2VN8A

Crystal structure of human reticulon 4 interacting protein 1 in complex with nadph
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
358
structure length
358
Chain Sequence
LYFQSMAWVIDKYGKNEVLRFTQNMMMPIIHYPNEVIVKVHAASVNPIDVNMRSGYGATALNMKRDPLHVKIKGEEFPLTLGRDVSGVVMECGLDVKYFKPGDEVWAAVPPWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAINKVGGLNDKNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVCSQDASELVRKLGADDVIDYKSGSVEEQLKSLKPFDFILDNVGGSTETWAPDFLKKWSGATYVTLVTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRWAFFMASGPCLDDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGKTVINVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RETICULON-4-INTERACTING PROTEIN 1
publication title Crystal Structure of Human Reticulon 4 Interacting Protein 1 in Complex with Nadph
rcsb
source organism Homo sapiens
molecule tags Receptor inhibitor
total genus 120
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vn8A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2vn8A01
3VPXA 4K26A 3P2YA 3PWSA 3SXPA 5C3MA 3WB9A 4MIOA 4RZIA 3V5NA 4JQCA 2P5UA 1Y8QB 5AVOA 4JP2A 4K1LA 1P1JA 1E7YA 2EP5A 1H2BA 4ZQGA 5A9RA 1XELA 1TT5B 3VDQA 3HSKA 3NT4A 3UN1A 1Z7EA 3DO5A 3WJ7A 2CDCA 1R37A 4R5MA 5CAEA 5L9AA 1LLQA 5C5IA 2C5EA 5AXDA 4A0SA 2C7VA 3DZIA 2ZK7A 1U8XX 3E9MA 1F12A 4E5PA 4U8GA 3WXBA 4UUNA 2HO5A 3RROA 4ID9A 2B69A 1H6AA 3JQBA 1TVEA 2DUUA 4KZPA 2QG4A 4U6QA 4B79A 3ETEA 3W1VA 4CMGA 1VPDA 1NVMB 2BI8A 4Q3BA 1DLIA 1AN9A 4JIGA 5KWEA 4BMNA 3I9JA 4GGOA 1YB5A 2FWMX 4FIZA 4CM5A 4I1IA 4GX2A 2ZB8A 1ENZA 4YRBA 1VL0A 4DWVA 2NTVA 4XQ9A 3OJFA 4A5OA 1BW9A 3H9GA 4J43A 3AUAA 4H3VA 2X5OA 3KBOA 2C7GA 2GUGA 3OEYA 3GGPA 3DL2A 4W9NC 3W6UA 3QW2A 2EW8A 4PLZA 1PJBA 2ZTUA 1PGQA 2Z5LA 1PIWA 1Z7BA 1NP3A 2D0IA 3HNPA 3KOUA 1PS9A 3PYXA 3Q2KA 5EIOA 3DBVO 3UICA 4ZHSA 2VWHA 3GMDA 3NUGA 3AY6A 3WGHA 2Y68A 4D44A 1CIVA 5A03A 3GT0A 1MV8A 3H5NA 4K6FA 3D4NA 5I7FA 3DONA 1I3MA 1CYDA 4OXKA 4NHEA 4NIMA 3VHRA 2FR1A 3QVWA 3NGXA 1QYCA 4W7HA 2G76A 4BNTA 2W98A 1LI4A 5LC1A 2D8AA 2PKRA 1IY8A 1XU7A 3NDJA 2C29D 4XGKA 3L6EA 2Q49A 4KDFA 5IZCC 3OA0A 3H9JA 4PGFA 1LSUA 3DR3A 1JKIA 4PG6A 3QP9A 2GRAA 1F8GA 3PGXA 4TWRA 1Z74A 3OEWA 5JO0A 1RM3A 3NT2A 2X7HA 5TQVA 1EDZA 4AJHA 2ZYAA 2IZ1A 4GX1A 1F17A 1GEEA 1UXIA 3LDHA 1GQ2A 1ULSA 2WD8A 2PGJA 1MFPA 5G4LA 4A10A 3A9WA 2GD1O 4WEOA 1SC6A 1UP4A 2O3TA 1TXGA 3ZWPA 1E5LA 4BO0A 4BNKA 1Y5RA 2B4RO 3HDYA 4PG7A 4ZU3A 2E48A 5IDQA 4YJGA 1GCOA 1HDYA 1A27A 4XYLA 3PQEA 2GCGA 3LC1O 3E48A 1PQUA 4M54A 2CDAA 4KMSA 4GVXA 1RM0A 4H15A 2OUIA 4KQWA 4F46A 2VOEA 3R3JA 3RWBA 5JY1A 4ROSA 5IN4A 3ASVA 2VWGA 2V7PA 3HDHA 2WYWA 1QYVA 1QXSA 2WYVA 4MO2A 5JC8A 4L73A 2WD7A 1AGNA 1UR5A 4NFYA 2Q2VA 3QE3A 4TVOA 1BDBA 1O6ZA 1B8VA 3D5TA 3OIFA 2O48X 4XIYA 2O2YA 4GLLA 1JWBB 4OQZA 3NTQA 2JHFA 1BWSA 4CR7A 3TZQA 2O3SA 3ZNNA 3SC4A 4BNUA 1QG6A 5A9SA 5KJEA 3IKTA 3ANNA 2NU9A 4K6CA 4IGFA 1ISJA 4HFNA 4DLBA 2SCUA 1ID1A 2WM3A 5JPIA 2VRCD 1XDWA 4IDAA 1F14A 4HY3A 3IMFA 4XDYA 3ZV6A 3ICPA 2AE2A 5A1TA 3R1IA 1UXGA 1W4ZA 5CEJA 3F47A 3BHMA 1E3WA 2CNBA 1NR1A 5TS3A 2HKIA 4LGVA 3PHJA 1WXDA 4N7RA 4C7JA 1V0JA 8ADHA 4XIJA 1GUYA 1EVZA 4KWHA 3C1TA 2PKQO 1K6XA 3JD3A 3OQBA 4CM9D 4B4WA 4CL8A 3E9QA 2POQX 4B7CA 1T2FA 2VYNA 1VM6A 1JKFA 2GN4A 3ROQA 2Y0DA 1CERA 1RYEA 3GDFA 2NQ8A 2VZ0A 3WSVA 4ALMA 5TRTA 5JNLA 5KTKA 2Y66A 3CIFA 1BHSA 1NHGA 3AU8A 1C1DA 1PGOA 1JAXA 2ZIZA 4Z3KA 2JFGA 4WEQA 5JO9A 3WBFA 2DLDA 4JXKA 3ANMA 3RD5A 4BIIA 3FTPA 1LRJA 3CTMA 4JBHA 2C54A 4DQVA 3CKYA 4BMVA 3FBTA 3HFSA 3V8BA 4UULA 5THKA 3NJ4A 3IIEA 2EF1A 1GZ3A 3RJ5A 4BKQA 3EVTA 4TKMA 3F3SA 1JTVA 5DBIA 3I6IA 1I8TA 3D5QA 1B2LA 1PGJA 3PHHA 4ZQEA 1TEHA 4CUJA 4D0SA 4DYDA 4I9NA 4YJGB 2HK7A 4YTEA 4AJOA 2EHDA 1SOWA 2B5WA 3O9ZA 3ZU4A 3KVOA 4H16A 2OP0A 3IC5A 4XKJA 3D7LA 4AJ1A 3CINA 4ZGWA 2DT5A 1SZJG 3EAGA 3OF2A 1PQPA 4NBTA 2C20A 5H82A 1XCBA 3SVTA 3U4IA 5IZCA 2PZLA 4I5EA 1HE5A 4B4OA 4CODB 3ZU3A 2EERA 1E3SA 2G1UA 2WD7B 1DC4A 2X9NA 4D41A 1UZNA 4YAGA 3K5PA 1E7WA 3QVTA 3WIEA 3DBRA 3MOGA 4EZBA 1X1EA 5IFLA 3E18A 1AHIA 1YS4A 5T5QA 3H2SA 3JD0A 4MIYA 4TRRA 3TFOA 1A4IA 3H6KA 3LVFO 3U49A 3LF2A 4ALIA 5A9SB 1LSOA 1E5QA 2Q46A 1TA4A 3MWDB 1BVRA 1HE2A 1B3BA 2BRUA 1OOEA 2NLOA 4IDCA 3ROMA 3SJUA 1IZ9A 3VPHA 3M1LA 3ZZNA 3BTOA 3HDJA 3NV9A 5B1YA 5CDSA 3S2GA 1DC3A 3JQGB 2V65A 4XR4A 1DC6A 5L7YA 4HP8A 4L4SA 1HDRA 5EQFA 3HFGA 5FF9A 1DEHA 2NV6A 4ND2A 2O2SA 4KUHA 3OFSA 3PIDA 1PWZA 1AXEA 1NM5A 5TGDA 2CF6A 1ZFNA 2ZTLA 3B70A 3ONEA 1UDAA 3MJEA 4TRNA 1K2WA 4L74A 4CPDA 2BMAA 1I3NA 4JCOA 4AJ2A 3O38A 1ADCA 2IRWA 1Z82A 1C1DB 1Q0QA 4LCEA 1PS0A 1QLHA 1ZK1A 3K96A 4LSMA 3S2EA 4DIBA 3NX4A 1DIGA 2YFQA 2WYUA 4MVJG 4DC0A 3FNHA 4URFA 3WIDA 5C7OO 2VTDA 5DCYA 4ZJUA 1YWGO 2X22A 4J7CA 1Q1NA 1EZ4A 3QJ5A 4PG5A 1DDOA 3TWOA 3ZWWA 2PTGA 1MG5A 5F5LA 3WWZA 3NKLA 4BNVA 5TLSA 1VE9A 3FPLA 5DBFA 4RJTA 2QZ9A 4J1TA 2HMWA 1NFRA 2LDXA 2WWRA 4D45A 5L7WA 2R00C 4Q9NA 4CLOA 2YY7A 3LYLA 1OC4A 1NAHA 1ADGA 1E1MA 4RLHA 4UVGA 1SMKA 2W2LA 3ROPA 4O1MA 4YAKA 5CDGA 5BSGA 2P4HX 1T25A 3PZBA 3S1LA 1CDOA 4MDHA 2DUWA 4IXTA 5ITWA 1C14A 5TX7A 1GV1A 4NU6A 1XR3A 2ZCVA 1WWKA 4P22A 1ENYA 3ZCXA 4RLSA 1X14A 1ADFA 2PNFA 5COQA 3BMCA 4FR5A 3ZNQA 1IOLA 1GYPA 4IPTA 2C2XA 3DBRB 5HBRA 1XKQA 4OYRA 2OGUA 1GTMA 2ET6A 3HUDA 3DZFA 1OI7A 1GUFA 2PKQP 3EY4A 4R68A 2IXAA 2HAEA 2J5KA 2PA3A 2FSVA 3I23A 3QWIA 2P9CA 1VL8A 4QFCA 5ITVA 4YDRA 4NDNE 1EUZA 1EFKA 4DPLA 3V1TC 3FRJA 5IG2A 4EYEA 4J1SA 1KEVA 3GVPA 3GNTA 2GR9A 5IDXA 2EXXA 3LT1A 3M6IA 4RQTA 1B26A 2VRBA 2EJVA 3S2IA 3F46A 4BNZA 4R1SA 3NTOA 2J3IA 4M49A 1FDTA 2OO5A 3L77A 5EESA 1GR0A 2BFAA 1E0DA 4MPDA 1MUUA 2GZ3A 4W99A 3RVDA 4F45A 1LSSA 4LW8A 2J3JA 4EEXA 2ZYGA 1VJ1A 1ZEMA 3WFIA 2ZB3A 4ALKA 4NBUA 3O03A 3RU7A 3LK7A 3RKRA 4IQ8A 1PR3A 1DPGA 1BDMA 3DB2A 2Y1DA 2JD1A 3LQFA 3PQDA 3LU1A 4UEJA 5TNXA 3W4IA 4LSWA 2WEKA 2BKAA 2O4CA 2ZKLA 2ZTMA 2HJSA 2W2KA 5G0WA 3ZWYA 3C3XA 3ZV4A 3WQSB 4ONEA 1SEVA 2D1YA 1BSVA 3ICCA 2WDZA 4NMHA 3PYMA 2V6MA 1H6DA 1ZIDA 3IP3A 2YW9A 2OORA 3DQPA 1CQJA 4FD3A 3UUWA 4CM1A 3DHYA 4B3HA 4OM8A 2J3HA 3FD8A 4OXYA 2O3UA 4WOJA 1AE1A 1ZZEA 3GRKA 3K2EA 4XD2A 1NQAO 1PJCA 2EIHA 1DLJA 3LZ6A 3L6OO 3MZ0A 4O0LA 4YJHA 3OSUA 3VC7A 1IHXA 3RCBA 4E30A 9LDBA 5U9CA 4GQAA 2PK3A 3K2BA 4O63O 4J0FA 4MVJE 3CZRA 4ND5A 1Y9EA 3CSDA 3DZJA 3HADA 3X2EA 3OM9A 2PZJA 2VOJA 1ZK4A 2YQ5A 3Q2IA 4CLOB 4OQYA 2GLXA 1U3TA 3BHIA 3BXXA 3QLJA 3QVXA 4N18A 4JBGA 3RBZA 5TJHA 3UCFA 4YPOA 5THQA 4E5KA 3GQVA 2UV8A 3I9NA 1EBFA 5B4UA 3KYDA 4Z9XA 1I36A 1HF3A 4CV2A 3PXXA 1LXCA 1UUFA 1E7SA 5HA5A 4IDGA 1PJLA 3E03A 5L4SA 3BMCB 4D3DA 1UAYA 3RC7A 2GGSA 2QRLA 2GERA 2P9EA 4CM6A 3OJ0A 3H3JA 4QTZA 4RO0A 2YZ7A 3IJPA 4HV4A 5TT0A 2VYND 5I9NA 3GZNA 3DEYX 1XGKA 2NACA 3ITDA 4ND1A 3P2OA 4R3WA 2D2IA 1UZMA 3JQBC 3Q6IA 1GQYA 3MJVA 1OC2A 3D64A 3F1LA 3M2PA 2JAHA 4GBJA 3PWZA 2ZB7A 3GNSA 3WYEA 3DAGA 5DOVA 2HQ1A 1ZMOA 4D7AA 1QSGA 2NVBA 2QRJA 5COBA 4RPHA 2UVDA 4W7IA 2XXJA 3ABIA 3D3WA 1TT5A 1EFLA 5HS4A 2P5YA 4IIUA 1EVYA 2EP7A 1I33A 1CEQA 1Q0LA 1BXKA 4KWIA 4Y8VA 4UUOA 5C37A 3WNQA 2QYTA 2HMUA 3PJDA 2IYOA 3HB5X 5DP1A 3W6ZA 1UZLA 3MJ4A 2Q1SA 2X0IA 1NPTO 1ZCJA 2UDPA 3OQ1A 4OKIA 2Y0EA 4PLGA 3DHEA 3KSZO 2VWQA 3RC2A 5CDTA 2VN8A 4P38A 2PR2A 4S1VA 4DBVO 5KNLA 1LQTA 1YGYA 2W2KB 3JQAA 3U09A 1RYDA 3ZW8A 2Q4BA 4HXYA 1E1NA 4M8SA 3CE6A 4WUVA 1DC5A 1CRWG 1C1XA 3W4KA 4XQEA 4N54A 4YQYA 2VHVA 1KVQA 3ZW9A 2PWZA 1MXHA 3CEAA 1NPYA 4MVJI 4N5NA 1VL6A 3LC2O 2QIOA 2BGKA 2Z1MA 4WE3A 4YJHB 4WLEA 4Q3CA 5A4DA 6ADHA 2OP1A 1HYEA 4FFOA 2JJYA 3INGA 3QVOA 4KUEA 5L3ZA 1QLJA 1PZGA 2DKNA 2HK9A 4R4JA 2I67A 4J49A 3W4JA 2GN8A 2I3GA 4PZDA 4BKRA 1E3EA 1I2CA 3FI9A 4PVDA 5HWSA 2DBQA 3TZ6A 5GZ1A 4E12A 2ZCUA 5CG2A 2VWPA 1O8CA 4M55A 4YEDA 2Q3EA 4PLVA 2J6IA 1Q0HA 5DCUA 2W4QA 5IDWA 4LVUA 1U28A 2PY6A 1HXHA 1YOVA 2O7QA 3GZNB 4JN6B 3E1KA 1YB4A 2FMUA 2DFDA 2PH5A 1E6UA 3VOSA 1E1LA 4WJZA 2Y93A 1IPFA 2H63A 2NNLD 1G0OA 3RUDA 1HZZA 1KEWA 2H9IA 3ZV3A 4FGSA 1MA0A 2XF8A 3TPCA 1DHTA 3GLQA 2OBNA 3D3WB 2RHCA 3IUSA 3TDKA 1E7MA 1H6CA 1HDGO 1KEPA 3A06A 4AJNA 7MDHA 1SBYA 3TRIA 1GPDG 1NX6A 4XCVA 3IP1A 4IMRA 3QA9A 1U4OA 1DXYA 4FOSA 4UREA 4EBFA 1TI7A 2AE1A 5JCJD 4GMFA 2O7SA 2W2LD 4PLFA 1DFGA 3RC9A 3GGGA 4BMSA 1V3UA 4NJOA 1UXHA 4WLVA 3WICA 3EGOA 4FOOA 1A71A 1E7QA 2FPGA 1LLCA 4DYVA 1DAOA 4WCFB 3E6AA 2Y1OA 3K8ZA 3JQAB 1CJCA 2AEFA 4BGEA 3MJTA 3KEQA 2NVUA 4CLEA 9LDTA 2XAAA 4XB1A 1DIAA 1PU2A 3FHLA 4JJIA 1S7CA 1HDOA 3C7AA 3L4SO 4ZQFA 1W6UA 2B37A 1C1XB 3QQPA 4I5DA 5BSFA 3R3SA 1J5PA 1C0PA 2VZ8A 3PIIA 4PLHA 3H65A 5T8KA 1O94A 5F1PA 5CDYA 4OH1A 2RIRA 1PJ4A 1Q7CA 1XIVA 4RDIA 2QZZA 4EEZA 2ZB4A 1DFIA 5L95A 1ARZA 4D0RA 4AG3A 3SC6A 1O0SA 3ASUA 4CM4A 5ADHA 3WGZA 1NQ5A 5I8WA 4WLOA 4Y9DA 3AM3A 2AXQA 2WE7A 4II3A 5FFFA 5KIAA 3O4RA 4CV0A 4J6FA 3GH3A 3GGOA 4J90A 1IL0A 4CM7A 2X1HA 2Y05A 3KHUA 1D1SA 4J9VA 4AVYA 1E6WA 3S55A 1LQUA 2YYYA 5TF4A 1O95A 2D5CA 1QRRA 1F0YA 4RVUA 1LRLA 1V3TA 1HEUA 1YQXA 4XYBA 4BKUA 4YJFB 4IZHA 4ND4A 1SB8A 4Y98A 2I66A 1OMOA 3EZYA 5MGBA 5BNFA 1SOVA 2CDBA 3LLSA 1P9LA 4CQMA 5L40A 1VSVA 1YOVB 5BT9A 3GNQA 4R41A 3VVCA 2JCXA 1XG5A 2TMDA 4Y6PA 3RC1A 3D1LA 4BNGA 5I7VA 3GK3A 2JFFA 4J1NA 2JL1A 4HWKA 3E9NA 3UGKA 3DTYA 4E0BA 3VH3A 3W8FA 4BO6A 5TJ9A 2DTEA 2Q50A 2YV3A 1X13A 5KCZA 3PQFA 4GSLA 2HSDA 4E32A 4GMGA 1V3VA 1FDUA 1YL5A 1EK6A 3T7EA 4BOYA 2BHLA 4KTTE 5KVCA 1B7GO 3PFWO 1ONNA 4DGSA 2WJPA 3KETA 1GYRA 4GH5A 1O89A 3EVNA 4RF5A 4JLWA 1IZ0A 2X9VA 2DPHA 2G0TA 5ICSA 1MLDA 3WGQA 3KYCB 3DAPA 1LA2A 3M2TA 1C0LA 4BUCA 5K6AA 1HWYA 2QYSA 5GZ6A 2X58A 4MVJP 5L53A 1E6EA 2NTJA 1C3VA 1KVRA 1M76A 1JW9B 1E7RA 5AXBA 1I24A 2I9PA 3GHYA 4E5MA 2X23A 1SAYA 3V1YA 3WX0A 4BNFA 2VT2A 4ALJA 4CMCA 3KUXA 1B8PA 3RASA 3WGYA 4AJIA 5DULA 2NVUB 4DMMA 5U1PA 3GVXA 2AMFA 3ZWVA 5TC4A 2CUKA 1BXGA 1GL3A 4M89A 5KVVA 3VZRA 4QO8A 4B7UA 4PVCA 1DO8A 1U9JA 3ZH2A 3ZWXA 2GNAA 3FR8A 1NVGA 4JJGA 3OMLA 1KY5A 1N1EA 4ALLA 1RKXA 1YKFA 7ADHA 2Y1CA 4BNWA 4EI2A 1BTOA 4F3YA 1U1IA 1T2AA 1PX0A 4DQUA 1HDCA 2P68A 1RJWA 3OHSX 5JAMA 4TZKA 3RAJA 1M66A 4CM4B 3JD1A 3JQGA 1JDJA 3GMSA 2OZPA 4EW6A 5CEFA 2EGGA 2VZ9A 4NJMA 2IYPA 4CMKA 1QP8A 4NPCA 3H9QA 3KV3O 4HUJA 4FPXA 4BO7A 4OMUA 2PFGA 3ZHZA 3V2UA 3ZNPA 4RVSA 3I9MA 4M87A 2GO1A 3MEQA 4EDFA 1HE4A 1U2GA 1YQGA 1R0SA 4MVJF 4BNJA 1M67A 4XA8A 2GF2A 3VZQA 3NEPX 4J9UE 3ULKA 1P1FA 3L07A 4K9DA 4U0KA 3TZKA 3QVSA 2EGHA 4E2ZA 4CQMB 4J3FA 5J23A 3WYCA 1LUAA 3KO8A 4Z0HO 1IB6A 1X1TA 1I30A 4TSKA 2IE0A 3N58A 3F5QA 2JAPA 2CZCA 3ZNOA 3JQAD 3DDNA 3GFGA 4XRRA 4J4BA 2I3AA 4FCCA 2FR8A 3WLFA 3K6JA 3WG9A 3L6DA 1VKNA 3DBLB 1HT0A 3G1TA 1QYXA 2YHUA 4A73A 1HDXA 4FW8A 5ENVA 1VRWA 4E2WA 1JVBA 4DPKA 3B1FA 3E5MA 3ONDA 3VDRA 2RH8A 3C1OA 2X9GA 3B1JA 4BB6A 1OAAA 3NGLA 1ZSVA 2GN6A 4BGVA 4YT8A 4MKZA 4E33A 5GZ3A 3TOZA 2C0CA 1YRLA 5LDGA 3CMCO 4EITA 2B83A 3BMQA 5CHEA 1JAYA 5FI3A 4NBWA 3IKVA 1I5RA 1ULUA 5CDUA 4BNIA 3BTUA 1HZJA 1P0FA 2B4QA 4LMRA 1T4DA 1U3UA 1ISHA 1N7HA 4TVBA 1W8DA 5JY6A 1WDKA 3K92A 2C59A 5ILOA 1N92A 1P44A 1I3KA 3BA1A 5JAQA 3WSWA 1GV0A 3WJAA 4EUFA 4YBZA 5I9LA 5MDHA 5B12A 3JTMA 1GY8A 2VUTA 4MVJM 1BXGB 1CQIA 3DMTA 1CETA 1H94A 3KM0A 3TL3A 4YRAA 1SO8A 1G6KA 3PZRA 4M86A 5T6BA 2X5JO 1LDBA 3GF4A 4XR9A 5FI5A 4E4YA 5A04A 3JV7A 3PK0A 1T26A 4IIVA 4LN1A 4DA9A 1T2DA 1P31A 1PL7A 1UDBA 2ZQZA 4RZHA 4Y67A 4GL4A 4RVFA 3WMWA 4A7PA 3ZWOA 2DU8A 1YJQA 3ST7A 3E5RA 3TF5A 3VH2A 1GQQA 1GZ6A 2AQ8A 1ZJYA 2VNSA 4NJMB 1FK8A 4B3JA 5F5NA 3OQ6A 4EJMA 3PWKA 4BS9A 1ZBQA 5DCWA 2DPGA 1LJ8A 1YBAA 2PD3A 5A05A 4FQ8A 5G0SA 5G2OA 1A7AA 3WS7A 1IE3A 3HZZA 2G5CA 1PJQA 1ZXBA 1KIFA 4O59O 5L45A 4FDAA 1LDEA 4XRGA 5IXYA 3FWNA 5LCXA 3DOJA 1EQ2A 4O5OA 3U0BA 3UHAA 1ISIA 4XDZA 4FN4A 4PLCA 2VYVA 4I9UA 3NDIA 1A4UA 3JD4A 5KKCA 1L7DA 4M1QA 4RF4A 2Q99A 3JQ8A 4OJNA 4ALNA 5AYVA 4YXFA 4WOKA 4FFRA 1AHHA 1XLTA 3I9OA 4RPKA 1JWAB 2UAGA 3RBXA 1WMAA 3C24A 5KOIA 3PLRA 3DHNA 4Y6RA 1GPJA 3UXYA 3IDSA 4IBOA 1J0XO 2A35A 1LSJA 1YVEI 3AWDA 5BQFA 2R2GA 2WMDA 3GY0A 2LDBA 1Y8RA 4A26A 4OKNA 3BMQB 4KDEA 3RJ9A 2Z95A 4K28A 5BSEA 4BL5A 1I2ZA 1NYTA 1O5IA 3ZWMA 4R16A 4YB8A 1X0XA 4IDEA 3OIGA 3H9EO 3ONFA 2UYYA 1PJ2A 3AI3A 1H6BA 3D3EA 1EVJA 1OZAA 1QYWA 4J7UA 2YJZA 1O9BA 3IUPA 3DBHB 3BYZA 3WLEA 1DBVO 3ZGYA 3PJFA 4BKPA 1AUPA 1K0UA 4CMJA 3DZKA 4IXWA 4CQMD 3ROKA 4MVJA 5K0ZA 4G2NA 3S8MA 1GYQA 2ZTVA 3TJRA 5CFZA 5L7TA 1GUZA 2AG8A 5C7IO 4WCFC 1XHLA 3UW3A 3ZN2A 5IF3A 4CQLA 3ADPA 4ND3A 5KJCA 1TLTA 3JYOA 2EG9A 2AQIA 2X0NA 4CLRB 1QV7A 4DPMA 3ANLA 5BNIA 3BIOA 3JQ9A 3DOCA 3VKUA 5JDIA 4KOAA 4DIOA 3OECA 5KJFA 4L0QA 3UF0A 4IQGA 3AOEA 4NQZA 3WGTA 3I4FA 4CV1A 4PCVA 4I08A 4WECA 1Q7GA 3U5TA 2QRKA 3NTRA 3VH1A 1KEUA 1JKJA 1OFGA 1XYGA 1DOHA 2IEDA 5AOVA 2RAFA 4CUZA 3LT2A 3H4VA 4ITUA 4MINA 3WQRA 1LTHR 1X7DA 2NUAA 1P1KA 3GEDA 3DAFA 5I9MA 2EKLA 4XWYA 4B4VA 1ISGA 1J6UA 4KUGA 4JJFA 3HN7A 1V8BA 3GVIA 4TQGA 3NAQA 4CL3A 1XEAA 1H9AA 4L8VA 1ENOA 3GG9A 1FJHA 2DAPA 3JQ8B 1IHYA 3LLVA 3SLGA 4BNYA 1PTJA 1LU9A 4QSMA 4FJ2A 1P0CA 1IULA 1EDOA 1WZIA 3DXFA 3K31A 4YAIA 4FGWA 2WSBA 4RF2A 2HMVA 4CMEC 4QFDA 2NSDA 2Q1WA 1CF2O 1TT7A 3DZHA 4ZVVA 2J3KA 5F1KA 1YDWA 2EW2A 5F3RA 3RI3A 4OL9A 4CJXA 1U3VA 3MTJA 4QXMA 4TKLA 1IUKA 4LK3A 1E77A 5JSFA 1D1TA 3I3OA 3UCEA 1LDGA 1EBUA 4JNKA 4R1TA 3KSDO 3WWYA 1Y8RB 1NAIA 1Y9AA 3KLMX 1DAPA 1GAEO 3H8VA 4OIMA 2C82A 4FJ1A 3FTNA 4YJDA 2IXBA 1HE3A 1MB4A 4LRTB 2HRZA 4FFNA 4AJPA 4DXHA 3V1UA 2PGDA 3TN7A 2AEJA 1EEHA 3A4VA 4MIEA 1CWUA 4BV8A 2OMEA 1GZ4A 3K30A 4ZN6A 4YCAA 2IDZA 4R01A 1J49A 4PZCA 4Q3AA 2DBZA 1M2WA 3TQHA 4BO9A 1W73A 1GFSA 5DDIP 1EE9A 1HSZA 3ETDA 4OHUA 3V2GA 3TSCA 4R54A 5T57A 2Q45A 4UVDA 3PFFA 1S6YA 3HB4X 3C8MA 1ZSNA 1U8FO 2DTDA 5EQDA 4L75A 3PTZA 1PJTA 4CQLB 3ORFA 2IEBA 4MP8A 3FNGA 3LSYA 2QQ5A 5DBGA 4IQ0A 5A06A 3NT5A 4HNGA 6LDHA 4BQRA 1QYDA 2ZJ0A 4Z9FA 4JBIA 5F1OA 5T8KC 4NZ9A 4UUMA 3ZWNA 3ITKA 1YONA 3H3FA 3R6DA 3GEMA 2VRCA 2Q1UA 3JQEA 3ZWBA 1PSDA 2NU6A 4WGGA 3ZHYA 2OFPA 1T1RA 3H2ZA 1DB3A 5IN5A 1D3AA 3K73O 2VUSA 3OJLA 4HBGA 3U9LA 5I7EA 3Q11A 4E21A 5A5FA 3KLPX 3OP4A 3RKUA 2CVZA 2JCVA 3SJ7A 4P8RA 4P4LA 3JQFA 3FNFA 3OJEA 4OSOA 2R6JA 1ZSYA 4OSPA 1V35A 1NWHA 4LISA 4E5NA 5KKAA 1LEHA 1PZHA 1BMDA 1HYGA 1V6AA 5B37A 4IJVA 4WCFA 3FCOA 1KS9A 1ZEJA 4C7KA 5IZ4A 3WDSA 4IY1A 3QIVA 5U4QA 3VZPA 1Y5MA 1Y7TA 2X0RA 4FFPA 4RPLA 3BTVA 3HWRA 1MC5A 3FF4A 4NH4A 4TROA 3RFVA 3ZU2A 1B0AA 2VHYA 3I9KA 4NU5A 3IQDB 5JE8A 3SBOA 5B4TA 4QEDA 3GDGA 1NR7A 2OBYA 5L4LA 3V2HA 4PLTA 3UFXA 1NQTA 1FDWA 4BO1A 2PGLA 5BSHA 1ZKMA 2O3RA 1EK5A 1VLLA 3GAFA 4UVIA 1HKUA 4WKGA 2NTNA 2NU8A 4OOEA 1I0ZA 4D43A 3FNEA 3PHIA 3GFBA 3U4HA 2Q2WA 1UDCA 4IINA 3W8DA 1UP7A 2NQTA 5JYDA 3WGGA 4Z6KA 4TRMA 1R12A 2WE8A 5GMOA 2ZQYA 2X4GA 4IS3A 2W8ZA 4RPJA 1LC0A 3OA2A 2Z1NA 4IDFA 1EQUA 3DMYA 4ILKA 4MKXA 4OOFA 4WLNA 4XYMA 4YJFA 5EMHA 3RSHA 4NK5A 2J5RA 3NYWA 4II2A 3EYWA 1Y1PA 3AFNA 5JAIA 4RVDA 2Y67A 1ZVMA 4QQRA 4RF3A 4INAA 1KYQA 2A9FA 5K6AC 2G17A 3ZHBA 1B3RA 1X7HA 1NASA 1HSOA 3JYPA 2I6TA 5CPBA 4DQXA 4X54A 4CMEA 3PRJA 4IGEA 3DC2A 4W6ZA 3WOHA 3B20A 3H9UA 2C5AA 3KXDA 1XSEA 2GZ2A 1LDNA 3Q0EA 4IMPA 4XJSA 4BO5A 1YBMA 4IJWA 1E1KA 4R3NA 1YE3A 2IZZA 1L1FA 2P2SA 1WPQA 2FN7A 3JQ6A 5IDYA 1B14A 1H93A 3AY3A 5JXWA 3BTSA 1SB9A 2Q4EA 1ADBA 2AQHA 1MXFA 4GKBA 3C7CB 3P7MA 3R0IA 3IOYA 4JK3A 5G0VA 3RBVA 5FWNA 2DC1A 3AY7A 4L4XA 4QUKA 2PZKA 1NVTA 2DM6A 1U7HA 1U5AA 1U3WA 1HL3A 3PJEA 4FSHA 1VKOA 4DBZA 3PPIA 5B4VA 2D59A 1I2BA 2GN9A 5EJ2A 5ES3A 4E2XA 1P1HA 4NNJA 1J4AA 3KYCA 4B4UA 4E6PA 1N2SA 2PH3A 3VZSA 2YFHA 3A1NA 5DNAA 1KC1A 2V6BA 2O4UX 4IJKA 4J2HA 3JYLA 1A9YA 4R9RA 1PS8A 4UAGA 2I65A 4DMLA 5EN4A 1P3DA 3AK4A 1GD1O 4YWJA 2FSSA 1P1RA 2A94A 1DRWA 4FS3A 3DZGA 2RH4A 3QWAA 1JVSA 2CD9A 4GWKA 3PLNA 3OETA 1FXSA 1M75A 1D8AA 2RHRA 1FDVA 5LDHA 3L9XA 1K5HA 4W82A 2P9GA 4OAQA 4BKOA 4FC7A 1A72A 4MVJD 1VSUA 4GSKA 4CMIA 3MCVA 3L0DA 2NVWA 1JU9A 4NBRA 2D4AA 1JLLA 4YYZA 1ZK0A 1VC2A 3VAZA 4BO4A 1T2EA 4LCJA 4A27A 1KC3A 2VHXA 2H6EA 3KYBA 4GX5A 3ZU5A 1PZEA 4XJTA 1PWXA 1N1GA 1Z6ZA 1UJMA 5TT1A 3VTFA 3VH4A 2D3TA 4OGWA 5ICMA 3G17A 3WTCA 1F8FA 1WNTA 4BO8A 1E3IA 2G82A 4L76A 4YT4A 3VPFA 2BLLA 4XX0A 1N8KA 1R6DA 4XZ3A 1YB1A 1I32A 3IAHA 2EWMA 1MGOA 2B35A 4Z0TA 1MC4A 2AW5A 3AI2A 1T24A 2Y1FA 4A03A 1WVGA 2Y1GA 2GDZA 3MOIA 2OHXA 4QX6A 3RU9A 1NTOA 4F6CA 3U62A 3GUCA 1YJ8A 2ZJ1A 4E13A 2O50A 2PLAA 4B8ZA 2BFOA 3N7UA 3QHAA 4BO3A 4MKRA 3GPIA 5JC1A 1BGVA 2XXBA 1XA0A 4R5HA 1I3LA 1LDYA 3CH6A 2YV2A 4AJKA 4C4OA 5KJ1A 2YDYA 3DBLA 3DMTC 1P33A 1AXGA 3U3XA 3ZWCA 3I4CA 3PI7A 3Q1LA 2OXIA 4BV9A 1HETA 1EVIA 5I7SA 1DIRA 4OXNA 4CLHA 5ILGA 4CLDA 2WTBA 3I6QA 1K6JA 2X8LA 1Y6JA 5A3VA 3OICA 1EUCA 4WCDA 2JCYA 1MG0A 3KSUA 4NG5A 4R9SA 5EL0A 3O8QA 2FOIA 1PZFA 4N5LA 3IJRA 5JYEA 1PGPA 1SNYA 3GRPA 4E5YA 3IL2A 4BNHA 1XWFA 1G1AA 2P4QA 3EMKA 3HDQA 2X5KO 3AI1A 2PD6A 4JROA 4EJ0A 1WZEA 3N74A 1YL6A 1JQBA 2VQ3A 3GN1A 1ZK3A 3INTA 5JMWA 2HUNA 4GAEA 3QRWA 1YQDA 3EK2A 4PLPA 1T2CA 2AHRA 4E3ZA 4UEKA 4Z3DA 1ENPA 4CLXA 2JD0A 3ENKA 1I10A 2JKVA 4TZTA 5HS6A 3HHPA 4AL4A 3H7AA 1HTBA 4XEHA 3WGOA 4LMPA 3EHEA 4GKVA 4CMHA 3H5RA 1HLPA 4CMIB 1R15A 5BR7A 4XYGA 2GASA 1ZXLA 3DFZA 4HFMA 3ZDFA 3F9IA 4RGBA 1KBZA 4PLYA 1B16A 3VVBA 2I99A 3UH1A 1MP0A 4DTIA 4AFNA 1HRDA 2HDHA 2YQ4A 2NM0A 3DOOA 4WLUA 1EE2A 3E8XA 4D3FA 2PD4A 3M1AA 3AFMA 2QX7A 3JYQA 2QW8A 3L4BC 2JHGA 4IDDA 2A92A 1ONPA 2CMDA 1LC3A 4RVGA 4YT2A 5IJZA 1BW9B 3COSA 5CG1A 2Q1TA 4MJLA 2FZEA 2JD2A 4OO3A 3TL2A 3VTZA 3NJ8A 2D5AA 3GVHA 5FEUA 2VT3A 1KVUA 1GADO 3KB6A 3GEGA 1GEGA 3CXRA 2O3JA 3AU9A 3PYLA 3D4OA 4YVFA 1WMBA 2DQ4A 4XYEA 1ZO8A 3F4LA 5G4KA 3VPGA 2HMSA 1DJQA 2YUTA 1H0KA 3C1AA 1D7OA 5A3JA 1UXJA 3S2FA 4GGPA 5T67A 4H7PA 3JSAA 3RQSA 5K9ZA 3MJCA 3TNLA 4E31A 4R51A 1T1SA 5JAZA 3WGIA 5CP8A 4FFLA 3DTTA 3KZVA 2BGLA 2HK8A 3U4DA 1QV6A 2NADA 5K1SA 3L9WA 2Y99A 4BNLA 1SPXA 2VCYA 4DREA 4NFHA 4PG8A 2VTEA 4QECA 4E2YA 4RDHA 2BFMA 3HG7A 4W9NA 4BO2A 1HLDA 4JP3A 3EW7A 1I01A 3O8QB 3Q3CA 4A2CA 1R66A 3JQ9C 3PDUA 4J0EA 2YDXA 2DBRA 4B3IA 4F6LA 5JDIC 3G49A 3PGJA 4Q39A 2ZYDA 3T7CA 4RPGA 3AOEC 3WFJA 4O6VA 2FPIA 1PEDA 2I5PO 5T64A 3X2FA 3I9LA 2DVMA 3DBHA 4FFMA 3I1JA 1U5CA 3A28A 4GI2A 1OBFO 2GPTA 4D46A 5F21A 5HTOA 3OJOA 3WR5A 3GOHA 1ISFA 3JQ7A 4BGUA 4BHTA 4YAEA 3AM5A 2ZATA 2YV1A 3PEFA 1MFZA 4PIVA 3A14A 1T4BA 4BNNA 1JN0A 2HU2A 4HFJA 4CR6A 3GVCA 1UH5A 1XU9A 3LT4A 1U4SA 5GY7A 3ZV5A 4CLRA 1X0VA 4MVJH 1X15A 1A7KA 4WNCA 4CM3A 4YR9A 1YO6A 5JDCC 3T4XA 4GLOA 1PQWA 4WNIA 4NFSA 2J5QA 2ILTA 1PL6A 3U4CA 3RUHA 1Z75A 3F4BA 4WPGA 1R0LA 2O23A 4NK4A 1ORRA 2DBVO 3AM4A 3GUYA 1DHRA 4PRLA 3ZI0A 1HYHA 4KP7A 3WTBA 1Y81A 1G0NA 1TB4A 4DVJA 1RM5A 5BNTA 4PRKA 4CMAA 1NBOA 1P74A 1R4NA 2NU7A 2XOXA 4ZA2A 5CEEA 1YH3A 3CPSA 3TZCA 1WDLA 4CR8A 4I9HA 1KOLA 4ZICA 1E3WB 3ETGA 2TMGA 1R16A 4XB2A 2CFCA 3P19A 1UP6A 3QWBA 1BVUA 4PG4A 5G4KB 3RFTA 3EC7A 2Y1EA 4BNXA 1RPNA 3JD2A 4UVHA 4YA6A 4GWGA 3I83A 1GU7A 1N7GA 4UUPA 4J7XA 4WK6A 3PDJA 5H83A 4P4NA 2GSDA 4EUEA 3H5AA 1KERA 2BD0A 1LNQA 4J16A 4DLAA 1RM4A 3G79A 5ER9A 2NWQA 1DIBA 1N9GA 1NNUA 3Q9UA 4J4HA 3L4BA 2OOSA 4U6SA 4J4TA 4D79A 3F6YA 1U2DA 3GAZA 5EERA 3KEOA 4J1QA 1ZMTA 8LDHA 2E6UX 4NI5A 4CMBA 3HQ4O 4U7WA 1QORA 1B8UA 5EINA 1YBVA 5C7LO 2C2YA 1NPDA 4I8XA 1ZJZA 1FMCA 1WLYA 4YQZA 4Q3EA 5A9TA 3GHHA 5HRUA 4BNMA 4PZEA 3STHA 1R4MA 1ZW1A 1PJ3A 1XQ6A 3QY9A 1K3TA 5DOZA 4FC6A 2E49A 3G3EA 1H5QA 5JCJA 2H5LA 3LF1A 2O3QA 1F06A 3UOGA 3BMNA 2DFVA 3JQFC 4GX0A 1Q2XA 3JQ7B 3K9QO 1QR6A 3P5SA 4Q3NA 3PP8A 3RUCA 5H81A 1XQ1A 2CF5A 3FBGA 3MJSA 4U5QA 2PZMA 1D4FA 4KQXA 4CM8A 3BMOA 4HX5A 3ADOA 3G0OA 3AUUA 3JYNA 1VJTA 4HNHA 1P1IA 5ER6A 2XPCA 3I52A 1ZK2A 4CV3A 2B4TO 4J2OA 1E3JA 3ZWAA 2YHIA 3OH8A 1KY4A 4G81A 4S3MA 3UCXA 3DFUA 1ZH8A 1KETA 4DIFA 2AG5A 4N5MA 1K89A 2HRBA 3ZHXA 1ISMA 3MTGA 2B0JA 3INRA 5AQ1A 4ZQBA 4GVLA 3PVZA 4MP3A 3O26A 1BG6A 3AOGA 4J91A 1R4NB 2E37A 2FY8A 3DWFA 5KVSA 1PR9A 2FRDA 3PJGA 4QO7A 4DRYA 4FB5A 1C0KA 2CVOA 4WASA 1DSSG 5EPOA 1YL7A 4HKTA 3VKVA 2X86A 5JCXA 2P91A 1LX6A 1BXZA 4BQPA 2AQKA 1PGNA 2BI7A 3QV1A 4DLLA 2BELA 2UUOA 5A02A 4R69A 4DC1A 3EUWA 4Z9YA 2PV7A 4KTVE 4RORA 3GC6A 3D4PA 4IUYA 1UXKA 4JGBA 5JDCA 1IYZA 3HE3A 5JBIA 2FP4A 4R1NA 1PJSA 1N9GB 2BFPA 3ENNA 2HJRA 3HN2A 3AJRA 2VHWA 3VPSA 1MX3A 4Y6SA 4EJ6A 3C7DB 4P4GA 4EGFA 1KVTA 3CZMA 1E92A 3WNVA 2OL4A 2H1SA 3QWFA 1LRKA 2V6FA 2JFHA 2VNAA 4U0JA 3LT0A 3C85A 3JQCA 5JW6A 3UKOA 4D42A 2E4AA 5CPFA 3DZBA 3B1KA 3BAZA 2BH9A 2DTXA 1RWBA 2UUPA 1A9ZA 3GR6A 1SEPA 4RV9A 1R4MB 4NBVA 3LC7O 4UVEA 2CY0A 2BF7A 1W0CA 3FSRA 1WP4A 3JQDA 3RUEA 4IM7A 3BMNB 4IZIA 1IPEA 2GZ1A 1V9LA 4PLWA 4AJ4A 2HCTA 1YDEA 1P77A 3GPDG 1ML3A 1Z45A 4MP6A 3CUKA 4RCVA 3ON5A 4UEOA 1LBEA 4DL9A 3AUTA 2F1KA 1P45A 4QT0A 1L7EA 4CM8B 3BMOB 3WMXA 5TIIA 2EEZA 5DP2A 1GDHA 3SEFA 4WLFA 4PFJA 3TFQA 3GZ4A 4W4TA 2QHXA 1FF9A 5JLAA 1QMGA 4PN3A 4TMFA 3D0OA 1NQOA 2YHIB 3OIDA 3QSGA 2HLPA 1YXMA 4CUKA 3AW9A 3E82A 3UVEA 2GYYA 5A5EA 3TOXA 3F5SA 1UAGA 1WW8A 2F00A 5ENDA 3T4EA 2A4KA 2R00A 5KVQA 4YT5A 1K6IA 5JFOA 1ONOA 4AJJA 2BGMA 1Y8QA 1Q7BA 5DT9A 3EZLA 4Q3DA 4FBGA 1C0IA 1NWCA 2Q2QA 3IS3A 3SLKA 5COAA 1U7TA 3AUSA 3GDOA 4ZRMA 1KVSA 4EUHA 3RUIA 5FYDA 4AICA 4AJEA 3FWZA 1DRVA 2VUUA 3JCZA 3RIHA 5IXSA 1DIHA 2B36A 2IZ0A 4JX8A 4Z0PA 4CM9A 1NXQA 4YACA 1WDMA 5IAAA 1QKIA 4YAJA 2RBEA 1NFFA 3FPCA 3B6ZA 3WQQA 1PL8A 2CVQA 3OBBA 2E82A 1HDZA 4ZRNA 2EJWA 4L4RA 1Z73A 1VJ0A 5JS6A 1ZUD1 1X7GA 2AEMA 3KTDA 5DN9A 4XQCA 2B5VA 2V6GA 3I5MA 5DZSA 1WAMA 3FN4A 2HMTA 1M6HA 1M6WA 3Q9NA 5TSDA 3KRTA 4HFRA 2IODA 3MWEB 3QWHA 3FR7A 3RUFA 2X0JA 5JMPA 1EUDA 3NRCA 2X6TA 3PHGA 4R1UA 4DUPA 1ZNQO 1DJNA 2FHSA 4LVCA 1N5DA 3PHLA 3TZHA 5G0TA 2EKQA 2W90A 4ZQHA 2EV9A 5AXAA 4ZD6A 3EDMA 3BZUA 4G5HA 4LRSB 5I8ZA 1NFQA 3NDRA 4IDBA 4L9RA 1A5ZA 1EMDA 4HADA 2J8ZA 3CMMA 3G1UA 1JA9A 4MOWA 4IS2A 1H9BA 4XGNA 3HJAA 4BB5A 2EKPA 3WYBA 4D3SA 1B15A 4NR0A 3GG2A 4TRJA 4XGIA 1FDSA 4I5FA 4RVHA 4YRDA 3UAGA 2AA3A 2VYVD 4IJUA 5G0UA 2CSUA 3KYDB 4BGIA 3GN2A 1H2HA 5AXCA 4RQUA 1LLDA 1LLUA 5KJ6A 5L51A 4GPD1 5L4NA 2Y0CA 2VHZA 4XQGA 3F1KA 4ESOA 4G65A 2RCYA 1BRMA 2FR0A 4B7XA 4RL6A 4B8WA 3GA0A 1NHWA 3SX2A 4FJ0A 4I5GA 4AJLA 1VI2A 2FPPA 3WBBA 3BHJA 5DF1A 1LDMA 2C07A 2I76A 1R0KA 3RFXA 3RUAA 1E3LA 1SCUA 2FZWA 1DFHA 3W8EA 1GCUA 4BVAA 5HM8A 1DRUA
chains in the Genus database with same CATH superfamily
1FSSA 1JDPA 1NJ8A 4UASA 1WR8A 4DR3B 3UYLA 4WN9B 4MIOA 4Q6WA 4TS9A 3SCZA 1XDSA 1Y8QB 2Q9BA 2C2HA 1U98A 3FKSA 3G13A 4LJ6A 2ZUDA 4M22A 4B1FA 2CFRA 4UHBA 3DKRA 2Y0PA 3BD9A 3F6PA 2PGOA 1V1RB 5H02A 4LF7B 1XELA 1TT5B 1PF7E 2R3SA 2QTCA 1FMJA 2ZJ3A 3HSKA 3NT4A 3CKMA 4KNVA 4RSGA 2YXBA 4B75A 2FMIA 1Z7EA 3MQFA 2CNLA 2VP6A 4KJZA 2D7CA 3ZZ1A 3DO5A 2Q5HA 4K6OA 4QT4A 4L4ZA 4WNYA 4WBNA 5LQMA 3IODA 2WQZA 5AXDA 2GLTA 3DPUA 2J0UB 1E5TA 2WVAA 2KB0A 4UUNA 3EXHC 2A0KA 1YF3A 1IN4A 3RROA 3ZPXA 2XZDA 5DW0A 1HV8A 1HGXA 4TWBA 5LQNA 2GYVA 1KNQA 5IKEA 4CT4B 4ZYWA 4AB1A 1QFYA 5CLHA 2GBGA 1SCJA 1B1CA 3BL6A 4ZVTA 3FCSB 4MLDA 3HGMA 3PNQA 3GLIE 2OUKA 1NVMB 2BI8A 1VKJA 3VUFA 4JIGA 1TOAA 5KWEA 4PCUA 4JT2A 1SR8A 3I9JA 1YB5A 5LU9A 5FHQA 5K99A 4FIZA 2EG5A 4CM5A 1NVAA 4I1IA 2ZB8A 4G2TA 4HYEA 4IKPA 1IN1A 1CY2A 1AG9A 2GVNA 2H92A 1VA5A 2NSHA 4HWRA 2HJHA 5HBGA 2JJMA 1BW9A 2YVKA 3UK1A 1J99A 2GK7A 2HY7A 3EW9A 1X9IA 3KBOA 1FUIA 2QRVB 3GGPA 1QBKC 1TEXA 1POWA 3MNFA 3WLHA 2GCOB 2ACWA 4I4TB 2QLFA 2RC6A 1PJBA 2ZTUA 3HNPA 1CPYA 1PS9A 2WK1A 1DKOA 3LUPA 3Q2KA 3PC7A 4MS3A 4PGMA 4PINA 3QOYA 1UDRA 3CPHA 3R7WA 1QIDA 1N5MA 4D97A 3AY6A 2QWXA 4R31A 1HMYA 2WINI 1G41A 3ZE2B 3ZQKA 5A03A 1K7YA 3GT0A 3EZFA 5FFNA 1MV8A 4JHXA 4UEWA 2O8BA 3IMGA 4BJ5A 4GQIA 3E9EA 4KXYA 1YZ3A 2B4AA 4YRQA 1A8IA 4LGCA 2AI2A 1DQYA 2P9ZA 3A1CA 1CYDA 4OXKA 4JI3B 2IHKA 1LF0A 2IF0A 4JOQA 4NIMA 3UPDA 5EXSA 1Z83A 4XWKA 1EE1A 3NATA 2W2OA 3QVWA 3ZBQA 3EZ7A 1QYCA 5FULA 3NHRA 2Z3WA 3CG4A 1F48A 4NQRA 2W98A 4BNTA 1E2LA 5DX1A 5LC1A 1Z6PA 3S3TA 3TQIA 2ZJ7A 1ZCFA 2ERYA 3L6CA 3KHTA 4KDFA 4PHCA 3C3WA 3PV0A 4PGFA 3SVZA 4WXYB 3F49S 1F8GA 2I2DA 2ZWOA 5EWMA 5JWOA 1Z74A 5JO0A 1RM3A 3NT2A 4EDHA 5KX5A 2CNNA 1ESEA 1KFEB 3DEHA 1FX0A 4BZWA 3OAAD 5LPNA 2GSWA 4ENTA 3AJ8A 2I7CA 1FUKA 4FSDA 4LRQA 2IZ1A 5HKOA 1GEEA 4OMFG 3LDHA 3QE0A 4EARA 1GQ2A 1SVWA 2WD8A 1MIOA 2NUBA 2PGJA 1MFPA 3BVPA 3KV1A 4J07A 5DI3A 9MHTA 3AEYA 4G8BA 3QI2A 5CIQA 2Z1DA 2XYGA 2O3TA 2CCGA 5F78A 4BO0A 2DCMA 4NDZA 4DZTA 4KACA 1H0HA 2JFBA 2P5TB 3HDYA 4QUIA 3RK1A 3SBEA 4IHJB 1GCOA 1HDYA 1RBZA 3AZQA 3K35A 1XKTA 1OD6A 2DRIA 2HFJA 2XMCA 2QL6A 2A33A 2C2OA 2E85A 3B6EA 3PQEA 3TECE 1H4SA 1JH9A 1PQUA 4G24A 3IR6A 3WMRA 2GT1A 3FPJA 2CDAA 3DDCA 3E5HA 4G4SP 2QTGA 1V26A 2YRFA 4H15A 4M54A 4KQWA 2VOEA 3GV0A 4AXBA 3VNSA 3U56A 2OOKA 4P84A 4ROSA 3I12A 2A88A 2Y9MB 3ASVA 2VWGA 3NB0A 4TLBA 2FKNA 2QL7A 4NENB 4MO2A 3WK7A 3RYHA 4L73A 4C1NA 2FB9A 1AGNA 4M9SA 4MHOA 3T3GA 4EG0A 3U31A 5JROA 4MDFA 4P53A 5B3JC 4ARIA 1VLMA 4HDOB 3PTAA 1T4MA 1ZM9A 4O4HB 2BFDA 3GLVA 1YZUA 1DUSA 1Q0UA 2O2YA 4LE0A 3TE7A 4CI0B 3HUEA 2FFBA 4DXAA 3HUUA 3SSMA 1T8RA 2VSXA 4V03A 1UWLA 1SBZA 3SC4A 4BNUA 5I7UA 5LOVF 1WBDA 2ZT5A 1Q0PA 3ANNA 3LW7A 4B7AA 4TT8A 5G1OA 3EPHA 1NVDA 4NLLA 1PFQA 4E6EA 1KEEA 5LA6B 2JIBA 2VRCD 2W58A 4IOMA 4KSBA 4UNPA 3U13A 1NRWA 1BDIA 1XDWA 4IDAA 4GD3Q 3H3XA 3IMFA 3QU4A 4XDYA 3ZV6A 4Q1EA 1N2CB 1O4VA 2J9FA 1UXGA 3FOFC 2HTEA 3KPJA 1D6JA 4G1VA 1R27A 2JGAA 3SWWA 5H3LA 3T3PB 3VI4B 1ZWLA 3HA2A 1E9DA 4L51A 5DYYA 3PHJA 1U4NA 4C7JA 5C7YA 5IASA 1V0JA 2BONA 4JYCA 3BA6A 3KB1A 4M0UA 1ZD4A 2FCAA 4HAOA 2W6ZA 2OKCA 3OT5A 1U8TA 1MABB 1K6XA 3AHJA 3C1TA 1X8XA 3KK0A 4KWHA 3ZYCA 4CM9D 4W5JA 1HX7A 4M21A 1LI5A 2JFNA 3OSZA 2A4MA 2QLNA 4LQCA 4YXWD 1C7ZA 4K86A 4RD2A 1T2FA 3OCYA 3UMBA 4NEHB 4B7CA 2EEPA 1ZGCA 2GN4A 5H1YA 2QT9A 1K7EB 3T3HA 5AFSA 3BQNB 3B3JA 2VZ0A 5H5JA 4YJ2F 5TRTA 4OL0A 1FFCA 4Q16A 5KTKA 1TQHA 3QXHA 1BHSA 1XHEA 2I8CA 2JLSA 4CXMA 2WJGA 3X3HA 1JAXA 4Q02A 1BC5A 4TTVA 2F1HA 3I01A 2RIPA 4DLYA 4ZI7B 3KHKA 2HW8A 1P9WA 2C5SA 4JXKA 1DO0A 4MV8A 1EXDA 3ANMA 4BV3A 4KFTA 3ONNA 1FMTA 3VYRB 2AYZA 1TFRA 4M6WB 5DXAA 4GUDA 2XJ4A 4M7OA 3S4YA 4DQVA 3RV3A 5TEWA 5JI2E 3FBTA 3EWAA 3HFSA 3V8BA 1VJGA 5THKA 5DX8A 1E2KA 3NJ4A 4LF9B 2I6SA 3ISVA 2ECKA 3K4PA 1QK5A 1TAGA 1Z5ZA 2I33A 3RJ5A 4AKGA 4TKMA 3T1YB 3AT1A 3F3SA 4RMGA 2W22A 4C0QC 4FU0A 3SDZA 5LNK1 1O87A 4K8RB 1DNPA 4FDVA 1B2LA 2DQSA 4KCGA 4QG7A 1P91A 1NKTA 1SC1A 1QZ3A 2B34A 2PPVA 3AV3A 3FDXA 3OT1B 3UQYS 1WOYA 4ZT5A 4CUJA 4R81A 2LIVA 5EJ9A 2EHDA 3FUVA 2RAVA 3OWOA 4XKJA 1GZ5A 3D7LA 5FUXA 5FPHA 2YXDA 4Q00A 1N2GA 4UPEA 4DM7A 1I80A 2P6RA 4C04A 1H1LB 2V55B 3U4IA 3ASZA 2PZLA 3B9BA 3U3OA 1T1EA 2JFUA 3ZU3A 3FOBA 1XX6A 3PNKA 5E6SB 4CODB 1A9TA 3OU7A 5HZHA 4IJMA 1XTSA 2JCSA 1W7AA 1DC4A 5IC5A 1DAHA 3G5TA 1UZNA 4MCJA 4ZVQA 4EB3A 4YAGA 5K0FA 1KP2A 4QM7A 1JIXA 3RRZA 4ZJPA 3B7WA 5LQDA 1KWGA 3F8WA 4C7VA 1L8LA 4ZYXA 3NU1A 5LQJA 2W2XA 1JJFA 2HJWA 4GWLA 2X0KA 3ZLJA 2FWJA 3QI7A 3CLTC 2IW3A 5HEKA 1E0AA 1A4IA 1HFWA 3BXEA 1E8MA 1GNVA 2YVQA 3H6KA 4D92A 4O29A 4EJ0A 2Z6VA 5AVXA 5A9SB 4KR3A 1U0JA 3FI0A 4IWXA 1E5QA 1I51A 3AVXA 3KAQA 3MWGA 2CN1A 5IRCD 1BVRA 3NPAA 4E1VA 1G16A 4FT2A 2XWQA 1HE2A 1X8KA 5K3DA 3OPMA 4KYIB 3EGDB 2G83A 1K08A 3UJHA 3VPHA 3ZJTA 2YWJA 3OZAA 4YN3A 3SC2A 3BTOA 2CDRA 1UPBA 1LLFA 4HTAA 4IYRA 4KR6A 2CV0A 3EMBA 1Y6ZA 4M0DA 3FCEA 4QJ5A 4WOBA 3VKWA 3WLKX 4DOMA 1DC6A 4KPEC 3ZIDA 1T8SA 4IAOA 4HP8A 1KJWA 1BOFA 3Q15C 4L4SA 4Q7LA 3T3MB 5J2UA 4PBSA 4BQQA 1RKVA 4YIKA 4BVHA 1DADA 1DEHA 2VSFA 4HAIA 4OQXA 4U4AA 2O2SA 1RWXA 4EUNA 2O8CB 3PIDA 3MMSA 5F73A 3KELA 4BVJA 2YOHA 2D8MA 1QB8A 2ZTLA 4PCLA 1Z0IA 1P2BA 3ONEA 5IVDA 1T9KA 2HL6A 3OQOA 4TPKA 4ZJYA 1K2WA 4L74A 4CPDA 1UBLS 1VSBA 3VU9A 4BRSA 4WXRA 2Z2KA 3LKZA 3TUIC 1Z17A 2M1XA 3TQFA 3PHCA 3UXMA 3KSRA 5I4BA 3PEWA 2EYUA 1CIJA 4LOJA 4AAYA 4NH0A 4B2IA 4H7KA 5KSOA 4HG2A 2OK8A 3HM9A 4CTNA 2R48A 2D1QA 1RJGA 3QOWA 5DIZA 5HNKA 4WINA 2YFQA 1CUYA 2AL7A 2W4IA 4ZO7A 5I9SA 4URFA 5KNBD 2QUJA 3H42B 1G7SA 1Z33A 4AUEA 3P4UA 3VR4A 2R6AA 2ZYWX 3QJ5A 4J7CA 4J0DA 3GCGA 1F2UB 3HI4A 2VPXA 1O5TA 1X1BA 3MCWA 2JLAA 2F62A 4YP1A 2NT3A 1VE9A 2PCLA 4V3CA 2BW0A 3SK0A 3FPLA 2AXPA 3I34X 5DBFA 2BSAA 4RJTA 2IU6A 4GPIB 1YA6A 1NUSA 1QIKA 5L7WA 3FUUA 3ZHCA 1I3OA 2R00C 4FZ3A 4P5DA 3I45A 3LYLA 1Q15A 3MWYW 3QMVA 1OC4A 2H2GA 3BC1A 1AUOA 5EZYF 3HJGA 2D5LA 2M1ZA 1ADGA 1E1MA 2QVBA 3N0VA 3NAZA 1SMKA 4TLAA 4R1OA 2GEBA 1CY1A 3QE2A 4AZ3B 4B48A 4W9MC 3SOPA 3LQQA 4PZPA 1D2HA 1JTFA 5BSGA 2DHEA 2QUIA 2ZEJA 1JDNA 5TF0A 1CDOA 1LBTA 4IIYA 4GZ6A 2GA9A 1ZUHA 2V74B 3AETB 3BBLA 3HKCA 3LP6A 3QEMA 4P22A 1F6BA 1G8SA 3ZCSA 1XCPA 3H1BA 3BMCA 5COQA 2FZLA 3ZNQA 1W44A 3T1TA 1KKLA 2XUQA 4P9NA 4WDQA 5HBRA 3R41A 3Q72A 1GPYA 4K7JA 3U7GA 3E35A 2XMSA 4RJLA 2NSLA 4IEEA 2OGUA 2GAOA 1W1UA 3HUDA 2ET6A 2BHSA 3AJ9A 3B3QA 3OPYI 4DRXB 4R68A 1XTIA 2IZ5A 4GHWA 2PA3A 3WO0A 4N8DA 4DUGA 1B8OA 4NSNA 3AEZA 3O1IC 5FA6A 3I23A 3QWIA 1FSFA 2NO1A 2P9CA 1KXZA 4XTRA 3TQSA 2PSSA 1BN7A 1G6HA 2FYTA 1JB9A 1M10A 3DT9A 3R4CA 1EUQA 2ANBA 1I7SB 4YRNA 5LZ9A 1JFSA 2JJQA 1XZNA 3BOSA 5BT8A 4D4IA 1BVYF 2JB9A 3GVPA 4MRRA 1BX1A 3OCJA 3OTGA 4Y30A 1R74A 1P75A 1ZGJA 2GR9A 4OFXA 4OYYA 3SICE 2MYPA 3BIWA 2XUOA 2H59A 4AMYA 1JF8A 3S2IA 5H16A 1XCLA 1OBHA 2HCRA 3OMXA 2J3IA 4M49A 1FDTA 1GR0A 3EC1A 3D5EA 3N7TA 4UQOA 4YRIA 5CB0A 2A9RA 4HX2A 1R0BA 4F45A 1OVGA 1QIFA 1NT2A 3CR8A 5KWVA 4I14A 4DANA 5H80A 3BRWA 5JH7A 4FYPA 4YAWA 2Z4RA 5H3CA 4BRZA 1I5OA 3LK7A 4RVCA 3RKRA 2EKBA 3SHTA 1OB5A 1DPGA 3DEKA 4AYXA 4MV3A 4RH0A 4XVUA 2R86A 1E2UA 1U9YA 2JD1A 3LQFA 1RQ7A 3FLEA 4P7BA 5D85A 1N8TA 2ZJZA 1VMAA 4QPPA 5TNXA 3JWEA 3EG5A 3RU3A 5CBKA 5K0BA 1E1QA 3OLWA 4ZT7A 1GGFA 6GPBA 1Z6QA 2CLSA 1XJCA 2CUNA 2WSSD 2H8KA 4P3NA 2Z09A 1QPGA 2O0JA 4J6EA 1SEVA 2D1YA 1BSVA 3ICCA 4NMHA 3W2EA 1PR5A 3WLSA 4COOA 2YW9A 1E2BA 3KL4A 2AN9A 3EGCA 4I1SA 2VQDA 2OORA 3DQPA 5D8DA 1T0PA 2GJAA 3N8HA 1COZA 4DV5B 3AF1A 3MJFA 3B3FA 2HM7A 1C50A 2NQ2C 3TLGB 4B3HA 4BLQA 4HTFB 4DLAA 1ZZEA 3HU2A 3LZ6A 4IZOA 1DLJA 4BO6A 2X4LA 4O0LA 1XBTA 2ORWA 4G5SA 5CD1A 5IPFA 1OX4A 2PK3A 2RK3A 2VH5R 3Q10A 3ERCA 1FOEB 4G1BA 1H22A 3CSDA 3DZJA 4QJIA 4GIBA 1KSFX 3Q2IA 4GRAA 4CLOB 1GAJA 4EA6A 2HV8A 4W5TA 1UOPA 4U7DA 1TAQA 5JZ9A 1GSHA 2YYZA 3L93A 1NVUQ 2RGAA 2Y6VA 2ZIEA 3LGXA 3QVXA 3UCFA 4O4IF 4EM6A 1L7MA 4YPOA 5THQA 2VXCA 1KIAA 3RG2A 3PKJA 1VLZA 3GQVA 3GFTA 1UIRA 2IYZA 3I9NA 1EBFA 4I19A 2ZANA 1I36A 1HK7A 5CHYA 3T5CA 4B17A 4NV0A 3S27A 4CF6A 2HIGA 3UKDA 3E03A 4D3DA 4F4IA 2MCFA 5KSZA 5F3WB 4HBZA 3ES9A 4DLKA 2RGCA 4OV6B 5AKKA 1CXZA 2NO9A 2C3UA 4KVFA 1H2YA 4BN5A 1G9TA 2HDOA 1IN6A 3D7NA 3FYCA 5LP6A 1IJEA 2NACA 1JIKA 3JR3A 1ZHFA 4FYXA 4XB6B 3OTHA 5KKNB 3EVCA 3R6TA 1XMXA 2GRUA 3IQHX 3O1JC 3TS1A 2Y2VA 1IEWA 1RZVA 3COWA 4IQ4A 1KHHA 2QOEA 2VDPB 5K0LA 4MGKR 3MJVA 3NNSA 3QPCA 4WZBE 5AUQA 4KOEC 4ATNA 3ABSB 3IQEA 2V54A 3RVOA 2UUCB 4KNYA 1B1AA 3LA6A 2AOTA 5GJBA 1GCGA 4ENQA 3DVSX 4JJ7A 4C88A 2ZB7A 3GNSA 4MUEA 5DOVA 4DR5B 3A3YA 5BO5A 4L5AA 2Q6IA 2R8RA 2H48A 5DXJA 4ARZA 2Q4TA 4MUFA 2UVDA 1PWYE 3D3WA 1Y1TA 1U0BB 1TT5A 2PSEA 3BSYA 4FGZA 4MJ7A 4B4KA 1JNYA 1BU5A 3BUSA 4QOHA 5JASA 3AF4A 1EFLA 2KQUA 4J75A 4Y6GB 5HS4A 4IIUA 1CEQA 4HPXB 2FEAA 1Q0LA 1H9CA 1H69A 1AO0A 1XTBA 3B6KA 2Z5FA 1SHLA 2O57A 4KREA 3HDTA 2PGXA 5AOCA 4DWWA 1S4QA 3K0SA 1WB4A 5ALPA 5BW8A 2HMUA 3LOPA 3PJDA 3O8OA 1Z0JA 2XNDA 4U39A 4URUR 4EOGA 2VTVA 3LDUA 2JLUA 2J0UA 1DBIA 1KPGA 1PAUA 1UZLA 2WAMA 3B1ZA 3L8YA 1ZCJA 4LIPD 1P7CA 2UDPA 3MB5A 3VJKA 4PLGA 2VJMA 2W2MA 4DMGA 5DK4A 1BKDR 1UC8A 1UCFA 2HA2A 2YNMC 4H3HB 3RS8A 1GNLA 2I3BA 1P29A 2VN8A 1OWMA 4S1VA 4ACBA 2IUTA 3PF8A 4P4TA 3IIKA 3O1HB 4Q4AB 5DYGA 2W2KB 3IB6A 1O95C 1CR1A 1N6IA 1W8IA 2ONKA 4HNAB 5IAOA 4ZYTA 3FJ1A 3PNMA 4K3VA 1WPRA 3KNZA 3ILXA 1OT3A 4L16A 5F33A 2WZBA 5NULA 4PAQA 4H6XA 3THYB 2H65A 2VYQA 1P17A 3NIDB 1W46A 2DT8A 4UNSA 2VHVA 3W4KA 3BWVA 3G7UA 1XTTA 2AX4A 4JU8A 4HRXA 4ZHQA 4MVJI 5FOXA 1L5OA 5HG0A 5B64A 3FDFA 4AQDA 3BWEA 2BGKA 1PI3A 2Z1MA 1PE0A 1SQSA 2C4UA 2ZOSA 4WLEA 3ZX5A 4LTNA 3CVOA 3N0XA 3NONA 3A9UA 1ZESA 1V8OA 3GJ0A 2K2QB 1E2NA 1ZKDA 4MW9A 5B36A 3UGTA 2UXCB 1OAKA 2ORIA 2DKNA 5TVKA 3AG5A 4LGMA 3ZZ0A 4UCWA 2XDWA 2YMQA 3WFZA 2HK9A 3NGMA 2G1AA 2X76A 2W4MA 4I1RA 2I67A 3NPMA 4IFEA 4RJIA 1XCGB 3W4JA 2I3GA 2VK8A 5DMXA 3MAJA 2PM8A 2VF5X 3E23A 4KX3A 5HWSA 4WI1A 1A50B 3SN6A 1H3EA 1OH7A 3EXAA 4KG7A 5K3FB 1C4KA 1XP8A 5IH7A 2ZBVA 2YIDA 1KTVA 4M55A 2X8AA 1PJRA 1M54A 4YEDA 1QQAA 1CQZA 1IOZA 4XCQA 1F5NA 3G5MA 2J6IA 3ZXIA 4RABA 3D54D 3KC2A 5GIOE 3R3XA 4U8HA 4D9NA 1ZD8A 2ODBA 5IDWA 2PY6A 1H2FA 4GXNA 3GZNB 1IDOA 4IIJB 3CWCA 5FOWA 4DN6A 4H17A 2G5GX 1NJSA 3BORA 5C8VA 1RTKA 1QM5A 4F3KA 2PH5A 1E6UA 4TS3A 3T3DA 3UOAB 1RT9A 3LD9A 1Z15A 2R8OA 3OY2A 1QH1B 4WJZA 5FPPA 2WUWE 1ODSA 2WWFA 3PC8C 1IPFA 2BCJQ 4KE6A 1QE3A 4M0PA 3WK9A 4OKSA 3HWWA 3WYGA 4ZC8A 2XMGA 3RUDA 4N03A 4ZAGA 4CGZA 3IHLA 4OX9Y 2H07A 1H2XA 2FDXA 3QH4A 4OATA 5HK8A 3R8XA 3MAGA 4IRXA 4KMMA 1XHFA 5DHUA 4HAXA 2CKMA 3CB2A 3LWNA 4FGSA 1NUPA 2XF8A 1W581 1XZBA 3CF0A 4HS9A 3GLQA 1OYVA 1P4SA 1QOZA 1EZ1A 3L0BA 3C6QA 5AI6A 1E7MA 3A1DA 1H6CA 4PO9A 5D7BA 4IJ6A 3V46A 1YZHA 3WXMA 5JATA 2O7RA 1YZGA 4C30A 3T7AA 4KPYA 1RYHA 2MDTA 3K1TA 4IHJA 4JR1A 5EEGA 1SBYA 3UWMA 1AH2A 3TRIA 4D9KA 4XCVA 3WYDA 5A4KA 3IERA 2PSDA 1NC1A 5IJXA 3QA9A 1U4OA 4PSVA 3WISA 4EB6A 1GL9B 1AKUA 2DR2A 3K09C 3PX3A 2KW5A 1Q92A 3R77A 3TD9A 4YMWA 3GFVA 3I61A 3CRZA 1XZGA 4MEJA 2HWXA 3IPRA 1JIVA 3TAUA 3O2QB 4NENA 4WLVA 3EGOA 5EXTA 1A71A 5CJPA 5EHNA 4UUAA 3RS3A 1XTQA 1LLCA 4DYVA 1M0SA 4R7GA 1WCYA 3E6AA 2WTNA 2TMYA 3JQAB 2AEFA 4OHFA 1KH3A 3HBAA 1MZPA 1EWRA 2XAAA 4EI7A 2QY9A 1PU2A 3HCNA 1GG5A 5AWFC 3KJGA 3R3SA 2FVYA 2I7DA 2QA5A 3FOWA 4KQFA 2WHQA 1MAAA 5T8KA 3UMYA 3I1FA 3R40A 1FTYA 2GPWA 2B98A 1XIVA 3FDJA 4RDIA 2ZYSA 3WLRA 3E15A 1A5SB 3DDHA 3SC6A 4CM4A 2NXNA 5BUQA 5ADHA 2GXUA 1N2CA 3WGZA 1W5FA 3CUUA 4WLOA 2WJVA 2GHTA 5I8WA 3G68A 3DSRA 4FKBA 4DIDA 4G89A 4O4LA 5IJ9A 2AXQA 1KF0A 4KBFA 3ZY4A 4K3UA 3UWDA 5G53C 3VZBA 1NXOA 2PU7A 5JNVA 1N5JA 2EX1A 2WA2A 1VJDA 1XZ8A 2AZ4A 2PBRA 2YNMA 1IL0A 3GGOA 2X1HA 2Y05A 3IKMB 3M5WA 4S2UA 3TMAA 4AVYA 2OV6A 1EUYA 3ZLBA 4CNQA 1CCWA 3AVYA 1EP9A 4ZOBA 1R0YA 1O95A 2JLBA 4XYBA 4BKUA 4YT2A 5KVSA 5EMJA 3FKQA 4YJFB 3PUWA 2YN4A 3V34A 3KAKA 4M7PA 5JSHA 1AZTA 3I0ZA 1YR2A 1OMOA 3BWYA 2WTMA 2I7VA 3Q3GE 5ALJA 3SE7A 4GC9A 2I87A 4BFXA 5H70A 2FN4A 1E99A 1Z2EA 1P9LA 5IP5A 1VSVA 3R5XA 1YOVB 5BT9A 2J3LA 4I1VA 4R41A 2HHHB 2PEYA 2JCXA 3VVCA 5KC8A 1XG5A 1QF6A 1WY5A 1QZUA 1WLSA 2NZJA 3D1LA 2YKGA 1UC9A 1CZUA 2N0SA 1FP6A 3IHKA 4J1NA 4KVAA 1YQQA 2CHUA 2JL1A 4N0QA 4PYMA 4ZI7A 2IELA 1SBNE 1G3QA 3DTYA 5EUMA 3SHOA 3PXDA 4FYYA 2MYTA 2D0PB 5KCZA 1OHHD 2I7XA 4JASB 5EJIA 3R9WA 2GYUA 4E32A 1V3VA 4RHXA 3OJCA 5I7HA 2OB2A 2E1RA 4P6VF 2FGKA 2HBQA 3QFFA 2J45A 2PYZA 2IH4A 4RD0A 5TQ0B 2HRCA 3EAFA 3AR8A 2MSCB 2Y1WA 3DVQX 3RS4A 4DGSA 3WYFA 1QYIA 2ZGVA 3TTYA 4RPIA 5GQSA 2VDOB 2JAWA 1OFHA 1II0A 3N59A 2X9VA 2QMQA 2DPHA 2M6LA 4L5YA 5K6AA 2HZBA 3DAOA 5E9QA 1HWYA 2QX8A 5D3MA 5SV2A 1H1LA 4KO2S 4MVJP 4BRWA 1E6EA 5F98A 2I9PA 2QGZA 4HWOA 2ZI5A 2ZULA 1W0KD 5DEOA 4Q4CA 1JR2A 1FS5A 1GG8A 2H29A 2P6OA 2UZ0A 3GLKA 4MVWA 4RAOA 1BA2A 5G1NA 1XA3A 5U1PA 4EHNA 3LHIA 5TC4A 4N01A 3TD6A 3U60B 3G2HA 1J5EB 2OESA 3GPCA 5P8WA 5KVVA 3CYFA 3HNOA 1CBUA 3ZWXA 1U9JA 2WKPA 3H83A 3UJCA 4JJGA 3OMLA 1KY5A 1P4RA 2F2TA 3A3NA 1H8HA 1NZJA 1U5BB 4NTZA 4D4KA 5K2OA 1LPPA 2B8TA 3JZDA 2VP3A 1P0QA 1CQWA 1DS6A 1T3GA 2VAPA 1T2AA 4HUQA 4QDUA 3TGWA 4F3YA 3FHTA 1PX0A 4CF7A 1J8YF 1HDCA 3K0KA 3L1UA 1F1JA 2QZSA 4IOKA 2SKCA 2Q3DA 3DGFC 3OHSX 3CV3A 1O6FA 5KOHA 3SEZA 4LWQA 3GMSA 3S8YA 2YZKA 5BPFA 5CEFA 2Z98A 3CUYA 3NAMA 2RKWA 2IYPA 5AJXA 5AW0A 4AXXA 2K87A 1KBOA 4FPXA 3JRNA 2V0GA 2FXIA 3ZHZA 5EZQA 4HQNA 3ZNPA 1C3JA 5FP0A 3UMFA 1Y33E 2LR0A 1XL1A 1WB9A 3OO1A 1PR6A 4HMPA 1AOXA 2YOGA 4HZUA 1REQB 2X40A 4OLAA 3LDFA 1YI1A 3VZQA 2A2ZA 1E5DA 3ETLA 3NEPX 2J0VA 1G7TA 3HM2A 3GGCA 4IV5A 4KKXB 3FSGA 1LW7A 4B87A 3IQIX 3O95A 4HOYA 4CQMB 3IPLA 2YHBA 5F7JA 4HQFA 1URPA 4J3FA 1LPBB 4EHIA 5LWHA 3U81A 1FY2A 4X3CA 1LUAA 3LUJA 3SX0A 1I30A 3K5WA 2O0LA 1AV7A 2Q2NA 3TEFA 1RR6A 3BWXA 1PK8A 4MUKA 2CZCA 3ZNOA 4XRRA 2NX2A 4FCCA 2A7QA 2FR8A 3BWBA 3FIJA 3WLFA 3L1VA 1UBKS 1V4BA 4KN9S 5DGHA 1ZW6A 3SHQA 5HIKA 1T6BY 1VKNA 4KK3A 1F2UA 3HO1A 2W2NA 2QN6A 1B41A 1QYXA 2OAP1 2XMBA 3KEFA 4FLEA 3HRIA 4F5ZA 1I7QB 4PYRA 5GONF 1UBSB 2DLNA 4A73A 2LW7A 3CY6A 3CN7A 2FSVC 4H7EA 1XNJA 4HXEB 4MTCA 3DXXA 1JHOA 3E5MA 3ONDA 4KAXA 1VCOA 2RH8A 3C1OA 3R6LA 4QHTA 2AIRA 3TEJA 3M1YA 3TSOA 4A92A 2KX7A 1THGA 2QVXX 3OCWA 3YASA 1ZSVA 4BB6A 5KMGB 1RYZA 1PZNA 3IPYA 3OG9A 3SGLA 1PEKE 2ZSIA 4AZ3A 4E33A 4RNCA 1ECBA 3CCCA 3FHJA 3HLYA 3Q5EA 4MB2A 3OZXA 3ZXUB 4EITA 5IWAB 2V9PA 5CVVA 2VNIA 1AC5A 1I5RA 4NBWA 5ES4B 3LECA 1IHUA 1UBTS 3V7UA 4CL2A 2B4QA 1BO6A 1N7HA 1OIWA 2JKZA 3AETA 3WLLA 3JS5A 4EMBA 5JY6A 1XRJA 1CLUA 1OWOA 4LBYA 4XVHA 2DF8A 1VIMA 1N92A 1ZOPA 5EE3A 5BUZA 4RHEA 3EXG2 4NXMB 3I62A 4NVRA 1D4ZA 4GXQA 4QUBA 1NJ6A 1TLFA 2XRFA 2D2VA 2YWBA 3F96A 5ANRB 3L5KA 3TNFA 4E07A 4O3FA 1FJXA 4Y9RA 1KZGB 3FJYA 5ETJA 1BXGB 1CQIA 3F6CA 5BYAA 2DR0A 3KM0A 1EG7A 1PW7A 3E3NA 2YWGA 3PZRA 4S12A 2B78A 4M86A 1T9GS 2XQGA 1XQWA 3DZCA 2QSZA 1E4YA 2WFMA 3USES 5A04A 3CRRA 1NW4A 4NU0A 4C0BA 3IUQA 4XUDA 5C35A 3JSXA 1A3CA 2R751 3W90A 5I7AA 1P31A 1UK9A 2L42A 2AJCA 4G1FA 4RZHA 4GL4A 1Y34E 4Y67A 4F5WA 1THTA 1H85A 4QDOA 2ZWPA 3VH2A 1GQQA 2AQ8A 1DXQA 2A7XA 3GIDA 2XTMA 1ZJYA 4NJMB 1TYEB 4TMVA 4B3JA 3SZMA 1DIOB 2QQ0A 3PWKA 2Q1YA 2Z6QA 1ZCZA 3K05A 5CT5A 3ABQB 1YBAA 5DE3A 4ZODA 3RODA 2EJBA 2QENA 1F7VA 5G0SA 4R05A 3Q7TA 1A7AA 1Z6YA 4LZAA 4PV7A 4QDZA 1WB6A 3TVTA 4DDKA 4EVSA 1RRKA 2R8PA 1N0UA 3BM5A 5AK4A 1IZYA 1O7JA 1Z9BA 4AWBA 3ZY3A 4B6FA 3EIQA 3TLYA 5IXYA 2IEAA 4FI3C 13PKA 4O5OA 3CZQA 1COWD 2QV0A 3OPYB 3B36A 2BI4A 2PT5A 1Z5OA 1QU3A 3DO6A 1C7IA 2G88A 1TD9A 5CCEA 1JT2A 1KQ3A 1QH8B 3H6GA 2HSGA 1A96A 3OUZA 4RF4A 2Q99A 2FH5B 2XBUA 4A4DA 2GJ4A 4ALNA 3WNZA 4ECAA 1BVHA 3GLSA 1O3YA 4WOKA 1EJ6A 4FFRA 3TLGA 1W2WB 3THWB 2ZAGA 3EBOA 3I9OA 4HTFA 2KMLA 2ORYA 4QHYA 2VRNA 1WMAA 3C24A 1N6RA 1K0FA 3R24A 3SZ3A 3C8UA 1DAMA 3PLRA 5FLXA 1GCAA 3AR6A 1SD1A 2CV2A 1N57A 1GPJA 3OZCA 3HO6A 3L1KA 1A8UA 1J7KA 5BSUA 2DHRA 3OIYA 1NQWA 5ERYA 1BCSA 3JXEA 2ACKA 2OCXA 5FBHA 1RPTA 3LOUA 2LDBA 3P0IA 1UFKA 1V8ZA 1RRCA 5EWJB 4JT4A 4OAOA 1RYNA 2YMMA 4FXPA 4QQ8A 2GM5A 1LPNA 3VGPA 2CBXA 1O5IA 3ZWMA 1PJZA 2DJIA 2GILA 4R16A 3LBFA 3ER6A 2OCKA 4IHAA 2OFFA 3W2GA 5IHXA 5FBVB 2UYYA 3GJ3A 4PCAA 3TQCA 2ZM5A 1YU6A 1NT4A 5C8DA 4GC5A 1QYWA 2ZYHA 4RQTA 3IUPA 1LK5A 3CIOA 2VK4A 3V9PA 2ZZKA 2R1VB 3WLEA 1NJ2A 2VQ6A 4LXTA 4UARA 2VR1A 2W2TA 3PJFA 4R9UC 5B2EA 1MW8X 4FHFA 1FNDA 1RCFA 4EW3A 5E6UB 2MMCA 2HB6A 3AIOA 2IZ6A 4N7BA 1EQAA 2CMKA 2QJFA 3HVHA 4ND7A 2XDYA 4CT0A 1R0CA 3X1KA 3DDOA 3P2MA 3HJUA 3RHZA 3BQMB 5DBHX 2ZRKA 1RCUA 5KJCA 1YS1X 5EYPB 3D43A 4JT8A 3PNLA 2NUTB 3C3MA 1CTQA 1OIXA 4CLRB 3B2EA 4HDQB 2JLZA 3KKOA 1FC0A 1IXKA 4BQIA 3ANLA 2AOVA 4OP3A 4U7PB 3DOCA 2A59A 4Z1MA 2DUMA 2C9MA 1GITA 2Q0HA 4M2LA 1J20A 1UM9B 1Z0DA 2EWWA 1UBOS 5K8VA 3EZ6A 5KJFA 1NVXQ 4E09A 1G8AA 3FYTA 1CS4C 4CV1A 1G8HA 4I08A 4N3CA 2BKLA 1ZLXA 1Q7GA 3FW1A 1K27A 1T8WA 3IAXA 2QRKA 2AB0A 1FYEA 2XGMA 2ZYRA 4Z4CA 1JKJA 1XYGA 2FUEA 4JJAA 4KFRA 4ITUA 3E7WA 5IT5A 1Y89A 4CKBA 4V0KA 3RJTA 5GJCA 5CLQA 2WYHA 3AKEA 2A57A 5J2TB 4FYVA 4HLQB 4CEHA 5I9MA 2ZZMA 4AY2A 2GYWA 2NSJA 4FBMA 1J6UA 2Q6KA 3EA0A 4BMCA 2L82A 3E22B 3HR8A 1W34A 2A5JA 3HN7A 1NUTA 1S9HA 1DAEA 1ADYA 4TWIA 5IS2A 3NAQA 3TOCA 5ALVA 1XEAA 1H9AA 5K3SA 5BWCA 1Q77A 2XA2A 3QUCA 3GG9A 4LZOA 5KYUB 1NBEA 3SYNA 5KZMB 1PTJA 3GBSA 1F60A 3GLHE 2V3VA 3L7OA 3MF4A 1J8VA 4H60A 4XPIB 5IBRA 2IWHA 3W5CA 2HXYA 1IM2A 1AN0A 1U28C 1PEYA 3SJBA 3DXFA 3DYBA 2WSBA 2OBLA 2EFGA 1CF2O 4PEVA 3WOVA 5D5PA 3HFRA 3VO9A 4WGFA 4M8LA 4W8HA 1V95A 3BGOS 1U3VA 4TKLA 4X7BA 4P7GA 4D8TA 2AD1A 1WW3A 4LK3A 3OAAA 4GNKA 1Z4MA 4MVYA 5JSFA 3UCEA 1EBUA 4JNKA 1HZZC 5J4VA 1OILA 4JVOA 4G0NA 4EA9A 2FX2A 3WWYA 4Y0NA 2L19A 1V71A 4P86A 2Q7XA 5T3UA 3SY8A 4M1KA 1X77A 4XUCA 1Y9AA 5BOVA 4MQLA 2GZMA 2ALJA 3FTNA 2R6HA 3G82C 5FTLA 2B2CA 4UBOA 4R2JA 3GJ5A 5D3ZA 4GFDA 4ZV7A 3VNVA 1Z7GA 2PGDA 1N6NA 2FMXA 1GZ4A 3SS7X 4TMYA 4ZN6A 4YCAA 2Q8PA 1ORVA 4B5LA 1P9OA 5FI0B 3ZKAA 1HNZB 4PZCA 3V1LA 2XD4A 2CLMB 5EWLA 2HRQA 3GRFA 5FR2A 1W73A 4BO9A 5BWBA 4G25A 3VR6D 4M9ZA 2D2XA 3S5JA 3NFYA 3CT4A 1QH1A 4R54A 2Q45A 2VH2A 2C5BA 1S6YA 3SF0A 4G0OA 1ZSNA 2J30A 1S2NA 2ZDQA 3C8ZA 4W6QA 3PTZA 4CFZA 1AX9A 4CQLB 1BXRA 2F64A 3LQKA 3J81k 3A4YA 1SG6A 4X45A 2IEBA 3CWZA 4MP8A 3RTCA 2JLRA 4ARCA 1XRMA 2ZR8A 4M88A 1GUBA 2ATEA 2QQ5A 4RY0A 5DBGA 3P9NA 1SQGA 5K1SA 1BA3A 3II6X 1TCBA 3F7NA 3HBNA 1O03A 4BVLA 5JMTA 4YV2A 3S99A 1KJYA 1T6YA 1ETHA 1TW2A 5F2KA 3ITKA 2ZUFA 2OAEA 3HB0A 2H06A 3SG0A 3R6DA 2MHCA 4I6EA 5B57C 2VRCA 2Q1UA 3C43A 3A1UA 1WDWB 1PSDA 2NU6A 5IBCA 2R9VA 2OFPA 5AW4A 1ZM2A 4I55B 1D3AA 3D8TA 3GLGB 4V1CA 1B6RA 2HHCA 2VUSA 4HBGA 5I7EA 4FQ7A 4NF2A 4KE9A 5LMCA 1XQXA 2HGZA 4OQPA 4Z4HA 1XNQB 2QMUA 2YL2A 4P4LA 3OJEA 1DV1A 1UANA 2C1EA 3F74A 3K5IA 1ZSYA 4KWCA 2WWYA 1V35A 2JGDA 3IIMA 3VPAA 1VGRA 1ZINA 1BMDA 3RSLA 1ZN9A 4IJVA 2WV9A 4F4CA 3A1FA 3UFBA 4BCDA 1KTIA 4F2HA 3AINA 3E1SA 1Y7TA 4XCXA 4TWZA 4FFPA 4GZ5A 3BTVA 4BNKA 4YXWA 5HQ3B 1Y3BE 3ZU2A 1FDIA 3OEED 4DMKA 4L1KA 2CLKB 4BECA 3DYIA 3JZFA 1CF4A 2VHYA 1H8EA 3I9KA 4LDNA 5FEMA 3E0QA 2CBGA 2B20A 1NR7A 2OBYA 4MRMA 4XFDA 4O2RA 4DARA 1EXNA 2P0YA 4U7TB 3UFXA 4EI9A 4RUKA 2I4MA 3TLAA 2Z5VA 5JSYA 2BGJA 3Q8KA 2CDNA 1G21B 3FKJA 3CM0A 3TLJA 3TIGA 1TYDE 1U0LA 1K98A 1PFUA 4RQAA 2WPDA 4C2AA 3R3WA 4ETWA 4OLBA 2R6R1 3RVBA 2DY1A 2NU8A 3N70A 4GM1A 1ZWKA 2P2GA 1PR4A 2Q2WA 1DWQA 1UDCA 3W5HA 2HEIA 4GOKA 3HSSA 4Z9BA 1ACLA 1YQTA 3GZTB 5EP2A 4FW9A 4Z6KA 4OHCA 4KR2A 2ZQYA 2X4GA 2Z58A 2G25A 3IURA 4RPJA 3U4QA 4N76A 1LC0A 3OA2A 4DC9A 4WLNA 4MKXA 1EQUA 3DMYA