2NVBA

Contribution of pro275 to the thermostability of the alcohol dehydrogenases (adhs)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
352
structure length
352
Chain Sequence
MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAELADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLDVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLVTHVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADP-dependent alcohol dehydrogenase
publication title Thermal stabilization of the protozoan Entamoeba histolytica alcohol dehydrogenase by a single proline substitution
pubmed doi rcsb
source organism Thermoanaerobacter brockii
molecule tags Oxidoreductase
total genus 107
structure length 352
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 2006-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nvbA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2nvbA01
1OOEA 2CVZA 3AY6A 4W6ZA 1Z7BA 3ZNPA 1ZSNA 1Y8RB 2C5AA 3FN4A 1P1IA 2DPHA 4WLOA 3ITKA 4L9RA 5TT0A 4AL4A 4EEXA 2OMEA 1H0KA 3FNGA 4WEQA 4B8WA 1TI7A 1U9JA 1V0JA 3QRWA 3WICA 3RVDA 1HEUA 2FPPA 3RAJA 1KEUA 1Y9AA 3E1KA 1B3RA 2VUUA 1JTVA 4Q9NA 3I9MA 1B16A 4LCJA 3I6IA 4K6FA 1U2DA 3U3XA 3EAGA 2OUIA 3QVSA 4CR7A 1U3VA 1YL6A 4K1LA 4U5QA 2BGKA 2CZCA 2O50A 2YV3A 1ID1A 1MP0A 5ITWA 4BGVA 1Y5MA 4I5DA 4IDAA 5IZCA 3G0OA 3RFXA 2PKQO 2WM3A 1K5HA 3A28A 8LDHA 5IZ4A 1X13A 4OSPA 4P4NA 1GAEO 1R12A 3WYCA 3L4SO 3PZRA 2ET6A 3SJ7A 4FB5A 2BFPA 5KJCA 1O9BA 2XXBA 1YB5A 3U4DA 3RASA 1M67A 1ZBQA 1ZK3A 4RGBA 3PYLA 4Y8VA 4AJEA 1L7DA 4DYVA 2Y1OA 1HYHA 5A04A 4YJHA 4KTTE 1U3WA 2IXBA 1BVRA 5B4UA 4MKRA 4X54A 1GQ2A 4HFRA 1T4DA 5B37A 4FOOA 3GA0A 2E48A 5T8KC 4CQMA 3TFQA 3BTSA 3VPGA 4MKXA 2ZATA 1JQBA 3RJ9A 4DC1A 4N54A 5IZCC 3JQ7A 3EY4A 3OJOA 1RM3A 1Z82A 3LDHA 5EPOA 3U0BA 3JD4A 2PLAA 3NRCA 1PS0A 1UXGA 3IL2A 3BTVA 3K96A 3S2IA 3FPCA 3GAFA 5G0UA 1NNUA 3ZHBA 3EHEA 1I24A 3IUSA 5JO9A 3GVCA 4E13A 1GZ6A 3TRIA 3JQDA 1NPDA 1MA0A 4NR0A 2ZKLA 3IOYA 2PZKA 4R9RA 1R0KA 3PGJA 1ORRA 2JFGA 1YBMA 3KSDO 2O3QA 3P2YA 3AY7A 5I8WA 3VTFA 3PRJA 5L53A 3L0DA 4BL5A 1P0FA 4I9HA 3M1AA 4OKIA 3TJRA 2EKPA 5L4NA 4NJMA 2RHCA 3TWOA 2CY0A 3GLQA 4BGIA 2E4AA 3ZWNA 4CV2A 3I9NA 3E6AA 1J49A 4CMHA 5TIIA 1ZCJA 5A5EA 1XKQA 1N92A 1EUZA 1R15A 4BNZA 1GTMA 1R4MA 5CPFA 3D5TA 3ICPA 3WNVA 1KYQA 3FD8A 1XQ1A 1A7AA 1E7WA 2BKAA 3GRPA 3NTOA 2Q1UA 1C0KA 1P0CA 2BLLA 2VHZA 2G82A 4AJPA 2NSDA 5CDUA 4II2A 3BMCA 3AI1A 2VHXA 1TEHA 2V65A 1VC2A 2FZEA 2D5CA 2JCVA 5CG2A 3FHLA 3PYMA 2UV8A 4DUPA 4O0LA 1ISHA 2X0JA 2BH9A 1WNTA 4XQ9A 1Y7TA 2JHGA 2NU7A 3C8MA 4BHTA 3AW9A 1CJCA 3VZPA 4CMEC 3QVXA 3GR6A 2Q1TA 3Q1LA 1Y8QB 3PIIA 3Q11A 4G81A 1PEDA 1R66A 3GH3A 2OHXA 3GEDA 1D7OA 1EUCA 2QYTA 3HHPA 2QX7A 1GZ4A 4RVDA 4BKUA 1XEAA 4FBGA 1ZKMA 2VTEA 2W90A 3EDMA 1DBVO 1KY5A 3HDQA 3F46A 4XQGA 3OQ6A 1T24A 4GKVA 2GZ3A 1H6CA 2QRLA 2V6GA 3GDOA 1HSOA 1YJ8A 2AW5A 2R00A 1CQJA 1WLYA 2JD1A 3OJFA 1E0DA 4NU6A 2IYOA 2DTEA 3DHNA 1UH5A 5DP2A 1N9GB 2G76A 3MJTA 5THKA 4UEOA 2F1KA 1E1LA 2HSDA 3PWKA 4UVEA 2AQ8A 3LZ6A 1FDVA 3K6JA 2O3RA 4HBGA 1MC5A 3KO8A 4EYEA 3BHJA 1PQWA 1AGNA 3RD5A 3FTNA 3OQ1A 4IZIA 1P1FA 4RLSA 4UUOA 1WDKA 5COAA 3ZWVA 4AJ4A 4IJUA 1PL8A 4JBGA 1NQAO 4R1TA 4FD3A 1WMBA 2W2KA 1G6KA 4BO7A 4EUHA 3KETA 4GAEA 3OMLA 4YRDA 1XQ6A 2HMUA 1GPJA 3WYBA 1JU9A 2H63A 5C7IO 5L95A 1AE1A 4DGSA 5DCUA 1EVJA 1UDCA 1EDZA 3I52A 3ANNA 1LLUA 2ZJ0A 3RUCA 1C0IA 4ND5A 4MIOA 4J7CA 4NU5A 3WGHA 3E03A 1XDWA 1DLIA 2X4GA 2YDYA 3KOUA 1XWFA 3AI2A 3WNQA 5I7FA 4KUHA 4TZTA 2PKRA 2AG5A 3F4BA 5TC4A 3DZBA 1QLHA 3EYWA 3RUFA 5T5QA 2P5UA 3UW3A 3GPDG 2VQ3A 3H3JA 4JJFA 4S3MA 2I6TA 4AJJA 3GN1A 2WDZA 1ISIA 3ZWAA 3GZNA 4M8SA 5THQA 4YRBA 4YJHB 1WW8A 2POQX 2ZYGA 2EJWA 4PLCA 1L1FA 3IQDB 4BO6A 2EKLA 4CQMB 1MV8A 1W6UA 3SX2A 3JQ9C 2GCGA 1O95A 4FOSA 4GWKA 5DBIA 1QSGA 1EQUA 1UZNA 4YAGA 2FPGA 2Y0CA 3FWNA 4YACA 3JQ7B 3FPLA 5F1PA 5C37A 5L40A 4IDCA 5HA5A 3ZNNA 5CHEA 2HMTA 1E5QA 4RF2A 5C7LO 3AM3A 4PLPA 1Q7CA 4CV3A 4XWYA 4J9VA 1BXZA 3Q0EA 1NASA 3AUAA 3VKVA 3L6OO 3WGZA 5KJFA 3L6EA 1Z73A 1DXYA 3E82A 4BMVA 1WMAA 4FGWA 3AU9A 1HDZA 3GZ4A 2G5CA 4M49A 1U28A 4MVJF 5ER9A 1PWZA 2BFOA 2OBNA 2WE8A 4O5OA 5BNIA 5CEJA 4LN1A 2A35A 2I5PO 4Z9YA 4D41A 2VUTA 4J1TA 3G1TA 4A10A 4E0BA 3D5QA 4NJMB 4XQCA 1C0LA 1SAYA 5EINA 3KEQA 4MDHA 5IXSA 4CM3A 2ZTUA 3A14A 2ZB4A 3UUWA 3NJ8A 1GUZA 4M86A 4UEJA 4XKJA 5B4TA 4MP6A 5GZ6A 4NPCA 4UVHA 5KVVA 3ST7A 5HM8A 3UCFA 3BMQA 3PEFA 2C7VA 3N74A 5I9NA 1K2WA 3BTUA 1AUPA 1QLJA 4IPTA 1R4MB 4FGSA 1M75A 3GPIA 3IKVA 1HZZA 1ZEMA 2XXJA 3DOJA 3FF4A 5L45A 3QSGA 4TZKA 4NBRA 1AN9A 2O3JA 4RQTA 4GI2A 4ZICA 3R6DA 1EQ2A 4C4OA 3U62A 1LA2A 1ZJYA 3BMCB 1ZK1A 2VYNA 3WIDA 1ZMTA 2DC1A 4YT5A 3P19A 4GLOA 1WXDA 1Z7EA 2FMUA 3WWYA 5JYDA 2VWHA 3QP9A 1XYGA 4J1NA 3R3SA 3D64A 1JWAB 5KNLA 2C5EA 2DUUA 1E7YA 2YQ4A 4PLGA 3WLEA 1XG5A 2Y0DA 3FBGA 4XIJA 4R54A 5JAIA 3HDJA 1IULA 2O2YA 3H5AA 3GDFA 2VYVA 3ON5A 3E5MA 3DAPA 3WSWA 1DC3A 5LDHA 3ZW8A 1KVTA 2BFMA 1ADCA 1SC6A 5U4QA 3JTMA 4MVJE 4RVSA 3GGPA 4HADA 5BSGA 5AXCA 4KQWA 4QSMA 3CSDA 3LF2A 2NADA 1HKUA 4WCFC 1PGQA 3JD1A 3OIFA 3PJGA 2GR9A 4NMHA 3DHEA 4Q3CA 4PLFA 4IIUA 3H5RA 1MFPA 2C20A 2O7QA 4IDGA 3U4CA 2EXXA 4ALJA 1YQGA 4ZRNA 4C7KA 4FSHA 3EZLA 1BW9A 4L75A 4ID9A 4MVJA 3PYXA 4KP7A 2LDXA 2VOJA 3VVBA 2FR1A 1Q7GA 4Y6RA 4ZQGA 4D3DA 4XYGA 2VCYA 5HTOA 3GFGA 2DTXA 4BOYA 1PGPA 3V1YA 4ZD6A 3DTTA 3U9LA 4II3A 2OOSA 3QWIA 2WYUA 4IIVA 4OAQA 4KOAA 2C2XA 2W2KB 2I67A 1HETA 2VHWA 1YB4A 5AOVA 1VL0A 2P4QA 3LQFA 3LSYA 4GX2A 4L4SA 2A4KA 2NV6A 4CMKA 1O0SA 2HJRA 2QZZA 1ENYA 1ZZEA 2VT3A 2AE2A 3RROA 2EV9A 4DXHA 2Y67A 2Y66A 3AOGA 3S1LA 2Y1FA 2BI7A 4TWRA 2QG4A 5GY7A 3RU7A 3GVIA 2O3UA 4WASA 3OETA 3NYWA 5DCWA 2A92A 4BV8A 1IUKA 3GN2A 4DMMA 4YJFA 2XAAA 4ZVVA 2C7GA 4Z6KA 1VKNA 1I36A 1LRKA 5JDIA 4JXKA 2JAHA 1R0SA 2HLPA 2WWRA 4JCOA 2AE1A 1WZIA 3WYEA 5JAZA 4Q3DA 5A1TA 2GDZA 2P91A 5G4LA 4E5YA 2NNLD 4TVOA 1ZNQO 2Y0EA 2Q1WA 3QLJA 3GZNB 1H9BA 1PR9A 4R51A 4TROA 1RKXA 3T7EA 4BNNA 4BNLA 3VPSA 3JQAA 3GNTA 2HK8A 4R5HA 2Q2QA 3NAQA 2D8AA 1BSVA 2Q4EA 1LBEA 2O7SA 4CUJA 2JFFA 1KVUA 2CF6A 1GD1O 3VVCA 4B4VA 3ZV6A 1DEHA 2YFHA 1T2DA 3VZRA 3ADPA 1W0CA 1MXHA 2NVBA 2VOEA 3PGXA 4GSKA 4UVDA 5JAMA 3SLGA 4CLXA 4YVFA 2W4QA 3LK7A 1D1TA 4G2NA 3MJ4A 3LC2O 5TS3A 4XZ3A 3EC7A 3K2EA 5KVQA 2FN7A 1BGVA 3ZWXA 4FFMA 3BMOA 4DPMA 1ZK0A 3PLNA 3VZQA 1N7HA 1M6HA 2G1UA 1WDMA 5DBGA 5H81A 3R0IA 3DEYX 2W2LA 5EIOA 4JK3A 3PJFA 1EZ4A 4PG7A 4TKLA 1H6DA 4L76A 4ZU3A 1ZUD1 2UDPA 1HLPA 1ZXBA 2AXQA 3DOOA 4J7UA 1LJ8A 1Y5RA 1M76A 1E5LA 1N1GA 3PFWO 1YKFA 1A9YA 5T67A 1UDBA 1XLTA 3B70A 3BMQB 3O9ZA 3AM4A 4YAIA 4B3JA 1LTHR 3ZZNA 2X9NA 3V2HA 3P2OA 2VRCA 2QRJA 1UXKA 1JW9B 4N5NA 4NK4A 4PRLA 4DIFA 4MVJH 2Q45A 4I08A 5IG2A 2WE7A 4CM9D 1DJQA 4YT4A 1YDEA 1CF2O 9LDBA 4IS3A 1T2CA 1E3SA 4Q3AA 1PZHA 1ZJZA 3ZI0A 1UXHA 1YQDA 3ZHXA 1J0XO 3IDSA 3O8QA 1Q7BA 1XGKA 2BMAA 2P9CA 3LU1A 4OKNA 5ENDA 3L9XA 2X5KO 1PJTA 3ADOA 3DR3A 4DVJA 3X2EA 4QEDA 3MWDB 1UAYA 1LSJA 1IZ9A 1R0LA 3ZHYA 1QV6A 4H16A 5IF3A 2ZTLA 4YAEA 1AHHA 1E3IA 5TJHA 2OORA 4BNJA 3WGYA 3JQGA 1ISMA 5DP1A 2ZQYA 5A5FA 1QYDA 2I76A 4TKMA 3DQPA 4YYZA 5JDCA 4ZQHA 4GX1A 1KBZA 3QV1A 1GCUA 2HU2A 2VNAA 4PCVA 1VRWA 3WOHA 3BIOA 4KTVE 1EK6A 1I3NA 4P8RA 2X0RA 1UP6A 3UGKA 4D0SA 4I9NA 5T64A 4CLHA 5ICSA 3C1TA 4LMPA 2ZCUA 3JD0A 3G49A 5A9RA 3KLPX 1BW9B 4YA6A 2YV1A 5IDQA 2GSDA 2VHYA 5CDYA 4NIMA 1RPNA 4NH4A 1QRRA 4UAGA 1DC5A 3W8EA 1W73A 3TNLA 1ZMOA 1DAPA 3RFTA 4D42A 1GYPA 3PI7A 4Y98A 4CMIA 4M1QA 1XA0A 4E5KA 4Y6SA 1EVYA 4IQ8A 4LVUA 2DAPA 3E18A 3RUDA 3K92A 5IXYA 5BSHA 3E8XA 4K6CA 1VPDA 4OJNA 4TSKA 2UUOA 1H5QA 3QWHA 3RBVA 1KERA 1LX6A 4BKPA 5JDCC 4YBZA 3RC1A 5J23A 3PWZA 1NAHA 3MZ0A 2TMDA 2Y1CA 1UUFA 2J3HA 4KWHA 2CDAA 3D4NA 3DZHA 2EHDA 1PS9A 1TB4A 2PFGA 3HG7A 5CAEA 1Y6JA 4MIEA 3ZV4A 4L74A 3EVNA 3UKOA 1KVSA 2GZ1A 3RI3A 2O23A 3RUAA 3F4LA 5K6AC 4GPD1 5A3VA 2P5YA 1SNYA 4QFDA 1M2WA 4CV1A 1ZW1A 3R1IA 3WSVA 3Q6IA 1MUUA 1L7EA 3IS3A 1SB8A 4J7XA 3BMNA 4YJFB 5JS6A 2JCYA 3L9WA 4CM1A 1ADFA 3IJPA 5F3RA 5HWSA 1DPGA 3WDSA 4TRRA 3AFMA 5CEFA 5BSFA 1PGJA 2ZB3A 4Y6PA 1VM6A 4CR8A 1E3WA 2JAPA 4R01A 2PK3A 4FR5A 3KLMX 3WFJA 1P1RA 1XELA 3KHUA 4E2YA 4XJTA 2NTNA 4JROA 2PGJA 5T8KA 3JQAB 2I3AA 4IZHA 1DIBA 3E9MA 1IL0A 4K28A 1VJTA 3QQPA 5G4KB 3CEAA 3WS7A 5LDGA 4JJGA 3INTA 3AM5A 4BO8A 4LSMA 5DNAA 2XOXA 3ZWCA 4B79A 4D0RA 1E3LA 4ZHSA 3GUCA 3ETGA 2X1HA 4CR6A 1B7GO 3OQBA 2B83A 3PZBA 4FCCA 4UULA 1NWCA 1KC1A 4BO4A 3CINA 3O4RA 3PLRA 3WWZA 3W8FA 4QFCA 4Y9DA 1EK5A 2Y93A 1LDMA 3BHMA 4AJLA 3C24A 4C7JA 4FJ0A 4LISA 3BMOB 4OHUA 3JQEA 3FR8A 4NDNE 1WDLA 3EUWA 2BGMA 4H7PA 5JCJA 2Y68A 3X2FA 1CQIA 1GYRA 3AK4A 3WB9A 4WOJA 3W6ZA 1I8TA 1HZJA 3Q2KA 1ENPA 1EVIA 4F3YA 3PHJA 5T57A 2IRWA 3GK3A 5IDYA 1A4UA 3N7UA 5IDWA 1AHIA 4BNMA 2W8ZA 2WYVA 3IKTA 4IGFA 3DFUA 4PG5A 3HSKA 3RSHA 1PL7A 3I9LA 3TOZA 4WEOA 5IDXA 1ZK4A 4XR4A 2HJSA 4LVCA 1P9LA 5F1KA 4OQYA 4OOEA 2JHFA 2IZZA 3PHIA 3MJCA 2B36A 4GSLA 2DFVA 1NVMB 4CMEA 1NFFA 3AWDA 4BNHA 3D4OA 2CDBA 1U1IA 1P77A 1DB3A 3O8QB 1YRLA 3H2ZA 4GLLA 4RLHA 1T25A 4PLYA 4YB8A 4R3WA 5U9CA 1BVUA 4IQ0A 1CYDA 4E31A 1LC0A 3DTYA 1Q0HA 4WLEA 2WMDA 3H9EO 4WNCA 4DQVA 1XU7A 3ROMA 5L7WA 3OBBA 3GUYA 4IMPA 3S55A 4ALKA 1GV1A 4YQYA 2PY6A 4J1QA 2EERA 4NI5A 3JQGB 3I83A 4MINA 1ZIDA 1DC4A 2I66A 1U7TA 4IJWA 3KYDA 3DZFA 4G5HA 5ENVA 1DIGA 3MEQA 3NT2A 2OXIA 3V1TC 2NVWA 4DWVA 3CE6A 2H1SA 4XB2A 2DPGA 2OZPA 1R6DA 5LCXA 1JVSA 1NHGA 5G2OA 1A7KA 4CPDA 3MCVA 1I33A 1PR3A 3LT1A 2ZTVA 1C14A 3CTMA 1T2FA 3NT4A 5C7OO 4JBHA 2JL1A 3LT2A 1O94A 4XCVA 2BD0A 2CMDA 2NU6A 1PX0A 1YH3A 3CKYA 4I1IA 4CMIB 4DBVO 3W4JA 4ILKA 2Z1MA 3RKUA 1ZFNA 4HFMA 3ZWWA 4R4JA 3GMDA 4FS3A 1EVZA 4RORA 1YB1A 3OJEA 3I9KA 4IDDA 5KJ6A 1VE9A 1IHXA 3WGTA 3ZW9A 1KY4A 3ZU4A 5JXWA 3PHGA 2UUPA 4D7AA 4GQAA 1PJQA 2YUTA 4NNJA 5JPIA 1IY8A 1QP8A 1UZMA 2ZCVA 1A27A 3FBTA 1WP4A 4J4HA 3HE3A 1Y81A 1SBYA 3DC2A 3BXXA 1FJHA 1CIVA 1LXCA 2YDXA 3GEGA 4DIOA 1N7GA 1OC2A 2J6IA 5DT9A 1GDHA 2V6BA 4DLAA 3ZCXA 4H15A 1UXIA 3Q9NA 4YT2A 5TLSA 2GF2A 1H6BA 4OYRA 3BMNB 4IY1A 4NK5A 4BGEA 2GNAA 1PU2A 2P9EA 4KDFA 1FDUA 4PG4A 2UVDA 4I5GA 3U09A 3ZU2A 4WECA 4OL9A 3LVFO 1YJQA 4M87A 3U49A 3KTDA 1E3EA 1E3WB 5L3ZA 3C7CB 2VN8A 4ROSA 1I32A 1QXSA 3I6QA 1X0XA 5KJEA 2V6FA 4A7PA 7ADHA 1KIFA 4MVJI 3H5NA 5T6BA 4CLEA 3O38A 4M89A 3JQ9A 4QO8A 1GY8A 3FWZA 4LMRA 2QIOA 4B3IA 2J3IA 5AQ1A 1ENOA 4PLVA 2NTVA 2V7PA 4LW8A 5C3MA 2OO5A 4S1VA 3WBBA 3Q2IA 5ITVA 3PQFA 2HUNA 1GQYA 2B37A 1BDBA 3A06A 1NWHA 2AEMA 5CFZA 5BNTA 3DHYA 4P22A 1QORA 4ND1A 1B8UA 3PDUA 3TF5A 3EGOA 3U4IA 1B0AA 3S8MA 4RJTA 4YRAA 4BNGA 1IZ0A 5I9LA 3IIEA 3PDJA 3PHLA 2NU8A 4FJ1A 3F9IA 5TGDA 4MVJM 2DM6A 5MDHA 3KM0A 3HJAA 1ZSVA 1X7GA 3ZWOA 5K9ZA 2FSSA 4PLZA 5A03A 1QMGA 3IJRA 1E7SA 2A94A 4U6QA 2YHIA 1DDOA 1W4ZA 2I99A 4CM5A 2R2GA 4MOWA 1K89A 1GEGA 3AFNA 3MTJA 3PPIA 3HB5X 4KUEA 3BTOA 2DQ4A 3RJ5A 4PVCA 1QG6A 1JAXA 4BUCA 4U8GA 3RUHA 5A9TA 2GRAA 3INRA 2Q3EA 1NQTA 3FTPA 2ZQZA 4XYEA 1GR0A 1HF3A 4XGNA 1UXJA 3H9GA 4CODB 2ZYAA 5AXBA 4CQMD 3OECA 1F12A 2HMWA 3G3EA 1CDOA 1X1TA 1NTOA 1ZSYA 4ALMA 5ICMA 1GU7A 5CDSA 1KEWA 1X14A 4WJZA 4MJLA 4CL8A 2VRBA 1SEPA 3B6ZA 5JE8A 4KQXA 2PV7A 2QHXA 3FNEA 5TT1A 1AXEA 3ONEA 3GGOA 3NGLA 4MO2A 3H8VA 4KMSA 3DBHA 4QUKA 1NR7A 4W4TA 4FDAA 3IMFA 1Z75A 4PG6A 4ONEA 1QYVA 1SZJG 2FZWA 3DONA 1YO6A 3O26A 1JWBB 3ZHZA 3WMWA 1PGOA 2BF7A 1GZ3A 1I3KA 1QV7A 1JVBA 2OP1A 1FDTA 4PLHA 1LLCA 1ISJA 2WEKA 4NJOA 1IOLA 1I30A 5EL0A 4FW8A 8ADHA 5JW6A 1TT7A 2HKIA 1T2AA 1EUDA 4YT8A 1R4NA 1K6IA 4IQGA 5L4LA 4BNIA 1MLDA 4HP8A 1E7RA 3W6UA 4U0KA 2HDHA 4WCDA 2E37A 4XDZA 3WGGA 3ZWPA 3M2PA 4HKTA 4WCFA 6LDHA 1EFKA 4DLLA 4CM7A 4IM7A 5EJ2A 3KYDB 1OAAA 5EQDA 1B15A 2DKNA 3GEMA 4XJSA 2DLDA 4P4LA 5L7YA 4RZHA 4EW6A 2JD0A 3S2EA 3IUPA 2X23A 5A4DA 1VLLA 2NTJA 3O03A 3TPCA 1RM5A 1TA4A 1C1DA 2Q2WA 2D2IA 3PHHA 4XYMA 4OH1A 3KVOA 3DBLA 4E5NA 4RPJA 1XHLA 4B4OA 2J3JA 5A9SA 4GGPA 1KEVA 4FJ2A 4A26A 3UF0A 4MVJP 1K3TA 3KRTA 2VTDA 2IEBA 3EVTA 4QTZA 3VPXA 1K0UA 2RCYA 3H65A 1SOVA 4IDFA 3GNQA 4E5PA 1EDOA 2DT5A 3QIVA 5G0WA 2PZJA 2CVQA 1V3TA 4ITUA 1B3BA 4BO1A 4E2XA 1SCUA 2C59A 4OMUA 4JP2A 1MB4A 3H9QA 4CM6A 3NKLA 2Z1NA 4EBFA 1G1AA 2CSUA 1DLJA 3LLSA 5DBFA 4CQLA 2RAFA 5AVOA 1MC4A 3WGQA 1UJMA 1PWXA 3W8DA 4BQPA 4CMAA 4Q3BA 2NQTA 5FI3A 3IP3A 3NTQA 2O4UX 1PZEA 2I9PA 4RPHA 3RC2A 1VSVA 2D59A 4MKZA 4WE3A 4NBWA 4CLOA 1LDGA 3K31A 4ZQFA 4YXFA 3TQHA 3GMSA 4EJ6A 2OL4A 4AICA 1NVGA 5DULA 1Q0QA 4DBZA 1FXSA 2DUWA 4ZQBA 1WVGA 3VTZA 2JJYA 4K26A 4CMJA 1PZFA 1Z45A 2Q1SA 2VUSA 1NQOA 4R16A 4J9UE 5F1OA 2X8LA 3SEFA 4YDRA 1BMDA 5FFFA 3COSA 1NR1A 1UAGA 5DDIP 1QYXA 5H83A 1A72A 2J5QA 4MPDA 4I9UA 1R16A 3D0OA 1PL6A 3SJUA 1U5AA 4WKGA 1H6AA 1T26A 3P7MA 2ZYDA 2RBEA 5F21A 1EFLA 4ALNA 3RQSA 3VOSA 1PSDA 4R69A 3F1LA 5BT9A 2ZK7A 3H7AA 3ETEA 3DL2A 2DBVO 3C1AA 3D7LA 3ZN2A 1G0OA 2P2SA 5G0VA 4INAA 3V2UA 3RBZA 2H9IA 3CPSA 4E5MA 2VHVA 2CUKA 1F8GA 1PJ4A 4CUKA 3DMTA 3QE3A 1XU9A 1R37A 4IXTA 4Q3EA 2C07A 3NV9A 4BO3A 4E33A 5JLAA 4AJ1A 2EGGA 3VDRA 4RDIA 4P38A 3PVZA 4B8ZA 2J8ZA 2D3TA 3BAZA 2FHSA 1LSUA 3CMMA 4J43A 3AJRA 1ONPA 4LSWA 3W4IA 4NZ9A 3OFSA 1M6WA 4AVYA 5HRUA 3EW7A 1YVEI 4NFHA 4J91A 3WG9A 3HFGA 4GX0A 1B8VA 2HO5A 1B26A 5TQVA 4GL4A 4I5FA 4R68A 2AA3A 1PJ2A 3GC6A 3JYPA 4FFLA 4YTEA 4M55A 2YHIB 4LRTB 3KSUA 4JQCA 5BNFA 4BNVA 4PVDA 2HRBA 1FDWA 5F5LA 4PN3A 1NPTO 3GF4A 3L07A 4NQZA 5COBA 3F6YA 3PK0A 3I5MA 3QJ5A 1A4IA 3DMTC 2NUAA 4FQ8A 4Z3KA 1CEQA 3OA2A 2FR8A 1JKIA 3GHYA 1ZEJA 3F3SA 4D3FA 1HLDA 2DFDA 4GH5A 5MGBA 1W8DA 2OP0A 3UFXA 2FR0A 5B12A 3JQBA 1Q0LA 4Z9FA 2AG8A 3G1UA 3UHAA 4TRMA 3JYNA 3TZQA 5JFOA 4L4XA 1YDWA 1NX6A 4ND4A 2BI8A 5KVSA 5EN4A 3DWFA 3DBHB 3GVHA 4O6VA 1RYEA 5FYDA 4CMGA 2E49A 3JQFC 4DIBA 3WGIA 1E6WA 2DVMA 3K73O 5DF1A 4E6PA 4UUPA 3EMKA 2VWGA 2EP7A 2B4QA 4CLRA 1YWGO 2JD2A 3BA1A 2NACA 2X22A 3VZSA 4L0QA 1V35A 1GEEA 5KCZA 3E9NA 4A2CA 4D3SA 3AU8A 3LLVA 1DSSG 4DQUA 1YOVA 2ZJ1A 4MP3A 1PTJA 3JQBC 4PGFA 4ZJUA 1LRJA 3KSZO 2GO1A 1NM5A 1E6UA 2EIHA 5EQFA 4DLBA 1R4NB 4IS2A 1DHTA 1RWBA 5JC8A 3PWSA 2FPIA 3ASUA 3JD2A 2CF5A 3D3EA 2B4TO 3L4BC 4DTIA 1BWSA 4HFNA 1RYDA 1YE3A 3GG9A 4WCFB 3KYCA 2IE0A 2Q2VA 3DBVO 3W4KA 2FWMX 3ZH2A 2X9VA 4E4YA 3GT0A 3W1VA 1V8BA 4EITA 1B14A 4BO9A 2VYND 1NFQA 2WD7A 2H5LA 1C1DB 2DU8A 1N2SA 1ONOA 4HFJA 3DBLB 5A9SB 3FRJA 1T1RA 2NVUA 1BDMA 1P1JA 1E77A 3UCXA 3GHHA 1SMKA 1HE3A 1FMCA 3UICA 4L4RA 5JCXA 5JY1A 2VYVD 2CD9A 4D44A 1NBOA 1F06A 3HB4X 3K5PA 1S7CA 2YYYA 1GV0A 5HBRA 3OIDA 3TL3A 4ZQEA 5KVCA 1HSZA 1QKIA 1T2EA 2XF8A 2JCXA 4F6LA 3ITDA 3KYBA 1IPFA 5L4SA 3KV3O 4L73A 4DL9A 4J0EA 4GGOA 4MIYA 2EJVA 3HZZA 4MVJG 2DBRA 3H4VA 1IYZA 1E1KA 3SLKA 3DO5A 3I1JA 4PLWA 5TJ9A 4O59O 4CLOB 1ISGA 1SEVA 1HDGO 4BGUA 5K6AA 3FSRA 3K30A 4JGBA 2DTDA 4W7HA 2TMGA 1DRUA 1PZGA 2RIRA 3IP1A 3MJVA 4MVJD 3TZ6A 3ABIA 3SBOA 1A71A 4ZGWA 3ICCA 5IJZA 4I5EA 4ND2A 3OEWA 3QWAA 4ALIA 2Y1GA 2P9GA 2QYSA 4WPGA 3ZNQA 3WJAA 2X5OA 2JKVA 3K8ZA 4DPLA 4J16A 3SC6A 2HK9A 5U1PA 2HCTA 2O3TA 2IYPA 3LF1A 3TL2A 2G0TA 5IN5A 4E12A 5TX7A 1D3AA 3JCZA 3QW2A 3VAZA 1UP4A 2PKQP 2YV2A 1GYQA 1BHSA 1RJWA 4Q39A 4B7UA 1MFZA 4JJIA 1U3UA 1ADBA 3UAGA 3WIEA 4GMGA 3B1JA 3MWEB 1PJ3A 4I8XA 4EJMA 5JSFA 3GY0A 4R1UA 3VC7A 5K0ZA 4J4TA 1U5CA 5GZ3A 1BTOA 2EGHA 2IEDA 3Q9UA 1LQTA 4BVAA 4HX5A 4CUZA 4J0FA 3B20A 4UUNA 3OSUA 2PD6A 4FFRA 2E6UX 1UDAA 2RH4A 3ZV3A 3B1FA 3MJEA 4XR9A 4FN4A 4PZEA 3H6KA 4YEDA 1DIRA 4W9NA 3DDNA 2D1YA 3ANMA 4BNFA 4RVUA 4BKQA 3M6IA 1BRMA 3DBRA 5EESA 4UVGA 2UAGA 1EMDA 1JN0A 1VSUA 2X0NA 4BO5A 1HE5A 2FP4A 3I23A 3SC4A 1JKFA 4PZDA 2C54A 3WQSB 3DAFA 3JQAD 4A73A 2Y1DA 2GD1O 4BKOA 4D45A 3WLFA 2YY7A 5CDGA 2Q4BA 1SOWA 5KJ1A 3ORFA 4NG5A 5HS4A 1JA9A 3DZJA 2EEZA 3INGA 3JSAA 3GOHA 1U3TA 4UREA 3NDIA 4W9NC 2E82A 4Y67A 3VH4A 4E21A 3MTGA 2DBZA 3ROQA 4BMNA 3JYOA 4HWKA 1YXMA 1NVTA 3GAZA 2YHUA 2IXAA 1PQUA 3FNHA 1HDOA 3C7DB 4F6CA 1LDEA 3OH8A 2AQIA 5TNXA 3T7CA 4QT0A 2IDZA 1P33A 1GQQA 4F45A 5C5IA 4CLRB 2FRDA 3C3XA 2W2LD 4R1NA 1M66A 3LC1O 4IBOA 5JO0A 3DZKA 3TDKA 3F5SA 4P4GA 3HDHA 4Z0PA 1B8PA 1KVRA 5CG1A 3RBXA 4YPOA 1HL3A 1U2GA 1YOVB 3VH2A 2O2SA 1BG6A 2D4AA 3N58A 3S2GA 2X86A 5F5NA 1E92A 1FF9A 2PZMA 4WUVA 3DB2A 1LUAA 3IC5A 4RO0A 1V3VA 4OGWA 1MG5A 3MJSA 3VKUA 4NHEA 5CEEA 2H6EA 3KYCB 2VRCD 2WD8A 1KS9A 5JC1A 4BV9A 3GRKA 5FI5A 1K6XA 1FK8A 1LDNA 1ZXLA 1NPYA 4F46A 5A3JA 5JYEA 2J3KA 3GVXA 2BELA 2CNBA 1DHRA 4JLWA 4D46A 5I7SA 4EJ0A 1Y1PA 4BKRA 1P1HA 1KEPA 2WD7B 1IHYA 3WJ7A 2ZB7A 4BS9A 3QHAA 4AJKA 5B1YA 3QVOA 4QO7A 4YWJA 1F14A 2D5AA 2NVUB 4BNTA 1KETA 2FSVA 3GGGA 4U7WA 4KWIA 4BNKA 3I4CA 3R3JA 3NEPX 3NGXA 5KKAA 1GCOA 1NFRA 4YR9A 1V9LA 1QYCA 2PR2A 1NP3A 3HUDA 4LRSB 1PJCA 1HXHA 4LK3A 1LEHA 3F5QA 4KZPA 2ZIZA 1HRDA 1NAIA 4K9DA 2O3SA 1DIHA 3ZV5A 4RF4A 1OMOA 2Q49A 2R6JA 3QWBA 5AXDA 1T1SA 4UVIA 5DOZA 4HUJA 4GBJA 3NDJA 4XGIA 3SXPA 2X5JO 4RPGA 1HYGA 4BNUA 4EDFA 1LSSA 4RZIA 3H9UA 2EF1A 5JMPA 1UR5A 4XRGA 4NFSA 1A5ZA 5I9MA 3RWBA 1YQXA 7MDHA 4ZN6A 3TZHA 2I65A 2OGUA 5HS6A 2ILTA 2UYYA 4IMRA 3GFBA 3VDQA 5B4VA 1I2CA 2PGLA 2NU9A 4WLVA 3ROKA 3QVTA 3M2TA 4LGVA 1P74A 2DBQA 3H2SA 1NYTA 2Q50A 2PWZA 4RCVA 5IAAA 3NUGA 2NQ8A 1O8CA 2HMVA 5BQFA 2P4HX 4YAJA 3GNSA 1DJNA 5BSEA 1P3DA 2VNSA 1E7QA 3ONFA 3DAGA 3P5SA 5EERA 5A06A 2QQ5A 2NM0A 1Y9EA 1V3UA 1HE4A 3JV7A 1V6AA 1DOHA 1JDJA 1HE2A 3C7AA 2YW9A 3HWRA 2PD4A 2Y1EA 4WGGA 3HQ4O 4HNHA 4XX0A 2CFCA 1P1KA 3NX4A 3UN1A 5BR7A 1IE3A 2YQ5A 3NT5A 1YL5A 3V8BA 3QA9A 3OJ0A 2X6TA 4AJNA 2OFPA 2NWQA 4ESOA 3BZUA 4E30A 3DXFA 3F1KA 1TT5A 1ARZA 2PH5A 4FC6A 4QXMA 1P31A 3H9JA 2R00C 3AI3A 3C1OA 3DBRB 2HRZA 3VPHA 1VI2A 1LNQA 1FDSA 3SVTA 4IDBA 5DOVA 1RM4A 1DFHA 1U8FO 4FFPA 2P68A 1VJ1A 3G79A 3UXYA 2YZ7A 3CIFA 3ZU3A 4RPKA 1DRVA 4O1MA 4AFNA 3AUUA 4E3ZA 2PTGA 1EBUA 4Q3NA 4XA8A 4RDHA 1H9AA 4BO0A 2JFHA 1D8AA 5JAQA 1I2BA 1I10A 1XCBA 4GX5A 2YFQA 3K2BA 5ADHA 3ENNA 4R41A 3RU9A 1LSOA 5KTKA 1JKJA 1OFGA 3ROPA 1GADO 2BGLA 4U0JA 3ETDA 1JLLA 3B1KA 3LT0A 5ES3A 2IZ0A 4BNWA 2VWPA 1VKOA 1PQPA 1CERA 4UUMA 4OSOA 4A5OA 4OOFA 1F17A 3NTRA 5DCYA 4RVHA 3KUXA 4WLNA 5KWEA 5JY6A 4D79A 3DZGA 5JCJD 1GUYA 4B4UA 1XIVA 3PQEA 3DOCA 1GFSA 5FWNA 4XGKA 4KUGA 3RC9A 3UH1A 3GVPA 3JYLA 3QY9A 3E48A 3V5NA 2VT2A 4OO3A 5KOIA 4AJIA 4CM8A 1J4AA 1PGNA 5G0TA 3RUEA 4AJOA 2X9GA 4W82A 4OQZA 4J1SA 3WMXA 1J6UA 1TXGA 3JYQA 3OA0A 2O48X 4TQGA 4DA9A 2C0CA 1ZK2A 3RKRA 2B35A 2PZLA 5JMWA 1ML3A 5G0SA 2HQ1A 3WQRA 4BNYA 4XDYA 4AG3A 2B4RO 4CV0A 4CJXA 4E2ZA 3KZVA 3OIGA 3VH1A 4J2HA 1VL8A 3DFZA 4EEZA 1C1XA 2AMFA 2GN8A 2B69A 3H3FA 3HNPA 4Z3DA 2Z5LA 4HY3A 1OZAA 2SCUA 4J4BA 2AHRA 3CUKA 2X7HA 4JBIA 4QECA 5ILGA 1WPQA 4R3NA 2VZ0A 3TZCA 2W98A 1NXQA 2B0JA 4CM9A 1ZH8A 5L51A 3OP4A 2WYWA 1K6JA 4RL6A 3ZWBA 3I9JA 1H2HA 1O89A 3G17A 4YJGA 3RC7A 4DPKA 4DQXA 4PLTA 3E5RA 2PA3A 3OJLA 2IODA 5TRTA 5ER6A 4KDEA 5GZ1A 4J6FA 4YJDA 1U4OA 3VHRA 1HDYA 3CMCO 3AY3A 1EE9A 3D4PA 2EW8A 5EMHA 1YGYA 1E1NA 3GG2A 3PTZA 1BXGA 3MOGA 2V6MA 4Z0TA 5AXAA 2AEJA 3CH6A 4CM4A 3PQDA 4XD2A 3E9QA 3ZNOA 1O5IA 4QQRA 1WAMA 4GMFA 3KBOA 2VZ9A 4IJKA 1NQ5A 1UP7A 4R1SA 1DO8A 4PRKA 4DRYA 2AQHA 4BNXA 1VL6A 2EKQA 3WTBA 2QZ9A 3D1LA 2VZ8A 1JAYA 3I9OA 3OM9A 3C85A 1E3JA 3ANLA 3EK2A 1ZO8A 3HADA 3HDYA 3PP8A 4PZCA 4B7CA 4E32A 2I3GA 1N8KA 4G65A 4BO2A 1H93A 3TZKA 1MGOA 1C0PA 3T4EA 5COQA 1HT0A 3ONDA 4D43A 2FY8A 1X7HA 1SO8A 2GN9A 2LDBA 2PD3A 5IFLA 3OF2A 2X58A 3A9WA 3JQ8A 2C29D 1NHWA 1PS8A 1KVQA 3V1UA 4DYDA 3FI9A 4ND3A 4E2WA 2OBYA 4XB1A 5FF9A 4B3HA 1LDBA 3FCOA 3LYLA 2HMSA 5CDTA 3VH3A 1LC3A 3D3WA 3OEYA 1I3MA 2A9FA 3CXRA 3GDGA 3JD3A 2BFAA 4RVGA 1N1EA 1LLDA 3EZYA 3AUTA 5CPBA 3WGOA 4EUEA 3ZU5A 4RQUA 4QX6A 1AXGA 3UVEA 5JBIA 1H94A 1B2LA 2J5KA 4WK6A 1J5PA 4TRJA 3I4FA 4RF3A 3ASVA 4J49A 1G0NA 1I2ZA 2ZB8A 1I01A 1CWUA 2Y05A 1U7HA 2EW2A 1GPDG 1PJBA 4PG8A 2ZTMA 1TT5B 2B5WA 2X0IA 3WTCA 1ISFA 3STHA 5IN4A 3PXXA 2BHLA 3ZWYA 3KXDA 4GVXA 5I8ZA 4J90A 1HDRA 2Q46A 4IJVA 4BMSA 2C82A 2PGDA 1PJSA 3ZWMA 4HNGA 3GQVA 4JIGA 4XIYA 1ZVMA 4B4WA 2HK7A 4R9SA 1I5RA 1SPXA 2CVOA 4BIIA 4JNKA 4YQZA 1Y8RA 2WSBA 3HN2A 4NBVA 1PIWA 1DFIA 1WWKA 3QVWA 2EG9A 4N5MA 1XSEA 2Y99A 4AJHA 1HDCA 1LU9A 1X15A 3IAHA 4TRNA 4A03A 2GN6A 5I7EA 1IB6A 3JQFA 3LT4A 4PFJA 4HXYA 1Z74A 3HFSA 2AQKA 3WQQA 3LC7O 2GERA 4TVBA 3PJDA 4XRRA 5GMOA 1F0YA 3RIHA 4WNIA 4N18A 1Q2XA 2GLXA 2HAEA 4XQEA 4XYBA 4ZA2A 4ALLA 4ZRMA 2QW8A 3TSCA 1GL3A 5I7VA 5G4KA 3U5TA 5DN9A 1P44A 5TF4A 2PH3A 2GGSA 5A02A 3L4BA 9LDTA 2WTBA 1KC3A 4XEHA 4H3VA 4RPLA 4TMFA 1HWYA 1YONA 3AOEA 2Z95A 5CP8A 4CM8B 1HYEA 4FIZA 4JP3A 4OM8A 1DFGA 5JDIC 3KB6A 3OHSX 1LDYA 1LI4A 1HTBA 3TFOA 1ULSA 1LQUA 3U4HA 3T4XA 4IDEA 1DRWA 2GZ2A 1I0ZA 2G17A 3A1NA 1OC4A 5LC1A 4FFOA 4N5LA 4YAKA 4YCAA 4N7RA 4A27A 2QRKA 1YBAA 1RM0A 4DREA 2GYYA 3PJEA 5L7TA 2RHRA 4J3FA 1QYWA 2O4CA 1SB9A 1ULUA 4BB5A 1C1XB 1WZEA 2GN4A 3RUIA 3PIDA 2Q99A 4GWGA 4J2OA 4FFNA 1T4BA 2J5RA 4CMBA 4L8VA 6ADHA 1E6EA 4Z0HO 3ULKA 2GPTA 3AOEC 4OXYA 4RVFA 3NJ4A 1X0VA 2BRUA 5K1SA 1QR6A 5JNLA 2FOIA 4CL3A 1YS4A 1U8XX 4BQRA 1TLTA 3DMYA 2GASA 1E7MA 2CDCA 4YJGB 5ILOA 4LCEA 2YJZA 3A4VA 1DC6A 2GUGA 4IINA 1Q1NA 1D4FA 1ONNA 1OBFO 1YBVA 3WFIA 4W7IA 1F8FA 1CRWG 1CETA 1PJLA 4RF5A 3NDRA 3WX0A 1MG0A 1N5DA 4IUYA 2NLOA 1BXGB 3ZDFA 3ZGYA 4CM4B 5H82A 3Q3CA 4AJ2A 1TVEA 1ADGA 4RV9A 3UCEA 1OI7A 4DC0A 2D0IA 3MOIA 4DMLA 5KIAA 4CMCA 1LLQA 2EP5A 1ENZA 4OIMA 2XPCA 3DZIA 3KEOA 5FEUA 4CLDA 1E1MA 4GKBA 4FPXA 4CQLB 3WBFA 4JX8A 1C3VA 3WXBA 1LRLA 2C2YA 3L6DA 2RH8A 3OICA 1VJ0A 1A9ZA 3QWFA 1Z6ZA 2VWQA 2WJPA 3TOXA 4UEKA 3VPFA 1X7DA 1EBFA 4XYLA 4EGFA 5AYVA 1O6ZA 4IXWA 3JQ8B 1MXFA 2AEFA 2F00A 3CZRA 3WR5A 3JQCA 3M1LA 1YL7A 1MX3A 2B5VA 3JQ6A 1Y8QA 1H2BA 4EI2A 1X1EA 4R5MA 3BYZA 5L9AA 1UZLA 3V2GA 3D3WB 1S6YA 4EZBA 3BHIA 5DZSA 4PIVA 2IZ1A 1DAOA 3RFVA 4EUFA 3I3OA 4OXNA 1DIAA 3TN7A 3PFFA 1BXKA 4WLFA 1D1SA 1I3LA 4NBTA 1EE2A 4W99A 4URFA 3UOGA 4HV4A 3K9QO 4WOKA 4A0SA 3RCBA 5KKCA 1XR3A 4M54A 1U4SA 1P45A 1EEHA 1GUFA 4WLUA 2PNFA 1IPEA 4NFYA 3FR7A 5A05A 4O63O 3S2FA 4IGEA 4JN6B 3F47A 3L77A 4MP8A 4GVLA 3AUSA 4OXKA 1N9GA 1KOLA 4BB6A 1HDXA 3FNFA 3CZMA 2EWMA 4NBUA 4FC7A 4Z9XA 4U6SA 5TSDA 4B7XA 3ENKA 3HN7A
chains in the Genus database with same CATH superfamily
1M1ZA 1XMQB 3NBXX 4EPRA 4KREA 2IEIA 1CEYA 1ZSNA 3FN4A 2QSYA 5PGMA 3MQFA 3AVPA 3CH7A 3QEKA 4WLOA 4A8HA 4AL4A 4EEXA 1T1EA 2OMEA 2Q21A 1A97A 2XNDA 1P61B 2ODAA 4KYTA 4EHNA 2XCTB 3LW8A 1B00A 4EMUA 3BJIC 4A6XA 4B8WA 4B40A 3QRWA 3RS0A 3ZBPA 1HEUA 4F1KA 3GEBA 3RAJA 1C9KA 2FWJA 1Y9AA 4RSHA 2P1DA 5CNKA 3E1KA 3QVGA 2B1RA 2WFMA 1B16A 2DKOA 1K9SA 5K45A 4M4SA 2HCJB 5CVEA 4BEJA 3HJFA 4MJ7A 1LF0A 2VCEA 2C4VA 3I6IA 3OEED 2ODQA 4RK0A 4URYR 5HFNA 5JRZA 2UYQA 3EAGA 2OUIA 3QVSA 4NZZA 1U3VA 1G63A 2J0UB 4K1LA 5E7MA 2BGKA 4O3MA 6NULA 5E7IA 2R5NA 4LRWA 3WIBA 2YV3A 1ID1A 1X8KA 2IHNA 2AW3A 3BE5A 5IZCA 1M73E 2OK8A 4FZ5A 4HEA1 3G2OA 4O2RA 4YHBA 2ATVA 5AW5A 1I80A 4GOLD 1HOTA 5EIBC 4J0QA 1A3CA 2IOFK 2DHQA 2PWAA 1JIKA 1KOFA 3L4SO 3PZRA 4FX2A 3SJ7A 2GDJA 2QY6A 3FNBA 2B1QA 2WT4A 3GIWA 4FB5A 4JL8A 2XXBA 1SHZA 2XCIA 1QGOA 4XX1A 3U4DA 3AMVA 2CLDX 4MQ5A 2VF7A 3SYTA 3SZRA 2WZQA 4E70A 1UKBA 3EHDA 1BAPA 5IABA 1HYHA 2QT1A 4PIMA 4KTTE 2YN0A 1IONA 5A04A 1U3WA 3S4YA 1YIAA 1J22A 2VPXA 5J40A 1ZGGA 3I8SA 1GQ2A 4QJ5A 3ZBQA 2BMFA 1QF7A 5H3LA 3ZYZA 3Q85A 3LOPA 3EC1A 1LF5A 3VPGA 3NTVA 5IJ9A 3W6NA 2ODBA 4IF4A 2IYRA 3L01A 5D8DA 1M0SA 4X94A 3RK1A 4ZI7A 4NYJR 1IG3A 2GN1A 3FAZA 3NPAA 3OJOA 4X63A 5DM4A 2VJDA 4HDMA 1RQRA 3L8FA 1XK7A 3LDHA 4FT4A 4NEGA 5FFNA 2CDRA 4V0MA 3ZK9A 1V6SA 3BWYA 1UXGA 2E18A 2PBRA 5JWRA 3RC8A 1L4EA 3S2IA 1FTYA 3AEUB 1PK9A 4LRUA 3JPWA 1WZUA 3L49A 4CXMA 2NYVA 5CH8A 3EHEA 2CE7A 4E13A 2JI4A 4JS0A 1GIAA 1MA0A 1CZHA 4KFTA 5KTPA 1PDOA 1SG0A 3AHFA 1N4DA 3FM9A 3IOYA 2PZKA 3SICE 1UQUA 1KE1A 4IO0A 3PGJA 1CZUA 4P7GA 2WWIA 1QG4A 2A0WA 3LQQA 3AY7A 5HRCA 3PRJA 1QHNA 3DAHA 5L53A 5FEMA 5BVHA 1F9EA 1DAKA 1S9DA 1I7NA 4I1PA 2RHCA 4GPTA 1OBCA 1QO0A 2XTZA 1N5LA 4HGQA 3MLBA 4K9RA 2I1QA 3ZWNA 2GF9A 1L5HB 2N0SA 4JT9A 3NBAA 2CXNA 5FAXA 4FGJA 2JAWA 3SM3A 4MO9A 3RVMA 1KZ7B 1XKQA 1KI6B 1EUZA 3NETA 3R6LA 4D8WA 1JDZA 1GTMA 2J9FA 3IE1A 3TECE 1T5LA 5FFMA 4PM4A 4BN4A 2FFAA 1C3OA 4ENRA 3HHEA 1E7WA 1EJ0A 4JR1A 2Q1UA 1C0KA 1E0SA 2BLLA 5KNBH 4N8DA 1E63A 4Y0VA 4YAWA 3A9UA 1SHUX 2JAXA 5JRJA 2NSDA 4RSGA 3AI1A 3WJ1A 4X91A 2NAFA 4LNHA 5CG2A 1IHDA 2FPXA 4DUPA 3ECSA 3V2IA 1UK7A 2BH9A 3T3HA 1UQRA 4XQ9A 3V55A 1Y7TA 2JHGA 1ZR4A 4KFSA 1TUBB 2QD2A 4B0OA 1N2EA 2RC5A 1IJEA 1PNOA 1XL1A 2IDMA 2J9ZB 2Q1TA 3Q12A 3Q1LA 3WOVA 3VISA 5IVPA 1JNYA 1ND5A 1Y8QB 3GJ7A 1EDBA 2E4XA 2ZWIA 3PC6A 1EAMA 3ML1A 1KK1A 3UG6A 2AFHB 2QYTA 2J9GA 1W5FA 3HHPA 2QX7A 2QN2A 3KL4A 5EXSA 4F06A 1GZ4A 2IP2A 3IOCA 1G19A 4BKUA 4FBGA 3UAVA 1XVVA 2GCPA 3UGJA 1KJ8A 3L8YA 3FKQA 4G09A 4PONA 3GP3A 4CU5A 3RADC 2ZRIA 1KY5A 1JA1A 1UFKA 3GMIA 3E5NA 3O94A 1ST2A 1LPMA 2Z3WA 3QLVA 4LKRA 3V4SA 5BRJA 5F7XA 1DG9A 5JNVA 4DR5B 3KX2A 3OQ6A 3C39A 4ROTA 1T9KA 2ZBFA 4PS0A 2QRLA 4DEVA 1BE8A 1HSOA 4R8SA 1TVKA 2K5UA 1VHQA 3L1IA 1FJXA 1F9AA 1FSSA 1U7WA 2AW5A 1CQJA 3CX4A 4YUVA 5K7SA 3OJFA 1QG2A 4GHWA 3SQDA 2IYOA 2WOJA 2DTEA 4O2BF 3F6SA 1XNRB 2X8BA 4BTEA 4MR9B 1WHSB 3IQGX 3GIDA 4M9RA 2C42A 3L43A 3NMUF 2ZBEA 4BB9A 1N9GB 2G76A 2PS1A 1EWTA 3AF4A 2H52A 3TXYA 4D74A 2GYVA 4UEOA 5LVAA 3DE7X 4IXMA 2YUIA 3LC0A 3I5YA 4AB1A 3RWMB 1FDVA 3K6JA 2O3RA 4HBGA 3LRPA 4XUDA 2D2EA 5IAJA 5ADWA 1GLNA 1ZLXA 4LG1A 2R65A 3GJRA 1PQWA 4GKKB 4HEJA 2WWHA 1ZIXA 3HRIA 4KVFA 5COAA 5EIFA 1NW3A 1PL8A 2N42A 4AJ4A 4JBGA 1NQAO 1SBZA 3C41J 5K8LA 1YNOA 1RQXA 3RTEA 5AM3A 1I7PA 1P7YA 2QRHA 1K63A 5E3IA 3F90A 4EUHA 3LHFA 1THTA 3AETB 5DSXA 3ELYA 3ZE1B 4DV5B 4W1PA 1GPJA 1KMCA 4MV0A 3JZDA 2HHAA 2FN4A 1JU9A 3LRTA 2H63A 4WFQA 3UHJA 1JX6A 1JHZA 5BPHA 2HT1A 4BEBA 4JSTA 3V8VA 4K2AA 2FPPB 4DGSA 2R44A 4KE7A 2EHJA 2Q5QA 3K1JA 1E0AA 5EE3A 4YMSA 1EVJA 1R6VA 2GEBA 4L7VA 1UDCA 3AH8A 2RH9B 4BASA 4X7RA 2OXRA 3M83A 3M6VA 4YRZA 1LLUA 1T8SA 2ZJ0A 3HA3A 1IBCA 1C0IA 4ND5A 3RUCA 4EDFA 1ZOLA 2JF0A 2X1LA 2Q5FA 3G8AA 3MELA 4UXIA 2X3UA 2X4GA 3BH6A 1G5PA 2A1UA 5EZ6B 1UF9A 1BCRA 1XWFA 3LQ1A 4TZTA 4C2UA 1ZNYA 2PL1A 5FPSA 3DZBA 5D85A 3KHKA 1QLHA 2G63A 3CYFA 4HPXB 4U7GA 3EYWA 2JLQA 2PGNA 4PGMA 4A8JA 2XCQA 1AKVA 2P5UA 3N2ZB 3ZHTA 4N8EA 4OJKA 5DX0A 2O52A 3ETNA 3NALA 1C9DB 3BRQA 3KC2A 2I6TA 1GNSA 4JJFA 4EQ6A 1KDRA 2YR0A 2PZAA 4IUDS 4JSRA 3T1OA 4DNPA 1J8DA 1N5JA 2WTEA 2B20A 4N0PA 1NXWA 1GPAA 5EJGA 3ZWAA 2DWOA 4URXR 3T9DA 4UUQA 1O9GA 1WW8A 4N7JA 4ZO9A 5KYKA 1GZ7A 2JFUA 1LK7A 4LNAA 4PLCA 1SZCA 4QWWA 5IBQA 4BRZA 5C9ZA 3IQDB 1TD1A 4L3WA 3L4KA 2VNJA 5AKKA 1TJPB 1MV8A 4BP8A 2HH9A 3S44A 3JQ9C 1O95A 1MC1A 3I12A 5DBIA 1RWKA 3RYCA 5HZHA 2VP3A 1J8MF 1L7RA 1WVIA 3IVMA 4UU8A 3JQ7B 4C89A 3ICWA 3PDWA 4KE9A 3RBAA 1F7UA 4NICA 2OO5C 4Z4EA 1W44A 2ZANA 2ZYUX 3ZNNA 1QE3A 2C5SA 4D9FA 1Q2UA 3GLUA 3C3MA 3JTEA 1IN4A 3KV1A 3ICQB 1VMEA 4K9KA 1CZOA 4MWEA 4MS4B 1L4LA 2C4NA 4Y6LA 2ZYHA 1M2NA 1Z5WA 3ZGNA 1ZI6A 4GUDA 1NGSA 4XWYA 2QG9A 2GK7A 5DHUA 5HGJA 4YV1A 4C0SA 4R81A 3TFWA 4PINA 1JFRA 3H8WA 3F6BX 4BLSA 1Z73A 1AQYA 1MBZA 2KJQA 4LHXA 4MKHA 3UXHA 5G1OA 2DJIA 3HXKA 4YROA 4DLSA 2G5CA 4M49A 2J45A 8OHMA 1U28A 2QM7A 4BX2A 2BFOA 2RE8A 2OBNA 5D3MB 5BNIA 1JWLA 1J8VA 4MHOA 1DQPA 2YJTD 2A35A 4LN1A 4AZ0B 2JFNA 3KUCA 2AYZA 2W2OA 2VUTA 1XHFA 2NSLA 3LM8A 4L07A 4Z9YA 3G1TA 4RFLA 3MMNA 2CFTA 1XEWX 4LFAB 1C0LA 3HPQA 1WXGA 5EINA 2FJ0A 1YBFA 4MDHA 4E09A 5LQJA 4MUKA 4F2DA 1N1DA 3MGAA 3E81A 3SZMA 5FTJA 3NJ8A 2WWXA 3UUWA 4XKJA 1Z8NA 4BQOA 5B4TA 4CIBA 2F1RA 821PA 2XKAA 1OR8A 3NH6A 3QF7A 2ZYSA 4I9GA 1T0BA 1UMDB 3BMQA 5AKGA 5I9NA 3N74A 3N8DA 3PNYA 4PPFA 4KO1S 5CVCA 3CZAA 3GPIA 2XXJA 2ZM6B 1Z2CA 3DOJA 3HKCA 4HUQB 1FQWA 1W5TA 3STXA 1E0KA 3B6KA 5AIAA 1QGAA 4IEIA 5FR2A 2O3JA 4RQTA 1G60A 4GI2A 4ZICA 2WSMA 2DLCX 3T7JA 1P0QA 2ACWA 4OHCA 3U62A 1ZJYA 4GOXA 2AUMA 2VYNA 3PC8C 1T43A 5CM2Z 1WXDA 1Z7EA 2IYFA 4HAOA 3N59A 1NI4A 3VTKA 2FMUA 4D02A 1V8PA 4J1NA 4RUKA 1N6OA 3D64A 1JWAB 4BY9E 3NUQA 2C5EA 4TTSA 2DUUA 5AI4A 1TMOA 4D6PA 4D0GA 5JAIA 5FT9A 3MHTA 1IULA 2O2YA 1HFJA 3PUYA 3PRKE 5TEWA 3AO0B 1N75A 3H5AA 5DLDA 5FPKA 4NCBA 2QMOA 2VYVA 3W77A 1PNRA 4PYRA 1UEXC 2B21A 2F1IA 2JW5A 3MWDA 1QHFA 1WD7A 1JJIA 4AD8A 2BPOA 5CFLA 4POOA 4JC8A 4XD7D 2JGDA 1SQFA 3T5DA 4Q7MB 1JAZA 1UWLA 3IPXA 4WHMA 3MBOA 3RO7A 2R1ZA 4BYGA 3TPZA 4YCCA 1YJAA 3CSDA 1E1DA 2OQ2A 3LF2A 3EDCA 1SELA 4HLCA 1G2IA 3ZE6A 1OBHA 1QZXA 3TNFA 3AVYA 2GR9A 3OZRA 2OK7A 5BURA 5KTOA 2AI3A 2VDNB 2KMLA 4IIUA 1XHEA 1MFPA 3EXHC 3PUXA 2IP1A 3DQQA 4IDGA 4V0RA 5WRFA 4B87A 4EJ2A 2EXXA 4AJ9A 4BDSA 3AILA 1EXWA 2CFSA 3HV2A 1XCGB 4MW2A 1BW9A 4G67A 3I0ZA 4I19A 1AUVA 3KVVA 3PYXA 4JY7A 3FJYA 1ZAYA 1I7LA 2FKAA 1P5ZB 4YMWA 3BWXA 4BDTA 3VMFA 3HCCA 1SXQA 3PFKA 1JIJA 4Y6RA 1FFAA 4XYGA 5KO2A 3FHTA 2FWIA 3EZXA 1W4LA 3P9PA 4X20A 5HTOA 3IE2A 1OXKB 3P9NA 3U7GA 2DHEA 3N0RA 2FRVA 1RZUA 2IUYA 2VHTA 5JVDA 5L40A 1RLTA 4DNOA 1E2FA 3JW8A 1NC3A 4OAQA 3CEPB 4Y3UA 2VYCA 2C2XA 2QUBA 2YYSA 4OFZA 2CYBA 5LLSA 3HY6A 3O8OB 1HETA 3OX1A 1AHPA 5J2UF 5DLEA 1Z88A 5FUWA 3SKXA 3F8SA 2P4QA 3LSYA 1W2GA 2A0XA 1FU8A 2MSWA 1Q11A 3CW8X 3G59A 3G85A 1KPGA 4KJZA 4EHDA 5LYYA 5BMVF 5KNDA 3IEKA 5HM6A 3ZDDA 2PSDA 4HQ6A 5IULC 1H4VB 4ZI5A 1C7JA 2HJRA 4F8YA 2H1CA 2ZIUB 2Q62A 3P97A 2XA2A 4FE7A 1ZM3A 2B61A 4P80A 4LOIA 1RPAA 1WETA 3O47A 4KGZA 2ZI9A 4G86A 3MGKA 3N6XA 2EV9A 3DCYA 4O4JA 3FPFA 4ACBA 2Y66A 1EZ1A 3A3YA 3AOGA 4YS6A 1CEEA 1QB8A 1U1DA 1WXEA 2I6UA 5HG0A 2ACEA 5GY7A 1O57A 2L42A 5ALFA 2VPZA 1QH8A 4RK4A 5DCWA 3TD6A 2OE2A 2A92A 5I7OA 4Q19A 2ID7A 3GN2A 1DKMA 3ZC3A 1GZSA 4A1FA 4B6GA 4W5TA 3QPAA 3D6AA 1CY2A 3TNDA 1TYEB 2J7PD 1L4MA 2GZRA 2JZCA 5JDIA 3FMFA 1Q1QA 1DP4A 2AE1A 2WT8A 1WZIA 3WYEA 5JAZA 1E2DA 2CUNA 4MAMA 1IEXA 1KYWA 2GDZA 1U80A 2WSLA 1G5FA 1TU0A 3PEEA 2NNLD 3WK6A 2Y0EA 1UBRS 4MWDA 2NT3A 3GZNB 3QLJA 1PR9A 2C2WA 2QYOA 2BIFA 1KEZA 1QHHB 2X2PA 4IFBA 3TMYA 4YRFA 3GNTA 2HK8A 2VDVE 1II8A 2EJBA 3FA2A 3NAQA 4F5WA 4WTOA 2I7VA 2O7SA 4CUJA 1CCWA 4GKAA 1SRRA 3VVCA 3AEQB 4RSRA 1T2DA 3RYFB 1MAVA 2P65A 3ADPA 1MXHA 2O1WA 3A6ZA 3JZFA 4OFBA 2VOEA 1HNXB 1KZYC 2FPGB 2QN8A 3PGXA 3G8YA 3L5KA 1S01A 4GSKA 4JLVA 5FBRB 3SLGA 5DNYB 1RLMA 3MS4A 3ZCQA 4CIXA 4CLXA 1WF6A 5K20A 3ZCTA 1XRMA 4QE3A 3AM1A 2P3QA 3TVYA 2EYQA 5TS3A 2O2JA 3EC7A 3K2EA 5AVSA 2ACKA 1HLGA 2GBPA 3NIGB 3BXGA 1N0IA 4ND8B 3BSSA 3CKLA 3BMOA 2ZP1A 3MCWA 3QPWA 1J8YF 2P0EA 5MN5A 3M7IA 1SOMA 1Y42X 2NO4A 4PXSA 3CPHA 5TF0A 3L04A 2OV8A 1P6XA 3O0TA 3IOMA 1IJFA 4U2EA 5IW8A 1VLMA 4LBYA 5EIOA 1E2EA 3ISJA 4Y9UA 5H1YA 3PJFA 5GP1A 1K1EA 1T2NA 4KACA 4PG7A 2CXSA 3W1WA 4G07A 4EWLA 4WACA 1WXXA 3NNSA 4L76A 3EXAA 4REQB 1LPAB 3KJQA 1ST3A 2B0CA 2PXAA 2FUNB 3CR7A 2ZJ4A 4N12A 2XRYA 4DV7B 3AC0A 3P9ZA 1PFWA 1A9YA 2W0MA 5T67A 1J2UA 3BULA 4Z9BA 3TTYA 4E1VA 3K16A 3ETCA 1EVEA 1IM2A 1GGFA 2QD5A 3UJDA 3BWCA 3DKPA 2AGVA 3AINA 5C51B 2NMVA 4QU8A 3HDGA 3ZKWA 5I45A 2OO3A 2LKCA 5BYAA 3OZTA 5IVHA 3LWNA 1W49A 3KKNA 5LPNA 3NOVA 3NWOA 1J23A 2QD4A 3T5BA 4MZDA 4V0NA 2QL9A 1H1TA 3Q7SA 2V5UA 5AJVB 2G1AA 3DEJA 5AHKA 5FRDA 1YDEA 9LDBA 2I1LA 2MU1A 2ZUBA 5C18A 4Q3AA 2C4HA 2VP0A 3M1IA 4NABA 4FNOA 2KLBA 4HQFA 3VSEA 3LFTA 16PKA 4Q9KA 4FILA 4MB6A 3ZHXA 3LX4A 4RTNA 3OLQA 1W88A 4EABA 1YJCA 1PLJA 3W3AA 3RSQA 4C06A 3LU1A 4Q21A 5HIIA 1JTEA 2KS6A 1TM7E 4UHHA 1FXWA 1LZKA 5KNDH 5AKJA 5JARA 4L22A 1IZ9A 1G8HA 2P2GA 2XB9A 3ZHYA 3KKEA 4UFOA 4IQFA 1N5OX 3ROTA 1H3NA 2OORA 3I58A 3PE6A 1DQSA 5IUKC 4BCBA 3GGJA 2ZQYA 1KDZA 1QYDA 2I76A 2BGWA 4D98A 4P7KA 2F43A 5DTJA 1FBNA 3DQPA 5EC8A 1U8ZA 2G8LA 1BHQ1 3UA3A 4C6SA 4W9MC 2CYCA 1OSNA 4FEAA 3IALA 2GARA 4G4SP 2VP5A 2HFJA 3EQ7A 3U81A 1GCUA 4DY4A 1G7SA 1G21B 1XVTA 1VRWA 2XDWA 1L5GB 4KTVE 2B82A 4LXQA 4R84A 4D0SA 2FMKA 4Y1RB 2XKBA 5ICSA 3C1TA 1YTUA 4Y0NA 3PEWA 2V4UA 4YA6A 3CZPA 5IDQA 1J0EA 5CDYA 1DJPA 4FYKA 3LBNA 5LU8A 3E22B 3ER8A 2IH4A 2QP4A 5LA6B 3DGEC 4ZKDA 3P9KA 1UT5A 2YOHA 2ZI7A 3HXQA 1GYPA 1X94A 3EVZA 3PI7A 4ZYZA 4M1QA 1ESDA 1XA0A 4Y6SA 1ES9A 2CCGA 2G70A 4L15A 1KSGA 1Q7RA 2IOQA 3OCZA 3ABOB 4JBLA 3E18A 2RHJA 3Q8LA 2PT5A 3VU8A 3DWEX 3QKIA 5LKAA 2UVPA 3E8SA 3B85A 5AJWA 5ANRB 1W4AA 1LX6A 1OILA 2ZXEA 1XBTA 4GSYA 4ZAXA 3RC1A 3GH1A 2G88A 5J23A 2MMCA 3ETHA 1ILWA 1Y7HA 3PWZA 4DARA 1NAHA 4CEHA 1VMAA 3ANTA 3CH5A 4KWHA 2IYYA 1XRRA 1TZ2A 2CFOA 5E3JA 2YTZA 2QRVA 4I14A 1GR1A 2XGGA 3BRWA 1RVV1 1YNSA 4G25A 2LRHA 3ZV4A 3SSOA 3KKZA 4L74A 3EVNA 2WABA 1FXUA 3LKDA 2GZ1A 1IOWA 4R9VA 3SFZA 2A86A 1JPNA 2E4YA 3VXKA 3RUAA 1T3SA 2C95A 1PZXA 1THGA 2ATIA 4UHEA 2RC6A 4OHRA 2X77A 2EKZA 2IQIA 3MCZA 3R6GA 3EY9A 2XADA 4NYMR 3Q7RA 4BZXA 2F9LA 1BFDA 1MUUA 2P7HA 3IS3A 4DA7A 2NXNA 2Z09A 3G7UA 3KCQA 1DKPA 3NU1A 2FH5B 4BMXA 4EW2A 1MB3A 1ADFA 5HCIA 3WDSA 5T4FA 3AFMA 5CEFA 2ZQ5A 3RGWS 4I81A 4Y6PA 2P41A 3FMGA 3FX2A 2JAPA 1V3QE 3GEEA 1ACMA 3MMZA 4G1EB 2OXEA 4PNPA 3PA8A 1Z5UA 2PK3A 4R01A 1T9ZA 3CBGA 1RWXA 4FR0A 4KVAA 4BAUA 3KHUA 5HPYB 4E2YA 4XJTA 1ZWLA 2NTNA 2XMZA 5T8KA 1YRQA 1W4BA 1FW8A 2CMHA 4PIPA 5C8XA 4GP7A 3Q98A 3AXSA 3KQLA 1DIBA 3D3JA 1FP2A 1QQ7A 4K28A 3QQPA 1WB6A 3CEAA 3P9YA 2X0KA 5LXTA 4PC6A 5H9WA 1V8ZA 2QX8A 3AM5A 4BO8A 4LSMA 3CVXA 3ZWCA 1H5UA 3GCWA 1S0UA 2FSGA 2V59A 3KFXA 4ZOLA 2WSSA 4QQNA 3GUCA 1J9EA 3ETGA 4OMCA 4CR6A 1B7GO 1T8TA 2Y76A 4UULA 5IYZF 1NWCA 2XKKA 5EIEA 4IO1A 4BO4A 3HK2A 1I1OA 2PGIA 1XL0A 1QYIA 3WWZA 3RRXA 1EK5A 4WZBA 3G2QA 4YCBA 4MARA 2C2ZA 3M6LA 3RARA 1R4ZA 4EW3A 4QXOA 1MW9X 4PBTA 4C7JA 2R7NA 3K2IA 4FJ0A 3W3AH 2WPDD 2ISQA 2R5FA 1L5RA 1NVVR 1P0MA 1SIUA 3EWNA 4GR4A 3IV6A 3EPKA 2GJSA 5F2OA 2WT9A 4BMZA 4YN3A 4RSMA 4YCNA 1E5DA 1JHUA 3A0UA 2G9ZA 1JIVA 3X2FA 5C1BA 1SUAA 1BWQA 5JCZA 2NO0A 2F3PA 1IBRA 1O97C 1OY1A 3AK4A 4WOJA 4C4SA 5B30A 2ZSIA 3H4TA 4CLOB 1I8TA 4J3NA 3O4GA 1HZJA 2PUGA 2I22A 1EVIA 4JJKA 3O92A 5DHQA 3PHJA 3ZGLA 5B6JA 2BCGY 2ZJ3A 4H08A 1MEEA 3UB2A 3QX8A 1FUIA 4KU4A 1QANA 4PX3A 4WWHA 1A4UA 1RJDA 2CJWB 3N7UA 4MYSA 5IDWA 1AHIA 2A9VA 4INJA 4OHKA 2AR0A 2GAIA 1KO8A 3N0XA 4ZZ1A 3IKTA 2Q3FA 4IGFA 1XCMA 1WCV1 4PG5A 3RSHA 1S1CA 3DCJA 3I9LA 1QS0A 2ZAIA 3TOZA 1N6PA 4BFVA 2V3VA 5DW3A 4XR4A 4LMBA 2QD1A 2HMYB 3NBYC 3K0CC 2V7GA 5GJWC 3M0EA 5CHYA 2VZEA 8GPBA 1KSJA 3SX0A 5F1KA 5CD1A 3CEHA 5IC4A 4C5AA 4GR9A 4OOEA 3EE6A 2JHFA 4QVKA 5FUVA 4I50A 2IZZA 4ZCLA 5IJXA 3MJCA 3DV9A 2B36A 5B1EA 3QOXA 1V9SA 1DAHA 3VR1A 2CYAA 4PAGA 1BVHA 1QH1A 2Q9CA 3ZY2A 2YIMA 2Q2NA 5DK4A 4M0UA 3KUKA 4ENWA 3GDWA 3O8QB 1YRLA 4I3GA 4GLLA 4RLHA 2GZAA 2WMOB 4DDKA 1R6UA 3SHOA 1JYEA 2PLNA 1CYDA 2GPJA 5JNTA 4CTOA 3STVA 1LC0A 2QY9A 1FNBA 3E61A 2QUZA 4WNCA 4KK4A 3GLFB 3LHIA 1QO9A 3CIOA 2ZIXA 4ALKA 1KAQA 3TQSA 3P2KA 3DDHA 4MGKR 1T8PA 3FZQA 1VLZA 3FYUC 3UJ7A 3JQGB 4RE6A 3I83A 4MINA 4G4IA 5FKJA 4MWOA 2J85A 3UW1A 1U7TA 4RC9A 3JVVA 3DZFA 4ZP1A 1DIGA 1TKBA 1SH7A 4G5SA 2OXIA 4IIFA 1B93A 2JAQA 1Z0UA 2ZJ5A 3CE6A 4GPIB 4XB2A 4QKQA 4Q16A 3ZDAA 3R9WA 2ZAYA 2O5EA 3DF9A 2VXBA 5LCXA 5A3QA 2G9VA 5G2OA 4CPDA 1M8KA 5EZSA 1SBQA 1RI2A 2QMEA 2VSFA 3AIMA 3MCVA 2PRKA 2MOKA 2W6OA 1W85B 2V1UA 3TQOA 1T2FA 5C7OO 4U8HA 3IBCA 3BD6A 3LT2A 2O0HA 4XCVA 3FLBA 1OZFA 2CMDA 4MQEB 3DSRA 1M1UA 4CMIB 3ZLVA 1E2IA 1Q1BA 2G25A 3EA5A 4ZYWA 2ZI6A 2WJAA 3BWEA 4ARAA 3N5KA 3UC9A 1UQTA 3GMDA 3KK0A 4RY0A 5CBPB 3QU9A 5C52B 1FJGB 1NMXA 1LQ2A 4MUIA 3KWJA 2M32A 3RSLA 4A6EA 1O2DA 3QKRB 2Y77A 2BLNA 4JB3A 4AF8A 3I62A 1O1YA 3QX9A 1L7BA 5E95A 3TZLA 3I9KA 5KJ6A 1JSXA 1VE9A 4R05A 3UJPA 2QVZX 2YWBA 3E2IA 1ETUA 3HSSA 1FVXA 3A6JA 3T5CA 2Z3ZA 3I6MA 1U4NA 1FW6A 2GB4A 4NS4A 5C1IA 4GQAA 4A91A 4CKXA 1ZW6A 4JHLA 1QP8A 4HGNA 3IPLA 2W9XA 3OEHD 1MN6A 1GPUA 2HLNA 4EMTA 4NONA 2EC5A 1PK8A 1X70A 1MX9A 3BXXA 1MABB 4TL6A 3GLSA 3QVKA 5F2KA 4GDFA 1AKMA 4IWYA 4QVGA 5AK0A 4BCCA 1OC2A 3VJMA 4ND6A 1OF1A 3Q40A 2V6BA 2PGOA 2PANA 2I87A 3RTAA 3ZCXA 4F4CA 4D4JA 2YVAA 4ZEOA 4NE7A 4JUBA 4B31A 4AMYA 1T5OA 3BMNB 3DT6A 1IHUA 4BGEA 3G0GA 1T5DX 1ZCAA 1J1IA 4PG4A 6Q21A 3K09C 3QELB 5D01A 2TS1A 2BI4A 4K6GA 4LV6A 5DT2A 3U49A 1YJQA 2A59A 2FEXA 5GIOE 3OFND 4OGGA 4I4IA 1E3WB 1ESMA 3HDTA 4C9BA 2JIDA 3HV0A 2VN8A 4EKDA 1CJKC 3QUTA 1T8UA 4OU5A 4BLWA 4V0LA 1R3UA 4Q03A 4R6WA 3R7SA 1YVDA 3WY9A 4KFCA 4MVJI 3H5NA 3SOPA 1W30A 4YRNA 1T91A 3BE8A 4CF3A 2A9KA 4QYXA 4NYJQ 3W5SA 1RI4A 1QTNA 1IJKA 3PUWA 5JSHA 1E9BA 5B1SA 4RJLA 5HDQA 5KB3A 3BIJA 2H5JA 2HDOA 2V7PA 4XW2A 3ZY3A 4NXMB 1A9PA 1HT1E 4BP3A 3AB7A 5FDFA 1GQYA 2QIPA 2VATA 1H2XA 5BNTA 1QORA 3JAWB 4X7MA 4JI5B 3FXAA 3SOZA 3EGOA 3RVLA 1B0AA 3TLZA 4YRAA 5I3ZA 5LYJF 1BCSA 4M6WA 3ILHA 4BNGA 5I9LA 3KNZA 1XDBA 4FJ1A 1Z6AA 2MSKA 3H3XA 1Y3FE 2DM6A 3I05A 5P8WA 3PHBE 3TLGA 4CIDA 2W8BA 1A82A 5F4BA 1UWKA 1X7GA 3HVRA 5K9ZA 1I4TD 1RRPA 3IJRA 5EP4A 3ZD9A 3DMGA 1E7SA 4URVR 2XRFA 4DCUA 3CZQA 5BT8A 4EPXA 2DRIA 1VE6A 1PEKE 2FX3A 4QODA 4YMHA 1RQNA 5INTA 3AFNA 4ITVA 3MTJA 2DQ4A 2H0AA 4HG2A 4J0DA 1QG6A 1ZD8A 2H00A 3LLCA 5HCUA 4BUCA 1XEXB 2OHFA 5E9WA 4BX0A 3SHWA 3INRA 4JVNA 4Y30A 1P5RA 1E62A 3FTPA 1X8LA 3V4FA 5L3QA 1HF3A 2OXCA 4CODB 3DKVA 5AXBA 4FCTA 1KRXA 3PF8A 3MC1A 2HMWA 5HMMA 3IKMB 4C4AA 3DKKA 2A0UA 1Z0SA 4CGYA 1GU7A 2JEOA 5IX8A 1CU1A 4S2EA 2XT6A 2XYRA 4HD8A 4MJLA 5GJVC 2YHSA 5JE8A 1YIOA 5TT1A 4ER0A 2G9RA 4HWGA 1R7RA 2RB4A 3PNBA 3U26A 5BWMA 1P6UA 3B78A 2HZ7A 1ZN7A 2W2TA 1XPOA 1JS1X 3AR6A 4RJ2A 4QUKA 3G5TA 1N9ZA 3H75A 2Z8ZA 5FNVF 1TF2A 4PNZA 5LZ4A 1Z75A 3FNIA 4WL0A 4PG6A 3PITA 2WPNA 3SIXA 2NT4A 4UNQA 5IT4A 1D6MA 4ER6A 2FW1A 5ELLA 2EATA 4UM9B 3S29A 1A8SA 4ZVQA 2OQVA 1SR8A 1ZONA 3IRVA 3CKKA 4HDRB 5B3JC 3BHNA 3RS7A 1GZ3A 1I3KA 3BDAA 4RTJA 3COZA 1W52X 3NQ41 3OZ7A 1FDTA 4E4TA 5EJ8A 5IANA 1RC8A 1ISJA 4E88A 2P6OA 3L05A 1TZMA 1SUCA 5EL0A 4EY5A 1KPIA 4FW8A 4G0VA 1HA3A 4JQOA 3LYUA 4MEAA 7ABPA 2HKIA 2ZUCA 4HDAA 5BYBA 3HCWA 2A7XA 3H2JA 2IKSA 5DBHX 5I7WA 1MLDA 1IDN1 3RSOA 1KYVA 1E7RA 4FLMA 1RADA 2IYWA 4PWZA 2E37A 3KJEA 3AF6A 2HBYA 3WGGA 2OR3A 1PJZA 3BFJA 3Q41A 1TCCA 2GCIA 3OX2A 5KC8A 1A8PA 4MLZA 2VCHA 3H2HA 4AO7A 4IM7A 4CL0A 4YI3A 1U0EA 3KYDB 2QOEA 5CA1A 1AZWA 1Q1ZA 3RSFA 4A2WA 4D4IA 2ZBUA 5EI5A 2FETA 4XJSA 4NH0A 4P4LA 1Q91A 1J33A 4QELA 4IEFB 3IUPA 3O3CA 5KQRA 1VLLA 5HUQA 3TPCA 1RM5A 4DT1A 1Y3HA 4FUTA 5CLIA 1C1DA 4HB0A 3KVOA 3DBLA 4E5NA 4RPJA 1XHLA 3LDAA 2GVNA 1J7JA 1QHSA 3H0CA 3KYIB 1FTWA 3O1JC 2NN3C 1K3TA 1AV7A 2CB9A 2W4MA 3CNBA 3KRTA 5E4JA 5JBQA 1QUEA 2W6CX 1SOVA 3HPRA 4IDFA 3GNQA 3BBLA 4XPIB 4E5PA 5D1HA 5G0WA 2FEMA 3OPVA 5LP6A 5CYOA 4BO1A 1HO3A 4AKEA 3FHCB 2UXBB 2OG2A 1SCUA 1QFJA 4JP2A 1MB4A 3H9QA 3ONVA 2GPSA 4EBFA 3LBFA 1HC7A 1G1AA 4K87A 1DLJA 1XEFA 2EG5A 4AMBA 4R2IA 4LY9A 2RAFA 1PHRA 3R9XA 2DPXA 2GHIA 1PWXA 3W8DA 3MB8A 4Q7QA 2ZW9A 1GNPA 2GO7A 1W6RA 3Q3EA 2NQTA 2WFAA 4HBZA 4Q3BA 3I76A 5FI3A 2F1HA 2F1OA 3NTQA 1SD1A 1YS6A 1PZEA 2PMBA 2QMYA 3OOJA 1SD5A 3RC2A 1UWCA 4D3YA 1BFUA 2WVAA 2D59A 1BXRB 2H9YA 2Q8PA 4MKZA 2Q9BA 4CLOA 2E4WA 2R8ZA 3PBKA 3KQSA 3KFLA 2QRGA 4EJ6A 4P2GA 3LUBA 5K4HA 1BS9A 5ARBA 3A2MA 3NOQA 3VU0A 1B73A 3Q4GA 3VTZA 3T34A 2JJYA 4K26A 3BD8A 1QF9A 5LUAA 1OH7A 1AS0A 3FPAA 3FZEA 1VSTA 4IJ5A 1FLAA 5ECGC 3SEFA 1XCLA 4PXAA 1T13A 5A2GA 3COSA 1NR1A 3QJGA 5FO1A 1H8ED 1E1RA 4PU0A 5DDIP 4JLPA 4MPDA 1MJGA 1A2KC 1UDWA 4Q05A 4LJ8A 4XUCA 1UMKA 2OQRA 1RYNA 1Y4SA 1WIWA 3A4NA 1LTQA 5HKKA 4MCAA 3RS9A 4JI6B 4XQ0A 4E7PA 2RD2A 1IWBB 2Z08A 2QS9A 2WRZA 2YIVX 4R69A 1OBVA 1P2TA 2MSLA 1Y48E 3THOA 1QTIA 4FNAA 4CKEA 6YASA 3OZEA 5GVRA 5KOHB 2QTFA 2XVAA 3A9TA 3D7LA 5EWLB 5I4IA 2B3TA 1GRNA 2B6NA 2H9IA 3BH0A 1N2OA 4RFSB 1BE1A 3CLSC 3MWEA 5KINB 1K6EA 3WISA 4CUKA 3DMTA 5H7XA 5K2MA 3CB4A 3OFVA 3PSHA 5JLAA 3FWKA 4XSGA 2ATXA 5FHQA 3CR8A 2DFNA 1PR1A 2D3TA 3BAZA 3CMMA 3NZEA 1XTQA 1KMMA 3M5DA 3O4VA 2XSZD 4ZAWA 4DIDA 2D2FA 2R2AA 4XVUA 3WAJA 1ELOA 4GXQA 3WG9A 3N76A 3HFGA 2A6PA 1K7YA 2HO5A 4JU9A 5JJBA 5EYPB 3HKDA 1FQKA 3LCRA 1Y98A 2WMYA 1E4YA 1N2BA 4B34A 2AA3A 4M53A 4OCZA 4UHCA 1A95A 3EN0A 3NORA 4YTEA 4BXOB 4MROA 5BNFA 1ND6A 1YCGA 1AKEA 2YHBA 1C4WA 1BKYA 4RD6A 3FGOA 4HAXA 4MEBA 3M6AA 3GF4A 2CNDA 5EGNA 2V7QD 5JANA 3PK0A 4D6YA 1FL9A 1AO3A 1SVNA 3QJ5A 1T9DA 5DJ5A 4FQ8A 3UT0A 1FJ2A 1M2OB 5DW0A 4DLYA 2NX2A 1XB2A 1IJBA 2R6HA 4W5OA 2WUFA 1JKIA 3F3SA 2ZUUA 3H97A 3KFVA 2V3WA 4GH5A 2RGNC 2UVQA 2C97A 2V6IA 3LKVA 4LYEA 4K6MA 5AK5A 3JRXA 3OZSA 2OP0A 2XVZA 3DVAB 4N40A 4Z7NB 5B12A 1Q0LA 3P9RA 4Z9FA 3T1QA 2HIMA 2I71A 3V1NA 3O75A 5BWOA 4WY5A 2AFIA 4KR3A 4OG2A 4HVCA 4OQNA 4OLAA 1ZJ5A 4ND4A 4X1KA 3TRFA 1XAIA 2Q0HA 4MPPA 4CKWB 5J2UA 5KVSA 3L7BA 2DETA 3IAAA 2ZT5A 4BVBA 3UB3A 3JQFC 3QIAA 3DQZA 4X93A 3HYSA 3K9BA 3SHTA 1QIHA 5DHTA 4XIIA 3SQNA 3ZLBA 3ZCPA 1X1SA 1NLMA 4LXUA 3L92A 4CDGA 1ODJA 2CZGA 3FRHA 4RH0A 2ZR9A 3UA4A 1I5OA 5TQJA 4C2AA 5BOSB 2B4QA 3JQRA 4MQFA 1EFVA 3DH0A 2QTNA 3K0AA 3KXLA 2A1TS 2ZAOA 3P5BA 3Q5DA 3QJYA 3K70B 3ZE9A 2FA9A 221PA 1AVTA 1V35A 3BKWA 3BCUA 5JWOA 1OWLA 4X0EA 1VDZA 5KCZA 1FS4A 2MR6A 4PYJA 2H16A 3LLVA 3UO8B 1DSSG 4YP5A 1YOVA 1OKKA 1NUUA 2A14A 2IZ7A 4MKFA 1PTJA 3A6EA 2F62A 3JQBC 5EJ4A 1B23P 1ODTC 2JA2A 3KSZO 4Q24A 5JHGB 5JTUA 2EIHA 2GA9A 2A1TR 1R4NB 1T36A 3OZBA 5DM2A 5JC8A 1UK8A 2WAAA 3AXTA 4EAQA 4BLUA 1X7ZB 4IL5A 1BWSA 3HYNA 1HURA 4AI6A 3DV0B 1G4AE 1RYDA 1YE3A 3GG9A 3MUNA 1D2AA 2F6RA 3L7IA 1LS1A 3W4KA 3S5JA 1M6VA 1R10A 3IEIA 1YFKA 3O84A 4PAWA 3Q88A 5EE9A 4NJEB 2TMYA 2FXVA 3KZ1E 1A5TA 4E4YA 1QZ3A 1KMHB 3N0TA 5LOVB 1KL7A 3K8YA 3W1VA 2VJLA 4RCZA 2BGGA 2H0RA 2CFIA 2P6MA 1T4GA 2G9QA 1XRNA 3IQFA 1Y6QA 5A9SB 4U7DA 4TUYB 1OZHA 2CLHB 2OILA 3WGJA 2AI1A 4KODA 2NVUA 5JS8A 4E03A 1BDMA 4II7A 1HX7A 4UMVA 2Q4DA 1EH5A 1NQXA 3F5MA 3CRVA 3TLBA 3U3JA 1FMCA 5H3HA 3UICA 3RDPA 2VAVA 2BRUC 4D44A 1QG0A 1F06A 3PSAA 5JADA 1PUXA 2XCRB 5C4IA 2PR7A 3OIDA 3T5MA 1CZKA 4MV8A 4ZQEA 2Z8YM 1QKIA 4OL0A 5G3ZA 5HILA 2DFTA 1YC2A 1NSTA 2AB0A 2XUDA 4WXPA 4XTRA 4F6LA 2EFEB