1JQBA

Alcohol dehydrogenase from clostridium beijerinckii: crystal structure of mutant with enhanced thermal stability
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
351
structure length
351
Chain Sequence
MKGFAMLGINKLGWIEKERPVAGSYDAIVRPLAVSPCTSDIHTVFEGALGDRKNMILGHEAVGEVVEVGSEVKDFKPGDRVIVPCTTPDWRSLEVQAGFQQHSNGMLAGWKFSNFKDGVFGEYFHVNDADMNLAILPKDMPLENAVMITDMMTTGFHGAELADIEMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKNGHIEDQVMKLTNGKGVDRVIMAGGGSETLSQAVKMVKPGGIISNINYHGSGDALLIPRVEWGCGMAHKTIKGGLCPGGRLRAERLRDMVVYNRVDLSKLVTHVYHGFDHIEEALLLMKDKPKDLIKAVVIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords NADP-dependent Alcohol Dehydrogenase
publication title Structural basis for the enhanced thermal stability of alcohol dehydrogenase mutants from the mesophilic bacterium Clostridium beijerinckii: contribution of salt bridging
pubmed doi rcsb
source organism Clostridium beijerinckii
total genus 119
structure length 351
sequence length 351
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 2001-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1jqbA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1jqbA01
1SNYA 1U3WA 4XGIA 4DLLA 2CDBA 1RM0A 4PZCA 1IUKA 2WWRA 4J2HA 1GYPA 3KUXA 4IIUA 1PZEA 2CVZA 4JN6B 2I3AA 2Y1GA 3SLKA 5B4UA 2W2LA 3Q2KA 1GY8A 5H82A 3H65A 1YE3A 3L0DA 4NMHA 4ZQFA 1EBFA 2ZJ1A 4AVYA 4RQUA 3GOHA 4TRMA 2VOEA 4C7KA 3ZU3A 1JWBB 1TB4A 4ZQHA 3NTQA 3M1LA 1K6IA 2WE7A 1GL3A 2FSSA 3GGGA 3W8DA 3HZZA 4S1VA 3I6QA 5DT9A 3RI3A 2ZJ0A 3WBBA 1ZEMA 1ISMA 3E9NA 2VN8A 3INTA 4W7HA 2OOSA 3RUFA 3UUWA 2BKAA 4Q3EA 4YRDA 5JDCC 1I0ZA 1QYXA 2YY7A 4BL5A 1BDBA 1GQ2A 4CQMD 1Q7CA 1UDAA 4R4JA 1ADFA 5AXAA 3QHAA 3F46A 5EQDA 3GT0A 4TVOA 2J6IA 3QWAA 3L9WA 1PSDA 4E30A 2Q45A 1ULUA 1T4DA 5G4LA 3AY7A 4A73A 1I3NA 4K9DA 1UP7A 3RSHA 3VTFA 2HK9A 2Z1NA 4ZICA 1I2ZA 1NX6A 2YJZA 1PGQA 4BO7A 2JL1A 3IL2A 4B79A 4R68A 5FF9A 5HWSA 1IL0A 5HM8A 4Y9DA 1RYEA 3H5NA 5ENVA 3Q6IA 5IXYA 4B7CA 5CDGA 4LW8A 3RBZA 4L8VA 3RWBA 2FOIA 3FPCA 4Q3CA 5F1OA 1YBVA 3GNTA 3DTYA 2CMDA 4LMRA 5COAA 6LDHA 5ICSA 5EMHA 4CV3A 4NFHA 1M2WA 4PLZA 1R37A 5G0TA 4B4OA 1YB5A 2QIOA 1FDUA 3H2SA 3ICPA 5F3RA 1B3RA 4BS9A 3CE6A 4M54A 4D7AA 4PLFA 3PHJA 5CDTA 3GG9A 1R6DA 4D0RA 2ZCVA 3GFBA 1B7GO 2I5PO 5EPOA 4E2XA 2X9NA 2VYVA 2DC1A 4UEOA 2ZKLA 2FR8A 2OL4A 2BGLA 2NVBA 3H4VA 2PH3A 2DQ4A 2Q2WA 4Q3DA 2P9GA 1YB1A 3WYCA 5DCWA 4P22A 2YQ5A 5IAAA 5CEFA 5KCZA 1P1IA 2ZB8A 4ALMA 3ZWCA 3G0OA 4LN1A 2DBQA 4FSHA 2FP4A 2O7QA 1NM5A 2XF8A 2FN7A 4XR4A 1UXIA 4ZQBA 2GN4A 4LRSB 1GPDG 5I9LA 4L73A 1GZ3A 5A3VA 1E3WA 5JDCA 4EEXA 2X22A 3AU8A 3RJ9A 3ADOA 4E2WA 2AA3A 3NDJA 3HB4X 5G2OA 3VOSA 2VUTA 4YJHB 3OBBA 3C7AA 1O89A 1SOVA 2G76A 4KP7A 4R16A 4L0QA 4XIJA 5JAIA 4CM5A 4JROA 1A9YA 3ZV5A 4EZBA 4WLOA 2JHGA 2POQX 5IG2A 6ADHA 1N7HA 2IXAA 5U4QA 2UYYA 2V65A 2FMUA 4UVHA 1PJSA 3F4LA 2X5KO 2ET6A 4J1TA 1R4NA 4GSKA 3GG2A 4XR9A 2PGDA 2PD6A 4CQMA 1MX3A 4E5MA 3WQRA 4OOEA 3W1VA 3Q1LA 4AJLA 1JLLA 1Y5RA 4BV9A 2OFPA 3F1LA 1YQDA 3TJRA 1T25A 5L7YA 4YT2A 2O7SA 4G65A 2DT5A 4KTTE 2D8AA 1EDZA 2NVUB 1NR1A 4WLVA 1ZIDA 3PVZA 2HSDA 1HDOA 3KYCA 1NASA 1Y81A 2VNSA 5CG1A 1QMGA 3LT1A 3BMNA 3D5TA 2PZMA 3IUPA 3NKLA 4DIBA 4EJMA 4GGOA 3ZZNA 2GZ1A 3HADA 3PYLA 3QWBA 3HNPA 3RUDA 3RC9A 4LMPA 1X14A 1WZEA 3A1NA 1LDEA 5L4LA 4XYMA 1I3LA 4CR7A 2XPCA 4QFCA 2DBZA 1I36A 1T2CA 4BNZA 3BHIA 3VZPA 2WYWA 1ISIA 1HE5A 1NVTA 2V7PA 3FI9A 4EW6A 2B5WA 5IXSA 1Q0QA 3B1KA 4EUEA 3WYBA 5I7EA 5IZ4A 2IZ1A 3DAGA 1E1LA 2VWGA 2NU9A 5A05A 4KQXA 2IEDA 3H3FA 1VSUA 2R00A 1YKFA 2DBVO 2F1KA 4IINA 2D2IA 1E5QA 4R1SA 2WDZA 1IULA 1P33A 5IN5A 1MUUA 5DOVA 4IMRA 2RAFA 3H9GA 2Q3EA 4IDGA 4N5LA 5AXBA 1PJCA 4D79A 3QP9A 3MJVA 4KOAA 4HV4A 1YBMA 4CV0A 2EP5A 5LCXA 3NV9A 1T2DA 4W9NA 2HCTA 3D3WA 1P0FA 4FFLA 1LNQA 4BO5A 1V6AA 3CMCO 5DP1A 5MGBA 4WLUA 2FSVA 3EW7A 3IUSA 4M1QA 4YJGA 1A5ZA 4IDFA 3DOOA 5BNFA 5IDXA 2X0IA 3LLVA 4NBUA 3PDUA 4PLVA 3ZU5A 4AICA 2DTDA 4OYRA 3AFMA 4IDBA 1U3TA 2ZYGA 4MVJP 2Y67A 1GUZA 3WGGA 4WCFB 1G1AA 3HSKA 1C0LA 1LDMA 4CMIA 1PZHA 3AOGA 2B5VA 1IHXA 2AHRA 5FFFA 3GHHA 5KWEA 5FWNA 3SC4A 3Q11A 4O1MA 5AQ1A 4O63O 3Q0EA 4BV8A 4RVUA 4DBVO 3V1YA 1RM3A 3MCVA 3DFZA 3OJOA 4UVEA 2D1YA 4BO0A 4TROA 3OFSA 4FD3A 4CMKA 2NTNA 4ID9A 3PXXA 1HSOA 1XCBA 1QV7A 3SEFA 3AW9A 4MIOA 4GAEA 1X1TA 4KUGA 1QP8A 1HZZA 1P77A 3K30A 4E3ZA 2RH8A 1YB4A 3WS7A 1U4OA 3T4XA 1C1XB 1FJHA 3FNGA 3R0IA 2XOXA 1B15A 4BO4A 1U1IA 5G4KB 1NNUA 4TKMA 2IYOA 3GGPA 4AJ1A 1R16A 1GYQA 3B20A 3CUKA 4K26A 3LQFA 4XWYA 4FN4A 3WTBA 1ISJA 1F17A 2V6MA 1I32A 3A4VA 3FNHA 4O59O 3F3SA 1B26A 2J5RA 1TVEA 5A9TA 3OIDA 4OGWA 1E3LA 1N2SA 1GV0A 1H6BA 3ZU4A 1Y7TA 1X7DA 2H6EA 1JW9B 4CODB 1WMBA 5DCYA 4Z3DA 3FRJA 3PTZA 2B4TO 3EY4A 1NQOA 4R9RA 1YL6A 3FHLA 3I4CA 3P2OA 3IDSA 1M67A 2E4AA 2JFHA 3ANLA 3GVHA 4ND5A 4C4OA 4B3JA 3FNEA 3IQDB 4BIIA 5L7TA 3DL2A 2BF7A 2H5LA 3IMFA 4HKTA 5JBIA 2ZK7A 1Y8QA 4TRNA 5T64A 7ADHA 1Q1NA 2YV1A 1JKFA 5ITVA 2HK8A 1SMKA 2W2KB 3JQDA 4MO2A 3EAGA 5GMOA 2YFHA 2Q1UA 5HRUA 3UN1A 3RQSA 3GRPA 1E7QA 4KTVE 3FTPA 4B4UA 2V6FA 1O0SA 2Q4BA 3KM0A 2EV9A 3LC7O 4CLRB 3ZHBA 4AJOA 3A9WA 4NPCA 5FYDA 4IMPA 3ZW8A 1DEHA 3KYDA 3JQ8A 1JAYA 1P45A 1X13A 3UW3A 4YYZA 2TMDA 2C7GA 4CMEC 2DVMA 3D4NA 1GEGA 2PFGA 4II3A 4JIGA 4LK3A 3WFIA 4BNTA 2PH5A 3BTSA 3OF2A 4PG5A 3WLFA 4XGKA 1NAIA 5AXCA 2P5YA 3STHA 1PQPA 3VDQA 4URFA 5H81A 4WEOA 1N7GA 1JVSA 2HMSA 5DBFA 1V3TA 2O4UX 1DPGA 3BAZA 3H2ZA 5GZ1A 1PS0A 1U4SA 3TDKA 3ENKA 3E48A 4GBJA 2PZKA 1UAGA 1NTOA 4Z0TA 4MIYA 3TQHA 2ZYDA 2YHIB 1CEQA 1XU9A 2HAEA 4XGNA 3RUAA 3S8MA 2PNFA 1XLTA 3VPXA 1EQUA 3O8QB 4CR6A 5A4DA 1I01A 4DMMA 3OP4A 2ZB4A 4EI2A 4J1SA 1OBFO 4OXKA 4Z0HO 3R6DA 1TT5B 3RFTA 3ONDA 4YRAA 2OHXA 1DSSG 1UXKA 2P9EA 1YO6A 1EEHA 4GSLA 3V5NA 4CLDA 1LLUA 4PZEA 4BB5A 2PGJA 4Z0PA 2VOJA 2PD4A 2TMGA 2WM3A 5BQFA 3MOGA 3VH1A 2WSBA 4K6FA 3U4CA 1DAPA 4DVJA 4KQWA 5JE8A 3PDJA 4IJVA 7MDHA 1FDTA 1ENZA 3C7DB 3CH6A 3VH4A 5A5EA 1VLLA 1FXSA 3PFFA 4MVJD 4JBGA 1PL7A 2P91A 1BSVA 1CQJA 2C2YA 3GRKA 3HN2A 3L6DA 4PRKA 5DOZA 3UVEA 1KVUA 3INRA 4EJ6A 1I2CA 1MC5A 3HDYA 2X86A 3GR6A 4DLAA 1Q7BA 4ALNA 3UFXA 1YONA 4KUEA 5A5FA 3GZNB 3WJ7A 3FBGA 3BMQB 1LU9A 2NV6A 5L45A 1WDKA 4NFYA 1H6AA 4XKJA 4INAA 3S2FA 3UKOA 1PS9A 3MJEA 1EVIA 3CXRA 3JQAD 1LSJA 3PP8A 3JD4A 4E12A 5A1TA 4MKZA 5B12A 4TZTA 1EUZA 3DHEA 3OMLA 3NEPX 4W6ZA 4RF3A 3KSDO 2JD0A 3O38A 2PV7A 3JQBC 2PZLA 2C5AA 3RKRA 4DA9A 1KVSA 3ASUA 4CMEA 4OOFA 2CDAA 3OQBA 5ER9A 3MTJA 2YDXA 3E18A 1H93A 2G1UA 2BI8A 2Y0DA 4EYEA 5JY1A 3I9OA 4R54A 3BA1A 2QRJA 4Z6KA 3OM9A 2GERA 1MG0A 3FN4A 2FPGA 4PG8A 3RAJA 1HE2A 4FS3A 1PJ4A 1XELA 1N1GA 3BTOA 2FY8A 3E03A 2I76A 2PLAA 1SO8A 4IXWA 3GVPA 1SB8A 4F6CA 1QORA 3LC1O 3CIFA 5BSGA 4NQZA 2O2SA 4F46A 2O3JA 4BVAA 3EUWA 1H6DA 3WB9A 3NX4A 3JCZA 4BNFA 3FWNA 3I83A 5ENDA 1KETA 4GLLA 1VM6A 4E6PA 1MGOA 3DBLB 1Y9AA 3PLNA 4CLXA 1PEDA 3HQ4O 5ES3A 1CYDA 1WDLA 3K31A 3ORFA 2E49A 1LQUA 2YDYA 3WNQA 1X0VA 3IP1A 4B8WA 2EERA 4WLNA 1EUDA 4LVUA 1GEEA 2YHUA 1C1DB 4PG6A 2OXIA 4NIMA 2I9PA 5GZ6A 2JAHA 1A7KA 4CUJA 3GY0A 4NBWA 1HE3A 4BNYA 3WBFA 3HFGA 3E82A 4EBFA 4UULA 2NTJA 5F1PA 1VJTA 5TLSA 2AG8A 4JBHA 3ANMA 3GLQA 3DBRA 1RWBA 4KDEA 4P4GA 4WLFA 2O2YA 1R15A 1D3AA 5TT0A 2VZ8A 2XXBA 3ZNOA 3H9EO 2JD1A 3OJFA 1HYGA 4MVJA 3GVXA 4Z9FA 4B8ZA 3KLMX 3H7AA 4PZDA 2GR9A 2O3SA 1NR7A 1TA4A 3NDRA 3ONFA 2ZIZA 4YAJA 3TWOA 3X2FA 2Y99A 3WMXA 1NPTO 2IEBA 4R1UA 2DAPA 1BXZA 2X4GA 4HP8A 3INGA 2NVUA 3JQBA 1CIVA 5C37A 3OJEA 4RLSA 1PS8A 1DC6A 1ULSA 2QX7A 5KJEA 3DBHB 3Q9NA 4QTZA 4XJTA 1GUFA 3TSCA 3GZ4A 4GWKA 3JQAA 1YL7A 3NRCA 3ADPA 3JSAA 4CM8B 3GPDG 1D1TA 1TT7A 2C07A 2A9FA 3PHHA 1N9GB 4K6CA 4XYGA 5JNLA 1P0CA 5COQA 3JQ9A 5JAMA 1YRLA 4QFDA 4EEZA 2OUIA 2CFCA 4G5HA 1LDYA 5IF3A 3F9IA 2DTXA 1F14A 3RU7A 3V1UA 1U5AA 4CMHA 2B0JA 4BGEA 1ZEJA 2BH9A 1DRWA 3RKUA 3EK2A 2Z95A 4UEKA 3ITDA 2YV2A 4A0SA 3JYOA 3PHLA 3R3SA 4A10A 3K9QO 4XYEA 5K9ZA 1ZK2A 1AXGA 1NFRA 2DUUA 3AI3A 1EFLA 4ZN6A 2D0IA 4B7UA 4I8XA 4C7JA 1O6ZA 4RJTA 4CQLA 5B4VA 2D59A 4E4YA 4DL9A 3RBXA 1CETA 3TZCA 1OOEA 4IGEA 4XYBA 1ADBA 3GFGA 1HKUA 1NVMB 2PKQP 3ONEA 3GEMA 5HS6A 1GZ6A 3DC2A 1E0DA 4LCJA 2Q49A 3GAFA 4L9RA 2BFPA 2Z1MA 4CMJA 4U6QA 3ITKA 2CUKA 1X1EA 5TIIA 4BGIA 4I5DA 1R12A 1MFZA 1BDMA 3KHUA 2OBYA 4I5EA 3AOEC 4DPMA 2QRKA 1C0KA 1ZXLA 4KWIA 4QSMA 1AHIA 1T1SA 1JDJA 2BFAA 1LC3A 1U5CA 4GQAA 3OICA 4HXYA 4IQ8A 3H6KA 2BGKA 4IXTA 4OJNA 2X58A 1HDRA 4UVGA 4WCFA 4XJSA 4OO3A 4FDAA 3LZ6A 2IZ0A 3ZWMA 1JAXA 2YYYA 1C0IA 4WJZA 5AYVA 2GUGA 2EKLA 2I6TA 4L75A 2CNBA 3S2EA 3I5MA 1NWHA 4ND2A 4CLEA 1LTHR 1I10A 1JU9A 4RVSA 4QUKA 1D4FA 2J3HA 1IHYA 4Y6PA 3RROA 4DC0A 4J9VA 5DF1A 1SC6A 1JVBA 1WNTA 3BHMA 4FC6A 1ID1A 1ZJYA 2EW8A 4FJ0A 3AU9A 3HE3A 4EDFA 2DLDA 2X0NA 2EGGA 1ADGA 1LBEA 2HMVA 4BMSA 5A06A 2C59A 4GVXA 5T67A 2GF2A 3QA9A 4NG5A 3E5RA 3ASVA 2P4QA 1VSVA 3W4JA 3TFOA 2Q4EA 1KC3A 4A2CA 4XA8A 3OIGA 3WWZA 4RO0A 4AFNA 3I6IA 1KEVA 5DN9A 4HNHA 3HB5X 1UP6A 1I24A 1C3VA 1H9AA 5TC4A 1SZJG 4FIZA 2AE2A 4M87A 1EBUA 2W4QA 2NADA 1JWAB 4IY1A 2B36A 4E32A 5A9SB 4CLOA 2BELA 1WDMA 3ZWVA 4RPHA 4XDZA 3UH1A 1E3SA 3B1FA 1KBZA 4JGBA 4I9NA 2HU2A 1QRRA 3VPGA 4MVJI 4E33A 1PQWA 2GZ2A 3JQEA 1N92A 1M76A 5C7OO 4Y6RA 4TRJA 1NAHA 4NDNE 4WE3A 5IDQA 1HE4A 1LRJA 5I8WA 2JFFA 3FR7A 2R00C 3HJAA 4XCVA 3TOZA 1HT0A 3FD8A 4RORA 3SJUA 4B3IA 1HLDA 2DPGA 3I9KA 2NWQA 2GNAA 3LVFO 4BNMA 3B1JA 4XQGA 3AOEA 4IPTA 1E5LA 3E9QA 3H5RA 3GNSA 2UUPA 3GA0A 5CDYA 3PZBA 4W9NC 2CD9A 5DCUA 4A5OA 1LA2A 4RLHA 4WOKA 1TXGA 4M8SA 2JFGA 1A7AA 1RJWA 5K6AA 4CR8A 5BR7A 4D46A 3OQ1A 3PIIA 5TRTA 2HMWA 2ZB7A 1X7GA 4G81A 5DZSA 3U4HA 2GSDA 5KVSA 5L9AA 3JQCA 1NFFA 4J4HA 2O4CA 2B69A 4TMFA 4TSKA 4P4NA 2V6GA 5A02A 4YAGA 3U62A 4GX2A 4R5MA 4KMSA 1KVQA 4IUYA 5EESA 3Q2IA 1JTVA 1OC2A 2VHYA 4XQCA 4RPGA 4YACA 3CMMA 3HWRA 4YJFA 1Z82A 4D41A 2BGMA 1RKXA 2X7HA 4MDHA 2C20A 4J1QA 4B4WA 1K89A 4PFJA 4Q9NA 2A92A 4UAGA 1J6UA 1KERA 2J8ZA 1KY5A 1N5DA 1OMOA 4BKQA 3O8QA 3GVCA 1W0CA 1YBAA 4ZD6A 4PCVA 3WSVA 3KSUA 1BGVA 3JD1A 5KKCA 3TL2A 1TT5A 4EUHA 4OMUA 2J3JA 3DZBA 4E5PA 5COBA 4XDYA 1HXHA 3DZIA 3SBOA 1U8XX 2QYTA 3RUHA 1PIWA 1Z74A 3SXPA 4BOYA 1EK5A 5DULA 4ALJA 4O5OA 5CEEA 5TF4A 4YDRA 1NWCA 1P1HA 3HHPA 4R1TA 4WUVA 5C7LO 4IBOA 5CDUA 4HBGA 2O23A 4M55A 1DLJA 1NVGA 3T7CA 3WICA 4M86A 3UCEA 1CJCA 2F00A 1UDCA 5ADHA 3V2GA 4PG7A 1WLYA 3UOGA 2JD2A 5CP8A 3I23A 3RIHA 2EP7A 4Q39A 4Y98A 3GN1A 4I5GA 5T57A 3AY3A 1L7EA 1BW9B 1MB4A 2G0TA 3VH3A 1VRWA 3DBVO 1I2BA 3GZNA 3WJAA 3QVSA 4QECA 1QKIA 3IKTA 3C85A 1MP0A 4JJGA 4BQRA 3P19A 4J0EA 4UEJA 3ZN2A 3BIOA 4RVHA 1NHWA 3MJ4A 3BYZA 5JMWA 3KB6A 3K8ZA 3TRIA 4DREA 1OFGA 2QQ5A 3EDMA 3HN7A 4NBTA 4OKNA 4J49A 3MOIA 1DHRA 1O94A 2QZ9A 2J5KA 4WKGA 4Q3BA 4DQVA 4HNGA 1LC0A 2Y1FA 4BNWA 4BQPA 1UAYA 2DFVA 1XA0A 2ZQZA 3JYPA 3NT2A 3R3JA 5FI3A 3WIEA 1V0JA 3MWEB 3U9LA 2HUNA 3DAFA 3VVCA 4U8GA 3VVBA 2E6UX 2BFOA 1YOVB 3AUUA 2PA3A 3DONA 4II2A 3WSWA 3PJGA 3AWDA 4QO7A 4PLTA 2VWQA 2X5JO 2NLOA 4OQYA 4JCOA 3F6YA 1QV6A 4CUKA 1NQTA 1RPNA 1DDOA 1QYWA 1MXFA 3RU9A 4CJXA 1Z7EA 4DIFA 4J9UE 5T8KC 2YW9A 3JQGB 3HDQA 4J4TA 1D1SA 1E7WA 1CDOA 1GUYA 4FFOA 4IDEA 3GQVA 4BNLA 4ZQEA 1RM5A 1PL6A 1VC2A 2LDBA 4OXNA 2CF5A 2R2GA 2V6BA 2IRWA 2E48A 4GVLA 3L9XA 5KIAA 2NQ8A 3U5TA 4A27A 3DBLA 4AG3A 4A03A 4ZVVA 4AJ4A 5DP2A 2Y1DA 3DOCA 3LDHA 4LSMA 4W99A 3IC5A 3DOJA 1ZNQO 4TRRA 1CQIA 1ZMTA 5T5QA 3S2IA 3WYEA 3GAZA 3K2BA 2JCXA 5ITWA 1PU2A 3V2UA 3W6UA 1XYGA 3AI1A 1ZK0A 1ORRA 2WTBA 3DZJA 4I9HA 5F5NA 5JAQA 2J3IA 2Y1EA 2O3TA 3VDRA 4BKUA 2EGHA 1SAYA 3VHRA 1HZJA 2HK7A 1O8CA 1VKNA 5THKA 2I3GA 4HFMA 4B4VA 3FCOA 3PYXA 2IZZA 4AJHA 2X5OA 4DYDA 5BSFA 2DUWA 1A72A 1Z7BA 5K1SA 5EL0A 3H8VA 4E5KA 5IZCC 1E77A 4GGPA 4CV2A 1HDCA 5G0UA 4ROSA 4B7XA 3PWSA 1KC1A 1B0AA 2WD7A 1ML3A 1E6UA 4OHUA 4RPLA 4YBZA 4LISA 1IOLA 1GFSA 4JXKA 1T24A 4NFSA 5DDIP 1I3KA 5KVQA 1Y1PA 2EXXA 3T7EA 4Z9YA 1SBYA 4F3YA 2X9GA 3A14A 3C1AA 4TZKA 1SEVA 1LEHA 2JJYA 1DXYA 2P5UA 3JQ6A 4K28A 3TZHA 3X2EA 4E2ZA 3KLPX 1PJ3A 1R4MB 4ZU3A 1ONOA 3NGXA 1UH5A 2WYUA 2H1SA 3EGOA 1N1EA 1LLCA 2EHDA 4DMLA 2RCYA 1GYRA 5IJZA 4O0LA 3PHIA 4JQCA 3RASA 1LSOA 4CM4B 1ISHA 1PZFA 1K0UA 4A26A 4XX0A 1BXGB 1YDWA 1ENPA 1G0NA 1N9GA 1T2FA 4CMBA 2QRLA 2VUUA 3KV3O 3N7UA 4FC7A 4JJFA 1L7DA 3JQFA 3RFVA 1DJQA 1VL8A 4KDFA 5T8KA 4OM8A 1D8AA 1HF3A 5IFLA 4LCEA 1I3MA 3I9JA 3ZCXA 5THQA 1Z6ZA 1E3WB 1SCUA 4NBRA 4R5HA 5FEUA 4QQRA 5JYEA 3V8BA 1ZZEA 2A4KA 1JKIA 1RM4A 2BI7A 3PK0A 4NJOA 4YCAA 3FPLA 1PTJA 3K2EA 1H2BA 3QVWA 2EEZA 2HQ1A 5LDHA 1GQYA 4DPKA 2FPPA 1PGNA 1BVUA 1WPQA 3AI2A 3IKVA 3VKUA 2EG9A 1LDBA 3DTTA 4ZRNA 1ZSNA 3G17A 2O3UA 4J90A 4DGSA 5BSHA 4CQMB 1E92A 1NQ5A 3O4RA 4MP8A 4CMGA 1I5RA 5ILOA 2NSDA 5H83A 1XQ1A 1S7CA 4S3MA 4YR9A 1HDXA 4D3FA 1WVGA 2Q1TA 5JW6A 2OP0A 3RJ5A 3H9QA 1VKOA 3NAQA 5U9CA 4GLOA 2EKQA 4FW8A 1V3UA 2VWHA 4M89A 4MVJG 2D4AA 3AK4A 3KYCB 3ROKA 5F5LA 4AJIA 3MTGA 4UUPA 4FB5A 4ILKA 4NU5A 4E0BA 3C3XA 4OQZA 5IZCA 4WPGA 4Y6SA 4YAKA 3KTDA 3NGLA 1H2HA 4ZHSA 1DFGA 3WDSA 5A03A 2ZQYA 5L51A 4F6LA 4BKOA 3NTOA 2C5EA 4XQEA 3KSZO 3VKVA 3P5SA 4IJKA 4J2OA 1R66A 2ILTA 2ZCUA 3HDHA 3NJ8A 4WNCA 1V35A 3B70A 2GGSA 1A71A 5LDGA 4A7PA 2AE1A 2E82A 4I1IA 1AN9A 5I7VA 4OL9A 4N18A 1P9LA 2CVQA 3S1LA 4ALLA 3L4SO 4AJKA 1UXGA 1ZCJA 5HS4A 4Z9XA 5JLAA 1B2LA 1H9BA 3NT4A 4ND1A 4N7RA 3CZRA 4D44A 4NH4A 3FBTA 4GX0A 4ZRMA 1EQ2A 4ZA2A 1H5QA 5KJ1A 5JC1A 4QEDA 4RF4A 5IN4A 1OAAA 4MIEA 1DLIA 3RC7A 5JS6A 5U1PA 4XEHA 4WOJA 3QVOA 1B8PA 1EFKA 4YRBA 1DIHA 3Q9UA 2VHZA 4JK3A 4BNIA 5LC1A 1W73A 5CFZA 5B4TA 3SC6A 2ZYAA 2XAAA 4L74A 1Q7GA 2Y1OA 1Y8RB 2Y66A 3UXYA 2WEKA 4E5YA 2EF1A 2Y93A 3PZRA 3GVIA 4QX6A 1U28A 3W4KA 2G17A 1H6CA 2JCVA 1ZUD1 2EW2A 3BMOB 4AL4A 1XHLA 9LDTA 4YA6A 3JQ9C 1IB6A 1HDZA 2GASA 3OEWA 3PWKA 3DZHA 4JJIA 3D3EA 4MPDA 4XRGA 3I52A 4MVJF 2VRBA 4IDDA 3JV7A 4KWHA 4DLBA 4GH5A 3LLSA 2VT3A 3C8MA 2DKNA 2VRCD 3ZWBA 3GEDA 1BTOA 1T2AA 3GHYA 2I65A 4CMIB 4R9SA 3QLJA 4PLHA 1WW8A 2HRBA 3M1AA 4J91A 3F4BA 2DU8A 3H3JA 2X9VA 3UF0A 4RZIA 1Z75A 4DYVA 4IS2A 4ESOA 5CHEA 4H3VA 4NK5A 4DRYA 1F0YA 4FCCA 1BRMA 4XB2A 2PKRA 2X6TA 3UAGA 4J16A 2OO5A 4HFRA 3PYMA 4MOWA 4NU6A 3EC7A 4D42A 5TX7A 1GCOA 4YJHA 4DIOA 1V9LA 4RL6A 4TVBA 1XWFA 4HADA 1ZW1A 4FFRA 4GL4A 4DXHA 3AJRA 3ABIA 3DFUA 5TJ9A 2RIRA 1ZKMA 2G5CA 4FJ1A 3ST7A 4ALKA 3DB2A 1KY4A 1WMAA 5EIOA 5I7FA 3DZGA 5TS3A 2VWPA 4WCFC 1KVTA 1QLJA 1UZLA 4RF2A 5TSDA 2X0RA 4EUFA 3QWHA 3AY6A 1T1RA 1MC4A 4PG4A 2CVOA 3SLGA 2C7VA 3QQPA 4H15A 1DIGA 4UVIA 4W82A 3PQEA 4NR0A 4L76A 3CINA 2CY0A 2GN8A 1DB3A 3CZMA 3NUGA 4I5FA 3ETDA 1JA9A 4EGFA 2Q99A 4PGFA 4HFJA 2VTDA 1J4AA 2GO1A 4NK4A 5GY7A 3RBVA 4KUHA 4E2YA 3D1LA 2NACA 2Q46A 5C7IO 3ZWYA 4P4LA 1XG5A 2O48X 3A06A 1EZ4A 1UUFA 2O50A 4BMNA 3UCFA 1Y8QB 3LT0A 3JD0A 4NNJA 3E1KA 5EQFA 4N54A 4BO6A 3OSUA 4MVJH 2AEMA 3E5MA 2P2SA 1CF2O 4X54A 5L40A 4YVFA 3ZDFA 1GZ4A 2AXQA 3H9JA 2VHXA 4YT5A 3W8FA 4E5NA 3NT5A 1IE3A 4PRLA 2QG4A 5CG2A 1DHTA 1LX6A 1IYZA 3WGQA 1E6WA 4RVDA 3VZQA 1W8DA 5L3ZA 4CM1A 3HFSA 2JKVA 4D43A 1PZGA 5BT9A 3LT4A 3F5QA 5EJ2A 4J7CA 3JQ8B 4CV1A 3M6IA 4FPXA 1X0XA 1ZK1A 4BHTA 4IGFA 3VH2A 1DFHA 1E7RA 2VRCA 1YJ8A 3WMWA 4CUZA 1U7TA 3BZUA 5KVVA 2QZZA 9LDBA 2PWZA 2W90A 3UGKA 4IS3A 3I4FA 3ETEA 1E1NA 3TF5A 4IDAA 3RUIA 4UREA 1DIBA 1VJ1A 1BWSA 1V3VA 4OH1A 4EITA 4BO2A 2NU7A 5J23A 4DUPA 4IQGA 4E13A 4OAQA 3MEQA 3MJSA 2I66A 5ER6A 1LLQA 1XR3A 4Y8VA 3P2YA 1AUPA 3KZVA 2VHWA 4O6VA 3W4IA 3OETA 4MP6A 4H7PA 4Q3AA 5BSEA 1G0OA 3LC2O 1FDVA 1K6JA 3PJFA 1YOVA 1ONPA 3AUSA 5JXWA 3ZWOA 1KOLA 5K6AC 3BTVA 1WP4A 1WAMA 1SB9A 1YVEI 3FSRA 1VL6A 1UP4A 4FR5A 3O03A 4NZ9A 1PGJA 2GLXA 2AG5A 1E6EA 2Y05A 5KOIA 3ZHZA 4UVDA 3OA0A 1MG5A 1C0PA 1ENOA 4DTIA 4CMAA 3CPSA 3JQGA 1AGNA 2X23A 3LF1A 1E3JA 3ZNNA 2DFDA 4FQ8A 1YL5A 3GC6A 3GGOA 1CERA 3I1JA 1LRLA 2UVDA 2B83A 3PEFA 3GDOA 3WGIA 3D7LA 1DIRA 3WGZA 4RF5A 3NTRA 2Q2QA 4YAIA 1E7YA 3PQFA 3G1UA 4XRRA 4D3DA 4I9UA 1C1XA 4J7XA 3I9MA 4FOSA 1M6HA 2NNLD 4ZQGA 1VL0A 2IDZA 2FHSA 3AUAA 5G4KA 1QYCA 3QE3A 5EINA 1GAEO 4HY3A 3BMCB 5B37A 4WCDA 3PHGA 3ZNQA 4YWJA 1PJQA 2ZTVA 4JP3A 1RYDA 1MA0A 3E6AA 1LDGA 3E9MA 1GCUA 3PWZA 1ZBQA 2BHLA 1MLDA 4IZHA 3AM5A 4FBGA 2HJRA 4GPD1 1E1KA 4JLWA 1OI7A 1CRWG 3A28A 3VTZA 1OZAA 5HTOA 4TKLA 4YB8A 2IXBA 3L77A 4DPLA 3UICA 5A9RA 2FZWA 2DBRA 1P1KA 5DBGA 3KO8A 2QHXA 4BB6A 2YV3A 2CDCA 3DMYA 3WFJA 1Q0HA 2HLPA 2HDHA 1F12A 5T6BA 4YXFA 3U3XA 2B37A 1ISGA 4H16A 4D45A 1T2EA 1U7HA 4BMVA 3PGXA 4XQ9A 1Q2XA 3WWYA 4XD2A 3IP3A 2AQIA 5AVOA 1B8UA 3OHSX 2HMUA 4D3SA 4MP3A 2W2KA 3CKYA 4CLHA 1LUAA 5KJ6A 3QIVA 1PWZA 1R4MA 1ZO8A 1P31A 4HWKA 1QSGA 5ICMA 2UAGA 3LT2A 4JX8A 1PR9A 2BFMA 4RQTA 1PJLA 1S6YA 5I8ZA 3O9ZA 3GMSA 1P1RA 4CM4A 4FFPA 4CLRA 5L4SA 1BXGA 1DJNA 1TLTA 3CSDA 2C82A 4OSOA 3WOHA 2D5AA 1FF9A 4BNUA 3TZQA 5JCXA 2WJPA 1LI4A 2WYVA 3COSA 1GV1A 3GN2A 1KIFA 2X0JA 5HBRA 1GR0A 4BO9A 4FGWA 3WLEA 3WGYA 5BNTA 4IDCA 4NJMB 3ZV3A 4PN3A 2VTEA 3DBRB 4EJ0A 2ZB3A 3ZH2A 4RV9A 3ZNPA 3KETA 5TNXA 1WWKA 4NI5A 1KYQA 1ISFA 2YHIA 4OXYA 1K6XA 1ZJZA 4WLEA 2NM0A 2FPIA 3WTCA 4ITUA 4YPOA 1A4IA 1NPDA 3DZFA 2Z5LA 3KRTA 3WNVA 1DRUA 1IPEA 3IAHA 4CM3A 1IPFA 1J5PA 2Q1SA 1DBVO 2NQTA 2AW5A 2WD8A 3GPIA 4IIVA 3G49A 5CPBA 1L1FA 4GKVA 2FR1A 2C54A 3F47A 3IS3A 2GRAA 5JPIA 1R0KA 4BNXA 2WE8A 1J0XO 3LK7A 5JAZA 2EJVA 4TQGA 1UZMA 3WGHA 3WX0A 2DM6A 3JQ7B 5EN4A 4PVCA 1U3UA 1EVYA 3N74A 1U2GA 4Y67A 1KS9A 1X7HA 1YDEA 1HDYA 1QG6A 3SX2A 5KVCA 4PLWA 1A4UA 4CL3A 2EKPA 1EE2A 1XQ6A 1H94A 2PGLA 3JQAB 3PQDA 3R1IA 1LXCA 3KYBA 2Y0EA 1HYHA 2AQ8A 4MINA 2HJSA 4DQXA 2AEJA 2CZCA 3VAZA 1BMDA 2IE0A 3E8XA 2I67A 1ENYA 1GDHA 1E7SA 3BHJA 3HUDA 2NU8A 2HKIA 4QO8A 3T4EA 2GYYA 3BMQA 3RC1A 1PQUA 3CTMA 4MKRA 4CL8A 3GH3A 1EMDA 1HRDA 1K3TA 3LYLA 3DZKA 4UUMA 4J1NA 2VUSA 2YFQA 2NU6A 3WGTA 3DAPA 1Z45A 3V1TC 1UJMA 2AMFA 2VYND 2CF6A 1ZMOA 3PJDA 3VPFA 3WR5A 1BXKA 3VPHA 1EE9A 3U4IA 1ZSVA 4RGBA 4TWRA 4U5QA 4CQLB 1XEAA 1PL8A 2AQHA 5AXDA 3VZSA 2AQKA 4R41A 3RCBA 1O5IA 1Y8RA 2G82A 3DEYX 1GU7A 3S55A 2R6JA 1LRKA 1HETA 2YZ7A 4ZGWA 1DC4A 3OJ0A 3RVDA 3FR8A 4UUOA 3RD5A 3ROQA 1I33A 1YWGO 1DAOA 3DR3A 3BMOA 1M6WA 1ZSYA 1ONNA 3JQFC 8ADHA 3GK3A 2RBEA 3L07A 1QYDA 4D0SA 5KTKA 4CM7A 4LGVA 1Z73A 4L4SA 4OKIA 3KXDA 4PLYA 3ENNA 1DOHA 1BHSA 5DNAA 4CM6A 1YH3A 2NUAA 2H63A 1LQTA 4ONEA 1CWUA 1X15A 3IOYA 1PGOA 3K92A 3GNQA 4NBVA 2OBNA 3F5SA 5TT1A 3SVTA 3WQQA 1PGPA 3I9LA 4WNIA 2Q2VA 3F1KA 1PJBA 3M2TA 4IQ0A 1N8KA 2P4HX 2OZPA 3QWIA 1C1DA 5C5IA 5JSFA 2D3TA 1M66A 1A27A 3QJ5A 3G3EA 2YUTA 1E1MA 4BNKA 3ZWPA 4AJ2A 4NHEA 3EZLA 5ILGA 4R01A 4WK6A 2NVWA 3ZW9A 2P68A 3FTNA 8LDHA 3OEYA 5L4NA 1M75A 2PKQO 3MJTA 4J3FA 4RVFA 1NXQA 3OQ6A 3IJPA 2ZTMA 1F8GA 1VPDA 2A35A 3QSGA 4BKRA 3AFNA 4WEQA 1ZFNA 3O26A 1MFPA 3PRJA 3SJ7A 1ZH8A 4BGVA 4F45A 5B1YA 3DHNA 3VC7A 4QT0A 1U8FO 3KOUA 4CM9D 4FGSA 4CLOB 5BNIA 3VPSA 4PLCA 1UDBA 1SPXA 4FFNA 3W8EA 5TJHA 1YS4A 5JC8A 1EDOA 1C14A 3QY9A 2XXJA 2FRDA 3ICCA 3DHYA 3QWFA 4GWGA 1FK8A 3OIFA 1W6UA 3DBHA 4JNKA 3PLRA 3GF4A 3EHEA 5GZ3A 5A3JA 3KEQA 3CEAA 3OA2A 5CPFA 1BG6A 4ZJUA 2VYNA 3NDIA 4CM8A 2HRZA 1B14A 3NYWA 4R1NA 4BNHA 4HFNA 3WGOA 1EUCA 1HTBA 3PFWO 1E3EA 2OMEA 1BVRA 1JQBA 4DC1A 2O3RA 1K5HA 2CSUA 2RHRA 2UDPA 2VNAA 2GCGA 3B6ZA 1HLPA 4RCVA 4ALIA 3C24A 2C0CA 3FNFA 2QW8A 4IJWA 4N5MA 1TEHA 3FWZA 5MDHA 4MVJM 2BMAA 1KEUA 1JN0A 4BNNA 1PJTA 4J6FA 3U09A 3GDGA 1LSSA 1P1JA 4G2NA 2UV8A 1AXEA 1KEPA 3Q3CA 1D7OA 2GN9A 1VJ0A 1R4NB 4DBZA 2VZ0A 5K0ZA 2FR0A 5JFOA 2C29D 3D64A 1DIAA 1YJQA 2Q1WA 3ON5A 4YJDA 3AM3A 4BUCA 2WMDA 2X1HA 1NHGA 5JCJD 1T26A 4AJNA 1GPJA 5F21A 1NBOA 1QXSA 5F1KA 4BKPA 4RPJA 2O3QA 3C1TA 2DPHA 1A9ZA 1UXHA 4OIMA 4R3WA 4YJFB 3I3OA 3ROPA 1AHHA 3ZV4A 3MWDB 4R51A 4CMCA 3TFQA 1IY8A 2P9CA 3QVXA 3H5AA 1NQAO 4GMFA 3WG9A 4IM7A 1EVZA 3BMNB 3DWFA 2IYPA 4BO3A 2LDXA 4E21A 3ANNA 2Q50A 1QYVA 1TI7A 1FDWA 1UXJA 4OSPA 3LSYA 5I9NA 3JYLA 1KVRA 4RPKA 4K1LA 1VE9A 2B4RO 3PPIA 1HSZA 3K96A 3ZU2A 3MZ0A 3L6EA 4QXMA 5JMPA 2FWMX 4GX1A 4J4BA 1YXMA 2H9IA 1PR3A 3QVTA 1W4ZA 1NYTA 1E3IA 4BNVA 1R0SA 5G0VA 4RZHA 3W6ZA 4IJUA 1XSEA 5JDIC 2BRUA 2GN6A 4BO8A 1I8TA 3L4BC 3C1OA 3AUTA 3TZ6A 1YGYA 4L4XA 4BO1A 3ZWNA 2VT2A 1P1FA 2Y0CA 1F8FA 2OORA 3ZWWA 4U7WA 3LF2A 4R69A 3GUCA 1UZNA 1AE1A 4RDHA 3RUEA 3PIDA 3JD3A 4CM9A 1ZVMA 2FZEA 5HA5A 3ETGA 3WQSB 3BXXA 1WZIA 1T4BA 2GD1O 4JBIA 4J43A 1ARZA 4LSWA 2VQ3A 4BNGA 1H0KA 1MV8A 4JP2A 3JD2A 5JYDA 5JY6A 1HYEA 1PX0A 1HEUA 1DO8A 3ZV6A 2A94A 2PD3A 3IJRA 3KEOA 3D5QA 4ND4A 4P8RA 1IZ0A 2IODA 1SOWA 4N5NA 1MXHA 2ZTLA 4WASA 5TGDA 3BMCA 3D3WB 3TPCA 1LDNA 1FMCA 5KNLA 3ROMA 1B3BA 4YQYA 3DXFA 4DWVA 3EVNA 1EVJA 3NJ4A 3QRWA 3U49A 1GTMA 5A9SA 1YQGA 4LVCA 4RVGA 3GEGA 3D4PA 4YJGB 2SCUA 3DMTC 4YEDA 2D5CA 3V2HA 2YQ4A 3TN7A 1OC4A 2PK3A 4YQZA 2W8ZA 3I9NA 3C7CB 5JO9A 1U9JA 4PIVA 4U6SA 2W98A 2AEFA 2Y68A 2VHVA 1XU7A 3VZRA 2JCYA 3RFXA 4CPDA 3PI7A 2VZ9A 1P44A 3TZKA 3DO5A 2BD0A 4YT8A 1Y5MA 4LRTB 3GDFA 2GDZA 3QW2A 1HL3A 3K6JA 3JTMA 1V8BA 3N58A 4BNJA 3K5PA 1SEPA 5KKAA 1NPYA 3DDNA 3BTUA 3ZHYA 4B3HA 4GX5A 1XKQA 4U0KA 5AOVA 5JCJA 1UR5A 1Y6JA 2W2LD 3EYWA 5G0SA 1Y9EA 5JO0A 2GPTA 1ZK3A 1DRVA 1QR6A 3ZGYA 4DQUA 3P7MA 4MJLA 2Y1CA 2B35A 1B16A 4YT4A 1LJ8A 4GKBA 5KJFA 1YQXA 4WECA 3UHAA 4U0JA 4Q3NA 1GQQA 4M49A 3HG7A 1NFQA 4IZIA 4YTEA 3TNLA 3OECA 1QLHA 5JDIA 1O95A 1PWXA 3EMKA 3WIDA 4AJJA 1J49A 3L4BA 3JYQA 2C2XA 5CEJA 4PLPA 1B8VA 4P38A 3G1TA 1HWYA 1P74A 2GZ3A 5G0WA 4PLGA 4XYLA 2OGUA 4UUNA 3JYNA 1LLDA 4PVDA 3U0BA 5KJCA 1P3DA 1Q0LA 4NJMA 2PR2A 3L6OO 3GUYA 3ZWXA 1HDGO 5I9MA 3G79A 2ZTUA 1JKJA 4GMGA 4MVJE 3U4DA 4XZ3A 5L95A 5EERA 2QYSA 5L7WA 3KVOA 2JAPA 3TOXA 3ULKA 4XIYA 1ZK4A 1XIVA 4R3NA 3S2GA 3IIEA 4FOOA 1U2DA 2RHCA 1DFIA 1NP3A 4HUJA 4J0FA 5IDWA 4FFMA 1LSUA 4AJPA 3D4OA 3PJEA 5TQVA 1WXDA 5DBIA 4RDIA 3EVTA 3DQPA 2WD7B 5L53A 4W4TA 2RH4A 1XDWA 1XGKA 2X8LA 1R0LA 2VCYA 2HO5A 1F06A 3DMTA 1G6KA 4I08A 3D0OA 3H9UA 3KBOA 1PJ2A 3JQ7A 4FJ2A 1FDSA 3QV1A 1ADCA 2BLLA 2J5QA 2OP1A 3LU1A 3OJLA 4J7UA 3RUCA 3OH8A 4E31A 5C3MA 3MJCA 1EK6A 2PZJA 2PY6A 2HMTA 4HX5A 4Z3KA 5CDSA 4GI2A 3ZHXA 4BGUA 4XB1A 4YAEA 4AJEA 1GADO 2I99A 2B4QA 5I7SA 2PTGA 3UCXA 2EWMA 2E37A 3M2PA 1E7MA 3HDJA 3WXBA 3FF4A 3PGJA 2EIHA 1I30A 1IZ9A 3AM4A 3KYDB 3ZI0A 1O9BA 4WGGA 2DTEA 2NTVA 1BW9A 2UUOA 4W7IA 4L4RA 1K2WA 3TL3A 5IDYA 4ND3A 2ZATA 2J3KA 3GMDA 4MKXA 5A04A 1GD1O 4KZPA 1KEWA 3RC2A 1VI2A 1ZXBA 1DC3A 2EJWA 2JHFA 2VYVD 3ZWAA 3EZYA 3K73O 5CAEA 1DC5A 5FI5A 1U3VA
chains in the Genus database with same CATH superfamily
5KVAA 2ZSIA 3QEKA 4CIYA 3ZKAA 4GXNA 1Y1TA 5JSUA 2CDBA 3VYRB 1VG9B 5KS2A 1KO5A 1ICEA 3KUXA 3RNOA 3DD1A 2DGDA 1KZ6A 2C2GA 1SWWA 2FSIA 3B48A 3T1QA 2W2LA 5B4UA 2OT3B 2SKEA 5AK6A 2FWRA 3WLLA 2J0SA 4JUFA 2R62A 4LTNA 1I5EA 1RHJA 3GYBA 5C34B 3V8VA 1EBFA 3ZQKA 3GLGA 5J2TA 4QBIA 3I42A 3GOHA 3P9QA 4TRMA 1V5FA 1HEYA 4D92A 1QC5A 5AW4A 4BYMA 4C7KA 5AKHA 2IJGX 1JWBB 1TIPA 3GLRA 1VJ5A 2GFHA 1L5WA 2WE7A 1GL3A 4FZ3A 3QXCA 1PBNA 1IWBB 1T6YA 1I2DA 5DT9A 2ZJ0A 1ZEMA 1ISMA 3UUWA 2QM3A 4EGCB 4LHVA 3FVRA 3F7MA 1RWVA 2R7NA 1DBPA 2WAAA 2WM2A 1LPMA 3LHFA 4M1ZA 4MJ3A 2IPAB 3HCWA 5FQNA 1MT0A 4CQMD 1UDAA 2OHOA 4QDTA 1ADFA 1NI5A 2IOFK 4R4JA 1ODFA 5AXAA 1JEAA 2RGBA 2WM9B 3CF2A 4NG4A 4MWBA 4JB2A 3RHZA 2J6IA 3ZBQA 1VKJA 1CY2A 2ZSHA 3L9WA 4K9NA 4MS3B 4ZEXA 1T5BA 3NVMB 3EQ9A 5SY4A 1YHZA 4X1KB 5HW0A 5G4LA 3NOVA 4A73A 1BJTA 2ISSD 3T95A 2ZBPA 2O2IA 1UP7A 4F3CA 1TJ3A 1DX6A 1D5WA 1E8MA 3FMVA 3LNTA 3OF5A 4Q01A 3AP1A 1CVLA 5B30A 2IWHA 1F5SA 3IDAA 4LDZA 3A6EA 4X8HA 2CL6X 1N6LA 1EAYA 4U2KA 1SHUX 4BO7A 4FFDA 1ZJ6A 2JL1A 4B79A 1TVMA 1W87A 2G67A 1IZ7A 3CJQA 2OD7A 3FE2A 4MEBA 4TYMA 4V39A 2C4HA 1KZ7B 3H5NA 3VFDA 4KQCA 4QEKA 5KU7A 2V1UA 2CNWD 4ICIA 5JWRA 2DPXA 1T9CA 1DUVG 2ZSDA 4LW8A 5IXYA 1R0RE 3WYDA 3RBZA 1E4OA 4L5IA 1U6KA 1RLOA 1XMVA 1KQNA 3HNRA 4F3RA 3CJTA 5AM2A 2FOIA 3LG2A 3PE3A 2C2MA 3L46A 4D0NA 1NVXQ 2QK4A 2CMDA 5A7FA 6LDHA 5ICSA 3JAWB 1H0SA 2CCKA 4PTZA 5AWFC 5EMHA 2J1LA 5LOVB 4JUAA 4YAWA 2ORIA 4NV0A 3WL3A 2BE7A 3N5CA 1XDZA 4O02B 4PHCA 2YJGA 4UHJA 3TLCA 1M2GA 2EQAA 4JV5B 1SCJA 1OIWA 4B4OA 4YX9A 5GTDA 3H2SA 3H5TA 3JVIA 5F3RA 3GDWA 3DMRA 4TUYF 5A3RA 1TUBA 4YMVA 1NIJA 3H2KA 5CDTA 3H2YA 1W36D 5JBNA 1Q14A 4RSHA 2HA5A 3UMBA 1OKKD 1F8YA 2ZI6A 1Q17A 1B7GO 4HUQB 3TO5A 2VHEA 4X95A 1JR6A 2VYVA 2DC1A 2ZKLA 3D9QX 5CXSA 3F4KA 1V48A 1VGQA 2EZ4A 1GPH1 2P9GA 3V97A 2H2HA 1KDOA 2H92A 2M6SA 4M6WB 4N0EA 3WYCA 5C46F 1E0SA 3L1JA 3CS3A 1BX3A 1L4NA 3EEQA 1OAOC 3W8NA 1UBJS 4W9RA 4E94A 5KCZA 2ZB8A 1XHEA 1C3XA 1Z4PX 3ZWCA 3LXRA 4E03A 1ZJ4A 1U8UA 4FSHA 1Y4AE 4TYYA 1X7WB 3DEJA 2ZT6A 2GAOA 5F2OA 2XF8A 2WU1A 5ARDA 2FN7A 2QMZA 1KPHA 1P7WA 2RHTA 5HYVA 2O8BA 2X7JA 2IW1A 4L73A 1JDBB 4FKZA 3P9XA 5EFZA 2G8LA 1PZMA 3TMAA 1E3WA 2WYOA 3ONVA 1E61A 2ARKA 1E2EA 2X22A 1CZKA 4NE2A 4D8VA 3FBWA 3A9SA 1VXRA 3HB4X 4R6XA 5G2OA 2VCEA 4UAJA 1JAZA 3WK6A 1QHNA 1SHTX 3FUTA 2QM0A 3OBBA 4KIFA 3W9BA 1P9RA 4R16A 3G89A 1KY3A 4EKGA 1A9YA 2J0EA 3L0PA 4EZBA 4N7BA 2J3LA 1IBSA 5TQ2B 6ADHA 5IG2A 1JWLA 1N7HA 2IXAA 3NONA 1E5DA 1RJGA 1FDOA 3A1SA 5DGHA 5JMTA 1VBFA 1OFHA 4DS3A 3LA6A 4TKUA 4UCFA 3VR6A 3GP8A 5KX5B 1YS2X 1DDIA 1L5RA 1IJBA 4TTPA 4NENA 1FOEB 2PD6A 1VTKA 3A6HA 4GPAA 1MX3A 3I9FA 4D9NA 3WQRA 4E5MA 4TM8A 4OOEA 2V7WA 3KJFA 1QVVA 2GEUA 1FFAA 1WKCA 3Q1LA 4AJLA 3ZHTA 3GUUA 2WG0A 5K2OA 5BWBA 4AF8A 4DCNA 2PXAA 3AIKA 1FJ2A 2GYVA 1XZGA 3B6EA 3LPDA 3N5KA 1WW2A 4I19A 1V4VA 4J6EA 2D8AA 2YNMA 2WIGA 1RNLA 1NR1A 1V1MB 2GH1A 1ZIDA 4FM9A 3NH9A 4Y0AA 2WJVA 3KYCA 3LQKA 3MXTA 3TMYA 5JHGB 2ONCA 4QNMA 5GV7A 2QMHA 2PZMA 1T8SA 5EVJA 1Y4SA 1RVDA 3AR5A 3NKLA 3P52A 4FZVA 4GGOA 3ZZNA 1RDFA 5ALKA 3HADA 1VA5A 4AUEA 3U3DA 5IM5A 1BU8A 4R3UC 3DULA 1H0RA 3DMPA 7MHTA 2OCYC 3G5MA 2FZCA 1WZEA 3D8TA 1D2AA 4YCDA 3PS9A 2OBBA 2BFWA 3SR4A 4C4SA 2C2HA 3IPAA 2C8LA 2DBZA 1U2SA 1I36A 4GU5A 1IM2A 3Q72A 2IZ7A 2P35A 1GRVA 4BVLA 1FA9A 3FI9A 4CEHB 1F2TB 3ZE2B 1Z9BA 4BWVA 2LCFA 4EW6A 13PKA 2OGSA 1X74A 1Q0QA 4MKIA 4X00A 3WYBA 3R7WB 3EXFB 5I7EA 1E1LA 4XASA 4KQXA 2IEDA 3Q7QA 3Q8WA 4I8IA 3KSBC 1PLKA 1SIWA 4BCDA 2J6HA 2PUFA 4OHRA 3BD6A 3SZRA 2DBVO 3T5MA 2F1KA 2RJOA 1DBRA 2E4XA 5K3EA 1RKBA 4HO1X 2VPWA 1FS5A 2R4QA 1OAOA 3CZ9A 4R1SA 1VJRA 1TOAA 5E2IA 1IULA 5C9ZA 4FHZA 4P0PB 2CD7A 1KHTA 5BSUA 3BJMA 4IMRA 2RAFA 4JUIA 1BCRA 2YX1A 4HC4A 4IDGA 1SVNA 5JQWA 2F2TA 1TCBA 2CXTA 1HK7A 4O2AA 1WXFA 3MJVA 2XDWA 1RXSA 1HQKA 4KOAA 1I7SB 1UKEA 1YBMA 3IHTA 4MS1A 1Q6YA 1Z4QA 5BP7A 5AKEA 5LCXA 4FCWA 3BREA 5LLDA 2BZGA 5JSYA 1JEOA 3OJWA 1P0FA 2ZIXB 3A6JA 1U6IA 3OKAA 4FCVA 2NP7A 4FFLA 2E21A 4DCGA 1RQLA 1XJ5A 1V6AA 4C20A 1BROA 2BJVA 2PGOA 2WWWA 2FSVA 4IFIA 2J3DA 4DJTA 1PWEA 2JIPA 2ZJZA 4M1QA 1Z25A 3BXEA 5IT9A 1J8QA 4IDFA 3H1TA 4QOGA 3DOOA 4QXPA 2REQB 3KR0A 3D0QA 4KWTA 3B3AA 4N7MA 3K05A 2EIXA 1OTHA 4NBUA 3ZU5A 4PLVA 5CJPA 2DTDA 2WF5A 4OYRA 3I6BA 4IDBA 1Z2OX 3CZ4A 3FUXA 1GUZA 2GNPA 4WD3A 5JH7B 2Q0HA 5K3SA 3RARA 1TYDE 5IMSA 2HQOA 1EFRA 1EGHA 1SC9A 3HZOA 1ZHHA 4NE9A 4P53A 5HKKD 5FR2A 1A7JA 2W6QA 2XVZA 1PZHA 3WYAA 5KQMA 4MW7A 1NMZA 2FF5A 2RARA 2AHRA 4Q37A 2JGAA 4ZALA 5FFFA 1CEEA 4CG3A 3PHCA 1YR7A 2ETXA 3OBIA 4UMFA 3SC4A 4ZCTA 4W5WA 1RE1A 2XQVA 3CIOA 5FBHA 3ZTYA 1TQ8A 2CLHB 3Q0EA 3QF7A 4EZIA 1LJLA 3U7GA 1JXMA 3AUXA 2ATEA 4RVUA 2GTPA 3X43A 4UVEA 4QU5A 5H9WA 5HF8A 3OFSA 1TEZA 4FD3A 4PBSA 3ISVA 3Q8XB 1Z4JA 3KR2A 1CU1A 3C3YA 3F96A 2A5JA 4B2PA 5J2UF 4WVFA 3E22B 2R5FA 3PFHA 2ZI9A 3AUJB 5JAOA 3LY8A 3G2QA 1WJGA 2QM7A 4ZVUA 4CKCA 5FOXA 3N76A 2XZTA 4QREA 1CPYA 3ADCA 2QXUA 4KQ2A 1VRVA 3L8ZA 4G25A 1KOGA 1C1XB 4MJXA 3R0IA 5BWOA 1M34E 2H1CA 4UU0A 1UC8A 4YUXA 3AEKA 1JH8A 1SVMA 3DOIA 1FUEA 4WGFA 1U1IA 3WWCA 2IYOA 3GGPA 2VAPA 1R16A 1GYQA 1RABA 3B20A 3DMNA 3FTFA 2Q3DA 1M1NA 1XZLA 3LQFA 3O4JA 4HMOA 2C61A 1J0DA 4PNZA 4RK0A 2PZFA 3JR7A 2V6MA 4K46A 2NO5A 4KPUA 2Q5HA 3A4VA 4RETA 1A9OA 1B26A 3HJBA 1TVEA 3CUUA 1NQUA 2FUG1 2GA8A 3OIDA 1V11A 1JSZA 5LQMA 1BD3A 1N2SA 1H6BA 3ZU4A 1Y7TA 3L7MA 2PMFA 3SZ3A 2JGKA 3LNCA 4I50A 2YJ5A 5I5GA 1VE3A 1NG9A 4YLYA 4V3CA 4M0LA 2EJCA 4QA9A 1NQOA 1FNDA 1TGYA 3V34A 3R74A 3P2OA 3IDSA 5JNUA 4N65A 4UUBA 2FFJA 2CXRA 2G8NA 4KLRA 1C9NA 1GPLA 2BKVA 2JFHA 5IC5A 1DQZA 2IOQA 4IH1A 1QBKC 4RQBA 3IQDB 4ER0A 1ZR2A 4AC9A 5ICGA 2ROQA 1P72A 1MAUA 4HNAA 4MIKA 3UGTA 3TW6A 4BIIA 4D2IA 5JY6A 4H35A 5KTNA 5L7TA 2H5LA 3IMFA 2GWHA 1ODIA 2JAUA 4KYUA 5A2GA 4P3OA 1JUDA 5JS7A 1I1QB 3V3TA 1S3GA 1T3ZA 3KDAA 3KU1A 4RHEA 4B4DA 4K7JA 2O9JA 1JKFA 3ZHVA 3V9PA 1DRKA 1OU4A 1U0FA 1VYHA 3F71A 4BP1A 2WQ6A 1SMKA 3ZE1B 1AHNA 2QNRA 1Q84A 2YFHA 4B34A 121PA 4OJTA 4IAOA 3C6QA 1N0IA 3COVA 4Q4JA 2DKOA 5AHRA 3V4PB 1WY7A 3LX6A 4IEEA 4W9MC 3UUGA 2X3UA 2XKKA 1INLA 3TB6A 2JFZA 2V6FA 2PQ6A 2Q4BA 2HQSA 2IXEA 2AFVA 2XIJA 3GBVA 2EFGA 4G1BA 1L4BA 3ZXUB 4C4ZA 4CLRB 2XADA 3ZHBA 3OEEA 3TQQA 2P62A 2EZ9A 2VJNA 3ZGXA 1YR8A 2IUEA 3B6MA 3ESBA 3ZW8A 3KYDA 4CF3A 2ZRLA 5JISA 3DLIA 5KYWB 2I6SA 1GPKA 3UW3A 4YYZA 5I5EA 3EC2A 1VXOA 3D4NA 2O52A 2D2FA 3D2BA 4OP2A 2I4MA 2NTEA 2PFGA 3LBIA 4PCAA 2N1BA 1JEDA 4P0TA 2PH5A 3BTSA 3WLFA 5AHWA 1NAIA 3TRKA 3MBOA 3N0VA 2AZDA 2DXIA 2YFKA 3LGSA 1GNSA 3DMHA 3FPHA 3IDQA 4K8OA 2JZOA 4URFA 2VDVE 3L7LA 1KZHA 2FWPA 1V3TA 1OFTA 4XUGB 1EFVA 1F60A 4MMYB 1BGWA 5KOHB 3W5BA 2GM9A 2HF7A 2F3SA 1H5UA 3ISJA 1BWRA 1CUDA 3RUAA 2G9ZA 3EWIA 1G21B 3S8MA 1IONA 2PNFA 1U0OC 3O8QB 1GG9A 1HBJA 4QGBA 4QJIA 1V16A 1NVBA 1Z5OA 2ZB4A 3A4TA 1USKA 4P1ZA 4EW1A 2ANCA 3E15A 2WJIA 4Z0HO 2BEKA 2VP2A 3A9UA 4D9MA 1P1CA 3FUUA 1JX6A 3QLTA 1ZI9A 3NM4A 4O08A 4RFVA 3WGLA 2WV9A 4Y9SA 5KYXA 1OHHD 2K7FA 2HZ7A 2QUHA 1LJUA 3V5NA 4KDRA 1YO6A 1EEHA 1N3YA 3KEGA 2XZDA 1LLUA 3EJ6A 3KUKA 3R20A 4GD3Q 3QLEA 4PBTA 4PX3A 4RNCA 5E1DA 3TR0A 2PD4A 4DUGA 3WHIA 2R48A 5CFQA 5DNCA 5GJBA 1FNBA 1Z6GA 2WSBA 3WLHA 4DVJA 1LVHA 4LNHA 5IXJA 4PIPA 3PDJA 1ORTA 3GELA 7MDHA 3J81A 3OQIB 2OV4A 2PSFA 1VL1A 3VO9A 3U6BA 4Z4EA 2ES4A 5GVSA 4GHWA 4N0DA 1HA3A 3SF0A 1B00A 4Y6OA 4RVOA 4BVEA 4ER6A 1CJSA 1PL7A 2P91A 1UXOA 2WFMA 3OE4A 3LCRA 3JQPA 1TC2A 2C2YA 1GZSA 3GRKA 1E0AA 1A2QA 3L6DA 1EESA 4ARSA 2JJMA 3QMPA 1GCIA 1KVUA 3WL8A 4JT9A 1BX0A 3CV3A 5JV5A 1I2CA 2Z57A 1MC5A 2A7QA 4I36A 1X8KA 4DLAA 5BOSA 1Q7BA 5CR9A 1J2RA 1KEEA 1QK4A 1YONA 1HM5A 1U9YA 4R81A 2ZBFA 3G85A 4GLJA 1QAQA 4D6XA 2ZSFA 3BMQB 2C4NA 3RYFA 5IANA 5L45A 1WDKA 1H6AA 3S2FA 4INAA 2D6FA 1PS9A 1S9HA 3HJRA 4CHGA 3WWDA 1O97C 3F6SA 3CXRA 4AECA 2BFCB 5A1TA 4CIDA 5B12A 4TZTA 3NIDB 3DHEA 2J33A 1KK0A 4FGLA 2JD0A 1RZ3A 2C5AA 4WN3A 3RKRA 3T1NA 5MHTA 1TEVA 3N0XA 2JVKA 1HE8B 3PKJA 2WFZA 5H4HA 4XI9A 1H1LA 3T94A 3DL0A 4IRMA 3MTJA 2YDXA 5GINE 1UDRA 1GN9A 1OASA 4PZPA 4B85A 4CN9A 3E18A 2XGMA 2G1UA 3DEKA 4EYEA 1H3FA 3I9OA 2MU1A 1ND5A 1NU6A 3BA1A 2QRJA 4KACA 2GEKA 5C18A 5DSTA 2WAMA 2XIQA 2GERA 2O8CA 5DEOA 3BB3A 4RTSA 2I9KA 3I32A 4Y6LA 3RAJA 4KIJA 4ME6A 3T5DA 4M8NE 1B8NA 1N1GA 2ZDHA 3BTOA 3G88A 4P84A 5CU7A 3T5TA 5CA1A 1NW4A 3HBFA 1SB8A 5BSGA 2R8PA 4R31A 4HWSA 5I6DA 4QVGA 4KYTA 4AZ0B 2FU5C 4B17A 1GGMA 4IIJF 3KG2A 4J2TA 1QCZA 3A25A 3WB9A 2X1MA 1FFXB 2KHZA 4GZ5A 4I2NA 3JCZA 1FUYB 4OXXA 4PV7A 8ABPA 2JLZA 3MINA 3P4YA 1PT9A 1KETA 3ILXA 1SPBS 2A4MA 2F59A 2YINC 4LJ5A 3QW4B 4F4FA 3NWOA 3PLNA 2B78A 1L5LA 3UH0A 1KYXA 4CKWA 1ZR4A 4Q4LA 3B9QA 1D2RA 1SUFA 1CIPA 3D2LA 3MUNA 1CYDA 1US8B 4Q9AA 5ES3A 4BN4A 2HQRA 4R98A 5DTRA 4DG8A 4YUAA 1T34A 3WNQA 2PEZA 3IELA 2EERA 4WLNA 1GEEA 2WD9A 1C1DB 3O0TA 3MN1A 1NW9B 1G4UR 5GZ6A 2JAHA 1A7KA 3FSGD 2F62A 3W1EA 1J39A 3VO2A 3QU2A 4EFLA 4NBWA 1Z38A 3HFGA 2J9FB 3ILSA 1VYVA 4ZAXA 3N6RA 2QUIA 4P4UA 4DCPA 5EJ7A 5TLSA 3C74A 4G36A 2PX0A 4YUYA 1JEYA 3IBSA 2F9MA 2Y0BA 3QBVA 1ITZA 1RYMA 2BEUB 1C2YA 3JU3A 4S35A 1SR8A 4WLFA 4E4RA 2N47A 2O2YA 3KOMA 4ETIA 1Q5PA 2HHJA 2FQQA 5JIBA 1R15A 1EX7A 4DVGA 4BZZA 1UBSB 3O2SB 4DY6A 2O06A 3UMVA 1RAFA 3H9EO 1WMSA 2FJ0A 2BWJA 3C8HA 1STOA 5LU9A 4H7KA 4XIIA 1LBSA 1Z4KA 1IDOA 4MVJA 4D5EA 2LIPA 3VKHA 4P32A 1Y5NA 2XBMA 1KJ9A 2NO1A 4PZDA 3S99A 2R1VA 3WLAA 3ONFA 4FGUA 4G0OA 2HN9A 2R5WA 2ZOSA 3RHFA 3SJBA 1HFEL 4LJ9A 1NF9A 2IUTA 4MV8A 4LXUA 1NPTO 4IQ4A 4I3FA 3SD7A 2WP0A 2FJPA 1G7RA 2X4GA 3INGA 2IHZA 3DL7A 2BGUA 3TUIC 4RACA 4OA8A 1NVWQ 3QPDA 1NXXA 2VPPA 3PENA 1GGFA 1KMHB 1C3JA 4EFDA 5J2TF 4C4XA 3CGWA 4I3HA 1PS8A 1ULSA 1JDZA 3K4HA 2A58A 4DNXA 1CHDA 2VJMB 1MVOA 1BHO1 1VGRA 3W06A 3CVJA 4ZWNA 2AFHA 2COKA 3GZ4A 4GWKA 1YL7A 1DELA 3PD0A 4EFMA 4IGAA 1IVSA 1E98A 3IYLW 1XRNA 3CPHA 4QIHA 1LI7A 1XFDA 1FBNA 1V1RA 3FDZB 4G84A 2A9FA 2WDPA 5JD5A 1XLWA 5LKAA 1UIRA 4J3NA 2LXNA 4WN9B 3UPUA 2CMKA 3N9IA 4NV1A 4E22A 1RI4A 2Q5LA 4LBWA 4QFDA 4X1YA 5CH3A 4RAQA 1EP9A 3C14C 1LDYA 3HJGA 1G2OA 1XV5A 4ZJYA 2OAEA 2FK7A 3F9IA 2DTXA 1F14A 1GKKA 2HXGA 1U5AA 3N8HA 2B0JA 3OCJA 4GOLD 5TMPA 4P83A 2BH9A 4LGYA 5CBPA 5KWIA 3PDIB 4IDOA 1YFLA 5EC8A 4F5YA 3MYRA 3DXXA 1V37A 2YV2A 3L7AA 2GARA 2W58A 5JANA 5EHQA 4A10A 4ENQA 5GIOE 4XYEA 1K5GA 3I5UA 4GOKA 3CNHA 4ZN6A 4KPYA 2OZLA 1GZHB 3HUFA 1QDUA 1GL6A 5JS2A 3CUTA 3WMRA 2O5EA 2QQ0A 5B4VA 2D59A 2HTFA 1X1DA 3ACDA 1K66A 1QQBA 3A6GA 1OOEA 4M60A 4IGEA 3HDVA 1ADBA 3GFGA 1HKUA 3ELYA 4MWDA 4XYBA 5HS6A 3CUVA 4EPXA 5BVHB 5H02A 3VX3A 3DC2A 3MBIA 5DTEA 2Q49A 4WK4B 5JD3A 1KTVA 1BE8A 2BFPA 5ECGC 1K7CA 5SZKB 3T3IA 3M6AA 3ITKA 1TFRA 2CUKA 3BM5A 3QEMB 3PVSA 4I5DA 1R12A 1MFZA 4BZXA 3HM9A 3KHUA 3S70A 5D3QA 4K0KB 3NAMA 2IE8A 2B1RA 4DPMA 4MHTA 3AJDA 1PQYA 2F3QA 1KKUA 1C0KA 1ZXLA 4QSMA 2OAQ1 4PY2A 4ZPXA 1WPRA 2XWSA 1JEQB 4LRXA 1IHDA 4LWQA 1C9MA 4GQAA 4HMPA 2XGGA 5J4LA 3H6KA 1DAFA 4IXTA 3UT5B 1GGEA 1KOFA 1QCCA 2PZBA 2HEIA 4P5DA 4RK5A 3LZ6A 1EBBA 1HMPA 1JAXA 2Q6KA 3E9ZA 1GQOA 1NT2A 1J42A 5AYVA 1JJBA 1XZ8A 1AV7A 1TQ6A 4JHLA 2CNBA 1F38A 2Z3WA 1NWHA 4BEJA 3FNRA 4ND2A 4CLEA 1LTHR 1FRNA 4DLTA 3ZEAA 3RF6A 2A3RA 2VDWA 3KOOA 4BY9E 2J3QA 5DF1A 5AW2A 2BPOA 1IQ0A 3DPSA 4K9MA 1W36B 2XWJI 3AX6A 3LIIA 4FC6A 2EW8A 2TS1A 2OBXA 4FJ0A 1GTSA 2O8FA 1YUNA 3HE3A 4EDFA 2QLMA 4EYSA 2DT8A 4R0VA 4KEAA 2HMVA 2C59A 2OE2A 1YR2A 4DLUA 1JDUA 1D04A 3GYGA 2DWOA 2P4QA 2GESA 3NP7A 4NARA 1XZKA 3QEBZ 4Z4IA 4RYLA 9ATCA 2YWCA 1KC3A 3H11B 1TIKA 1GZDA 3C16C 5CVUA 2NNWB 2MINA 2B25A 3I6IA 1P0PA 1T29A 4HNHA 1P6UA 1CUCA 1UP6A 1I24A 1E4YA 3BGWA 4OHWA 2W4QA 2NADA 3GRUA 1JWAB 4LVNA 2B36A 2WWGA 3OT1A 4BEBA 5LXTB 5A9SB 4QYXA 4NF2A 4JGIA 1DG1G 3ERCA 3Q87B 5FWXB 1NY5A 4RPHA 4XDZA 5EA2A 4FYWA 4JGBA 4I9NA 2EZTA 3QPBA 2XCLA 3IAS6 2CJWB 1WV1A 1YB6A 1KU6A 3KWMA 4KLAA 4LWZA 5IKEA 3D02A 2QDXA 5C7OO 4Y6RA 2JDID 1NAHA 2Y1LA 2ID4A 1AQLA 2DR3A 2WNHA 1E1DA 1RI2A 3LMKA 3HEBA 5KSWB 5CIYA 2CK3D 5ALQA 3M89A 2GZMA 4Z49A 1M0TA 1R64A 1K92A 2R00C 4UNPA 2IYSA 4IH9A 3G9TA 3TOZA 1HT0A 1K8YB 2C3OA 4RORA 3T35A 2DPGA 3IVAA 2ALJA 4P82A 5LMUB 3D0RA 1CV2A 2H2GA 2WJ3A 1E5LA 4Z1MD 3EF0A 1DKNA 3CLTC 1B0PA 5TVKA 3IODA 3UJ7A 4IXNA 5E3JA 3AERB 1ZN2A 1M2NA 3WLPA 2WQ7A 3A2KA 1Q77A 2ACEA 4C30A 3DE4X 2ZE5A 5DCUA 3WAGA 2C4MA 521PA 1UT8A 1RQPA 2YZKA 4M8SA 4WBNA 1RJWA 2NUTA 3HCAA 3N75A 2DMRA 3OZUA 1TIBA 1XAIA 3PIIA 1UWCA 1EP2B 4GOJA 5TRTA 1L4GA 5JR3A 3VAAA 4JX9A 2QGFA 2ACVA 5BWCA 1H8EA 2W93A 3UG7A 1I9CA 2H85A 3DNPA 2PQ2A 2Q5EA 4P4NA 3R4VA 2XTMA 4LJ6A 4TSKA 1OV6A 1U9IA 2V6GA 5ENZA 5FRDA 3TFWA 3ZWKA 5A02A 5A4FS 4LOHA 5DTQA 3GA7A 5I7AA 4FFSA 4GFDA 2PIDA 1KVQA 3OCVA 1CUIA 4MQEA 1U0TA 2I7TA 4IUYA 4EEKA 1M2KA 2VHYA 3CTPA 3IIJA 4RK1A 4RIIA 4PTYA 4YACA 3SCZA 1LQ2A 3TOVA 4DZRA 3U7JA 1Z2PX 4EELA 1G21E 5J4KA 5EWMA 4KRYA 1QG4A 1Z82A 2YH2A 4D41A 2PCLA 4O2AF 2FSGA 2WU4A 3BXFA 4J1QA 3VPCA 5ESWA 5IKPA 1NY6A 1JDTA 1WBJB 2B1GA 3IAEA 1QRDA 4PHHA 3T7TA 2Y4NA 1OMOA 1IJKA 3GVCA 1USWA 1YBAA 3OD5A 4DWOA 3UIEA 4ZD6A 4IKEA 2BGIA 1GFIA 3B5IA 3LUPA 4IVQA 5KKCA 1KS2A 4OMUA 1YRYE 1Q0SA 4XLZA 3SQWA 3L7KA 5YASA 2JKZA 1CJTC 2DFNA 2GRJA 3JATA 3SBOA 5DGIA 4EG8A 3BGDA 1K4YA 2QYTA 2HPHA 4ON9A 5A3QA 1VBKA 3KNZA 1UJ6A 3MJHA 4FVTA 5D5PA 2BZ1A 4HZUB 4DXDA 4QM7A 1EK5A 4ALJA 4O5OA 4MGIR 1V8DA 4PZUA 1GG2A 4YUVA 5J5AA 2NZ8A 1ZGJA 1TUGA 2G36A 1P1HA 3BIFA 4MV1A 1WOMA 2RE8A 3VYWA 4BRSA 4E11A 1DVRA 3DDWA 5CDUA 1Y82A 2IXDA 1Q19A 5TMDA 3OI7A 4M55A 3BE6A 2IQIA 1NBHA 3FLMA 4M86A 4V1CA 5JADA 5JS1A 1Y3IA 4HAYA 3ZD7A 2HU8A 3N1UA 4XM0A 2VS1A 3V2GA 5JZ9A 4C2TA 4PG7A 4G5QA 4BTEA 4D9HA 4QVIA 1QR2A 5EXPA 1B73A 1HC7A 5J40A 2QA5A 1XYVA 3CLRD 4HGQA 3O47A 3OZCA 2G0TA 1MVLA 2Q6LA 2XDYA 3NQ41 1I2BA 3WJAA 3ZDZB 1AX9A 3ZTTA 3A05A 3JS5A 5EWJB 2GTIA 4HYEA 1MP0A 4G97A 3WHPA 1ECPA 3H83A 3Q8KA 3V4RA 4J0EA 3IQZA 4IOMA 3LT5A 4QODA 3BIOA 1N2EA 4RVHA 2DCMA 1NHWA 2D1RA 3MJ4A 4Q47A 3PWTA 3WGMA 5JMWA 1N6PA 2JGRA 4LF7B 3RYTC 1OFGA 3EDMA 3CX6A 1JILA 5E4YA 1PK7A 1MO3A 4LY9A 3NBUA 3QNWA 2Z9DA 5TQ0A 3RFFA 2PUWA 1S4MA 2J5KA 4YCBA 4WKGA 4A5SA 3UV7A 2DWUA 4HNGA 1LC0A 2JIMA 1N78A 2XMRA 3EOAI 1CB0A 3JWPA 4WAUA 4PPFA 1TUIA 4EO4A 1FLVA 4NYJQ 3R3JA 1BDJA 2QAGC 2Y2UA 4X7MA 3MWEB 3HLTA 1P2SA 4U8GA 3ZS9A 5I9IA 3Q9LA 3AUUA 4RS4A 3ZY6A 4HNTA 2HSJA 4OV6B 1MW8X 1OWPA 4OMCA 2GEDA 3AWDA 1MGPA 4GE0A 4GZMA 4QO7A 4RKRA 3UKJA 3AESB 3VKFA 3VGPA 1SURA 2VRNA 2X5JO 4OQYA 4I50F 3TSZA 3JZFA 3DE6X 2LWIA 4K88A 5FL7D 3WAKA 5J47A 1DDOA 3ZJUA 4HNVA 4RFSA 3RU9A 4CJXA 1Z7EA 4DIFA 4J9UE 1U3GA 1NXTA 1O58A 3HUUA 4JBLA 3RSQA 1QTNA 2JFPA 3FZQA 3HDQA 3CCBA 4J4TA 4Q4AA 3V8PA 1D1SA 6Q21A 1M72A 3U81A 1GNTA 4LJ8A 1AQUA 4OXNA 1QHXA 4N0PA 2CF5A 3BX1A 4GVLA 2IRWA 4LYGA 2Q4TA 2WB4A 1KZ4A 4FHDA 5FTMA 1IFXA 3MERA 4ZEOA 3T9FA 3KQHA 2CHUA 1QS0B 3VVMA 4ZVVA 2Q5OA 3TLYA 1EJ6A 5DP2A 4AUKA 2OHIA 1SVSA 2HF8A 1V45E 3DOJA 1ZNQO 3NBFA 3IRVA 4OJMX 2HHLA 4LWOA 4M38A 1ZMTA 4RTKA 5TMEA 4MUFA 4P7GA 3EMBA 4ZI3A 5IUJC 4LY0A 5KMGB 3GAZA 1E1QA 1O7JA 1B74A 1PU2A 1VBMA 3V2UA 4CNBA 1DX9A 2BMWA 1M1ZA 1NQXA 1ORRA 3DZJA 4I9HA 5JAQA 1AZLA 3C6YA 4KKVA 4RTRA 1KGDA 4PSCA 3OKFA 3BICA 3MT7A 2RK4A 4EQZA 4EG3A 1RBYA 1QG0A 1O8CA 3K8OE 3TB4A 2IY9A 3N2NA 5THKA 1SY7A 2CKDA 5IKOA 1KP3A 3LHDA 1WSBA 2Q4OA 2DHQA 3PYXA 2X77A 4ZTUB 1G9TA 3BH0A 3R75A 4DYDA 2Z2KA 2YIDA 8MHTA 4EENA 1A72A 2H2WA 1Z7BA 4UBOA 1EAMA 4P34A 2G83A 4KU4A 5ALPA 1T0HB 1EB9A 3DEZA 2ZSEA 4GZ6A 5G0UA 1KC1A 1B0AA 4P4SA 3AYXB 4CIXA 2OXFA 3M6MD 4MB0A 4LISA 1UKBA 4YBZA 1JSXA 5KREA 4ZT4A 1B41A 1T24A 2ZUBA 4RV4A 5EQJB 3MAGA 5IBPA 4N3NA 4NFSA 1I3KA 1Y1PA 2EXXA 1PWHA 4AZSA 1M2EA 1UMKA 4G3XA 1DZ3A 5ERXA 3WDLA 2IQ5A 4X20B 1FX0B 3T7EA 1XNGA 2EAUA 4KJXA 1FTWA 3M9WA 1L1EA 3QVGB 3E27A 3EIQA 1LEHA 2J3MA 2JJYA 3O1HB 3IT1A 4E2ZA 2WMOB 3GD5A 5FD8A 2II6A 2OK7A 1KJWA 4HHEA 7REQB 5EE3A 4D8TA 2QAGA 2V9ZA 4RIEA 4PW0A 2DQSA 5CUQA 2H1SA 1UEIA 3B60A 4M9SA 4YS6A 5KB3A 4DMLA 2RCYA 2W4IA 3S5JA 1JLRA 3PKZA 1FP1D 4C06A 1Z5ZA 2WQZA 2QTHA 1ACMA 3MJFA 2DUNA 1Y8AA 1DKPA 1UODA 2FN9A 3RASA 1ISHA 3FJOA 3IAXA 5BN3B 5E6UA 4DOMA 5AJUA 3MB5A 2A9VA 1N0HA 1ONSA 3KV3O 3O3CA 3KQOA 4G6ZA 1L7DA 4G01B 4R9UC 4LDRA 1DJQA 3VNSA 3ZPXA 2CN1A 1AGPA 4XGRA 1T36A 4JVLA 3O4GA 2C58A 4OM8A 1TZJA 3U40A 3KCQA 4LCEA 2WWYA 3FPFA 1OVMA 5FEUA 1C8LA 1SCUA 3MB8A 3EXEB 4NBRA 5IYZF 3TSYA 4MRMA 5J63A 5ESDA 3RF7A 3V8BA 4R7ZA 3ZBTA 2A4KA 1IWOA 1R0YA 1RM4A 3A1DA 5J4YA 2AX3A 5JARA 3PK0A 4LDJA 3FPLA 2QSYA 1TTHA 3K2EA 1T8TA 1H2BA 1WTAA 2AMYA 2HQ1A 1U0RA 2XNDD 4KN6A 4RXUA 3SYRA 2E7ZA 4BVFA 5F23A 1GQYA 5E4JA 4B74A 3HGMA 3EMVA 3F73A 1G2IA 3VKUA 1MIOA 3NOXA 5DBOA 2XUFA 4K3VA 3TIFA 1ZWKA 1OBHA 2VG8A 4ACBA 1M1YB 4B6EA 4AKGA 2FPIB 1AKVA 2HCJB 2VBGA 3RVLA 4LYJA 5E38A 1ZC3A 3DLCA 4MP8A 1AQYA 1I5RA 4Z9BA 5DM0A 5BV1A 5EJ6A 1XQ1A 2LZ0A 4S3MA 4OBEA 2OSVA 3G59A 4JMPA 5CLIA 1R8SA 2JLSA 2YJ6A 3RSZA 1P19A 1WVGA 1IY2A 1KQOA 4PYKA 5T4HA 4X84A 1CUBA 4B4KA 3H9QA 4F12A 1H4QA 2R6FA 3LPLA 1M1XB 1FYWA 4HGPA 3RR2A 3L4JA 4JOSA 3KXIA 3L04A 4HQLA 2AJ8A 1V3UA 4MVJG 3IDFA 5LU8A 2ATIA 1GA1A 4UNQA 5DNWA 3ROKA 3NEAA 5ARCA 1J00A 1P7ZA 2PPLA 4BWFB 1Q0UA 3SAJA 3DLHA 1JDBC 4N5IX 3QUCA 4RVCA 4FB5A 4FWTA 1N8SA 1Z56C 4G0ZA 2CMFA 2RGCA 4OQZA 1IBKB 1OZGA 4RM2A 1CQXA 3FM9A 1ZISA 3NGLA 4IDHA 5E4FA 3WDSA 1UC5B 3TGLA 3QX9A 2A1IA 4F6LA 2VA9A 4QZVA 1DV1A 3IUJA 1W34A 2C5EA 4I1OA 4P3PA 3A6KA 4Q3LA 4XQEA 4OY3A 4B6RA 1R10A 1KI8A 3P5SA 4O1HA 4MS3A 4NOLA 2UVPA 3M6VA 5F2KA 1R66A 1QQTA 3QZUA 3TTWA 2Z5VA 3HDHA 3NJ8A 2CHVA 1ZOPA 3U4QB 4X7PA 1MX5A 3B70A 3HBMA 1L3CA 5J43A 1A71A 2PBFA 5SYAA 2AE1A 4I1IA 4CIWA 5JHHB 1AN9A 5I7VA 5EHGA 4N18A 3VDNB 5F78A 1F2UB 2W43A 2BE9A 3L4SO 1UXGA 2BUAA 2XMPA 3AO0B 1ORHA 3N6VA 3NHMA 3K53A 4IVNA 4MHSA 1LCIA 1KF0A 4LQDA 4WJKB 2O8EB 2GLTA 1ES9A 5AMXA 1JPVA 1X1RA 5A71A 4N7RA 1X6VA 4GX0A 5KTOA 4X8MA 4ZRMA 3W6NA 2GHQA 4ZA2A 4X6LA 1ZCBA 2FZ5A 2QQEA 4M53A 1WNFA 2C3UA 3MELA 3R9XB 1EG7A 1I7PA 5JS6A 1RKVA 4ZCPA 2XVMA 1W88B 1CE8B 2IDJA 5C8YB 1NJ8A 1Q1EA 2Z6VA 4OQEA 3QVOA 2YZ2A 1XU4A 3GCWA 4NZMA 4YRBA 5CFZA 2VHZA 4JK3A 1CY8A 4M1SA 3SMVA 3MILA 3MW8A 3IXMA 4UTZA 2ZYAA 3JAWA 4F9FA 2XEXA 1I2MA 3FFWA 4RDCA 4LBYA 1Y8RB 1BA3A 1SJ9A 1YUMA 4HQFA 4DLVA 1J8YF 1R74A 2GYUA 1ZH4A 2J9XB 2W5UA 4S1PA 5FULA 4QX6A 5B7PA 4I55B 2WSMA 5CLGA 1KXZA 1XD9A 5BQ3A 1ZUD1 2XE7A 3BMOB 1U7OA 3DCNA 4C78A 1K98A 4DV0B 1VPWA 1MV5A 4NZZA 4N41A 1JP7A 1AGYA 4XRGA 1XZJA 4JT2A 1DXHA 4MVJF 4A8PA 3PUVA 3DP9A 4HUQA 4TWBA 4ZCQA 1E18A 1Q1GA 3EZ6A 2AC7A 5D86A 3SU8A 1G38A 2G7ZA 3P4UA 1P9OA 3GEDA 2XE4A 4M6WA 2IH2A 1EGMB 1EHIA 3GHYA 1OIXA 1PBTA 1WTCA 3AR9A 3HBAA 4PLHA 3SSAA 2XNHA 5EZYB 3K9HA 4BFXA 1BKDR 2Q5QA 3CZ5A 5CVVA 3TLGB 3K9NA 3LJKA 3OT5A 4N7JA 3F4BA 2EHJA 2DU8A 5F35A 4KXFB 4PZLA 2CB9A 2OD2A 2FW1A 4AMVA 1D09A 3EODA 4ESOA 3EUFA 3RKSA 1TU0A 3SZLA 4H3VA 4KC0A 4DRYA 3BB1A 1V4BA 1BRMA 3AC0A 4FCCA 2OV1A 4PAWA 3T9CA 1RYZA 4FNOA 3L7OA 4MOWA 1OLSB 1SA0B 1YVDA 3EC7A 1A2OA 1AKYA 4D42A 5IJ0B 5TX7A 1W75A 1Z7GA 3ICQB 1OH5A 4NKRA 5E2AA 4CN8A 4LJ4A 5FHRA 3WGJA 4HADA 1PKXA 4FFRA 4FGZA 1RJDA 1UBEA 3R0VA 5TQ2A 1KAHA 3NBKA 3AJRA 2ONJA 4PPGA 4C0QC 4HAIA 5TJ9A 1PLLA 4GO1A 4M9RA 1T91A 3AVOA 4LZOA 3EPKA 2FGJA 3ST7A 4D56A 3ED1A 5KX5A 1WMAA 1U9CA 4GQIA 1VSTA 1LPNA 1P2DA 2GKSA 1NVDA 3JRWA 1FLDA 3IQHX 5TS3A 4YMSA 3LQ4A 3UUEA 1KVTA 4RF2A 5TSDA 5DO9A 4ECEA 1R5BA 1Y98A 2WKQA 4NPHA 3D7SA 4CT4B 4PG4A 1XC7A 4CEJB 2FVXA 2OAGA 1BS2A 3S68A 1UPXA 4H15A 2HL6A 1DIGA 4FS8A 1WE2A 1Z2NX 4W82A 3PDCA 2WFLB 4PFKA 1S8FA 1SQ6A 3W3AH 2AWOA 2C99A 2CY0A 1TO6A 1EVLA 1V1MA 1DB3A 3NS7A