2VN8A

Crystal structure of human reticulon 4 interacting protein 1 in complex with nadph
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
358
structure length
358
Chain Sequence
LYFQSMAWVIDKYGKNEVLRFTQNMMMPIIHYPNEVIVKVHAASVNPIDVNMRSGYGATALNMKRDPLHVKIKGEEFPLTLGRDVSGVVMECGLDVKYFKPGDEVWAAVPPWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAINKVGGLNDKNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVCSQDASELVRKLGADDVIDYKSGSVEEQLKSLKPFDFILDNVGGSTETWAPDFLKKWSGATYVTLVTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRWAFFMASGPCLDDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGKTVINVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Reticulon 4 Interacting Protein 1 in Complex with Nadph
rcsb
source organism Homo sapiens
molecule tags Receptor inhibitor
molecule keywords RETICULON-4-INTERACTING PROTEIN 1
total genus 120
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vn8A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2vn8A01
2X0JA 3PHIA 4CJXA 4D43A 4KQXA 1SBYA 4CMIB 3IDSA 1VKNA 1WXDA 3BMOA 4JLWA 3I3OA 4GX0A 1ZUD1 4OL9A 2J5RA 3RUCA 3B1FA 4YJHA 4AJIA 5ER6A 1LDBA 1A4UA 2H6EA 3HFSA 3LQFA 1B8VA 7MDHA 5JY6A 3OJLA 3PZBA 3R3JA 1SB9A 2P9CA 3QWAA 3N7UA 1XQ6A 1P1IA 3DAGA 1LBEA 5COAA 2ZYAA 5K6AC 2Y93A 2Q2VA 3DMTC 1Y9AA 4CQMA 3GAFA 2FSSA 4OQZA 3RBVA 4Z6KA 4GH5A 4NZ9A 1HTBA 3K6JA 4MKRA 1EEHA 1ZEMA 2NTNA 5AQ1A 1AHHA 3BZUA 4Y8VA 1LLDA 1EVZA 3GVHA 2B5WA 3RCBA 5EESA 2C54A 1GZ4A 4E2YA 3DBLA 2Q46A 2IZ0A 4UVEA 4D3FA 1I5RA 1Y6JA 4NPCA 3R0IA 4CMHA 5JSFA 2QG4A 1V9LA 2C5AA 3L4BC 4ZVVA 1ENZA 2WE8A 3GA0A 1GYPA 4WLVA 5G0VA 4WPGA 1B7GO 1UXKA 4KOAA 5DOZA 3FN4A 2JFGA 4MPDA 3ORFA 3R1IA 2GYYA 3PGJA 4R01A 1KC3A 1ZJYA 3WBFA 5C37A 1NP3A 5F1KA 3WQQA 1SPXA 3WYEA 1PQPA 4Q3EA 4YRBA 5IXSA 4FDAA 3X2EA 2G17A 2W2LD 2A4KA 1M6HA 3PJFA 1R66A 3KYDB 5AOVA 4RJTA 1DC6A 2WD8A 4Q39A 1SOVA 3VZQA 2DPHA 1IUKA 3KHUA 4F45A 1VL6A 4J4BA 1YJ8A 1E7RA 1P3DA 3TQHA 4B7CA 4BNFA 1I36A 3GNSA 2ZTMA 1UJMA 1K6IA 1R4MA 1VC2A 1X14A 2OO5A 3INGA 4CMBA 3WWYA 1FDUA 1HSZA 3D3WB 1IZ9A 2JCVA 3ANNA 4YAIA 2I66A 1K2WA 1DIAA 1UZNA 3GEGA 1J49A 3CTMA 4JXKA 1YB4A 1VLLA 3RAJA 5CDTA 1IOLA 4EYEA 3WGIA 3L9XA 1PR3A 3MWEB 4W9NC 1HDGO 1YBMA 2B4TO 5ENDA 5L7YA 1NVGA 5I8WA 3ZHXA 3NRCA 2UAGA 1DC5A 3FRJA 5L40A 4FFLA 2E6UX 4G81A 3FD8A 1LRKA 3WOHA 1I2ZA 1MX3A 2IODA 1PTJA 3SC4A 2C7VA 3OA2A 3BIOA 2FZEA 2RIRA 1EFLA 3I4FA 3CKYA 2ZTUA 3GEMA 5C7LO 4I8XA 1VL0A 3A4VA 2WWRA 1E6EA 3UGKA 1Z73A 2OBYA 3NT2A 4MVJI 4RORA 1YB5A 2NWQA 4IIVA 3PI7A 1T26A 1YL6A 3GDOA 5A4DA 1HYGA 4L0QA 1GR0A 4DYDA 3FWZA 3VPGA 4NDNE 4CLDA 3TDKA 4OQYA 3GF4A 2HRZA 5IN5A 1U1IA 1P1HA 3AOGA 3V1YA 5JDIA 1KEWA 4XQEA 2DTXA 3QRWA 1IHYA 1F0YA 3F5SA 1EZ4A 1Y8RB 4G5HA 5GMOA 4BUCA 1E5QA 2PD4A 2QRJA 1RPNA 3O8QB 3K30A 3UICA 4XB1A 1DO8A 4PG7A 4YAKA 5BSFA 3DOOA 1C1XA 1LEHA 1PJTA 2YV1A 1DIRA 5DULA 5JMWA 3KLMX 3TJRA 3JCZA 2HQ1A 2G0TA 3MTGA 1DIHA 2EWMA 3LK7A 1XQ1A 7ADHA 3U4DA 1LC3A 5JAZA 4E0BA 3V2HA 2EJWA 3A14A 1QV7A 2P9GA 4PG5A 3RFVA 4ZRMA 3KEOA 4A03A 3GDFA 1B0AA 4ZN6A 5EN4A 2Y0DA 3GMDA 4J3FA 2A94A 3ZNPA 4UEKA 3VDRA 1EFKA 1ZBQA 2O48X 1GD1O 5L51A 5JAMA 2D3TA 1P45A 4I5DA 5TT1A 4BB5A 1T2AA 1KVQA 1FF9A 3ZV3A 3ZN2A 1PS0A 4MVJA 5F1PA 3OEYA 4R3WA 1I2CA 2FN7A 4PRLA 3TFQA 4RZHA 1BMDA 5KVVA 3WMXA 3SX2A 3W8FA 5L95A 5CEEA 2HMSA 3I9OA 4XEHA 3VOSA 3EMKA 3RKUA 4D45A 1H9BA 2DPGA 1K6JA 1KOLA 3DC2A 5DBGA 5EINA 5L9AA 3JQAD 2R00A 3H65A 3DMTA 3EUWA 3H7AA 4FJ2A 3Q6IA 1RM0A 1KEPA 5G4KB 1WDMA 3ETGA 3IS3A 3INTA 2VWPA 2CDBA 2PFGA 1FDTA 4TZTA 2PD6A 3BMNA 2VTEA 2V6BA 4RDHA 2OP1A 4Y6RA 5KJEA 1UXJA 1ENYA 4XKJA 5HTOA 4YQZA 1PS8A 3WNVA 4WCFB 3JQ9C 2DVMA 3ULKA 2XXJA 1E3EA 4INAA 4K28A 3RVDA 4BO7A 1P0CA 1PWZA 1T1SA 3B20A 3I23A 3LLSA 5COQA 1Z75A 2E82A 4L9RA 3GZ4A 2VYND 3ZCXA 4GLLA 3UCFA 2PR2A 3INRA 2WTBA 3V2UA 1QLJA 3RIHA 5DT9A 1SB8A 3C7AA 3H9QA 3KLPX 3NX4A 2DU8A 4XQCA 3D7LA 2DUUA 1GFSA 2PKQO 3D64A 4J7CA 4KMSA 4BNUA 4PLFA 1C0PA 1FJHA 1LXCA 3ZU5A 4XQGA 2E48A 5ICMA 3NJ8A 4GSKA 4QX6A 3B6ZA 2P68A 5KCZA 3GR6A 1GCOA 3B1KA 1YS4A 3N58A 3E48A 2DTEA 2W98A 4W7HA 3DZKA 4EEZA 3ENKA 4DVJA 4IGFA 3I6IA 3KRTA 1H93A 2ZB3A 1ENOA 2OXIA 1CERA 1W4ZA 1J0XO 3JQBC 4II2A 1W0CA 4Z0PA 4R5MA 1ID1A 1W8DA 4ESOA 2JHGA 3WSVA 1E7QA 4BGUA 3LC7O 1ENPA 1R4NA 1G6KA 1QMGA 2B5VA 3ITKA 4BIIA 1SO8A 4NIMA 3EVNA 4RF2A 3ST7A 2DTDA 2BKAA 4W6ZA 1SC6A 2X9VA 4Y9DA 3NT5A 4HFNA 1I3MA 2J5KA 5T67A 1MGOA 2O7SA 1SMKA 1Y8RA 5U9CA 4J1NA 4KP7A 2ZJ1A 3DHNA 1Z74A 4AJ4A 5KVSA 3ICCA 1ZK4A 2RCYA 5LDGA 5JY1A 2BF7A 4OM8A 3PDUA 4L74A 5KNLA 1YOVA 1YBAA 1N9GA 4DA9A 4FGSA 1PJSA 1YQGA 4II3A 4TVOA 3DR3A 1B8UA 3DB2A 6LDHA 2FHSA 3L4SO 4O6VA 3AM4A 3Q1LA 3SC6A 1EDZA 1MFPA 4CV2A 4RDIA 1LUAA 2NQTA 4DL9A 2QQ5A 3GZNB 3DAPA 1RM5A 4Z9XA 1ZKMA 1XU9A 1AN9A 1F12A 4YCAA 5TRTA 4DPMA 1ADFA 4XWYA 2HLPA 2AEMA 4AJKA 1BDBA 1QG6A 3C3XA 3I9NA 1H5QA 4QFDA 5DBFA 1BG6A 3WTBA 1GYQA 1XWFA 3L6OO 4OXNA 1NR7A 3CE6A 4U6SA 5ER9A 4J9VA 4CM9D 4LMRA 1DRWA 1ZIDA 5AYVA 4ALIA 4WKGA 1PSDA 4OHUA 1BXGA 1DXYA 3W6UA 1V3UA 5JW6A 4UAGA 4GWKA 3U09A 3VH2A 3CINA 4BO2A 1U3TA 3D3EA 3GH3A 4DRYA 1HYHA 3V1TC 4BNZA 5KOIA 1YH3A 3DMYA 1P74A 4RVDA 3KSDO 3C8MA 2HCTA 2OUIA 1U8FO 4WOJA 4HV4A 4DLLA 1NXQA 2UV8A 4O0LA 1K5HA 3N74A 1KVUA 2X7HA 1PQUA 5LDHA 3AI2A 2XF8A 3JQBA 4L73A 1KBZA 1VKOA 5AXAA 2RH8A 5TNXA 4QQRA 4ITUA 4R54A 4IQ8A 1UUFA 4YJFA 3B1JA 1ZVMA 1I10A 4IJWA 4D46A 3UAGA 1R4MB 2IDZA 3VH4A 1NHGA 1K6XA 2HKIA 5KVQA 4J4HA 4AG3A 4MJLA 3M2TA 1Y7TA 4MP3A 1GEGA 2I6TA 4CQMD 4BNLA 3GLQA 4OKIA 5KIAA 3AJRA 5JBIA 4QO8A 1N1GA 4MVJD 1YVEI 5DCYA 1YRLA 2V7PA 3PFWO 1E3IA 1CJCA 3WGHA 4AL4A 4MIEA 3UXYA 1NYTA 4PLHA 1JLLA 2DBVO 3K5PA 2VRCA 1EK6A 3DAFA 4AJ1A 1MUUA 2R00C 4WE3A 3S2IA 1VM6A 3ZV4A 3KEQA 4BQPA 4CLEA 3C1TA 4IBOA 1ZH8A 1F8GA 5A03A 2HRBA 2B4QA 3MJVA 3QIVA 1N7HA 3KYCA 5BNIA 2D1YA 3FCOA 1LNQA 5TSDA 3UF0A 3IIEA 1LLUA 5DCUA 5I9MA 4CMGA 1QRRA 4M55A 3GEDA 2AMFA 4KUGA 5TQVA 4FFPA 3ONFA 2H5LA 3HADA 3ZWVA 5JDCA 2GZ3A 2PLAA 4I9NA 4JNKA 2DBQA 2W90A 3DBVO 1HLPA 1L7DA 1AXGA 1GUZA 2O3SA 3LF1A 4DMMA 2Y1FA 1C0IA 2BFPA 2AEFA 1YB1A 4UUPA 3NDIA 3E5MA 2PWZA 3DZIA 2LDXA 4CMIA 3O8QA 1WPQA 1HDCA 3EAGA 3UCXA 1RJWA 2PV7A 3JQFC 1TT7A 3ROPA 3EGOA 2EHDA 4FFNA 4U0JA 4YWJA 3UFXA 1V0JA 1YL7A 1MP0A 1HKUA 1YBVA 1E7YA 2W2KA 2Q1WA 2FRDA 1E6UA 3K8ZA 1EE9A 1UAYA 3IP3A 1I24A 5H81A 1JKFA 4FPXA 1XU7A 2CSUA 2RHRA 2QZZA 3S1LA 1NVTA 2Q4EA 2SCUA 5KKAA 3T4EA 2C0CA 2G82A 3ZV5A 5JPIA 1LSJA 4DLAA 2H9IA 5CPFA 1QLHA 2J3HA 3L4BA 3NTRA 5G4LA 3V5NA 5B1YA 3ZDFA 1GADO 1QXSA 3RU9A 4DREA 4WEQA 2AQHA 4MVJP 1K89A 1NPYA 4PLPA 3WNQA 3U4CA 1O5IA 4MOWA 5IDXA 2FMUA 4CLRA 3H5NA 4EI2A 3RC9A 4AJPA 3JQ8A 3PPIA 1HWYA 3KB6A 2Y0EA 2AE2A 2YQ4A 1KY5A 3GFBA 4GLOA 3WGYA 1NPTO 2NVWA 2A9FA 1CETA 1DPGA 4YT2A 4BGEA 5DP2A 3RC7A 4H3VA 4CM8A 3Q2IA 3JD1A 1A71A 5CDGA 2ZCUA 1P1FA 2GUGA 1R0KA 1DOHA 1OZAA 3PVZA 3DHYA 3FR7A 1CWUA 1LRJA 2I67A 3S2EA 2HMWA 3KOUA 1PZHA 2BH9A 4YPOA 5CFZA 5A1TA 3E03A 3GGPA 4AJLA 1YDEA 4FIZA 4GX1A 4U8GA 9LDBA 1JA9A 1GTMA 4I9HA 2NU6A 4R69A 3BMCB 4BV9A 4G2NA 3TF5A 3W8EA 2NVUB 4DC1A 4W9NA 1VJTA 5FI5A 4MIYA 4S1VA 1D1TA 3QVOA 4CM7A 3D4OA 1PU2A 3PLRA 4OYRA 1H2BA 1KEUA 2GN8A 5JCJA 3DZBA 3HN7A 1JWBB 4A73A 5KKCA 3WSWA 1SNYA 4OGWA 2OORA 2LDBA 4F6LA 4HY3A 3KETA 5ILGA 4OIMA 3WQSB 4M87A 3W6ZA 1HE4A 5L4SA 5L7TA 1KIFA 4JQCA 4NU5A 1F8FA 1I3KA 4NI5A 3FBGA 4RQTA 2C82A 4IJKA 1LLCA 4XYLA 4LK3A 4M8SA 4D41A 1OI7A 1TT5A 1F06A 1VE9A 1IYZA 2JD0A 1G1AA 1HDYA 1IL0A 1B8PA 2Y1EA 2X5JO 3W8DA 2GD1O 1ZO8A 2B0JA 4BVAA 4GX2A 3ROQA 4DLBA 4FSHA 3WS7A 5F21A 3E6AA 1MC4A 1H6CA 3ITDA 3KYBA 3TWOA 1UDAA 3JQ8B 3PHJA 1KETA 4R1NA 1B3BA 2AG8A 2POQX 5FFFA 4CPDA 4R41A 3R3SA 1DSSG 1HZJA 3QVWA 3MZ0A 3OJ0A 2GZ2A 1E1KA 4M54A 4YB8A 5I8ZA 2O23A 3UCEA 4XGNA 3OIDA 4E5YA 4YJDA 2DBRA 3H5RA 4A27A 3VZSA 4CM8B 3AU9A 5AVOA 3FNHA 4Q3AA 1QYXA 1N9GB 3ZNQA 3ONDA 3UVEA 1YONA 1H6DA 2VYNA 3JYQA 3I9MA 4ND3A 4RZIA 5TC4A 1OMOA 1P1RA 3GPDG 5EMHA 4K1LA 3D1LA 2I99A 3AOEC 2Q1TA 3U4HA 3C7DB 2JD2A 4W99A 1R37A 3AY6A 3GAZA 3NJ4A 3WYCA 3JD2A 3ZWNA 4E4YA 5GZ6A 1FXSA 3UKOA 4BGVA 3WFIA 1J6UA 4IGEA 4N54A 4RL6A 2YV3A 2CVOA 2Y1CA 1OOEA 3WGZA 4ID9A 4TQGA 5TLSA 4PGFA 1BTOA 1KERA 3DBRB 4JBGA 2DC1A 4CR6A 5IG2A 2NACA 4PN3A 3DZJA 4BNNA 4BMSA 1ZEJA 2YQ5A 2ZB4A 3HDJA 3EDMA 3TZCA 1E1LA 1EBUA 1PJ4A 3DQPA 3Q11A 2ZB8A 4IXTA 4RPHA 1HRDA 2O7QA 4XR9A 5HBRA 4BNMA 3OQ1A 4LW8A 4CL8A 5AXBA 3FPCA 1C1DA 2HUNA 4B79A 4EBFA 2BELA 2X9NA 2ZTLA 1N8KA 3SLKA 3DFUA 4KWHA 2ZQYA 1DLJA 5JAQA 1UH5A 4XCVA 2HO5A 3ZH2A 4ALNA 2AG5A 4NK4A 4YDRA 2PH3A 1V8BA 2I76A 1MXHA 3PHLA 2O2YA 2O3TA 3BYZA 3BTVA 1HE3A 2Z5LA 1T2FA 1HXHA 1DRUA 4UUOA 4Z9YA 4E12A 3WBBA 3DDNA 4PG4A 3Q3CA 1T2DA 5MGBA 4M86A 3IC5A 2ZCVA 1MB4A 1MC5A 1HE2A 1V3VA 3TFOA 2PY6A 2XXBA 3GN2A 1ONNA 2X0IA 2FP4A 4XYEA 4MVJH 3ETDA 3VC7A 2G76A 4RVSA 4MP6A 2WSBA 5IFLA 4JIGA 3HWRA 1NX6A 2JJYA 3GVCA 3QJ5A 3VTZA 3HG7A 3OF2A 1FMCA 4OH1A 3RJ9A 5CG1A 2CNBA 5JYEA 2BI8A 3H9JA 1C0KA 2JFFA 2O3UA 1GPDG 2HMVA 4BNXA 3CMCO 2V65A 2V6MA 5F1OA 3NUGA 5G0WA 1DC3A 2DBZA 3HE3A 2C2YA 2VTDA 1QYVA 2XAAA 1TXGA 5ICSA 3NTQA 4TRMA 4LMPA 4LSMA 4BO4A 3TN7A 1LSSA 3K2BA 1CQIA 3AK4A 3ZHBA 4E5PA 4FOOA 1ZK3A 1QP8A 3LDHA 4I5FA 1JVBA 2GF2A 4FFMA 1E3WA 5ILOA 3F5QA 4DPKA 1H0KA 5K0ZA 4MDHA 4YJGB 3ZV6A 4Y6SA 1Z7EA 3RC2A 3OMLA 1KY4A 1WMAA 1NQOA 3DBHB 5ENVA 3FPLA 8LDHA 1BXKA 4PLCA 1CYDA 2PK3A 1P44A 3RUEA 3AY7A 4I1IA 5I9NA 4QO7A 2PZLA 2HK7A 4R5HA 4RVHA 4K6FA 3GQVA 5EL0A 4FC6A 1U4OA 5IDWA 2WMDA 1WW8A 4AICA 4NQZA 2D8AA 1QYWA 4DIBA 3OM9A 3I5MA 4PZEA 4YA6A 1R4NB 4ALMA 1I01A 2WE7A 2I3GA 2WDZA 1Q2XA 1E7MA 5IJZA 3TL2A 4DBVO 3P5SA 5CDSA 1N2SA 1PR9A 3QP9A 3P2OA 1U5CA 3EK2A 1KEVA 5DDIP 3E8XA 3M1AA 4ZQFA 1I0ZA 1VRWA 2VHVA 3CH6A 3IL2A 5I9LA 1X0VA 1TEHA 2P91A 4C7JA 2QX7A 3I52A 2GR9A 4YT5A 1N92A 4XYMA 3L9WA 2FPPA 3HHPA 4YT8A 4ZJUA 5ES3A 4KUHA 1PGJA 4OO3A 1KVTA 2QYTA 4NJMA 3DFZA 3AUUA 3BTSA 1NQAO 2IZZA 2J3IA 3NDRA 3PP8A 3VAZA 1PWXA 1WVGA 5KVCA 3RI3A 3C85A 2Q4BA 3EZLA 2DFDA 5CDUA 3JSAA 4IPTA 2ET6A 4DWVA 1A27A 2NADA 1E7SA 4XZ3A 3PQEA 2WD7B 4FOSA 1ONPA 1GQ2A 4YAJA 2BHLA 4W7IA 1YL5A 1UR5A 3MTJA 4XIJA 3HB4X 3JD3A 4HFJA 3G3EA 1BVUA 3I9JA 3U9LA 3GVIA 5BSHA 2Q1SA 2CMDA 4PLVA 2CVQA 3DBHA 1Z6ZA 2VQ3A 5G0UA 1RM3A 1HDOA 3AI3A 5JAIA 2YHIB 3PYLA 4Y98A 4IS2A 1HL3A 1GPJA 1DRVA 4UVGA 3KM0A 1Y8QB 3DTYA 1PL7A 1SCUA 4QXMA 3IKTA 3WIDA 2I65A 1CRWG 1EQUA 3KUXA 3HDYA 3RUHA 2FR0A 2FWMX 4N5LA 4PVCA 4EUHA 4M89A 3BXXA 3GNTA 3QW2A 2FY8A 3OSUA 1ZZEA 4YJHB 5F3RA 3VZPA 4E3ZA 3RU7A 1DAPA 4B4OA 2Y68A 1EVIA 2E4AA 4N18A 1E92A 4BHTA 1HDXA 1GEEA 1IE3A 1VPDA 1IPEA 4WLEA 4YJFB 4B3IA 5HRUA 4NFSA 3DL2A 4RF5A 4BNVA 1V3TA 1DFHA 3KTDA 1TLTA 4EGFA 1HE5A 1PZEA 1TVEA 2Y67A 4HX5A 2C7GA 4K9DA 3OJFA 3U62A 4E2WA 2GNAA 2YFQA 5B4VA 5L4LA 2NM0A 1L1FA 1XSEA 2PZKA 2AE1A 5LCXA 3TNLA 2EP7A 1ONOA 3I1JA 4BNGA 4GL4A 1BWSA 4IZHA 5GY7A 3OFSA 3QWHA 4MINA 1UZMA 1PGNA 5HS6A 3CIFA 5AXDA 1M66A 4ALLA 2ZTVA 3NEPX 5TS3A 1XKQA 3S55A 1T4BA 1X0XA 1ZXLA 3U49A 1DJNA 2ZKLA 3F1KA 4NBWA 2QRLA 2QIOA 3OEWA 3L6EA 1DLIA 1QR6A 3WR5A 1S6YA 2F1KA 1ZSNA 2EG9A 4Z9FA 4A5OA 3AM5A 5IF3A 1QV6A 3KYCB 1D3AA 4WNCA 5JO9A 4K26A 3QV1A 1H94A 4N7RA 1X7DA 1LSOA 4BB6A 4WGGA 3JYPA 3TSCA 3CUKA 1PGOA 3WIEA 4ZICA 3GY0A 1ISFA 2G1UA 4GKVA 4RF4A 2RH4A 3WB9A 3HDQA 3ANMA 4BO1A 3HNPA 5BQFA 1JTVA 1EQ2A 2IE0A 1Y8QA 3VHRA 2JFHA 3ETEA 3EZYA 1PZGA 2HU2A 2UYYA 4FJ1A 3MJTA 4HWKA 2VYVA 2GN4A 3PTZA 4J1TA 2O50A 4GMGA 3O38A 3BAZA 3OETA 1JKIA 1HT0A 3ASVA 3V1UA 3VKVA 5I7SA 4CMJA 2X23A 2B37A 2PH5A 3GVPA 4FFRA 4RF3A 2YDXA 2X0NA 2VZ8A 4WK6A 5L3ZA 5ITWA 3QVXA 5TF4A 2VWQA 2EKQA 2AHRA 1Y81A 2CD9A 3GRPA 4PFJA 4NJMB 1Z82A 4R68A 1QYDA 1VJ1A 2C59A 4DIOA 2CF5A 2X6TA 4BO8A 3ZGYA 4HFMA 3RWBA 3VH3A 4PIVA 1W6UA 1C14A 4B3HA 2VCYA 3BHJA 1TB4A 4NK5A 5FEUA 3Q9NA 3LT4A 4JK3A 4RVFA 3NAQA 5JDCC 5B4UA 1NVMB 1I32A 2NVBA 1UXGA 3C24A 2VZ0A 5EQFA 3SXPA 1Z7BA 3CMMA 4CLXA 3WJAA 4LVCA 4E5KA 3VDQA 4JCOA 1U3UA 4L4XA 1Q7CA 3JYLA 3DOCA 1GZ3A 3LT1A 2X9GA 4UVHA 1CQJA 2J3KA 4DQXA 5FWNA 3WLFA 1E77A 4NNJA 1ZXBA 2EJVA 1I30A 3H3FA 4XJSA 4WOKA 1X1EA 3GHHA 3H6KA 1N5DA 1PL8A 3LC1O 4GBJA 1VJ0A 2GO1A 3C1OA 1R0SA 3G1UA 2ZK7A 5IXYA 5DNAA 4OKNA 5THQA 2IZ1A 1WDKA 1GUYA 4MKXA 4QTZA 4FFOA 1LDEA 2CVZA 2PZMA 3VPFA 5HA5A 1X13A 3E9MA 4CODB 4FW8A 3NTOA 3TZQA 4P4LA 5IDQA 2PNFA 4URFA 3OICA 3T4XA 1R15A 1BHSA 4NU6A 5A5FA 4ZRNA 4XGKA 3JQ6A 2JD1A 3F9IA 3EC7A 2FR1A 3VVCA 1G0NA 1GU7A 5IZCC 3AFNA 2X86A 2EW8A 4P22A 5JCJD 1W73A 1C1XB 2V6GA 3GFGA 3NGLA 3RJ5A 2X5OA 4YACA 3QHAA 4YAEA 4TRRA 1T1RA 4BKQA 1E1MA 3ADOA 1NNUA 3P2YA 4Z3KA 1ZCJA 1M2WA 2OOSA 3AY3A 1MA0A 1ULUA 2R2GA 4CQMB 1YDWA 2P2SA 2Q2WA 3EHEA 4GVXA 5IZCA 2I3AA 4J2OA 3AFMA 2IEDA 3UN1A 4OSPA 2Z1NA 1YE3A 3HJAA 4BNIA 2P5YA 4EUEA 3DBLB 2DAPA 2WYVA 1IPFA 1XLTA 4LCEA 3PXXA 4MO2A 1FK8A 1JU9A 3AUSA 4GPD1 4CR7A 4I08A 4IMRA 2VN8A 5JLAA 3L77A 1DDOA 1TT5B 3BTUA 3E5RA 4P4NA 2EGHA 4BNYA 2ZB7A 5HM8A 4DC0A 3PWKA 3FR8A 4OOFA 1EUZA 1A9ZA 1LDGA 2C2XA 4QT0A 5AXCA 3K9QO 4UUNA 2C29D 1A7AA 1GUFA 3GGGA 1JWAB 4TWRA 1H9AA 4N5NA 1HZZA 1U28A 3LSYA 4IJUA 2OL4A 4DMLA 3SVTA 1XA0A 4MVJG 1PGQA 3AOEA 4LVUA 3JYOA 1UP4A 3H8VA 4BO6A 1I8TA 3KVOA 4TSKA 5T5QA 4G65A 3JTMA 5B4TA 5GZ3A 4GMFA 4UREA 3ZU3A 2PA3A 1ZMTA 1UDCA 1B3RA 4OAQA 1ISMA 3V8BA 4WCFA 4PLTA 4OMUA 3PRJA 2I5PO 2NUAA 4L75A 4NBVA 4M1QA 3BMNB 3VPSA 1EVYA 5CG2A 4BNWA 4E5NA 4HXYA 1JKJA 4PZCA 3DWFA 1D4FA 4PVDA 1T24A 2CZCA 3F6YA 1MV8A 1ZW1A 3I9LA 4IQGA 1LLQA 1LU9A 2O3RA 4LISA 5I7FA 3ZHZA 4S3MA 1MXFA 3QLJA 3BTOA 4IM7A 3PWZA 3QWIA 3AI1A 4BKRA 4D0RA 3WWZA 3ADPA 3UW3A 3QE3A 3GMSA 1PJBA 3PFFA 5G0SA 1HYEA 2F00A 1DHRA 5T8KC 4R1TA 2YUTA 1LDYA 3IOYA 3TOXA 4KDFA 3UHAA 4YR9A 4HP8A 5ITVA 2GASA 4B4WA 4GAEA 3LVFO 1U2DA 2BLLA 2PGLA 4BQRA 2EP5A 3AW9A 4AFNA 1Q7GA 2TMDA 3ZWYA 4EJ6A 4FR5A 4JGBA 5CEFA 2YHUA 5C3MA 1X15A 2VHXA 1WLYA 4CL3A 3TZHA 2OMEA 3O4RA 4XJTA 3COSA 2VNSA 4C4OA 4PLZA 4YBZA 4CM4B 4UVDA 3GT0A 3FTNA 1O9BA 2YFHA 3K96A 2BGMA 4IDAA 2BRUA 4J43A 1OAAA 2OBNA 3S2FA 4WLUA 1T2EA 5CEJA 3TRIA 1ZJZA 2D2IA 2VRBA 5L53A 1T25A 4BKUA 1Q0LA 3AU8A 3ZW8A 4YAGA 1C3VA 3STHA 3PJDA 1GDHA 3OIFA 5BNTA 1PX0A 3ZWBA 4O63O 2GN6A 2E37A 3FI9A 4WECA 1PZFA 1XIVA 5KTKA 4Y6PA 3JQEA 5TJ9A 2HMUA 5K6AA 2GN9A 4WLOA 1WWKA 4U0KA 2PZJA 4KUEA 4YTEA 3ZHYA 1ORRA 1OBFO 1S7CA 3ENNA 1YQDA 3LC2O 3OIGA 3M6IA 2C20A 1WNTA 3T7EA 4E32A 2OHXA 4IJVA 2GPTA 3RSHA 1VL8A 4H16A 5JXWA 3A06A 1KC1A 4U6QA 5EIOA 4J2HA 3E9QA 5H83A 3JV7A 1TI7A 1NQTA 3LF2A 2GSDA 5JMPA 4Q3BA 2BFMA 3VPXA 1LJ8A 4QSMA 3AWDA 4RPJA 3OP4A 5IDYA 2UUOA 3ICPA 3QA9A 2GDZA 4CLOA 1WZEA 1YQXA 2RAFA 3T7CA 1JVSA 3FSRA 5A5EA 3MOIA 4J49A 5TGDA 5U4QA 1KVRA 4BMNA 1E3SA 3C7CB 4YRDA 2HK8A 3W1VA 3G1TA 2W8ZA 2D59A 3OECA 4NH4A 5I7EA 4IDGA 4ZD6A 1GYRA 4JP2A 1Q7BA 2GLXA 4Q3DA 4AVYA 4FJ0A 4DQUA 1WP4A 4CM4A 3SEFA 2J5QA 2YYYA 2P5UA 5ADHA 3VH1A 2O3JA 4RVUA 1DEHA 4DQVA 2DT5A 4CR8A 3PIDA 4FS3A 4BL5A 2A35A 1V6AA 2VOEA 3KO8A 4I5EA 3FNFA 2OP0A 3FWNA 2W2KB 4N5MA 4B7XA 3QWBA 4XGIA 1DAOA 4DIFA 3D0OA 2I9PA 4TKMA 4E2ZA 1AGNA 4J90A 4J0EA 1IY8A 1B26A 2RHCA 3PIIA 3FTPA 3JQGB 4DPLA 3GG9A 1O0SA 4J1SA 4R3NA 4HKTA 4YQYA 3BA1A 3O26A 1I2BA 3RASA 3TPCA 4D3SA 2IEBA 1R6DA 4A2CA 4FQ8A 2IXBA 5JNLA 4CM5A 2VHWA 4WNIA 1IB6A 2VHZA 2FZWA 5DZSA 4MIOA 1NTOA 5JE8A 1IZ0A 1PJQA 3LLVA 4HNHA 2JAHA 1OFGA 1YXMA 4L76A 3GG2A 2DLDA 1AXEA 3JQDA 4F3YA 3ASUA 5TJHA 4BNTA 1LTHR 3JYNA 3WQRA 4C7KA 4DUPA 1J5PA 2BFOA 1P1JA 4RPLA 2PTGA 4GKBA 3W4IA 3OH8A 3RROA 3ZWAA 1I3LA 1PL6A 3QY9A 3ROMA 4M49A 4FC7A 4IDFA 4Z0TA 1ADCA 1ML3A 3H5AA 5A05A 1GQYA 2PKRA 1E0DA 2Q2QA 3U0BA 5A06A 1ZK0A 1U2GA 3PZRA 3DXFA 2Q1UA 4MVJE 1MG0A 5TT0A 4BV8A 3B70A 1H2HA 4QECA 3WDSA 3SBOA 3MCVA 4XR4A 2ILTA 4HADA 1HETA 3DTTA 3I6QA 4CM1A 1JN0A 2BGKA 3I4CA 2H1SA 1RYDA 1SAYA 4AJHA 5FYDA 1ISGA 3PHHA 4FCCA 1A4IA 1DFIA 3RFXA 9LDTA 2DQ4A 1ULSA 5LC1A 4ND2A 4E31A 5KJ1A 4U7WA 2CFCA 4QFCA 5JFOA 3RUIA 2VT3A 1BW9A 1C0LA 5K1SA 1ZMOA 1BSVA 3GK3A 5K9ZA 2ZATA 3DO5A 1HEUA 2B35A 2O3QA 2EXXA 4UULA 4GQAA 4YEDA 3WLEA 5C7IO 2QZ9A 2YW9A 3PHGA 4KDEA 3WXBA 4CMEC 2NLOA 4TRJA 3CXRA 4EDFA 3GZNA 1ADGA 5F5NA 2B83A 5U1PA 4CM6A 3HFGA 5JCXA 1LQUA 3KV3O 3VTFA 1QORA 2D5CA 4I5GA 3ZI0A 4LSWA 1ISJA 3JQAA 1M75A 1GQQA 4ROSA 3MJSA 4IDDA 5CPBA 2AXQA 3KXDA 3GN1A 4R1UA 1U5AA 1YJQA 1XG5A 3FNGA 4CLRB 1G0OA 1BGVA 2Y1GA 3I9KA 3JQGA 4UUMA 5T6BA 3SLGA 4AJOA 4D3DA 4ND1A 3A1NA 4OSOA 4AJEA 2IYOA 4R9SA 4BKPA 4PLWA 2IYPA 3GNQA 4OJNA 2C07A 1PGPA 3MJCA 3HN2A 3PJEA 1Y5RA 1GV0A 3H2ZA 5DBIA 4NR0A 3PGXA 3JQCA 4ZQEA 2G5CA 4D42A 1Q0QA 2X8LA 2VOJA 4TZKA 3FF4A 2B69A 1U7HA 3OA0A 3PQFA 4R9RA 4NBUA 3VVBA 4W82A 3MJ4A 5IN4A 4PRKA 2ZQZA 3SJ7A 5JC1A 5I7VA 1BW9B 3AUAA 4E13A 1ISIA 3F4LA 4RV9A 1ISHA 4ZQHA 3EYWA 4RPKA 4ND4A 1SEVA 3S8MA 3Q0EA 1N1EA 3C1AA 5FF9A 1O8CA 5TX7A 3PEFA 4O5OA 3IJPA 1Q0HA 4H15A 3GPIA 5EPOA 4IY1A 4NFYA 4OXYA 5FI3A 5T8KA 5A9TA 4RPGA 1HDZA 1UZLA 3SJUA 4B8ZA 4GVLA 4KQWA 4MP8A 2VHYA 4KTVE 1UP7A 1UXHA 5L45A 1EK5A 1RM4A 2J8ZA 2VUUA 3X2FA 4P38A 4F6CA 2DFVA 3Q9UA 3NKLA 3H9UA 2HAEA 1D1SA 4R16A 4ALKA 2BFAA 2FR8A 2YV2A 4ND5A 3EVTA 2QW8A 2YJZA 1V35A 3JQAB 1NFFA 1U3VA 2BGLA 4D7AA 5JC8A 4PLYA 1DBVO 4R1SA 2VWHA 4IIUA 4A26A 1FDVA 1YKFA 2WJPA 1BXZA 1U4SA 1XGKA 1XHLA 1YGYA 4HUJA 4IQ0A 4CMEA 1IULA 3GHYA 3O03A 2JKVA 2HMTA 1XELA 4IZIA 5HWSA 1DIBA 1P31A 2Q45A 4XQ9A 5G2OA 4EJMA 1JAYA 2FOIA 5A02A 5TIIA 4OXKA 1A72A 3QVTA 4LCJA 4EZBA 2WD7A 3EW7A 3EY4A 2J6IA 1BXGB 1UP6A 4J6FA 4QEDA 2QRKA 3G0OA 4WASA 3IUSA 3WGTA 2JAPA 1ARZA 1B15A 4D79A 4XRRA 2A92A 4P8RA 2BD0A 3F1LA 4ONEA 5BNFA 2FPGA 1AUPA 3CPSA 4IDBA 3CSDA 2Y05A 4BNJA 1Q1NA 3GVXA 4IUYA 4K6CA 1MLDA 1N7GA 3NDJA 4KZPA 4LRSB 4D44A 4ZQGA 1B2LA 3GUCA 5L4NA 1GL3A 3U5TA 1SZJG 4B8WA 4NBRA 3H3JA 4HFRA 4BMVA 4F46A 1KS9A 3ZW9A 5JS6A 3VZRA 2D4AA 4FN4A 2DM6A 4YRAA 3CZRA 3F46A 2TMGA 3RUAA 1R0LA 3HUDA 3H9EO 5KWEA 3RFTA 4CV0A 3RQSA 3IKVA 5EJ2A 5G4KA 1GZ6A 4O59O 4CM9A 1PJLA 1EDOA 4J16A 5A3JA 2WEKA 4XDYA 4A0SA 1F14A 4DGSA 4PCVA 4CUJA 1DC4A 4ALJA 2BI7A 2OFPA 2VWGA 1H6AA 2OZPA 4JJFA 3FHLA 4TMFA 3ANLA 3WGGA 4PLGA 2QYSA 1NM5A 4LGVA 4I9UA 3LU1A 4EEXA 1X1TA 3ZZNA 4BKOA 3LT2A 3DZFA 3K2EA 3ONEA 1E3WB 1C1DB 1O95A 3ZWXA 4CV3A 2BMAA 3PJGA 4GI2A 3UH1A 2P4HX 3OHSX 4YJGA 3HSKA 1AHIA 4IDCA 1ZK1A 3TZKA 2AQ8A 3HDHA 1QYCA 2W4QA 1R16A 1HLDA 1RKXA 1LQTA 3D5TA 3GRKA 4WJZA 3RC1A 4BNKA 3NT4A 4DBZA 3KBOA 3FBTA 5EERA 5J23A 4DTIA 1K0UA 3UOGA 2Y99A 4EITA 3GDGA 4WUVA 1ZSYA 1ZSVA 4WCFC 3BMOB 4RGBA 1X7GA 4R4JA 1A5ZA 4P4GA 3H4VA 3CZMA 3M1LA 4Z3DA 3ZWOA 1XR3A 6ADHA 3DOJA 2J3JA 1P33A 1NWHA 4B4VA 1EVJA 4QUKA 5BR7A 1GY8A 1RYEA 4NG5A 1WDLA 3F3SA 3MEQA 1SEPA 2JCXA 1AE1A 2UVDA 4LRTB 1GV1A 2O4UX 4FB5A 2E49A 1YO6A 2Y1DA 3BMCA 3U4IA 1LC0A 1EBFA 4AJJA 2PKQP 1IHXA 3D4PA 3F47A 3MJEA 3RUDA 5JDIC 5KJ6A 4DYVA 2VRCD 2B36A 2AW5A 4NMHA 5THKA 2Z1MA 1NPDA 3D5QA 3JQ7B 4KWIA 5F5LA 2WM3A 1PIWA 3E1KA 3F4BA 3NV9A 3AUTA 3ROKA 2Z95A 1KYQA 3IAHA 5JO0A 5DOVA 4JX8A 4YVFA 4BGIA 1PS9A 1CDOA 3ABIA 1PJ3A 1I3NA 2RBEA 4RO0A 3UUWA 3OJOA 4ZHSA 1ZK2A 2P4QA 3DZHA 3JQFA 2NTJA 2D0IA 3K92A 1A7KA 1P1KA 1R12A 3PQDA 4D0SA 1Y1PA 1I33A 1U8XX 4J0FA 1T2CA 5A3VA 1PQWA 2NU7A 3ZWWA 1E6WA 1LRLA 3LZ6A 4Q3NA 4RQUA 2XPCA 1QSGA 2CF6A 2VNAA 2UDPA 3P7MA 1XCBA 2EGGA 3JD4A 4J9UE 3KYDA 3K31A 3A9WA 1D8AA 2O4CA 4YYZA 4IINA 4HBGA 3W4JA 1UDBA 1X7HA 3BHIA 4L8VA 4CV1A 1P9LA 2Y66A 4RVGA 3VPHA 1LI4A 2GRAA 4CQLB 2C5EA 4NFHA 3WFJA 2EV9A 1NFQA 1U3WA 4IDEA 4B4UA 4IS3A 1Y9EA 2WYUA 4GSLA 1BRMA 5CP8A 4ZU3A 4NHEA 4E5MA 4L4RA 1CEQA 4GGOA 1PJCA 4E6PA 4GWGA 3H2SA 3L0DA 1OC2A 2EW2A 2V6FA 3GOHA 4JP3A 4Y67A 5COBA 3U3XA 5A9SA 3D4NA 3MWDB 1HDRA 4CUKA 3K73O 1PJ2A 2AA3A 3GGOA 3PDJA 1MG5A 4A10A 5A9RA 4JBHA 2JL1A 1PEDA 4BNHA 3OQBA 3WGOA 4TRNA 1D7OA 1EUDA 2ZYGA 1M67A 3BMQB 5G0TA 2EEZA 4XB2A 2Y0CA 4MVJM 3JQ7A 2H63A 3RUFA 1E3LA 3WG9A 1LSUA 2Q50A 2X58A 3RBXA 2ZYDA 1OC4A 4TROA 4Q3CA 4IMPA 1SOWA 4X54A 1BDMA 3LYLA 4L4SA 4XX0A 1GCUA 2PGJA 2P9EA 4XRGA 2AQIA 3E18A 3RBZA 4RCVA 3JQ9A 2GCGA 1NWCA 1ADBA 3G17A 2X22A 1NR1A 4PZDA 1K3TA 1GAEO 2X5KO 4CLOB 2GZ1A 3QVSA 1XEAA 4B3JA 3WMWA 1Y5MA 5L7WA 2CY0A 1RWBA 4ZGWA 4CQLA 4JN6B 1P77A 4J7XA 3S2GA 1TA4A 2W2LA 3PWSA 4ZQBA 3DHEA 5JYDA 4XYBA 5DP1A 2VT2A 1EUCA 1ZFNA 4OOEA 3IQDB 2GGSA 4J7UA 1DB3A 1E1NA 5EQDA 5B12A 4YT4A 1XYGA 1WAMA 4A7PA 1JQBA 4JROA 3PLNA 5IZ4A 4GGPA 4BO0A 2Q3EA 2UUPA 4LN1A 4E2XA 2EKPA 5DCWA 3RD5A 3JD0A 4U5QA 5A9SB 1WZIA 3BMQA 2NU8A 3W4KA 3LT0A 5A04A 1NAIA 3L07A 1EE2A 1UXIA 5IAAA 3I83A 1EMDA 4H7PA 4JJGA 2B4RO 4B7UA 2O2SA 4DXHA 2R6JA 4UVIA 1LX6A 1DIGA 1VI2A 3D3WA 2NTVA 2NVUA 3GUYA 3ZNNA 1YOVB 3A28A 2PD3A 3DEYX 4CMAA 4EJ0A 2EERA 3V2GA 3PK0A 2NSDA 3AM3A 2ZJ0A 1WMBA 4RLSA 1NHWA 4XYGA 3DBRA 5HS4A 4WCDA 3KSUA 2HJRA 3R6DA 1DHTA 3ZWPA 4O1MA 3IUPA 4CUZA 1VSUA 3TL3A 2XOXA 3RKRA 2IXAA 3ZU2A 1NFRA 3WX0A 4XA8A 1F17A 4Q9NA 2EIHA 3IJRA 3KZVA 3ZWCA 4GX5A 4BO3A 2X0RA 1KVSA 1FDWA 2AQKA 1P0FA 1M76A 3E9NA 1A9YA 5H82A 2OGUA 2IRWA 4Z0HO 4WLFA 4R51A 3WGQA 4E21A 3G79A 4PG6A 4FD3A 2X4GA 4UEJA 4MVJF 3BHMA 4CLHA 1M6WA 3QSGA 4NBTA 4WLNA 1U7TA 4J91A 5MDHA 1CIVA 3OJEA 3GC6A 2ZIZA 4FBGA 4UEOA 5GZ1A 2JCYA 4KTTE 5BSGA 2NQ8A 2FPIA 2CDAA 4HNGA 4TKLA 3P19A 3QWFA 1J4AA 4IXWA 3HB5X 3IMFA 5CDYA 2QHXA 3IP1A 4E30A 2HDHA 1T4DA 5CHEA 5BT9A 4XDZA 4TVBA 2AEJA 4ZA2A 5T64A 4BO5A 3Q2KA 3CEAA 2Y1OA 3ZU4A 5B37A 1FDSA 1HSOA 3FNEA 2DUWA 2EF1A 4XIYA 5CAEA 1CF2O 2YDYA 2GERA 2YZ7A 2VYVD 3NGXA 3L6DA 2HJSA 5C5IA 4FGWA 2PGDA 3VKUA 2CDCA 5C7OO 1E7WA 1Z45A 1LA2A 3ON5A 5DF1A 3WYBA 3OBBA 1ZNQO 2NNLD 2HSDA 3O9ZA 3WJ7A 2HK9A 1H6BA 8ADHA 4AJ2A 2NU9A 4J1QA 4EW6A 3DZGA 1JAXA 2Q99A 3PYXA 2VUSA 4MKZA 4RLHA 3DONA 3WICA 5KJFA 1QKIA 2FSVA 3TZ6A 2Q49A 1YWGO 2EKLA 3WTCA 1MFZA 1E3JA 1HF3A 1O6ZA 4JBIA 1B14A 1LDNA 2NV6A 2WYWA 1JW9B 2YHIA 4W4TA 3H9GA 3ZWMA 3QQPA 1NAHA 2VZ9A 1B16A 1NQ5A 1O89A 4AJNA 1O94A 1E5LA 5KJCA 4ILKA 3PYMA 3G49A 2D5AA 5T57A 1L7EA 3NYWA 3TOZA 1LDMA 1UAGA 3HZZA 1VSVA 4WEOA 4J4TA 1DFGA 4XD2A 4BO9A 2X1HA 1BVRA 3OQ6A 1NBOA 2CUKA 4YXFA 2VUTA 4PG8A 1DJQA 1JDJA 3HQ4O 3ZNOA 5DN9A 4EUFA 3KSZO 4CMCA 4CMKA 4JJIA 4BOYA 4BS9A 3E82A 1XDWA 5BSEA 4E33A 3MOGA 4NJOA 1NASA 2JHFA 2YY7A 1U9JA 3M2PA 2DKNA 4CM3A
chains in the Genus database with same CATH superfamily
2Q6OA 1SCQA 4D43A 3IUBA 4EYSA 1D6SA 3QVGB 5F4ZA 4BRZA 3IDSA 2DWOA 3DMNA 3KHSA 2BBTA 3KXPA 1WXDA 4JLWA 3I3OA 4GX0A 1VZ2A 4OL9A 3GGSA 2G5GX 1NYRA 1SU6A 3RUCA 2WFMA 3B1FA 3K32A 4PTLA 4YJHA 5ER6A 4AJIA 2WJVA 1A4UA 2PSJA 2YV5A 2FPWA 3KJZA 3R0QA 4PW0A 4X71A 1EXVA 1DTSA 2ZANA 1SCNE 2RIPA 4B8YA 3R3JA 3QWAA 1O5OA 3BE4A 3II6X 2AMYA 1XQ6A 1Z47A 1J8QA 1GTRA 4L5IA 3RTEA 2Y93A 3EA0A 3UWKA 4KG7A 3AP1A 1THMA 4F4HA 5EJ9A 1H5UA 2FSSA 4KFSA 4OQZA 2BTEA 3LWBA 1OD6A 3A9SA 3OZBA 4IEEA 4MVCA 4OQLA 4ZVKA 3DH0A 3K6JA 2VSFA 1ZEMA 2NU9B 1AHHA 1G8SA 2LIPA 4C14A 1ECLA 2SKCA 3GVHA 5K0TA 2P1ZA 2ZAOA 1KKLA 3HBMA 3HO6A 2OZEA 5EESA 4B2PA 1Q2UA 3R7BA 2Z2KA 3PQ3A 2ODNA 2YWDA 3FCEA 1MTZA 1I5RA 1Y6JA 2GCNA 1U0GA 1T1JA 1V7QA 4QUGA 1XLUA 1E60A 1SQSA 1CD5A 4CMHA 2VSYA 2JI9A 2N75A 2C5AA 2WE8A 3GA0A 2QUBA 5G0VA 5HE8A 3IURA 2FSPA 2ZYVX 5EJ5A 1B7GO 1UXKA 2PUJA 2XNJA 3LHFA 2WPNA 3FN4A 3PRKE 3NTXA 1M7BA 2P8JA 2D2FA 4PYLA 5EIHA 3BWYA 3H6GA 3RSSA 4CFZA 3KSBC 5CNKA 4QXAA 3F49S 3WQQA 4G5QA 10MHA 2XSZD 3WYEA 1PQPA 3EQ6A 3LLCA 5CVJA 3SHTA 3V8EA 1F1JA 3T4UA 3X2EA 2W2LD 2W43A 3H1BA 1R66A 1SH7A 1BEZA 5AOVA 1NBHA 2QM3A 4MTCA 4TLLB 1Q16A 3Q7EA 5E6RA 3EEYA 4TUYB 4X3CA 3ZGLA 1P1BA 4Q39A 2C7RA 3HV0A 2DPHA 2WILA 3EDRA 3TCXB 4C3UA 5ICEA 2FKAA 4M53A 3KHUA 4X7RA 4Y7CA 2OXFA 2HGZA 5ALNA 1FNBA 4NMWA 1YJ8A 2HM7A 1P3DA 1WHSB 4CYMA 4WBSA 4D4LA 2PTHA 3P4XA 2ZTMA 5JRZA 2MR6A 3IAXA 1NXVA 1WSWA 5ALJA 1TK9A 5G0TA 2F6RA 3GMTA 1VC2A 1D8TA 2OO5A 3KUDA 3ND5A 1NT2A 4ASUD 3BD8A 4PU0A 3WWYA 1I1OA 1FDUA 2C4KA 3A9RA 1ABEA 5BN5B 3U7QA 1M1YA 2F1OA 4NG4A 4TTQA 4HVCA 4WXYB 2I66A 5A4MS 1Q0ZA 1IN4A 2RHHA 1EHIA 1Z15A 2FGJA 3L0IB 1N3LA 1U7OA 3QVVA 4JLSA 2IHUA 3P2JA 4MR8A 5CDTA 3ME5A 4PQEA 2QMHA 3WGIA 3LUDA 3U7GA 3AMVA 4Q05A 1IN7A 5AK5A 1HKHA 5ENDA 3LZCA 5L7YA 1GLGA 5EWJB 2JA1A 2ORVA 3D5EA 4Y3UA 4L51A 1RBQA 4AO7A 5JEDA 3NRCA 2UAGA 1DC5A 2QRPA 3FRJA 3H8SA 5CHYA 3DM5A 4PX9A 2EBUA 3M89A 5ALLA 4UHEA 4BVGA 1PNRA 1I2ZA 4IXMA 5CD1A 4O0MA 1B76A 2RIRA 2E6KA 1G8FA 1WABA 3FYUC 3H4TA 3RB8A 3VR6H 3GEMA 5C7LO 2HA5A 4I8XA 1HNXB 1PBNA 4CIAA 3KYJB 3PVCA 2WWRA 4IKPA 1YI0A 1FOEB 4K2AA 4Z9AA 1OPRA 2OBYA 3NT2A 3L8CA 5E8JA 4CTOA 4IIVA 1H23A 1E5VA 4I4TA 4ITRC 3UFBA 4C3VA 4HVLA 1PD0A 1EVLA 2FX3A 3K1AB 3SVZA 4DYDA 1YDGA 2FWNA 3NDBB 3GF4A 1U1IA 1P1HA 2PA0A 3G5UA 1U2DC 3OUZA 1KEWA 4G5SA 1EGMB 3PNKA 4XQEA 5T3UA 2XBMA 4W1PA 1QE0A 2UXBB 4W6QA 3C98A 1AQYA 1C3EA 4D02A 1PR2A 1Y8RB 5GMOA 1E5QA 3LUBA 2IE8A 1MOPA 2N3ZA 2PD4A 3OZXA 4QPPA 3S7ZA 2OLKA 3GMIA 3K30A 3O8QB 3RC3A 3TBKA 4HDKA 1DO8A 2XAUA 4WFJA 5HK8A 4PG7A 4DW8A 2D7DA 4Q1AA 4RTMA 1V3QE 4QIHA 1HV8A 3O8DA 5JMWA 4X94A 4G24A 3L7YA 3JCZA 3PE4A 1VHTA 1U31A 2ZIEA 3MTGA 4Y2PA 4ZK2A 1E1QA 1PWEA 2EWMA 1XQ1A 1TZMA 2KJQA 1LC3A 2HLDA 3CFYA 4E0BA 4PBTA 3PKJA 2EJWA 4RACA 6CHYA 1RIFA 3LCJA 3M6FA 3RFVA 3LWNA 1E4OA 2XR1A 4ZRMA 3T9BA 4A03A 1W0KA 2JLQA 3GDFA 1NMZA 2PUBA 1L5RA 1Z62A 1B0AA 3WRWA 3PS9A 1FBNA 1GNVA 4HX2A 3ONNA 3KDSE 1BKSB 2VL7A 3ZNPA 1TQ6A 2INGX 4J3FA 4WX2B 4UEKA 3F2IA 2O48X 1GD1O 3NBKA 4Q7JB 2ZE6A 1DJOA 4N7MA 5L51A 4JUFA 5JAMA 1Z13A 1ZNYA 2PHZA 4FNGA 4RCYA 4Y6LA 2YS7A 1VE3A 3AR3A 5TT1A 1KVQA 1LF5A 1FF9A 1HQDA 1U3FA 2O8CA 5FNVB 3NETA 2IUSA 4DS3A 1J2TA 4EG4A 4R3WA 4ZT4A 5HDBB 1E2NA 1UOOA 2E4WA 5KVVA 3WMXA 3W8FA 4DXDA 3L7MA 3RHFA 4YMTA 1K86A 3I9OA 4XEHA 4BP8A 3EMKA 2FA9A 3VFDA 4OQDA 3NLLA 2W6OA 4QOEA 1EZZA 1RQNA 5EWJA 2R1UA 1Y3BE 3ZKWB 5EINA 1OXSC 1SVMA 3NI2A 3HVRA 4FQ7A 4WDRA 3LUFA 4PHGA 3EUWA 4O3MA 2QP4A 4FJ2A 1FDRA 1PTJC 3DHVA 3Q6IA 1HFJA 2B0CA 5G4KB 1C1HA 2GKSA 1AGPA 1RLIA 4TZTA 1FDTA 1SKYB 2PD6A 3HEAA 4FFBB 2WJAA 3HL4A 2AXEA 1OH8A 2CL0X 3DXXA 2V6BA 4I3GA 1YVRA 2J08A 2OP1A 1RJ9A 2HCRA 1UIMA 3L18A 1ENYA 4XKJA 1T0UA 2ADFA 1ORDA 3FLAA 3PUZA 3QZUA 5YASA 3UWPA 1UBCA 4ZFNA 1COWD 1CIJA 2E1RA 1APBA 1E3EA 4K28A 4BO7A 1GTSA 2VA8A 3F7NA 5KX5A 2AT1A 1PWZA 2WIFA 5A3QA 4HLUC 2A59A 4AUKA 1Z75A 2XQFA 4OB7A 4ARIA 5GP1A 3QNMA 3UCFA 3LUKA 4NYMR 4RETA 3RODA 1FZTA 2PN1A 3V2UA 2OFWA 1QLJA 3RIHA 3AQ4A 1SB8A 3H9QA 2WAAA 1J8VA 3NX4A 1FJ2A 1B1AA 2QMOA 4XQCA 2DUUA 4MWZA 4F1KA 1JLLB 4PLFA 4V2IA 4H7EA 3SFTA 1ZJJA 2I6UA 3HPQA 4GRAA 4XQGA 1U11A 3X2SA 5EHXA 5KDOA 5LQJA 4RMGA 4DT1A 4EKEA 4QX6A 4TSFA 4AKTA 2OG2A 4H77A 1JXMA 1GCOA 1O7JA 1ZM9A 2Q5CA 1UDXA 2RDMA 4Q00A 5I7AA 2NZVG 3ZLTA 3HVUA 1QVZA 2PVSA 4D25A 1L5MA 2DR2A 2VJMA 3ENKA 4IGFA 4L0CA 4F9TA 2H7CA 2HA6A 2ZB3A 3PPYA 5H3HA 5TPWA 3RRMA 2GAAA 1CERA 1W4ZA 5D5HA 2YOFA 3WO0A 3BXFA 3JQBC 1W0CA 1U02A 1E1DA 5MN4A 1HQKA 2JHGA 4AJ9A 1JXQA 1E7QA 4IVNA 3LC7O 3FOWA 1NJ5A 3QKTA 4TGLA 5GGXA 1XTRA 3L7CA 1UFQA 4WW0A 1Y42X 3U7JA 3CR3C 4EHBA 3ITKA 1B8OA 1CZKA 1I51A 1QP4A 1SO8A 2QMUA 2Q62A 4FFBA 1MBZA 4NIMA 3KB8A 4QM6A 2ZWAA 3QH4A 5T6MA 2UZ3A 3UG6A 4P98A 3V7NA 3LDAA 1F4PA 3N76A 2BKAA 1XNRB 1DMRA 4HFNA 1R1DA 1IJFA 3WKBA 3SZRA 1SMKA 1GUBA 5KOYA 2WU4A 5U9CA 5CR9A 5KOJA 2A1TS 2P2LA 2ZJ1A 1WCYA 5H4GA 5JNWA 3TJMA 2AFIB 2VFAA 4DQKA 2GF9A 1ZK4A 2ZUEA 4MGHA 1DU4A 1FXUA 2Q0SA 5BYJA 2W0MA 3OCYA 1VJ5A 3WP0A 5I4IA 3ZY6A 1TJPB 4DA9A 4FGSA 1YQGA 2B30A 2ZSJA 4MDEA 3MWLA 4TVOA 5AVSA 3D7MA 4N6GA 3DR3A 3N0VA 2H11A 3NAGA 5ALXA 4FWBA 2PL3A 4NE2A 2FW8A 2FHSA 3P9RA 3VNUA 4O2AB 3SYMA 2CWDA 4MR9A 2GBIA 2IF2A 1H4QA 3LBNA 1FPQA 4I55A 1BIFA 4N49A 4P5PA 1JSXA 4GI1A 2BHNA 2CBGA 1Y8ZA 1SU7A 4Z9XA 1T34A 4MV8A 4MQ4A 4WT7A 5DHQA 2WWYA 4LVNA 1AN9A 5EHQA 4DPMA 4C6SA 1H2XA 4ESEA 2OQ2A 4MQMA 5JNVA 4XWYA 3T15A 4A9AA 1GVNB 2AEMA 1VDMA 3WRYC 3GRUA 3PPXA 1BDBA 1NW3A 3AFHA 2HXYA 3C3XA 4P3KA 1IUPA 1H5QA 5GJVC 1BG6A 4WK0B 4B5LA 4RIFA 3QMVA 1R88A 1U6IA 3V8PA 2Y71A 3D8BA 3Q88A 4HAYA 4JR1A 2XSZA 4U6SA 1NONA 1WCIA 4OKSA 1V48A 5AKLA 1BROA 4KBYA 4LMRA 1ISRA 3W7BA 5IKPA 3L4KA 2BMFA 4QICA 3BSFA 2NSLA 3TK1A 5AW7A 1BXGA 1V3UA 1XMJA 1U3DA 5CTAA 4YC7A 4RKQA 2ZI5A 3WWPA 1TFRA 3VH2A 1YB2A 1N6HA 4BO2A 3GH3A 3P0RA 3WY9A 4NH0A 3MRVA 2ZZMA 1YH3A 4UM7A 1P74A 4LDZA 5FPYA 1GSHA 4J03A 4H60A 4W5QA 2XRZA 2CHFA 2P3QA 2JVKA 1ZS9A 2E85A 2RGNA 4JLOA 1AQUA 1RP1A 1KI9A 1QCYA 5B1HA 4ASUA 4C4ZA 1KARA 1KVUA 2R7AA 3NWOA 4FYYA 3CO5A 6Q21A 4CIBA 1XJCA 2XF8A 2O0LA 1DQPA 4URWR 3P20A 1UQTA 4QQRA 5LQMA 5KKNB 1LK7A 3IE2A 3O3MB 4IQ8A 4OPMA 4YJFA 3B1JA 1I10A 1ZVMA 2R4UA 3GI1A 3H17A 2FZ5A 1QMPA 3DUWA 5LYYA 3RO7A 5EHNA 3A31A 1KE2A 1NHGA 1XWIA 1QVRA 2GFIA 3BXZA 5KVQA 2ZTHA 3U16A 2IYNA 3M2TA 3Q10A 4MJLA 1SQGA 3WKAA 3ZV7A 5JNSA 3B3AA 3BWMA 3HMQA 3NBZC 5H3LA 1IJBA 4CF6A 1NDQA 1N33B 3FHJA 4MKHA 4Z4CA 3QBEA 3NASA 5JBIA 4QO8A 4GR9A 2IGBA 2P2ZA 4C9BA 4GG1A 3GO4A 1JECA 2H2HA 1UKBA 4IXDA 3RU3A 3GLFE 2OHIA 3QVKA 4NTZA 1G21A 3TW6A 2LZ0A 2V7PA 3IVMA 4HQFA 4PHTA 1CJCA 4AL4A 1E2PA 2HZ7A 1NYTA 2ICAA 2O14A 1GL7A 2ZI6A 3KDAA 2P6UA 3DAFA 2ZT8A 4WE3A 4WK4B 2ZCJA 3S2IA 3FSGA 3W9YA 4ERNA 4UDXX 2R7KA 4O4LA 5HKKD 4BQPA 2NO7A 1D2AA 2L0XA 4Q7KA 2I4MA 3ITEA 3SQDA 2WNHA 3QIVA 4JH0A 4LDNA 4NEHB 2F62A 1ZD3A 3MHTA 3OMXA 2IU0A 2D1YA 3QU7A 1LNQA 4QHSA 3IIEA 1LLUA 3C8HA 1QRRA 4FT2A 4M55A 2AMFA 4KUGA 4ARBA 3MD0A 1XQXA 2H5LA 3HADA 3ONFA 5JDCA 3JAWA 2GZ3A 2G88A 1HMPA 2HQBA 4DARA 3H6HA 5T41A 2I1QA 1AXGA 4DUGD 3WL5A 1CZRA 2QJFA 4G36A 2O3SA 1CUBA 4HVAA 4V0SA 5ALRA 2WHPB 2Y1FA 4AYXA 4GZ3A 3Q98A 4CNBA 4QTYA 1DEXA 2AEFA 2OEPA 3B1WA 3NPMA 4DMFA 1QU2A 5JR3A 1PF7E 4MEJA 4Z7QB 5AVVA 3UCXA 1W85A 1PUJA 1TT7A 4FQ5A 3D81A 4FFNA 4U0JA 2ZRIA 3CLHA 2A2ZA 2JEOA 3NNDA 5KI6A 3VKGA 2WF7A 5F7ZA 4DA6A 5LOVA 1EWTA 2EL9A 2FE1A 2GJAA 3QVGA 1E7YA 1R6TA 1VLVA 4EMSA 1DUSA 3I76A 4YJ2A 4LWZA 3PKZA 2J0UB 2BAGA 5A7FA 3K8ZA 5FWYB 4DQ0A 2IS6A 3DTVD 1IG3A 4MS3A 4ZOAA 1G38A 5C1BA 1EE9A 5E4YA 5J59A 2XUFA 1JKFA 3BWCA 2CSUA 3AL0C 1F5NA 2QZZA 3S1LA 1ZL0A 2SCUA 3GB9A 2DZDA 3FDFA 3GWGA 3LJKA 5ABPA 5AJWA 2G82A 1EHYA 5LPNA 4XXHA 5AIAA 1LSJA 4OXQA 2QTNA 4DLAA 1CNMA 5CPFA 2J3HA 5G4LA 3SSMA 3PNPA 1PVVA 3JQPA 1SIBE 1NN3A 3B60A 1T5TA 3F5DA 4N5DA 3TNFA 4B32A 2AVNA 3EH2A 5AM2A 5I47A 2JLZA 1SN7A 2EX0A 2ZAMA 4F3NA 4UXIA 1JG6A 1O5IA 4K9NA 3W90A 3ZJ5A 3M5WA 5FV4A 1SFRA 1X6VA 3ELBA 3RIYA 3TEFA 4AJPA 3JQ8A 3THXA 2AG1A 3VDMA 1JKJB 3CLKA 3MT7A 1FRFS 3ZGNA 5CCBA 2FWIA 2QTHA 1NX9A 1GHTA 2R1VB 5TPZA 1KZYC 1ZGZA 1CXZA 3RF7A 4PHFA 4GLOA 3HTXA 3GJ4A 3SWWA 1BA2A 2H57A 2EYQA 2FSVC 2A9FA 1XZDA 3CA8A 3Q8LA 3KTAA 2WV9A 1YB7A 5DP2A 2Q5QA 2ZIGA 3ET5A 3JD1A 3DNPA 5CDGA 1HA3A 8MHTA 3R44A 1OZGA 2HPAA 3IVXA 1DOHA 3ZX5A 1S1MA 3IULA 4OGGA 3A4NA 1GILA 2H9YA 4H17A 4RD3A 5I8PA 3OQNA 2COUA 2VJBA 1Z0SA 3LL7A 4MRPA 4UE6A 5EMNA 4M6WA 4FZRA 1QLWA 2PMDA 4DLXA 4YPOA 2O8BB 2JASA 4MCIA 5JRJA 1JHAA 3A3OA 1PRYA 5ALSA 4YV1A 2EZ9A 3P96A 4CI9A 4D92A 1YDEA 4LBYA 5E6RB 4TS3A 1U0OC 1W88A 2E0IA 5ALGA 4PYQA 5CDFE 1V4NA 4CTJA 2NU6A 2CUTA 4R69A 1X9GA 3MW8A 3LVRE 2WIAA 5LJIA 3TF5A 2FRVA 2YOHA 2NVUB 3CZAA 3AIOA 1VJTA 2WLSA 1D2MA 2AOXA 1O57A 3GP8A 4C29A 1NDHA 1P4AA 4GM0A 1L5FA 2POCA 3NBUA 1GNQA 2H06A 3SF8B 4OYRA 4BCBA 1H2BA 5LR6A 7ABPA 2HRCA 2JG3A 1UINA 3BRWA 3ZTYA 2JGRA 2OCBA 2IQIA 3DZBA 3FPHA 5KKCA 2A9VA 3LA8A 3H4IA 3IVRA 3M1IA 4FEGA 5FEMA 3WSWA 2QLNA 4OGWA 3RDPA 4F6LA 4IG9A 1HL7A 3IX7A 4JLKA 4KQCA 5FULA 4MWGA 1NKSA 1OIWA 1FS5A 1KIFA 4JQCA 3GT4A 2XT6A 3KLBA 1A97A 4NI5A 1FRZA 2XB8A 4EY7A 3KKKA 4IJMA 4BP1A 5JBQA 4XYLA 5HIIA 3EYAA 1S2GA 4IJ5A 2V54A 4LV5B 1N57A 1OI7A 1F06A 1TD9A 3KR0A 1T9KA 1A50B 1IYZA 2JD0A 1G1AA 1T3LA 2H52A 1B8PA 1PG0A 3OJCA 1GT6A 2B0JA 1M0EA 3QF7A 1OROA 3ROQA 2Z56A 1W5TA 3UH0A 4DLBA 1W30A 2AZ4A 5WRFA 3D4BA 1N5KA 1PE0A 2Q8NA 3FDIA 1UDAA 3DFKA 3JQ8B 1KP3A 1T8TA 2W8BA 4Q4AB 4ZCTA 4PZYA 3Q3GE 4YUWA 1O6GA 2G71A 5FL7A 2FDCA 1C2TA 3BORA 1LBTA 3L7LA 3MZ0A 5I8ZA 3CVJA 1L5GB 1IEQA 1MX9A 2O23A 2OZKA 4XGNA 3Q7SA 1CUGA 3ZY5A 2DBRA 3ZHUA 3IODA 1C9EA 4B75A 4HUQB 3HXTA 5DI9A 1GPWB 2Y92A 4PZUA 4Q3AA 5IMSA 1SK9A 3FFTA 2X1LA 1JALA 3ONDA 1YONA 1MO5A 4Q5IA 4B3GA 3I9MA 3L41A 4UEQA 5F9HA 2KSQA 2QN9A 3D1LA 3CT6A 3NBFA 1E79D 3U4HA 1UWCA 3C7DB 4TV9A 1NW8A 3EEQA 4RMHA 3I34X 1M2GA 1R37A 3AY6A 2LPMA 3NJ4A 4TT8A 3JD2A 4LJ8A 3ZBPA 1XOIA 2Z8ZA 3IQIX 5GZ6A 5IKOA 1F2TA 4DV7B 2B92A 2GA8A 3EFEA 1HC7A 3H5VA 3LUCA 1J6UA 4TMYA 3WFIA 4IGEA 4ZMBA 2YYSA 1YR3A 1V4BA 2YV3A 2GAJA 4B2YA 1IMOA 1NN0A 3MQFA 4LYYA 1VYHA 2KLHA 3VBCA 1KWGA 1W88B 3T5GA 4PGFA 3GP5A 1BTOA 4YRCA 1KERA 3DBRB 5FR1A 4D0NA 4YQFA 3JALB 3SMVA 4PN3A 1E2BA 2NO6A 2YQ5A 3LUGA 1P9NA 1D4ZA 2FSUA 4H6PA 2QK4A 2Q0XA 1DTEA 3Q11A 2GTIA 2ZBGA 1HRDA 4U02A 1OGIA 4Y6QA 5HBRA 4IW3B 1KZHA 4E51A 3OQ1A 1Y3DE 4LW8A 2AJBA 1BH2A 2HUNA 5CCXA 4B79A 2VYFA 4EBFA 1OAOC 3R5XA 4BAGA 2ZJ7A 4V0ME 3D8HA 5FOXA 5JAQA 2XZOA 3RIXA 1JIVA 3RRNA 1O8BA 2A58A 4NCIA 1S2MA 4YCDA 2XWSA 2JIPA 1V8BA 2I76A 1E8NA 4PAMA 3ZTWA 1UMBA 1WKBA 2FZKA 2VP4A 4RK5A 1HE3A 3U13A 1U94A 4JLMA 3PG5A 4LJAA 3NJRA 4QELA 4KAFA 2Z5LA 1T2FA 5FWXA 2WJIA 2VJKA 4DTCA 4EI8A 5BSVA 4PG4A 3SY8A 1T2DA 4WXRA 5A6VA 3U3RA 2GDJA 5MGBA 2DR3A 1MB4A 4MPPA 4UU1A 4RJIA 4Y2HA 3QKWA 3N6RA 3IEKA 3OZEA 4W8OA 4WKBA 3FWHA 3LH5A 2PY6A 4MJ7A 4V0MA 2V9CA 3GN2A 4GQBA 4HNUA 2X0IA 4GWLA 2EFDB 1ZMBA 4NBSA 1ZX1A 2GMWA 4XYEA 1X7ZA 4FGJA 2G76A 2AX3A 3BCHA 1ETUA 2WSBA 4RPIA 1X7WB 1FLDA 4XOUA 3HWRA 3RHZA 3ZD8A 5B3JC 5K4GA 5NLLA 1YSCA 2D0PB 1KYXA 4NHOA 4CDGA 3B7PA 3U7QB 3RJ9A 5BN5A 1S2IA 2CNBA 5KZMB 4H9GA 5KYUB 3RSOA 1JNXX 1C0KA 3H9JA 5K0EA 2HPHA 1H8EA 2R68A 1GVHA 2HSJA 4I36A 2QI9C 3AEQB 4D74A 1NYQA 3RLFA 1VHLA 3P9ZA 4LJ6A 2X2FA 3CMCO 3FI0A 3H7IA 4XTRA 5HP4A 1P5FA 2J46A 3QE2A 3Q9SA 1T29A 2C9OA 4NOMA 1I2AA 2Z2YA 3HE3A 2M1ZA 4G4SO 3RTGA 1QYVA 2ZXFA 2YMPA 3DS8A 3EZGA 4AYTA 4LSMA 1OYYA 1XDBA 3TUJC 1CQIA 3BXEA 3GT3A 3R3YA 4LE0A 3RVKA 2R2AA 1F2UA 1GRQA 2XDWA 1H2YA 3A3YA 4QYWA 4E5PA 1IUNA 1HLFA 2CNWD 2WPDD 3OTWA 1QP8A 4I5FA 4RZSA 1WEKA 1NSTA 2GM3A 1U7XA 4RTQA 4FFMA 1E3WA 1OPXA 1UWVA 2PWBA 1XA4A 4I1OA 4RKWA 4Y0NA 2I2BA 4YO8A 2XB4A 4ZOBA 1D1QA 2R8EA 2A1IA 3KWJA 1P0IA 1RAAA 1KDYA 1IQRA 4Y6SA 3JALA 3OMLA 4X95A 3T9EA 1NQOA 3DOFA 3FPLA 4LHWA 8LDHA 1BXKA 4X1IB 2J1LA 3VYUB 4EPTA 1TC1A 2PK3A 2OTCA 4BQQA 1FS6A 3JWHA 2DULA 4I1IA 5FUQA 1TM1E 3GJ7A 4R5HA 4K6FA 3GQVA 4FC6A 5TPWB 5B6JA 4S1WA 4EUKA 1XL1A 1AK2A 4C4PA 1FDIA 3NM6B 4Z9BA 4DIBA 3OM9A 3QKSB 4L02A 2EKZA 5J4HA 3SYNA 3NZEA 3WMFA 3A1FA 3BRWD 1ZINA 3PV0A 4DBVO 4EEKA 2PL5A 3P5SA 3SR4A 2HIHA 5EHGA 4CZ2A 1N2SA 1G5RA 2OCGA 3P2OA 5IKXA 3EK2A 2D5IA 3ETNA 1KEVA 4JEUA 2AR9A 3R8FA 4CEIB 2PX3A 1JFSA 1TO2E 2DGDA 3I92A 1ZA1A 2YV4A 1JPUA 4RKRA 4ZQFA 3RYIA 3UAZA 4DG9A 4QBFA 1ECGA 1FFCA 1JX6A 3BWDD 3CH6A 3IL2A 3WLNA 4AZ0A 2C99A 1TEHA 2VDMB 1A96A 1SY7A 1KY3A 1NC1A 1N92A 2AFIA 4QU0A 5EYPB 4FBLA 1XF1A 2EJBA 1BMQA 2GARA 3AEKB 4ZJUA 3M4ZA 4QNNA 1PGJA 2V98A 1TPZA 3SNKA 2N1BA 2DJIA 3QFFA 1H4SA 5EFOA 4DR5B 1WVGA 3KKQA 1T5HX 3C85A 2Q4BA 3HY6A 1AMNA 3TI9A 1JNYA 4G67A 3W8RA 4ZVNA 2J9XB 3JSAA 4JY7A 4IPTA 1OVGA 1TECE 2ECOA 3M49A 4LECA 4LJ7A 1A27A 1VGVA 1ZI9A 1NRWA 4XZ3A 3TE7A 3F96A 1J25A 5JVDA 1Y4DE 2ZOSA 2FMXA 2XA9A 3F6RA 4Z5XA 1KQFA 4Z4QA 1YL5A 1SULA 4XIJA 3VTAA 3UT5A 1RXCA 1J0EA 3HYNA 2H4WA 1IXZA 4J0JA 2Q1SA 4P84A 1ZGBA 4Q66C 5ALHA 2Z0MA 3U9LA 5HGXA 1Z6ZA 2VQ3A 1YVDA 4IIGA 5DYGA 1VG8A 4OB8A 1GPJA 1DRVA 4DV0B 4PZLA 2ZDQA 5J4YA 1T3ZA 1X42A 4LZOA 3IKTA 4Q7EA 4WBNF 4Q48A 1CRWG 4LI3X 1JUDA 1KYYA 1EQUA 2GVZC 1SCBA 4V1CB 2X8JA 3OU7A 3G0IA 4LI0A 1KFBB 4PF1A 4EUHA 1WOMA 1XWWA 2YOGA 4NAVA 5IM4F 1L7BA 3BXXA 3GNTA 2AOWA 1A9QA 2PZFA 3HUUA 3I2YX 4Q3KA 3A7EA 3IVGA 3MRXA 1LLFA 1IG0A 4G07A 4J3NA 3RU7A 5FA6A 1EVIA 3PTLA 3TMAA 3AG5A 3Q2OA 1GQFA 4N18A 5BORA 1HDXA 4WLEA 3ZOKA 3KVRA 1IPEA 4KXMA 3REOA 4BPBA 2R8PA 3DP7A 2JLXA 1DMSA 5EYPA 4RTPA 5KQPA 3S8YA 4KSYA 4DCGA 1K0FA 2DCUA 2W2OA 4JJ7A 5JFGA 2W6CX 1OHHA 1NOKA 2HYIC 2NP7A 3ETCA 3PX3A 2PG3A 4JXZA 5JJIA 5GTDA 1MJHA 4LY0A 1TVEA 2Y67A 3TR6A 3U62A 5FWAA 3OJFA 5AJZA 2GNAA 4QE3A 3UJ9A 2H2IA 4HDQB 5BO5A 3HP7A 5L4LA 1F7UA 1L1FA 2AE1A 3P9NA 1RQRA 2GBPA 2EP7A 4KO2S 2ATIA 3VBEA 3VVLA 4ZCRA 4J3JA 4BNGA 1DX6A 2O2GA 2V7WA 3CLRD 1W47A 3DAHA 4IZHA 4UBJA 2OVBA 5EUMA 4MINA 5FOTA 5LBUA 5HS6A 1I6MA 1HQCA 1AX9A 5AXDA 4US1R 1XQ9A 1WB9A 1N4DA 1NXSA 2ZTVA 3NC1C 5TS3A 2ZRBA 3SYKA 4RHCA 1L1EA 1U2PA 1T4BA 2E5FA 1T8UA 4HAUA 4XWGA 4OHFA 1XD8A 2P30A 3EWNA 4ETWA 4RDXA 3QEBZ 4JHXA 4LHSA 1XZQA 5A6SA 3ZLJA 3EG9A 4BY9E 1TUEA 2IHVA 3DW1X 2H1WA 2GCOA 3H83A 3LPAA 3PHBE 2ENUA 2I3ZA 2OK8A 2VJAA 2WKRA 4FN5A 2PKCA 4GI5A 4TLCA 1E3DA 3SIRA 3IPYA 3SHWA 3TQCA 4DSNA 1ZSNA 2OV2A 3ZY4A 3PX2A 4Z9FA 5IARA 1PYOA 3B6KA 3VNQA 1UQUA 3MN1A 3WK9A 4A5OA 4A0GA 3ORHA 2GCPA 3O95A 4LTDA 1W5AA 2A6PA 4GOLD 1MX1A 3TQIA 3VU3A 3ZI7A 4H7IA 1OH7A 5BUZA 4AKIA 1L4YA 4EW3A 4WNCA 3QLUC 1PWHA 4K26A 4Y2RA 1H94A 1Q5PA 1CQXA 1LSOA 1X7DA 5FBHA 3T38A 3WV5A 3JRWA 2J9YB 1JFTA 3IR5A 1PNTA 3OZUA 4UMDA 3LVBA 4M7WA 4P2BA 1CZOA 4ZICA 5BOSA 1X1RA 4ZKEA 5HKOA 3P71T 2BEUA 4G37A 1Y3IA 2PH1A 3LIPA 1QV9A 2ZUWA 3HDQA 1KGSA 3GJ0A 3HCFA 2H2FA 1IDOA 1VBFA 3K16A 1JTVA 4CG1A 3FFBA 2WSMA 1A5SB 5ILOA 4ZAZA 3AONB 4BBJA 4G1EB 3EZYA 3ETEA 3GD5A 5AUOB 1PZGA 4N76A 1Q57A 2XWJI 2VYVA 3O38A 3OETA 3EIXA 2C3MA 3RH0A 3D4IA 4AS3A 1G98A 5LOVB 1JKIA 4DSAA 3ASVA 3V1UA 2I7DA 4CMJA 5KNDA 2B37A 4RF3A 3HCCA 2YDXA 4WK6A 3QVXA 1U2SA 2J0UA 4MXDA 5TF4A 2VWQA 2EBHX 2IPOA 4TTJA 4HN9A 4PFJA 2WTMA 1Z82A 4NJMB 4O33A 4ZZIA 2WF9A 3ZI4A 3SJZA 2RKBA 3REQB 1HEYA 5HRAA 3RWBA 4B3HA 4PIVA 1W6UA 1XALA 1OILA 2O06A 5K0NA 3FGZA 1LPMA 4J6EA 1ML4A 1UAAA 4RVFA 3NAQA 1OX6A 4BZWA 3DYBA 4TV9F 4M9SA 2NU7B 1M2HA 5IAEA 3WHPA 2NVBA 3O9VA 4DA8A 2EOAA 2VZ0A 3MWEA 3CMMA 4WY5A 4URXR 4MHSA 3WHLA 4QM7A 2FG6C 3GU3A 4KDRA 5G0UA 4RD1A 2G09A 3VQTA 3WIUA 2CXUA 3PQ5A 1WE2A 2GFHA 3JYLA 3LT1A 5EZQA 5FPSA 3VSEA 1XVVA 4HK4A 1OLSB 4NNJA 1XQYA 3CEJA 4RFLA 3H3FA 2JFZA 3OKPA 2M1XA 5HMMA 1RU3A 5C31A 3KAQA 3GHHA 1WO8A 1VYUA 2ZKIA 4DKJA 1XCJA 4BFZA 1J97A 4UASA 3W34A 2GO1A 4L15A 2IYZA 2Z9BA 3AJ9A 4DNPA 5IXYA 1U3CA 3OPXA 1O95C 4OKNA 5THQA 2IZ1A 2IH2A 4Y2JA 4PAGA 2IV3A 1ID8A 2WJGA 3GROA 4ZYXA 4FU0A 4G8DA 4YIHA 4QTZA 4EHHA 5JAOA 3NW9A 2X3FA 1QPGA 1LDEA 1UPCA 2CVZA 2V45A 4K81B 4B35A 4RA6A 3VPFA 2C96A 2QM7A 4CODB 3IIKA 1YBFA 3QPVA 1IJKA 2OCAA 3OQPA 5KREA 5IDQA 2ANBA 2PNFA 4URFA 4O29A 2P9YA 5H68A 4LWOA 1R15A 3D8RA 5DK4A 4ESHA 2IDKA 3Q87B 3PUVA 5AHRA 2Z04A 1OV6A 3DNMA 3O2JA 5DGTA 1NW4A 4JJAA 5CAEB 2AVDA 4M7RA 2W4IA 4TLAA 3EPRA 3VVCA 3WNZA 1QYIA 4R2LA 1HYBA 1NG9A 1NVBA 3IBTA 1SVLA 5CYPA 4LBZA 5ALOA 3B1XA 2A7XA 1A9XB 1IRXA 3ONVA 1W73A 4JJ6A 2V6GA 3NGLA 5JCJD 4P82A 4AKGA 4RM3A 2Q7DA 1E1MA 2KMLA 3ADOA 3IT0A 3P2YA 4PPQA 1GPKA 2OOSA 4HHEA 4PZ9A 1ND6A 1MA0A 2R2GA 2ZBPA 3A1UA 4MICA 4KU4A 5TQ0B 4GVXA 2QV7A 3AYZB 3QLTA 1EP9A 3CWCA 4KNWA 1KI3A 2I3AA 4MEBA 3UENA 4AAYA 4RV5A 2GCIA 3OP1A 2QQFA 4HVTA 1RACA 2F3TA 4U39A 2Z6QA 2FN9A 2XBLA 2O52A 1L5WA 4HDNB 1Z34A 3UJBA 5CGQB 4HS9A 1RYFA 1S2LA 2DUJA 2RHWA 3PXXA 4JFRA 3REQA 1GARA 1W96A 1FK8A 1LQ2A 1FP4B 4MO2A 4YIKA 2YINC 2VZEA 2RAVA 4GPD1 3AUSA 1P5RA 3E0QA 4LJLA 1MH1A 5GOTA 1EXMA 4CR7A 4I08A 4IMRA 4OHBA 2VN8A 4YI5A 4ZI7B 1DDOA 3BTUA 4XVHA 3TJZA 4BVBA 2EGHA 1FVXA 1JHDA 2D1QA 1R0YA 3CRZA 3JRXA 4N01A 2B82A 3HBNA 1N3IA 1N2EA 2V7BA 3PWKA 4A6DA 1R8SA 1A9ZA 2ID7A 4YMGA 1GRRA 4Q37A 1FEZA 1W1WA 1W85B 3OVMA 1OTXA 1JEAA 5LU8A 2P90A 2G36A 3LQRA 1JWAB 5TQ2A 3BDAA 4YP0A 1QGYA 2XKJE 4LY3A 4P58A 3GJ5A 3SVTA 2IOFA 1QRDA 2B9VA 2BH2A 2IOHA 1Q7TA 4LWQA 3CV3A 3PNMA 1PEKE 1UP4A 3OLCX 5C4GB 1SUSA 2ZDGA 5C34B 3RE1A 4BGDA 4MS3B 2XECA 4TSKA 5KSOA 1A7JA 3K0EA 3QITA 1O6FA 4Y9SA 3DOEA 1QGUB 2BEWA 3JTMA 4BLSA 5GZ3A 4FE3A 4LBWA 1KK3A 1GGFA 2FB9A 2NZJA 5DVZA 3QYAA 3ZU3A 1ZMTA 2LCIA 5FR2A 3CSSA 1L4EA 2XQKA 4QDOA 5B3LA 5KVAA 3M6WA 1YFKA 4QRHA 4OAQA 3C6KA 2QMEA 5IK2D 1MRZA 4XPIA 3ACCA 4G1VA 5MF6A 3FGPA 3GIWA 4OMUA 8GPBA 1L8QA 1PDVA 2BBOA 3FMFA 2NUAA 4L75A 4ZALA 1G5HA 4QTXA 4LJRA 1U9YA 2C2WA 2Y27A 1D2EA 2VT6A 2ZAGA 4BZQA 1EVYA 1Y4UA 2ZXUA 1C3OA 4E5NA 1JKJA 3NOXA 5ALFA 7GPBA 5JMTA 3FAZA 3SFVA 4PX2A 1JQJC 3GRVA 1QZ3A 4HDNA 4EG3A 4PVDA 1T24A 4IQGA 4ENUA 1LLQA 1JR3D 1I6KA 1O4VA 2WIDA 2Y0BA 3N87A 4RJKA 1A4RA 1E1RA 1XP8A 3V8QA 3W0LB 3N6XA 4KCGA 2HNBA 3VXKA 4JC5A 2XB6A 4C07A 2JH3A 3HGQA 2FFHA 1PWYE 3TD9A 1UBRS 1YOBA 3PWZA 4IIYA 4IKEA 5FT9A 3R41A 4ZYUA 1ZOLA 1I6WA 4N82A 2WYIA 3BAFA 3U2QA 1PV4A 2JGDB 5A4KA 4ZXPA 2F00A 1HYEA 2FWPA 2A1UB 1JQEA 3MFYA 2XUHA 3IOYA 3TOXA 2FQWA 4KDFA 3DHWC 4O2BA 3UHAA 5BW5A 5ITVA 2XJ4A 4KR0A 2GB4A 2BM1A 1QVVA 1QUFA 1TM3E 5CNJA 2OV4A 3PEVA 1VCOA 3AR8A 4H6XA 3EC1A 2TMDA 2Q2NA 2HF8A 4JGBA 4Y2VA 2OM2A 1QO9A 421PA 5IUJC 1Z0ZA 3TZHA 3WWEA 2QA5A 3LYHA 3OQOA 3O4RA 3I72A 4MV1A 1FTQA 3D6VA 3IQWA 3QEMA 2XCIA 4XJTA 4GUAA 4XWTA 2VNSA 3VVMA 1A8HA 4PLZA 3WLLA 1TJ5A 4YBZA 3AR7A 3JATB 3GT0A 4GO1A 2UZ4A 3CRQA 4H3KB 2EP8A 3L0PA 2X4DA 3EODA 3GLKA 4OXIA 2PAAA 2BRUA 2ZI3A 4P5DA 3C1UA 3C2QA 1VPWA 4WLUA 1T2EA 4YREA 3KEFA 5CEJA 3TRIA 1ZJZA 2VRBA 4RMJA 2O1SA 1T25A 3MA0A 5D51S 1CDZA 1QHNA 3L46A 4FB4A 5JALA 5JD5A 4LXYA 4M46A 4C4SA 2YMMA 4JCCA 5JH7B 2OO3A 3PJDA 1GDHA 4ZOQI 5BNTA 2PYIA 4O63O 3W1EA 1GPBA 3ERCA 3VC2A 3IPAA 3R74A 4FBMA 4MROA 5KTKA 1NNLA 2GPBA 2VTVA 4NZPA 3TTTA 3UTDA 1YUMA 4HN4B 1ZHFA 5K6AA 3G13A 4PNPA 1KK2A 4KOEC 4F96A 2QAJA 1Z26A 1U65A 2J0SA 2WJJA 5IJ9B 2QUJA 1BHJA 4MUFA 1OW3B 3HY3A 3JXEA 1SIOA 3ENNA 3PXAA 5FNZA 3ZGXA 4HAOA 1YQDA 2P35A 1XAGA 2JGDA 3PQ7A 4Q1VA 5FUYA 2GOYA 1RIIA 2ATXA 1UPAA 2HRRA 2PZAA 3RARA 2CLMB 1JFFA 2GPTA 4OBBA 1VL8A 4NBKA 3EXHC 1EJBA 5EIOA 4A6EA 4J2HA 1Q1GA 1MAWA 1K88A 1TI7A 4JC8A 4NV0A 4XB6B 1NV9A 1WXXA 5LD2B 4HH1A 3GEBA 2GSDA 1QOPB 2KPOA 3M34A 3R0ZA 4KKVA 4Q3BA 4X1KA 4XVQA 5JMPA 5TB5A 3VPXA 3AEXA 4EBBA 2Y0PA 4QSMA 5CX4A 3WL8A 3HM2A 3AWDA 3WDKA