA 2QQ5A 5ES3A 2PD3A 3NV9A 1YRLA 3E5RA 2Y93A 1TT5A 2ZQYA 5IAAA 2W2KA 5DNAA 5AXDA 1C0KA 4I9NA 2QRKA 4J1QA 5L45A 4FFLA 3LLVA 4WLUA 2GNAA 2QW8A 3O4RA 1M75A 3DFUA 4QO7A 1N92A 1XEAA 2PGJA 2I3GA 4ROSA 3OJEA 4AG3A 3JV7A 3BYZA 1C1DB 1H9BA 4RPLA 2XOXA 5TS3A 3K96A 1GUZA 2JAPA 4G65A 2GD1O 3NT4A 5ENDA 5L40A 3FNFA 1ISJA 2AG8A 3SC6A 5ADHA 1O94A 1R6DA 1CDOA 3G1TA 4RORA 2O3UA 3PJEA 3PIIA 3TSCA 4FR5A 2CF6A 2ZYGA 2DTXA 1YGYA 1F8FA 1E3SA 3ROQA 4BO8A 3NRCA 3DZHA 4HNGA 1B8PA 4J2OA 2IE0A 4ND5A 5G4LA 2VUSA 2HJRA 1Y9AA 2DBVO 2WJPA 3QA9A 2PD4A 1W0CA 4DVJA 5A02A 4MVJD 1Z45A 5I7EA 2PZMA 4OJNA 4FS3A 1ZXLA 1O8CA 2EF1A 3DDNA 3DHYA 1UXKA 2AA3A 4PZCA 1CQIA 1LBEA 4DIOA 3VOSA 3Q11A 3DBLB 3TDKA 1C0PA 1LDYA 5JAIA 1GCUA 2HUNA 1GV1A 3KTDA 3MOIA 1LDEA 1P1RA 3IUPA 1T1RA 4OKIA 3FBGA 3GGOA 3GPIA 4TSKA 1EDZA 4IQ8A 3DBLA 3EW7A 2D4AA 2VTDA 3DBHB 3KRTA 3PRJA 4GVLA 3ZWYA 3AW9A 4J1NA 3CTMA 2H63A 1X7HA 1FDWA 3V1YA 1R4NB 2RHCA 3FTPA 1WMAA 1T2EA 3DBHA 1DO8A 3GG9A 2D59A 4J91A 5JE8A 4BNHA 3LT2A 3IC5A 1ZXBA 1V3UA 1VI2A 5L95A 4DQXA 1VLLA 4EZBA 2HMTA 3V1UA 2AMFA 4JGBA 3RUHA 3PWKA 1B0AA 4RQTA 1PSDA 4I9HA 1K2WA 2PD6A 2JJYA 8LDHA 3KSZO 2RBEA 3I9OA 1O9BA 3WGZA 2G17A 1UDAA 3TQHA 3GNTA 3QWHA 3OIFA 1C0IA 3OIDA 4HKTA 2E4AA 3IOYA 4CM5A 3FN4A 5DULA 4B7UA 1NFRA 1NQAO 2Y1DA 3DHNA 3MEQA 1SC6A 1Q0QA 2GASA 1LQUA 3NTOA 4FGWA 4KDEA 4IS3A 4TKLA 4CLRA 4ND2A 1IHYA 2AW5A 1EBUA 4NZ9A 1YOVA 4R1UA 3H2ZA 4ALIA 1Z75A 2D3TA 3TL3A 4DPKA 4HFNA 4FGSA 5T6BA 2CNBA 4MINA 4LSWA 1I36A 3SEFA 2DTEA 1CYDA 3FHLA 4IJUA 2HRBA 4YXFA 2H6EA 5IFLA 3GVCA 1EE9A 2P5UA 2G0TA 5DCUA 3DONA 1PJSA 3C8MA 2EP5A 5KJEA 2IXAA 4IDCA 4XIJA 2B0JA 5H81A 2IZ0A 4MPDA 2OMEA 3KM0A 3L6OO 2EG9A 3PTZA 2VOJA 3GG2A 4NPCA 4QO8A 1F8GA 1MV8A 3LK7A 4IXTA 2F00A 4TZTA 2WMDA 4FFRA 3W4IA 4RF5A 2VYVD 1PS8A 4Y98A 2AEJA 3OICA 1GYQA 4R16A 5IDQA 2HKIA 3H3JA 2Q1SA 5DCYA 1LSOA 4Z9YA 1X15A 2FZWA 3HADA 1HZZA 2JCYA 4RPHA 5U1PA 1X1TA 1X0VA 4AJPA 1E6UA 1GQQA 3EZYA 4KWHA 4YAKA 4J16A 3PJFA 3IQDB 1N7GA 1Z74A 4U5QA 5ILGA 4GX5A 3B1FA 1ISMA 2NUAA 1C1XA 2ZYAA 4E5NA 1I3NA 1BXZA 3U09A 5C3MA 1HE3A 4EW6A 3G3EA 1N9GA 4PLVA 3WS7A 2PWZA 4O6VA 2IXBA 4YBZA 1P77A 4D0SA 4UEOA 4L4SA 4FIZA 2RCYA 1HSZA 1LI4A 1OI7A 1KVSA 1MFZA 1ZK3A 4BNJA 4ILKA 3K2BA 4JIGA 1BXGB 4JP2A 2YUTA 1U7HA 3QWBA 4CV1A 2IZ1A 1BXGA 3RFVA 1NAHA 3N58A 2GYYA 3S1LA 2I3AA 1NNUA 3JTMA 1FMCA 2J3IA 4K26A 4BV9A 4UUOA 3PHGA 2HRZA 3GZNB 4U8GA 1EVYA 5G0TA 1Q7GA 1K6JA 3OECA 5FEUA 2Q50A 1WDMA 1EVIA 1TEHA 1I5RA 2PTGA 3B1KA 4RQUA 4E2WA 1R15A 3GZNA 3GGGA 4E30A 3NX4A 4P8RA 2UV8A 1MC4A 5KJFA 4KZPA 5COBA 3CE6A 3IS3A 1KVTA 3EMKA 4BNTA 1NM5A 1U7TA 1I33A 4RCVA 5B37A 1M76A 2PZJA 1H2BA 5A05A 3GNQA 3DFZA 4ZHSA 3KVOA 3MJ4A 3ANNA 3GGPA 1FXSA 2EW8A 3GZ4A 4PG6A 5FI3A 1A7AA 5CDSA 3S2FA 1U3WA 1BWSA 4R41A 3F1KA 4R3NA 4EITA 5IDWA 3L4SO 1R16A 4J7UA 2X0NA 2BI7A 3E9MA 1NVTA 1EBFA 3ONFA 3A28A 1IYZA 3Q2IA 5DZSA 2EP7A 2E6UX 1GYRA 1S7CA 4IM7A 3GEMA 1HXHA 1D1TA 3FPLA 2P2SA 1N2SA 4N5MA 3PWZA 3F4LA 4ALJA 3H5NA 4JJIA 4NH4A 4E5YA 4ZQGA 1N7HA 1MC5A 4FBGA 3JQCA 2EEZA 1QLHA 4J49A 4A2CA 1ULUA 2ZK7A 4O59O 1NXQA 4EJ6A 3VDQA 1H0KA 1HTBA 3VKUA 1PR9A 3M2PA 2Q45A 4CM8B 1DIHA 4H3VA 4BIIA 2JFHA 4N18A 3LF1A 1Z7EA 2E82A 3GLQA 1SEPA 3ZU4A 3DZIA 3H6KA 2X9VA 1NBOA 1LSUA 3DMTC 5F1OA 4XQCA 3PQEA 3GK3A 2X5JO 4RDIA 1J4AA 1SNYA 1U5CA 3GDFA 2W8ZA 3E03A 4DPMA 3RD5A 2UYYA 3SLGA 1V35A 1ZEMA 2BFAA 2DBQA 1E1KA 1ADFA 3E8XA 3NKLA 1I10A 3GHYA 1WWKA 4B4VA 3CUKA 3FBTA 1I01A 1I24A 2B69A 1P9LA 3ZV3A 5K0ZA 5I9LA 2AE2A 3EC7A 3GN2A 1IY8A 4FJ2A 3CZMA 3QP9A 2P9CA 1JVSA 4P4LA 5CEJA 2GRAA 4IBOA 5JCJA 3BTOA 5K6AA 4CLOB 4ZQHA 2IEBA 4O63O 1SPXA 5JAQA 4NBRA 1DC6A 3TN7A 1DDOA 1G1AA 4JQCA 1A72A 3VPSA 4K28A 2A4KA 2P5YA 3HE3A 4U6SA 3RC2A 2EIHA 5IDXA 3ZV4A 2QX7A 1XLTA 4AJEA 2GCGA 4BO3A 5I7FA 1PGOA 1H9AA 4LMPA 1MX3A 1E3IA 2P4HX 2Z1NA 2NTVA 4ONEA 3HWRA 3RI3A 3WGHA 1XIVA 1EMDA 4XWYA 3AOGA 4CPDA 4G2NA 4GQAA 4BO6A 3KEOA 4E5PA 4OXYA 3BHMA 4R5HA 2ZJ0A 3NJ8A 4MVJH 3SLKA 2I65A 5A9RA 1DRVA 3UH1A 4EEZA 2JHGA 3KSDO 3GF4A 3NAQA 4YRAA 2O4UX 1P1JA 7MDHA 4KUHA 3WIDA 4YDRA 4II2A 4D42A 1YKFA 2YFHA 2VHXA 4WECA 4NQZA 3P7MA 4NFYA 5A3JA 1B8UA 5IF3A 4MP8A 5A5EA 3PXXA 3MJCA 1LNQA 3S55A 1KC1A 1PGPA 3L4BA 5CDYA 1NX6A 3GRKA 3QY9A 4N5NA 1DRUA 1UAYA 4PZEA 4J43A 4RJTA 2VNSA 3KLMX 1GFSA 4CQMD 2DFDA 5ITVA 1E7MA 2WD8A 1D8AA 4LN1A 4G81A 1I3LA 2YQ4A 4IUYA 3ONDA 3WFJA 2VZ9A 2X7HA 4NBUA 2O48X 3ZWAA 2EKLA 2J5KA 4CQMB 1YBVA 3SJ7A 1JWAB 4GI2A 5KWEA 4BNUA 3LLSA 1L7EA 4AJNA 5JSFA 1SAYA 2BHLA 4BMSA 4D43A 5K6AC 1DEHA 2ZTUA 1B15A 4K6FA 1P31A 4B8ZA 1DIRA 4OXNA 1R66A 4MJLA 4RVDA 4IDDA 2NU8A 3RUDA 5C37A 1PJ2A 3M6IA 4PVCA 3VPHA 2G76A 1P1KA 4DMMA 4NDNE 2DT5A 2VZ8A 4PRKA 5LDHA 3TOZA 3JQFA 1H6BA 1HT0A 4DMLA 1Z73A 3ON5A 4Z9XA 1EFLA 1U8XX 4OQZA 3VZQA 3P2OA 5G0WA 1X7DA 4CMEA 3UFXA 3WGTA 2W2LD 2JD2A 4S1VA 4YJHB 4D41A 1W8DA 3EY4A 4R51A 5B4VA 4J4BA 2OFPA 1K0UA 2EJWA 4A0SA 1WPQA 4CQLB 1HDRA 4L8VA 1MP0A 2P68A 2UUPA 1DLIA 3ZHYA 1BVUA 1SB9A 1KVRA 2FHSA 2GUGA 3OHSX 4YJHA 4Y9DA 3JQAA 1FDTA 4I08A 3LZ6A 1NQOA 4AJLA 3WYEA 3S2EA 1E7QA 4J90A 3HN7A 4CQLA 3BMQA 2FP4A 3AUAA 4ZQBA 1T25A 3KYCA 5F3RA 3UF0A 2OP1A 1EZ4A 3LSYA 3JCZA 3BXXA 4RF3A 1Y81A 2BFMA 5ICMA 2EGGA 3MOGA 1NPYA 1XKQA 5DP2A 1QV6A 1LJ8A 3AFMA 1T24A 1JN0A 1Y5MA 3L4BC 3C1AA 1RYEA 2C2XA 3DAGA 4XB1A 3JD2A 1PJ3A 3DEYX 4H16A 4JJFA 4L4XA 5CPBA 5K9ZA 4MDHA 1HDOA 4UVGA 5IN5A 4EJMA 4RDHA 2VOEA 3QV1A 2D0IA 2Y99A 3IJPA 1L7DA 1RYDA 2VHVA 4PLZA 3JQ6A 1Q0LA 4CM4B 1I3MA 4PLCA 3KBOA 3LVFO 4L0QA 5EN4A 5FF9A 3ZHXA 5JAZA 1IOLA 1GPDG 5JO9A 4B7XA 4U7WA 4YB8A 1E3JA 4K6CA 1QYDA 4CMCA 2VRBA 3BIOA 1XYGA 1Z82A 3MTGA 5DF1A 4CM4A 1Q1NA 1U5AA 1IHXA 1PGJA 3NUGA 5IN4A 1BRMA 4R3WA 2JCVA 5IDYA 5L3ZA 3WR5A 4IGFA 4MKZA 4R01A 4BO1A 3NYWA 2NQ8A 2X5OA 2D8AA 2ZTVA 4M87A 2OHXA 3WMWA 1GCOA 2EKPA 3RJ5A 4RPGA 1ENYA 2SCUA 1B2LA 2CF5A 4QX6A 3SXPA 2BRUA 2B35A 4CR8A 3WLEA 5C7LO 1G0OA 1GTMA 3DOOA 1NVMB 3M1LA 4CMEC 5AOVA 1BHSA 1N8KA 4AFNA 2BF7A 3OJFA 3VC7A 3PPIA 4EBFA 5F21A 1EFKA 2CMDA 3FR7A 3RC7A 1XQ1A 3BAZA 2ZB3A 3EAGA 4D45A 1P33A 1X0XA 1OC4A 1MG5A 1VPDA 1M67A 2XXBA 1KY5A 2PY6A 3PJGA 1GDHA 1YB5A 2NVWA 3EUWA 3TFQA 3OA2A 1YDEA 5TJHA 1NFQA 2I76A 3FSRA 3IDSA 4RVFA 1BSVA 3QJ5A 3RC1A 1UXGA 3JYPA 5ENVA 3PHHA 3PDJA 4WNIA 1U9JA 1WZEA 1UXHA 3ROMA 1VE9A 3ZV6A 5TNXA 5TRTA 2Z5LA 3OSUA 3RQSA 4BNXA 5JO0A 1A9YA 2PR2A 4I5FA 1N1EA 1A4UA 4XR9A 3DWFA 1UDBA 1JW9B 1JDJA 4BO7A 5A9TA 2Y0CA 5MDHA 4WCFB 4AJKA 2PLAA 3WLFA 3RJ9A 3ST7A 1X14A 3CMCO 4GVXA 1TT7A 1YB1A 2QHXA 3QLJA 4DQUA 1R0SA 4Q3AA 4WCFA 3VKVA 1YL7A 3ONEA 5B4TA 1NP3A 1RPNA 2NU7A 1NR1A 1LUAA 3IMFA 3KYDB 3I5MA 3QHAA 1HSOA 1T4BA 3TPCA 1ZSVA 3GEGA 5I7VA 4PIVA 1OOEA 3DZJA 3WWZA 4UUNA 3BMNB 1PJQA 1PJ4A 1QG6A 1JKJA 3KYDA 1ZUD1 2ZATA 2O3QA 4AJJA 3NT5A 3B20A 5G4KB 5ITWA 2O4CA 3PHJA 4ZD6A 3RBXA 4BNIA 3INGA 4CLDA 4E0BA 3KEQA 2VT2A 4WOKA 3RSHA 3GAZA 1T1SA 4ESOA 3W4KA 2RH4A 1ZH8A 1GD1O 3U9LA 4KUGA 2X58A 2CVZA 3I9NA 3ZWXA 6LDHA 3W8EA 1H93A 4M8SA 4TROA 3G1UA 2HCTA 2W2KB 4E21A 1JKIA 1B16A 5L4NA 5JW6A 1XCBA 3W6ZA 2O2SA 4E3ZA 9LDBA 3RUIA 4U0KA 3AI1A 2CZCA 4CMAA 1QR6A 4RO0A 3DZGA 3VTZA 4BKRA 2QYSA 1ZSYA 2ZJ1A 4XGNA 3G0OA 1XQ6A 3H5RA 3PVZA 5HS6A 3HDHA 2DFVA 3PLNA 5CDUA 3GMDA 3A4VA 1Y5RA 2GO1A 1GZ3A 2JFFA 3V2GA 1QXSA 4PG4A 1J0XO 1BDMA 3GFGA 1HE5A 2Y0DA 1ZK2A 1YE3A 2GDZA 4W4TA 1LDNA 2DM6A 3E48A 5CG2A 5BSHA 4IQ0A 4GAEA 4IJVA 4NNJA 3OF2A 5COQA 1R4MB 1B7GO 2X8LA 3AK4A 5KKCA 2R00A 3IP1A 5A3VA 4UVHA 3RASA 5CG1A 1I32A 3U0BA 2V65A 2NLOA 3GVPA 4FFMA 2IODA 1A7KA 3ASUA 4WCFC 1R4MA 3K92A 3ASVA 5EQDA 4J9VA 3KETA 3K6JA 2NQTA 3DOCA 5DT9A 2FOIA 5GZ6A 4KTTE 1KVUA 3FWNA 1J6UA 1KERA 3FI9A 1F17A 6ADHA 2CDAA 1T2AA 4NJOA 3O8QB 4YEDA 3ZH2A 1PIWA 3B1JA 3G17A 4RL6A 3QVSA 3JYOA 1AXGA 3R3SA 3U4IA 3KZVA 1YWGO 2X0RA 2AEMA 1YDWA 1NHGA 2ZB7A 3O8QA 1PZHA 3PLRA 5HA5A 1DIAA 2ZB4A 3DB2A 4Q3EA 1IL0A 2H9IA 5EINA 2YV3A 3EGOA 4CM9A 4TVBA 3S2IA 1UZMA 4DGSA 5L4LA 1YVEI 1LEHA 4QXMA 4BUCA 3PHLA 3ZWNA 4YJDA 4F6LA 2P9EA 2D5CA 3PYLA 4J2HA 3PQDA 1DXYA 1O5IA 2YZ7A 4GWGA 3QQPA 1UAGA 3FTNA 1ZVMA 2VRCA 4L75A 4JNKA 1HDZA 1ZMTA 4URFA 3IIEA 3WNQA 4M86A 4PG5A 4MVJA 2EKQA 1HRDA 3LQFA 4Q3CA 3ZW8A 2FR8A 4XYGA 4DPLA 3UVEA 3OP4A 4R1SA 1GQ2A 4YAEA 4JK3A 5L9AA 3MJVA 4MVJI 5A9SB 1ZJYA 4CLRB 3I9JA 2EW2A 2X9GA 4GX0A 2C29D 5EIOA 4JROA 1HYEA 1YOVB 2DVMA 5BSFA 4DWVA 3C24A 5A9SA 2LDBA 4FW8A 4NU5A 1GZ4A 3P19A 3RFTA 2PZKA 1H5QA 4BB5A 5HWSA 4FFNA 3OJLA 5T57A 3NEPX 5GY7A 1P3DA 1OAAA 4FC7A 2B4TO 1K6IA 4FOSA 4WJZA 2R00C 5HTOA 1F12A 1SBYA 3GAFA 2VN8A 5MGBA 3X2EA 1PL8A 1JA9A 3VZSA 4FSHA 3ZHBA 1I0ZA 1O89A 2VWPA 3E18A 3RKRA 3KB6A 4DIFA 1EQ2A 3I6IA 5T67A 1LRJA 5CEEA 4UUMA 4NMHA 2O2YA 4D7AA 3D3WB 1DIBA 3WGIA 1YXMA 1I2ZA 4BGVA 1EUCA 4DC1A 4B3IA 2IEDA 4BNMA 1BTOA 2VHYA 2WSBA 4OIMA 4CV0A 3PYMA 5FWNA 3CMMA 1FF9A 2AQHA 3D3WA 3FWZA 3I6QA 3JQDA 4JJGA 3H3FA 1CRWG 3AI2A 2XXJA 4J9UE 5KVQA 3QVWA 1ZK4A 2YV1A 3O03A 1YJ8A 4BKQA 1DC3A 3DMYA 3LT4A 3W8DA 4RGBA 4CMGA 1C1XB 5LC1A 1U2GA 3F6YA 3O9ZA 1N9GB 4S3MA 3VH2A 1PJBA 2VHZA 4PCVA 4WLOA 4PLGA 3WYCA 1DBVO 1KVQA 2J3KA 5JDCA 1PL6A 2EHDA 1U3VA 4GSLA 2OUIA 4TRJA 5IZ4A 1K6XA 3UUWA 4D79A 4XA8A 4DC0A 5KNLA 2EJVA 3DBVO 3HFGA 2BGKA 4KOAA 1P0CA 3BZUA 3R6DA 4PLTA 4F45A 2AG5A 3GVXA 3KXDA 3RU9A 5JY6A 1HF3A 2P91A 3RC9A 4W9NA 3D7LA 3VZPA 2JL1A 4M89A 3Q1LA 4IS2A 1QYCA 2B5WA 4J7CA 4WLFA 2XF8A 1CQJA 1Y8QB 2PFGA 1YS4A 2IDZA 2VYVA 3DL2A 5DBIA 3IP3A 5AXBA 1WDKA 3PYXA 1HDGO 1RKXA 3ENKA 4JN6B 2JFGA 3FNEA 4NBTA 1U3UA 1Y8QA 3SC4A 4YQZA 4BQRA 4BS9A 3MJTA 5EESA 1OMOA 1VM6A 5KOIA 1NFFA 4LCEA 2NTJA 3F1LA 1ADBA 4KQXA 5TC4A 4PFJA 4BKPA 4E32A 5HM8A 1IZ9A 3RROA 3DZBA 2HAEA 2ZCVA 3WWYA 1SEVA 1Y8RA 4CR7A 3STHA 1ADCA 3WQSB 4UULA 4MVJE 2VUUA 3UCFA 4OXKA 1I2CA 1TVEA 1BDBA 1DB3A 4HXYA 1WAMA 1DHTA 2WWRA 4EUHA 1RJWA 2Q2WA 4JX8A 5DP1A 4BNWA 3ANMA 2GLXA 4PRLA 4BO4A 4BV8A 2HSDA 4HP8A 3WGQA 2C5EA 1YB4A 3DO5A 3TWOA 5BR7A 3F47A 1CEQA 4XGIA 4XYLA 1GAEO 1JLLA 3N74A 4II3A 4GGPA 5THKA 5FFFA 1ZEJA 4Q9NA 5T8KA 3RU7A 2XPCA 1PWXA 1ZJZA 5JDCC 1EK5A 2WEKA 1KS9A 3D5TA 1NWHA 3V5NA 3WG9A 3T7EA 4BNZA 3VH3A 4BVAA 2DTDA 4IDFA 1MXHA 3HHPA 5B1YA 2O3JA 3DR3A 1EQUA 1KBZA 4IZHA 1NWCA 4PLWA 2EWMA 4RLHA 1ZIDA 4W9NC 2GN9A 3EDMA 1C14A 5A04A 5JMWA 5TX7A 1JAYA 3K31A 3JQGA 3KO8A 3B6ZA 4G5HA 1IPFA 1E92A 2HJSA 2J3HA 2WTBA 5KJ6A 1LDBA 1OFGA 3RUAA 1RM5A 3DTYA 4FPXA 3MJSA 4MVJP 4HWKA 1P45A 1E1LA 4B3JA 2NWQA 3CEAA 3X2FA 4HV4A 4KP7A 1V6AA 3A06A 2GN6A 1HE2A 3B70A 1B8VA 2NU9A 4DRYA 2BKAA 2YHIB 3VPGA 4GLOA 3RWBA 4YJGB 2I9PA 5CDGA 1GYPA 3QVOA 4B8WA 2Q1TA 3RCBA 3HB5X 5GZ1A 2YHIA 1A4IA 2Q2QA 3PZRA 4YJGA 2DBRA 4AICA 3MWDB 3QVXA 3JQBA 3GDOA 5IZCA 1KETA 2WDZA 4AVYA 4XKJA 1ADGA 1ZO8A 1ONNA 2A92A 3QWAA 4OQYA 4RZHA 2C20A 4RF2A 3ROPA 2X0IA 3I23A 1PQUA 5JPIA 2CD9A 2PA3A 3PGJA 5EERA 2BGMA 4J3FA 2PGDA 1P1IA 1GUYA 4XX0A 1LTHR 1PGNA 4K9DA 2GZ2A 1XU9A 2ZCUA 3MWEB 1MFPA 4L4RA 2OO5A 5A4DA 1UZLA 5L7TA 2G82A 2VWQA 3RVDA 2PNFA 3KSUA 3F46A 5TLSA 1WXDA 2HK8A 2O3TA 1EDOA 4MVJF 5T8KC 1K5HA 4F3YA 3CSDA 2WE7A 2C2YA 4ZGWA 4NIMA 3F5SA 4LVCA 5HRUA 1ZZEA 2AHRA 1WNTA 1YQXA 4IDBA 3JD3A 4TRMA 3CINA 3A1NA 3ZWMA 2C7VA 2VYNA 2POQX 1LC0A 2D2IA 2QZZA 3WTCA 4WUVA 4EYEA 1X13A 4WE3A 4A7PA 4AJ1A 1T4DA 3LU1A 2ZB8A 4CJXA 5ILOA 2R2GA 5BNFA 3WOHA 4CMBA 2NU6A 1PWZA 1A9ZA 1YBAA 4FD3A 2FMUA 1HEUA 1NQTA 5EJ2A 4DBZA 1VL6A 4EI2A 1AN9A 5JAMA 3C7DB 5KIAA 4GGOA 4ID9A 1ONOA 4MP6A 3EZLA 2IYOA 1UZNA 2RAFA 3EVTA 1O6ZA 1AHHA 4ZQFA 3UW3A 4CM6A 4E4YA 4GPD1 1V3TA 1GZ6A 1M2WA 1ML3A 1YO6A 3PEFA 4LW8A 5B12A 2BMAA 4YT4A 1HDCA 4RZIA 3VPXA 4N54A 5JBIA 3C1TA 3RFXA 3W8FA 1TA4A 4C4OA 2X1HA 2GF2A 2DPHA 2FSVA 2FR1A 3F4BA 3HUDA 1TB4A 3WGYA 1U1IA 3JQBC 2PH3A 3ZU5A 4OGWA 3ITDA 3U5TA 1E0DA 3I83A 3WSWA 1Q0HA 2GN8A 2VCYA 4BGEA 1ZBQA 2GGSA 4IDAA 4O5OA 4MKXA 4BNVA 3GDGA 3PK0A 2J3JA 4XYBA 4WLVA 2DUUA 3OH8A 4P4NA 1IB6A 1XWFA 3GN1A 4Z9FA 4QT0A 4CMHA 1B3BA 5G0VA 2HU2A 1UDCA 2X23A 5ER9A 5T5QA 1R0KA 3JQAB 4WKGA 4DXHA 4XRRA 4IMRA 1T26A 4E2YA 2FZEA 3GEDA 3HB4X 3PIDA 3PZBA 3VZRA 3BMQB 1GU7A 3Q9UA 3ZZNA 4CV3A 1SO8A 3IUSA 3QWFA 3AM3A 1ISFA 1H2HA 4FN4A 3KYCB 3M1AA 5CAEA 2JD0A 4FCCA 4QQRA 2VUTA 3U4CA 2LDXA 4ZN6A 3I3OA 4GH5A 2OGUA 3E82A 3RBVA 5T64A 3WDSA 2QRJA 3JD1A 3JYQA 1WP4A 5J23A 4TRRA 4CMJA 5AXAA 4Q3BA 3PQFA 3UGKA 2TMGA 3GVHA 3E9NA 4Y6PA 3ZWOA 2I67A 4WASA 3F3SA 3NGXA 3Q6IA 2JCXA 3FRJA 4AJIA 7ADHA 1PS9A 1LRLA 4LGVA 4UREA 4NBVA 1PQWA 1NAIA 1ENOA 2HMWA 4J1TA 3UCXA 1OC2A 1ZNQO 1DOHA 4XRGA 1E1NA 3BHIA 4GL4A 1JU9A 2OXIA 4OOEA 5JFOA 2B4RO 4IJKA 4A73A 3I52A 2CUKA 4BNYA 3ENNA 1F06A 3R1IA 4J1SA 3OIGA 5FYDA 2Q99A 4N5LA 5DOZA 3IJRA 1A27A 3K30A 2GPTA 3AJRA 2DKNA 3HJAA 4W7IA 1GEEA 2BELA 1E3EA 4OMUA 4XDYA 3JQFC 2Y0EA 3ZNQA 1ISHA 2YV2A 3GRPA 3UOGA 4CODB 2C07A 4QECA 1KEWA 3EYWA 4XYEA 3OFSA 4L73A 1MXFA 4JP3A 3V8BA 3NGLA 5CFZA 3WFIA 4XQEA 2VWHA 1T2FA 1Y1PA 3KOUA 3RUCA 4QSMA 4HY3A 4GX1A 1G0NA 1ISGA 1DHRA 4YCAA 2O23A 4PLFA 4YRDA 1LA2A 3GA0A 3AUSA 4GKVA 5DN9A 4MVJM 1ONPA 3ZWVA 3ZV5A 5C7IO 4IJWA 1KOLA 2TMDA 4JXKA 3AY7A 3H5AA 3KYBA 4UEKA 1XGKA 5K1SA 4W82A 4B7CA 5KVVA 1FK8A 5EQFA 2CDBA 2FR0A 2YJZA 3CXRA 2WYUA 4RPKA 3UCEA 2YDYA 1DFGA 4R68A 4ALNA 5JYDA 1ZW1A 4A27A 2BD0A 3HSKA 1XELA 4A10A 2VHWA 1Z6ZA 4Z6KA 3FCOA 2R6JA 5BNIA 5A06A 1GY8A 4UVEA 1WZIA 2P4QA 4BO0A 1TLTA 2PH5A 9LDTA 3K9QO 3L9XA 2FPPA 1YL6A 1JQBA 4IINA 4KWIA 4QUKA 4Z0TA 4UAGA 3U4DA 2Y1OA 3LC7O 3H9UA 3RUEA 1E7RA 1I8TA 1ID1A 1RM3A 4FFPA 1UH5A 3ITKA 2CY0A 2NVBA 5BSEA 4CLEA 4Q3DA 4RF4A 8ADHA 3DZKA 5KKAA 4P4GA 3D1LA 3PWSA 1XG5A 2CVOA 1HYHA 2O3RA 1KEVA 1OBFO 3CPSA 4ZVVA 1VJ0A 3L0DA 3WTBA 3ZNPA 2DPGA 1D7OA 1ZK1A 1Y9EA 3O38A 1LSJA 1S6YA 3OQBA 4HUJA 4FDAA 3OEYA 1NASA 2Q4EA 4FFOA 2Q1UA 4PG8A 3VAZA 4OYRA 2DU8A 1DC4A 4WGGA 4YAJA 3WXBA 4DBVO 3GVIA 3L6DA 3EHEA 1E7SA 2NTNA 3DHEA 5TJ9A 1QMGA 1SMKA 3ICCA 4CUJA 2CSUA 3C85A 2V6FA 3TOXA 3H7AA 3Q0EA 4IXWA 3IKTA 1EUZA 2A35A 1R12A 5LDGA 1BW9A 4YT8A 4HFJA 1FDVA 1E3WB 1NHWA 5F5LA 1QKIA 1U8FO 3JQ9A 2Y1FA 4KQWA 3DAFA 1AHIA 3K8ZA 1FJHA 3D4NA 1ORRA 3TF5A 1E3LA 4YA6A 1HL3A 1E3WA 3GPDG 3ETEA 3C3XA 4XYMA 4E33A 4PVDA 4FJ1A 3ZWPA 4KDFA 1VL0A 1P1HA 1U28A 1VKOA 3AUUA 5JS6A 1RM0A 4DREA 2PKQP 4CUZA 1Q2XA 1VJ1A 1ARZA 4CM7A 1W4ZA 3SBOA 1UP4A 4YT5A 4BNLA 1Z7BA 1VKNA 2DUWA 3PDUA 3G49A 2DQ4A 1ZKMA 3GT0A 3OQ1A 1EVJA 3I4CA 2B36A 2PK3A 3WGGA 4INAA 3I9KA 4WLNA 1NQ5A 4J0FA 4CM1A 4BNKA 3E5MA 5GMOA 2BFPA 4TZKA 4XDZA 4D3DA 4D3SA 4EJ0A 4PN3A 1H6CA 1PZFA 2HO5A 4OM8A 5L4SA 3LDHA 2GN4A 1PZEA 2QYTA 3E6AA 4WLEA 3CIFA 4D44A 2HDHA 4R1TA 1N5DA 4XZ3A 2AQKA 3WB9A 1HZJA 1C1DA 2I6TA 4QFDA 1ULSA 4I1IA 2E48A 3A14A 3PGXA 3HDJA 4CM9D 4OO3A 2X22A 3DXFA 3H4VA 3MJEA 3VVCA 3RKUA 3OETA 5BQFA 3HQ4O 1WW8A 2J5QA 4UVIA 1Y6JA 1VSVA 2V6BA 5I8ZA 1M66A 2HK9A 4F46A 3V2HA 2VRCD 2Y05A 4JCOA 3ZW9A 3ETGA 3IL2A 1F0YA 5DBGA 5AVOA 1UJMA 1D1SA 2AEFA 3VH4A 4E31A 3OJ0A 1E5LA 3ZNOA 1QRRA 2A94A 1PGQA 4HFRA 4DTIA 5KVCA 4IDGA 3Q3CA 3JQ9C 1UR5A 2QG4A 4BMNA 1PJTA 2GERA 2BI8A 2RIRA 4B4UA 1K3TA 1E77A 3OJOA 2Y68A 4NR0A 3DTTA 1MA0A 4MOWA 2RHRA 2O50A 4ITUA 4BQPA 2V6GA 1PX0A 3GUCA 2WM3A 3AUTA 4BKUA 2EXXA 3PP8A 1VSUA 4LSMA 1XDWA 3V1TC 5H83A 4Z3KA 4RPJA 1R4NA 4BHTA 4ND3A 4Z0HO 4MIOA 1NTOA 4EUFA 1HYGA 4WPGA 4YWJA 1LQTA 1QV7A 1I2BA 1B14A 3DC2A 2YYYA 4ZJUA 5A1TA 2JAHA 1DJQA 5HBRA 3AM4A 5JYEA 2HLPA 2AXQA 5KTKA 3F9IA 5ICSA 4TMFA 3NJ4A 3E9QA 5COAA 2ZYDA 2V7PA 4E6PA 1V3VA 1QORA 1YQGA 3BMOB 5KVSA 5L51A 1P1FA 3INTA 4Q3NA 4ZU3A 2QRLA 4DLBA 2V6MA 2Y1EA 1E6EA 4XCVA 5TT0A 4YPOA 5LCXA 2FN7A 3TNLA 3BMOA 1KEPA 1N1GA 3RBZA 4IIUA 1PTJA 3T4EA 1M6WA 1P0FA 4NBWA 5IG2A 1WLYA 5JLAA 1QYWA 1RWBA 2NM0A 5DCWA 5HS4A 3O26A 4LRSB 3W1VA 4CLHA 1T2CA 3QWIA 2NACA 1T2DA 3HDYA 1ZK0A 4DLAA 3D64A 4XB2A 5JCXA 2E49A 2UVDA 4EUEA 5L7WA 1O0SA 5CHEA 4XR4A 4W6ZA 4XQ9A 4CLXA 3P2YA 2OZPA 4LRTB 3L77A 3I9LA 1Y7TA 4XJTA 4LISA 1SOWA 2ZQZA 5EL0A 4YQYA 3GC6A 4R69A 1G6KA 1MG0A 1ZCJA 4BO9A 1PR3A 3OMLA 1HDYA 4MP3A 2Y1GA 1U4SA 3FNHA 4BNGA 4JBIA 2PKRA 4RLSA 1GEGA 4BNFA 3AU8A 1UXJA 4KUEA 5CDTA 2GZ3A 2J8ZA 3DOJA 2Q3EA 4E2ZA 4GSKA 3NT2A 4R4JA 2E37A 2XAAA 3M2TA 2IZZA 1UP7A 3TZ6A 2HK7A 4UUPA 4NK5A 2C0CA 1VJTA 4I5DA 4CL8A 4OAQA 5EPOA 1DAPA 3I4FA 2WE8A 3QW2A 3AM5A 2FPGA 2W4QA 3WBFA 5H82A 1Y8RB 2C82A 4Y6SA 2JD1A 3JD0A 1GUFA 5G2OA 3WICA 3AFNA 4CR6A 1DSSG 3V2UA 3FPCA 1DFHA 2FPIA 1KC3A 1PS0A 2DLDA 1EVZA 3H2SA 3DMTA 4X54A 1SCUA 3R0IA 1QP8A 1UP6A 1LRKA 3Q2KA 4BB6A 3WBBA 1EK6A 3GY0A 3N7UA 3BTSA 4KTVE 5JC8A 4OH1A 1GR0A 4D3FA 4XGKA 4WK6A 1HLPA 4IGEA 1UXIA 3LT0A 3HN2A 1MUUA 2FY8A 3ADPA 1GQYA 3Q9NA 3G79A 3ZCXA 4W99A 1IE3A 3UAGA 1YBMA 1ZSNA 1BXKA 4YACA 3R3JA 2ILTA 3JQEA 4O1MA 1BVRA 3QRWA 5TQVA 2QIOA 2Q49A 1E7YA 3A9WA 3NTRA 4M49A 4A5OA 3ULKA 2DBZA 1NYTA 2UAGA 3VPFA 3WJAA 4WOJA 5IJZA 4LCJA 3W4JA 2VZ0A 3HDQA 3BHJA 3PFFA 5L53A 4CV2A 2C7GA 1LLCA 5JC1A 4YVFA 1NR7A 3PFWO 1HDXA 3JQGB 4OHUA 1PQPA 3F5QA 1ISIA 4ZQEA 3UHAA 1Q7BA 5JXWA 3PHIA 3GQVA 4GX2A 3ZN2A 1SZJG 5A5FA 4EEXA 1D4FA 3GH3A 3K2EA 5U4QA 3OA0A 4O0LA 4CUKA 2DAPA 1U2DA 2YHUA 2UDPA 4H7PA 1BGVA 2CVQA 4Y67A 3UICA 4B79A 5I8WA 2C59A 3LC2O 3KLPX 2ZKLA 3FNGA 1LLQA 4IPTA 3INRA 1VRWA 3HNPA 1HETA 2Q4BA 4ND4A 4U0JA 5JCJD 2IRWA 4NHEA 4WEQA 3QSGA 4XQGA 3DBRB 1LDGA 3H9EO 4YAIA 5L7YA 1DJNA 1L1FA 1W6UA 1YL5A 4CL3A 5BNTA 3FR8A 4Z3DA 3FF4A 3GR6A 4CM8A 3JYLA 3DBRA 5JDIA 2D1YA 4D0RA 3C7AA 3HG7A 3WSVA 2ZTLA 3K5PA 2YDXA 5F1KA 2B83A 4C7KA 1B3RA 3ZWBA 5F5NA 3ABIA 3I9MA 3MZ0A 1PJCA 3PJDA 3WGOA 4DA9A 4RVSA 4R9RA 3BTVA 3JSAA 1ZMOA 2AQIA 3RUFA 5TF4A 4BNNA 4ZRMA 1GADO 2VYND 1WVGA 4TVOA 4A26A 1X1EA 2HMSA 4M54A 3KV3O 2Y67A 1XR3A 3OQ6A 3ZNNA 3BTUA 1JTVA 3ORFA 1MGOA 3ZDFA 2GZ1A 1OZAA 3C1OA 4NFSA 4E2XA 4I5GA 1E7WA 3COSA 1HKUA 3HZZA 3IKVA 2VWGA 1C0LA 2F1KA 4CLOA 1CERA 4DLLA 4PGFA 5C5IA 4XJSA 4BO5A 4R54A 1XHLA 2I99A 1GPJA 1JWBB 2EGHA 4YTEA 3ZGYA 2I66A 5JMPA 4TKMA 3JQ8B 4Y8VA 4IDEA 4M1QA 4J4TA 4PZDA 3KHUA 3VTFA 1CJCA 5A03A 1BMDA 3U4HA 4BO2A 4JBHA 5CP8A 4YAGA 3D0OA 4XD2A 1U4OA 3JQ8A 3C7CB 4R5MA 5I9MA 3JD4A 1DIGA 2WYVA 3ZHZA 2X9NA 2ZTMA 4B3HA 4E12A 1P74A 2J6IA 1AGNA 3QVTA 2JKVA 1NPDA 2VNAA 4IIVA 3WYBA 1XA0A 3GOHA 5I9NA 4FQ8A 3MCVA 4P38A 3GUYA 5C7OO 2Z95A 3KUXA 2Y1CA 1BG6A 2X0JA 5FI5A 4GMFA 2D5AA 4AJHA 5JDIC 3SVTA 1J49A 1R0LA 1SB8A 4TRNA 5B4UA 4J6FA 1DLJA 1EUDA 1KY4A 4RVGA 5IZCC 1E6WA 1CETA 3AU9A 4E5MA 1LSSA 4OL9A 1TXGA 5KJCA 1F14A 5JY1A 3BMCB 3RAJA 5DOVA 4ALLA 1Q7CA 4R9SA 4YR9A 3DQPA 3JQAD 5ER6A 1HWYA 2DC1A 1LC3A 1A5ZA 3BMCA 5U9CA 4WCDA 3ETDA 3E1KA 4J7XA 2H1SA 4ALKA 2Q46A 5KCZA 3ADOA 4L9RA 3OEWA 2X86A 4LK3A 3W6UA 4CQMA 1PU2A 2QZ9A 1NVGA 2G5CA 1JAXA 4DL9A 1KYQA 3SJUA 4U6QA 2EERA 1HLDA 2J5RA 4AJ2A 1FDSA 1CF2O 4H15A 4ZA2A 3ZWWA 4BKOA 2VQ3A 1KEUA 3CH6A 2YW9A 4YJFB 3GHHA 1HE4A 4ZRNA 2A9FA 1W73A 1YQDA 3VDRA 5EMHA 4RVUA 1UUFA 3H9QA 3UXYA 4B4OA 3U3XA 1E5QA 2B37A 2PZLA 4YJFA 1PL7A 3LC1O 4I8XA 5I7SA 3CKYA 4FB5A 1WMBA 4B4WA 1QLJA 3ICPA 4ND1A 3OM9A 1DPGA 2AE1A 3AY6A 4PLPA 1AUPA 4LVUA 2BLLA 4CM3A 2OL4A 2W90A 3L9WA 1QYVA 4Q39A 1CWUA 4BOYA 1JKFA 4QFCA 2W2LA 2ET6A 4A03A 1KIFA 4K1LA 3TFOA 3D3EA 4BGUA 3LF2A 5THQA 1GL3A 2YY7A 3TZQA 3I1JA 3QIVA 2RH8A 3AY3A 4NK4A 3AI3A 1QYXA 4FC6A 5TIIA 4AJOA 1H6DA 2GR9A 2WD7B 4MO2A 4EGFA 2BGLA 3D4OA 3WQRA 3ZWCA 2W98A 1LX6A 3WX0A 4ZICA 3ROKA 4C7JA 4DQVA 2IYPA 4IMPA 2HMVA 1ENZA 5F1PA 2Y66A 4Z0PA 3TRIA 4MIYA 2X6TA 1AE1A 2WD7A 4DYVA 2NVUB 3WJ7A 2H5LA 2ZIZA 4FOOA 3K73O 1O95A 4I9UA 5TT1A 2CFCA 2FRDA 3CZRA 4XIYA 4E13A 4YT2A 4JBGA 4L76A 1PEDA 4MKRA 3S8MA 1LLUA 2NVUA 3ZI0A 2NNLD 4UEJA 1M6HA 2G1UA 4TQGA 1I3KA 1WDLA 1YJQA 3NDIA 1RM4A 5KJ1A 5TSDA 4M55A 1YONA 5G0SA 2VTEA 3NDJA 4NI5A 3DZFA 1IUKA 2JHFA 4OSOA 2OOSA 3NTQA 1IZ0A 4P22A 3TL2A 4YYZA 2UUOA 1IPEA 4J0EA 5IXYA 4DIBA 1CIVA 3EVNA 1XSEA 3RIHA 4Y6RA 3VHRA 5AXCA 4HFMA 3WQQA 1LU9A 4GMGA 4PLHA 2BFOA 2NSDA 4HADA 3PI7A 2B4QA 5CPFA 4JLWA 4E5KA 4F6CA 5G0UA 3AOEA 4CMIB 1A71A 2EV9A 3L07A 2OORA 4L74A 4NG5A 4QTZA 4WNCA 3TZCA 3LT1A 2C54A 4CMIA 1DAOA 5BSGA 2O7QA 3TZHA 4J4HA 3U62A 2OP0A 3H9JA 3OBBA 1LDMA 3P5SA 1IULA 1P44A 5DDIP 1TI7A 3DAPA 3H8VA 3IAHA 4TWRA 3JYNA 1E1MA 4DYDA 2PKQO 2Q2VA 4BMVA 3FD8A 3U49A 3S2GA 5CEFA 1LLDA 3GNSA 1MLDA 5JNLA 1YH3A 4FJ0A 1JVBA 5TGDA 3WIEA 1DRWA 4AL4A 3WNVA 2NADA 3L6EA 1C3VA 1DFIA 3NDRA 1ENPA 1SOVA 4NU6A 2O7SA 2X5KO 4HX5A 2GSDA 1B26A 1VC2A 3HFSA 3UN1A 2O3SA 3T4XA 2PV7A 4MIEA 4IZIA 3VVBA 1QSGA 4IQGA 1NPTO 2FSSA 4OKNA 3ZU2A 1XU7A
chains in the Genus database with same CATH superfamily
2WLTA 1GNVA 5BMOA 4OSPA 1O95C 3JPYA 3GFBA 3UWKA 1V0JA 1V9LA 2JLRA 1PVVA 1JQ5A 1X7GA 2AI3A 3AUJB 3CR8A 4JH0A 2FYTA 3OZCA 1H94A 3C5EA 4BFSA 4PLYA 1VL8A 5DYWA 3ZU6A 2WB4A 2J1LA 1NRIA 4ZAFA 5A2QA 1TJ4A 2IYSA 3ZD7A 2BM9A 3EVDA 3WGUA 1PZGA 3NG1A 4S35A 1GV0A 1U0EA 3SZOA 1PT9A 1QG2A 1X8JA 4WEOA 1UBUS 2D5IA 2PCJA 1GGJA 2VG8A 3KIPA 2H1CA 4LWZA 5AUQA 2C84A 4NFHA 1B42A 2CDCA 3ZU3A 1L5MA 3MRVA 4R1NA 5B3KA 3AL3A 5B3JA 4HNHA 1DBIA 4J2TA 4RV9A 3IT2A 3CM0A 4Z4QA 3NB0A 2KLBA 3AWDA 3MTJA 3PUYA 5HDBB 2GNPA 4C5CA 1K89A 2PQMA 4GKBA 4JKIA 2YQ5A 4QEDA 3V4SA 3ANLA 3A1DA 1VL2A 4J29A 4V0ME 5DBFA 4EO4A 4YRBA 1YJCA 1N3IA 4AY2A 2C1XA 3AOEC 4LY9A 4DR1B 3KUDA 5I48A 1B23P 1V8BA 3EF3A 2HRDA 4RFSA 3TSWA 3X1JA 4AG6A 1C7FA 2PL1A 1FFCA 1TT5B 2C1ZA 2VNHA 2VP2A 3I6YA 4YRTA 3H8SA 4MGZR 4W7HA 3T7CA 3UKOA 4H1WA 3O3NB 3FUXA 1RT9A 2QQ5A 2AL7A 1APBA 3AERA 3EXIA 3TRHA 3B1VA 3VR4H 1M3SA 2ZQYA 1UWKA 4B35A 5IKMA 5EE3A 1SBTA 1HURA 1U5BB 2CXPA 3PUKA 2BZ0A 1G64A 1H2XA 3HJCA 4OREX 1YOBA 5HGJA 1L4KA 1JHUA 2XMDA 3HBLA 1XEXB 2BBTA 4GE0A 1XEAA 1AUVA 4TL7A 3RRMA 1A98A 2I3GA 1GKIA 4PIPA 1H9BA 5TS3A 3MRTA 4FMCF 3ME5A 2JAPA 5I6DA 1R9JA 2GCPA 4UHHA 2WWGA 1KZHA 3WYGA 2AKEA 4F60A 4A8HA 3OU7A 4RK7A 5I7OA 1ISJA 3OZAA 4PX3A 4Y2YA 1O94A 1R6DA 2JIZA 4PS1A 2GYUA 2O3UA 2QXYA 2JK0A 4C87A 2IS2A 4FZ5A 4FR5A 5JROA 1RAHA 4XPIA 3JARA 3OBIA 1YGYA 4AUNA 4C88A 4EM6A 1E3SA 4OK5A 2AOWA 3HXLA 3OU2A 4MRNA 3DZHA 2QLJA 1AQIA 2AZTA 1EWRA 2MSEB 3DL7A 2ANBA 1R8XA 4O8ZA 1DNPA 4QPJC 5EIAA 5K4AA 1WXXA 4MULA 1T3SA 5I9TA 1XALA 1ZC4A 3GQBB 3QEAZ 1ZICA 1C9KA 2EZTA 2PD4A 1CQIB 2A9KA 1LQ2A 3R0XA 4J0QA 3Q41A 4TWJA 5A02A 1O5OA 3I4LA 3L40A 5I7EA 1G2PA 1T1IA 3BJIC 1P2FA 4LJ7A 4DLTA 1UXKA 2AA3A 2VDRB 3EEYA 4UUAA 5HF6A 4OA8A 3OZSA 1BX1A 4A0RA 3M5PA 3PE3A 3VOSA 3KL2A 1LDYA 1GNRA 2YY6A 1GCUA 1YU9A 3RKSA 4HAVA 3FNRA 1VP3A 4RV5A 5AVRA 3LBNA 3A3NA 4IDPA 1RAGA 1SCDA 2IS1A 5ALJA 1UZAA 2ZRMA 1ZD5A 1U2TA 2D4AA 2VTDA 3C5VA 3DBHB 2B21A 3EW7A 3KRTA 3KOYA 3PC6A 3PUHA 4GVLA 3SP1A 3H19A 3CTMA 4QXAA 3T06B 1JJ7A 2P2LA 1G98A 2PVSA 3UAWA 4EFMA 5EMKA 3T9FA 4DMRA 2RHCA 1SA0B 3FTPA 4FFBA 4G0NA 4OUKX 4C30A 4YXWD 3AONB 3EOZA 4GOJA 5D8DA 5HK8A 1Y3CE 2ID8A 4E11A 2JNWA 3M4ZA 1NY5A 3LT2A 4DYHA 3F7OA 1K4MA 4MR9A 4L0DA 3LOPA 4DG8A 1V3UA 1FNNA 4NMMA 1CR0A 2Z3VA 3WRWA 3V7FA 2GBCA 4R40A 1R5OA 7ABPA 4JUDX 4DQXA 1VLLA 5D1HA 2PS3A 1GLNA 1MOZA 5C9ZA 3OQNA 1L1EA 2R65A 3I8OA 4HR7A 4GMKA 2AF4C 4YLGA 1B0AA 4TL6A 4D92A 1FYXA 1IUNA 4JJ6A 3ZS8A 1K2WA 2ZANA 4QU0A 2JGDA 2IL1A 1U1GA 1O9BA 2ACKA 2EJTA 1I4EB 3T54A 1HI9A 2JH9A 1FXWF 1NNSA 4RYLA 3PFKA 3OIFA 1JHPA 2IQIA 4HKTA 5J47A 3IOYA 5DULA 4A1FA 1NQAO 4N8SA 2ZRGA 4CTMA 1Q0QA 2GASA 1LQUA 3FWPA 3E7PA 3IMEA 3I12A 2MT9A 3IQIX 2Q7XA 3KJQA 4IF6A 4LYYA 3TCKA 3OJWA 5EG5A 2KBEA 4ND2A 5KQSA 1O54A 3GJXC 5DASA 1Z4QA 2RI0A 2W9XA 1SHUX 4H1VA 1F2DA 4HN9A 5A5VA 5HX7A 4R1PA 3H2ZA 2RHHA 3MGGA 4NOKA 1Z75A 3TL3A 5LQRA 1C3EA 5TVKA 4FGSA 5T6BA 1FTGA 5FD8A 1SXJA 2JZNA 4LJAA 4BCCA 2HRBA 4DDKA 3LJKA 2H6EA 5IFLA 1NVDA 2W6JA 3GVCA 2P5UA 2W4MA 1PJSA 3FYHA 2EP5A 5KJEA 5BMVF 4IDCA 5IHXA 2B0JA 1LK7A 4YMTA 4EKYA 1QCCA 2JFQA 4LBZA 2OBLA 3R20A 3DF9A 3BXOA 1VB5A 3L6OO 4FOLA 4IH4A 3WA6A 3PTZA 3GG2A 3BJEA 2I6XA 4L0CA 1JR3E 4KVFA 4ZAZA 4QO8A 1ORVA 2FWAA 1F8GA 2VJCA 4IXTA 4KRGA 1K27A 1R3DA 1KR5A 1RWPA 2W4IA 3HCWA 3HPQA 1L5NA 1DARA 3USES 4ZIRA 1O0BA 2WMDA 4FFRA 4WN9A 4EQZA 2YVUA 4RF5A 4MV4A 1U9CA 3CWZA 3V8NA 4BX9A 1P2SA 3EA0A 1BGWA 1ULAA 2GPBA 5EKDA 5DHAA 3VUFA 1QP4A 4JI1B 1RQGA 4NFLA 1NSFA 2HKIA 3H3JA 4I4TF 4S1NA 1JDSA 4A8JC 1CJKC 3FJOA 1DTEA 3F71A 3G88A 3ISJA 1LSOA 3F3YA 1V2GA 3VTAA 2JCYA 5C8YF 2AT1A 1X0VA 4F4DA 1DAFA 3GLSA 4IAOA 6GPBA 1GQQA 2ZTSA 3EZYA 3R7DA 4YAKA 3GRAA 1E79A 3SS7X 1QZUA 1N7GA 3IQDB 5B2ZA 4AUKA 1FP6A 1QTIA 10MHA 1ISMA 1QB7A 3HFRA 2Z30A 3NHYA 3O84A 2ZSUA 5IK2D 2ZYAA 2VQFB 1I3NA 1V26A 3VR5H 2QN9A 4PLVA 3WS7A 1HBJA 1K8XB 1A88A 2PWZA 3G0IA 3HZHA 4O6VA 2GYVA 3ZDRA 3UUGA 3OEHD 1XRRA 3MHTA 2W37A 2AD1A 5LU9A 2OCIA 1EI9A 1NF8A 2NUTB 4UEOA 4L4SA 4BFXA 4DANA 4BC0A 3Q3VA 2IS4A 1XRLA 1LI4A 3M82A 1BX0A 1FZQA 1RXYA 5LP6A 3U7IA 1B6SA 3DS8A 4JIGA 2VSXA 5F1YA 2XLCA 2YUTA 3FWHA 4HCJA 1LF0A 4M46A 5ALYA 4EKNB 3STWA 3I92A 4ERXA 1JLSA 1SC4A 2QRVB 3AIKA 4TQ9A 5AMXA 3SQLA 3H84A 5DO9A 1SKQA 3WC4A 1JBKA 1S9HA 2Z4SA 1S8FA 3BE4A 1TFUA 5HK9A 2WHRA 2XECA 3PNKA 3SOPA 2GYYA 4XQ0A 4E08A 3PL1A 1Z12A 4WBXC 4YONB 3ILXA 4UBLA 1E0AA 4N1AA 2CLHB 5HKKD 3G9QA 3PHGA 2HRZA 5JYCA 1PI3A 4DV6B 2X6QA 3QVVA 2QBYA 1LPSA 4KXWA 3CRQA 4EHBA 5C7YA 2Q50A 4G0QA 4GYJA 4BZZA 3H5TA 5JH7A 4ISCA 4RQUA 3PPVA 1UINA 1V4VA 2ZRDA 3UAOA 4IFTA 1R15A 2WMOB 4HVTA 5K03A 3GZNA 1V7ZA 4MUXA 1YKGA 4DLZA 4P8RA 3RAGA 3ZLUA 2UV8A 4B2IA 2Y76A 5KJFA 2VJMB 4MMXB 1CU1A 2V7QD 4D81A 1KVTA 1U8EA 3VR1A 1SQFA 3QXJA 1XZJA 3LVRE 4JITA 1II8A 5TDHA 1DELA 5M29A 3U9TA 1M76A 2J9FA 1H2BA 2V0GA 1XYVA 2W5UA 5A05A 4V1CA 1EFAA 4IIDA 4HDSB 1CUIA 1E59A 2G9QA 1K97A 1GNQA 1NVVR 3V7NA 2C4UA 2VJKA 4INZA 1JSZA 3H86A 5FI3A 4TSFA 3TD9A 4WNYA 1QH9A 3L41A 1A9TA 3F73A 3HY6A 1SQGA 3UOAB 1U3WA 1BWSA 4NBNA 1Q44A 4D8WA 3F1KA 4ZTZB 4RK0A 1NVTA 3ONFA 1TD1A 1IYZA 3E0QA 2X7XA 2E6UX 2EP7A 1S7CA 4EBBA 2MU1A 3RPEA 3IEIA 5T41A 2G4VA 1TM1E 5CYGA 2UVPB 2BE7A 3PWZA 4Q18A 4X45A 2IPXA 1VSBA 1UMDB 3PGKA 2ZUUA 4AKEA 4E5YA 2QJRA 1MPTA 1P4HA 2BGUA 2C0PA 4QUIA 4E5DA 1TZMA 1E64A 4JEUA 4TLEA 1OV6A 4HH3C 2FEWB 1XAJA 1ULUA 2ZK7A 1NXQA 3OD5A 3QEJA 4TL8A 4YMHA 4QJ5A 1G7RA 1R74A 1HTBA 3VKUA 3ZLVA 1NUUA 1UWCA 3GLHE 5E3JA 2EKBA 3VRHA 2DFTA 1ZIPA 2MOKA 5BV2P 3I72A 2JFHA 4E1AA 2H1LA 2W93A 3WLOA 1ZQ9A 3OE7D 1Z7EA 2E82A 1TEVA 2EQAA 1HYQA 2W6PA 1SEPA 2WTMA 3NOQA 2XMCA 3DKKA 3DZIA 3MB8A 3H6KA 3NEAA 1ACJA 2YWXA 3I37X 1NBOA 3G6WA 3DVAA 5CT6A 4FDLA 1Z4MA 5F1OA 2X2EA 4XQCA 5BSTA 3MGBA 1SCIA 5I45A 2HADA 2J6CA 2ZXUA 2FQQA 4UTNA 3S40A 3K1ZA 5CBPA 2BCGY 3LGSA 2PN1A 1SNYA 4IIJB 3BJMA 3DW1X 2B6HA 3E03A 5FJIA 5K01A 2J87A 1NZDA 4UE3S 2A6PA 1ADFA 3WO1A 1VG1A 4GI3A 1IK4A 2FX3A 3NKLA 4OXIA 5A7FA 4KVZA 3B7PA 3FBTA 4TTSA 5EVCA 2XQJA 3M1IA 1QO0D 2KLHA 3ZV3A 5K0ZA 2I6SA 3K9HA 1FU4A 5D86A 2OAGA 1I1NA 2PAAA 1RKBA 1YZKA 5FTJA 3QP9A 4I4NA 3IOMA 3LBIA 3PUJA 4MUIA 4JA2A 4QHSA 2A5DA 3SJZA 2BFDB 4WADA 3L7YA 1BMTA 1FU7A 3LUBA 1AIPA 2IEBA 2WWWA 9ATCA 1A1VA 1XPRA 4G0WA 3EXG2 2YWBA 2CXTA 3N2NA 2R8XA 1YHYA 1KF0A 1O96B 1WCIA 3DCJA 2X8WA 4JLJA 2P5YA 1U90A 3RC2A 5IBPA 4PO8A 2ZWOA 1UJ6A 4UJ3A 3W5SA 4CDRA 4DQKA 2OZLB 4LXIA 1OPXA 4H9GA 4AJEA 2C0QA 3OQMA 3LDGA 4FINA 2PO7A 3ASZA 2WQ7A 4J0GA 1HLFA 2MSDB 3Q7EA 3BCSA 1PFWA 1C9JA 1E3IA 2AJLI 3EUEA 4LNUB 2P6NA 3HWRA 1PSWA 2GLTA 5ALNA 3S3TA 3SMVA 4KBGA 4XWYA 1P8AA 1ESCA 4UCFA 4OJYA 3AEZA 4MUMA 2HW8A 2D1RA 4R5HA 1W4BA 4EHHA 3NJ8A 2WNSA 3SLKA 3PL5A 4F56A 1QJCA 5A9RA 3UH1A 3RC3A 2J7PA 1FNBA 3ILYA 3A1WA 4QHTA 3NAQA 4YRAA 2O4UX 1IRIA 2Z08A 1UFVA 4QRDA 1TVCA 4GMDA 1P7PA 5IJ9B 4DEXA 1HFEL 4EPWA 2XBUA 3DE7X 4II2A 4K9PA 4D42A 4EI7A 1J5XA 1X7ZB 3P5BA 2MMCA 2DHQA 4X7PA 2VDWA 3M1YA 4QOHA 3NBFA 1EP1B 1SU8A 1QZTA 2O8CB 1PGPA 3IQEA 1KQGA 1UAYA 5E95A 2QUHA 3HA7A 2JVIA 2A9OA 4Q19A 3CVWA 4RJTA 4ND7A 5E2BA 4DZTA 4M0MA 3SFVA 2FLVA 1E7MA 2RJ3A 3OP1A 5JAHA 1A5AB 2I87A 3PCTA 1AOXA 1D8AA 3DTVD 3OLQA 4LN1A 3GLVA 5EZ5A 1EFDN 1DEXA 3DFMA 3KWMA 1Y33E 1Y6RA 1YBVA 1J33A 2BDUA 2VTKA 4OGLA 4TZ6A 1EINA 4R6XA 2WJYA 3DP9A 3GEHA 4DJEC 1EX6A 1PTKA 3E5NA 3SKXA 1KI3A 4ACAA 5JSFA 5KHOC 5FA5A 3X43A 3E4CA 2VDUE 4QUDA 4BMSA 5KNCH 2VVTA 2RGWA 2PZAA 1TL7C 4BATA 5K6AC 1AS2A 4DXAA 1PT5A 3E5HA 4K6FA 1DIRA 1ISSA 3AGQA 4OXNA 2DHRA 3O3OB 2O8FB 1VPWA 4H7JA 2Z56A 1PJ2A 1QVRA 2YCLA 3U9SA 2JRLA 2G76A 3LWDA 1P1KA 3FVWA 4DMMA 2DT5A 4PRKA 1UXOA 1QP0A 1FP2A 2Y9PB 4DMLA 2I4TA 1Z73A 3AZQA 4Z9XA 1VKRA 1YAJA 3VZQA 4OQZA 4FMBB 2AG6A 2FEOA 4CMEA 1X2EA 1P17A 2P9QA 3TLXA 1DBQA 5BN5B 2WUEA 3ETCA 3WGTA 1W8DA 2R6CA 1I13A 2HTEA 4R51A 4NZNA 4J4BA 3DLHA 3P2MA 5DV9A 3CRVA 4LYGA 2R4UA 4CQLB 1DLIA 1BVUA 2QVXX 1SB9A 3Q3EA 4BEVA 1KVRA 1FTYA 3AR4A 1F2UA 4Y9DA 1XRMA 2XNKA 3EOBI 1NQOA 1ZGJA 3G7SA 2CXQA 1E7QA 3EXHA 4JEMA 3S2EA 2D00A 4ZDJA 5LP6F 5K0EA 2FAXA 1N6PA 1ETUA 5HKOA 2PWYA 1P60A 2ZQ5A 5D51S 4P83A 5H70A 1QG0A 2ZRHA 3ELWA 4AECA 3W5AA 1XZNA 5WRFA 2VBCA 4PBRA 3GY0A 1S2IA 3KUCA 5JSQA 4WA8A 3KT6A 2ZBFA 3QTLA 1A9PA 3O82A 2HLDD 4KN6A 1H4TA 2BFMA 3KT3A 5ICMA 3OZUA 3FRIA 3E15A 3DYIA 1KEEA 1XKQA 3TLEA 4ZI2A 4O4IA 1N0IA 2PUGA 2IHVA 1FB5A 2RG1A 2X3YA 4XM2A 3L4BC 2PZ8A 1ES9A 3C1AA 2V74B 3DKPA 5CIYA 1QP7A 1YE8A 3SHWA 3EZ9A 2EKZA 2JA2A 5JH7F 1PJ3A 3IIJA 3D54D 4JJFA 1SG9A 3CQ9A 1P2UA 2X1VA 2G77B 4LS3A 1HDOA 4HEA1 3ZY6A 3VU1A 4KMOA 5CLLA 1XTIA 1NVVQ 3T7TA 2VOEA 2IEYA 2D0IA 3QHPA 3W2GA 4PM4A 3TYXA 2VH1A 1VSQA 2Q29A 3TKLA 1OFUX 1I3MA 2BFEA 4PLCA 2X0KA 2WUGA 3UMBA 4ZVNA 5JAZA 2E5WA 2NXWA 2YRFA 3C3JA 1JAZA 5FRDA 4YY3B 2ZVQX 1N25A 1IIRA 1Z82A 3MTGA 5BYJA 1IHXA 1SULA 1PGJA 1V39A 3N5KA 1XVVA 1J39A 5IN4A 3VYSB 2JCVA 5A4KA 1QOPB 9MHTA 1NC1A 2FZLA 2GILA 1GL7A 2NQ8A 3T5DA 4CG0A 4NULA 4H6XA 3PE4A 4O1IA 2EKPA 1DXHA 2C9ZA 2FPOA 4QX6A 4MQEA 1NYRA 3SXPA 3KBBA 5JVDB 3AEKA 4D4GA 1G0OA 4PZLA 4ZVLA 1NVMB 1TUEA 3FPBA 3LFUA 4AFNA 3THSA 2ZSKA 4M37A 1NUAA 4R2MA 1YZVA 1E2DA 3A4TA 1M33A 2L17A 4FVTA 4ZVQA 2C96A 3K9BA 3IV7A 1EFKA 1VYHA 2CMDA 3P9KA 3BAZA 4XD7D 1VL5A 4QASA 2NIPA 1M83A 1WU7A 1Z4IA 2QKYA 3PUZA 4BV2A 4H27A 4EGQA 5CT5A 1AMOA 1OC4A 1J7KA 4LOLA 3WMEA 1F4LA 3IJEB 1MB3A 4AZ0A 1YDFA 3KL4A 1IJBA 1S4MA 1E66A 2XXBA 5JWOA 3BFKA 1EXMA 3A2KA 5BN4B 2IXDA 3GELA 5DLQC 3EUWA 1IBMB 2XQFA 1NFQA 3R3UA 2I76A 3IDSA 2C31A 3NDPA 3FGZA 3SR4A 2MWMA 3U7QB 3PNPA 2WTXA 2RHOA 2AXPA 4KGVA 4IIHA 1VYUA 4HI0E 4OMDA 1R9MA 4FMPA 4N5HX 2CXUA 3AJEA 5ENVA 5BURA 3VZDA 5EVJA 2HYIC 1HEIA 2C99A 4LHWA 3ROMA 4A2QA 5BUSA 5TNXA 3OSUA 3R5KA 4WOPA 4LJRA 5LZ7A 3ROGA 3ZBQA 2PR2A 1J2YA 1GGMA 3HR7A 3Q6MA 3IDFA 1CLUA 3JY6A 3DWFA 3H11A 4M53A 1JDJA 4BO7A 3ZKWB 3T1YB 1ODLA 1UPCA 1AKUA 2PEYA 5J59A 4D4JA 3OY2A 4WCFB 4AJKA 3RC8A 3O90A 3EXFB 2VHCA 1FVXA 5CJPA 3KPYA 4JFAA 5DM60 3OMWA 1NQXA 2EQBA 3OQIA 4YNBA 1EDDA 4M76B 3TPZA 2I55A 3UKDA 1ZNYA 3OZTA 2NGRA 2YXDA 3N8DA 3ONEA 1NP3A 4KN8A 4LSGA 3Q8LA 1LUAA 4CKXA 3IMFA 5AIBA 3OOSA 1JZSA 5LMNB 1HSOA 1ZSVA 4YASA 5J4HA 1P39A 1D04A 5DSZA 2R8ZA 1FS5A 3WWZA 5EJ7A 3BMNB 1PJ4A 4FSDA 4CG3A 3I1FA 3KYDA 5L3QB 2OV6A 4PGGA 2F9MA 4BMOB 3KQLA 3B20A 3PHJA 4XI9A 4BNIA 3PX2A 2KYRA 1E1QA 2PIDA 2R84A 4COKA 4JWKA 4ECAA 1GRQA 3KEQA 3UNXA 3STYA 3JR3A 1UOPA 1SY7A 4JD5A 1GOTA 2X4IA 4YMLA 4QOSA 2PSDA 1LPMA 4ZALA 4BDSA 1SKMA 1U0FA 5JJLA 2OORC 5CXSA 2VF2A 4RA6A 1PV1A 3V46A 6LDHA 5LZ2A 4QYSA 2FZCA 4BASA 3A0RB 2W2KB 2IBSA 2QD5A 1RACA 4ITRC 4C4TA 1GR1A 1BCRB 2CHVA 2JAOA 5ALPA 4AZ3A 2P77A 3F96A 1GPBA 1GA6A 1Z0UA 1CSEE 2ID9A 4PAWA 1KPHA 2O2SA 5KOJB 4F2HA 3Q12A 4KWEA 2X41A 5IXJA 2BTOA 3RUIA 3KTAB 2XODA 4Z5XA 5MN4A 1RR6A 2OG2A 2Y1WA 2WFZA 3QGMA 3R0QA 4KBYA 4RO0A 1JS1X 2WV7A 3PU6A 2JAQA 5CK5A 4ENQA 1E32A 2C00A 3H5RA 5HE9A 4G5SA 1VA5A 3HDHA 2DFVA 2WF7A 1WDTA 3E22B 3BGOS 3R41A 4YRLA 1DJMA 1MU0A 4KIFA 4HQ0A 3USCS 2GO1A 2JFFA 3B7GA 3KWFA 1GTL1 4IQ4A 5KSYA 3O91A 4RHCA 2GAFA 4LYHA 2VBFA 2CYBA 1YE3A 5JCOA 1T5LA 2DM6A 3E48A 1K5GA 3EZNA 1H0HA 3A6PC 4IQ0A 4M9UA 2IZ5A 4GM4A 3PC8C 3OF2A 5ALLA 1B7GO 3ZQ4A 3EXEA 4EZEA 1R0CA 2DWUA 2XTNA 2WLSA 3IP1A 5A3VA 3RASA 1XNRB 1EE1A 2NZUG 5DLEA 2NLOA 4FFMA 2IODA 1Z2EA 5EE5B 1R4MA 1G3RA 2IIQA 3HLTA 3KZXA 4UE6A 3KETA 3K6JA 2MSLA 3CRZA 5GZ6A 4DSAA 2AVDA 3KDAA 2BZGA 1PEAA 5JFTA 2F1HA 1KERA 2GARA 3THXB 4AKIA 3FI9A 3HB0A 3BS4A 1X86B 1K7CA 4HN2A 1YR2A 4LBVA 1RJEA 1TYBE 3N2KA 5H9WA 5AW4A 4AZWA 1GPKA 3B1JA 5TMEA 3QVSA 4R2IA 3E2IA 2FW9A 1JBEA 2O0JA 3U4IA 3KZVA 3T3HA 4HO1X 1AD2A 1LPAB 3I6MA 3TNDA 2DR2A 1N0WA 1M2EA 1OR8A 2ZB7A 2I4OA 3ZJ4A 2LNDA 5DISB 5EP4A 2M2IA 4TXLA 1MAVA 3DB2A 3OLCX 4UZEA 1IL0A 3VFDA 4ARZB 3EGOA 4CM9A 4ZDIA 2ASEA 2GM5A 1UZMA 3K3PA 3N0TA 1USKA 2XMGA 1G8FA 1YVEI 4XPZA 5F2KA 1E1YA 4V0KA 1WOYA 3M4JA 4FDVA 5AKLA 3PHLA 4IV5A 2PJZA 1TA9A 4KSYA 1SBCA 4LRYA 2WJJA 5C46F 1QIHA 2D5CA 2WTNA 2NVOA 4I2VA 4KXVA 4HGPA 1EVLA 2WI8A 4K1XA 1JQDA 3WAGA 2VRCA 4JNKA 4QPZA 3CSSA 4O4IF 1I3OA 2BFFA 3IIEA 3WNQA 5HJ7A 5JS1A 2FDRA 3AJ9A 4TYYA 1X19A 4H1UA 1W48A 4ARVA 4PG5A 4KR6A 1B8OA 4MVJA 3W5DA 3KPVA 2JJ1A 3LQFA 3KD2A 4K87A 4XYGA 2OHGA 1D2GA 3EW9A 4MV6A 1UOQA 3OP4A 5HW0A 1JHMA 3L84A 4Q05A 5L9AA 2ZLBA 1G3MA 1OIXA 3L8DA 4Y6LA 4MVJI 4QU5A 4DSUA 1ZJYA 1ZA1A 2W6CX 2JANA 3IBFA 1EJ2A 2EW2A 3FIUA 4UDYX 4B3DA 1QZZA 3QXCA 1SXJD 3G2KA 3NBQA 2XKAA 1QAMA 2X9GA 3HWSA 2I8LA 4RNDB 1T0IA 5BSFA 3ZGZA 1SVLA 2VJYA 3UJCA 3T5CA 8ABPA 5A9SA 4OY3A 4NU5A 1GZ4A 3A6DA 1BN6A 3BHNA 3GRFA 3RFTA 1VOTA 1RYZA 4FFNA 1PFQA 2PQ6A 4KFUA 5KU7A 2IYXA 4DMUB 1IJEA 2AOXA 2Q3DA 4WJZA 2KW5A 1A9RA 2Q3MA 1SRRA 1F12A 4G85A 1K4KA 4JJ8A 2P9ZA 2XQVA 5AK6A 4RTKA 2X8JB 2VDLB 3PJRA 1PL8A 2BEWB 1JA9A 3LC0A 3RK0A 1CS0A 3GLHB 1Q0PA 3K53A 2R7MA 1NT2A 3I64A 4W5JA 1D09A 2VWPA 1BIFA 1VTKA 2PCLA 4O02B 4XWAA 4MMYB 1FFXB 3NTLA 5ALIA 1N9ZA 3KB6A 1EUCB 1Y7PA 4DIFA 2QE7A 3KTFA 1RFGE 5I3ZA 3WMGA 1UC4B 3OM0A 4FZVA 1SD5A 3D3WB 1DIBA 4RJ2A 5H59A 1YXMA 3WXMA 1NVAA 4BEJA 3ZDCA 4US0R 1MJHA 1E79D 2XZDA 2WSBA 1GCIA 1GQFA 3PYMA 3MWYW 5BSWA 1FF9A 4IOJA 4JJGA 3LAWA 2CNLA 2WDPA 1CRWG 3DO8A 1M8PA 4J9UE 2XXJA 4FZRA 4ENTA 3IEKA 1UMCA 1Z6QA 5H3LA 4A0HA 5C35A 2IY8A 3OT1A 1IZYA 4CMGA 1BQ3A 4CIDA 1VHTA 4BZWA 3LD9A 1U2GA 3QKTA 2A8YA 3T3NA 4MH0R 1O9GA 3KUKA 4MUFA 3O9ZA 4RWEA 1N9GB 5M5BA 2VHZA 4QDZA 4ZT3A 1MVLA 4B3TB 1QFZA 1KVQA 1XMIA 2J3KA 1J1UA 1OV4A 2X15A 2QM3A 1U3VA 1X7YA 1LF5A 1VSTA 3HA5A 1R6UA 4TRJA 3MWFA 4MAMA 4KQIA 1XU4A 4N48A 2OV1A 2BIFA 4D79A 2B92A 2WF9A 4KQEA 1VFNA 4DC0A 5KNLA 3QXGA 3DJFA 3UENA 2BGKA 1OQAA 3FLBA 3D2BA 1M7BA 3G9ZA 4WY2A 2EG5A 5GAJA 3RYHB 2P91A 3PFBA 4DKXA 4W9NA 1D2NA 4KPUA 2JL1A 3TLMA 3UJBA 1KQNA 4FWTA 4B45A 4TTJA 1QYCA 2CCJA 4J7CA 3GB9A 2PFGA 4HAIA 1CFJA 1MH9A 2JFYA 5AK4A 2EAUA 2QY9A 3HKCB 1AQNA 1MX5A 1D07A 5ELXA 2R5WA 3SC4A 3M9LA 1PNQA 4BQRA 4D4HA 3M5WA 1KJWA 3OZIA 3BULA 2HUPA 3E9EA 5CU7A 5DK4A 1XTKA 5EESA 5F2NA 3P20A 1OMOA 3IPXA 5DRTA 3WK4A 4R71A 2Q4RA 2A2ZA 1XPUA 2INGX 3N39C 1MRZA 4F91B 3F1LA 1N2EA 5HM8A 4PFJA 3VSCA 1IZ9A 2ZBVA 1EP3B 1CIPA 4HDAA 2ZCVA 3S2SA 3WWYA 1NOIA 1TLFA 3LUJA 3UJDA 3QPBA 5C0OE 1Y8RA 4CR7A 4ME6A 1P0MA 4G9EA 4TL9A 4K7JA 4MWCA 4TSFD 4MUJA 5BOSB 2O5RA 1FFBA 3GAMA 3O2SB 5TVGA 4FNOA 4OXKA 4HLCA 1I2CA 1RRVA 1TVEA 3GL9A 4XVUA 5E2AA 1KIAA 3I73A 3QOYA 1WAMA 1C7RA 3X1DA 1T8SA 3DFKA 1QRUA 1U7XA 5T6MA 2ZS7A 5FR1A 1Z5OA 1M2VB 2JGNA 1JLLB 1M7HA 2ZJ8A 4BV8A 4FX5A 5CB4A 5EJ9A 1YB4A 1B4DA 1YA4A 3IAS6 4HN4B 3DGEC 3QBEA 1A5BB 2BSXA 2FJ0A 2OV8A 3HABA 2BT4A 3BILA 5AVWA 4XGIA 3VR2D 3DQQA 3HMKA 3Q8WA 1RYNA 2Q2NA 4BP3A 2IPOA 3MUFA 2O8DA 4GGPA 5ULLA 5FFFA 1ZEJA 1CUEA 3JWHA 2Z04A 2F9LA 4U2DA 2EJCA 5T8KA 2FEPA 4XCXA 3TEMA 4DMGA 3KZMA 5BW4A 3KQHA 2PT9A 3TMKA 1A4XA 2CLMB 3RU7A 1V37A 4J16C 1CUYA 2WEKA 5B55A 5JQGA 2DULA 1KS9A 2VSNA 3D5TA 4KE7A 4GNKA 4WD3A 2PSSA 1OZFA 3V5NA 2QLBA 4WOCA 1MXHA 2P9TA 3HHPA 2C61A 3QUTA 4GMXA 4ZOEA 3R5FA 4I5IA 4EKEA 3BSSA 4IZHA 1GHTA 2XZOA 3ER8A 2AKAB 5G53C 6REQB 1GKKA 2CNKA 3G2IA 3K4HA 3RS2A 4C03A 2HREA 1UBOS 3VU0A 4D2IA 5IWAB 3GFPA 1ZIDA 2QS9A 5EXTA 3C3MA 4QDUA 5L3SA 1X9GA 3NC4A 2W6MA 3NWBA 4BLUA 2WA1A 3UXMA 3ZJUA 1U1CA 5TX7A 2CKDA 2QNIA 1JAYA 2W2MA 4N9WA 1QK4A 1U11A 4JT2A 1J99A 3CXUA 4R8MA 3B6ZA 3D8HA 4OHMA 2WTBA 4ZANA 2CHGA 2HJSA 3TOVA 1I7LA 1SHKA 4ZAYA 3T34A 4YRGA 1HYBA 4C4SA 2QAGC 4GQIA 4UTOA 2YJNA 1RM5A 2JI7A 3DOHA 1YACA 1PDOA 3DTYA 3RJZA 1XA3A 2FWRA 2C95A 3PRKE 1TQDA 1W96A 1XZKA 1ZGAA 4LFCB 1YTUA 3SM9A 1UEXC 4FLFA 4TMZA 2NWQA 1J56A 3SIRA 4HV4A 2IXFA 1WHTA 4KP7A 4KKVA 2UYGA 5HZHA 2ZB2A 1KDYA 3A3OA 4LDJA 1WXQA 3WLIA 4DEYA 1B8VA 2NU9A 1BCSA 2BKAA 1U9ZA 2YHIB 1XVAA 2DJIA 3MVEA 3PBKA 4OHCA 5AI5A 4ZT6A 2GKSA 2PRKA 5EEGA 4BMPB 3ET5A 3P9XA 2WR8A 3WB1A 1JHXA 5TPZA 4KPFC 1QE3A 1KDVA 1BNCA 1TZKA 2GETA 1YC5A 3HB5X 4RZSA 1KGDA 1XD9A 3PZRA 4YJGA 2DBRA 4W5RA 2ZYIA 3MWDB 3JQBA 3OZWA 5JYBA 1Y4DE 4OP1A 2WDZA 3KT0A 5J3JA 5C1OA 1ZJ5A 5DGHA 4L5AA 5FLKA 4Q1AA 4UHJA 5FWYA 2A92A 1ONNA 3NBYC 4OQYA 1E4VA 5GM1A 1NBME 3KDSE 1GQSA 1PQUA 4KV7A 2G83A 1XQYA 3PGJA 2CFRA 1G21A 5E1OA 2PGDA 4L9AA 4REOA 5EERA 1P1IA 2QYHA 4XX0A 3WKAA 5I7WA 1TPZA 1XKLA 1LTQA 2REXB 3UB4A 3TAXA 3X0DA 3G0DA 3FKJA 4NZZA 1Z07A 5G1PA 1TAQA 5EXPA 1C4KA 4TS4A 2Q41A 2F43A 5L7TA 2ZSEA 2G82A 3C7KA 2J7PD 1QKJA 2D13A 1WXDA 1JRLA 2JFBA 3OJXA 4MVJF 4OGFA 5CHYA 3GRVA 4F3YA 3WL8A 3LP8A 2WE7A 3ESCA 4Z86A 4NIMA 3QPDA 1VHQA 3AHDA 4LVCA 2HHLA 2ONJA 1DQNA 5HRUA 2QD2A 1CZHA 1QMPA 4LQCA 4IDOA 5BSEA 3T1HB 1Z7GA 3ZWMA 3LRTA 3RUPA 1TDJA 4PYLA 5F9HA 2V1UA 2D2IA 3OX3A 2PJDA 5CXUA 3E3LA 3VR4A 3JZIA 4F06A 3C3PA 2CXRA 4N8DA 3QVGA 4WE3A 1XBTA 1T4DA 1J2RA 3VNRA 1BROA 4YX9A 3LU1A 5EAIA 3CJRA 3D1JA 1Y6GA 2ZB8A 4JB8A 121PA 1Z8HA 3Q88A 4FMDF 4URYR 1GAXA 5AW6A 3K4QA 4JC0A 3RREA 1BHO1 1DWOA 1YFJA 2NU6A 1N78A 3P9CA 1HEUA 3W6NA 1DCFA 5JAMA 4DBZA 4H1HA 4V0QA 4LPSA 1T8RA 4ID9A 3M5CA 3SC3A 4CGYA 4MP6A 2R6ZA 3ROTA 1UFKA 3QE9Y 5LQJA 1UZNA 3M4YA 1AHHA 5FB3A 2BBSA 1RQ7A 2JJMA 1LWNA 4YCJA 1OB5A 1E9SA 1K63A 1PFUA 5HF9A 4D5GA 4GLJA 1M2WA 4QOJA 1M5TA 2QVGA 3PEFA 1CNEA 2YN4A 4E3WA 4IV8A 3KAJA 4GS5A 4TTQA 4BV3A 1TO2E 4CEHA 1JJFA 4TMYA 4E5SA 2PLWA 3K9LA 3RFXA 1QH1B 5GM2A 3VVMA 4C4OA 4L78A 4MRMB 1JQEA 3IAM6 3ZJ5A 1DXQA 3RK4A 2DPHA 2FSVA 1OCEA 2HV8A 2J0SA 1E3MA 3L6UA 3AL2A 2XCTB 4LWQA 3U5TA 3HU2A 3IAFA 2QL5A 3IESA 1Q0HA 2VHQA 3G2PA 3KB8A 4NZMA 4RKWA 4BQOA 4RANA 2GGSA 3MN1A 4KQ1A 3A05A 4MKXA 2GTHA 1JDBC 1XZHA 1J2JA 2WWHA 5ALXA 3L1KA 5HUHA 2RE8A 2ODEA 1GSHA 2ZJZA 4WLVA 1QR2A 3O0DA 1O2DA 1XLWA 1BKDR 1NXTA 1U1EA 4FT4A 3EFBA 3E7FA 3R5HA 2YFYA 1OX4B 2P3OA 2GCOA 3S68A 1DJPA 4BX2A 2P6PA 4ZHQB 5ER9A 5T5QA 1WY7A 1KPIA 2YVAA 3JQAB 4WKGA 3WZLA 4QUAA 4FM9A 1W85B 3HVKA 4DXHA 4ROTA 2BGWA 1T26A 4G0XA 2YZ2A 4PR3A 4E2YA 4PNEA 1H2YA 3QKSA 4HQFA 3VZRA 4D82A 1GU7A 2GOYA 4CF5A 1MX1A 1IUPA 1XPOA 2AUTA 3QWFA 3AM3A 1KI7A 1V6CA 3EDQA 4E6EA 1QQBA 1JA1A 3KYCB 3L06A 2XA9A 3M1AA 3UAYA 5FWXB 2PHZA 2JD0A 3PF8A 5ENZA 2HR1A 4CXMA 5HCNA 2C2HA 2R6GA 1L5KA 1GPYA 2A5LA 4GH5A 1UKAA 2DRIA 2GHIA 3K16A 3LPCA 3PC3A 4YROA 2VCEA 4J75A 1NW6A 1UM9A 3FPKA 1A9XB 4D8XA 3MUEA 2ADOA 5FFMA 3EULA 2FVXA 2NNWB 3RYIA 2CJFA 1G5QA 2H2DA 1U9IA 4QDJA 1J97A 5AXAA 2XBMA 5B5SA 1WDWB 1QWOA 5D3MA 1ZGBA 2TMGA 5B7GA 2HYDA 3E9NA 1EFPA 3MD0A 4NU0A 3NGXA 2ZS9A 1RXSA 4OHKA 5GP1A 3SGLA 1QGED 3OEEA 1XJ5A 3NUZA 4OK6A 5ALRA 3UT6A 3WK5A 2A0FA 3ZIAA 3GCZA 1WKVA 3IQZA 3KK0A 1HX7A 4NG4A 4QG3A 5CH8A 3A9UA 3D2LA 4KH0A 4UREA 1IN5A 1E1CB 1V4BA 2FN9A 2ZJBA 1PQWA 4X44A 4AB1A 4J1TA 3QVKA 4HX9A 4R3UC 1GNLA 3WLRA 4CHTA 4CEJB 1P29A 4UBNA 3H13A 5HIIA 4S24A 1I0IA 5IJAA 4HNVA 1BE6A 1J8MF 2UZAA 4OOEA 2DR0A 1ZD3A 2CJWB 2CFTA 1R8SA 3I52A 4OIFA 5KYYB 1MHTA 2O2XA 1FXUA 1KSFX 2CHQA 2XB8A 3PVSA 3R1IA 2AJCA 4ZO8A 4B3RB 3EXAA 4N5LA 2H8GA 2QI9C 3R7SA 1ULBA 1JG6A 2G7ZA 721PA 3RF6A 3PX3A 3FOAA 5AVQA 4OGGA 5AVTA 1L7PA 1EHIA 4QAJA 4LXHA 1F5NA 3AJRA 5A5GA 1IQ0A 2OCYC 1OD6A 4JR2A 1G291 2PS0A 4TOIA 1JILA 4H18A 5KTMA 3TGPA 2BELA 1E3EA 1C50A 1D2CA 2J30A 3JQFC 2ZPTX 2G28A 3E05A 4GNRA 2YV2A 3K1AA 5TGZA 4KR3A 5JQGF 3QQ5A 5EJ5A 1KEWA 3ESDA 1E2IA 2B1GA 2AZMA 3A1FA 5G1OA 3E9DA 4DRXA 4DADA 5HMLA 3T12A 4MZDA 1K3UB 3IMKA 4HNAB 1WM1A 1L7OA 1U6JA 2W0MA 2PRYA 3OHMA 3F8SA 2OKGA 2H9YA 3OO1A 1GKYA 1HC7A 4KCGA 4R2HA 4QAQA 1YDGA 2HWUA 1UPBA 2MSKA 3BD8A 3K0AB 4PLFA 4RHEA 4YRDA 1J00A 2H1VA 1FCJA 3BX1A 3FZQA 4FKZA 5BSKA 4WHMA 1RU3A 5B64A 3G2MA</