2NVBA

Contribution of pro275 to the thermostability of the alcohol dehydrogenases (adhs)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
352
structure length
352
Chain Sequence
MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAELADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLDVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLVTHVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADP-dependent alcohol dehydrogenase
publication title Thermal stabilization of the protozoan Entamoeba histolytica alcohol dehydrogenase by a single proline substitution
pubmed doi rcsb
source organism Thermoanaerobacter brockii
molecule tags Oxidoreductase
total genus 107
structure length 352
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 2006-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nvbA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2nvbA01
3HN2A 4FDAA 4PRLA 3UN1A 2CF5A 2YDXA 2YW9A 4IDCA 3GGPA 3FD8A 1N7GA 3HNPA 4PCVA 4S1VA 5CP8A 4YQYA 3SEFA 4FB5A 4CMBA 1G6KA 2EF1A 5BQFA 4CQMB 5A05A 4OH1A 3CZMA 3B1JA 3EGOA 3GFBA 4IZIA 4AJJA 1WMBA 3JQ8B 2AEMA 1XYGA 2Q2WA 3GG2A 1QR6A 1PEDA 2QQ5A 1HETA 3KLPX 2VZ8A 1ISHA 3RU9A 5TJ9A 4A7PA 1PJLA 4TROA 1LTHR 4BO2A 1LDMA 1Y5MA 4YDRA 1JLLA 3WGTA 4B3HA 2PZKA 1U7HA 7ADHA 2V7PA 2Y1CA 5KNLA 2ZB4A 4XA8A 4XQCA 1NR7A 2EKLA 2RH4A 3KSDO 4OSOA 1B2LA 4I08A 4L74A 3VKVA 3Q3CA 1H2HA 1KVUA 4GLLA 3PQFA 4WLUA 2NM0A 1I0ZA 3U09A 3WJAA 2OP0A 2EKQA 3AK4A 1GU7A 4L9RA 4DXHA 3WNVA 1Q0HA 1J49A 2HRBA 1B15A 1PJ3A 5JPIA 4MP3A 4LSMA 5G0TA 2G17A 2P91A 4ND2A 2J6IA 1UP6A 4RVDA 1HLDA 1PJSA 5DCWA 2X7HA 2GZ1A 3PFWO 1O89A 4WK6A 3LZ6A 5DNAA 2UV8A 4Y8VA 3PI7A 4XDYA 1ZMTA 3VTZA 4DRYA 5TX7A 2ZJ0A 3WGZA 3I1JA 1HDRA 3NJ4A 3L9XA 1MFPA 4QECA 2GN4A 5KJ6A 3EVTA 2HMUA 2Q45A 4DMLA 3HFGA 4DWVA 3AUTA 3STHA 1KC3A 2ZQYA 4XYEA 5TT1A 3OEWA 4BKPA 1HZJA 5AQ1A 3E9NA 5GZ3A 3VZQA 1P33A 1MX3A 3OIFA 5C3MA 3PGXA 4RZHA 2EP7A 1MXHA 2B5VA 3ZWMA 3H9UA 3P19A 5JAQA 4I1IA 4AJEA 3JQ8A 5TQVA 4YJGB 1LRJA 3WFJA 3WB9A 2HRZA 4JJGA 3DOCA 3KSUA 4MVJM 1DFHA 2PGLA 3H5NA 3BTUA 4NJMB 4PG5A 4CLHA 4DQVA 5L7WA 2VUUA 3H3JA 1U3WA 3ZV4A 4BNLA 4NBWA 1X7DA 1FDTA 4KMSA 2BELA 1T1SA 2VNAA 3RBZA 1E7YA 2VYND 3E9QA 3DHYA 3L4BC 4YT8A 2VZ0A 3MZ0A 3TFOA 2X23A 3EY4A 4M49A 4BNVA 4YT2A 2DM6A 3KYDA 3UH1A 1ZO8A 3IOYA 3P2YA 4XR9A 3DZHA 1ENPA 4CL3A 4JJFA 1KVTA 2QZZA 3VTFA 5IDWA 2G5CA 5A9RA 4L75A 3UXYA 3ZV6A 5A9SB 1XA0A 1QV7A 4CUZA 4RQTA 4YRAA 2YHIB 3KLMX 3MJSA 3DXFA 3BTSA 3PLRA 4I5DA 1N1GA 3WGYA 2HJRA 1Q7BA 3DZJA 2G82A 4BNTA 5CG1A 1M76A 5JMPA 4BNIA 4HV4A 4WASA 1VJ1A 4W82A 2F00A 4MIOA 4B4WA 4IIUA 1RPNA 4WLNA 4P4NA 5G4KA 1MV8A 1N7HA 4IJUA 1V3UA 4M87A 1MC5A 2YYYA 1RM3A 1DIGA 3KEOA 4OM8A 4UUMA 5F3RA 3N58A 2FR1A 4TVBA 1N1EA 1SCUA 2POQX 2ZB3A 1JVBA 2DPGA 4CR8A 2ZYGA 4K26A 3WWZA 4DYDA 3PEFA 2A94A 1G1AA 3GDOA 1D3AA 1E3EA 4L4SA 3CE6A 4DTIA 4Y6RA 2ZCUA 3DZGA 3TZKA 2Y68A 4UUPA 2BFOA 2PR2A 1NHWA 2C29D 4KQXA 5TF4A 5BNTA 3L4SO 4Y9DA 1Y9EA 3I52A 1VE9A 4RVUA 1ZH8A 4BNUA 3ZHBA 3ZWOA 2AE1A 4W7IA 3LLVA 5BSGA 1CEQA 5EINA 4M8SA 4JCOA 1J6UA 3ANMA 4PLCA 3RVDA 3U49A 3PWZA 1XR3A 1U3UA 4CV0A 4YJHB 2V65A 4AG3A 5ENVA 3BMQB 4B7XA 3KVOA 1T4BA 3DZBA 5JSFA 3IP3A 2VT3A 1GZ4A 2O48X 1PWXA 3K2EA 5KVCA 4D3SA 4AJOA 1E3JA 3AU8A 3CH6A 1NQTA 2JFHA 4NBUA 3LVFO 4N5NA 5JE8A 2C59A 2QYTA 4XQEA 4BO9A 1PS8A 5A9SA 3KM0A 4LW8A 4Y6PA 1QP8A 2IYPA 1F0YA 2QRKA 1KY5A 3R3JA 3RUIA 1YKFA 5A06A 4IJKA 3LQFA 3ADPA 3MJCA 3DEYX 1YB4A 3HB4X 4GLOA 4IBOA 4H15A 5KOIA 1I3NA 4QQRA 1KC1A 3DMYA 3P5SA 3PHHA 4MDHA 4CM9D 3NDRA 5JDIC 3NJ8A 5DDIP 4AJHA 1CQIA 3VH4A 4BV9A 3KZVA 1HDGO 4R5HA 2D2IA 1AE1A 1TVEA 2FN7A 1YDEA 1I10A 4RPGA 2Q46A 4HWKA 1N9GA 4HY3A 3UAGA 4UEKA 3V1UA 3QIVA 1LC3A 4XCVA 4CL8A 2GDZA 4IDDA 4L8VA 4DVJA 2QIOA 3AI3A 2GERA 1C1DB 1JVSA 2BLLA 2D5AA 3UHAA 1LRLA 4Q3DA 4B8WA 4CLOA 3I9KA 2NUAA 5KVQA 5A4DA 4ITUA 4Y98A 3BXXA 3KHUA 4CMJA 3HJAA 2EGHA 4QUKA 4MVJF 3K2BA 4GVLA 4R3NA 4Z0PA 3LYLA 1HSOA 4DLAA 1WP4A 1ZFNA 2NWQA 4J3FA 1ID1A 2GZ3A 3V2HA 3WSWA 2AA3A 3TZCA 4YJHA 4D7AA 1KEWA 2NV6A 3BMQA 4FJ1A 1NQAO 1PQWA 3GDGA 1V3VA 4R9SA 1A71A 3QY9A 1KBZA 1U2DA 5KWEA 4ALMA 3ZDFA 3RUEA 1AXEA 4BNWA 2Q4EA 1U9JA 3PYMA 1NPTO 4CM7A 1AGNA 4ZHSA 4YR9A 4GGPA 1XLTA 2RH8A 1UAGA 4TVOA 4HX5A 2FSVA 2ZJ1A 2P68A 4LK3A 4YTEA 2BFAA 3G1UA 4EJMA 4CLDA 5U9CA 4NH4A 3OJFA 4ALKA 1EFKA 3QWAA 2Q1WA 4DPMA 3DTYA 1R16A 1KEUA 2O3RA 1VM6A 2XXJA 4ZQFA 3AOEC 3DZKA 1SOVA 3ZHZA 4OMUA 1XKQA 2QRLA 2VWGA 5B1YA 1IUKA 2NACA 2Y99A 4FC7A 4HKTA 3VAZA 2AHRA 3GRPA 1W73A 1C1DA 3I5MA 3U4IA 1JQBA 3NGXA 4I9HA 3S8MA 1O9BA 3GUYA 3VC7A 9LDTA 5L9AA 3OETA 3ZU2A 4BO5A 2Q1UA 2UUOA 3HHPA 2I67A 1HTBA 3KRTA 3TNLA 2ZTVA 2LDXA 2WD7A 1IOLA 3IDSA 1YONA 4RDIA 1UP4A 3U0BA 4S3MA 1WVGA 1BXKA 1N92A 1V8BA 3Q9UA 3VDRA 3AUSA 4R51A 3ZZNA 1XQ1A 1S6YA 4OAQA 1UZMA 1ZCJA 2RBEA 4O0LA 3RKRA 3V1TC 1ZK2A 3H9QA 8LDHA 3GC6A 3DTTA 2EGGA 3W8DA 2PV7A 1DAOA 1ULUA 2DBVO 1DC3A 4L73A 3UGKA 3LT2A 3LU1A 2ZTUA 5TNXA 3RC9A 3W4KA 2VWQA 2X6TA 1EQUA 1EK5A 3FRJA 2O3UA 1X7HA 4DBVO 1XHLA 2CMDA 1YWGO 2AQ8A 4HFMA 4OJNA 2AEJA 2JCYA 4FPXA 4RF5A 3DBVO 4W9NA 4Z6KA 1DIAA 1GAEO 3DMTC 4CM6A 1IPEA 3C1TA 3BZUA 1YB5A 4ALLA 2BF7A 3ZU4A 3GG9A 4BMVA 4BKQA 1D7OA 3EVNA 2JD0A 1HYGA 2GR9A 2GRAA 5C7IO 2C0CA 2ZTLA 3LF1A 1I3MA 3OICA 2GCGA 2X5KO 1LJ8A 1BW9B 1PL8A 4LISA 2XXBA 3RQSA 1XQ6A 1IZ9A 1LLDA 2X9VA 4KUGA 5JFOA 3ZV3A 5BSHA 5F21A 3MEQA 1LQTA 2NSDA 2UVDA 4AJPA 3NX4A 1E7WA 3KYCB 4O5OA 1OI7A 1U3VA 4OQYA 3DBHB 2OORA 4DC1A 3LT1A 4P38A 3INTA 4RZIA 1GYPA 4XD2A 1BXGA 4JJIA 2Q2QA 1D4FA 1OAAA 2C7VA 4ZRNA 1CETA 2Y1GA 3DB2A 2BH9A 4NFYA 4XGKA 3E1KA 4ZVVA 4XRGA 3PHLA 3ZN2A 3E5RA 5JO9A 3RFXA 3HWRA 2TMGA 4CV3A 1E5QA 3OJLA 2ZK7A 4TZKA 1V6AA 2HMWA 5FWNA 2VYVA 3BHMA 1QRRA 2O2SA 3WG9A 2O3QA 1ZSVA 2ZB7A 3WR5A 4PZDA 5C37A 3IMFA 1EK6A 1U7TA 1JKFA 4HFJA 4E2YA 1PJTA 4J1SA 1LA2A 3WSVA 3A14A 3VZRA 3GMSA 3HDQA 2IE0A 3D4NA 3HADA 4XGIA 4BVAA 4C7KA 3OSUA 2CVQA 1X1EA 1EE2A 4MPDA 2DTDA 3ZHXA 4NK5A 2PGDA 1VL6A 1H6DA 3ZU3A 4AJ2A 4E5KA 3L6OO 2J3KA 5CEEA 3VHRA 5U4QA 3JQFA 4BB5A 3EUWA 1EBUA 4DQUA 4J4TA 3H5RA 3ZNOA 4O59O 4TZTA 3KETA 1DC4A 2VHVA 2QX7A 4ZGWA 1HRDA 3ZU5A 2CVZA 1PU2A 3I4FA 4MINA 2HK7A 2YJZA 4UREA 3JQGB 1MG0A 4RVFA 4A5OA 5FF9A 4EJ0A 2B4TO 1GPDG 4MVJH 4YAJA 5ICMA 5CDSA 1R4NA 2CY0A 4FJ0A 4IY1A 3DBRB 4QT0A 5I7VA 2J3HA 3Q2KA 1TLTA 3M2TA 1FDUA 2GD1O 3RUCA 1ONOA 2CZCA 5IN5A 5A1TA 4YXFA 1XU9A 1I01A 1PGQA 1YOVB 1GADO 1DIBA 3DZIA 3GVCA 3DBHA 2G1UA 2YY7A 1U3TA 4R1TA 3T4XA 5G0UA 5CFZA 1EBFA 3PDJA 4IGEA 3IL2A 2C5AA 4L0QA 2X0RA 4J9UE 4CV1A 2X0IA 4BNKA 4Q3BA 2Z1MA 3HB5X 1E1KA 2C2YA 2OL4A 4R1SA 1B7GO 1NBOA 4NZ9A 5C7LO 2Q99A 2AQKA 2PD4A 2DKNA 1MC4A 3PIIA 3PIDA 4J0EA 3BMOA 4IXTA 4TRMA 1PTJA 5CHEA 3JQBC 5KJFA 3JQCA 3B70A 4RCVA 1RM4A 3JYPA 4QO7A 1HE4A 5C5IA 1Y9AA 3RROA 4HUJA 3WLEA 3FPLA 1B14A 3QQPA 2QRJA 4AFNA 1L1FA 2W2LA 4FFLA 1EVZA 4CM4B 5A5EA 1NPYA 1EZ4A 5A5FA 3S55A 3FNHA 2NVUB 1GZ6A 1QYXA 1SZJG 1GYRA 5CPBA 2EERA 2Q50A 2BFPA 1DDOA 3GMDA 3V5NA 3JD0A 5IZ4A 3AWDA 3VVBA 3ZHYA 1WLYA 1OC4A 1SEVA 3LT4A 3ENKA 3NRCA 4PFJA 3VDQA 3FCOA 1HE3A 1JKJA 1TEHA 1WZIA 4ZQGA 5JCJD 1G0NA 5H82A 3IQDB 3LDHA 2BGMA 2PTGA 1LUAA 2CF6A 3W4IA 2A4KA 2Y93A 3JYLA 4RQUA 5AXCA 1U2GA 4UVHA 3ZNPA 3AY6A 4BKUA 1DIHA 1DFGA 1GCUA 1WPQA 1YXMA 5HWSA 4GVXA 1DLIA 1KY4A 1CQJA 2WD8A 3NTOA 1GUZA 2OBNA 4Z3DA 4FW8A 3E03A 1XELA 3NTRA 5HS6A 1ORRA 2PKQO 3JQAA 4P4GA 5HBRA 1Y81A 5IF3A 3GZ4A 3L07A 4ZQBA 5IFLA 3FSRA 1LEHA 1A4IA 1QYCA 1R15A 3FNFA 5EQDA 2Y0EA 2GYYA 3PP8A 4JIGA 4XDZA 4W4TA 4BNYA 2D5CA 3N74A 2X58A 3AW9A 3O8QB 4II2A 4WCFB 4MP8A 3TPCA 2C5EA 2BFMA 4PG7A 1ISFA 3PZBA 4GMFA 5A03A 3WQRA 3TZQA 5L3ZA 4WEOA 3DAGA 1P0CA 3I9LA 4U0KA 3VPGA 2ZKLA 1HDCA 3I9MA 4CMAA 5BSFA 2GZ2A 1PR3A 3OM9A 1YGYA 2P9EA 4IM7A 2R00C 4P4LA 2O4CA 1VPDA 3FNEA 3MJVA 1J4AA 3ZGYA 4BQPA 4J2OA 4CJXA 3D5QA 5AVOA 4OO3A 3FNGA 3RJ5A 4DLBA 4PLWA 4NR0A 1P1KA 4K9DA 2VN8A 1LNQA 3QVSA 5DT9A 3RI3A 1SO8A 3HDJA 4BNMA 3R6DA 4CMEC 4MVJD 1O8CA 2WYVA 3FBGA 4M86A 1O94A 1MFZA 3M6IA 4MO2A 5G0WA 4OQZA 1K6JA 3ROPA 1GR0A 3JD4A 4IQGA 5DCUA 1Q1NA 5IZCA 3EHEA 5BR7A 5BNIA 1PGPA 2QZ9A 1ZK4A 4Z3KA 3JQ7A 3Q0EA 3ZCXA 2D0IA 4XR4A 2GF2A 1B0AA 3KBOA 1Y1PA 3SXPA 3MJ4A 3F4LA 4RVGA 1JU9A 4BL5A 4CMIA 4I5EA 4Q3AA 3AM3A 3DAPA 3I9JA 3AY7A 5DBFA 1T1RA 4OGWA 3PRJA 5K1SA 3D5TA 4M1QA 5EJ2A 4ALNA 3U5TA 5J23A 3GT0A 1HSZA 2GASA 5T8KC 4JBIA 4QFCA 2HUNA 4MJLA 1Y8QA 3FBTA 2NQTA 3LF2A 2OMEA 3ETGA 1Z73A 4R4JA 1R12A 2JFFA 4G81A 2PNFA 4RF2A 4YWJA 4BQRA 4DPKA 2JL1A 3O8QA 1NYTA 3I3OA 4QO8A 1PX0A 4D3DA 1DBVO 4JBHA 4E2XA 4UULA 3NAQA 2BHLA 1S7CA 2Y66A 4YRBA 2W2KB 1JDJA 1TXGA 4RPKA 4BIIA 3AY3A 3JQ9A 2YV3A 2P5UA 4PLZA 1P31A 1E6WA 3DO5A 2NTVA 2WWRA 3B1KA 5G4LA 1YDWA 2NLOA 5THQA 2WSBA 2RHCA 1IHXA 1I2ZA 1QYWA 2D8AA 3U4CA 3ZWCA 1P77A 1ZJYA 3MJTA 3GAZA 2VRCD 2X22A 3NUGA 3OBBA 1I2CA 3GEGA 3VH1A 4CQMA 3OH8A 4IJVA 1MGOA 3IKVA 2FZWA 4IZHA 3UOGA 2R2GA 1F8FA 3EYWA 1DO8A 4XX0A 4PLFA 5L7TA 1GPJA 2NTNA 2VHYA 1DLJA 4U7WA 3EZLA 2J8ZA 3LLSA 3CZRA 4JN6B 3ZNNA 5FI5A 4WCDA 4WLFA 4IJWA 2DTXA 3GGOA 4XYGA 3PWKA 2DVMA 4WLEA 4ALJA 4EUHA 4JP2A 2GNAA 2W8ZA 3DQPA 3E18A 1VRWA 1Z75A 4NFSA 4LVCA 4PGFA 4AJIA 1C14A 2G0TA 1ZK3A 4C4OA 3VVCA 2B36A 2O2YA 4II3A 4EUFA 2CD9A 1JA9A 1SEPA 3C7CB 5IDXA 2C07A 4OKNA 4ZD6A 4I5GA 3OECA 5KJEA 4OOEA 1XCBA 1W0CA 4PG6A 5CEJA 2YFQA 1PJ4A 1I30A 4M54A 4J49A 1Y8RB 3DONA 5KKAA 1QG6A 4J2HA 3IUPA 3OF2A 4QXMA 1T2AA 4WLVA 3GPIA 1X0XA 1W8DA 5CAEA 2I66A 4CM1A 1ADFA 1EUCA 3KXDA 2B0JA 1T25A 4I5FA 4MP6A 2CDCA 1DFIA 4MVJE 4E4YA 4A10A 3QA9A 2V6MA 2QHXA 1UXKA 3GGGA 2VRBA 2BMAA 4BHTA 3DDNA 3OP4A 4CV2A 1IZ0A 1UXIA 1Y5RA 3UFXA 2FPIA 1PGJA 1A7AA 2FWMX 1BVUA 2J5RA 5JYEA 3DL2A 1K89A 1NR1A 4YAKA 5K0ZA 2AG5A 1ZK0A 2P9GA 4IDEA 3C24A 2GN6A 1JAYA 4BNNA 3GPDG 4Q39A 5ER6A 1T2DA 2VOJA 4KZPA 1K0UA 1CDOA 1SPXA 4IIVA 1A9ZA 4YJGA 2P9CA 3ON5A 2HO5A 2BGLA 1E6EA 3DHEA 1NASA 4K6FA 2YZ7A 2AQIA 3O03A 4YJFB 3WGIA 4NJMA 2C20A 4NU6A 4YA6A 2D4AA 1BRMA 4NQZA 2FHSA 4ZU3A 3K96A 4R54A 2ZCVA 2NU8A 4RVHA 4YBZA 2RHRA 3ZWYA 3TWOA 4ZN6A 4Z9XA 5CDYA 3H3FA 2EV9A 1E5LA 4GH5A 3I9NA 3IIEA 1UH5A 2Z95A 5CDUA 3T7CA 3UVEA 3F5QA 1M6WA 4CM8B 5JDCA 1Y8RA 4BO8A 5LC1A 4JGBA 4AICA 1YBAA 2A35A 2FMUA 2FOIA 1I36A 3GZNB 4YJDA 2B4RO 5COBA 4XIYA 1Q0LA 4LN1A 3CTMA 3WFIA 4CLEA 3SVTA 1KVQA 4GKVA 2YHIA 4U8GA 2GPTA 4NBTA 3WTCA 2VUSA 4D43A 5DP1A 3KO8A 3IS3A 3VZPA 2B5WA 2CUKA 3GQVA 2X0JA 1TT7A 2ZYDA 1DC6A 1GUFA 1T4DA 1VKNA 1MLDA 2JKVA 4Q3NA 5EMHA 1LLQA 4C7JA 4BNJA 4TRRA 1NXQA 1E7RA 2DTEA 1HKUA 1CERA 3WXBA 4URFA 4GAEA 1RYDA 2NADA 5T67A 1VSUA 2EIHA 3SC4A 4AJ4A 4AJLA 2YQ4A 1LSOA 3PHJA 5CDTA 5LDHA 2PFGA 1QORA 3T4EA 4DREA 3WNQA 4L4XA 1KVRA 4XJTA 1M67A 3JQDA 9LDBA 1O6ZA 1P74A 4DQXA 5I8ZA 1FMCA 3DBLB 4QFDA 4E5PA 2EXXA 3ASVA 4WUVA 1BVRA 4LMPA 3ZWAA 5LCXA 4N5MA 2R6JA 3P7MA 4R3WA 1IPFA 1IYZA 4LSWA 5KKCA 4DIFA 5FYDA 3V2UA 4YJFA 1YS4A 2FY8A 4TMFA 4ZRMA 4GQAA 1W4ZA 1FXSA 2XAAA 1GY8A 1HWYA 2FSSA 2VT2A 4I8XA 5BNFA 4H16A 3S1LA 2YV1A 5AXBA 1WDKA 4XZ3A 1H2BA 4HNGA 1H94A 3RKUA 3H9GA 3GRKA 4M55A 1KOLA 3ZW8A 4ID9A 3R3SA 2HK9A 3VOSA 5CG2A 2QG4A 4DMMA 1VSVA 1BG6A 3ZWWA 4EYEA 2WE8A 1OOEA 2UAGA 1ZXBA 2WTBA 1RJWA 4U6QA 2AMFA 1FDVA 4JK3A 3ZI0A 1Q0QA 1DHTA 4XYBA 4TRNA 4KWHA 4YRDA 3ZNQA 1B3BA 3EW7A 3GZNA 1Z74A 1H0KA 1QV6A 1P1JA 3O9ZA 1MP0A 1NM5A 4TQGA 2JD2A 4J43A 5JNLA 3OJEA 1UP7A 4CLXA 4QSMA 4B4UA 4ND4A 3QVTA 2Y1DA 1I32A 1ZUD1 1BHSA 1T26A 4WOKA 1ZEJA 5A3JA 3L0DA 5FI3A 1FDWA 1UDCA 3ENNA 3TJRA 5JS6A 1E77A 2LDBA 3X2EA 3HQ4O 3MOGA 1LDNA 1K3TA 3KV3O 1G0OA 1DHRA 4ZJUA 3K92A 4IDBA 1GFSA 1R0KA 1CIVA 3ULKA 4UVEA 1GDHA 4YT5A 2HJSA 3HUDA 3H2ZA 4BO3A 4PLVA 3WGOA 2IZZA 4O6VA 4XB2A 4FGWA 4D3FA 2XOXA 3GVPA 3IJPA 3KYBA 1UAYA 3NKLA 2JAPA 4YAGA 5T5QA 3WBFA 2C2XA 4NK4A 3PQDA 3JD3A 3K31A 3QWIA 1X15A 5JLAA 4IS3A 1UZLA 5KJCA 5CEFA 1E1NA 1NFQA 1XEAA 1AUPA 2F1KA 4UVGA 1ISIA 2XF8A 4I9NA 4YPOA 2AW5A 3WBBA 4PVDA 4IGFA 2GO1A 1ENZA 4FS3A 1TB4A 5TIIA 1O95A 1I8TA 4Y67A 1ONNA 2ZIZA 3ASUA 3M1LA 4E6PA 3G79A 1GTMA 4GWGA 4YAIA 3PLNA 1R6DA 1PWZA 4KDEA 5BT9A 4RF4A 1HLPA 4K6CA 3WYBA 2OHXA 5IDYA 2Q3EA 2I65A 4DC0A 5KTKA 3HFSA 1SOWA 2QYSA 3QE3A 4YQZA 1KIFA 5DP2A 4KDFA 2O23A 1HYEA 3NEPX 4FFPA 3RUAA 4IINA 4Q3EA 1HDXA 1GQYA 4FFNA 4WNIA 3SJ7A 4K28A 1L7DA 1ZXLA 3AM5A 3RSHA 3WMXA 1OFGA 4JNKA 4NNJA 4AJNA 1O0SA 3I9OA 4TKLA 1FK8A 2JFGA 3S2FA 1KEVA 2IZ1A 3MWEB 3OIDA 4ESOA 3QP9A 5MDHA 1V9LA 2RIRA 1N2SA 2DQ4A 3TN7A 1MUUA 1LDGA 2GN9A 2Z1NA 2DBQA 4PZCA 3C85A 4J1TA 1GEEA 2VTDA 3VZSA 3ZWXA 1E92A 2UYYA 3SX2A 1Q2XA 1UDBA 3UCFA 7MDHA 4YEDA 2Z5LA 4KTVE 4E30A 3Q2IA 3OQ6A 4EW6A 5K6AA 4B4VA 4YYZA 2WYUA 4N18A 1J0XO 3GY0A 1E7MA 3FF4A 1IE3A 3RCBA 4OKIA 1HXHA 2OBYA 4WKGA 1NVMB 2VOEA 4MIYA 4R68A 4AVYA 2HQ1A 3E82A 5EQFA 4FOOA 4BGIA 3OJ0A 3C7AA 1ADGA 4RF3A 3TDKA 3DC2A 3VPXA 3ETEA 3BIOA 3PHIA 2C54A 2NNLD 1ZMOA 1RKXA 1A9YA 1EEHA 1QXSA 3GAFA 4WGGA 4BGVA 3B6ZA 4DUPA 3GHHA 1YQXA 3D4OA 1NFRA 1K6XA 1P45A 2VQ3A 3A06A 4FGSA 3GN2A 1LC0A 1VJTA 1O5IA 1YL6A 5I9NA 4XGNA 3DR3A 4NIMA 1X0VA 4DPLA 1IB6A 1ZNQO 3SLKA 4PLHA 3GUCA 2DBZA 3C3XA 1QLJA 4TWRA 4PIVA 5B12A 4BNHA 2Y1EA 3NGLA 1LLUA 1WMAA 2P4HX 3E48A 5GY7A 2VZ9A 3WGHA 4BB6A 4F6CA 2E49A 1DJNA 3WX0A 5JBIA 3H5AA 4XRRA 3QRWA 4HBGA 3QVWA 4CQLB 4YACA 2I5PO 2X86A 3JYNA 4KUHA 1BW9A 1GV1A 5DULA 3S2EA 4FFRA 2PZLA 2PKRA 3CUKA 5JCXA 3GEMA 2O3JA 4L76A 2IXAA 3ZWNA 4Z9YA 4Z0HO 1BXZA 3I4CA 4MIEA 4RL6A 5EPOA 1VJ0A 3KYCA 1NP3A 1BDMA 1P0FA 2H1SA 3H7AA 4NU5A 3A28A 3OFSA 1FJHA 4O63O 1T2FA 1A7KA 1LLCA 1IULA 5BSEA 1T2EA 1E3WB 1I2BA 3FTPA 3U4HA 1M2WA 3DOJA 1B8PA 1HT0A 1TT5B 2H6EA 4MKZA 4BO0A 2HDHA 4UEJA 5TGDA 1Q7GA 1HF3A 2JD1A 4RVSA 4XEHA 2BGKA 3H4VA 3W1VA 4LVUA 4ND3A 3UUWA 2O7QA 3QWFA 1EUDA 1QMGA 1HL3A 1YJQA 2B83A 2O3SA 2Y05A 1IL0A 3FTNA 3TRIA 1DXYA 4NJOA 2EEZA 3R0IA 3QJ5A 1NWCA 3D3WB 3UKOA 5I9MA 3RWBA 4HADA 4XWYA 3QW2A 3AFMA 5L4SA 1BGVA 2B35A 1SBYA 4RLHA 4BMNA 3PGJA 4FJ2A 4YVFA 2X0NA 1UR5A 5A9TA 1JKIA 4CR6A 3GLQA 3VH3A 3NDJA 1I24A 5GMOA 1M75A 4LRTB 1QSGA 1KYQA 1GL3A 3GNTA 3KB6A 3OJOA 3S2IA 4MKRA 5ILGA 4J9VA 1U5CA 4EJ6A 4DL9A 2A9FA 5HA5A 3EK2A 3WS7A 2NQ8A 3ROQA 3JQGA 3ONFA 1C3VA 4ND5A 3H8VA 3F5SA 4XKJA 5CPFA 3U62A 2P2SA 3GR6A 1WZEA 3WMWA 3E6AA 3NT2A 1OBFO 4WE3A 1YB1A 3DBRA 3O38A 1JWBB 2I3GA 4NBRA 1P1RA 2RAFA 4IDFA 3DHNA 3W8EA 3UCXA 3PVZA 1H5QA 5KIAA 1H6CA 2GGSA 2HU2A 4D42A 3L4BA 3CMCO 3TZHA 1YOVA 3GFGA 4W9NC 4EITA 1CJCA 1UXJA 4G2NA 1QYVA 5DBIA 1ZZEA 2PK3A 2X5JO 4B7UA 3JD1A 2YDYA 1E3WA 3L6DA 1NQ5A 3NT4A 4XQGA 3V8BA 4CPDA 1Y7TA 3PYXA 4DBZA 5JMWA 2EW8A 3TZ6A 2EKPA 3GEDA 4E13A 4RV9A 2H63A 2OOSA 1U8FO 3CIFA 4TRJA 1GQQA 3MTGA 4Y6SA 4CR7A 3HDHA 5DBGA 2IRWA 3OHSX 1H9AA 2OO5A 1YO6A 3W6UA 4Q9NA 1DJQA 3PJGA 1FF9A 3ZWBA 2DLDA 1H6AA 3FR7A 4KOAA 3KSZO 3WJ7A 4JXKA 1WDMA 4EEZA 1XU7A 3COSA 5ER9A 1JTVA 3PWSA 4NHEA 3ZWVA 1KETA 3D3WA 1Z7EA 4J91A 4OXKA 3RU7A 1SMKA 4GBJA 2NTJA 2VRCA 4LGVA 4IMRA 4CM4A 1X14A 2CDAA 4UVDA 4ROSA 4A0SA 3R1IA 4UUNA 3B1FA 2NVUA 2Q1SA 3BAZA 4W6ZA 2B69A 4KQWA 2D3TA 4QEDA 4D79A 2VHWA 4BO6A 5JAIA 1XG5A 2ILTA 1E1LA 1D1SA 2EJVA 4PLYA 1PJCA 4D0SA 4BS9A 3PJFA 4R16A 2IYOA 3WQSB 4RPHA 2HAEA 2ET6A 3KEQA 4GKBA 3FWNA 4A73A 3WDSA 1ENYA 1ZKMA 3M2PA 4ND1A 3E5MA 5JO0A 2VYNA 4A26A 4R9RA 3HE3A 5F5LA 1I33A 8ADHA 3IAHA 4INAA 3U3XA 1RWBA 4NI5A 3L9WA 4GL4A 3ROMA 4AJKA 4JROA 3JQFC 2W2LD 2DAPA 4J7XA 3G49A 1PZEA 4CMCA 4LMRA 3WGQA 5JC8A 3E9MA 1EQ2A 3PK0A 4R41A 1HZZA 5KJ1A 3TQHA 3KUXA 2DUUA 3FR8A 1BMDA 1AN9A 3FI9A 1PR9A 1B3RA 1EVYA 1NFFA 5DOZA 3KTDA 5ENDA 5FFFA 4E31A 2JCXA 3GK3A 1XDWA 1DIRA 3EAGA 2Q2VA 5B37A 2H9IA 2EHDA 1DEHA 5B4TA 1ADCA 3VPSA 3GOHA 2EW2A 4WCFA 5IN4A 1Q7CA 5JDIA 2YUTA 3WWYA 3D0OA 3KYDB 1D8AA 4LCJA 1X7GA 4CLRB 1QLHA 4W7HA 2ZYAA 2XPCA 1LSJA 4FOSA 3F1KA 1B16A 5G0VA 2DU8A 3AI1A 3HSKA 1PS0A 1GV0A 4J4BA 1U5AA 3L6EA 1SNYA 3U4DA 5B4VA 5LDGA 4B3JA 3K73O 3JQAD 1NHGA 1C0LA 4NDNE 3AJRA 4IDGA 1AHIA 4GI2A 4AL4A 3GF4A 3ANLA 1A5ZA 3OA0A 4XJSA 3F6YA 2I9PA 2Q1TA 3H65A 1GUYA 5EESA 2CVOA 3HN7A 4RLSA 5G4KB 3TFQA 5IAAA 4IQ8A 1CWUA 3AU9A 5GZ6A 1B8UA 1HE5A 5DF1A 1NWHA 5DN9A 2BKAA 3RC2A 2OP1A 2FPGA 1RM5A 1SB8A 1MG5A 1WWKA 4CM5A 1XIVA 2X1HA 4R1UA 4Q3CA 5TC4A 2OXIA 3RBXA 1UUFA 1X13A 3ZWPA 4F6LA 3NYWA 2EG9A 4IQ0A 2PZJA 5TJHA 1YRLA 1V0JA 4ALIA 1DRWA 2C82A 4PZEA 1YH3A 2Y0CA 3CPSA 1Y6JA 3AUUA 2WDZA 3I6QA 1P44A 1LI4A 2I6TA 5IG2A 3A4VA 1GYQA 4N7RA 1YQDA 1DOHA 5T6BA 2AQHA 2TMDA 3DAFA 3GNQA 1PZFA 3LT0A 3UICA 4PRKA 1R0SA 3JYQA 5B4UA 3X2FA 3LSYA 4BV8A 4NFHA 4CM9A 4A2CA 1DC5A 3TSCA 4E12A 4QX6A 2YQ5A 3C8MA 4R5MA 1GQ2A 3GVHA 4HFRA 3F4BA 4FC6A 4I9UA 2W2KA 4CLRA 4CMKA 2DFDA 2HKIA 3C7DB 1J5PA 4RJTA 1F14A 1NNUA 1PJBA 3EDMA 1YVEI 1ISGA 1YL5A 3AOEA 2DC1A 4Z9FA 4B4OA 1I5RA 3OIGA 2GLXA 1U1IA 4FD3A 1LBEA 4N54A 4J1NA 4O1MA 1EVJA 1TI7A 2HSDA 3ICCA 1ADBA 3NDIA 3A9WA 4FN4A 4RPLA 4BNZA 2AG8A 5ADHA 1OZAA 4R01A 1ZBQA 4XQ9A 5I8WA 1ENOA 2WE7A 4HP8A 3AI2A 4GSKA 3QV1A 1DRVA 1ISMA 3HG7A 1T2CA 4EBFA 1M66A 3HDYA 1YBMA 4GX1A 4NPCA 1C1XB 4HXYA 3PJDA 2AXQA 3ONDA 3BTOA 4B79A 5IXYA 5IJZA 1N9GB 4H3VA 1HYHA 3GA0A 3WICA 1H6BA 1PQUA 3RJ9A 3WYCA 3OEYA 3FN4A 2BI8A 1LDEA 4CLOB 4UEOA 4J16A 2HCTA 3F9IA 1PIWA 1MXFA 1P1FA 3G1TA 4GGOA 4NMHA 3KOUA 3VKUA 4CQMD 4RGBA 2E37A 3P2OA 5A3VA 5TS3A 3BTVA 3DMTA 2CFCA 3RUHA 4OXYA 5EN4A 1LRKA 1M6HA 5IZCC 2OFPA 5JYDA 1ZEMA 1E3SA 1GCOA 5AXDA 4AJ1A 3Q9NA 2QW8A 5KCZA 3H9JA 1CYDA 1NTOA 1BSVA 3EMKA 4OHUA 5I7FA 2ZATA 1N8KA 3I83A 3UCEA 1VC2A 1YE3A 1P1HA 3JSAA 5F1KA 1YL7A 2VWPA 2UUPA 3K6JA 1LQUA 2V6BA 4E2ZA 1F06A 3TL2A 3RFVA 2SCUA 3QLJA 1RYEA 3PDUA 4GSLA 3BHIA 3CSDA 1R37A 4H7PA 1ARZA 4HNHA 2Q4BA 4KWIA 4NBVA 3PPIA 4PLGA 1XWFA 2J5KA 3U9LA 4CM3A 5JXWA 1PJ2A 2AE2A 4FCCA 3ICPA 1VL8A 4DLLA 3GDFA 4JBGA 2ZQZA 1B26A 1UXHA 4WCFC 1R66A 4FFMA 2FR0A 2EP5A 3LC1O 3E8XA 1UZNA 1DAPA 1HDZA 3B20A 4OXNA 3F47A 1P1IA 1EMDA 2I3AA 1BDBA 2JHFA 1IHYA 3VPFA 4NG5A 1C1XA 2E82A 4D44A 5IDQA 3JQ9C 1ZK1A 3RUFA 2DPHA 4U5QA 1HDOA 2JJYA 3ABIA 3TOZA 1I3LA 1H9BA 3ETDA 1U4SA 3RASA 4ZQHA 3O4RA 2WM3A 4F45A 5AOVA 2B37A 2DFVA 3AUAA 2B4QA 3K8ZA 3Q1LA 4EEXA 4ZQEA 5ITWA 5COAA 4Z0TA 3I6IA 4J4HA 4EDFA 3JQEA 4LRSB 1ML3A 3D4PA 3GVXA 4WJZA 1PJQA 2WD7B 5DZSA 4CM8A 4A03A 1YQGA 1CRWG 4WNCA 3NT5A 3D3EA 4XYMA 6LDHA 1PL6A 3RC7A 4BNXA 1X1TA 1B8VA 2A92A 1PS9A 2NU9A 4GPD1 5KVVA 4PLTA 3IP1A 4BNGA 1ISJA 1KVSA 1MA0A 2O50A 4PVCA 1Z6ZA 4WOJA 5EERA 5C7OO 4P8RA 4D46A 4OOFA 3QWBA 4PG8A 5MGBA 4E21A 4DYVA 2Q49A 4WEQA 1EVIA 1EE9A 3C1AA 2IEDA 4YCAA 2AEFA 3CINA 4B8ZA 5ES3A 1JW9B 5JY6A 2ZTMA 1LDYA 1SC6A 2X4GA 1OC2A 4IPTA 1NQOA 2JHGA 3S2GA 3ZV5A 4J0FA 1EDZA 5GZ1A 2HLPA 2FRDA 4G65A 4MVJG 5G2OA 5L40A 1F17A 1NPDA 3RC1A 3WOHA 4F46A 4FFOA 5ILOA 2HMVA 3EZYA 1K5HA 3DBLA 4UUOA 1P9LA 3WIEA 5HTOA 4E5MA 1H93A 4PN3A 3FWZA 1NVTA 1MB4A 2X8LA 1YBVA 3ZH2A 5JY1A 3MTJA 3ONEA 3JD2A 3CXRA 2VCYA 3INGA 3F3SA 5L4LA 3JQBA 2BRUA 2P4QA 2WYWA 2BD0A 3I23A 3AOGA 1BXGB 2PWZA 3N7UA 1PGOA 4OL9A 1WW8A 1C0PA 1DSSG 2G76A 4ONEA 5JC1A 4IS2A 3Q6IA 4FBGA 4R1NA 4QTZA 1UDAA 1NVGA 5DOVA 1NAIA 5AYVA 1JWAB 2JAHA 3ITDA 3JV7A 1KERA 5F1OA 1LSSA 2PLAA 3D64A 2GN8A 3ANNA 1BWSA 2EWMA 3D7LA 4F3YA 1IY8A 5HRUA 3OQ1A 3D1LA 5I7SA 4J7CA 1QYDA 2O4UX 2FZEA 1VI2A 2V6FA 3SLGA 2Y67A 1KS9A 1LX6A 1E7QA 2RCYA 2J5QA 3G17A 3CKYA 2VHZA 3OA2A 4RO0A 1OMOA 5I7EA 5EL0A 5AXAA 2OZPA 1BTOA 5U1PA 3W8FA 3PQEA 2NU7A 3K30A 4K1LA 4MVJI 3LC7O 4BKOA 3QHAA 1UXGA 3PZRA 5TRTA 3QSGA 3SJUA 1PZHA 1WAMA 3UW3A 2W4QA 1V3TA 1LSUA 1SAYA 5H83A 3WIDA 2FPPA 5JDCC 1JAXA 4CUKA 2P5YA 4A27A 4TKMA 4CUJA 3AM4A 4D0RA 2IZ0A 2E4AA 3GN1A 4XYLA 3EC7A 4TSKA 2I76A 4OYRA 3JQ6A 3WTBA 3DOOA 1XGKA 4EI2A 4RDHA 1N5DA 3GHYA 3M1AA 4J1QA 3F1LA 1NAHA 2WEKA 4WECA 1AXGA 4R69A 1K2WA 1PZGA 3RD5A 3OQBA 3G3EA 3RFTA 4IMPA 1PL7A 4GMGA 2DT5A 1ZVMA 4PLPA 2X9NA 1R4NB 5IXSA 1KEPA 4U6SA 1AHHA 4YAEA 5ICSA 4LCEA 4OSPA 4GX2A 2PD6A 1I3KA 5L4NA 2PH5A 2HMSA 1TA4A 2IXBA 3K9QO 3V2GA 5HS4A 2YV2A 3RUDA 2VHXA 4BO7A 1PGNA 3WYEA 3PFFA 2HK8A 2D59A 1SB9A 1A4UA 3F46A 5G0SA 2R00A 1LDBA 4JLWA 1LU9A 3WGGA 1T24A 3K5PA 4FQ8A 4EGFA 4CODB 4D45A 1A27A 1E0DA 4UVIA 2GSDA 1JN0A 3SC6A 1EDOA 1E3LA 3L77A 3ROKA 1EFLA 4E33A 5JW6A 4CMEA 2CDBA 3ZW9A 3DFUA 4BMSA 4D41A 1ZSNA 1ULSA 2PA3A 1ONPA 2DBRA 3BMOB 1ZSYA 4MVJP 3ST7A 2X5OA 4JP3A 3WLFA 6ADHA 1Z45A 3IKTA 2Y0DA 3QVXA 2YFHA 5JCJA 3FHLA 2O7SA 1VKOA 3GVIA 3MOIA 3DZFA 3PTZA 3JYOA 4EUEA 5L53A 1V35A 2Y1OA 1E6UA 3HZZA 5A02A 3NTQA 1E7SA 4RPJA 1WNTA 3NV9A 5DCYA 4YT4A 4ILKA 5JAMA 3DFZA 2UDPA 3BMCB 3RIHA 1E3IA 3BMNB 1HEUA 2GUGA 4DIBA 5I9LA 4XIJA 4N5LA 5T8KA 1CF2O 2E48A 4JQCA 5H81A 3FPCA 5F5NA 4BUCA 2OUIA 2BI7A 2H5LA 3IJRA 3VH2A 4WLOA 1U28A 1W6UA 3IC5A 3MJEA 3INRA 3H9EO 2IEBA 3GNSA 1K6IA 4B3IA 1L7EA 3MCVA 5HM8A 2D1YA 2IODA 3RBVA 1PQPA 4IDAA 4ZICA 4U0JA 4GX0A 4PG4A 5JAZA 1LXCA 1Z82A 1Z7BA 4E2WA 2PH3A 5THKA 5F1PA 3WQQA 3BHJA 3PXXA 1R4MB 4MOWA 3CEAA 2J3IA 1NX6A 4E32A 5CDGA 3C1OA 3JQAB 1P3DA 3PJEA 4HFNA 2PZMA 2JCVA 4GX5A 2VWHA 3A1NA 3QVOA 2WJPA 2VUTA 4XB1A 4MKXA 4CMHA 5ITVA 1GEGA 4MVJA 4E5NA 1RM0A 2V6GA 4DA9A 3ORFA 1U4OA 4IUYA 4DIOA 1QKIA 2VYVD 3DWFA 5K9ZA 2YHUA 4KUEA 4BGEA 4FR5A 2DUWA 2NVBA 4E3ZA 5TLSA 2C7GA 1ZIDA 2PKQP 5TSDA 4CQLA 1VL0A 3H6KA 5A04A 4W99A 3V1YA 4GWKA 3ITKA 3O26A 1F12A 1GD1O 4J7UA 5T64A 3MWDB 4J6FA 2I99A 4FSHA 4OIMA 4UAGA 2IDZA 4FIZA 4J90A 3TOXA 1XSEA 1E1MA 5TT0A 3BA1A 2NVWA 3BYZA 3BMCA 1A72A 3PHGA 4BKRA 3BMNA 3PYLA 4X54A 4CMGA 2Y1FA 4YB8A 2FP4A 1ZJZA 4M89A 1VLLA 1TT5A 5L95A 3TL3A 3VPHA 2FR8A 3UF0A 5COQA 4BNFA 2J3JA 2VNSA 4B7CA 3JQ7B 4KP7A 2CSUA 2WMDA 3TF5A 3GH3A 3G0OA 2O3TA 3OMLA 4BOYA 4CMIB 1U8XX 4E0BA 4IXWA 1DB3A 1R0LA 1EUZA 5L45A 4G5HA 1PSDA 2OGUA 1DPGA 2HMTA 3SBOA 4BO4A 4BGUA 3LC2O 5T57A 1R4MA 2PGJA 5KVSA 3LK7A 3QWHA 2VTEA 1WDLA 4EZBA 4P22A 1HE2A 5K6AC 4RORA 3Q11A 3T7EA 4JX8A 1Y8QB 3W6ZA 2E6UX 1DRUA 5L7YA 2W98A 1UJMA 3JCZA 4WPGA 4ZA2A 4BO1A 2ZB8A 2NU6A 3AFNA 2CNBA 4DGSA 3RAJA 4E5YA 3CMMA 1FDSA 1C0IA 2X9GA 2PD3A 5EIOA 1ZW1A 5L51A 3W4JA 1D1TA 3ADOA 3IUSA 2PY6A 1GZ3A 1HDYA 1F8GA 4L4RA 2EJWA 1YJ8A 5FEUA 2W90A 3H2SA 3JTMA 4KTTE 1C0KA 1WXDA
chains in the Genus database with same CATH superfamily
3HN2A 3S27A 4BU0A 2GF9A 1RYBA 2CF5A 2YDXA 2YW9A 3N7TA 2HEIA 3HNPA 1N7GA 1PCXA 4IDCA 5CP8A 2KX7A 2B30A 1W49A 2EKBA 1ECFA 3AUJB 4OBBA 1G6KA 3SEFA 4MPJA 3V8RA 4PS0A 5F52A 2I7CA 3K0SA 5MHTA 2H1CA 1H5UA 4IZIA 1H8EA 2PSDA 5T4EA 4EA9A 2VSOA 5SV2A 1OFUX 1XYGA 1MABA 4K6GA 1QR6A 3P9PA 1SCDA 3VR0A 4RQAA 5AM4A 3KZ1E 2OGZA 1QTQA 4E94A 3FYUB 3GFVA 1DEAA 4JOCA 1ISHA 4QGSA 2VTBA 3TEMA 4US2R 4QBIA 3IAS6 4ZOLB 2GH1A 3MAGA 1UOQA 1XQVA 5KNLA 2V7UA 4PQYA 4XA8A 2CKMA 2EKLA 4ZAXA 1GPYA 2RH4A 2PT7A 3K0CA 4OSOA 1B2LA 1H4QA 3EGCA 4I08A 2ZRQA 3N2YA 4L74A 4EAAA 2WVAA 1C7FA 2HPVA 3PQFA 4J7AA 2IU4A 4WLUA 5TQJA 4C4XA 3AB7A 5IC5A 2ZVDA 4ZT2A 3WJAA 1W581 5ALOA 1GU7A 1FP4B 5NLLA 4DXHA 1D6JA 3V42A 2TSYB 4O3FA 2ID8A 1Z6GA 1GFZA 3OF3A 5C3UA 3OUUA 2XOKD 5IS2A 2P91A 1Y3HA 2J6IA 4RVDA 3Q12A 2QRVB 1OR8A 3IR5A 5DI3B 1I7NA 1CF4A 4MLDA 1OBVA 5BRNA 2X7HA 3LCCA 1GNLA 1GT6A 1MEJA 2OZLB 4Y7DA 4DVGA 3FLAA 2F8LA 3RIXA 2UV8A 4Y8VA 3VNUA 4W8OA 3PI7A 1KE2A 3DCJA 3M9XA 4DIDA 1S3SA 4DRYA 3HYTA 2CUNA 1UIRA 5J47A 4X1YA 1N8NA 2C2MA 3VHLB 1QZTA 3NJ4A 5TMPA 2PJRA 5HYVA 1IDN1 2EARA 1A9RA 4QECA 4URVR 2X2FA 4Q19A 4XIGS 3R7FA 5KJ6A 5E4FA 2Q45A 4L8GA 121PA 1NVFA 2IEYA 1W34A 2Q3HA 4DWVA 1USVA 3AUTA 4FNOA 1D8TA 4RETA 2YWDA 1P2VA 1TQ2A 2I7VA 2ORIA 2P3LA 3EY9A 3OEWA 5DNDA 2H5IA 1KDZA 5AQ1A 4NXNB 4Y6SA 3ZE9A 5KO2A 5GZ3A 2XX3A 5M34A 1R9GA 4WZAB 1P33A 3C3WA 3Q3JB 1DAHA 1UMDB 4Z54A 2YJ3A 2JVJA 4TQ9A 3H3XA 1WSDA 3L7YA 1SCJA 1Z0IA 1ZBDA 2B4KA 2XJ9A 3HBNA 4X1IB 3W05A 5J2UF 4V1CA 5KDDA 1XA4A 3OMXA 3I8OA 4WHMA 3UANA 4A3SA 3MF4A 1HNZB 3I4LA 2HRZA 4JJGA 3FSEA 3PBKA 1I7DA 3MINA 3OUZA 2WM8A 2X76A 4BEBA 2DLNA 3G88A 3WGMA 4I99A 1PSWA 3BTUA 4PG5A 4TT3A 4C2BA 5AUOB 5L7WA 1G21A 2VUUA 4UTOA 5EJEA 2GHRA 2R8EA 4BNLA 2XGGA 1LV7A 1XAIA 5BVHB 2VNAA 1E7YA 2BZ0A 2VSXA 1T4GA 1ORWA 1LJLA 3E9QA 3M9WA 3ZH9B 3J80A 5ECYA 2QLMA 3K94A 2VZ0A 3BXFA 3MZ0A 3D43A 4PC1A 4CKEA 4ETNA 4YT2A 5D7NA 3KYDA 3UH1A 1ZO8A 3P0EA 3RREA 4CEIA 3OOJA 3MUNA 2JFBA 4XR9A 4WY8A 1SKYB 1TK2A 1SUAA 521PA 5IVDA 1B6SA 1ENPA 2J1LA 4M7OA 1AVTA 3QTLA 1UC5B 2I22A 2V96A 1KVTA 2QZZA 2VEOA 1K1EA 1U2SA 1WABA 2YJ4A 1SH7A 1UMBB 1CKEA 1VECA 1M0TA 2A88A 1Q57A 2W0SA 1T29A 2YY5A 4JJEA 4RIIA 4Q9AA 4Y2UA 3R8XA 5AKHA 3V8EA 4B6FA 4D3ZA 1C30A 1HTTA 3MJSA 4I7EA 4XD7D 4FBLA 4FXOA 5K6TA 2QLJA 1S8AA 4BNTA 1DJMA 3GCDA 5JMPA 1NT4A 3QYFA 1VJ1A 4W82A 3V7WA 9MHTA 4RHUA 1W0KA 1B00A 4HS9A 4V02A 1CDDA 4B4WA 1D1PA 3HBJA 1RJGA 3H13A 3KL4A 5J1SB 1B6RA 1Z83A 1MC5A 3KEOA 3FCAA 1HE8B 1DO2A 4DYHA 3NW9A 3IEMA 3L1HA 1QPGA 4BVFA 4EJSB 1WSAA 5DI9A 2ZB3A 2R7LA 1QQ5A 5BV0A 2DPGA 5J2UB 3KS9A 4DYDA 3WDLA 1KOJA 2Q6VA 3KJQA 3OOHA 3UOWA 4W5TA 2V9PA 3D6JA 3ZVKA 1JFRA 3GDOA 3S70A 1YZLA 2C9OA 4DBLE 5J4VA 4DTIA 3LQQA 4RXUA 4EGQA 2OFOA 1RC0A 1V47A 1SIUA 4UUPA 2BFOA 1VG1A 4ABTA 4H3KB 1V8ZA 1U0BB 3CX4A 3LUBA 4Q9IA 4CCSA 3NBXX 5BNTA 3QYAA 5HILA 3U17A 2W8BA 3T7JA 3GJ8A 3LYAA 4JEHA 1ZH8A 2ZSIA 1OF1A 1ZOOA 4PPNA 3I04A 3NP9A 1FTSA 1NKVA 3RSOA 1NBME 3IVMA 3JVDA 5FBZA 3HYCA 3LLVA 5DYIA 1DAGA 4M8SA 3DF7A 2YRXA 1Z6PA 1IU9A 3U49A 4D25A 3L46A 1TM7E 3PWZA 1G20E 3UGTA 3GA5A 1JSZA 2Z09A 1VE1A 4CG2A 4YJHB 4Z49A 4AG3A 2OBBA 5ENVA 3VR2D 4XX1A 4B7XA 4KR3A 1ABBA 1I6MA 3DZBA 3E58A 4TLLB 3IQFA 3VM6A 3N2KA 1GZ4A 1LK0A 4ZVSA 3VU9A 2LE0A 1Z0AA 3K2EA 2R6R1 4HXGA 5KVCA 1XZDA 4D3SA 1K98A 4JYAB 1XAGA 1O96B 3OJWA 2JFHA 1L1EA 4NBUA 4L4YA 4WN9A 5BVGA 3FB4A 3IR6A 4BJ6A 3BSSA 3N3AC 2GVDC 2H1VA 5CW1A 2XJ4A 3EODA 3A05A 2W71A 1Q1ZA 2AX4A 2RSLA 3ANXA 4OB6A 5GONB 5LIPA 2I3BA 5JZMA 3IP7A 4MW6A 5A06A 1QGZA 3ADPA 3K0CC 3MJCA 4GLOA 4MV7A 1VCHA 3I6YA 2BDTA 3MJHA 3PIRA 4QNMA 1V37A 1XZPA 3HCRA 2B2XA 1KC1A 1H0SA 4JLNA 3PHHA 4KO1S 1M72A 3D7SA 4CM9D 4MQLA 5JDIC 1CY7A 2XNDA 8OHMA 3BXOA 2B21A 2RHLA 2NXJA 3R7BA 4D9IA 1PD1A 1V5GA 1D2GA 2H1FA 2QGFA 2D2IA 2AFHB 1FDIA 5F33A 2A5LA 5JG7A 5K2MA 1Z63A 1GPLA 1WY7A 4ZCRA 2ZR0A 4PPQA 1T6XA 5KWVA 3HYSA 1T2VA 4QRDA 4LJYA 3V1UA 1N77A 4PSAA 2QRHA 1O58A 2H7YA 1MHTA 1L4LA 5DM60 2XDQA 4HVTA 4CL8A 4PBTA 2VPZA 4G9BA 1T1EA 2BLLA 2FLWA 2GPNA 4FX2A 3T1QA 3UXMA 4Q3DA 1ZJWA 3DULA 4B8WA 3KT6A 4Z2YA 2NUAA 2J9GA 3KDAA 4A6PA 4ZDJA 2OBLA 4PWZA 5A4DA 4LIPD 1L3BA 3LTNC 3ZTYA 4O2AA 3BD9A 3SZUA 5L6MB 1LX7A 4GVLA 4R3NA 3ANTA 4NP6A 4GYKA 4B83A 4LNAA 2QTTA 3FJ1A 1SHKA 1WDTA 3GLSA 4HRAA 1ZFNA 2H2GA 2NWQA 4LV5B 4O4JA 4R2JA 4J3FA 5EJGA 4DANA 3EZ9A 5B3JC 1ID1A 3HBFA 2GCOB 3EXFB 4PE5B 4EFMA 3R76A 3IBTA 3DS8A 3EARA 4Q93A 4Y1FA 1RLOA 2QE7A 3AT1A 4D7AA 3QF7A 1HMYA 4FJ1A 3T94A 4KQKA 4ZK6A 5LQCA 1Y6RA 3GDGA 3SE7A 4KDRA 2O5RA 4R9SA 2PV0A 3NTLA 4MGYR 4JJ8A 1VRVA 2O2XA 2QJFA 3OY7A 4QPJC 4KGVA 5JZOA 4YRTA 2GMWA 4GPTA 4ALMA 4CKZA 3RAEC 1B6GA 1W76A 3RUEA 2B7CA 4BNWA 3U7GA 3O31A 3UKDA 1ZIOA 2FLVA 3PYMA 1E94E 1NPTO 4OUDA 2Y1WA 3HRKA 4QHTA 2GLTA 2A1UB 2IXGA 3PEUA 1AOXA 4XM0A 1LBIA 1UAGA 5IYZA 1N5IA 1J8QA 1NJSA 4RLQA 2RHOA 4WZBE 5M7EA 4AKHA 3F67A 3G2JA 2OYRA 4X1OA 5HF8A 2VPTA 4UTVA 1RWKA 5BYAA 1CY6A 4YRLA 3QFHA 5U9CA 4MR9B 1QK5A 2XKAA 3SYTA 1R8QA 3F2VA 3LFUA 4YO8A 1MAHA 5BSWA 2Z4TA 3OJFA 2WY2D 1ZGJA 4TWBA 3MPUA 1QGED 3P26A 5F9FA 4DV4B 1ZPDA 5DXAA 1E4EB 2IYTA 2PUEA 1XDGA 1OIVA 2DFNA 2EYQA 2O3RA 2R6DA 2MSWA 1G98A 4WV3A 4NYIQ 4XASA 3KU4A 3ZCUA 2NTEA 3ZHZA 3A70A 5DHRA 2VWGA 3EIWA 2Y99A 4FC7A 1X39A 4HDQB 4WZ6A 3QUBA 3DHWC 4CG3A 2QZ4A 2X5NA 2HI0A 1TA9A 1N2EA 3I5MA 4I9HA 1JQBA 2VRWA 3NGXA 4HWSA 4H1WA 3VC7A 1XAJA 4E7PA 1AQ6A 2Z57A 3WK9A 1JBKA 1JJ7A 4BO5A 5C4MA 1JJIA 1XPJA 1MQSA 1WV0A 3IT3A 2Q3DA 1HO3A 2RGGA 2X8JB 3FKSD 3QFFA 3UYLA 4QGBA 4UDNA 3VOTA 3IDSA 4BTEA 2H51A 1I2DA 4MVYA 1P2DA 1RZUA 1XWIA 1BXKA 3VDRA 4BGVA 4LFBB 3TFWA 3ZZNA 1S6YA 3EDCA 4OAQA 1GGEA 2QZSA 4O0LA 4Q4JA 1P4HA 2AOUA 4I1VA 2ODEA 5B3AA 3RSCA 3U3RA 5A5GA 5DNUA 3F74A 3KXIA 4RA6A 4LF9B 3IP8A 2EGGA 3N28A 2YZGA 5A4JA 1MX1A 3GLKA 4G3XA 1CD5A 1ULUA 2DBVO 4P7FA 1T8PA 3C4VA 4AZ0A 2A0UA 3N1UA 4EO7A 3LT2A 2CMGA 2OCPA 4YP9A 3RC9A 5TNXA 1FMJA 5SY9A 4ZEMA 5I4IA 1AGYA 4J16C 2O3UA 2V5VA 2VK8A 1IBRA 4I4CA 4C1NA 1Z2DA 3BDAA 2Q8NA 3RHZA 5I7HA 5BWLA 3U6KA 2C04A 1RC1A 1XRSB 1YWGO 1P62B 2VP6A 2W4IA 3R3WA 3NC4A 2GBLA 1UFQA 4RF5A 4DJTA 4W9NA 1VGQA 1TPYA 3GJ4A 1DIAA 3DMTC 3B5IA 2XTAA 1GPBA 4FN5A 4HH0A 2E6KA 4ERXA 1YB5A 2KYRA 4ALLA 1USWA 4H1HA 1YMUA 4D5GA 3T7IA 1Z5GA 1UOEA 2VLIA 1ZMRA 4BKQA 3WY9A 1HYGA 2GR9A 2LIVA 5AHKA 2VP0A 4CN8A 3OICA 1ZJJA 2ID7A 5BSUA 2XUHA 3DBOB 4QTXA 2C9BA 3DL0A 4EHIA 5AVRA 2XBMA 1P80A 1P2UA 3AINA 1XTVA 1IBMB 2PLFA 1XRRA 4EF6A 3LRPA 3DEIA 3KPJA 4NESA 3PCRB 2VJOA 1KIAA 2XXBA 4W1SA 5JFOA 3KQUA 3U19A 2HX1A 4LOJA 5BSHA 5F21A 1THGA 3MRSA 1UJCA 2NSDA 2QNRA 2UVDA 4AJPA 3N0VA 4K9LA 1QHFA 2PVPA 3BB4A 1JDSA 3DBHB 1JNYA 2ZANA 1W5EA 1JJFA 2VJKA 3G0DA 1TW2A 3LT1A 4ER7A 2Z6AA 5A0VA 1KZ4A 1RXYA 1X1AA 2K2WA 4NEQA 1S3FA 3I2HA 1D4FA 2C7VA 2FXIA 4HWRA 2O7NA 1CETA 1D0IA 4IIDA 4R7GA 2UU9B 2IY8A 2PFSA 4NFYA 3NHZA 1WCXA 5JO9A 3WP1B 3RFXA 4N0EA 5EJ5A 2VKTA 3JVIA 4I4LA 4QTUB 2QAIA 5E38A 1E5QA 2C4NA 2V59A 2Q5EA 3LW8A 4HDNA 1U3CA 4HH1A 4IWYA 1E1QA 4TSFD 1FP1D 4HQKA 4B84A 1FZQA 1XDZA 5JRDS 4B32A 4I55A 2GK3A 1ZSVA 2A4MA 3OCYA 2DWOA 8ATCA 2VBGA 1JL3A 1WSBA 3IMFA 2QL7A 1XQYA 2PBLA 1EK6A 5JTTA 1JKFA 3JRXA 1OWPA 3HU1A 5K03A 3SJBA 3BK7A 4N7JA 4MQ5A 2NAFA 4J1SA 2JLXA 4OHVA 5SYNA 2PZFA 4O2LA 3WSVA 4F72A 1GTVA 3GCWA 4N48A 1X19A 1E9DA 1LV8A 3D4NA 3R44A 3OFJA 4MV8A 3W06A 5AW1A 1IQUA 4MPDA 2JFYA 2VR1A 4CGYA 1SBHA 1CFJA 3IL2A 1KSJA 5JQGB 4MS4B 3V9AA 3L6OO 1KTIA 4MUNA 5U4QA 4TMVA 1Z18A 2QBYA 2W6CX 2CWWA 1B6TA 3UATA 4CL2A 4CEJB 3T1VA 4J4TA 2VDWB 3X1KA 2P6PA 1LS6A 4A82A 4ZYXA 2IZ7A 1DC4A 1BFKA 1JDPA 2FJPA 3HB9A 1HRDA 1ZRNA 3ZU5A 4EQZA 3K4QA 5E7JA 3Q98A 1M10A 2O5VA 1UEIA 3C39A 5BW8A 3ET4A 4EBBA 5EKUA 1AQJA 3JQGB 2EFDB 3F3MA 5DM4A 5LQUA 1KZ6A 4J0KA 1GPDG 1KZGB 5CDSA 2CY0A 4FJ0A 5I7VA 1DWQA 1GN9A 3DBRB 4LJRA 4TV8A 1UT6A 3M2TA 1FDUA 1E2DA 1BGXT 1L7OA 3OEEA 1P81A 4ID3A 4KFRA 3FA2A 1GGVA 4IFBA 4R8VA 4AW9A 1GVNB 2TYSB 4U2EA 3AFGA 1A1VA 1XFDA 3HKEB 3PI6A 1T8WA 4MW9A 4V2IA 1YR6A 3UK6A 1DP4A 5AD1A 3V80A 4JB0A 1Q0SA 4KV9A 3WK4A 2G63A 2ZYUX 1Y9JA 3B3GA 1NYLA 4EW2A 4XPIA 1EG2A 2D1TA 2D0OB 1EXMA 1UEXC 4J9UE 5DTRA 3T3HA 3E9RA 1E2FA 3WSTA 1D5CA 5KU7A 4BFXA 5CH3A 4N3NA 3AV0B 2O1WA 3PQ6A 2Z6QA 5A7GA 1M2GA 3QX7A 5EE5B 4PWYA 1DWUA 4OGGA 1FQOA 2NOAA 1ZYUA 1OXTA 2XQGA 1IG3A 4MPTA 3I2KA 4NZ9A 3LDFA 1VPEA 2Q99A 2PD4A 2FNAA 2DKNA 1MC4A 1I0IA 3A6HA 3ISVA 4J0EA 5EIAA 4E15A 1TTPB 2XA1A 2Z0MA 3CUEF 2MDTA 2H29A 3KELA 4GPEA 1PTJA 1S3GA 4JI2B 3JQBC 2OHGA 3JQCA 3C6KA 1MB9A 1XQ9A 2CYBA 1HE4A 2X2EA 3OE1A 3WLKX 1NTRA 3RROA 4B76A 1P2GA 1T0HB 2D1FA 2MYPA 3FPLA 3L0OA 4MAMA 2QRJA 4QU8A 3UMSA 5FORA 3VHXA 3OPYA 3LX5A 2J4DA 2I2FA 3A4TA 3HN6A 2IT1A 2GZSA 3WKAA 1YS7A 2OLJA 5JHHB 3TXYA 5CB4A 1XVAA 4G0ZA 1FYDA 3TDMA 2HMYB 1ZI9A 2Q50A 3BFVA 1YU9A 4YS6A 4BZPA 1L7RA 3TVTA 4YUZA 3QX3A 5FUVA 5IAGA 3L1KA 3TRHA 3HY6A 4B6GA 1WLYA 4FFBA 1ADJA 3VUFA 2BGWA 4BLQA 3PEEA 1BQEA 1W0JD 4JT4A 1SEVA 3LT4A 1Z36A 1C50A 3ENKA 4ZHQB 4L8LA 4B46A 4JI7B 4FBMA 1KJ9A 1TEHA 1R27A 2P6UA 2VHQA 4PNPA 5BUQA 5AVQA 4KLAA 3NQ41 4XCQA 4PXSA 4UMDA 5JCJD 5H82A 1WXQA 3EIEA 3LDHA 1FNMA 2BFWA 2PTGA 3IE2A 1K3UB 1LUAA 3W4IA 4ZO6A 1PI3A 3HJTA 3ZNPA 3CRQA 4LEIA 3CZCA 4GHWA 4TMWA 4LOLA 4BKUA 1JT2A 3GRVA 3QKWA 1UZUA 1YXMA 1DLIA 3ILVA 1KY4A 1L7NA 2WD8A 3NTOA 5FADA 2ZUTA 5EAIA 1WUTA 1XELA 4MSUA 1RYYA 3NTRA 3GLGE 4WNYA 4R8SA 4R8RA 5TMDA 3N5KA 3SEAA 2LVBA 4RQBA 2FP3A 1OU0A 5SYAA 1Y81A 2OA0A 3ZKWB 3CQ9A 3L07A 3R6LA 4ZQBA 5I7UA 1LEHA 2GWHA 1U90A 4NOJA 4ARZA 4EH1A 4POAA 5LQMA 3LUPA 3Q72A 3FNFA 4YCMA 2A7XA 2Y0EA 4AKEA 3BSWA 3PU6A 5AVVA 4YR7A 3O2SB 4MICA 1Y1RA 1W4BA 4II2A 4ZI5A 3TPCA 3LWBA 4QXOA 4MRSA 4CGZA 2BFMA 4PG7A 5JJLA 3ZZ1A 1BWQA 4IRXA 4OM7A 4X64B 1KP9A 2AUNA 4U2DA 5REQA 1PHPA 1U7PA 2NUTB 4P82A 2R8ZA 2FDRA 2O8CA 1P0CA 3E5HA 1W85A 3H8WA 3SX4A 3GLFA 1NOJA 4YDQA 1BAPA 3QUAA 2R6HA 1TZ2A 1NVWQ 1S2MA 2P9EA 3A2MA 3I58A 4IM7A 2O8VA 5G3ZA 5DHFA 3TVDA 3VR4A 4DA8A 1M1YA 2ZBEA 3ZEIA 2YWXA 3SEZA 3MWKA 2H4YA 4LG1A 4BQPA 1JEJA 1KZ1A 3D5QA 3QBTA 4OO3A 5BQPA 5BORA 4LRYA 4XEUA 2HH9A 3MWDA 2DWUA 4NR0A 4D3XA 1P1KA 1RQ7A 3DQQA 1OGJA 3SM3A 1E3TA 1SO8A 1ZD2P 4CMEC 3BIJA 2FUKA 4I3HA 4MVJD 2V1XA 2WTNA 1CW2B 3OQIA 1UDRA 3QE4A 2P9FA 3R24A 5G0WA 4OQZA 1K6JA 5E0KB 1SULA 5DCUA 3F5FA 4A0RA 4PCUA 5FTNA 3GFRA 5BR7A 2HCRA 3AJ8A 1ICEA 4ZI3A 3O82A 3LOUA 2KSQA 4RESA 3P8ZA 3ZGNA 3FTQA 5HE9A 3IURA 4JKOA 4NATA 4MB6A 1KKUA 3JZDA 4O1IA 5EJIA 3UAOA 3F4LA 4RMJA 3U2QA 4BL5A 3VI3B 4CMIA 4CTKA 3SXUA 3I9JA 1VKZA 3Q7IA 3FUXA 2AKAB 1BXRB 5T4HA 2C58A 2PGAA 3CISA 3MJRA 2LNDA 3G8YA 4PZLA 4UE2A 4YP6A 4O4LF 1KF0A 4X65B 1K7CA 1YI0A 1GXSB 1RWMA 4M1QA 3N86A 4ALNA 1U0TA 1ZGBA 2LW7A 3OZUA 4OMFG 5J23A 3OQOA 1HSZA 4XD7A 5T8KC 5IABA 4ZCTA 4MJLA 2M1ZA 4FHEA 3OCJA 2Q5OA 4PQEA 4ER5A 2Z8YM 3ETGA 1Z73A 1OY1A 1KEKA 1QCYA 4Z4FA 1MBZA 1P9RA 4OQDA 2YIJA 1RE0A 3EJ6A 3KQSA 1NBMD 1QGAA 4PZAA 1EFPB 4C5BA 2PNFA 4RF2A 4TKZA 4QJBA 5DPMA 3WNBA 4BQRA 4QO8A 1J70A 2E3JA 3REQB 1QIIA 3RT1A 1J8MF 5ALZA 1FFEA 4U2FA 4QDJA 1XNQB 4KQ9A 4QYIB 3R23A 1DRKA 3QLUA 3O3MB 1CR0A 4HN9A 4BIIA 1JEEA 1JWLA 1SG0A 2P5UA 2YV3A 3DVLA 1FVXA 4CLRB 5G4LA 3V3TA 1P6QA 4Q1BA 4W5JA 4ZZ0A 5BN5A 2O19A 2H4WA 4Q1FA 1AKUA 3GEHA 3ER9A 1K66A 3DOIA 4NZZA 4A6EA 5IM4F 5GADl 1EUYA 1SC4A 1TO1E 3UMGA 2FQWA 1V7CA 2YX1A 5LZ5A 3HV2A 1DQYA 3GAZA 1RFGE 2BY4A 2GD6A 3CZAA 3E23A 1I2CA 3GEGA 3IMGA 3V00A 1DAIA 3HP7A 2AMVA 3IKVA 3UOGA 3QMPA 4CL0A 1MNAA 2R2GA 3EXEB 4N65A 3RANA 3EYWA 2I3ZA 3A1UA 3R0VA 3Q15C 1I51A 4AECA 5DX0A 5JAOA 4PLFA 1KPGA 2DR3A 1GPJA 2ZIEA 3Q8KA 3JR7A 4X61A 4CTNA 2NTNA 3AEKA 2JG3A 3K9GA 1MIHA 4NHOA 5AJUA 2FFJA 3CZRA 5AW5A 4IG9A 1A8IA 4WLFA 3EG5A 4WACA 2EX0A 5F76A 3THRA 4NKRA 2J0EA 1FYEA 4JP2A 3WO1A 3ZLVA 3DQPA 3PA6A 3D3KA 4B17A 4LI3X 4CTOA 4NFSA 5CJPA 1ZN7A 4LVCA 4PGFA 2B8NA 5AK0A 1LPOA 2G0TA 1ZK3A 4C4OA 4J0JA 1PK7A 1FNBA 2B36A 2LKCA 2Z56A 1MO5A 3SF8A 2QVGA 1F20A 2CD9A 1JA9A 3CLHA 2W6NA 3IX7A 3MS4A 4IGKA 1GUDA 3KXKA 2IYLD 3OZSA 5GOTA 3CVUA 1PEKE 3A6FA 2KS6A 4GIBA 5ALDA 2OKGA 2ZYTX 3TLXA 1W0CA 3QKTA 4P6VF 4FNMA 5DHSA 4JBNA 1CE8A 3CTPA 3NONA 2OM6A 1EK1A 4J49A 1QG6A 4PHCA 3A1DA 2B99A 3PJRA 4BCDA 3A7EA 5C8YB 1X94A 2IK8A 3T5CA 1GRQA 1CS4C 3KUCA 1GTL1 3B89A 2RGWA 1PQ4A 5EJMA 4CM1A 5H3LA 1G9SA 1ADFA 1SIOA 2BHSA 4TYYA 2G0NA 2B0JA 4EB6A 1T25A 1NY5A 1R5BA 3E3AA 4MP6A 4J3NA 3VDNB 1RI4A 4FKMA 3ZYCA 1CU1A 1DFIA 2XZPA 3FVWA 1BX0A 2WAYA 2WWYA 1PJAA 4A10A 3BKWA 3QA9A 2BN4A 1VKRA 3KXLA 5IJAA 3EXIA 3CF6R 9ABPA 5IANA 2ZM5A 3LDUA 3OP4A 3CS3A 2I6UA 1IZ0A 4CV2A 3X1JA 4IUBS 4RSHA 3W6OA 1L5GB 1PGJA 1QGUA 2V7VA 3BMXA 5E1MA 1CP3A 1E79D 1T5DX 2BFBB 3EOBI 3FGNA 4IG4A 5K3FA 5BN4A 5JYEA 3T1YB 4ROTA 2H5JA 1NR1A 2O0HA 2QUHA 2FKNA 2PNJA 1ZK0A 2QJRA 1U0LA 1PV4A 1GDTA 1I7PA 2GN6A 4HGRA 4BNNA 2QB5A 1X2BA 1FUIA 1EM8A 3ESRA 3I12A 4JI4B 2WWIA 1T2DA 3VKGA 2YHSA 1TZJA 5JXGA 2KE5A 2Q41A 4OJMX 5KX5F 2BGLA 4HDOB 3FPJA 3MBOA 1NBAA 1NIJA 2ZS8A 1VLZA 2AR7A 2JFQA 2F3UA 3KX2A 3MTBA 3NAMA 5E9JA 1NVEA 2P2YA 5BUSA 1PTKA 1TPZA 4W6QA 1NE7A 2BFFA 2D1SA 3COVA 2NU8A 1H3EA 1XEXB 4F5DA 2RHRA 4CG0A 1VE7A 1W5AA 4G8CA 3TWOA 5CFPA 3EA0A 4AP6A 3N8HA 4QTYA 5FPHA 5EQJB 1VP3A 4PY2A 5CDYA 1A7JA 5HJ7A 1BCSA 1TRKA 4GH5A 1M0WA 4EYGA 3Q85A 3MAAC 2XAUA 1IM2A 3IIEA 4KYUA 1M1XB 1HBJA 2Z95A 3BFJA 1J2YA 4Q4HB 2H4JA 5CDUA 3VR3A 3DE0X 4MXDA 3DFMA 1M6WA 3BF7A 1EJ2A 4DJAA 4LF4B 4QD3A 1T0IA 3R7WB 4DV0B 3GBVA 3IDZA 4JGBA 4MROA 1SQ0A 4URWR 5SYMA 1IQRA 2A35A 3CLKA 3WNDA 4F2DA 4YJDA 1Z6QA 3PHCA 4Q9DA 2WD9A 1WXIA 5COBA 1Q0LA 4PYLA 4XUCA 4CLEA 5LP1A 4FUTA 4F2HA 4RXMA 3CYFA 4HMQA 3NHKA 3SDSA 3BQMB 5JEEA 2NZJA 3E5NA 1ILWA 1VHWA 3IS3A 4MHSA 4ZT5A 5IFLA 2DH5A 3LNCA 4GNKA 4DLXA 4HAWA 2WTAA 3O83A 5E4JA 1G7TA 2W00A 3EPPA 1VI6A 3PNPA 4EKYA 1C9YA 4JBLA 5EMHA 1LLQA 1S89A 1E63A 4JI8B 3ECCA 4HF7A 3TKLA 2D2EA 5HRCA 2R48A 1NXQA 4AMZA 2WAXA 1VE5A 2EHJA 1UPBA 1XDSA 4GAEA 2AYYA 2EIHA 4EEKA 5LB4A 1J0CA 4JFRA 5AKGA 3PHJA 1G291 1P9OA 5EFOA 4DCUA 5HKBA 1G9TA 1NATA 4X8OA 2JJ1D 1Y5NA 3T4EA 3RFUA 4COKA 1JHQA 3PXCX 5L3SA 4LJAA 1CR4A 1VPTA 2CXOA 1M67A 1UJ2A 3ZU6A 5KQRA 1UBLS 1P74A 4WFKA 3T5GA 4QASA 1FMCA 3WHPA 5F2NA 3CRVA 4ARCA 1E8NA 1BVRA 3QITA 2CJWB 1RQNA 3G9QA 5LCXA 1NXSA 2R6JA 3P7MA 2GUWA 2OQRA 3G9UA 5BOVA 5WRFA 4DAEA 5JSZA 5KKCA 5FYDA 2W6ZA 5ICCA 3LX8A 4A6XA 2C31A 1SD1A 1UKEA 4FSDA 2D06A 1HWYA 4V0ME 1ZR4A 4JXJA 4HDSB 2OHFA 2CLIB 4DMKA 4H16A 2E4WA 4G23A 2PCLA 4LSZA 4KVFA 4XZ3A 1H2BA 4M55A 5CYPA 3ZW8A 1D03A 3NTUA 4R81A 2PL1A 5CG2A 5CM8B 1KK3A 2BEWB 4TMZA 2WE8A 3FDZA 3ZWWA 5EE9A 4BLTA 2O54A 3NXKA 2YZMA 3PX7A 2HDNB 2W5UA 3HEAA 3KQMA 1Q20A 5E6RB 1N2OA 3KQKA 2HJVA 1PZNA 1ZDMA 1CS0A 3KJZA 3NTXA 1Q0QA 5I45A 4XYBA 3GZNA 1KYZA 3DZCA 4RHXA 1KAQA 1AZLA 2ODPA 1USUA 2L17A 2PEZA 4RK6A 4IVNA 5DE3A 4NY1A 3VPDA 4PONA 3T1TA 2QXYA 2WA2A 1T36B 3NR2A 1DADA 2JD2A 5JNLA 2WWVD 1UBRS 3A25A 3AG5A 3GX1A 2AXEA 4B4UA 1JBQA 1I7LA 1DMRA 2FZVA 2QGNA 1N78A 3HU3A 4AWXA 2FMFA 2RFLA 4MMZB 1BHSA 1Z07A 3QYPA 2A9KA 4OQEA 4C9BA 1TQDA 2LTAA 4G1VA 4BMPB 4QUDA 1FDWA 3IMEA 4GSYA 2PTHA 3TJRA 4IO1A 1E77A 2LDBA 3S81A 2FPPB 3UYKA 3HQ4O 3MOGA 4K8OA 4F21A 2A33A 1G0OA 1DHRA 3PXBA 1KSGA 4ZJUA 4IDBA 1GFSA 4D4KA 3I5XA 4MWDA 2TMYA 1GDHA 4YT5A 3ZCTA 3H2ZA 2O1EA 1R8JA 4EMBA 2DGDA 1VLVA 4XB2A 3TKYA 4RHYA 4YJ3F 2XOXA 4EKDA 1PDOA 3KJEA 3NKLA 5HOEA 5IT5A 1LWNA 5T5QA 1NLYA 1G41A 3S1AA 3WBFA 3A1CA 4H7FA 1Y4UA 5CVUA 3PQDA 2QJWA 4K9SA 1UC8A 2W2QA 3K31A 1KP3A 1DBQA 1RBYA 1USIA 1V11B 2AXPA 2P9JA 3CZPA 5JLAA 2V0GA 1YNSA 1Z0KA 3CR3C 1YS9A 2JIPA 3LUCA 3OPNA 2WI8A 2AOWA 1ECBA 2EC5A 1WU7A 1GTG1 1YHYA 3G9ZA 1XLVA 2BMWA 3L82B 4DA6A 1Z26A 5CM2Z 1D2EA 1MRSA 3N8KA 4X6YA 1MO2A 3GP3A 1U0HC 1ONNA 1QIKA 3ASUA 2FK7A 2W6MA 3MMNA 2ZRFA 3AFHA 1FMTA 3LXRA 4CCAA 4GWGA 1O3YA 3DW3X 4YAIA 5CDHA 5KNBH 1J22A 2Y9MB 4KDEA 4AO6A 4YH1A 4I9FA 4DJEC 4ENSA 4K6CA 2OHXA 3AL2A 2Q3EA 2BBWA 1Q0TA 2YVLA 1SOWA 1AGXA 1SKAA 3CFYA 2QYSA 3MK31 5FNZA 3GLIA 3UK7A 1IUNA 4KDFA 4KMMA 3OLXA 4FFPA 3HO6A 4N9QA 4U7PB 4OUKX 5FX2A 4RADA 2CCJA 4Q3EA 1KJYA 2WWHA 4WNIA 1UBCA 4RTMA 4LY9A 1FS6A 3BWCA 1UM9B 1JVNA 1OCEA 4K28A 1F2TB 1AMUA 4V0OA 4NJEA 2XMBA 1JB9A 1OFGA 1P5RA 3WMXA 3HVKA 3E15A 4HNAB 5C18A 1FE8A 1MVNA 1FFDA 4TKLA 2CNWA 3S2FA 1Q6ZA 4H77A 3OIDA 2IZ1A 4Q3OA 2ZBVA 4JHLA 4RSGA 3OWOA 3ABZA 4JLBA 1XZIA 1XDDA 5MDHA 1N2SA 3ZJ4A 4QEKA 3UY4A 2OV4A 2D0PB 3E1GA 4ZALA 1C7ZA 2OK7A 2Z1NA 4MUXA 4WDRA 1SUEA 1WB6A 2GN0A 4JSTA 4RANA 2W4MA 5AHXA 5I9BA 1QP0A 4DJDC 3V48A 1RRKA 4FGJA 1KMHB 1NUSA 2DR0A 3ZWXA 3ZZTA 4JWKA 2FW8A 4D4HA 1K5GA 2FN8A 3PC6A 4YEDA 4PX2A 4KTVE 2XVZA 1B8OA 1JFLA 4QXQA 3CT4A 4N18A 3FMOB 3CO5A 3DFFA 3ICOA 3P71T 4MVWA 3JWJA 3WGJA 1E7MA 1G2QA 3IXMA 2DY0A 5H80A 3RCBA 1CNEA 1DO0A 1TYBE 5JVDB 4ZTBA 3T5MA 5CA1A 4MS3A 2ON6A 2DPMA 2QGZA 3KK0A 1UBNA 3QU4A 1XHFA 1PDVA 2FCAA 3C3YA 4D1YA 1QIEA 4PSDA 4X6UA 3CVXA 3OJ0A 2ZIXA 5LP6F 1ADGA 3ZD7A 4LECA 2ZOSA 4LBZA 3PCTA 1ZUNB 2D74A 1CY1A 3DC2A 1KAEA 5LZ2A 4QUGA 5FTJA 3SHTA 1JEOA 4PGGA 3UEOA 6YASA 2WNSA 3E70C 2WWXA 3PHIA 3PQCA 3EUFA 3QI7A 1F8UA 1ZMOA 2BTQB 2C9MA 4H2DA 3KR2A 2O0JA 4CF6A 1XTIA 4F4DA 1T5BA 1K6XA 1P45A 4X7MA 4I4TB 1VJTA 2ZLBA 2JBAA 1SCNE 1GVHA 3EIUA 4MYUA 1IHDA 3DR3A 4KXNA 3IO3A 4JP8A 4QOIA 1H2XA 4QYMA 4EKNB 5DKFA 3UJPA 3L8EA 1NI4A 2E4ZA 2PZAA 3J81A 4PLHA 5KTRA 3GUCA 3CCBA 3RKSA 5EIWA 2UVPA 1OT5A 2XMCA 5AFSA 3CG0A 2FMTA 1I9GA 3S40A 4L7QA 3ZZ0A 4GZMA 5GY7A 2ZBFA 4BB6A 3LQ1A 3FVRA 2QTVA 1B76A 3RYTC 4OB8A 4DE5A 3H5AA 3CNHA 4M0KA 3OP1A 2XE4A 3QVWA 4U7FA 2AJ8A 4RZSA 2ZU0C 4RZQA 4L0DA 4ZOLF 1BW9A 1UZAA 4LMAA 1GAQA 5DULA 3TSOA 5TR9A 2CL6X 1XXLA 2JGAA 1Y89A 1J00A 4HAXA 2I29A 4L76A 4MUYA 4QLOA 3W34A 2J9XB 3TK1A 4Z0HO 2XODA 3ROFA 1D2CA 1U2DC 4KPFC 1U80A 1W59A 1EX9A 5EPOA 4CIVA 3NWOA 4BV3A 3KYCA 1NP3A 2GPWA 1BDMA 1QDEA 2DOKA 5B6JA 1WCWA 2B2NA 1LPBB 2E5WA 1WX1A 3A28A 3OFSA 4YRCA 4ICIA 2EJCA 3FFBA 1GDDA 4DDKA 3OCXA 1I2BA 2G77B 4WMLA 2PH7A 4PYNA 2FSVC 4L0CA 3TOCA 1OBHA 4Q48A 3VAAA 1M2WA 3OWXA 3TLAA 2BHNA 2H6EA 2JGMA 5DTJA 4B2IA 4XLLA 4LQLA 1CEXA 4GYYA 1FJ2A 2HDHA 3CBGA 3UWOA 3IEVA 1RI1A 2ZREA 2MCFA 5IFKA 1Q7GA 1CSEE 1HF3A 2JD1A 2WVHA 1XD8A 2RAPA 1V4BA 3LBFA 4IHKA 1M8GA 2H2AA 5FI1B 4LVUA 3SXJA 2JIDA 4EDHA 4HLNA 1D7AA 5KYXA 1FFYA 4A8JC 2O7QA 4KPUB 2PKXA 4N9WA 1W4RA 5JYCA 4TM7A 4TL6A 3MT7A 3CVVA 2RGYA 5DTMA 1RXEA 2Y05A 5EHGA 1IL0A 2PS3A 4TMXA 1X1BA 4X84A 3ZI7A 4KOEC 3DLIA 2HBRA 4NCJA 1DXYA 3QUQA 4PAOA 1SXJE 4M8KA 3IKJA 4PC7A 3GUUA 2OOKA 1KQGA 3QJ5A 2G71A 4IIGA 5CCEA 1M2EA 1D2HA 4NYJQ 4DR2B 1JHVA 3GQBA 4XWYA 3STXA 2QORA 3QPUA 4OQQA 3AUKA 4DCNA 2IPAB 2VIIA 2XA2A 1QK3A 1SBYA 4BLOA 5TPWB 4P3PA 4Y6OA 4G63A 1OX4B 5CFRA 4NWIA 1G18A 5IK2A 4NC9A 3N70A 1ZOPA 1O6BA 4YUVA 2HA2A 2JASA 2YY6A 1I24A 4D98A 1NZDA 4FDVA 1M75A 1EGQA 3WWDA 4L8YA 5L3QB 1NVDA 2BJWA 1PLJA 3GNTA 4TL9A 2UZ1B 5K09A 3S2IA 4MKRA 5BWCA 5KKNB 2OXEA 3OCUA 3K8OE 4DL9A 1XQXA 2PO5A 3NAZA 2PQ2A 2YNMC 3DZ8A 4XKJA 5CPFA 1PVVA 1S8NA 1YC2A 3U62A 3GR6A 5BMOA 2B3DA 1J20A 2BFDA 2Z83A 3FCEA 3ZGOA 4AS1A 1W93A 2N46A 3NT2A 3WMWA 5IBRA 1YB1A 4RNDB 3PR1A 1UBTS 1A8SA 1L4BA 2IU3A 4IDFA 4C0XA 2NO9A 3UCXA 4YCBA 3KJHA 5KIAA 4PSKA 2BFEB 3L0ZA 4Y2YA 1Z33A 1JMYA 2IYZA 3CMCO 3EC1A 3L4BA 3NNSA 4TMYA 4Y0AA 1RXSA 4IEEA 4MYTA 1MO6A 2MT9A 2J32A 3KQTA 1OWOA 3ACBA 2WSMA 1C3OA 3NANA 4FMDB 4HAYA 4L1KA 5DBIA 3T0FA 4B7UA 3JWGA 1GG8A 1Q83A 1VOTA 2F3SA 2I34A 1AY0A 1JTEA 2NZYA 3JD1A 3X2SA 5HJ5A 2I4OA 1HA3A 2CD7A 1YCDA 3D0KA 3EQZA 3KSMA 2JGKA 2ONCA 3BCSA