2NVBA

Contribution of pro275 to the thermostability of the alcohol dehydrogenases (adhs)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
352
structure length
352
Chain Sequence
MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAELADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLDVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLVTHVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADP-dependent alcohol dehydrogenase
publication title Thermal stabilization of the protozoan Entamoeba histolytica alcohol dehydrogenase by a single proline substitution
pubmed doi rcsb
source organism Thermoanaerobacter brockii
total genus 107
structure length 352
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 2006-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nvbA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2nvbA01
1C1XA 2CNBA 5ILGA 4CMCA 1ML3A 4GWGA 1T2EA 1P1HA 2D0IA 5ER6A 1HE4A 3OETA 1TT5A 3OJEA 3RUCA 1Z74A 3NDRA 3JQAA 2IODA 2YV1A 4RVGA 1N92A 1ZW1A 1TVEA 4HWKA 4N5LA 1DAOA 2I99A 2VYNA 2C82A 2C20A 3KEQA 1LNQA 2C7GA 4QUKA 3JQBA 2QZZA 1T4BA 5I8ZA 2QQ5A 1TEHA 4IS2A 4YJGB 4B7XA 3UICA 4CLOA 1B14A 1RPNA 4KUGA 4EJMA 4IMRA 3E6AA 5ADHA 2CDBA 1GDHA 1YL5A 1XLTA 4A27A 4EEZA 5BSFA 5JYDA 4ND4A 5K6AC 2ZJ0A 3S2EA 4BNXA 4J1QA 4IDEA 1LSSA 1HLPA 4CQLA 4XGIA 1OC2A 1PWXA 4QX6A 1O0SA 3QE3A 5KJEA 3GA0A 2ZB4A 1BVRA 3JQFC 1VRWA 1GR0A 1U5CA 3GDGA 4FFMA 5EQDA 1V3VA 3SLGA 3FTNA 2DTEA 3BTSA 1NFFA 3PRJA 4ID9A 3V8BA 3GUCA 3DAPA 2PNFA 3A1NA 4BVAA 2Y1EA 4QTZA 3C7CB 2HMWA 1K5HA 2NNLD 4R68A 3DZBA 1EBUA 5U9CA 2O3TA 3DOJA 3KYCB 4RVHA 1JKIA 5ICSA 5L51A 4DLBA 3GHYA 4RLSA 2DBVO 4E32A 1AHIA 2AQ8A 2EF1A 4ZD6A 1YONA 2RH8A 4EEXA 1B15A 2JD1A 4RPHA 3UAGA 2RH4A 4BNZA 4ZGWA 3GMSA 3E1KA 3TOXA 3FWNA 2GDZA 1KY4A 3WLFA 4DIBA 5JAZA 2FRDA 2Q46A 1P31A 1DRVA 4NU5A 3S1LA 4DMLA 5L4NA 5JPIA 2VWPA 1R4MB 2OP1A 1BDMA 1T1SA 1QR6A 4PG4A 5TLSA 2PH3A 5KJCA 1YQXA 5AQ1A 2AXQA 2W8ZA 4LN1A 3Q3CA 1C0PA 4Q9NA 3S8MA 3WBFA 1M75A 4BO4A 1IPFA 1ZCJA 4ITUA 3JQ8B 4UUOA 4O1MA 1RM3A 4MVJD 4OYRA 1JKJA 2HUNA 1RYEA 5DCWA 4Y8VA 5L7TA 3HFSA 3JD4A 1XELA 2HK7A 4B3HA 3DZGA 4RVUA 3GZNB 3GRPA 3K8ZA 4WCFA 3LLVA 2P68A 4CLDA 1O95A 4RF5A 2IE0A 4TZTA 4MO2A 3RASA 3ZW9A 4WEQA 4ZQEA 3KO8A 1I8TA 4U0KA 2UV8A 1NQAO 1WMBA 2E4AA 3H7AA 4GH5A 4B8ZA 2J5RA 5HRUA 3LSYA 3A4VA 2P4QA 4D3FA 4AFNA 3AW9A 4XD2A 1UXHA 1YBVA 3JD1A 4J0FA 1AUPA 4MKRA 1KERA 4XYBA 2ZQYA 4BMNA 3OIGA 2EW2A 4BB6A 2O48X 4NBRA 4IJVA 2FMUA 4AJNA 1V3UA 2EP7A 3DB2A 5JXWA 1MP0A 1HL3A 3RBXA 4YR9A 2A35A 4Y67A 1PJSA 4EW6A 4CM6A 4LMRA 1C0LA 3Q2IA 3TQHA 2ZK7A 3ZWNA 4IIVA 2QZ9A 2XXJA 4GX2A 4UVEA 4EUEA 3HG7A 5ITVA 3HQ4O 5G0WA 3DBVO 1DHTA 3LC7O 4NK5A 3ZWXA 5EN4A 3LT4A 4AICA 1H6BA 2ZYGA 4IMPA 1AXGA 1E7WA 3DBHA 1H2BA 1WDMA 3I4CA 2J3HA 3I9MA 4HFNA 3WGIA 4A10A 2YHIA 3PWSA 2BLLA 4R5MA 1HETA 3RROA 1YRLA 3MJ4A 3OJ0A 1VSVA 4DBZA 2WD7B 4E12A 1Y5RA 1B3RA 4MVJG 1H9BA 4DPLA 3ORFA 5F1KA 1D3AA 3PWKA 1OAAA 2Y1GA 3CZRA 5F3RA 1I3MA 3RI3A 1NHWA 2ZJ1A 3INGA 3MJEA 1VL8A 4O63O 4C4OA 2JKVA 1YB1A 4AJHA 3EK2A 1PJBA 1PGQA 1GZ4A 3JCZA 3MEQA 4XKJA 3KZVA 2O7QA 4D3DA 2VHYA 4M54A 2VN8A 2YY7A 2BKAA 4PGFA 3QVXA 1HT0A 4PVCA 5DBFA 4KP7A 1EUCA 2Y1CA 2Z95A 1K2WA 4GBJA 4MVJI 3VH2A 3WQSB 9LDTA 1FF9A 2G17A 4Z6KA 4URFA 2QRLA 1E1KA 1OC4A 2V6MA 4UVHA 4D43A 3H5AA 3T4EA 3X2FA 1U1IA 3QWHA 3SVTA 1BGVA 4IUYA 5EINA 4ZHSA 3KEOA 1QRRA 2WM3A 4RPKA 4HNHA 4E30A 1CQIA 3V2GA 3PHJA 3W8EA 3CMMA 1LA2A 1Y8RB 1U4OA 4YJDA 1BXKA 3L6EA 4AJKA 1E7SA 4IDBA 2W2LD 2AQKA 1NNUA 1U4SA 4OXKA 4CL3A 4A26A 2O50A 5GZ1A 2BFPA 4GX0A 5TRTA 4RJTA 4ALKA 3SEFA 5CDUA 3Q1LA 4B4OA 5L7YA 1XA0A 1UUFA 2Z5LA 2WDZA 4P4LA 1AE1A 2EW8A 1LSUA 5JBIA 4N7RA 4WLUA 3KYCA 2B37A 1NP3A 4HFRA 2G5CA 2EP5A 5G0VA 4CV3A 2AQIA 1ZNQO 3VH4A 3RQSA 4XGKA 4CR8A 3HFGA 4GMGA 4UEOA 1NM5A 3WX0A 1HYEA 2IXAA 3F47A 2IXBA 1EDZA 4P4NA 4ZQGA 3ANMA 5JMWA 1QYVA 1V8BA 3HE3A 4GMFA 4AJLA 5L40A 2YHUA 2DVMA 4O6VA 1ENOA 3WJ7A 4TSKA 1R4MA 1YQDA 3WYBA 1NXQA 2I76A 3DO5A 4IJUA 3NX4A 3QVWA 5ENDA 1GUYA 5T64A 4KOAA 1MXHA 4PG7A 4FC7A 3BHIA 3RCBA 4F6LA 1ZEJA 5IDYA 3OEWA 4R69A 2D1YA 2GRAA 2CF5A 3EY4A 1E92A 4FIZA 2AQHA 3PFWO 4GKVA 4Y9DA 1CYDA 5T67A 1Q0LA 1YB5A 3PYXA 1ZK1A 2OORA 3AU9A 2CF6A 4P22A 2D8AA 4Q3BA 1PJTA 2H1SA 3WYCA 1P33A 1TA4A 4R1NA 4UULA 4YT5A 3U4IA 4CJXA 5JDIA 4IZIA 3X2EA 2QG4A 1CERA 4ZQFA 4ZU3A 3ZU4A 1I2CA 4A7PA 5JO9A 3ZCXA 2X5OA 5HWSA 4EBFA 1UJMA 1GYQA 4MVJH 4CM4B 5L45A 3GF4A 4DXHA 1GEEA 2Q1TA 4RL6A 3PQDA 3GEGA 4WGGA 2YDXA 3VPHA 4DMMA 4KTVE 3TOZA 2EG9A 1FXSA 4II2A 1P1RA 1XDWA 1B8PA 1U3TA 3PDJA 1O9BA 3K31A 3UH1A 1MFZA 4IM7A 3UVEA 4BO9A 4AJIA 3UXYA 2W98A 3QWAA 3KUXA 2UVDA 3WIEA 4PG5A 1J0XO 4RF2A 1LJ8A 4ROSA 2Y0EA 3PHIA 4DQXA 4OXNA 5A3JA 1RJWA 3K92A 3C24A 4QEDA 2FSSA 8ADHA 2RHRA 4LGVA 1V0JA 3B6ZA 1IY8A 1BRMA 3HDJA 4Z9FA 3A06A 1PS8A 1W6UA 4XGNA 1U8XX 4XRGA 3EVNA 4YQZA 2PKRA 2GN4A 5KCZA 1ISMA 1R0LA 4TKMA 1JAYA 1EE2A 4FB5A 5KOIA 2GSDA 1PIWA 1P3DA 5H81A 1DIRA 1JAXA 5JCXA 1ZXLA 4M87A 4YVFA 3WWYA 1B8VA 3PJFA 3B1FA 3F4LA 5K6AA 1KVTA 4JXKA 4BQPA 4UREA 3M6IA 2NVUB 3KSDO 4QSMA 4J7UA 2JHFA 1Q1NA 4J2HA 3JQFA 2PK3A 4UUNA 3V5NA 3RBVA 4R9RA 1EQ2A 3EW7A 3AFNA 5DULA 4PLHA 2JCYA 2DC1A 1Z7EA 4L4XA 1ZK0A 3VPGA 1MUUA 1UZNA 2HKIA 5ICMA 3QVOA 5TJHA 4CMAA 2HJRA 3M2TA 2C5AA 3RUAA 4FOSA 4ONEA 4OOEA 1YL7A 2Z1NA 5F1OA 1Y8RA 4GL4A 1Q7BA 1GZ6A 2O4UX 1AXEA 2NU7A 2A94A 3ROKA 6ADHA 3A14A 4RLHA 4MP6A 3JQGB 5IDWA 1Q0HA 2NUAA 1H9AA 1ONOA 4PLCA 1D8AA 4XYLA 5CDTA 5IZCA 2TMDA 2WJPA 2X9GA 2GLXA 2HCTA 4XB1A 3AI2A 2X0NA 3WIDA 4MVJF 3NAQA 4GAEA 2YJZA 1A71A 1FJHA 1QP8A 1GTMA 4R54A 3WJAA 2PD3A 3QSGA 1P1KA 2DBRA 4JP3A 3TFOA 3F1KA 2BFOA 2YW9A 1HDYA 2FN7A 4DA9A 3D0OA 2EXXA 5CDGA 4I1IA 2WEKA 2VRCA 4JP2A 4NQZA 1MA0A 1PQUA 4E5KA 1EBFA 4BKOA 1BWSA 5A02A 3ETEA 4Y6SA 3RSHA 1XGKA 3WGTA 3ENNA 1X0VA 4L73A 3GUYA 3M2PA 4E4YA 3UGKA 4FDAA 4L76A 1BTOA 1H6DA 2RIRA 4OKIA 4AVYA 3VH3A 4AL4A 3L9XA 4DPMA 3AY3A 5BQFA 5FF9A 5MGBA 3WGQA 2Y99A 1PGOA 1TT5B 5B4UA 4IIUA 3W8DA 3RD5A 1WZIA 4GQAA 5CEEA 3Q9UA 1K6IA 1F8GA 5CFZA 1X1EA 1ZFNA 3TZKA 4D3SA 1T2DA 4CMHA 3OFSA 1PEDA 2J8ZA 4AJEA 3ANLA 3BTVA 2PKQO 3DOCA 2C5EA 3ETGA 5EESA 3JQDA 3U3XA 2X23A 4NZ9A 4WEOA 1DIHA 2AA3A 7MDHA 3ZNNA 4WJZA 2YQ5A 3TRIA 2NTNA 3LT1A 4CM4A 2J5QA 2Q2QA 4E5YA 4DYVA 2NQ8A 2Q4EA 2E48A 4MIOA 4W7IA 4GKBA 2EKPA 2HO5A 2X22A 4R41A 1MX3A 1Z6ZA 1ZSVA 1J4AA 3WDSA 4RQUA 4K28A 1ZSNA 3VPSA 3O26A 3RFTA 1FK8A 2E37A 3IDSA 3L9WA 3PHGA 4J49A 1I2BA 4XDYA 3PGXA 1SZJG 1ULSA 5EERA 4ZQHA 2O3RA 4UVIA 3LT2A 2DAPA 4ND2A 2O3UA 2FR0A 4XX0A 1E77A 2GD1O 3D3EA 3VDRA 2NVBA 4PN3A 2GR9A 4DUPA 4J9VA 1SC6A 1U3WA 1LLQA 3AOEC 4FBGA 3T7EA 2HJSA 4FFPA 3CH6A 3KM0A 2WSBA 2C2YA 1LC0A 4E21A 4YT4A 5EPOA 5KTKA 2GN6A 1WPQA 1BDBA 1ZMTA 1ZKMA 4MIYA 4RZIA 4UVDA 5MDHA 1EVYA 3BHMA 3GFBA 4GGPA 4Z0HO 2JFFA 5HM8A 3JD2A 2VHZA 2NSDA 2ZCVA 3LF1A 1GEGA 4FFNA 4KZPA 4TRNA 5T57A 4FFOA 4MKZA 2I65A 2RHCA 1E3LA 5ES3A 1FDWA 1LLCA 2EERA 4MPDA 1X7DA 4R3WA 5KNLA 3K96A 4R4JA 2BHLA 5I7FA 2R00C 5B37A 1JKFA 1YS4A 1Q7GA 2X8LA 4L74A 1GQQA 3PYMA 5CPBA 4BNMA 5EJ2A 5COQA 3TWOA 3GDFA 3FR8A 3BTOA 1L7EA 1Y9AA 1P45A 3WQQA 5IG2A 3QLJA 1E0DA 4LK3A 3L4BA 4A73A 3GT0A 4L4RA 4GVXA 1KS9A 4OAQA 2PGLA 4GLOA 4YA6A 3VTFA 3FRJA 4JBHA 3WOHA 3TZCA 3JQGA 5BNTA 3V1TC 1RM5A 3GHHA 3I3OA 3ZWOA 1ADFA 5KVSA 3KOUA 1AHHA 4TVOA 1DO8A 3C1TA 4BNYA 4UVGA 3GPDG 5LCXA 5U4QA 1N1EA 1PJ2A 5AXBA 1WAMA 2O2YA 3R3JA 4UEKA 2FPIA 4XQCA 2BGKA 5TNXA 1EVZA 4NDNE 3STHA 1NAHA 3IUPA 1TT7A 5EMHA 2FPPA 2QX7A 3H65A 3K2EA 4B4WA 1VPDA 2HDHA 3OQ1A 4DLLA 4YJHB 3W1VA 4EUHA 3IQDB 1SEPA 4IQGA 4I9UA 4GSLA 5JC1A 1R66A 2GZ2A 2PGJA 3ZHXA 1DPGA 1QMGA 2Y66A 3DTTA 4E5PA 1SAYA 2HRBA 4NPCA 1KY5A 3WTBA 1CJCA 1YJQA 2X0RA 3QIVA 5DBGA 3AJRA 3IL2A 2X9VA 4I5FA 4J1TA 3VVCA 1HDGO 3IIEA 3GR6A 2AE1A 4J2OA 4OO3A 4YAJA 1LEHA 3L6OO 5KJ1A 3H9GA 3NUGA 3AUSA 1VI2A 3CKYA 1ZH8A 2QRJA 3QP9A 1HYHA 4N18A 2Q99A 1DIAA 4M49A 1XSEA 4NIMA 4EYEA 2BFAA 2CVZA 5FYDA 3FBTA 2XPCA 1PQWA 2Y68A 1JQBA 4O59O 4BV9A 3QVSA 1DJNA 1Y7TA 2GERA 3RU9A 3H8VA 3HUDA 2FSVA 4AJ4A 5L4SA 1O8CA 1XIVA 1B7GO 3QY9A 4YRAA 1XU7A 3Q6IA 3UOGA 1J6UA 1FDTA 1YKFA 2P9EA 3D64A 4K6CA 2NLOA 3ONDA 1EFLA 3DHYA 2X0JA 4ALJA 2PKQP 4WPGA 3TJRA 4EDFA 4Z3KA 3AFMA 3JD3A 4D0SA 3S2FA 3F1LA 3U49A 3I5MA 1CDOA 3OBBA 4K1LA 3IP1A 2I66A 5C7LO 2VHWA 5COBA 1XKQA 4WE3A 4YT8A 5G0SA 4WASA 4NMHA 3LK7A 1GD1O 1DFHA 5HS4A 3GN2A 4U7WA 4I9HA 2IRWA 2A92A 1H0KA 2PLAA 4FFRA 3F9IA 3U62A 1NFQA 3RC7A 1OFGA 2DFDA 2Q49A 1CEQA 1I30A 3UCXA 3JD0A 1PZFA 3O9ZA 3ZWPA 5CG1A 5DDIP 1ADCA 1XEAA 3G1UA 3ANNA 1ZK2A 2X5JO 4JNKA 4R01A 1ZVMA 1NWCA 3HB4X 4YAGA 4CLXA 2GCGA 4XQGA 2EGGA 5BR7A 2B36A 3NT4A 1JA9A 3V2HA 4MIEA 1O89A 3QRWA 3FSRA 3F4BA 2BGMA 1DOHA 3LVFO 1B2LA 2R6JA 3CIFA 4K6FA 2B35A 4MJLA 1B16A 2B83A 3C1AA 3NDIA 1WLYA 1YBMA 4AJ2A 1VJTA 4OIMA 2VHXA 3MWEB 4A5OA 2VWGA 4J4HA 4G81A 4R5HA 1YO6A 3CMCO 4FC6A 1R12A 1S6YA 4B4VA 2X0IA 3PTZA 3MJVA 4R51A 3DBLA 4U8GA 4ZRNA 4D41A 2R2GA 4AJPA 5JC8A 3R6DA 1UH5A 3QWBA 5FFFA 3SBOA 1MG0A 3COSA 2VRBA 1DBVO 4HBGA 1HE5A 3CE6A 4R3NA 3DHNA 2VRCD 5TIIA 4BNVA 1LQTA 4RDIA 3RUIA 4G65A 1ISIA 1FMCA 3FN4A 2B5WA 4ND3A 2Y67A 4NBTA 1XQ6A 1VM6A 3TZQA 1LLDA 4DIFA 1NQOA 1XU9A 3WNQA 1CWUA 2X58A 3RU7A 3L07A 1QYDA 4RPLA 4FW8A 1AGNA 1NQTA 2GUGA 3RFXA 4UEJA 2AHRA 4FQ8A 4OKNA 4TVBA 5C3MA 3DC2A 1WDKA 3BA1A 3WS7A 4HV4A 4J7XA 4YJHA 4RVFA 1LDNA 3FNFA 3W8FA 3VH1A 2D4AA 1F17A 3A28A 5TC4A 1X0XA 1PGPA 1Q2XA 4N5MA 4DQVA 2CDAA 3H4VA 2OOSA 4QFCA 1T25A 4XWYA 1PZHA 4ESOA 1ZJZA 4XCVA 4WLNA 3D3WA 4QQRA 1ONNA 3RUDA 3FNGA 4ALNA 1HDOA 4XRRA 3ROPA 1EQUA 2HSDA 4WKGA 5JAIA 2TMGA 1W73A 2W90A 3DMTC 1JWAB 1QG6A 1YQGA 3QV1A 1R15A 1BXGB 5J23A 5GZ3A 4R1TA 2HMVA 4JLWA 5JW6A 4JK3A 4WLFA 2GN9A 4RPJA 2IDZA 4R1UA 4BNLA 3BTUA 3F3SA 4U5QA 1XHLA 3OMLA 1A7KA 3JYQA 3OJLA 3P2YA 1LUAA 3PFFA 3U4HA 3EUWA 4YXFA 3N74A 3AI1A 4BKPA 1EFKA 3OM9A 4RO0A 5I7SA 3I6IA 1KVSA 1F8FA 3GVXA 3HSKA 4JX8A 2BRUA 2I67A 1EUDA 4AJOA 1GAEO 1LXCA 2HQ1A 2HK8A 3EC7A 4N5NA 4KUEA 3WGYA 1KVRA 1G1AA 4NFHA 4XZ3A 3ICCA 3ZU3A 3ZNQA 3BMOA 1PZEA 4E5NA 1LQUA 3FR7A 1UR5A 2Y1DA 1MB4A 5DF1A 3EYWA 4XR4A 5JS6A 4N54A 1MG5A 1OOEA 1Q7CA 3AOEA 3LQFA 3ROMA 3DFUA 4GVLA 3IAHA 4NJOA 6LDHA 1DIBA 2G76A 1QYCA 4Q3CA 1LLUA 1R6DA 4PZCA 2PR2A 2QHXA 3GNSA 2AG5A 2NVWA 3I9KA 3P5SA 4ZA2A 5AOVA 4CMBA 4II3A 5DCUA 2PZMA 4J91A 1HDCA 2CZCA 3Q0EA 1I2ZA 2BFMA 2OL4A 3U5TA 4ZRMA 4D0RA 3JQ7B 3IKTA 4JJFA 4D44A 1PTJA 4B7UA 2IZ0A 4J6FA 4CR7A 5IXYA 3WBBA 1MC5A 4M89A 4BO6A 4U0JA 1E7YA 5KVCA 1GPJA 5EQFA 2VTEA 4CLEA 4DBVO 2VYVA 2P4HX 2Y0CA 3KVOA 1LRJA 2P91A 1GY8A 3FPLA 2R00A 1A4UA 2DBQA 2X4GA 2GGSA 3DWFA 1KC1A 1H6AA 2B5VA 4D45A 3H9QA 1Y8QB 3PXXA 3C1OA 3PIIA 4IDDA 3W6UA 3U9LA 1D7OA 1M6WA 3F6YA 3PJEA 1QV7A 3I52A 3OJOA 2Q50A 3CPSA 3HNPA 4FD3A 4IQ0A 3OIDA 3K9QO 3KSUA 4KTTE 2Y93A 3LU1A 3HDQA 5JNLA 2FZWA 1O6ZA 1KC3A 3IOYA 4E6PA 2JD0A 3GDOA 4XIYA 3WGHA 3TF5A 4M1QA 5IZ4A 1SMKA 4MKXA 4IJKA 5JCJA 2JL1A 3ZV4A 4L75A 5G4KA 3VZSA 1TI7A 4DTIA 2C2XA 2NV6A 1UP7A 2H6EA 1GQ2A 3AM5A 3F46A 3WTCA 4CM9D 4DC0A 3I9JA 3IJRA 4W9NC 1BSVA 4OOFA 1LDMA 5CEFA 1N2SA 3E5MA 5JO0A 1OBFO 4H7PA 3H9UA 4NBVA 2DT5A 1ZK4A 3CXRA 4Y6RA 3BAZA 2GZ1A 3ITKA 1JTVA 1Z82A 2A9FA 1DC4A 3ONEA 1ISGA 2YUTA 5U1PA 4J0EA 3GVPA 5F21A 2EHDA 3I1JA 4DRYA 1PU2A 1QYWA 3JQAD 3VDQA 3JQ9C 4W4TA 1B0AA 4LSMA 1F06A 2VQ3A 1U2GA 5FWNA 3QQPA 3LF2A 4KMSA 2VYND 4UUPA 1GV1A 4IDFA 1P1IA 4QT0A 4GLLA 1HWYA 2B4RO 5T5QA 2ILTA 1EMDA 2IEBA 4DPKA 2VOJA 2J3IA 2W4QA 3GH3A 2CFCA 2GYYA 2Q1WA 4BNJA 4BO0A 2NTJA 1GYPA 1ZO8A 2C0CA 4JCOA 3RC1A 1EZ4A 1CETA 1WVGA 3VZQA 3BZUA 3MOIA 1H94A 1LC3A 5C37A 5JY1A 4WLOA 3P2OA 4IS3A 1HDRA 1A27A 4FGWA 1UZLA 4EI2A 2BI8A 5T6BA 1BXGA 4DVJA 3LDHA 3ROQA 2JFGA 1XYGA 4DC1A 5A4DA 3ZV3A 3DHEA 3HN7A 3ADOA 1G0NA 2PH5A 2YV3A 4RVSA 1MC4A 4YT2A 3S55A 3PLNA 2IYOA 4RDHA 4WLEA 4OL9A 3FD8A 2P2SA 4YAIA 1NTOA 1EE9A 1PJ4A 3UW3A 4YYZA 3D4OA 4WNIA 4CLHA 4NNJA 1BVUA 1C14A 1K89A 4YB8A 2B69A 2FP4A 4S1VA 1M67A 4D79A 2NTVA 3WGZA 5KJ6A 3GRKA 5CAEA 3BMCB 1YBAA 4H15A 3GK3A 5A06A 3ONFA 3PVZA 3NT5A 4AJJA 3VHRA 1QLJA 4G2NA 4PLPA 1YE3A 5A9TA 4CQMB 4R1SA 3DTYA 4DQUA 2GO1A 3AI3A 1SOWA 1ADGA 1SCUA 3E5RA 3OQBA 3W4JA 2ZB7A 3GMDA 5A04A 4TRJA 4PFJA 5COAA 3O03A 3DXFA 2JCVA 4J43A 3GGPA 1E6UA 4TRRA 1E5LA 5DBIA 2VT2A 2B0JA 3AM3A 2FHSA 3E9QA 4X54A 4LCEA 1HSZA 1TB4A 2H63A 4XQ9A 4A0SA 1KEUA 1NPYA 2EJVA 3QA9A 3Q9NA 3OIFA 3GLQA 5CDSA 3U09A 3OP4A 4WCDA 2QRKA 2ET6A 3JQ7A 1X15A 2HMTA 2YQ4A 1R16A 4BNIA 4A2CA 2LDBA 3HADA 3DBRB 1EK6A 1R0SA 2Y1FA 3JYNA 4KDEA 1GFSA 3IC5A 4RVDA 3ETDA 1L1FA 3KBOA 3FHLA 5IDXA 4F3YA 4KDFA 1Q0QA 2HAEA 1QSGA 2WMDA 2Y0DA 1TLTA 1HE3A 3ZNPA 1Z7BA 3DQPA 5A9SB 5AVOA 3I83A 2H5LA 2EWMA 3JQEA 3ZZNA 1BXZA 3V1YA 3G49A 4HNGA 1C3VA 1Y8QA 1C0KA 5B1YA 1JN0A 3BXXA 4NG5A 3HJAA 3D5QA 4CV0A 4ZN6A 4B3IA 1XQ1A 1ZXBA 2ZB3A 1E3SA 1T2AA 4U6SA 2Q4BA 2UYYA 4BNHA 1UZMA 1UDAA 2DUWA 3L77A 5ILOA 3PP8A 1RWBA 1YOVA 4JBGA 5CDYA 4BO5A 4ZJUA 3WYEA 1NVGA 3HB5X 4MVJE 3L4SO 2CMDA 3GVCA 4XJSA 2NWQA 4FJ1A 4BO2A 2VNAA 1DJQA 3GG2A 3AM4A 3TL2A 5A03A 4UAGA 3DZFA 1DC5A 4P8RA 2OHXA 3WFIA 1HZJA 4ALMA 1EUZA 4BNFA 4J4BA 4WOKA 3DZKA 3WXBA 5CEJA 2FWMX 4RF4A 3CUKA 1I24A 5G0UA 2AMFA 3PQEA 1R4NA 2CDCA 3R1IA 1DLIA 4FPXA 3TDKA 1I3LA 2QW8A 1VJ1A 3P19A 4LVUA 1B8UA 1KIFA 4MVJP 3RUFA 1A72A 3VOSA 1EEHA 1ZIDA 5GY7A 9LDBA 2ZATA 2CVQA 4NU6A 2O3QA 2NU9A 1RYDA 3U4CA 5HA5A 1X1TA 4E5MA 2OBNA 1N1GA 4BGUA 5BNIA 2G0TA 1LX6A 3EAGA 4XYGA 4C7JA 5LDHA 3DMTA 1QYXA 3V2UA 1GCOA 1Y1PA 5TJ9A 1PJLA 1Z45A 5IF3A 5L53A 3ZWBA 5H83A 3TN7A 1J49A 1KBZA 3KXDA 3PDUA 4YBZA 1HXHA 3K5PA 2DU8A 4IXWA 2B4QA 4G5HA 4W6ZA 4BKUA 3H6KA 3IMFA 3INRA 2EJWA 1YVEI 5I8WA 2DQ4A 4E31A 1DHRA 1MXFA 4RF3A 3PQFA 2HMSA 4PLFA 4L9RA 1XCBA 4XYMA 3MWDB 3KYDB 2X9NA 4DWVA 1ZZEA 1GU7A 3EHEA 2VUSA 5A9RA 1G0OA 1M66A 3B20A 4WNCA 1NPTO 4RV9A 3V1UA 1EVIA 1P44A 3TPCA 4BV8A 3DBLB 2E49A 1OI7A 4I08A 3L0DA 1F14A 4Z0PA 5JDCC 4OGWA 4BIIA 3IJPA 1DEHA 1U9JA 2C29D 2GZ3A 5C7OO 1YDWA 1WNTA 1PJQA 2HMUA 3BMCA 4A03A 2HU2A 4NHEA 1QLHA 5G0TA 1SPXA 4BOYA 4I5GA 3N7UA 4YAKA 5JMPA 1UXJA 4CQMA 4FJ0A 1NVTA 3H3FA 3WICA 1TXGA 2UAGA 2C7VA 5HS6A 5JE8A 4QECA 5TT0A 4TQGA 3UN1A 1GL3A 1T26A 2VNSA 3PI7A 4CODB 3ZI0A 1PR3A 4CMEC 4TZKA 3AK4A 3WGGA 1IHYA 2G1UA 8LDHA 4GGOA 1T24A 1X14A 3O8QA 1DC3A 4GWKA 4J7CA 2VYVD 4W99A 4ALIA 1WWKA 4YTEA 1NAIA 3L6DA 4JROA 3UCFA 4W82A 2Q2WA 5K9ZA 5B12A 4FFLA 1D1SA 4DIOA 4ALLA 1HLDA 2I6TA 3O4RA 1VKOA 1FDVA 1ENPA 3WB9A 2OO5A 1Y9EA 2GASA 3DBRA 4YCAA 5A3VA 1E3WA 1IYZA 1QV6A 3RJ5A 1LBEA 1WXDA 2OXIA 5ITWA 4QO8A 1Z73A 3OEYA 1M6HA 3NT2A 5A5FA 1SNYA 4IDGA 5DP1A 5DN9A 4OQYA 3D3WB 3NKLA 4E2WA 5A9SA 1E6EA 2ZCUA 1I3NA 5IAAA 2XAAA 1LSJA 3DONA 5ER9A 5AXAA 2DPGA 5IN4A 1UDBA 1E1NA 1HZZA 3DZIA 5I9LA 1PSDA 1T2CA 1PJCA 5LC1A 1I32A 3GFGA 3GAFA 3ZGYA 1V6AA 5L4LA 1NWHA 5HBRA 1KVUA 1E3JA 4XIJA 3I9OA 1X7HA 4HFJA 1YXMA 1AN9A 3KYBA 5K0ZA 4KQWA 4W9NA 1DSSG 4CMIB 5ENVA 2Z1MA 4EGFA 5DP2A 3EMKA 4LRTB 2FR8A 3FPCA 1ISHA 4FCCA 4BGIA 1XWFA 1NBOA 1B3BA 4U6QA 2PV7A 4HXYA 3H5RA 4IGFA 3GQVA 4XEHA 1HF3A 4NR0A 1E6WA 1NR1A 2W2KB 4LSWA 5I7VA 4XB2A 1DDOA 4DLAA 5CHEA 4H3VA 5FI5A 3GGGA 4J4TA 3ZWAA 1R37A 4CMKA 3D1LA 4MDHA 3DOOA 3JQ9A 1YJ8A 4GX1A 1SB8A 2Q3EA 3F5QA 5C7IO 4NH4A 5F5NA 2WE7A 3BMOB 3NYWA 5CG2A 4L8VA 1DRWA 2OP0A 2D5AA 3ASUA 3HN2A 3KLPX 3LZ6A 4D7AA 3C7DB 4NFSA 4BHTA 4BQRA 3WWZA 2V6FA 3SLKA 2D59A 3MCVA 2ZTUA 3F5SA 3NTOA 4PVDA 1I36A 4NFYA 5AXCA 1HE2A 4IGEA 2UDPA 4CPDA 2C59A 3G0OA 2OZPA 2VOEA 5IN5A 5THKA 3KV3O 4CUZA 1NASA 1VKNA 1LDGA 2AEJA 2V7PA 4HUJA 4OMUA 2SCUA 1U7TA 1E1MA 4YQYA 5AXDA 1OMOA 2YFQA 1GYRA 1K0UA 1ULUA 2EKLA 2OMEA 4IPTA 2ZTVA 2O2SA 2IEDA 1N5DA 2BH9A 4B8WA 3I9NA 1PL8A 4ILKA 1N7HA 4R9SA 1OZAA 5JFOA 4J90A 3GC6A 4YPOA 1PS0A 4MP3A 4IJWA 1I33A 3GVIA 2Y1OA 1HEUA 5EL0A 3C7AA 3RAJA 3SXPA 5TGDA 3GVHA 5C5IA 4BKRA 5I7EA 5TF4A 4YRBA 3D7LA 1WDLA 5FI3A 3WMXA 3ZN2A 4BNKA 2O3JA 1MFPA 4D46A 1RM0A 3NDJA 5IZCC 3RIHA 3KYDA 1HYGA 5JAQA 1GPDG 4MOWA 1NVMB 1I0ZA 3JYOA 1YWGO 4WUVA 3OA0A 1JVBA 2ZB8A 2YFHA 1VL6A 4O0LA 1PZGA 1YH3A 3D5TA 5L95A 2YDYA 1WW8A 3G3EA 4DL9A 2WYUA 1ADBA 2I3GA 3D4NA 3RC9A 4DYDA 1Y5MA 3GOHA 5G4KB 4CM1A 2QYTA 3EDMA 3I23A 1U3UA 1UAYA 2I3AA 4F45A 1N9GB 4IINA 4NJMA 3UKOA 3H5NA 1PGNA 1VLLA 3BMQB 1PJ3A 3HHPA 3MJTA 4I5DA 4M8SA 1LI4A 2PFGA 4Z0TA 2FZEA 3BHJA 4I5EA 1DXYA 3ZH2A 5TT1A 2DPHA 3OQ6A 3G17A 4FOOA 3JQCA 2DM6A 3OSUA 1B26A 3KTDA 4JJGA 3PJDA 2C54A 3WNVA 3CINA 4UUMA 2FPGA 1DFIA 4CMGA 3EGOA 4PLVA 4BNNA 5THQA 3VKUA 5L9AA 4Q3DA 4ZQBA 1Z75A 4CV2A 5BSGA 4BUCA 3RKUA 2JJYA 4BO8A 5FEUA 3FNHA 3MJSA 3LYLA 4J16A 4GI2A 2PD6A 4XDZA 1PL7A 1P1FA 3E18A 4CM7A 1HDZA 4J9UE 5KWEA 2C07A 3H2ZA 1K6XA 4BGVA 4OSOA 3H9JA 3PJGA 3D4PA 4PLZA 1ORRA 4D42A 2JFHA 4PG6A 1LRKA 2E82A 2P9CA 2IZ1A 2P9GA 4EJ0A 2X7HA 3E9NA 3AOGA 4YAEA 1D4FA 3ZDFA 4BO1A 1M76A 4M55A 5BSHA 1GV0A 3ENKA 3RJ9A 1ARZA 2G82A 1CRWG 2ZYAA 3DFZA 4LW8A 4IZHA 4ZVVA 3RUHA 4CMIA 5IDQA 4YRDA 3UCEA 2VUUA 4L4SA 4TRMA 2X1HA 4KWHA 3PZRA 2IYPA 2ZKLA 2DBZA 4PZDA 3KLMX 4BNUA 1BMDA 3QWFA 1ZUD1 2W2KA 1PR9A 1IOLA 3GEMA 1YDEA 3OHSX 2Q1UA 4O5OA 4GX5A 1E7RA 1R0KA 1YL6A 4FS3A 2ZQZA 4LISA 5CPFA 3ZWCA 4BKQA 4RPGA 1DB3A 4P38A 4YJGA 2HLPA 4TKLA 1A9ZA 2PZJA 3GY0A 1VL0A 1L7DA 3JYPA 4TWRA 4K26A 4YJFB 2JHGA 1O94A 1UXKA 2V6BA 1UP6A 4E2YA 3MTJA 3MTGA 1P1JA 4IDAA 5DT9A 2RAFA 4ND5A 4XQEA 3SX2A 3VTZA 3GZ4A 3KETA 3HDHA 1C1DB 1EDOA 1DRUA 4IXTA 3CEAA 2UUOA 4L0QA 2V65A 4I8XA 4MP8A 1KVQA 1PX0A 1SB9A 2EV9A 4XA8A 1IL0A 1KYQA 3KHUA 3RUEA 3QJ5A 3HDYA 3IP3A 1I3KA 3B1JA 2PGDA 4BS9A 3ICPA 3GPIA 3EVTA 3EZYA 2D5CA 4IQ8A 4WK6A 2AG8A 3SC4A 3L4BC 2Q45A 3ST7A 1VSUA 2EKQA 1IULA 3ZWWA 4LMPA 1D1TA 2XOXA 3DL2A 2BMAA 5CP8A 4PG8A 3ZWVA 3SJ7A 2ZTMA 4BMSA 1YB4A 3M1LA 1H93A 4IY1A 4BMVA 5JDCA 2ZIZA 4CQMD 1ZMOA 4CM5A 5JAMA 2AW5A 5KIAA 1ZJYA 2F1KA 4HY3A 3PGJA 4EZBA 3ZNOA 4RZHA 3KB6A 5DNAA 2X5KO 1JDJA 1KETA 3ZHYA 1W8DA 1XR3A 3IKVA 4CLRB 1JWBB 4TROA 2NU8A 3WGOA 1U7HA 3WMWA 3PPIA 2I5PO 1UDCA 3C8MA 3KSZO 2EGHA 3A9WA 3NJ4A 2GF2A 4CM8B 4EITA 3JQ6A 4CMEA 1YOVB 3JQ8A 1LDYA 2CY0A 5T8KC 1NYTA 1ENZA 2Q2VA 4JN6B 3AU8A 3GZNA 3LT0A 1N9GA 5TSDA 5TQVA 2CVOA 3ZWMA 2NACA 1P77A 2XF8A 3BMQA 4M86A 3MJCA 2DTDA 3VPXA 4B3JA 5L7WA 2ZTLA 3OA2A 2PZKA 2CUKA 4MVJM 5TS3A 4E0BA 3GAZA 3RVDA 5JYEA 3E48A 1ENYA 3ZWYA 3VKVA 4OQZA 1R4NB 2YZ7A 2DUUA 1PGJA 3AUTA 3RWBA 3AUAA 3UUWA 4CMJA 2WD8A 3NGXA 5F5LA 1UXIA 2RCYA 3RC2A 3JQBC 2VTDA 3RKRA 1WP4A 4EJ6A 3OICA 1E3EA 4CR6A 3H2SA 2BGLA 1UAGA 4K9DA 2OFPA 1P74A 3E03A 1H6CA 3ASVA 4HADA 5JY6A 3JTMA 3FTPA 4BB5A 1LDBA 5HTOA 3K30A 3ZU5A 1QORA 4I9NA 3ZV5A 3DAGA 2FOIA 3B1KA 3C85A 1E7MA 3SJUA 5KJFA 1WMAA 3ZV6A 3I9LA 3FWZA 2OBYA 1PS9A 3DR3A 4Z9XA 1J5PA 4AG3A 2FY8A 3T4XA 3WSWA 4H16A 4B4UA 4BO7A 1X7GA 4XJTA 4QFDA 5B4VA 1P0CA 1U8FO 1VJ0A 5KKCA 3JSAA 2WD7A 1W4ZA 1BW9B 3TFQA 2PZLA 4HFMA 3S2IA 1NFRA 2X6TA 1EK5A 1LRLA 1SEVA 2UUPA 2J6IA 3BIOA 3M1AA 3H3JA 4QXMA 3ZHZA 4YWJA 4MINA 4B79A 5KVVA 3NTRA 1P0FA 2WE8A 1ISJA 3ADPA 5KKAA 2EIHA 1QKIA 3MZ0A 2CD9A 3OH8A 4LRSB 1U5AA 3BMNB 4JGBA 3RBZA 3P7MA 3MOGA 3C3XA 1KEWA 2QYSA 1Y81A 3NRCA 3FBGA 3ZW8A 2PTGA 1SOVA 2O4CA 4OM8A 4IDCA 4J1NA 4Z9YA 3EZLA 3AY7A 4YJFA 1K6JA 4PLGA 3CTMA 1IHXA 2DLDA 2VT3A 3JV7A 4YDRA 5GZ6A 3TZ6A 1ZBQA 2Q1SA 5DCYA 2FR1A 5G4LA 4AJ1A 1A9YA 1UXGA 1U2DA 2IZZA 1BG6A 3PK0A 1LSOA 3O8QB 3VAZA 3ZU2A 1C1DA 3PHLA 5DOZA 4Q3EA 1MLDA 1MV8A 1SO8A 4WCFC 2VCYA 1LDEA 2WYWA 3WR5A 1LU9A 3VZPA 4MVJA 2O3SA 2QIOA 4JBIA 4NK4A 3TZHA 3WSVA 3RFVA 1K3TA 4J1SA 4KWIA 1T2FA 4JIGA 4BNTA 4EUFA 4PLWA 3GEDA 5BNFA 1JU9A 3PIDA 4FN4A 1E3WB 1GZ3A 3UFXA 4WOJA 4Q3NA 3QVTA 3O38A 2GN8A 4CUJA 3AY6A 1GCUA 3QW2A 3FF4A 4F6CA 2I9PA 1C0IA 1IE3A 1M2WA 2DFVA 1V35A 4NBWA 3QHAA 3FCOA 1E1LA 4Q39A 4W7HA 1H5QA 1GUFA 2O23A 2X86A 3U0BA 3ZHBA 4E3ZA 2YV2A 1DFGA 4B7CA 3T7CA 3I4FA 3CZMA 1GQYA 4CLRA 3AWDA 3PLRA 3UHAA 3DAFA 1PL6A 3NV9A 3VPFA 1BHSA 1ID1A 3JYLA 2AEFA 1C1XB 3DMYA 1JVSA 3K73O 2VWHA 4CM8A 4FJ2A 3TSCA 1V3TA 1UP4A 4BNGA 4OXYA 1E3IA 1RKXA 2BD0A 1JLLA 2O7SA 1E7QA 2VHVA 1HDXA 3JQAB 3W4IA 1HSOA 1FDUA 1Y6JA 1IPEA 2VWQA 1E5QA 3DZHA 4E2XA 5A1TA 2XXBA 1MGOA 1T4DA 2JD2A 1F12A 3N58A 3R3SA 4ND1A 4INAA 1PQPA 5JSFA 4NBUA 4PIVA 2VZ9A 3PHHA 4YACA 5DOVA 5F1PA 4CLOB 2F00A 1N8KA 2VZ8A 4PZEA 1I10A 3G79A 4XR9A 7ADHA 3WLEA 3FI9A 2VUTA 3I6QA 1NPDA 5GMOA 2P5YA 5IFLA 3OECA 1GADO 5IXSA 4E33A 1CQJA 3CSDA 5I9NA 2PD4A 5A5EA 3NTQA 2NM0A 2RBEA 4S3MA 4DREA 2P5UA 4CQLB 4E13A 4BL5A 1DIGA 1KEPA 1NX6A 1QXSA 2OGUA 3INTA 5A05A 4HX5A 1N7GA 5B4TA 4BNWA 2B4TO 2YYYA 1VC2A 4GPD1 3E82A 2PA3A 2EEZA 1XG5A 1EVJA 4TMFA 3K2BA 4JJIA 3VZRA 1DC6A 2V6GA 1U28A 3QWIA 4OHUA 3WQRA 3GGOA 2JCXA 5AYVA 3WFJA 1CF2O 2BI7A 2J3KA 2J5KA 1U3VA 2JAHA 2OUIA 3E8XA 4GSKA 4KQXA 2H9IA 3LC1O 1PWZA 2LDXA 4PLYA 4F46A 3OJFA 3U4DA 1FDSA 4FR5A 2D2IA 1HTBA 3DDNA 4WECA 3ABIA 4LVCA 2PWZA 1ONPA 1T1RA 5TX7A 1IB6A 5JLAA 1BW9A 1ZEMA 2POQX 4RQTA 3SC6A 4HP8A 5BT9A 2W2LA 3DZJA 4DGSA 2D3TA 1A7AA 5L3ZA 3IS3A 1ISFA 5G2OA 3HWRA 1A4IA 3W6ZA 3VC7A 4Q3AA 1VE9A 3TNLA 1G6KA 4R16A 2WTBA 3GNTA 1S7CA 3B70A 4RCVA 4RGBA 1I01A 3PWZA 1RM4A 1NQ5A 2AEMA 3BYZA 3G1TA 2DKNA 3K6JA 5H82A 5I9MA 1H2HA 3LLSA 4Y6PA 3TL3A 1CIVA 2HK9A 3NEPX 3PYLA 4KUHA 2NU6A 3UF0A 4BGEA 4XYEA 5KVQA 1KOLA 2ZYDA 3BMNA 4RORA 2NVUA 3LC2O 1I5RA 1HRDA 2AE2A 4OSPA 1ZSYA 1O5IA 4E2ZA 2Y05A 4CL8A 3WG9A 4WCFB 3VVBA 4BO3A 4CV1A 4NJMB 5EIOA 3E9MA 1HKUA 3R0IA 1GUZA 4PCVA 1A5ZA 1X13A 2E6UX 3GG9A 4J3FA 2GNAA 2JAPA 3HZZA 1NHGA 4PLTA 2CSUA 2NQTA 2WYVA 2HRZA 3ON5A 3Q2KA 3FNEA 1JW9B 4FSHA 4Y98A 4WLVA 5K1SA 2J3JA 4OJNA 4PRLA 1SBYA 4NI5A 4OH1A 2DTXA 3S2GA 2WWRA 1IZ9A 4Z3DA 1DLJA 4LCJA 3ITDA 1NR7A 5IJZA 2A4KA 5JDIC 4ZICA 1WZEA 4PRKA 3ULKA 3NGLA 1F0YA 4QO7A 3GNQA 3W4KA 4HKTA 1DAPA 5BSEA 4IBOA 4YEDA 1IUKA 1V9LA 3AUUA 1KEVA 2GPTA 3H9EO 3OF2A 5JCJD 3PZBA 4CM9A 1YGYA 1W0CA 2VZ0A 3GN1A 1P9LA 1ZK3A 2NADA 3DBHB 2PY6A 3IUSA 4C7KA 4FGSA 2YHIB 2BELA 1IZ0A 3DEYX 3Q11A 3PEFA 1LTHR 2BF7A 5T8KA 3NJ8A 5LDGA 4P4GA 3KRTA 4CM3A 4JQCA 4CUKA 5DZSA
chains in the Genus database with same CATH superfamily
3X3HA 4UARA 4QSHA 5SYNA 2R8YA 4BLTA 3KAKA 5ILGA 5AVYA 5CDFA 2OXRA 3IKJA 1COZA 5A7FA 2BMWA 1P1HA 1XF1A 3LKBA 4C4TA 2P41A 1HE4A 4XSGA 1Q6YA 2CDNA 3OETA 1Z74A 2CBGA 3D02A 4P36A 3KXPA 5AKEA 5KWVA 2ZAIA 2Q5IA 3DP9A 1TZ2A 3GLRA 3ANXA 1OGYA 3KQNA 1YMUA 1ZW1A 1PZXA 2KE5A 3HCBA 1DJMA 4MVYA 2C20A 5E7MA 3N70A 1LNQA 2C7GA 3IRVA 1I6WA 4QWWA 3LOPA 3G5TA 2ASEA 2JFPA 1XA3A 1ZN8A 2QZZA 3M5WA 5I8ZA 4B7XA 2BM0A 2HGSA 3PUJA 4OF4A 2AR9A 3UICA 4CLOA 3BFJA 4ENPA 2XTJA 5EWJB 2OCXA 3H0EA 2IEYA 2PAAA 5J40A 1CR0A 2IBMA 4AI6A 1GAWA 4EHFA 1XU4A 4U2GA 3C41J 4G9EA 2BEVA 4A27A 1JQ3A 1I0LA 2ASVA 1Q74A 2ZREA 1B42A 1SVSA 2O05A 2ZAMA 3BGOS 2R3SA 1J20A 3EVZA 3PNMA 4ND4A 2W6PA 4RIHA 3RIYA 2OBXA 1A1SA 4P93A 3GJTA 5FWYA 2GPJA 1P2DA 1V47A 4IDEA 2C9MA 3MM4A 1HLPA 3IR5A 4CTMA 2VA9A 1O0SA 4IJ6A 3DW3X 1PF7E 1XT6A 3L0SA 2WKQA 1U5CA 2H7YA 2NZWA 1V3VA 3AB7A 1QPGA 3B2NA 1ZJ6A 3BTSA 1QZTA 3EDRA 3AFOA 3I1FA 2NGRA 2JFZA 2I0FA 4FWIB 4ID9A 1FVXA 3V8BA 3GUCA 1D0IA 1GNPA 3ME5A 3RYIA 2OFWA 2D3WA 2GPAA 3NBKA 5ERGB 1EBBA 2GK4A 3A1NA 4RZXA 4TLEA 3TLJA 1ORHA 1TC2A 2Y1EA 3WOVA 3C7CB 1GM5A 1JPNA 2HMWA 4TTVA 3SE0A 2NNLD 1C8KA 3NKFA 4QRHA 4R68A 4CIYA 3C6XA 5AKYA 5K0NA 1M8FA 1V5EA 3JYHA 3KQQA 3DOJA 1VHTA 3OC6A 4RVHA 4XVCA 1DI0A 3LX5A 2B8TA 3JZAA 3KD2A 4PSVA 1DG1G 5NLLA 4RLSA 3M6FA 3SFTA 4IFEA 1PJZA 1Z4MA 2XUHA 3F3KA 3RHSA 3L0IB 1B15A 1CPYA 4RPHA 5B58C 2BSQA 5BQ5A 3DOFA 3MUEA 1U7PA 3DF7A 1M2FA 1L7NA 2EZ8A 1VQ1A 2Y6UA 3EPPA 3GMSA 5EE3A 2UZ4A 4FUTA 4RC9A 5SYAA 5JRZA 3WL7A 2DOKA 4ETWA 3HEMA 3W9UA 4A2QA 1YQEA 4QGFA 1FTQA 5K4GA 1VG0B 2Z6QA 4MR8B 1HDIA 2OP1A 3L82B 3KJNA 5LR6A 1WCXA 4UEWA 4JXXA 3DWEX 5EMKA 2AXQA 2HV8A 3OQIA 1T8RA 1RHKA 2I4RA 2WABA 4WWHA 1KSGA 2WQ7A 2UUBB 2ZVJA 4UUBA 4AZTA 5A4KA 2GHIA 4HZUA 1IPFA 1ZCJA 4HSGA 4M1MA 4CKBA 1MC8A 5KS2A 2I2BA 1JQ5A 3G2PA 2X6QA 3V33A 4LNAA 3E8SA 4OYRA 3HCAA 1JKJA 2HUNA 3NORA 4TL8A 4C4PA 1J8YF 2Q7OE 4DG9A 3GRPA 2ERCA 3K8ZA 1BS9A 3LLVA 4CLDA 4OFBA 4B6RA 1GCGA 5CT6A 2NZVG 1IQUA 1N6LA 2OSVA 2XYVA 2UV8A 1NQAO 3KTFA 4G4JA 2E4AA 2ZULA 2ZIFA 4H1VA 4K1XA 4RD0A 1TW3A 4R1MA 3V8PA 2AKAB 1KJNA 1XP8A 3FDZA 4ISCA 3WKBA 2P4QA 3UA4A 3AW9A 3FTFA 3WGNA 1UXHA 5T41A 4CFSA 5JD4A 3L01A 5DT2A 3GW8A 4MKRA 4TZ0A 3R40A 4WAUA 1KERA 2D4HA 1KL7A 1S02A 2ZQYA 5IWCA 3U7GA 4Q34A 1NXPA 4GS5A 4PPQA 4NBRA 5FOSA 4P0QB 3JAWA 2FMUA 2ZIUB 5EMMA 3A11A 4YLGA 5HJ7A 1H8HA 5IK2A 1DKRA 1WOMA 1P5FA 1E4EA 4YRJA 2VS1A 3GWZA 3RBXA 3H1BA 1B1AA 5DU2A 1VRCA 3EH1A 3OZWA 1MH1A 4EW6A 2OLJA 4JASB 5IT0A 3EVAA 5IYZA 2C78A 1TC1A 5F51A 4UHEA 5JAPA 2O0LA 2D13A 1L3BA 4UVEA 1Q77A 3EWAA 4EUEA 5I4KA 4Z53A 2B21A 3GA7A 5G0WA 3BXPA 3IUMA 4TTSA 1OAOC 3WL8A 1Z16A 5JADA 3LC7O 3LNTA 4BNDB 5B3KA 5EN4A 4CIAA 1T2NA 1QYIA 3L7OA 1FTSA 4AICA 4C0WA 1NF8A 1LY1A 5GV8A 1XXHA 4HFNA 5DM60 1EVQA 4LOLA 1ZUIA 1L8XA 5GJWC 1PW5A 2BLLA 3T7AA 4ZEMA 1YRLA 3MJ4A 4IOKA 3OJ0A 4OHOA 1NY6A 4QWMA 4DBZA 1MV5A 4EVQA 3IQEA 3WYNA 4Q7EA 4KYTA 2HEGA 4KHZA 5C80A 1QH9A 1ESCA 5HF9A 4KI0A 1JLHA 4JAVC 1RR6A 2J4CA 1UODA 2IS6A 1N6RA 1W4LA 3FBWA 1JHAA 2CV2A 3SGLA 3K9CA 4NE7A 3TR0A 4H4DA 3ZE0B 3CZRA 2AW3A 1C41A 3FOWA 3RI3A 5BN4B 2RI0A 3MJEA 4QPPA 4O63O 4C4OA 4YJ3A 2HBRA 3MINB 2OBFA 3EK2A 1PJBA 1WD5A 4NZPA 4WINA 1F9AA 4R71A 2H5IA 4JMPA 4N9QA 3FXAA 1Q0RA 3KZVA 3TLBA 4C06A 4D3DA 2VN8A 3UAWA 4YMVA 3QKTA 4F85A 4ZT7A 1PYOA 2BKAA 4PGFA 2RSLA 1WW3A 3LHFA 1J21A 3B5JA 5CD9A 3G9ZA 5DGIA 1ZAYA 2V7WA 3VH2A 4KMRA 2AMVA 1FF9A 3NEJA 1ZH6A 2YVUA 4URFA 1SUIA 1E1KA 2V6MA 1ST3A 4WBSA 4OLAA 1XZGA 2CUZA 3F6PA 2Q5JA 4MK4A 5AW7A 5FH9A 1NJGA 3X2FA 1U1IA 3QFRA 4HCJA 2ZJ3A 1L3CA 5IMBA 3H1TA 4IH4A 5CT9A 3CG4A 1KZ1A 4QDUA 5FB3A 4RPKA 4FFDA 2R6FA 1N6IA 4D8UA 4HAYA 3M4XA 3NAMA 4K46A 4E46A 1XK6A 2O0MA 3S70A 1I7QB 1N3BA 2ZYHA 3AF4A 1BXKA 3FF1A 3L6EA 5B36A 4PBSA 4JT9A 3ZIUA 2ZZMA 2AQKA 2ZYUX 1U4SA 4OXKA 1EXVA 4C30A 4QVGA 1EGMB 1GNSA 2BFPA 1FUIA 3I04A 2O19A 5TRTA 3SS9X 1LK5A 4EMBA 3SWWA 3SEFA 4MW5A 4X62B 4IQ4A 3AHFA 3Q1LA 3K72B 5L7YA 3BK1A 1U2TA 2Z5LA 3U56A 1VE6A 2PAFA 3ESDA 1EVKA 5ECWA 3RW9A 4V2UA 3UUWA 4Y9RA 3HA7A 1A9TA 3OY7A 5JBIA 4DEYA 2ZRLA 1FVFA 1YS6A 4GOLD 4HFRA 1XCMA 4BE9A 2WC1A 3PNOA 4BZPA 2P2ZA 4CV3A 1ZNQO 2F59A 4A23A 2C57A 4LGCA 4XGKA 2W42A 3QKWA 3N5KA 2W6ID 4CR8A 4DLYA 1NM5A 4IGAA 5F4BA 1K68A 1VI6A 3SZGA 1H4VB 2IXAA 4Q0MA 3FPJA 2GVNA 3O92A 2DFNA 2KWIA 3N2ZB 4FNGA 4H7JA 4N6OA 4O2BF 4P4NA 5KYTA 3P2EA 4K9RA 1JDPA 1SUSA 4L2IA 1RXUA 5K4AA 5DBHX 2G28A 2Q9AA 4C4RA 4DDTA 4OBXA 1ENOA 1UINA 2R66A 1YQDA 3G85A 3WAGA 1Z37A 4QTXA 1EYZA 4IFBA 1ZWLA 2XMZA 5ENDA 1GUYA 3UTCA 4AQDA 6GPBA 5HM6A 4PG7A 1N0VC 4FC7A 4PXYA 4H0NA 5HBGA 1JHOA 1ZEJA 2WSSA 5IDYA 4YP9A 1UC8A 4M9UA 3NZEA 4ASUD 1NDQA 2BFFA 2OM6A 4CF5A 2CF5A 2V9CA 2I4IA 4TV9B 4FGUA 4UNRA 3HCDA 3H99A 4TWZA 4QXPA 3TCKA 4NV1A 1NXSA 2WAXA 1CEEA 3IDAA 1VA4A 2ZBVA 2KSQA 1Q0LA 3C3EA 3K1TA 5SY4A 3GLFB 2GZAA 3N0VA 4DDKA 3AU9A 5JH7B 1V8PA 4P2GA 2D8AA 3PRHA 3T5DA 4RETA 5LL6P 2BMVA 2VPQA 1HI9A 2BE9A 4D8TA 1CEYA 1U2RA 3TVDA 4DFDA 1XDSA 3OVMA 1TA4A 2GN1A 2QXUA 4NCBA 4NZOA 2PWPA 4TKVA 5JDIA 4IZIA 3SOPA 1BHJA 2C77A 1PDWA 4LXHA 1T6XA 4ZQFA 1OXXK 4MI6A 2X5OA 5HWSA 3NRBA 1QFXA 1OXMA 1UJMA 4AIRA 1TMOA 4FYKA 4CM4B 3QI7A 1J06A 3O1IC 3GBPA 2OHGA 2ADOA 3QJYA 2Q1TA 4J0KA 3SKVA 3GEGA 3ZUGA 2YDXA 4LXIA 4F91B 5EXEA 3TOZA 4CCSA 1RRVA 2EG9A 4B84A 3MAAC 1US8A 4B3BA 2IW3A 3VNBA 3WNBA 1B8PA 4MB0A 3MXOA 3WLHA 1OFTA 4EKEA 4TM8A 5KHOC 2JIBA 1AQJA 3MQ2A 3FHCB 5IBQA 4ZCLA 3UH1A 3QLTA 3KKPA 1Y6FA 1MABA 1UJ6A 4L72A 4AJIA 5L3VA 2EBUA 3GLKA 4M9ZA 1N2EA 5JSUA 3GX1A 5TEWA 4RF2A 2GN2A 4HQ6A 4RULA 4AYTA 3GO4A 1XZDA 2Y0EA 4HLCA 2IVZA 4MQEA 4MRMA 4QFBA 4DQXA 5FL3A 4GOOD 2QI9C 4JVLA 3UC5A 5EJAA 1QPBA 2XCIA 3ESCA 4I55A 1JIKA 2FV8A 3C24A 1R5JA 4NEQA 5AKIA 2GTIA 4ZWNA 4YXWA 2FSSA 3LOUA 3TSYA 3Q9LA 2RHRA 5GTDA 1VYHA 1S2GA 5HIKA 3HXOA 1XMVA 1DE0A 1VJDA 1E4VA 2XYPA 4QUGA 1BRMA 5TMBA 1CYEA 3KVNA 4Z9FA 3TI7A 3TIXB 4D0LB 4XGNA 4MQFB 1U8XX 1OTHA 1UPAA 2CZQA 2RHDA 4XRGA 4ZHQB 4X5OA 5FUVA 1ISMA 5DJ5A 1GPLA 1EE2A 3U3JA 5KOIA 3KSAC 2EFEB 4IMJB 3IBGA 5ARDA 2DULA 1T0BA 1DIRA 3L0YA 3M1YA 4FN5A 4KBGA 1JAXA 5H81A 3M3DA 1FBTA 2X0KA 2XE6A 1KSJA 3F4LA 3WBJA 2Y1LA 2JK1A 4BQPA 2WWHA 1Q91A 3M6IA 1ORVA 2NG1A 4J7UA 3NWEA 2YWBA 1II8A 2PMCA 2QNRA 3H2JA 4Q4LA 2JIPA 2C2BA 1BHQ1 3DFFA 4BEWA 4J2HA 5B7QA 5ALSA 1DKNA 3L7NA 2BN4A 4ISBA 4M0KA 1AZWA 2CCJA 3IEVA 2MSEB 2KI5A 1YZVA 3U1VA 5C1DA 2AR0A 4LVOA 4PYIA 4GMHA 2HKIA 2GEFA 1PSZA 5GOTA 4B6OA 5CK5A 1RJEA 1P5HA 4D3YA 3E9DA 3MWGA 4J2TA 3LBIA 1CP2A 3ORRA 2VF7A 1NBAA 3QE0A 4IVPA 3T9CA 4DDHA 1H0SA 4XDGA 2NU7A 4RIFA 2ACVA 3IAAA 6ADHA 3IB6A 1Q0HA 1XTIA 2NUAA 1ITZA 1H9AA 1IAVA 5JMOA 1KYIA 1JQLB 4UQPA 2ZBUA 3KQPA 4XYLA 5IZCA 3O2SB 3RVLA 1AKRA 1N1DA 3LIIA 2XCSB 1T9BA 2GLXA 2JB9A 2P4SA 4KZKA 4OBEA 1WCYA 3RYFA 2PEZA 1SUEA 2J32A 4PZPA 3UMBA 3T1TA 1EI9A 1YRAA 3SAJA 3T5GA 1QP8A 2GEUA 2JA2A 1BN7A 1GTMA 3CWCA 3R24A 4K9KA 4MGYR 4R54A 3QSGA 4Y2PA 3ED1A 4XWKA 4JP3A 5AVKA 5CJJA 4MQLA 3ZE7A 5AW8A 3H13A 2R1ZA 2FN7A 3W04A 2EXXA 2YTZA 1YI1A 2GTPA 4ZT4A 5CDGA 2FPPB 4JOSA 2FG6C 4E5KA 1EBFA 4BKOA 1KKLA 3ETEA 2XOEA 4RSHA 3RSHA 1XGKA 2J09A 5BXQC 3ENNA 1BX1A 1X0VA 1FP1D 3R76A 2AN1A 2LP4Y 3DT6A 3GUYA 2HHCA 1KPHA 2R6ZA 4FDAA 4E4YA 4IJ5A 1YULA 1AY0A 3HCPA 4M6WB 3E23A 3L7IA 3ZHUA 1BTOA 2RIRA 4EG6A 2E18A 2SKDA 4AVYA 4AL4A 3H4MA 2VSQA 3C45A 3NIBA 3WB2A 2V9ZA 2Y99A 4D8YA 1TT5B 1VMAA 1YZLA 3DEHA 4KGVA 5B4UA 4IIUA 2OD9A 1C30A 2VHUA 3HLTA 1W4AA 4FI3F 1GNTA 2P9BA 2CT8A 2GH1A 3DDOA 5AI9A 1H8HD 1M54A 3QTLA 3FOEC 4R98A 4U00A 1TJ3A 4BE7B 2DWUA 3L84A 5CFZA 2EZ4A 4D4KA 4Z4GA 2AN9A 1DZIA 1T2DA 2BP7B 2E5WA 2JI8A 3LY8A 3OFSA 4MB2A 2XUAA 4R7ZA 3O1JC 4XLLA 1IQ0A 3V4PB 2IUEA 3BTVA 1T0HB 3QPWA 4ZTBA 2O8BB 2C5EA 1NG9A 1YC5A 5EESA 4PYJA 2I29A 1U90A 2X23A 5CNKA 5ADUS 1C3EA 2HY7A 4WJZA 2PFSA 3QU2A 4KBYA 5JG7A 3TRIA 3BT7A 4MS3A 1EM8B 1EQAA 3TW8B 1ZLYA 3WK8A 4E5YA 4RPCA 5CCBA 4BQEA 2BBSA 1OAOA 5TV2A 2OV4A 1GSIA 2CHVA 2E48A 1OY1A 1U11A 2Q4EA 5K0CA 2FW1A 2HO5A 5B2ZA 2DY0A 1G4AE 1MX3A 3FMIA 1J4AA 1TYAE 3LXMA 1OIVA 3C7TA 3STTA 3FUWA 3NHFA 4EVIA 1VJ5A 2G77B 3Q12A 4MS4A 3IPCA 4XIGS 4PTZA 3LA8A 4MV9A 3ZDQA 2BRUC 1K08A 2AOWA 1XVTA 2XEDA 3VZDA 2P6MA 3PHGA 3VYTB 1AU9A 3U7QB 4DT1B 3CB4A 5ALGA 4O4HB 1DAEA 3I05A 1HM5A 3ABRB 3LD9A 3WMFA 4ERXA 3AR4A 1PUIA 2IPOA 5KYWA 5H3LA 4Q3LA 2ZT7A 4MQ6A 3AR3A 3AXTA 3COZA 1L5KA 1ESZA 3S7ZA 2GCEA 2ZTHA 4TKUA 3VDRA 2LTAA 2AOUB 2CYBA 2GF9A 2GR9A 3NHSA 4DUPA 1YZGA 2WF9A 4GG1A 1SC6A 4J9VA 3SC2B 2JHPA 2VL7A 5BVHB 4RKQA 3T7EA 2L82A 4FFPA 4G9BA 2W6MA 2PH1A 1O94D 1YSCA 3MT9A 4DSUA 2TECE 3FPSA 4WN9A 1YA6A 1VG8A 5JNRA 1EX9A 1Y8CA 4JI4B 3TTUA 3ZX4A 2IXFA 5EPOA 1W88B 5KTKA 4RNCA 1ZD5A 2Y27A 2GN6A 5LUBA 3VU1A 1QHEA 1ZL0A 1VMKA 3MIZA 1J23A 5J2UA 1DT5A 2YNMA 3TYXA 3EDCA 1OR8A 4RZIA 2Q41A 2YWCA 3IVRA 3BHMA 1N2CE 5D5QA 3RV3A 4JI0B 3P4XA 2PZAA 4GGPA 4Z0HO 3S2YA 3JD2A 2VHZA 1IDOA 3SFVA 1SQ5A 3K15A 2ZCVA 4LC0A 4I9FA 4FCWA 1TX4B 1ZM3A 5K3CA 5KYYA 2Y1XA 3IMKA 5LA6B 4G0VA 1LLCA 1NU6A 2EERA 2XKBA 3D2AA 5KNLA 2MSWA 2BGWA 5A6VA 4JR0A 3W0LB 2R00C 1M6VB 2DLCX 1Q7GA 1DKLA 2X8LA 4P4SB 2QUJA 1XCJA 1A8HA 5CPBA 5ELMA 4BNMA 5EJ2A 3IEMA 3HSSA 3GDFA 2CLDX 3FR8A 2LKCA 1RDFA 3D8RA 1F5SA 1JJIA 2X14A 3OUZA 4NONA 1WUTA 2W9XA 2OCGA 2WICA 2WJVA 4GVXA 4L4RA 4A73A 1JXQA 1K7FB 1OYOA 1RPZA 3BSFA 4ZXPA 4GLOA 3EULA 3NNDA 1JFTA 1DRJA 2HRRA 3A9RA 4OTZA 4QYMA 4JBHA 1CTQA 3VTFA 3TZCA 3WOHA 4A2PA 1E3MA 3DTVB 1G66A 1XFDA 5BNTA 1CS4C 4Q7JB 3GHHA 4W5WA 1WCV1 2HF8A 1ADFA 1QDEA 1QO0A 3RARA 4N0MA 1AHHA 4RTSA 2NYAA 2E21A 4TVOA 2Z6VA 3QMVA 1L5LA 1MIOA 1CUSA 4EPWA 1J24A 1R8XA 1C7QA 1KU6A 2OV3A 3T95A 2ZSKA 4B2YA 5AXBA 3SJCA 4C07A 4E1AA 5BYKA 1S9HA 2O2YA 2V55B 2WSSD 2HIAA 1HE8B 1NG1A 3EUAA 3R3JA 2ORVA 1DCMA 2FPIA 3EQ7A 2F43A 3DP7A 3GJRA 4FEGA 1YU9A 1P60A 3PFBA 3IUPA 5BSVA 3UWMA 5EMHA 1BGWA 1R8QA 1TOAA 4JJ6A 1FUUA 3JVEA 4OA5A 4POAA 3VYVA 1JAIA 1CUDA 1U2EA 4EUHA 4ZZ0A 3K9NA 4WKBA 1R66A 3SQWA 1SWVA 1QMGA 2Y66A 3DTTA 1P0IA 2V03A 5DM4A 4DR1B 1P4JA 1P80A 1SAYA 1NBIA 2HRBA 1HYBA 4NPCA 4OXRA 5DX8A 5B58T 3TL6A 4R8MA 1IVYA 5CU7A 2ZJ6A 2XMBA 5KX5A 4XUGB 2X0RA 1N4DA 3PQ4A 2GBPA 1JA0A 3GFOA 5JBNA 3HCCA 1U2GC 2WF8A 3QMPA 3AJRA 1VMIA 4P7GA 4BEBA 4I5FA 1ZI6A 1ZR2A 2Q28A 2QE7A 3IIEA 4ER7A 2AE1A 1UWLA 3R0VA 3NHYA 4OO3A 4EO4A 1GZ7A 4OD0A 2PUHA 3H9GA 4A3SA 3NUGA 3T0FA 4RSRA 4RTJA 2DMRA 3ORHA 1R64A 1EGHA 4Q37A 1UJ4A 3SS8A 2GD2A 4N18A 2Q99A 1DIAA 4EYEA 1ECCA 3N2GA 1Y5NA 5FTKA 3FNBA 2XUOA 5FYDA 4RA9A 5EKUA 1PQWA 2JEYA 4DCSA 1PT7A 3QVSA 4Y2JA 3FOZA 2GERA 2GBFA 1Y6ZA 5IT9A 3H8VA 1Z0SA 2FMIA 5INTA 5L4SA 1MNAA 1PR0A 5B3LA 1B7GO 3QY9A 1CQPA 5AHOA 1Y8ZA 1KGSA 3U7EB 2XW6A 3HRHA 3OURA 2CV0A 3CKMA 4YCMA 2P9EA 2Y71A 4EECA 5K3BA 2IYTA 4PNHA 1U81A 2CLSA 1OXUA 3PE6A 2CFIA 5DN6A 5KNDA 2ZOSA 4COOA 4YXWD 4YCDA 1V16A 4LECA 4LQ4A 3G1WA 1DAHA 3J7TA 2H4FA 2QVYX 2X0JA 4LSZA 4ALJA 2WU8A 4ZGBA 4HQOA 2QN8A 4BN4A 5TR9A 4C0QC 3CVVA 2IS4A 1VZ3A 2C2ZA 2ZB2A 2P2DA 1RBQA 1H3FA 2FZKA 3U49A 4X1IB 4BATA 5E7IA 2PXHA 3OBBA 4K1LA 4MULA 4BBZA 2QA5A 2GILA 5BV0A 4ACAA 5COBA 1EVEA 3CR8A 1CQZA 3L6RA 3NAZA 2O2CA 5E3JA 3QNMA 4WASA 3LCCA 1K7YA 4G0ZA 4FBLA 2ZDQA 5HS4A 3PVCA 3TLYA 4ZVPA 4DCOA 3EXFB 3QUSA 5CGQB 5FCDA 4DIDA 5LYJF 2DB3A 2NUPB 1RFLA 4BYMA 1K27A 2DFDA 1T0IA 2Q49A 2HIHA 3PXAA 4DCMA 1RZUA 2QLBA 1B2RA 3GPCA 5HNKA 1ND6A 3ZWPA 2AG6A 5CG1A 5DDIP 2X8AA 2FU5C 1II0A 1XEAA 2NYUA 4M0UA 4O2AB 4US1R 3RM3A 4BBPA 3ANNA 2X5JO 1TUBB 5BUQA 2J7KA 1ZVMA 5BWNA 3HB4X 4YAGA 2GCGA 2GB4A 5LKAA 1RKBA 3IKLA 3BF7A 4JLSA 5DHRA 4D3SA 2CL7X 2MMCA 4KLRA 1TYBE 4MWCA 3ICEA 4GXNA 3RVNA 3V2HA 3VJMA 4NFLA 4V1CA 3V1LA 1O89A 2H5JA 3VR0A 1VP3A 2A33A 2IPXA 2F1OA 1E61A 3LRXA 3LVFO 4G41A 1B2LA 2R6JA 3UWDA 4AWBA 1Y3FE 1Z2DA 3N6XA 4RKRA 2B35A 4MJLA 3OTOB 4MUMA 3L8HA 1A9OA 1M34A 4BJ3A 2HDWA 2ZG6A 1WLYA 1R10A 2PUVA 3WRXC 4QRDA 1EJ6A 4OIMA 2VHXA 4BTEA 4LXTA 4G81A 4UMFA 2N0SA 3GAAA 4B4VA 3CIOA 3PTZA 3DVLA 3DBLA 3MCWA 1YF3A 1JQDA 4OHYA 2R2GA 2C5LA 6AT1A 3R6DA 1S8FA 1MC1A 3F5MA 2COKA 3AF0A 2N46A 3COSA 3PPYA 3QMWA 3A4LA 4M0FA 1KK2A 2VRBA 4Q9LA 3RVKA 2QUKA 1S5PA 4AMVA 3N6RA 3IDZA 1HE5A 1ZP6A 4FI3C 4CG0A 4R3NA 1PFYA 3DHNA 3LE8A 2J30A 3ZD6A 3ENQA 3X1XA 3T1OA 4F56A 1UPUA 3D4BA 4IV5A 4RFSA 4BFYA 2H00A 3DS8A 4IDNA 2Z09A 4RDIA 1PG2A 4C4AA 1PV1A 1HRKA 1VM6A 1Z2NX 3JQRA 2ZIWB 4FR2A 3TZQA 3V6MA 4OU4A 4G6ZA 4D1YA 1P73A 4R84A 3N0XA 5FUWA 4AX8A 1CWUA 2AVDA 3FE2A 5GP1A 3RU7A 4QT4A 4W5QA 1JXMA 1QYDA 1G8KA 1IG3A 1AGNA 3GBSA 1Z4NA 5T6MA 2X3FA 2AHRA 3JRXA 1WSBA 2HSZA 4LZLA 5BOVA 1TJNA 3QE4A 1UBCA 2JGAA 4JB3A 2VSOA 5C3MA 4CIWA 1WDKA 3IAFA 1FC0A 1GGHA 5L53A 3I6BA 5G41A 1W96A 4YJHA 1QC5A 2EEPA 1XAHA 1GKYA 5E95A 4DNXA 3O91A 4IW3B 4XOUA 2IH2A 4A92A 1VLMA 2P9JA 2RJNA 2OZLB 3FCYA 4OPMA 4C3UA 4DQVA 2XGJA 2JPDA 3DNMA 3H4VA 4HDRA 4OJMX 3KKMA 1T25A 4OFXA 3L6BA 4K5QA 3VV2A 1GPBA 2XVMA 3ZS8A 2QX4A 3U16A 4QQRA 4GR5A 5EYPB 3R75A 4ALNA 1POWA 2HSDA 4WKGA 3QK7A 4A8JC 2QD4A 5JAIA 3FB1A 1CUWA 1IBLB 3B89A 3LUGA 2HREA 3DMTC 1N5MA 4KXYA 1JWAB 5JV5A 1QG6A 1UANA 3SLRA 4LDAA 1AQNA 1R15A 3PB3A 3K5IA 4FFBB 1QR2A 3K0AA 3FFXA 4JK3A 3VYUB 1SUWA 1JBEA 4FE4A 4I1RA 1H0HA 3WDKA 3AEUA 1T3SA 3BTUA 1BVHA 3OZ7A 4U7GA 4YR7A 1XTTA 5DGCA 2G88A 2XEXA 4Z1OA 1U99A 4YRCA 1AV6A 5JQGB 4QG7A 1SKYE 1ULBA 3JYQA 1LUAA 4KLZA 1SBIA 3I6ZA 2DH6A 3AI1A 1EFKA 3HYSA 1XZJA 3HKCB 2Z2IA 3OM9A 3RE1A 1WNFA 5I7SA 2BBWA 2BZSA 1KVSA 2OXCA 2QP9X 1M8PA 1RAGA 3AQIA 4OQEA 5L3QA 3AERB 4WDRA 2FP4B 2BRUA 2R44A 3G7SA 3PKJA 5EZSA 3CNQS 2CXRA 1SKAA 2D2XA 3NTVA 2HQ1A 1Q21A 1UC4B 4J3NA 3X44A 1JWLA 1CFJA 2WYIA 1NVUQ 3ADKA 1G8YA 2RBKA 1RVV1 4RSMA 2OHHA 5DFAA 3OTGA 4PQFA 1M5UA 1KVRA 4XZ3A 4FHGA 4FP9A 1YZHA 1A9QA 5CCDA 5FUQA 2NN3C 1MR3F 3TIGA 1SCUB 4E5NA 4DLWA 3EQ9A 1UR5A 1MB4A 1WCIA 3EYWA 2JI9A 3UJDA 3P4YA 2OV1A 1II9A 3KQWA 3LQFA 3RUPA 3ROMA 2V0CA 1OREA 3PIRA 3STXA 4LFAB 1DIBA 2BY4A 2P78A 1PFUA 2YNMD 3QEJA 1ELOA 3IT3A 4HDSA 4Q3CA 5KREA 4RZQA 1KK1A 3IA7A 1HEYA 1QHNA 3L8DA 3LGAA 1V4VA 1MO4A 2AG5A 4M53A 1NBHA 4ZA2A 2Q3MA 4CMBA 5A5GA 5DCUA 1DEKA 1SD2A 3L6UA 4GQIA 1E18A 5B1SA 4BVBA 3CT4A 5F2NA 5AJXA 2JLBA 4PU0A 3H2KA 3PR1A 4ZRMA 3K8YA 2W7TA 3C6BA 4JJFA 5LLSA 2ZIAA 3V8QA 5IKEA 5C4GB 3QVGA 4CBVA 5AI6A 4CR7A 5IXYA 4BQIA 4M89A 1QKJA 4O2BA 4P1ZA 2WPNA 5LYYA 1OV4A 5ICGA 5TB5A 1QX4A 1P9OA 3E0XA 4BUZA 3V8RA 121PA 2VTEA 4CLEA 2ZBEA 1UBUS 1JEDA 2P4HX 2VYVA 4BQQA 3HI4A 3KVOA 1JU3A 1MVLA 1LRJA 4GOND 2P91A 5KDLA 5CLQA 5AKHA 2R00A 2V45A 3F8TA 4MJXA 1X39A 1H6AA 2B5VA 2OWDA 4RIIA 1IBMB 5LZ7A 3BVPA 2OR3A 4DUGA 4JVOA 1GU0A 2UKDA 4B3FX 4L0DA 3W6UA 2UZ0A 1D7OA 1VDZA 3HABA 4L8YA 3W9BA 1U9IC 2A5FA 3HJCA 3MWEA 3THSA 2Q50A 3CPSA 4ED9A 1TYEB 4RKEA 3H9BA 5JNLA 2D0DA 3HDQA 1ZJ4A 1MEEA 4QDJA 5LVAA 1FVHA 3B6KA 4B83A 2AFVA 2J08A 3NUQA 3GDOA 2XTNA 5F78A 3TF5A 4M1QA 1SMKA 4MKXA 5JCJA 2QX6A 1BA2A 4L75A 4WA7A 3T5BA 1Z6TA 5KQLA 3ADCA 2GN0A 1O58A 4E08A 5CA0B 4CM9D 2YZGA 3AM5A 3WTCA 4J0QA 3V00A 5K2OA 4QM6A 1JPVA 4EGSA 1YZUA 3IBYA 3MQFA 3P96A 5E0KB 5DI3B 1OFUX 4LQCA 2JJMA 1N2CB 3U3RA 3U7IA 1OBFO 4KPUA 2BGUA 1C8VB 3H9UA 2BL4A 2DT5A 4R40A 4YJ2B 2QUAA 3CXRA 3REQB 3KQKA 4IV8A 2NSLA 3BAZA 2Q29A 3CJRA 4UTZA 4WFIA 5F52A 4RMIA 2GXSA 4LS3A 1KDYA 2XZOA 5F73A 1TLLA 5ELLA 1DCFA 1Z5OA 4RXUA 1DXQA 5F21A 2EHDA 1T6BY 3NV7A 1VHDA 1P9RA 1JIJA 1QYWA 3JQAD 4XUEA 4MS1A 3MQ4A 5TEVA 4HUQA 5EAIA 1CUHA 3GH1A 1IJEA 1NF9A 1U2GA 2EU8A 2VQ3A 3CW9A 2NU9B 1U9CA 4DDVA 1XMOB 2A5YB 1HLGA 3FCAA 1OYYA 1SHKA 4L02A 5HIJA 1E2EA 1YI0A 2XTZA 3WLJA 4ZMBA 2HPAA 2PX5A 4AMUA 2ODTX 4GLLA 2B4RO 1BE8A 1LH0A 1EMDA 5T5QA 2BGGA 1XQ9A 2BJVA 5LQSA 4BNJA 2PKEA 3GH3A 3IT2A 3R0QA 5CLLA 1JG2A 3HUFA 1TECE 1XTBA 3H11A 1GYPA 1KAQA 1FE8A 4O2LA 5J2TB 1QP7A 4ARSA 1DG3A 1KA9H 1UBEA 3MGGA 4INZA 2W2TA 1CETA 1IONA 1E9VA 3H5IA 3F9CA 2CW5A 1JHUA 5KVAA 4X90A 4MGEA 5TQ2B 3C5VA 3O73A 2QTAA 3O74A 1S2LA 3Q8MA 3LUBA 5JY1A 4IS3A 1HDRA 4C0AC 2ZJ7A 2OXTA 1UZLA 2PPVA 4Q9AA 3O8CA 2P9YA 5KNDD 5DN6D 2WZCA 4AS1A 1BXGA 3HXTA 3BILA 4RZ2A 3QKSB 3QV2A 5CX4A 3ROQA 1ZUWA 2DY1A 2JFGA 5DM70 3B60A 3FMGA 3GEPA 3UJNA 3ZV3A 4ODIA 3DHEA 4NECA 1G0NA 2QN1A 2RKBA 1MC4A 1CHDA 3DL7A 2BFNA 4NC9A 3IPAA 3TE6A 3PLNA 2IYOA 1FFDA 4FFWA 4WLEA 4UZSA 5LWQA 3FD8A 4CZ2A 4DCCA 4WOPA 2P2SA 1LWOA 4XIIA 4YAIA 1G59A 1EE9A 2MINA 1UKCA 4YYZA 1AHNA 1BAPA 1KY2A 1C14A 1QKKA 3M6AA 1GAXA 2P62A 4ZAFA 2EVWX 3ML1A 3FKSD 1M67A 4DLNA 1D2AA 3IALA 1T36B 3FSGD 3SZRA 1G19A 4PIPA 2IY9A 4K3VA 2V5UA 3ONFA 4TSRA 1U7WA 3NT5A 4LJSA 1JEOA 3DBIA 4GI7A 4KO8A 4ZV7A 3UK7A 3EGCA 4JKOA 3VHRA 4CQMB 1T5DX 1L8OA 4HXFB 3IAEA 4JBWA 2ZUEA 2GO1A 3C5WP 4EG0A 3QU5A 1HG1A 3U1BA 1ADGA 4L22A 4G0WA 1ZUNA 1FUEA 3GMDA 3ZY2A 3CPJB 5A04A 2BTEA 4MRPA 1N9ZA 5HPYB 4PR3A 4RTPA 2X9LA 1XRRA 3CQ9A 2FDCA 2JCVA 4MUEA 2RHWA 1JIXA 3GGPA 4TRRA 1VYTA 4FYWA 1KJZA 4KQ2A 3E9QA 3T9DA 3DOIA 5AH0A 1TB4A 1SA0B 1TQ8A 1WA5A 2GBIA 4RY0A 1KEUA 1NPYA 2ZBRA 4QNRA 2XSZA 4XQ9A 5EZQA 4A0RA 1Q0TA 3WMGA 2B5OA 2FJ0A 4IWYA 3NM5A 3U09A 1Y7IA 5AW6A 3ZHVA 5K8JB 1EEXB 2QM3A 2YQ4A 4M38A 4C08A 4DSTA 1MO5A 2LDBA 3JRNA 2EFDB 2VJLA 4OGKA 2P9FA 1IXYA 3GUUA 3KQMA 1VE3A 4IIDA 3JYNA 4KDEA 1E2HA 1E9BA 4V0QA 5LP6A 1UKYA 2FJPA 1L4FA 2AEEA 3CISA 5JANA 2HSWA 2AZTA 3O90A 1IY2A 4FMBB 2E87A 4I4LA 2ZPAA 2PBZA 5EE1A 5P21A 3WRXA 4DLPA 4F3YA 4WK2B 5KSZA 5T4HA 2YOHA 2Y0DA 3NVMB 1HE3A 2FTKE 5AVOA 2H5LA 4RGYA 3SSOA 5IJ9A 2H3HA 5F9HA 2C1ZA 2IP4A 1BXZA 3T7SA 2CLEB 3ZIAA 2XUJA 1QF9A 3C3MA 5AK6A 4RTQA 5B1YA 1GQSA 4IR7A 4ZYZA 2XT0A 3HJAA 2YRXA 1P8AA 1GR1A 3MUFA 1ZXBA 1P6QA 2ZB3A 1Y7PA 5LD2B 4X8LA 3GRAA 4DJDC 5B3JC 5JRDS 2WIJA 3EGVA 3T8YA 2X2EA 1UDAA 3CUSA 2RK4A 1CP3A 1FTNA 4TV9F 3PP8A 2V7VA 4M1WA 4N6NA 5C8YB 3NO4A 4KPEC 4JBGA 4JS0A 5CDYA 1TQDA 4BO5A 4NJEA 4ZJUA 2WKSA 4I99A 3CA8A 4TXNA 2A0FA 3TDNA 1QZXA 1I5OA 2V1UA 2CMDA 3AFGA 1R9GA 1UMKA 4FJ1A 2VNAA 4HAZA 1QMPA 4BO2A 4Z4IA 4Z4FA 1XZCA 2JG3A 4GF5A 4RXMA 2BFWA 3AZOA 5A7GA 4UAGA 1DC5A 4N3BA 1F2VA 1HZJA 4ALMA 1S01A 1KAHA 1NQVA 3EF1A 4Y9SA 4PXSA 3OEEA 3F90A 2FWMX 1V45E 3G5LA 2OUKA 4RF4A 1Z62A 3CGGA 2G1KA 3CUKA 3PQEA 4CF4A 3FPHA 2C5FA 4G86A 4C05A 4CN8A 5JRJA 4Y2XA 2PGAA 2A78A 1D9ZA 2PA0A 4F4DA 3AIIA 4RH3A 1WIWA 5AQEA 1J5EB 5JYCA 1S4MA 1J07A 1UM9B 2PU5A 5IUNC 2QJOA 1G5QA 4WZBE 1AD2A 1KZ9A 1ZGBA 1WULS 4RM2A 3ZGZA 2PSJA 1T91A 4IDPA 3T1VA 4H0FA 5DYTA 3L0OA 2JBAB 4A0QA 1V7CA 2PEYA 4D4JA 3LUJA 5LMUB 1D1QA 1GGMA 3HA3A 3I01A 2YWGA 2EL9A 4ZDKA 2GBLC 4A8TA 1X1TA 5I7UA 4RPIA 3NC1C 3W7AA 5BNIA 2CNKA 1JTFA 1N6KA 3Q5GA 4A8JA 4RU1A 3EAGA 3ABQB 1E9SA 1T0PA 2H8GA 4ON9A 3DMTA 1QYXA 2HJGA 2XCLA 4OQXA 5AJZA 1E2IA 4WOBA 1GCOA 5F2OA 4DDWA 1V1JA 2EQ5A 1RQPA 3FWKA 3L1KA 5JYBA 2DFLA 1G5HA 4KSBA 1Z45A 1ZS9A 3D6HA 4C2TA 1L7PA 2QTZA 3OHMA 5H83A 1KE2A 4E5DA 1Q0SA 4GFDA 2INGX 2PLFA 1K9VF 1GZ5A 3SYLA 1DKPA 2VPPA 1Z7YA 1AKMA 2WVGA 3K5PA 4IXWA 4Q4JA 3V2IA 4DJ5X 4Q4CA 3VYWA 3H6KA 5GJBA 3INRA 1YVEI 2H51A 1XZLA 3VDQA 3AVPA 5JJLA 4KQMA 3UT5A 2PMWB 4AG6A 1SH7A 1ZU5A 3GJ4A 3GRVA 1ZYUA 1TE2A 4QNMA 4RF3A 3UQYS 2WTMA 5K99A 5AM0A 3EEOA 2OVFA 2UYGA 3QFFA 2IBTA 1TM1E 1OLOA 1XCBA 3BEOA 3MWDB 5B53A 4ZHQF 1L4EA 1R6TA 1XB2A 4DWVA 2GRJA 2YY6A 1ZZEA 1GU7A 2WJ6A 2J0UA 3NFRA 2WFLB 1FIUA 3LO8A 4D3ZA 1YJCA 2FZCA 2P2CA 3EVFA 4WNCA 4ZO8A 2PT9A 1O3YA 1QK4A 5FO0A 1EVIA 2V5VA 1CW2B 1OAKA 4REQA 4X1KA 4KFUA 1GTG1 3RLFA 2CB0A 2H7XA 4NQRA 3B3FA 3HVIA 4OGWA 4YC7A 3KOOA 2WJIA 2G08A 4FSXA 1YDWA 2FZVA 1JR4A 1KMHA 3TBKA 3LUKA 2PL5A 4A03A 2O6LA 5KNDH 1EIWA 4WKPA 5JMPA 2YZNA 4L4UA 3WHLA 4QOF