1JQBA

Alcohol dehydrogenase from clostridium beijerinckii: crystal structure of mutant with enhanced thermal stability
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
351
structure length
351
Chain Sequence
b'MKGFAMLGINKLGWIEKERPVAGSYDAIVRPLAVSPCTSDIHTVFEGALGDRKNMILGHEAVGEVVEVGSEVKDFKPGDRVIVPCTTPDWRSLEVQAGFQQHSNGMLAGWKFSNFKDGVFGEYFHVNDADMNLAILPKDMPLENAVMITDMMTTGFHGAELADIEMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKNGHIEDQVMKLTNGKGVDRVIMAGGGSETLSQAVKMVKPGGIISNINYHGSGDALLIPRVEWGCGMAHKTIKGGLCPGGRLRAERLRDMVVYNRVDLSKLVTHVYHGFDHIEEALLLMKDKPKDLIKAVVIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NADP-dependent Alcohol Dehydrogenase
molecule tags Oxidoreductase
source organism Clostridium beijerinckii
publication title Structural basis for the enhanced thermal stability of alcohol dehydrogenase mutants from the mesophilic bacterium Clostridium beijerinckii: contribution of salt bridging
pubmed doi rcsb
total genus 119
structure length 351
sequence length 351
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 2001-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1jqbA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1jqbA01
2VRCA 3LSYA 3VHRA 5I7EA 1ZKMA 4FFNA 1KY5A 4RVFA 2VRCD 5B4UA 4DIBA 1E1MA 1I24A 1D1SA 4A0SA 2FR1A 4E6PA 3FNGA 4XJTA 5G0VA 2QRLA 3DXFA 5FWNA 4GGPA 4PVCA 3JSAA 2R00A 3KB6A 1WZEA 3SC6A 4PG5A 5IAAA 3V1YA 3TN7A 4PLGA 2ZCUA 4A10A 1MXHA 3E9QA 2X0JA 1KVRA 2XXJA 4F6LA 2Q2QA 2O23A 2Q3EA 3GEMA 4FJ1A 2Y93A 3GGGA 4IDDA 4YRAA 4WOKA 5EN4A 5TS3A 2IEBA 1W73A 1A71A 3S1LA 4HFJA 2X22A 2F00A 2AHRA 4MVJM 4R54A 3DHYA 2YV3A 4A26A 5C7IO 4RF3A 1CJCA 1E7WA 3GH3A 4RPJA 2ZTUA 2FRDA 3U09A 1DIBA 1VRWA 2JD2A 4OQYA 3WGHA 3B1FA 3UH1A 1H6AA 1HDCA 2R00C 4G5HA 1PS0A 4CMGA 2QZ9A 3B20A 1LEHA 2CF6A 4JCOA 2Z5LA 1Q7GA 5TLSA 3CZMA 4CMAA 2YUTA 2Y0CA 2VOEA 4RORA 5BQFA 3SBOA 4O0LA 1UH5A 2AXQA 1XDWA 3EHEA 4GQAA 5EQDA 3GG9A 3SJ7A 1W0CA 1GV0A 1DDOA 1GQYA 1B7GO 3GFBA 3O8QB 3KV3O 5HBRA 1XHLA 3CTMA 4GMFA 4EJMA 2VT3A 3PIDA 3VKUA 3DAFA 1PQWA 3E6AA 1DIAA 2NTJA 3MTJA 3VZQA 1PS9A 1SC6A 1KVSA 1EVZA 1ZO8A 3WJ7A 3WR5A 3FSRA 3GT0A 4XGIA 2D8AA 3ZWBA 3QE3A 5CDGA 4B4VA 3I5MA 2EKPA 3C1OA 4N7RA 4ALJA 3JQFC 3BMQA 3O8QA 3GZNB 4Q3EA 4BUCA 2VNAA 3A14A 3PQDA 1TA4A 3GAZA 1E7YA 1MUUA 4E33A 5KWEA 2CVZA 1U7HA 3RFVA 2OL4A 4U6SA 1GD1O 1NTOA 1N1GA 1QSGA 4ZVVA 5JC1A 1CIVA 2TMDA 5U1PA 3ASVA 4B4UA 4UUOA 1YB5A 4RLSA 5ER6A 1ISJA 1F12A 1FXSA 2Q50A 3F5QA 4U0JA 1YBAA 3H7AA 4BMVA 4HNHA 3GNQA 3EK2A 1LC0A 4FPXA 3TFQA 5CG2A 2QX7A 2FSSA 4CJXA 1V0JA 1HSOA 1BRMA 4ZA2A 3RSHA 5G4LA 4E31A 4WLVA 5ER9A 2BH9A 1QV7A 5DP2A 4EI2A 1E5LA 4IDGA 4CV1A 3G0OA 5L4SA 3UCEA 2C20A 1ORRA 3D7LA 1BMDA 2UYYA 2YYYA 1E3IA 3LT2A 1I3KA 1E7MA 1YOVA 2PH5A 2VWQA 1ULUA 1U28A 4PG7A 4D0RA 2OZPA 1YL7A 4AJ4A 3BTOA 3M6IA 1JN0A 3NV9A 3HUDA 3K96A 1LLDA 2GCGA 2GPTA 5L4NA 4YAKA 1LLQA 4ZQHA 1W6UA 3VH3A 1QKIA 1IPEA 2NLOA 3DAPA 3ONFA 5EINA 1NASA 3GEGA 3PYXA 1ADFA 2RCYA 1O9BA 5B1YA 3PI7A 2G17A 3PJEA 2ZJ1A 5C7LO 4NG5A 1M66A 3CIFA 1E6UA 4K6FA 5CPBA 2C5EA 4RF5A 3WS7A 4XGKA 2FY8A 4O59O 1DRVA 3JYNA 4JNKA 4JIGA 3H5AA 3NJ8A 4NI5A 3RWBA 2JHFA 3IUSA 1V6AA 3JQBC 4LGVA 1NQ5A 1NHWA 1PQPA 2FHSA 2IZ1A 4HKTA 2POQX 4CL8A 1W4ZA 5G0TA 3H9GA 3F4BA 1VC2A 2ZJ0A 3AUTA 3RD5A 1C0LA 5ICMA 3HG7A 4UUPA 1EE9A 3H9UA 5B37A 4XYBA 4J7UA 5IN5A 1MGOA 3H8VA 1IE3A 3L77A 2RH4A 2W2KA 1Y5MA 3RROA 1CQIA 1YKFA 5K9ZA 3BMNA 5L3ZA 1J0XO 1ZK0A 4FS3A 4IGEA 1A5ZA 1N2SA 1B8VA 4Z0PA 5MDHA 4GVLA 4D3DA 4CLHA 1EVIA 2EGHA 3GY0A 4YT5A 3VPXA 5I9NA 2GGSA 5F1OA 3CEAA 4M55A 3BTSA 4DIOA 3R6DA 3K9QO 1P1IA 4KUHA 2Y1GA 1E1NA 2PD4A 4ND1A 2YFHA 1IHXA 4XZ3A 2J3IA 3GUYA 4LN1A 1BXZA 3GLQA 3SLGA 2IYPA 4E5MA 4N5MA 3ANNA 3AOEA 5C37A 4O5OA 2ZKLA 1YL5A 3WBFA 1T24A 3U9LA 5CFZA 2VUUA 1NR1A 2DTDA 2EXXA 4R51A 4XX0A 5IG2A 3QA9A 4QQRA 2OMEA 4RJTA 1ZW1A 1IZ0A 3AY3A 4LCJA 5DN9A 1E3EA 5AXDA 3RUCA 4AJEA 4FC6A 1I8TA 4YR9A 4EBFA 3OMLA 4TZKA 2BI8A 2YV1A 3C7CB 3RU7A 4BNXA 4JP3A 5IFLA 5DBGA 4ID9A 5GMOA 4H15A 1Z82A 2VUTA 3Q3CA 1LC3A 4U7WA 1V3VA 1YH3A 3DMTC 5L95A 4PZEA 2DBQA 2IE0A 1SOVA 3MJTA 3OIDA 4KUEA 5F3RA 4KUGA 1QR6A 3S2EA 1HKUA 2X58A 3CSDA 1Y8QA 3QP9A 4YJGA 1O5IA 1DHRA 3KVOA 1DC4A 2BRUA 3D1LA 4LVCA 4YB8A 4RCVA 1T2AA 3UN1A 2YHIB 5L51A 1I2CA 1PJCA 4JX8A 5B12A 1E77A 5IZCA 1FDVA 2YFQA 2FWMX 2YY7A 5JCJD 3RKRA 2IZ0A 5CPFA 1XKQA 2UDPA 4I08A 4CUJA 1GEEA 4I5FA 4Y6SA 3P19A 4L4XA 1WW8A 3T4XA 1JAYA 3ZWPA 1K0UA 4J1SA 4FFOA 1YOVB 2A94A 1HL3A 2AEFA 4LSMA 1RJWA 3FHLA 4M49A 3Q11A 4BGIA 2HK8A 3AOEC 3BIOA 4A2CA 2Q2WA 1EE2A 1LDNA 1NWHA 1C3VA 3ASUA 2P5YA 1DSSG 1R4NA 3KUXA 2JHGA 5CG1A 3PHHA 1NX6A 5TNXA 2ZB7A 5IXYA 4ZICA 2HUNA 2O3QA 4PRKA 4AJ1A 3IAHA 1B15A 3IC5A 1X0XA 3W6UA 2NU8A 1YBVA 3RQSA 3ANMA 4XIYA 2YZ7A 2D59A 1XQ6A 2GSDA 4BO5A 3QV1A 4M87A 1PZGA 2ZYDA 2B4RO 4MIOA 4G2NA 3EMKA 3JQ7B 4IINA 5L7TA 3FI9A 5L40A 3BMOB 2DBVO 3OJOA 4BMSA 3HB5X 3GVIA 1WDMA 5CP8A 4CL3A 5FEUA 5A02A 5KKAA 3ICPA 3OETA 4YACA 1AUPA 4R5MA 4F6CA 5KJCA 5EESA 3U4HA 4MJLA 1LRKA 2AG8A 4B8WA 2GF2A 2CF5A 3ROMA 2NUAA 3QIVA 1KY4A 5JYEA 1P45A 2DTXA 4DVJA 3G17A 1I2BA 4EEXA 3GDOA 2X5JO 1BXGA 1WLYA 3G1UA 1EK5A 4XRGA 3KETA 1ENOA 4BNNA 5TX7A 2EEZA 1MA0A 1IPFA 2DUUA 3ZH2A 3V2GA 3JQ9C 1YGYA 4WJZA 5I9MA 2WSBA 1ZIDA 3JQ8B 3PHIA 4II3A 3P5SA 2JKVA 3HFGA 5DP1A 1QYWA 3WTBA 5ICSA 3D3WB 1YBMA 2B69A 3ZV6A 1DB3A 2OP0A 3O03A 3L4BA 3F47A 1JKJA 2D3TA 3BHIA 4QUKA 3EVNA 1VKOA 4LRTB 4BNKA 1I2ZA 4CR6A 1EZ4A 1MFZA 2Y0DA 2FPPA 3FBTA 4GKBA 3K5PA 2ZQYA 3W8EA 3ZU3A 3OHSX 3PK0A 4C7JA 3C85A 4P22A 4D43A 5A03A 5DT9A 1G0NA 1MV8A 3GVXA 2VHWA 1Y6JA 3O26A 5BSHA 3JTMA 1N9GA 1UDCA 1EUCA 2NQTA 3BYZA 3E03A 4CM7A 4DPMA 2JD0A 5KVQA 1ONPA 2ZB3A 3NT2A 3D4OA 1JU9A 3DZKA 2JFGA 3GNTA 1PSDA 7ADHA 5IZCC 4J4TA 3IJRA 4CMIB 4R5HA 3PZRA 4BOYA 4CQMD 1PGJA 1PR3A 5T8KA 4E32A 4CLOA 3PFWO 3GNSA 3L6EA 2CSUA 2PR2A 4FQ8A 2R2GA 5IDWA 3LT1A 4KWHA 4O6VA 4XWYA 4NMHA 1AXGA 2CY0A 1ENPA 2JJYA 3D5QA 1HXHA 2GN8A 3ZHXA 2EW2A 1U7TA 1LRJA 2AE1A 3RUIA 4NJMB 4RO0A 4W99A 4MVJH 1ENZA 1BW9B 1HE4A 1VM6A 1CF2O 1UZNA 4J7XA 4J6FA 3ZNOA 2X8LA 1LI4A 3MWEB 1E6WA 4N18A 4DBVO 3MOIA 2B5WA 2GASA 3OM9A 4FGSA 1WZIA 1YB4A 1GZ6A 2QIOA 1OI7A 2RHRA 1JVSA 1R16A 3OFSA 3FPCA 4ZQBA 4BNWA 4IJWA 5A05A 4MKZA 5IDXA 3DHEA 1U1IA 1H2HA 3JD4A 1GZ4A 1UXJA 5EL0A 3T4EA 5TT1A 3W1VA 5G0SA 3CXRA 1CQJA 1NPYA 3RIHA 3VTFA 3WIDA 4BS9A 4H16A 4XRRA 2DBZA 3UCFA 2G82A 3NYWA 1AXEA 4GI2A 4PFJA 1R12A 3JQAA 1WXDA 2DC1A 3UGKA 3DB2A 1R0LA 1TT5B 5JAZA 3E5RA 3FN4A 2AQKA 1K2WA 1H6DA 3PYMA 4GSKA 1XYGA 4E5NA 5AOVA 4KTVE 4CM8B 4CM4A 3OA0A 2BFMA 2QRKA 2V6GA 3TL2A 5EJ2A 5C3MA 5KCZA 3D4NA 5F5NA 2DUWA 4NU6A 2Q4BA 2EGGA 2P91A 3WQSB 4M86A 2O7QA 6ADHA 1DOHA 4AICA 2GRAA 2GYYA 3PHGA 4OH1A 2GR9A 2HQ1A 3FWNA 1P1RA 2VYVD 3BXXA 3IDSA 3NT5A 3OA2A 3DOCA 3I6IA 1EQUA 3I6QA 3BMQB 2P9EA 3QWIA 4YJHA 1ZK4A 2LDXA 1SMKA 1Q0HA 4TKMA 2BFPA 1EVJA 4QX6A 3VPHA 2OOSA 4I9UA 4NJOA 3D5TA 2NVWA 3HN7A 1D7OA 5HS6A 4CM1A 4I5DA 3LF2A 3WOHA 3KHUA 3GDFA 3I23A 1IB6A 2YJZA 2IXBA 5TJHA 1OZAA 3JV7A 5DCYA 1BXGB 1WMAA 1QYCA 2W98A 3PFFA 3QQPA 4ITUA 3RJ5A 2EJVA 1KOLA 4H7PA 1L7DA 3DZGA 2CUKA 3PTZA 2W8ZA 3T7EA 3FBGA 1TEHA 4RV9A 1EQ2A 2FSVA 1M6WA 4J2HA 4MP3A 4NK4A 1NFFA 4XQCA 3K2EA 4YPOA 3ST7A 3MEQA 5A9RA 5L45A 1HT0A 3GA0A 3V5NA 3TOZA 3FNFA 4WKGA 2VYNA 3ZN2A 2NVUA 4MVJF 4AJ2A 4Y8VA 3B1KA 5TT0A 3GOHA 1J49A 1B26A 3C3XA 2W4QA 3D4PA 4OAQA 5BNTA 2J5KA 5L7WA 2ZTVA 3CH6A 2AQIA 5MGBA 3A06A 3KYBA 1PTJA 3LLVA 4BKOA 1QLJA 2P9CA 1O89A 3GVCA 4X54A 1F06A 2FN7A 1E1LA 2I6TA 4BGVA 2NVUB 3TZCA 2PTGA 1P1FA 3BMNB 1KBZA 2HMWA 3ZWNA 4DGSA 3HSKA 4ALNA 4YJDA 1U8FO 4NQZA 4QT0A 4DLAA 3A4VA 4DQXA 1MC4A 1OC2A 2X7HA 4OM8A 4YYZA 2HMTA 1GEGA 1YQDA 4E5KA 1R0KA 1Y9AA 3PWKA 2WYWA 2D5CA 3BHJA 4Y9DA 3PYLA 4CMIA 4F46A 3KSUA 3WYEA 4BB6A 1FJHA 5DCUA 5AXBA 2VYVA 3BMCB 4BNFA 1P31A 1VKNA 4R16A 3DTTA 1K89A 4BNIA 3DAGA 1ZEMA 4XCVA 2ZQZA 1NHGA 2BGMA 3RFTA 3UOGA 2EV9A 1LTHR 2H1SA 2VHVA 4MVJG 4GKVA 1RM0A 3F46A 4QECA 1E7QA 2GNAA 4BNTA 1UXHA 3PQFA 2WM3A 4H3VA 3OJLA 4HP8A 4B3HA 2ZIZA 4L74A 4CQLB 2X86A 4W4TA 1GUFA 2NNLD 2NU9A 3HHPA 1TXGA 2OBNA 5KVVA 5LDHA 5K0ZA 1FDTA 5JDIC 5FF9A 2Q1TA 1N5DA 4CV2A 1PJSA 3I52A 4LISA 5FYDA 5T64A 1Q0LA 3G49A 1KEWA 1X15A 4R68A 2AEMA 2Q1SA 1B8UA 4DREA 4IZIA 3ON5A 3RFXA 4E0BA 4MDHA 4A73A 1MLDA 1LSUA 1Q0QA 4JP2A 5ITWA 1GR0A 3ROQA 1IL0A 2VWGA 3EGOA 3ZU5A 3GR6A 2HRBA 3C7AA 3KYCA 1RM3A 3ENNA 1M75A 4J9VA 2PKQO 1ISIA 1FDUA 1SOWA 1WDKA 1WMBA 2NTNA 3HADA 3LC7O 2AA3A 4CV0A 4DMMA 4KQXA 3Q9NA 1LQTA 1C1DB 1LDMA 4XB2A 4D46A 3BTUA 4S1VA 4DWVA 3BAZA 3JQAD 4QXMA 4DL9A 3PXXA 3AY6A 3OECA 4Z9YA 5JAIA 5KNLA 3BHMA 5FI3A 4PIVA 1HDRA 2PD3A 4FFPA 3QY9A 4YJFA 1T1RA 3EYWA 2QZZA 3E9MA 1YB1A 2B35A 2UUPA 1SEVA 4F45A 1ZNQO 4ALIA 5KKCA 4YAJA 3VDRA 3PZBA 5IDQA 4HFNA 2JCVA 4OKIA 3WLFA 1WDLA 4OO3A 1C0IA 3OBBA 1GPJA 5JDCA 3EC7A 2SCUA 5DOVA 2JD1A 4MIEA 5KJ1A 2AMFA 2X6TA 1KIFA 3PJGA 3PWZA 5FI5A 1PGPA 4TKLA 1P0CA 3ULKA 4LK3A 4PN3A 3AI2A 3R1IA 5BT9A 1KVQA 3JQ9A 1JQBA 2HLPA 4OQZA 4J43A 1A9ZA 1M6HA 1H9AA 4IDAA 5CEFA 4CLRA 4J4HA 1HE5A 1UDBA 1CEQA 2PZJA 3E18A 5DBIA 5I9LA 4RLHA 2VTDA 3E5MA 1B2LA 1NWCA 2AEJA 2P2SA 4K1LA 5JXWA 3NTRA 3GK3A 4OOEA 4DYVA 3PQEA 2C29D 2ZTLA 2O2YA 2ZYGA 3OQ1A 3Q2IA 5LCXA 2W90A 1EK6A 3H9QA 4AJJA 2A9FA 2GZ1A 4IJKA 4BNJA 2OP1A 2X9VA 4NH4A 2VZ8A 2Y99A 3NGLA 2GZ3A 1PGNA 3NGXA 4NR0A 5JCXA 3SEFA 2NWQA 1PX0A 4ZU3A 2C0CA 5KJ6A 5HRUA 3JD1A 4NBUA 1D1TA 4IJUA 2A4KA 4DRYA 5G2OA 5GY7A 3WMXA 3V1TC 3VAZA 1YONA 4AJOA 4INAA 1QV6A 3ADOA 4CM9A 3IMFA 4GWKA 4K9DA 4Z0TA 1X13A 2X23A 3R3JA 2J5QA 4D7AA 2DTEA 1LSJA 2A92A 4Z3DA 3GHHA 3MTGA 4FOOA 4MVJA 3TDKA 3M1AA 4CR7A 3ADPA 4R1NA 3ZI0A 4CM3A 4CQMA 3BZUA 2AQHA 3PDUA 4UEOA 3GHYA 4JBHA 2ZB8A 4Q3CA 2CNBA 2O3SA 1KVUA 2FZEA 2HJRA 1N7GA 1ZJZA 3O38A 1MX3A 5B4VA 1R4MB 4NFYA 1QP8A 4GBJA 1P1JA 4WASA 1ULSA 3JQGA 1OC4A 4MINA 2F1KA 4BV8A 4OJNA 4I9HA 1QXSA 1HYEA 2G5CA 5HM8A 4RVGA 5EIOA 3ITDA 3GUCA 2Q49A 4P4NA 5DULA 4BVAA 2C59A 1HEUA 1GYQA 2PD6A 3NTQA 4OSOA 4WGGA 5I7FA 1O8CA 2J3JA 2XOXA 5F5LA 1IHYA 3QLJA 1C0KA 3TOXA 5JPIA 4WCFA 1NVTA 1E7SA 4FR5A 1N9GB 3JCZA 4TRRA 3IJPA 1VLLA 2GUGA 1Y5RA 5AVOA 2EIHA 3CPSA 5JDCC 2X0IA 4QO8A 3Q1LA 4WE3A 4DC0A 1XWFA 1P1KA 1ID1A 4CMBA 4GAEA 1HE3A 1PS8A 5GZ3A 3KZVA 1DPGA 3RJ9A 2VOJA 3OF2A 1KEPA 3DMTA 4YT8A 4B3JA 2B4QA 1N1EA 2NQ8A 4RZHA 3RUAA 3NUGA 3D3WA 3DZIA 3WB9A 5L53A 2JAHA 2X9GA 4UEJA 2BHLA 3R3SA 3DBHB 3WX0A 2B36A 3NAQA 2P4HX 4WNCA 3GRKA 3VOSA 3WICA 2YW9A 5A9TA 3KLPX 5T8KC 4RPGA 1AHHA 1PL6A 4OSPA 4KDFA 1KC1A 3SJUA 1EUDA 2EJWA 1LX6A 2AE2A 4NBTA 4BO8A 5T6BA 1T26A 3F4LA 4ONEA 3H9JA 4IBOA 4GLOA 3UUWA 3WIEA 3AY7A 4J1QA 5CDYA 3R0IA 1PEDA 1WNTA 4LCEA 2DFVA 3I1JA 3DBLA 1SBYA 1DBVO 4AJHA 2I99A 2VZ0A 5A5EA 4NBRA 4JK3A 1I5RA 1JWAB 2VTEA 1ZJYA 1Y8QB 3WGIA 1SZJG 3N58A 3KYDB 3E8XA 4IJVA 1SB9A 4ZQEA 4Q3BA 1YRLA 4AFNA 4XKJA 1UP7A 5FFFA 1DFHA 3AJRA 3Q2KA 5F21A 5U9CA 1ISMA 1T4BA 1W8DA 4KOAA 5TRTA 1SB8A 4AG3A 4G65A 4CLOB 3JYPA 1A72A 4ND3A 4HFMA 5DBFA 3WBBA 4K6CA 2WD7B 2QYTA 2HK9A 1ZMOA 4RPKA 1HETA 2D1YA 3Q0EA 1JW9B 2EERA 3UAGA 4Y67A 4BKQA 1GADO 1DFIA 1VSUA 3BMOA 4LW8A 4WLFA 2UUOA 2D4AA 2NSDA 5CDTA 2HRZA 4W82A 2UAGA 4NJMA 3ZV4A 1BDMA 3C8MA 4E4YA 2DQ4A 1S6YA 3EZYA 2HJSA 2X0RA 1I36A 1H5QA 1XR3A 3KRTA 4BNGA 3QWAA 4J3FA 1EFKA 2X0NA 1CYDA 3B1JA 4DC1A 8ADHA 3PEFA 5A4DA 1P44A 3E1KA 4L73A 1G6KA 1VSVA 1VL0A 3F1KA 1DC6A 1BTOA 1AHIA 1U5CA 4PLVA 1HDYA 4RDIA 3K92A 1P33A 1T25A 5JSFA 4Z0HO 1UZMA 4P38A 4CM5A 1A4IA 4EGFA 5DF1A 4J2OA 5G4KA 4YWJA 1K6JA 5A3JA 2VHZA 4YT4A 4R9SA 4UAGA 2E82A 2I66A 2V7PA 3CKYA 1BWSA 1O0SA 4CM9D 4FJ0A 1X14A 4RL6A 4Y6PA 2NADA 4FFRA 4RGBA 2IXAA 1GCOA 1V9LA 1Z7EA 3NEPX 1U8XX 4P8RA 1R37A 4J1NA 4R3NA 3P7MA 1U9JA 1PJTA 2YV2A 1E0DA 2VUSA 2DVMA 2EF1A 2NU7A 2UVDA 3Q9UA 4FW8A 4WCDA 3VPFA 5KOIA 1LDYA 4J7CA 2YDYA 4GL4A 1VPDA 3FR7A 2JFHA 5IF3A 3LC1O 3PJFA 3O9ZA 1R6DA 5CDUA 1DAPA 2EKQA 1V3TA 4YJHB 3WGZA 4WLOA 1A7KA 2PFGA 3G79A 3KLMX 1Y8RB 1ZH8A 1F0YA 4Y6RA 1KC3A 4IPTA 1I01A 3DMYA 2C2XA 4AJNA 3FR8A 3W8FA 5EPOA 2Q4EA 4QSMA 1XG5A 1NVMB 4L75A 5TSDA 1Q2XA 3S2GA 1F17A 4Z3KA 4Y98A 2PLAA 3OIFA 4OXYA 3DQPA 3PDJA 4CUKA 1ISHA 4UEKA 1GPDG 2RAFA 3ZHYA 2O4CA 3I4FA 3IP1A 3DONA 3UKOA 1L1FA 3RKUA 3ZWMA 4FOSA 3JD2A 3LT0A 4JGBA 3BMCA 4CMCA 3V8BA 2BFOA 3NX4A 4QEDA 3ZU2A 3VZPA 3L07A 3ABIA 5DCWA 4JJGA 4UVGA 3PHJA 1F14A 3PLRA 3VTZA 1H2BA 4NZ9A 4O1MA 1D8AA 2O50A 1UZLA 2HU2A 5JBIA 4DLBA 1LJ8A 4G81A 1HYHA 1XGKA 4YTEA 1I33A 3FPLA 4UVIA 1Y9EA 3FF4A 1CDOA 5BSEA 1FF9A 3DHNA 3PPIA 2FMUA 4IXTA 3TZKA 2GERA 3VVCA 2HKIA 5HS4A 3MJSA 5F1KA 2NACA 1YL6A 4IM7A 1F8GA 2HSDA 3AFMA 2O4UX 5CDSA 2Y1CA 4KZPA 3ICCA 4MIYA 3H6KA 3WFJA 2BF7A 3LQFA 3RC7A 1NPDA 4HY3A 3DFZA 5JNLA 3AFNA 2VYND 2ZYAA 3EDMA 3FRJA 4FD3A 1V8BA 1E1KA 1BW9A 1I32A 1U5AA 1RM4A 3IIEA 4WECA 4FFLA 5T67A 5KVSA 2Y1EA 1LSOA 1LQUA 1DRUA 4YQYA 2E6UX 3E82A 2HMVA 1RYEA 3LDHA 3GEDA 1I10A 1XQ1A 1GQ2A 2Z95A 3FD8A 1NYTA 1U4SA 2DPGA 1PWZA 2PY6A 3OJFA 4YCAA 1LU9A 4YEDA 2VRBA 4I8XA 4JJIA 5IN4A 5HA5A 4YJFB 1GUYA 1LXCA 3U4CA 3WYBA 3GPDG 4IQGA 1U3VA 5K6AC 4MVJE 4Q3AA 4J9UE 1PIWA 2JCYA 3GN2A 3NDJA 3LVFO 9LDBA 5JYDA 3ZNPA 2O48X 4YJGB 2J6IA 1ZK3A 4EUFA 1EUZA 1HF3A 1K6IA 3JYQA 3KOUA 3SLKA 3VZRA 2Q46A 1QYVA 4FBGA 4GSLA 1H94A 2WEKA 3EUWA 2W2LA 4BMNA 5CAEA 4ZGWA 1JA9A 3H65A 4PGFA 2BI7A 4JN6B 5TQVA 4GX5A 3E48A 4BNMA 1YO6A 2O2SA 3WGTA 3GMDA 4U5QA 3RUFA 4AJPA 2IODA 2HK7A 1VJ0A 3C1AA 3I9KA 2FZWA 3CZRA 4MP6A 1NQAO 1ZSVA 1ZCJA 3IQDB 4BHTA 5B4TA 1J5PA 3OEYA 1A7AA 1MG0A 2PV7A 3RCBA 3PRJA 4Z9XA 4HUJA 4PLTA 4XIJA 3LYLA 1Y1PA 1M2WA 5IZ4A 1IYZA 3PVZA 2I65A 1LUAA 1UXKA 2E37A 1N92A 1I30A 4IMRA 5KVCA 3ZWYA 4BNUA 4EJ6A 4E2YA 1FK8A 1GUZA 1LRLA 4JQCA 4I5EA 1ZUD1 3I4CA 5C5IA 4BKPA 4KP7A 4YAGA 2VCYA 1E3WB 4IQ8A 4ND5A 3RVDA 4PG4A 4U8GA 4A7PA 4CMEA 1Y81A 3I83A 2PNFA 1H6CA 1OAAA 2Q1UA 3K30A 3WLEA 2PA3A 4DPKA 2OHXA 1DIGA 4ZRMA 2DBRA 4K28A 5AQ1A 2W2KB 4J0FA 2EP7A 2WD8A 1QRRA 2CDBA 4WK6A 3RUHA 3MJVA 1GDHA 2NM0A 3WJAA 1B14A 4HV4A 4FGWA 4WLEA 4IY1A 1RKXA 3AUSA 1TB4A 4CMHA 3ETEA 1ZVMA 4XA8A 4NIMA 4OGWA 2Y0EA 1QLHA 3I3OA 4KTTE 4YRBA 1R4MA 1X7DA 3AM3A 4ZRNA 3OJ0A 3W4IA 1P1HA 2ZB4A 3PHLA 2HCTA 2DT5A 2GN9A 3JQFA 3LU1A 3M1LA 4R1UA 4J0EA 1YWGO 2FR8A 3H5RA 3DBRB 3GGOA 1QG6A 4BL5A 1OOEA 2J3HA 5JAMA 1WAMA 1PU2A 3DTYA 1PJ4A 2J3KA 4N54A 2D5AA 5TC4A 3STHA 4KMSA 3ITKA 1H93A 4WCFB 2D2IA 3RC2A 3TJRA 1UUFA 3FCOA 3SVTA 3ANLA 3DZBA 4LMRA 4ZD6A 5LDGA 4I1IA 3NTOA 2WTBA 1XEAA 4B3IA 2E48A 3TQHA 1HWYA 3DFUA 1NM5A 4EEZA 1GYRA 3TRIA 4AVYA 3U62A 4XYEA 4CQMB 2HDHA 1P3DA 3GC6A 4ILKA 4M89A 4A5OA 4XEHA 2C5AA 3L0DA 1ADBA 1J6UA 3UF0A 3VPSA 4JROA 2PH3A 1UP4A 4IIUA 1DAOA 1HDZA 2FPIA 4IGFA 4HX5A 2PZMA 3L6OO 1NP3A 1JAXA 3ZGYA 4EW6A 4NFHA 4W6ZA 1IZ9A 2OBYA 5JY6A 1GZ3A 1MXFA 3RUEA 1HTBA 1Z75A 3KSDO 1RWBA 4Q9NA 2C07A 4FSHA 1DC3A 3EW7A 3JQEA 5A04A 1E5QA 1C1XB 1SAYA 5AXCA 2HMUA 3IL2A 5TIIA 3K73O 1GTMA 1SNYA 3X2FA 4PVDA 5KJFA 1DLIA 2J8ZA 1RYDA 3WQQA 1DFGA 2CDAA 2NU6A 2XF8A 2RIRA 3ZHBA 1YJ8A 4TRMA 1SO8A 1BGVA 4FN4A 1KVTA 4XD2A 1XA0A 5HTOA 4MPDA 1AE1A 3ZDFA 1DXYA 4TROA 3IKTA 4J90A 1LDBA 1XU7A 3HDQA 2X1HA 4R9RA 4CMJA 4CMKA 5JMWA 2B0JA 4IZHA 3U3XA 1EDZA 4GLLA 4MO2A 4D3FA 4R41A 1KYQA 1GFSA 3VH2A 2GN6A 3FWZA 1PZFA 2BD0A 4QFDA 1X1EA 3UHAA 2IRWA 5A9SB 1LLUA 3HN2A 1PL8A 4CMEC 4NFSA 5J23A 4UUNA 4L4RA 1ADGA 1AGNA 4Z6KA 1ZZEA 1IOLA 3MZ0A 3IKVA 1ARZA 3HDJA 4GX2A 3GPIA 3JQAB 5KJEA 1VL8A 1KEVA 3I9LA 4PZDA 2V65A 3H9EO 4W9NA 5U4QA 4UULA 2I3AA 1YS4A 1IY8A 1K6XA 4EUEA 5JY1A 4RQTA 4NNJA 2GD1O 3ROKA 3HZZA 4E5PA 3LLSA 5JFOA 2Y66A 2R6JA 4MKXA 3IS3A 3WGOA 2NTVA 4CM4B 2VNSA 4MOWA 1D3AA 3L9WA 4YAEA 1VJTA 1U2DA 4L9RA 4QO7A 4XQ9A 2EHDA 3ONEA 5I8WA 2C2YA 2PWZA 4FB5A 4TRJA 3GG2A 4OL9A 1XSEA 3OH8A 4PLCA 2HMSA 1R4NB 4URFA 2QYSA 4TSKA 2XXBA 5GZ6A 4L8VA 3WSVA 2Q99A 3BTVA 3L6DA 2GLXA 2PGLA 3KSZO 4DMLA 4BV9A 3A1NA 3U0BA 1H6BA 2Y1FA 2ZK7A 4BNYA 1P77A 4GX0A 1XLTA 3JQCA 3AUUA 4NK5A 3RASA 3RBZA 3QVWA 4YBZA 4TRNA 2X9NA 1EBUA 1EFLA 3OQ6A 4CLDA 4FJ2A 4XDYA 4FC7A 2BGKA 3A9WA 3GN1A 4D41A 1X7HA 4B7XA 1I3MA 4M8SA 1RM5A 3TL3A 3F9IA 3S2FA 1U3TA 2G1UA 1MFPA 5COAA 1PJBA 4ESOA 5IJZA 1CERA 4M54A 4ZQGA 4PLPA 2CVOA 1QYDA 2H5LA 4RPHA 1PGQA 4B4WA 4D0SA 3EAGA 2EP5A 4TVOA 3GDGA 3U4IA 3ZW8A 3QSGA 2CMDA 1GQQA 2Q45A 5JO0A 3EZLA 1BVUA 4EZBA 2OORA 4W9NC 2WWRA 4WLNA 1L7EA 3DBHA 5T5QA 5I7VA 1CRWG 1V35A 4TMFA 3U49A 3DOJA 4NBWA 1OMOA 5COBA 3RBXA 4IIVA 3WWYA 4A27A 1QMGA 1S7CA 4WCFC 1P9LA 3QRWA 2X5KO 3OSUA 5BNFA 3JQ8A 4UUMA 4M1QA 4RF4A 4YQZA 4EYEA 4DQUA 3AI1A 4IUYA 3CMMA 3C24A 1D4FA 2OUIA 5A5FA 1X1TA 4DTIA 2I67A 1GL3A 3W6ZA 4BNZA 2DFDA 3F6YA 1ONNA 4GX1A 3JYLA 4YVFA 1HDXA 1HLPA 1NPTO 4ZHSA 3QVTA 5ILGA 6LDHA 1U3UA 1Y8RA 4XQGA 2CDCA 4R69A 5TF4A 2YDXA 3QVXA 3TNLA 3I9MA 3ETGA 3ZWAA 1ZK2A 3I9OA 5CHEA 1B0AA 3DZHA 3U4DA 1KETA 4PLWA 3V2HA 1FMCA 5DOZA 3ZWXA 1HSZA 4PG8A 4Q39A 5K6AA 1BXKA 2YHUA 5COQA 1EEHA 3QW2A 2HAEA 4JBGA 4MVJI 3GVPA 4F3YA 1JLLA 2DAPA 1GCUA 4ALLA 3W8DA 4B8ZA 4ZQFA 4OMUA 3JYOA 3DWFA 4UVHA 1TT5A 1I3LA 2H6EA 3LZ6A 3F1LA 1DJNA 4JBIA 3DC2A 2C7GA 3NJ4A 4J1TA 4CM6A 4E12A 3HB4X 3PGXA 1UDAA 4RVHA 3RBVA 4EJ0A 3DZJA 4CR8A 4E13A 4IS3A 4ZJUA 1WPQA 3E9NA 5TJ9A 4DLLA 3LT4A 4UREA 3WG9A 5I7SA 4IXWA 4BO9A 4TZTA 3TZ6A 1PQUA 3WQRA 4PG6A 5JW6A 1GYPA 2Y67A 1HDGO 2O7SA 1C1DA 4DUPA 3Q6IA 1AN9A 3ONDA 1LSSA 3I9JA 3NRCA 1U3WA 3HDYA 3JQ6A 3H4VA 4IDCA 4WNIA 4D42A 4EUHA 4YRDA 3ZWOA 1WVGA 3CMCO 3WNVA 3WNQA 4TWRA 3AM4A 3CE6A 1TT7A 3B70A 3GF4A 1B16A 4WPGA 4RVSA 3P2YA 3ROPA 1QYXA 1LNQA 4FDAA 3QWHA 3TZQA 2PGJA 3ZWWA 5G0UA 4B79A 4WOJA 1Z7BA 1K5HA 2CVQA 3OEWA 3FNHA 1KEUA 2RHCA 3AK4A 3WMWA 4DPLA 2A35A 4CLXA 4BB5A 1PWXA 2IDZA 4R4JA 4IDFA 3K6JA 3PIIA 2VWPA 3GZNA 3HDHA 4RF2A 4E3ZA 3WGYA 3H3FA 3IP3A 1NQOA 3C1TA 4RPLA 3IUPA 4BO6A 1EDOA 3PLNA 3S55A 1Z74A 5G4KB 3M2PA 1E92A 3JQBA 1HZZA 2Q1WA 2NVBA 2PZKA 4ZN6A 3FTPA 1IULA 1BSVA 1TVEA 1WWKA 3ETDA 1PZHA 3F5SA 2JCXA 5EERA 4E2WA 4LRSB 3D0OA 3QWFA 2Y68A 4DYDA 3FNEA 3OQBA 2B4TO 3RU9A 1GV1A 2YQ4A 3WXBA 4BKRA 5DDIP 5BSFA 3QVSA 5ENVA 5CEEA 2P5UA 3WYCA 2QRJA 5HWSA 4B4OA 1HE2A 4NPCA 2QG4A 1Q7CA 3LF1A 3COSA 3G3EA 2WYVA 4JXKA 2GZ2A 1XCBA 3PP8A 1OFGA 4IDBA 1C14A 4BKUA 2ET6A 2IYOA 1PJLA 2HO5A 1ML3A 1DHTA 3WWZA 1FDSA 3JD3A 4YXFA 1QORA 1LDGA 2NV6A 4XR9A 2B83A 2WYUA 1JTVA 2IEDA 1LA2A 3N74A 1ZMTA 3QJ5A 4P4LA 2ZCVA 3KBOA 4PLHA 4E2XA 4OHUA 4NDNE 3AM5A 4CUZA 1J4AA 2OGUA 2VT2A 4BNHA 2OO5A 1ZXLA 3MJCA 2JL1A 1E3JA 2VHXA 1B8PA 3DR3A 1ZEJA 2BKAA 2YQ5A 4DIFA 4KDEA 4CODB 4IMPA 3MWDB 1HYGA 3T7CA 4RDHA 4PLFA 4BNLA 2Z1MA 3W4KA 2VN8A 1EMDA 3INRA 1FDWA 2AG5A 2J5RA 5JS6A 5BNIA 2GO1A 3IOYA 2P4QA 1R0SA 1Z73A 4J91A 3ZWVA 4IS2A 2H63A 4OKNA 4Q3DA 3HWRA 2EKLA 2FPGA 3RUDA 1CWUA 4FCCA 4AL4A 3UICA 3KEQA 4TVBA 1JWBB 1KS9A 3SC4A 3F3SA 1YDEA 5CEJA 3KM0A 1X0VA 1OBFO 3GFGA 1P74A 4R01A 1I3NA 2I3GA 5JDIA 2DLDA 3SXPA 4II2A 3X2EA 4E21A 4IDEA 2RBEA 4RVDA 3B6ZA 4PZCA 1T2EA 1NR7A 1UP6A 3AU8A 2QW8A 2Y05A 3LC2O 3KYCB 3DBRA 1G0OA 5A06A 3DBVO 1ISGA 1B3RA 4EITA 1ZFNA 2X5OA 1E3LA 1H9BA 1UAYA 4I5GA 1YQGA 1HLDA 1R66A 2LDBA 4NU5A 4PLYA 5ILOA 1EVYA 2C7VA 2PKRA 4GGOA 4MP8A 1MG5A 1N8KA 2CZCA 5IDYA 1HZJA 1Z45A 1VI2A 2BLLA 3H2ZA 4WUVA 5F1PA 1I0ZA 3H5NA 2VWHA 4QTZA 2BGLA 3O4RA 3K2BA 3H2SA 4Q3NA 1BDBA 3AWDA 2I5PO 4L0QA 3UFXA 1LLCA 4R1TA 5H83A 4D3SA 2ZTMA 4HADA 4OYRA 1O94A 1V3UA 2WDZA 2D0IA 1B3BA 4W7IA 1MB4A 2YHIA 3W4JA 2BMAA 2DKNA 3UCXA 3ZW9A 5H81A 4PLZA 3K8ZA 3ZWCA 3VH4A 3ZNQA 4XDZA 4BNVA 4BGEA 4L4SA 5KTKA 5K1SA 4RQUA 4CV3A 4NBVA 2CFCA 3GGPA 3C7DB 3L4SO 3KYDA 4CLRB 3AUAA 2VZ9A 1ONOA 4LMPA 5EQFA 3WFIA 5JE8A 3VDQA 4BQPA 4TQGA 1YDWA 1DC5A 2GDZA 1ZXBA 3TSCA 1Q1NA 1ZK1A 5JMPA 2WD7A 3HNPA 3TZHA 5TGDA 2WMDA 5C7OO 4MVJP 2AQ8A 1T2DA 1HDOA 4S3MA 3CINA 4A03A 1E7RA 3V2UA 3RAJA 3ZHZA 3U5TA 7MDHA 4WEOA 3HE3A 2Y1DA 2GN4A 2QQ5A 1MC5A 4BGUA 1ZSNA 3GRPA 1NNUA 3SX2A 5JC8A 3FTNA 1DEHA 4N5LA 1WP4A 3S8MA 3DO5A 1ZBQA 1DRWA 4DA9A 2C82A 3OIGA 1U2GA 2EG9A 2Q2VA 4FIZA 3QHAA 4RZIA 4E30A 3GAFA 1JVBA 3MCVA 1G1AA 2XPCA 2X4GA 5A1TA 5A9SA 1UR5A 4E5YA 4R1SA 4YA6A 5THKA 1E3WA 4E2ZA 1SPXA 1RPNA 4GH5A 3WTCA 1C0PA 1XELA 1X7GA 5GZ1A 4XQEA 3HQ4O 3ZNNA 4BO0A 4HXYA 2V6FA 1CETA 4I9NA 1NFQA 4CPDA 1VJ1A 5LC1A 3JD0A 2PGDA 4PCVA 3S2IA 3CUKA 1PJ3A 3WDSA 3MJEA 3NT4A 1P0FA 2VQ3A 3INTA 1BG6A 1YJQA 3KTDA 5H82A 1UJMA 1YVEI 1LDEA 2I76A 5L4LA 2G0TA 3AU9A 1E6EA 1UXIA 1LBEA 4WEQA 3VH1A 3ZU4A 3OP4A 5THQA 2ZATA 4ROSA 4C4OA 2C54A 4DXHA 4C7KA 4K26A 3RC1A 3DDNA 4B7UA 1E3SA 3MJ4A 1ZSYA 3H3JA 4U0KA 3EY4A 3HJAA 1GY8A 2QHXA 1F8FA 4XJSA 4R3WA 5KIAA 5L7YA 4OXNA 5ES3A 3V1UA 1ADCA 4CQLA 3NDIA 1DJQA 3JQGB 3VKVA 5AXAA 2B5VA 2FOIA 1Y7TA 4WLUA 2UV8A 3DOOA 4GVXA 1DIHA 3EVTA 3WSWA 3DEYX 3MOGA 2O3JA 4PRLA 3QVOA 1UAGA 4LVUA 4CLEA 2DPHA 1A9YA 1PJQA 4JLWA 1Q7BA 5BR7A 3TFOA 4N5NA 2RH8A 4JJFA 4ALMA 2AW5A 3RI3A 1T1SA 2OXIA 3G1TA 2JAPA 5AYVA 4J16A 2IZZA 5DNAA 1NBOA 4YT2A 2JFFA 1JKFA 4LSWA 1VL6A 3HFSA 5G0WA 3ZZNA 3ZV5A 3DL2A 5JAQA 1NFRA 3P2OA 4D44A 4DQVA 1N7HA 4YDRA 3VPGA 2PK3A 1O6ZA 4GMGA 4AJIA 2G76A 4ND2A 2BELA 3VC7A 3KO8A 1ISFA 3KEOA 1C1XA 1GU7A 3D3EA 3BA1A 4BIIA 4DBZA 4B7CA 4O63O 1NAHA 5ENDA 1A27A 1DLJA 1PZEA 5ADHA 4OIMA 1JDJA 1VE9A 4W7HA 2XAAA 2Z1NA 4MVJD 4BO2A 5ITVA 4EDFA 1NQTA 4GPD1 1PJ2A 3ZV3A 4RVUA 1PR9A 3DZFA 4QFCA 4ALKA 3GQVA 1YE3A 2VHYA 2I9PA 3AI3A 3RC9A 4BO3A 3VZSA 2E49A 1DO8A 5L9AA 4MKRA 1O95A 3L4BC 3K31A 1NVGA 2PKQP 2BFAA 2DM6A 3UW3A 2O3RA 4FFMA 3UXYA 4HNGA 2WE7A 3WGQA 2P9GA 3L9XA 3PWSA 4XB1A 1K3TA 3DBLB 5T57A 1PL7A 3OICA 4D45A 2PZLA 1YXMA 4P4GA 5BSGA 3AW9A 1H0KA 5JLAA 2B37A 3JQ7A 4BO1A 3VVBA 1HRDA 1NAIA 4L76A 5A3VA 4BQRA 3ZCXA 1SEPA 1YQXA 3JQDA 4J4BA 1U4OA 1GAEO 2ILTA 4KWIA 3GVHA 2EWMA 4CM8A 3TWOA 3PGJA 3QWBA 2DU8A 4J49A 4IQ0A 1KERA 5JO9A 1MP0A 1TI7A 3GMSA 1T2FA 2V6BA 3NDRA 3LK7A 1R15A 4UVDA 4XYMA 1PGOA 2WE8A 4HFRA 2TMGA 3M2TA 3OJEA 4XYLA 1XIVA 1UXGA 1Z6ZA 2O3TA 2FP4A 2P68A 3ENKA 2CD9A 1NXQA 4AJKA 4Z9FA 1T4DA 3INGA 3TPCA 2E4AA 1IUKA 2WJPA 5I8ZA 2H9IA 4GWGA 4HBGA 5EMHA 4XR4A 1DIRA 4BO4A 3ORFA 1BVRA 2EW8A 4HWKA 1T2CA 2V6MA 4UVEA 3NKLA 9LDTA 4D79A 8LDHA 1TLTA 3A28A 5JCJA 3WGGA 1A4UA 3KXDA 5IXSA 2W2LD 4XGNA 3UVEA 3TF5A 2OFPA 4ND4A 1ENYA 1M67A 4BO7A 5DZSA 4AJLA 1XU9A 4XYGA 4YAIA 4U6QA 4OOFA 2Y1OA 3AOGA 1M76A 1EBFA 1JKIA 3D64A 4OXKA 4NHEA 3I9NA 3N7UA 4KQWA 3GZ4A 2O3UA 3PJDA 1SCUA 1BHSA 2FR0A
chains in the Genus database with same CATH superfamily
1W75A 3D0KA 1FLDA 1Y5NA 4G1CA 4C0JA 4LF6B 1KY5A 5EXDA 2A84A 4B48A 2NAPA 4OXXA 3SS7X 2ZEJA 5KZMB 1D1SA 4ABTA 4YLEA 3ECAA 3Q3HA 2OSBA 3C45A 1OB5A 2VLIA 2IL1A 3FNGA 1UBHS 3HR7A 4XJTA 5G0VA 4D4HA 2APJA 4G0YA 2QRLA 5DHFA 2YZ2A 3RFVA 1ETUA 1C50A 3B7PA 4RJ2A 2H65A 4PBSA 4G5QA 3JTEA 4YJKA 2WJGA 4Z7JA 5JMOA 5KWJA 1JIVA 3LTEA 5E6UA 4XJVA 2XTNA 4BV2A 1WDWB 4C0WA 1YIAA 3G23A 1UPBA 2P35A 3I8SA 4LXGA 3C74A 3V1YA 1CF4A 2ZCUA 5KQGA 3E9QA 4F6LA 5AWFC 5CYFA 4MLZA 1VL2A 1C7RA 1JQLB 5AW8A 3CRW1 2BGRA 3L7BA 1ZJ5A 2O23A 5GIOE 2AXNA 4FJ1A 4FHFA 4GOOD 4CCAA 4UCQA 3L8MA 4YRAA 4WOKA 1EFAA 1A71A 1X1RA 2H8KA 3S1LA 2DPLA 1UBLS 3AEYA 2R87A 3OTQA 2IDKA 1O1YA 5DTIA 2PXAA 1UBMS 2Q9BA 3DTVD 4AZ0B 4ENQA 2RI0A 1GG9A 5ALXA 2YV3A 1EJ2A 1E0KA 1U8YA 3ID6C 3ROEA 4A26A 4GZ5A 2JBAB 1EUYA 1Z7YA 3ZWDA 4GR9A 4B2LA 2H4YA 4TLBA 1HYQA 1T2UA 3AEKA 1OGYA 3CVOA 3GH3A 3EY9A 3L1UA 3PFGA 5D6OA 1XVLA 1VRWA 2C4HA 3OLWA 1DWQA 1ODLA 2HEGA 3I34X 3WLJA 2QMHA 1U5BB 2ZSIA 4KYUA 3ZDZB 4CU5A 2Z8YA 3X1WA 1XMVA 1WPRA 4WZBA 3NONA 3QUBA 1BFDA 2R00C 4QDXA 1PS0A 3WLAA 1QH8B 2JGLA 1BS1A 1ZINA 3LY5A 1Q7GA 1XDDA 3GLIA 5EMJA 1SR8A 4BE7B 1J1IA 1JYEA 1PHPA 1JHQA 1C2YA 3WL8A 2CMFA 2ZI6A 1G38A 2IIPA 3G0HA 1B0ZA 4J6EA 3N2YA 4OHCA 5BQFA 2FW8A 1UMCB 1OT5A 1UH5A 2XMZA 4O0LA 5KWIA 1SUSA 2SECE 2CT8A 4MA4A 1XDWA 1YZUA 1ZIOA 4GQAA 4KSYA 2MYTA 4HBZA 1W94A 1PN3A 1W0CA 2ZREA 3IDQA 3QKUA 1B7GO 3O8QB 4MVCA 5ALIA 2RDMA 1XJ0A 4TQAA 4ZO8A 2QGZA 1Z8DA 1RI5A 2VT3A 4FW9A 1BS9A 3G2KA 5EI5A 4A8JA 1WCXA 1DTEA 2WVJA 3EFHA 2ODBA 4QPDA 4IX9A 4M0LA 5JJBA 3E9YA 1PS9A 3I76A 1KVSA 1EVZA 2YXDA 3A9SA 3GT0A 1Z0SA 1FP4A 2QD2A 3I5MA 4P82A 2XJ9A 4QZVA 4ALJA 3TIIA 2JAWA 3HLYA 2VDRB 3TRHA 3GZNB 2V1XA 2YV5A 4Q3EA 4ZVQA 3TW4A 3C0KA 3UTCA 4BUCA 1AQJA 2VJOA 4MLCA 3QEMB 2BDTA 3GAZA 1MUUA 4PNHA 5KWEA 1U7HA 2E85A 1G2IA 2OL4A 1L7VC 1U0OC 4JT9A 4C0BA 4F04A 3NIWA 1TVMA 3IVGA 5CFQA 4G1BA 1AOXA 2QLJA 3E3MA 4FQ5A 3STXA 5FI1B 5U1PA 3ASVA 2RONA 3CVWA 2ETXA 4RLSA 2Q3CA 2I33A 1JHZA 4QJ4A 5BUCA 4PZPA 4Y18A 3VA7A 5ALFA 3LS2A 2QVXX 3AEQB 4JWKA 3VDNB 4YONB 1SD1A 2R7NA 2QJRA 2WYHA 4IILA 4MVWA 4NZMA 4LC0A 3EK2A 3DMFA 1U9CA 3TFQA 3JWHA 2FSSA 3BL5A 1HSOA 1YQTA 3V1NA 1G17A 4E31A 5G4LA 3WWEA 3E1GA 4M6WA 3DT6A 1HFWA 1NI3A 1NBHA 3PFIA 4PHGA 4WLVA 5ER9A 4YRJA 2BH9A 3TTUA 5AKIA 1BXRA 1G8FA 1NGSA 1SVNA 1KYVA 2I6XA 3G88A 3GXOA 3LA8A 1DG9A 1VSBA 3KEGA 1KDVA 3SYTA 4Q7JB 1F2VA 3OLQA 4M21A 2NUPA 2WMYA 4PXAA 4DMFA 1EUQA 2CW5A 3DH0A 4F1JA 2EFJA 5AH0A 2CLOB 3VZDA 4BLVA 4DIDA 3V34A 2TECE 5A3RA 1ORRA 4PHTA 3PDCA 1N9ZA 3QVMA 1JG1A 3HUEA 1H5UA 5H3HA 1CY4A 2JFVA 4P36A 2R6HA 4ZCLA 1OHHD 3QF4B 2VWQA 1ULUA 1U9IA 3BQMB 1PW5A 4PG7A 3T54A 1PKXA 2ONZA 3UWKA 3OZTA 1JN0A 3PC8A 3K96A 1LLDA 2Z98A 4F84A 4DZRA 5C35A 4NEQA 3RIEA 3ACCA 2E7ZA 3C3CA 3LOQA 4D4KA 1JHPA 4ZQHA 3SZ3A 5DI3A 1KAEA 4E5DA 4TUYA 4LF4B 1E6KA 1TF2A 1HRKA 1PUJA 1HE8B 1XLUA 1ZQ9A 3KP1A 5EINA 4ETMA 3VSEA 3FDZB 2JAOA 2WUVA 5LYJA 1UBUS 1QVWA 4N6OA 4YRNA 5JSUA 2EWWA 3PYXA 3E3NA 4J0GA 3PJEA 2ZRAA 2VK4A 5KX5A 1ZOLA 3QEKA 3TRFA 1V48A 3JASB 1E6UA 1JR3E 1N0HA 1T5LA 3ETLA 4HDQB 4K6FA 5EZQA 5F7JA 3RAGA 1A1VA 3WS7A 4UDYX 3VKWA 2O2DA 4KCGA 5EG5A 4D74A 3U16A 1TUEA 2JJ1D 1Y1SA 1V9CA 2R8RA 1OPXA 5CTJA 4I1PA 2JHFA 3JARB 2WYOA 5AM1A 5K0FA 1VXRA 3S29A 3FCSB 3GCDA 5A3QA 2ONCA 2VA8A 1HEIA 3U4MA 4HKTA 4ZOLF 2PSHA 4F7DA 6Q21A 3O75A 2JGRA 4EHAA 4NMWA 4G63A 3F4BA 1G2OA 1P18A 2ID4A 5K4HA 4DV7B 1DO2A 3CRVA 4UUPA 3D8HA 5ICMA 3H9UA 5B37A 4J7UA 2QGFA 3NOOA 3W6OA 1R00A 1RAEA 3LOPA 3LP6A 4TTJA 1CQIA 4CTJA 2PMKA 3KVVA 5K9ZA 4KQMA 2H1OA 5CBKA 3OVMA 2NPOA 2NXJA 3GT4A 3OLYA 1SA0B 3SPXA 4XI9A 2WICA 1YJCA 3P45A 1XQXA 1XMXA 4HH3C 5CBPA 1DUVG 3UMBA 1QIDA 3GLUA 4X62B 4FLEA 5F52A 4KR7A 2C2BA 2ZSFA 1H65A 1P5RA 4YUVA 3VPXA 2QMEA 3UPTA 4DIOA 5DJ5A 3R6DA 1GSIA 2HT1A 3K9QO 4JLJA 4JX9A 3RVLA 3GLIB 1GNPA 1E1NA 1L4LA 4HQKA 1IHXA 3GGDA 4XZ3A 3VV2A 1W47A 3CE9A 4PZYA 2J3IA 1I80A 1J33A 5I3CA 4EHNA 3DDZX 1UFOA 4LN1A 3AERA 4DBLE 2IOHA 2TMYA 1Q12A 4E5MA 1IY0A 1V8PA 1UMCA 2XMPA 4N5MA 2IGTA 1O2DA 4K87A 5C37A 2X77A 2ZI9A 4S1TA 4WXPA 3A1SA 4YI3A 3N2NA 1T24A 4IO0A 4ETIA 1K3UB 1XWIA 1CVRA 3G8AA 3HDTA 3U9LA 5I3ZA 5MN4A 3KJXA 3IEMA 1CJMA 4QQKA 4R51A 2RGGA 4XX0A 5IG2A 3QA9A 4ARBA 1BRTA 2WQ7A 1XCGB 2COKA 2Q62A 4TGLA 2F7SA 2H4WA 2X8BA 1CUSA 5A0TA 2ZAGA 4ZI3A 5TR9A 1A5SB 2QSUA 2OFWA 5DN9A 3TQTA 1K8QA 5AXDA 4FC6A 1I8TA 4UZSA 3H6GA 5KYYA 5DIZA 2P7HA 3KD3A 4TZKA 2YV1A 4BVFA 3SQXA 4NAUA 3SHFA 1UDXA 2HA0A 4ZCIA 3IAS6 4ID3A 3QFHA 3F2IA 4QTYA 1QS0B 2W0MA 2XYGA 3IV6A 1WZNA 1LC3A 1N57A 4U7WA 3ZD8A 3EXHC 3HCCA 2AIRA 5KDLA 1NZFA 1RHMA 3GYBA 2DBQA 1VCOA 4JY7A 1J21A 2F4NA 1OIXA 1IBLB 2QMYA 1EFDN 4CKBA 4DNXA 4YJGA 1Y8QA 3QP9A 4BE4A 2H0AA 1ZA1A 1T13A 1PO7A 3KR1A 13PKA 4C2TA 1V16B 4BLTA 4DCGA 2O8BA 1IEWA 3AVQA 4LVCA 3SMQA 1RZVA 1WHTB 1R8XA 5FBVB 5AVRA 1PJCA 1YI8A 1RYFA 2MDTA 1CHNA 2IIVA 1V5WA 1MQ9A 3VO8A 4MR7B 5KTYA 2FWMX 2M98A 4B3CA 3WO0A 5JI2E 5AVJA 2IZ0A 5CPFA 1FTWA 1U2EA 1VJGA 2UDPA 4Z4FA 1QGAA 2AOWA 3OQVA 5CLGA 4YFVA 4CIVA 4S1OA 3K6RA 3IERA 4MUJA 2QYOA 1YQWA 1ST2A 1FFAA 3ZEIA 2GCOB 3LPLA 2W6CX 2HFJA 3D6FA 1DKUA 3P19A 1CEYA 3OCJA 3ZBPA 3ZUPA 5CA1F 2ZRMA 1LLFA 1WBBA 1XZPA 3PPVA 4B7AA 1M7HA 4F5YA 2VRNA 1T6YA 4A2WA 5JHHB 4HDNB 4O2BB 4IXMA 3SP1A 3PA6A 3R76A 3HJHA 3GLHE 1ATZA 3G0GA 1ZWKA 2N0SA 3AL2A 1UODA 3GU3A 4UTOA 2RBGA 4B3FX 2QW1A 2ANBA 3AOEC 4O29A 3GLFE 1CR2A 2GF0A 2JANA 4A2CA 1L9KA 1IWBB 1LDNA 2OSVA 4DM4A 1KKLA 5JH7A 3F7OA 3EB9A 2IOYA 2JHGA 4OM7A 2YICA 3NANA 4OU5A 5DI3B 3DCJA 5A2GA 2B8WA 3PHHA 1E94E 5TNXA 4DCJA 4ZICA 2HUNA 1H4TA 3K1YA 5F5XA 1BKSB 2J0SA 4IIXA 4AJ1A 1XPUA 4D56A 2WJ4A 3QX8A 1B15A 2NZWA 4MTCA 1QZ3A 2ZRNA 2IXTA 4LBWA 2WHPA 3T0GA 3TQRA 3PE3A 3ANMA 4D8TA 1RD4A 2YZ7A 1LK7A 2J6HA 3R5FA 2D59A 4HMPA 4I4LA 2GHQA 4XIYA 5ALHA 3RV3A 4BO5A 4CKCA 5JQGB 3UGJA 1LI5A 1ULZA 3EMKA 1L7QA 1R74A 3FI9A 4Q19A 4KXNA 5TY0A 2DBVO 5M5BA 1LPMA 5K5EA 3HB5X 5ARDA 5FUWA 1IHUA 3DV0A 1R0CA 1J2JA 5K0LA 2WSMA 1KK1A 1UOPA 3GLSA 1YZ3A 1T4MA 4IWNA 4A0RA 1OBOA 5KKAA 4L50A 2IF2A 2VPXA 5CITA 1QRTA 3AB7A 4RLFA 4Y2GA 3E9EA 5HZGA 3U4HA 1KO7A 2VJQA 2P8SA 3E4CA 1Z29A 3S27A 3UK7A 3WL5A 1T5HX 1P45A 3T7RA 1BQEA 1CY8A 1M6NA 1RQLA 2CHEA 4V0KA 3DL4A 2YBEA 1NJGA 1D4OA 1KMIY 3WK5A 3UXMA 4N0PA 2PHZA 4R0VA 4DF3A 5TX7A 3CNHA 4IOKA 4ATNA 1IPFA 5CA0B 4NYIR 2PYZA 5EIAA 1RWXA 4KQEA 5AKEA 2IU6A 3V2GA 3JQ9C 1DV1A 1XWWA 1ZIDA 2O0HA 2WSBA 3JQ8B 2OC4A 1FX0A 4KH0A 3ZKWB 2WKRA 2WF5A 4QUJA 4HATA 4MLDA 2B69A 3L0BA 1TUIA 1DB3A 4MHSA 5AR1A 1JKJA 4LZAA 3BDIA 4CN8A 3C8UA 4DDUA 1EEXB 4MIKA 3LY7A 2JJ8A 3CLTC 1I2ZA 4BNKA 4CR6A 1EZ4A 1OFTA 4KGDA 1OXXK 3HS3A 3N7TA 1T9GR 4H7HA 1OFHA 4DDKA 3DT8A 3C85A 4P22A 1S2DA 5C3UA 4D43A 1MENA 1YUNA 3N2LA 5D00A 3O26A 5FL7D 5BSHA 3L0OA 4YBRA 1EH5A 2PH7A 1H1DA 1EUCA 3AKCA 2IELA 2HWKA 3OHMA 3BYZA 1YR8A 2YZMA 3K6KA 1MO5A 3A2LA 3R6LA 4GEGA 4TWBA 5DVZA 3L1JA 3K7EA 3KCNA 2C31A 4Q47A 2RGWA 5EJEA 5JWRA 3IAS1 3IUMA 1FSGA 3AEKB 4GBMA 3HP1A 4JOQA 4LDZA 5ALJA 3WMFA 3ZS9A 4HB3A 2ZB3A 4YIKA 3TEFA 3J7AC 3ZCSA 4RA9B 4INZA 4OI2A 4EI7A 4KVGA 4LJYA 5JRZA 4OHOA 3QSYA 3IEIA 3BM5A 1B41A 2AOTA 3IJRA 1GFZA 2ODQA 3E53A 3PC7A 5CW1A 1CNFA 1L4MA 1QS0A 2WAAA 1M3SA 4EZIA 4G4GA 4CQMD 2HGSA 4WADA 1N6OA 4E32A 5EJ9A 5JJLA 3GNSA 2CLEB 1JZSA 2CSUA 4U9UA 4BRUA 5B3JC 2HIHA 4S2EA 4I4TB 1U0GA 3LT1A 4G1EB 1J00A 2BFDA 4URUR 2WU8A 3IESA 4NMHA 1AIPA 4YI5A 5KYGA 3THOA 1YS7A 5I47A 3H0EA 1HXHA 1T4GA 1QTRA 2K5UA 1M1YE 3R5KA 1G3QA 3ZQKA 3ZXUB 1DE0A 1FYFA 1P2UA 4OAOA 4A8JC 4NJMB 3M4NA 4RO0A 2AXPA 4W99A 2YN2A 2MTBA 4QXAA 1HE4A 1OLSA 3ZNOA 3TTVA 4GO1A 1E6WA 2DQKA 5KYWB 3SDBA 4DBVO 2GASA 1JHAA 3G8DA 4FGSA 5IUJC 2BONA 2NSHA 1GZ6A 3IQWA 2Q5QA 4GQBA 2QIOA 5EE3A 1Q3HA 5I9IA 1JVSA 5H02A 3OFSA 3D6TB 4NICA 1BYIA 1UDWA 3SIWA 2QR2A 3OPQA 3K0FB 3M7IA 3I12A 3DHEA 3ZDDA 1HFJA 1N5OX 3N2KA 4PNPA 3JD4A 3QXJA 3ZCPA 4JI8B 2BR3A 2EHJA 3FOCA 5G0SA 3CXRA 3IT3A 3TZBA 3VJMA 1E8MA 5AW2A 2RK3A 1K92A 1Z33A 1M83A 1NPYA 5AI6A 1QH9A 1Q77A 2DBZA 2BFFB 2PL1A 2AI3A 3N0WA 1CP3A 1MZVA 4JMLA 4RJKA 4C29A 2FE1A 2GWRA 3CEMA 3VYUB 1N0VC 3BF7A 5B2FA 3WISA 5K4AA 2DC1A 5BT8A 1SBQA 1R0LA 3B52X 4JU8A 1OVGA 3AEQA 1XZGA 5ESRA 5CDFA 1XTQA 5FTWA 1Z38A 1ESMA 1LVUA 1UKEA 4X24A 5IM4A 1K2WA 1H6DA 4GSKA 4XTRA 3IOMA 2CL6X 1BKYA 4O4JF 4DCMA 4MPJA 3VVLA 1USKA 3LBFA 4E5NA 1NMYA 4EF5A 4CM8B 4CM4A 5C3MA 2BFMA 4HJRA 3D4NA 3G0IA 3QFTA 2QT0A 4UJ5A 2XMBA 5F5NA 6NULA 3L82B 4HXEB 4B3RB 2RGAA 4D4LA 2QPOA 2EKDA 2RIPA 1U0LA 4XLTA 4AD8A 1PP4A 2WWFA 1QHEA 4OYHA 3GAMA 2CKDA 2HQ1A 1P1RA 2Q2OA 2VYVD 4PGAA 2AR7A 3IDSA 3NT5A 4QDJA 4TL6A 3PD0A 3Q8WA 4R8LA 2ATCA 3MOSA 3OA2A 3K8YA 5DW3A 1WABA 2ZYVX 3BMQB 2I03A 1OBHA 4IHKA 2EAUA 1P75A 2BW0A 1ZK4A 5CR9A 1JFFB 3SYLA 2Z6QA 2H18A 2LDXA 3BOSA 3DW1X 1Q0HA 4LV8B 3GCGA 2K7FA 1EVJA 5MF6A 4ENWA 4I9UA 3H1FA 4NJOA 4Q93A 2BZGA 3D5TA 4IV8A 1XEFA 4MRVA 4XFKA 2HDOA 1S2MA 2XVAA 3PC4A 1QIMA 4K8OA 1OX6A 4RMNA 4TWAA 1IEQA 1FJXA 3A4LA 1WXFA 2DFLA 4J2TA 4O4LF 4FX2A 2C99A 3GDFA 2LD4A 3I23A 2YJZA 4K05A 4KC0A 4NG4A 2WTUA 1OZAA 2VYFA 2WWTA 1PT5A 3JV7A 5DCYA 2G63A 2A33A 2W98A 4UDOA 1UAAA 3QLVC 3QQPA 4L78A 2HRDA 2EJVA 2PR7A 2PDAA 4RAQA 1KOLA 1V7ZA 3UFBA 1XPOA 3A1EA 3DNMA 3QE0A 4Y6OA 1IJEA 1KU6A 1NOIA 3FZNA 1TEHA 4RV9A 1E4OA 3FOWA 1CF9A 4X65B 3EUFA 1I1HA 5FUVA 1IN6A 1M6WA 4J2HA 4KXXA 4MP3A 4A8TA 4MW6A 1FSPA 2QUKA 5B2ZA 3V5NA 1SXJC 2Q41A 3FNFA 2FRXA 3H8JA 5EMNA 3SQMA 4YMWA 4Q6BA 3RRMA 1OWLA 4XSHA 1IMJA 3RRFA 4FZ3A 4U00A 3GOHA 1J49A 4CF5A 3D4PA 2CJYA 4BN5A 2PXCA 2YWRA 2J5KA 4G4SP 3QBJA 5G41A 5JSYA 2ZTVA 3PPXA 2OVBA 5JSQA 2AQIA 5MGBA 4FYHA 2W42A 3L8EA 2YBDA 4J0HA 4Y2UA 2P9CA 1O89A 3IXQA 1PTKA 5DWVA 2WHXA 1L5FA 2OQIA 1F06A 4HRYA 4QHYA 1PX2A 1QCDA 1TF5A 2KYRA 2NVUB 4M9CA 3TZCA 3TAXA 3EPLA 4A6DA 3TNJA 5H4GA 4GFDA 1N78A 221PA 3HSKA 2JVKA 4X5OA 2RJOA 1JLMA 3ZXXA 3SK0A 5JVDA 1PBNA 1U8FO 2J08A 4QT0A 1OX5A 2FW7A 1MC4A 2GKGA 5CBPB 3F9RA 3MBOA 2HMTA 2O1WA 4CLDA 4YYZA 1QHYA 1JMVA 4PXSA 2VHCA 2TRSB 1KEEB 1Q1EA 5HUHA 2WYWA 1DEOA 4IVPA 4U3JB 2IPAB 1NN1A 2HN9A 4BB6A 2ZVQX 1FJHA 2Z3VA 2R96A 4HK4A 5FLYA 4RIEA 1H3NA 1CV2A 2PKYX 1B42A 2VDLB 1TEXA 3ASYA 4KXYA 1N2XA 1R0ZA 1DI0A 3DTTA 4P1ZA 1K89A 5EZYA 2YMMA 1Y8AA 3K0FA 4KYVA 1DO0A 2EBUA 4GKJB 1XPRA 1TRKA 3Q8KA 4CCYA 3D3KA 3UOGA 1LTHR 2VKQA 2HHHB 3KVYA 2X2EA 3F46A 3KKZA 4GKVA 4MVJG 1E7QA 2GNAA 3B48A 1CVLA 1N2JA 1UXHA 2IZ7A 3D5EA 4H3VA 1RJ9A 1OR8A 4S0XA 3R09A 1MKYA 4Y2VA 3CRMA 3R6TA 5K2OA 1K66A 4JSRA 1T4CB 5KHAA 3UH0A 2NNLD 3OEED 4JITA 4W8OA 2NU9A 3HHPA 1TXGA 2OBNA 3SHTA 2IYWA 3ADDA 3RFFA 2REOA 4RIGA 4CV2A 1F4LA 2EBWA 4WK0B 3GLGE 3KJQA 4RACA 5T64A 4ICIA 1PG2A 1FUUA 4XWGA 4BVBA 3AEZA 5FA8A 3GGJA 1X15A 2PIAA 5TVKA 3ZNQA 3K9FC 3PDIA 2AEMA 3AQIA 5C1IA 3D7KA 3BB1A 4W6QA 4YJ2F 1JDBC 1VBFA 1WUHS 3ON5A 1RBMA 2WK1A 1S9DA 1Z2PX 2FG6C 3FAZA 3I42A 1V7QA 4A73A 1ZNZA 2LPMA 2HTFA 3R20A 4G2TA 4N8DA 3UJ3X 3ROQA 3T1QA 5KTPA 1M72A 4AUEA 3ZU5A 4DCNA 3QM1A 3NM5A 3GR6A 3V8PA 1X19A 3R5TA 3VJRA 1K8XB 4IIDA 1RM3A 1CCWA 1LJUA 4TMYA 4DCTA 4TM7A 4J9VA 5H0IA 1ZCBA 4KXQA 3R24A 2J0VA 4ZAYA 2AMYA 3HADA 3LC7O 4DMMA 2AA3A 5L3SA 1LQTA 4XB2A 3BTUA 1NVVQ 2XYHA 1R4AA 3I53A 3WYFA 3PXXA 3OLZA 5BXYA 5NLLA 3OECA 2BFEB 5JAIA 4PIVA 4FFPA 2QUBA 5T4BA 3QY9A 3C5HA 1E6CA 3D6AA 2B35A 2UUPA 1SEVA 3BWCA 3ZW7A 2MSNA 2N75A 3TLMA 1ZNQO 5JXJA 2WWGA 2YRFA 5KU1A 2DSNA 4YAJA 3PZBA 3DCYA 3T1OA 4YLGA 2B1QA 2JCVA 1IY2A 1SCNE 3PEUA 3MRVA 3OT4A 2JKZA 1GPJA 3OBBA 5JDCA 2FTKE 5EUQB 5J4LA 2NYRA 3C15C 5KJ1A 2YL2A 3EEIA 3IPAA 3MT0A 4TKLA 5CT8A 5HDBB 4ARVA 1G8JA 4LK3A 4QU5A 3M81A 4XVRA 3WVNA 2JI9A 4YMUA 1X8XA 5DLQC 3CUVA 3JQ9A 2HLPA 4XWAA 3R8XA 1GWNA 1P8AA 1NW4A 1A9ZA 2O8DA 1M6HA 1KR5A 3EDCA 2XD9A 1SUWA 5DMXA 5J63A 1X38A 5TGTA 4IDAA 4AMZA 5CEFA 1YFJA 4J4HA 2I80A 1Z7GA 5DBIA 4Y3UA 2OAGA 2ROQA 3VOTA 1P62B 1JLSA 1YRBA 3E5MA 1YR6A 3SF8B 3QUQA 3C1UA 1B2LA 3W7AA 4D26A 2XV1A 3NTRA 3QE4A 3T3PB 5BWMA 4CZ2A 4DYVA 4RJJA 8MHTA 3HKEB 2ZTLA 2ZYGA 3DEJA 2XQFA 3R7FA 1H2XA 3IILA 1JJ7A 1GSHA 1G4HA 1MABA 1VZ3A 4IJKA 4LYEA 4WY8A 2COUA 1R0YA 4NH4A 5BQXA 2H4ZA 4OQPA 4JGIA 1DINA 1GA6A 1RACA 2ZP1A 2C4WA 2C9ZA 4LDQA 3SIRA 3BFXA 4BMZA 3NXSA 5C4IA 4XOIA 3WIUA 3KKOA 1D1TA 1WMEA 1OWMA 4ER6A 1R8YA 1ODJA 3R40A 1UC9A 3Q7EA 1UIRA 5GY7A 3VAZA 1E5XA 1Q0UA 1QPGA 3OPYB 4OQXA 4RABA 3SIXA 3WIVA 4G8CA 4BNDA 2UVPA 3IMFA 4Z0TA 4CM9A 1V5GA 3KDSE 3C3DA 2IYSA 3R3JA 5KI6A 4C7XA 4MUHA 4R8MA 3ZUGA 2C7PA 3LO5A 1YAHA 2JJ1A 2RHJA 4IJ6A 3MTGA 1YDFA 1JJVA 4U8HA 3ZE6A 2O2ZA 3M1AA 3T9CA 1SBTA 2EARA 4H3HB 4DMHA 2AQHA 2G08A 3Q3IA 4FZ5A 2XYRA 4N0QA 4RC9A 1MQ8B 2XUDA 4PX5A 4N48A 4Q3CA 2CNBA 5HCUA 2O3SA 3OZWA 1IXSB 4JBNA 3KR2A 5IJ9B 3O8RA 4JL8A 2HJRA 1N7GA 3O38A 3IJ5A 5FP0A 1FX0B 2ODEA 1LPSA 1P1JA 3BXOA 4WASA 3ASZA 4DIMA 5HZKA 2RHHA 4RS4A 2HBZA 1WOMA 4BV3A 1QXSA 2QTZA 4PHFA 3DDOA 1FXWA 1HYEA 1JPVA 3PNSA 1U7DA 4TT3A 3L4JA 3H1TA 1MPXA 1O7JA 3VHXB 5DM60 2CVHA 2Q49A 5EKXA 8AT1A 3ZE9A 4A4DA 1T9HA 1HLGA 1HBJA 2NXNA 3J80A 1I1NA 1O8CA 2XOXA 3OZSA 1IHYA 3UJAA 4ZARA 5KX5F 2H4XA 4I8DA 2WRZA 1MDBA 4F72A 3DXZA 5IMBA 3JX9A 5JPIA 3RYHA 1IRXA 1IHPA 2A8YA 2CZQA 2R8OA 3I9FA 4Q4JB 2PAAA 2POCA 4ZDJA 1T9KA 1HURA 2EYUA 3BSSA 4LI0A 3BK7A 4K1XA 3BWDD 4FOLA 4W5JA 4KE7A 3RE1A 1OV6A 1XZMA 3TSAA 1Y5RA 4KX3A 5AVOA 1IUPA 2EIHA 3TB4A 1GNQA 3HUUA 2X0IA 4RANA 4WE3A 2R8XA 1P1KA 1ID1A 2G25A 3AT1A 3GAAA 1PS8A 4NCAA 4HNSA 4PNEA 1ZDMA 4JI3B 2NTEA 2XNDD 3IB3A 4J8PA 3W78A 1QF6A 1ISPA 4L16A 4CHGA 3OF2A 2P7IA 3PNOA 3LHDA 3T7KA 1Q44A 4ARCA 1QDLB 3ZIDA 3RUAA 3UW1A 4EUKA 2W2OA 3CCFA 3AHCA 2HTEA 3D3WA 2CB9A 4HZIA 4LV5B 5DHRA 2DHQA 3RS9A 4IL5A 1ULHA 2JAHA 3H3XA 3EIUA 2BHLA 2GX6A 2WUDA 3QU5A 3KOZA 3NAQA 3R3SA 1VGVA 4R2LA 3MTDA 3CPJB 3QUAA 3AR9A 4E88A 1CSEE 2XUHA 2XXAA 3KLPX 4LGMA 4I1RA 5AK5A 3RJMA 1PL6A 1PNQA 1C81A 5HEKA 1AB6A 2H5JA 1EUDA 3NCTA 4RXMA 4NBTA 4BO8A 5ISMA 3PNVA 1I7QB 5F7OA 4GLOA 5CDYA 3AY7A 5G3YA 1TKRA 2IH4A 2J7PA 5FWYB 3KCQA 3TOSA 3UMCA 1AQIA 3I1JA 2JKYA 4N12A 3IP9A 4FI3F 5H80A 1U7OA 2IS6A 1XNHA 1FE8A 1BJRE 3EOAI 3V2IA 5JPDA 4BMXA 3H4MA 1JWAB 1ORIA 2RSLA 4I9FA 2NO7A 4K3VA 1Q0ZA 3N58A 1NVAA 1D9ZA 2ZZKA 2IUTA 3EEBA 4Q3BA 4X6UA 4D9CA 4XKJA 2E9SA 2JEYA 3CZQA 1UP7A 4O2AF 5FB3A 3AJRA 1RQRA 2VHJA 1WCV1 1LTKA 3O8OB 2ZRJA 2CXOA 3MJDA 4LNHA 3V8NA 5U9CA 3UJNA 2AJLI 4GM4A 5TRTA 2A30A 1XYYA 2I6GA 2XI4A 4G65A 2BFFA 1EX6A 4LVNA 4CG1A 4CLOB 1GTVA 4F5WA 5DBFA 5CCXA 4K6CA 2WD7B 3I45A 2HK9A 2W6OA 3RFCA 1HY3A 2VBCA 3VBEA 5K3EA 3BEDA 4OMDA 1E2PA 3EQ9A 3HXMA 4BJHB 2CK3D 3L1IA 3BMOA 3U6BA 1C3OA 1G8PA 3FPSA 5CDTA 1L5GB 3M6WA 3GLHA 3QQ5A 1JX6A 5F9FA 4BAZA 1MU0A 1DBIA 4XLLA 3RGWS 3AV0B 3FFXA 2AFIA 3VX3A 2V0CA 2WIJA 3P9YA 2PEYA 4OBBA 4U2BA 3I73A 4E4YA 3ESAA 2DQ4A 2H1RA 2H54A 3QXHA 1C3XA 3LYHA 2WAXA 1XR3A 4FHCA 1Z8FA 4KO3S 4NLLA 3BWMA 5ALWA 5BMVA 3W2EA 1Z25A 1KFJB 1NRJB 3KAQA 1J97A 3KBBA 3E0QA 4D2IA 3ER6A 1EFKA 1SC9A 5DHPA 4NS1A 5T4EA 1Z47A 2P2ZA 2XUGA 5EZ5A 3T3EA 4DM7A 3TVDA 1KH3A 3WGKA 2PS3A 2QUJA 3TE7A 1P44A 1RIFA 5C8YF 1L7RA 3PS9A 4I66A 1G6KA 2AI1A 2WUFA 3T9EA 3F1KA 3ZLBA 1Z8HA 2JLXA 1BTOA 1T0UA 1UPXA 3K92A 5JSFA 3FOFC 3E15A 1ODTC 2QUZA 1SCJA 1XX6A 4Z0HO 5BYBA 3JAMA 3VJKA 1Z2EA 3IEKA 2FUEA 1A4IA 1S9HA 2FSHA 2GEDA 1K4YA 3OPYA 3S81A 4W8HA 1W19A 3LP8A 5DF1A 2DH6A 2QLTA 3OM0A 5FKJA 4U2GA 5GWXA 5A3JA 4C07A 3NHMA 2WU4A 4R9SA 1PRYA 3OTGA 4NYJR 4DLYA 2QJOA 1K7EB 2ENUA 1X14A 1CUBA 2NADA 4FFRA 4AMVA 4D9FA 1PR4A 2V3WA 4AWAA 1JEYB 3IRVA 1T35A 1TJPB 2IXAA 1GCOA 3OCUA 1R37A 3FUVA 4R3NA 3P7MA 1U9JA 5AKYA 4ZYZA 4LBYA 3MNFA 1E0DA 2VUSA 3H1PA 4O2BF 3R9KA 1JE1A 3FB1A 2DVMA 4MO9A 4OUDA 4XAQA 3B8HA 2W2XA 4B6PA 4MWGA 3ZOKA 4KMRA 1QAOA 3DKRA 3HGQA 3A3NA 2ECQA 2EQAA 2YDYA 3AUYA 4DG8A 1CZLA 5F35A 3AJ9A 1XMOB 3WK4A 1SIUA 3E5NA 3L43A 3PJFA 1YI0A 3O9ZA 4B71A 3VHXA 3TMAA 5CDUA 4OGFA 1DAPA 1PLJA 1W30A 1YZQA 5C1BA 3WGZA 4KHZA 1BO6A 1NN0A 1XTVA 2FPKA 3UUFA 4GZ6A 4UXJA 1D04A 3T9DA 4M0MA 1IIRA 4PQYA 1I01A 3DMYA 3F8SA 4I50F 1SN7A 4N0MA 3DZDA 4IIJB 4AJNA 3FR8A 2GARA 3W8FA 1TVKA 4RK6A 4HQ0A 1NF2A 3HZHA 1UFKA 1NVMB 1F38A 3BB4A 3BPSA 3IAM6 4L75A 4O4HF 1Q2XA 3S2GA 3V8VA 1T29A 3U5ZB 4X44A 2FFBA 1E5TA 4NYJQ 4IIBA 4UUAA 1GPDG 2RAFA 3JWPA 3IULA 3DLCA 2R85A 4REQB 1QO0A 3UKOA 4BE9A 3Q7IA 2PKWA 1PK8A 1L1FA 5DN6D 1N2OA 2W6QA 4FOSA 1F7UA 2AYXA 3UBMA 3C3WA 2OHOA 2JCSA 4CMCA 4QEDA 4HEA1 2E21A 3O47A 1M9NA 2G40A 2VNJA 2WF9A 1GRVA 1J9GA 1B4DA 1NXPA 2PMDA 2W9XA 3A9CA 2YXPX 2A1UA 2ZSHA 4KO4S 3PHJA 3D1JA 1F14A 5AKLA 3ZWQA 1H2BA 4WXMA 3V80A 1DCTA 2D7JA 2ZAMA 1Z4IA 2BJWA 2HU2A 3L5KA 4I9GA 4RUKA 4DLBA 4Q05A 3K5WA 1T3ZA 3EOBI 1F6DA 4MWDA 4S35A 1U2GC 2DPMA 3DPSA 3ZX5A 4JT8A 5HSGA 1QZXA 1FVXA 3COPA 2IYVA 1CDOA 4DQDA 4NOLA 4LJRA 3DHNA 1GGHA 3AINA 3PPIA 4IXTA 1QAQA 4NTZA 3TG8A 2EFEB 3MQ4A 2VL7A 1C8KA 2GFIA 2CL5A 2PVPA 3UJ7A 3LLCA 4AQDA 1DUSA 1US8A 3ETHA 3IPXA 4N39A 3L4EA 1H9CA 4A9AA 3LPCA 1E58A 2XYPA 4IXDA 4MRMA 5DXJA 3X1DA 5CDSA 2Y1CA 4KZPA 3VYRB 3H6KA 3VYWA 4H6PA 1G5IA 3A31A 1KQPA 5FDFA 4J0QA 1RDFA 4KBGA 3H97A 3A7DA 2ZYAA 3NOXA 3EDMA 3ZWKA 4WTOA 1V8BA 1L4HA 3ELYA 1O95D 1PT6A 1U5AA 4EFLA 4URYR 2H9YA 4FNGA 5HFAA 3WLHA 1NW7A 1JSCA 1KMCA 4WBNA 3KB8A 2E6UX 1XN1A 1RMTA 2G8NA 2WBLC 2Z95A 2BFCA 1W0KD 2O7VA 1C3OB 1ATIA 3LL7A 4JVMA 3RKSA 1U4SA 1N75A 2ZR7A 3OJFA 2QL6A 1RZUA 2ZRGA 1KQNA 2AFIB 1WNFA 3DTNA 4I8XA 1AZLA 2O07A 4JJIA 3LSTA 5CXSA 3GPDG 1R3DA 5K6AC 4Q3AA 4Q18A 3P27A 4J9UE 4JLUA 3V4PB 5CDFE 1PEYA 2AG0A 2JCYA 3FPKA 4WNYA 1OFUA 3LVFO 5JYDA 4LKRA 2I7TA 3QXGA 4GI7A 4OJQA 1EUZA 3K4PA 1GTSA 4FWBA 4FBGA 4GPIB 5A71A 2A9QA 2QXYA 1KZ9A 1YCFA 3VC1A 1M73E 1UANA 3CUUA 4CFZA 4BFXA 1RWPA 5MFPA 4O2LA 5C7YA 1Z6PA 3OLXA 3K9LA 1KORA 1P9WA 3TZQA 2C2OA 2YHAA 1U0JA 2BI7A 4FCTA 4PGFA 1VHWA 2J31A 1IBRA 2PBZA 3A10A 3AILA 3AI7A 4R9VA 5ALKA 1KY3A 4CDGA 1T8UA 3HJGA 2W5UA 4Z8YA 4Y2PA 4AP6A 2O2SA 1M33A 4DLZA 5K0SA 2DHRA 4UEQA 3ZDXB 2GJSA 2JRCA 4AJPA 2QR3A 4WH0A 4WD3A 4MAMA 5DK4A 2XECA 3TR0A 5BN1A 3WRYA 1WRBA 1RFGE 3C5VA 4MQFB 3GLVA 5TVGA 4EX7A 1FYWA 1SVKA 3EFBA 2IPOA 4HXFB 1HT2E 1SIBE 2FUCA 1ZCJA 2ZRDA 4ZVOA 1NBAA 2L82A 1LBHA 2RGYA 3LHIA 3OEYA 3L6UA 3IPRA 1IQ0A 1F3OA 2BBSA 3KZKA 4QYMA 3RCBA 4EO4A 3PC8C 4U4AA 2BZSA 3MD0A 1CT9A 1ZN8A 1IJFA 1T1IA 1MEEA 1M2WA 1Y1PA 4TL8A 5IZ4A 2NO6A 2RHLA 5JZVA 2EP8A 2ZE6A 1XO1A 4OUDB 5LA6B 1LUAA 1UXKA 4JP1A 3HPQA 2R9VA 1RJGA 1X6VA 4PWZA 4Y9TA 4BNUA 4EJ6A 1J56A 1QGYA 5K0NA 1RRPA 2ID7A 1GUZA 4FILA 1H8HA 3U44B 2DPXA 3MJHA 1FJ2A 1Q57A 2JCGA 5ALPA 3ESQA 1C8VB 4YAGA 3E9RA 4AZSA 3PUXA 1H69A 3JZMA 4B47A 1OILA 4UATA 1DADA 2SBTA 1Y81A 5KTOA 2FX3A 2BLNA 4H60A 1KPIA 5DNUA 5LQKA 5FPHA 1KI8A 1OA1A 5EXXA 5DLPA 1DIGA 4ZRMA 2DBRA 4H1TA 1JEQB 2ZDGA 2IQIA 2VBIA 3EEFA 5GQSA 5I7AA 4Z1OA 2XOKA 4JHXA 2IDMA 3QIAA 4TTSA 1CJTC 4YV1A 2GH1A 1E8NA 2PQ0A 1RRFA 2QZSA 3LNCA 3N2ZB 4UOQA 4HV4A 5BSWA 3AUSA 3FMGA 3NDPA 3ZHSA 5C52B 1ZVMA 3HR8A 2WTMA 3LUKA 4OGWA 2YOFA 1HFEL 2QSYA 3I3OA 4JLVA 1SCKA 4KTTE 2BEVA 1QFMA 2QQ0A 1XZHA 1X7DA 4LPKA 4YMSA 1RHUA 1M6VA 1Z0JA 2CHFA 1M2KA 3AF4A 1W46A 3NRBA 2YQZA 1P1HA 4GGMX 4NJEA 4WN9A 3W4IA 4DLRA 2HCTA 4YCNA 1BJKA 2GN9A 2QBYB 4R1UA 1GIAA 4ZAVA 3REQB 3LRXA 2XCRB 1YWGO 2FR8A 4CN9A 4A8PA 3EQZA 3GGOA 1VP3A 1QG6A 3IEUA 3B7WA 3OP1A 4FXOA 4G4IA 1FSSA 1WAMA 2IBTA 1PU2A 4IUDS 4Q4DA 2QORA 1PJ4A 4N5HX 1TQ6A 4MYUA 3STHA 4RFSB 1AQ6A 4WKBA 5AHRA 3SICE 1ZU5A 3RYHB 2HDNB 3RC2A 2A6PA 5LNK1 1UUFA 1VPEA 3UT5B 1XLWA 2CXPA 5FJIA 1AF4A 3QH4A 4ZD6A 821PA 2WTBA 3M9WA 3AR6A 4Y7DA 3P9NA 4J03A 2O2GA 1Y4SA 1UC5B 1V1JA 5EHIA 1LW6E 4EEZA 2ACKA 3TRIA 6ABPA 1KMQA 2DETA 4PZUA