4DUPA

Crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
331
structure length
331
Chain Sequence
MSLPQEMRFVDLKSFGGPDVMVIGKRPLPVAGEGEVLVRAEAIGVNRPDIAQRQGSYPPPKDASPILGLELSGEIVGVGPGVSGYAVGDKVCGLANGGAYAEYCLLPAGQILPFPKGYDAVKAAALPETFFTVWANLFQMAGLTEGESVLIHGGTSGIGTTAIQLARAFGAEVYATAGSTGKCEACERLGAKRGINYRSEDFAAVIKAETGQGVDIILDMIGAAYFERNIASLAKDGCLSIIAFLGGAVAEKVNLSPIMVKRLTVTGSTMRPRTAEEKRAIRDDLLSEVWPLLEAGTVAPVIHKVFAFEDVADAHRLLEEGSHVGKVMLTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords quinone oxidoreductase
publication title Crystal Structure of a quinone oxidoreductase from Rhizobium etli CFN 42
rcsb
source organism Rhizobium etli
molecule tags Oxidoreductase
total genus 101
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dupA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4dupA01
5JMWA 1IL0A 1R16A 4R54A 5IXSA 1ZVMA 2Z5LA 3W6UA 5A9RA 1ULSA 3GC6A 4L74A 3LC2O 1GEGA 2PR2A 3DHYA 4AJ4A 1MP0A 1E7QA 3CMMA 4ALIA 4DMLA 5JYEA 3NJ4A 3S2EA 1VI2A 3W6ZA 3L4BA 1R66A 4KMSA 4KUHA 5JCJD 1V3UA 2D3TA 4YJHA 2JJYA 2YV3A 2EW8A 1D8AA 1DRWA 2A9FA 1NFQA 4YJFB 2O3RA 4FFPA 4G65A 2G0TA 1Y1PA 3QWAA 1RYDA 2EKQA 3WNQA 1T1RA 3DONA 3UKOA 4YAIA 2NM0A 5DP1A 4BNNA 3GEGA 2WTBA 5JAZA 1LEHA 4KQWA 3R6DA 3A28A 2FWMX 1VSUA 4FFLA 4EGFA 3MWEB 4ZGWA 2X5OA 2RH8A 4GVXA 2W2LA 4R5MA 4DPKA 4E5NA 1A71A 4BKPA 3CH6A 1BXGB 3B1KA 4FW8A 3GLQA 4YBZA 3ZWAA 3I83A 1YONA 1PJLA 3JQCA 2AE1A 3GRPA 3I4FA 3JQ7A 5K0ZA 3ASVA 2G17A 4AJNA 2BELA 1MA0A 3PWKA 3VPHA 2NVUA 5JC1A 4I8XA 3GZNA 2UDPA 1DO8A 4KTTE 5A5EA 1P31A 2AXQA 4U0KA 5TIIA 1ZFNA 4ZD6A 4HKTA 2B83A 5BNIA 1X15A 3ITKA 4WE3A 2Q4EA 5BNFA 1XQ1A 4RPGA 3JYLA 5DDIP 5DULA 3BYZA 2VNSA 3KSUA 4J9VA 1U3WA 2WYUA 3WYEA 1GV0A 9LDBA 4LMPA 3BHMA 3OICA 2JCYA 1JAXA 4WOKA 4XDYA 1JA9A 1I3MA 3IP3A 2C20A 4RLSA 1ADBA 4BKUA 5AXCA 4CM9D 4CV2A 3DWFA 4CV1A 3GRKA 4J7CA 1MGOA 4XA8A 5I7FA 1P9LA 3AUSA 1CDOA 3TJRA 2Q99A 1QLJA 3F47A 1U2GA 1DIAA 2NLOA 1AXGA 1YB1A 3DC2A 3L6DA 2V7PA 3PTZA 4WEOA 1VJTA 2DVMA 2NU7A 4GKBA 4FQ8A 2JD2A 4FFNA 3I5MA 4GLLA 3PFFA 2O2SA 3GNTA 3D3EA 3NJ8A 4DC1A 1MB4A 1NPYA 5G0WA 3KLMX 2QRLA 3PYXA 2CVOA 3DOOA 2B0JA 3I9JA 2DUUA 2W2KB 4WJZA 4DXHA 1YGYA 3PWSA 4GPD1 4BQRA 3W8DA 4WCDA 1NBOA 3M1AA 4M8SA 3E9QA 1SO8A 3WNVA 4CM8A 1X7GA 4FPXA 4B7UA 4CMEA 5GZ1A 1ZK3A 2DTEA 3RU9A 1JAYA 3GT0A 3BTUA 5KKCA 1PQPA 1NFFA 4TVOA 3KEQA 4NFSA 2A94A 2GERA 2B36A 3FNFA 4Z6KA 1E3JA 5CPFA 3V2GA 1PS0A 1F0YA 1LSOA 1RKXA 1VPDA 3RUHA 2QW8A 1ONPA 4MP6A 4YB8A 1PX0A 2WYWA 2B5VA 1BXKA 5ILGA 1ZK4A 5F1PA 1E1NA 4EJ6A 1WZEA 1HZZA 5CG2A 2XPCA 4P4NA 2WEKA 3E6AA 1NQAO 3PWZA 4ONEA 1Y7TA 3WBFA 5I7SA 3SJ7A 2P68A 1WMAA 3D3WA 3JQAD 1B14A 2D59A 3TZKA 1S6YA 4DMMA 2Q4BA 4IGFA 2OOSA 3G1TA 2Y1GA 3GF4A 4CQMB 2Y0CA 3FSRA 3OECA 1E0DA 4Q3CA 4WLUA 5T8KC 4FC6A 3FTNA 2ZCVA 3C7AA 2CD9A 2QQ5A 2C82A 2DBRA 5JFOA 5COBA 1ZCJA 1YKFA 2NTJA 3RUDA 4I9HA 2GF2A 1BMDA 4GMGA 1OZAA 3UF0A 4R1UA 1LRKA 4UUPA 4QX6A 4IDAA 1ENYA 3H5RA 2DTXA 3HE3A 1FDUA 2BHLA 1N2SA 1XCBA 4JJIA 5DZSA 1I33A 5GZ6A 1H6AA 4UVHA 4B7XA 1KEUA 3ZDFA 5KVSA 3WGQA 2E48A 4IDGA 2J8ZA 2NQTA 4B4UA 5F1KA 3ZWVA 1HWYA 1X1EA 3C7DB 2HO5A 4BOYA 1I01A 3DTYA 1LRLA 2DU8A 1F8FA 4YA6A 3NAQA 5BSEA 4YDRA 5HTOA 2BFMA 1N1EA 3PZRA 3C7CB 3JQBC 2QZ9A 2FN7A 3KYCB 1VSVA 1ZIDA 4AJIA 3OJ0A 1WW8A 5EQDA 1LLCA 1AGNA 1KY4A 2WE8A 3KV3O 4PCVA 2O3SA 4OO3A 2HMVA 4ZN6A 4GQAA 2ZCUA 3WJAA 4OSPA 5L51A 5TGDA 5AXAA 1ZSNA 3FPCA 4LRTB 4KUEA 1ZEJA 3AY3A 4GL4A 4PZEA 4XJSA 4Z3KA 4NBRA 3LT4A 4E21A 3IAHA 4PLFA 1SEPA 2DBZA 5L4LA 3ZWMA 5IXYA 1Y8RA 2D2IA 3P5SA 2BI7A 2EJWA 3DHNA 3GNSA 3OIGA 1LSJA 2JL1A 3PLRA 3QWIA 1GQQA 4OOFA 4YAJA 4F6LA 1GUYA 4BO8A 2CDCA 3H2SA 4ND2A 4MVJP 2Q1TA 2ZIZA 3O4RA 2BGKA 1N5DA 3K96A 4XIYA 3NT5A 4BKRA 4YT8A 4RVDA 4ROSA 1PJ4A 3F5SA 2YDXA 3NRCA 3F6YA 3IQDB 1J4AA 4KDFA 1FMCA 1NQ5A 3L77A 2I3GA 1MFZA 4JX8A 5DNAA 5JBIA 4CM6A 1KS9A 1F12A 4GI2A 4XCVA 3TZQA 1H6BA 3O26A 1D1TA 4II3A 3DL2A 2LDXA 1NASA 4PIVA 2I5PO 3FWNA 4YJHB 1F8GA 1YO6A 4DA9A 4HNGA 4NK5A 1KOLA 3DB2A 4RF4A 5KCZA 2IE0A 1BHSA 5IDXA 4E6PA 2UYYA 2ZTMA 4L9RA 2H6EA 4PLCA 1ONNA 4OIMA 2QIOA 1RJWA 4XQEA 2B35A 5T6BA 4C7KA 1E3LA 3PQFA 1P44A 2P9EA 3AUAA 4TMFA 1M75A 1TT7A 2FSSA 4J1SA 3BIOA 4QEDA 3DDNA 3KEOA 4IQ0A 4ND5A 5DF1A 4Z9FA 3GQVA 4BGVA 2PD3A 3AK4A 3WQSB 3ONFA 1GAEO 1R0SA 3JD3A 3QP9A 5J23A 4ID9A 1W73A 1NM5A 1SPXA 1G0NA 1NPDA 3ZHBA 2WE7A 4E2YA 3GG2A 3ZV5A 4WLFA 4FSHA 1I3LA 3ON5A 5BSGA 2OP0A 1ZJYA 2EW2A 4IGEA 2VHZA 1YVEI 4PLVA 1ENOA 4EJ0A 2P91A 2J5RA 3GZNB 5CP8A 3GN1A 4FBGA 3HG7A 1SC6A 1HLDA 4YQZA 1N7HA 2GR9A 3WS7A 3CZRA 4WKGA 5HS6A 1WDLA 3OFSA 1HE4A 2YUTA 4J90A 3C1AA 4IIVA 5DN9A 2AEMA 5GMOA 2QYTA 3R3SA 4M87A 4O0LA 1YE3A 2AHRA 3QVTA 4XQCA 3OJEA 4IQ8A 5A4DA 2PTGA 4DPLA 3BMNB 4IPTA 2Z95A 1GPDG 3B70A 3VDRA 5CFZA 1PJSA 2Y93A 5IZ4A 1Z73A 1FDTA 3K6JA 4FOSA 4CPDA 3ZWXA 4E30A 3IDSA 4BNTA 1M2WA 4FJ2A 1DEHA 2CDAA 2PA3A 2VWQA 4DIFA 2DPGA 4XWYA 2JHFA 2BMAA 3IKVA 1RM3A 3KRTA 5T8KA 4O59O 2Y1CA 5FI3A 1HYGA 1R6DA 3JD2A 4YRAA 1SOWA 2A4KA 4MDHA 3INTA 3QV1A 3GVCA 2ZTLA 3RKUA 2GNAA 4D3DA 4Q3EA 1R12A 1TXGA 1PSDA 4FC7A 4KUGA 1V8BA 2UUOA 1RYEA 4OHUA 5L7TA 3TDKA 1EUDA 4IMPA 3VZQA 4JP2A 3F5QA 3PEFA 3WTCA 1JWAB 3PLNA 3ZI0A 4YT5A 1V3TA 1T2EA 2DUWA 2F00A 3DBHB 3QHAA 3E82A 5ER9A 1EE2A 3SC6A 2OGUA 1Q7CA 4B3JA 4BO3A 2RAFA 4GX1A 1E7RA 4UEKA 1QYXA 4YJGA 3ZGYA 1WZIA 3VZPA 5FI5A 4QQRA 2R00C 5KVQA 3UVEA 2Q1WA 4E5KA 3RROA 4F46A 3T4XA 1UXKA 3RBZA 3JQBA 4MIEA 5I7VA 1C3VA 1I36A 2RBEA 1ZW1A 3FR7A 4BS9A 3GUCA 2CUKA 2HMSA 3JTMA 2X5JO 1MC5A 4RVGA 3WB9A 1YDEA 4BNZA 1M67A 3GEMA 1NVGA 4CLOA 2DBVO 3HFGA 1NXQA 3NYWA 1DRVA 1QG6A 5DBGA 3ADOA 4II2A 2I99A 4MVJA 3E9MA 3GDOA 3UH1A 3OH8A 2GSDA 1FDSA 4ND4A 3D3WB 5EERA 4A7PA 4ZRNA 1HDCA 2H9IA 3FBGA 4QTZA 4MPDA 3TF5A 1KVSA 4F45A 4B7CA 4BGUA 5H83A 3H2ZA 3JV7A 4EBFA 3DZHA 5KOIA 4BO7A 4DWVA 1EZ4A 1WDKA 2C2XA 3GK3A 4XR4A 3TOZA 3FBTA 3FR8A 4XR9A 2EERA 1HETA 1NAHA 4O1MA 2PKRA 2NWQA 2EJVA 3W4IA 2GZ3A 1G1AA 3QVSA 1IPEA 4CLXA 3ZU4A 5L7WA 5K1SA 2W8ZA 1O89A 5BSHA 1ADGA 2A92A 2Q2VA 5A06A 5HRUA 3RUAA 1EFKA 1A9YA 1ADCA 1Y8QA 3GGPA 3ENNA 3JYQA 1LTHR 1DSSG 5C5IA 1K6JA 3HFSA 4AJJA 1AUPA 4OM8A 4CM1A 3OP4A 4S1VA 4UEJA 1JKIA 4XX0A 3ZU2A 2P4HX 4XEHA 1IPFA 5L95A 1MFPA 4INAA 1O6ZA 3V1TC 3DTTA 5IDWA 4PRKA 1ULUA 2I67A 2AEJA 1B7GO 1HE3A 2AQHA 1E3WB 1RM0A 2V6FA 1V0JA 1EQUA 2X22A 4YQYA 1EFLA 4D46A 2VYVA 1UXIA 1VM6A 2Q2WA 3E03A 4IDEA 1UDAA 3AOEC 2DPHA 4OAQA 2BGLA 2VHVA 5F5LA 3C1TA 1PZFA 1Z7EA 1DLJA 2P2SA 1N9GB 3CINA 2X6TA 5TLSA 2PZMA 3ANMA 4IZHA 4UREA 2EXXA 2D0IA 3K92A 2PZKA 3W8EA 1C1DB 5JAMA 4TROA 4MP8A 3BMQB 1KIFA 3WGZA 2V6MA 1W0CA 3QVWA 2ZJ0A 5DCWA 3GGOA 5KJ6A 4ZQHA 3NX4A 2Y1DA 3RC2A 3NGXA 1F14A 3TQHA 3KO8A 4KP7A 1HLPA 1U3UA 1EBUA 4NZ9A 4YT2A 1K0UA 4GGPA 2A35A 5B4TA 1K2WA 1NVTA 4A0SA 2ZYGA 2B37A 3ENKA 1LI4A 4NBWA 2VZ0A 1QV6A 1B3RA 3F1KA 4J91A 2Q50A 5KKAA 1PWXA 2P4QA 2PGDA 4PFJA 2X9GA 4QUKA 2O7SA 2ZB3A 4ND3A 5G0VA 1PQWA 5TJ9A 1IOLA 5ICMA 1HDYA 4N7RA 1HRDA 4DRYA 3AW9A 3LVFO 3ZV4A 2QG4A 5GZ3A 1YJQA 3KHUA 3E5MA 3PZBA 1E6EA 4UVDA 3ZW8A 3V8BA 5IF3A 3LT1A 4IY1A 2HQ1A 4BUCA 2BGMA 3WGOA 1PJ2A 3WXBA 5IG2A 1KEPA 1YS4A 1VJ0A 4CODB 3ROMA 1E1LA 1PZHA 4RCVA 3BHIA 2J3HA 3ETDA 1LX6A 4MIOA 5U9CA 1BG6A 3I6QA 2Q3EA 4O6VA 2JD0A 1DC3A 1VRWA 2ZKLA 2Z1MA 1EDZA 1P0FA 2RHRA 2X4GA 4FJ1A 4W9NA 4L73A 2GGSA 3W8FA 1DLIA 5B12A 2WJPA 3H3FA 2OZPA 4O5OA 3QA9A 2R00A 2NACA 4LISA 1VL6A 1U5CA 3JCZA 4UUOA 3MCVA 2NU6A 2VOEA 5KJFA 3WSVA 2HLPA 2GO1A 3V1UA 2AQ8A 1JQBA 1JWBB 4CUKA 1C0IA 3WGGA 2P5UA 3NDJA 1WXDA 1DJQA 2FR8A 1Z6ZA 1GYPA 2O48X 2Y05A 1T2CA 2R6JA 1IUKA 3D5QA 1LJ8A 4U6QA 1D3AA 3BMOA 3VAZA 3JQ8B 4BO1A 4LN1A 1PL8A 4IDFA 4UUNA 4BO4A 2R2GA 2Q45A 1LU9A 4CLRA 1HL3A 4YT4A 2I66A 3VPFA 4NIMA 1EE9A 2VYND 4ITUA 4NJMB 1P0CA 3ROKA 1DIGA 1UXGA 1YBAA 2AE2A 3ICCA 2DLDA 2HK8A 3A4VA 8LDHA 3PQEA 1H2BA 4G81A 3JSAA 4WCFC 1PS9A 4BB5A 1TVEA 1Q7GA 1JN0A 4R16A 1ZSVA 5FWNA 4D45A 1HDXA 2J3KA 4BHTA 4BNLA 4E2WA 1U2DA 1V3VA 2JKVA 4EJMA 1VKNA 4Y6PA 9LDTA 4ZVVA 2PH3A 1B15A 4BO6A 4BNIA 2VTEA 4TWRA 3KSDO 4L0QA 4DQVA 1WAMA 4AVYA 1QYCA 1T4BA 4CJXA 4P22A 4NFHA 4I9UA 1U9JA 4L4XA 2NU9A 2OFPA 1K3TA 3OJOA 1B8UA 4PZCA 1E5LA 1BW9A 4RGBA 2O3JA 4YJGB 4GGOA 1DDOA 3OSUA 4E2ZA 4NPCA 5AVOA 3Q1LA 4WNCA 6ADHA 1LNQA 1C14A 3UFXA 2Y1OA 3L07A 1ZMTA 3O03A 3QVOA 5B37A 4BNKA 3ZWYA 1E5QA 1PGJA 3GA0A 3PK0A 4CR7A 2VQ3A 4IXTA 1KVQA 4QO7A 3GZ4A 2GPTA 1CQIA 1GU7A 4Q9NA 1KETA 3E8XA 3AOEA 4AG3A 3MOIA 3UCXA 1A5ZA 2C2YA 3WJ7A 5BNTA 4IMRA 4BKOA 4RVFA 5A02A 2PD6A 4J4BA 2Y1FA 1QYVA 2CF6A 3BA1A 4KOAA 4PVCA 4DBVO 4XQ9A 3DBLA 3TWOA 4R3WA 1R4NB 3ZW9A 3LQFA 4D43A 4DPMA 3DZJA 4R4JA 3OIDA 4LSMA 1IZ9A 3KSZO 3GAZA 2BFOA 5C3MA 3I9LA 2X5KO 3NT4A 1GR0A 3CUKA 3SJUA 2PH5A 4DLBA 3MTJA 4CV0A 5T57A 3OBBA 2Y0EA 1T25A 3P2YA 4DL9A 1U8FO 4MVJE 2VNAA 4I5EA 3WDSA 5IZCC 1I3KA 5G4KA 1ZO8A 3U4CA 5AXDA 4JBGA 3VH4A 2GN6A 4M54A 3AM4A 5JXWA 1HDZA 1ZNQO 4JQCA 3RJ5A 5ADHA 4AJOA 4FIZA 4ILKA 5L9AA 4E3ZA 3O8QA 4RDIA 1A9ZA 1AHIA 1H93A 1P1IA 1XG5A 3KTDA 2GASA 3Q2IA 3HNPA 3M1LA 4H7PA 1YQXA 3GGGA 3H6KA 1Q7BA 5A9SB 1LQUA 4BGEA 2YW9A 4FFOA 2VT2A 2B69A 3PDJA 3C8MA 1B3BA 3ZZNA 4A73A 8ADHA 1EEHA 1YXMA 3DAFA 1ZZEA 1U1IA 1XGKA 2VWGA 2X23A 3H7AA 2J5QA 4CLHA 1G0OA 2E49A 2D4AA 4CM4B 4WLNA 1SCUA 3WMXA 3RC9A 3QVXA 3G49A 4RV9A 3DMTA 3QQPA 5JCJA 3U0BA 3PXXA 1G6KA 3WLFA 1YQGA 3U5TA 3LC1O 4DQUA 4XGIA 2ZK7A 2O23A 4E12A 1AN9A 2OP1A 3FPLA 3WQRA 1X14A 5K6AC 5L4SA 5I9NA 1P1KA 2YQ5A 5KVVA 3QLJA 4LCEA 1KYQA 3U4HA 3WR5A 4B8ZA 1QMGA 3O38A 3OEWA 3GOHA 4DGSA 3EYWA 3BXXA 3RI3A 5AQ1A 3I4CA 3I6IA 4CMGA 1ENZA 2QYSA 5A1TA 1LBEA 4J7XA 5B4UA 3U4IA 3I1JA 5CEJA 4N5NA 4CM3A 3VH3A 4YACA 3OA0A 4ALNA 2NADA 1IYZA 3HDJA 4ZRMA 3DZGA 4AFNA 4BMVA 4TVBA 4PG4A 3AI2A 4Q3NA 5HS4A 5H81A 1QP8A 2GN9A 4WCFA 3DMYA 3OJFA 1IY8A 2ZJ1A 4M55A 3G3EA 5EIOA 1OC2A 1UAYA 3GPIA 5CDSA 2FZWA 2DT5A 3DBRA 1IE3A 1CERA 4QFCA 4AICA 3U3XA 3KVOA 3GH3A 5JE8A 1J6UA 3ZU3A 4FOOA 1C1XA 3ZU5A 4ZICA 4MVJF 2OMEA 4K28A 2FP4A 4CM9A 4J1QA 3NTRA 1U28A 2DC1A 4WLOA 3SBOA 1D4FA 1DIBA 1XELA 1GL3A 5EJ2A 3FHLA 3WYCA 3H9QA 4YAKA 3DAGA 4P4GA 4NBTA 5IFLA 3KOUA 4RL6A 1H2HA 2EV9A 3EK2A 1XR3A 4NU6A 1YQDA 5TRTA 3ZH2A 2X0RA 1HSOA 1GQYA 4L75A 4BMNA 4RVSA 4JJGA 4ZQBA 4Q3AA 4CMBA 1LRJA 4YAGA 1LA2A 5EESA 3MZ0A 5LC1A 1EBFA 2HMTA 2YHIB 3BMOB 4I5DA 1Q1NA 2EKPA 4RPLA 3GHHA 1CEQA 1VL8A 4MOWA 2IYPA 1QXSA 1ZXBA 3I52A 1A7KA 4R5HA 2B4RO 4YXFA 2DBQA 5DCYA 4CLRB 1H6CA 3PYLA 5MGBA 4I5FA 3Q2KA 4E5MA 3PYMA 1HXHA 3S2IA 5CAEA 1PS8A 4EZBA 1A27A 3NTOA 4UVGA 5I8ZA 4HFRA 4BNJA 4R41A 2Q49A 5JC8A 3OIFA 3AI3A 5KNLA 1ZBQA 5L53A 1JW9B 2BRUA 3D64A 1KVTA 1NTOA 3OQ6A 3EVNA 4I9NA 4TQGA 1YB4A 2CNBA 3BHJA 4M1QA 4PLYA 5IZCA 2WM3A 1JVBA 1U3VA 2Y0DA 3EGOA 3G79A 4J43A 4QO8A 3Q3CA 3JQAA 1GADO 1CWUA 2G5CA 4CM7A 1GZ3A 3BTSA 1K6IA 3ZCXA 1UXHA 2PZJA 4YTEA 3PVZA 1R4MA 4W82A 1GUZA 4YR9A 4RORA 3N7UA 4QECA 3SLGA 4YYZA 2FPGA 1PGQA 3BZUA 3D4OA 4TZKA 4D41A 3L4SO 1DC4A 4LCJA 4OKNA 2PD4A 4KDEA 4XYLA 1VLLA 1WNTA 1LC3A 3V2HA 3I3OA 4GWGA 1ISFA 1EK6A 3NDIA 3PDUA 4NBVA 3D4PA 2V6BA 3F1LA 2GCGA 1PZGA 4B4OA 2FPIA 3JQ7B 1OFGA 4R1TA 3ST7A 4U0JA 4W7HA 2WSBA 2EP5A 2D8AA 2NVUB 5BQFA 1M66A 1QORA 5TQVA 1A4IA 3ZWBA 3IUSA 3MJEA 2E4AA 1TT5A 1UUFA 5DOZA 4GVLA 2IRWA 1U3TA 4YEDA 4GAEA 2RHCA 5JAIA 2V65A 1EVIA 5HA5A 5K6AA 3GVHA 3IJRA 2POQX 5ES3A 2AMFA 1PL7A 2X58A 3M2PA 3RKRA 2OORA 1PL6A 3MTGA 3A9WA 4B3IA 4B8WA 3H9UA 3JYOA 4XRGA 3E18A 3H4VA 1IZ0A 2WMDA 3WBBA 4E0BA 2NTVA 4E4YA 5KJ1A 3GR6A 3CE6A 4Q39A 3UCFA 2EKLA 2ZB8A 3K2EA 3QIVA 4Y98A 1N92A 4KQXA 2JCVA 4OXYA 2FR1A 3ZV3A 2EG9A 3ITDA 5ENDA 1Y6JA 3M6IA 4M49A 5IN5A 2ZQZA 5MDHA 1T26A 3CSDA 2CVQA 3K30A 4EEZA 3VTZA 1A7AA 4J49A 4HV4A 2Q1UA 1ADFA 4GMFA 4BNWA 3M2TA 5I9MA 1Y5RA 1XLTA 2TMDA 1EMDA 4WNIA 5EQFA 1XKQA 1K89A 3E1KA 4N5MA 2CVZA 3OA2A 1IHYA 5EN4A 4FR5A 3F46A 3EZLA 1PZEA 1GYRA 3IUPA 4CL3A 2ZB7A 1PTJA 5EPOA 5FFFA 3FNHA 1A4UA 4P4LA 2X0IA 3P19A 3NKLA 1I3NA 3T7CA 1IHXA 4CM8B 4N54A 4LGVA 5IN4A 4W9NC 3W4KA 3HUDA 2YFQA 4ALLA 3QE3A 4J6FA 4U8GA 2GUGA 3F3SA 1N8KA 2X9NA 5COAA 3OM9A 2EF1A 1H9AA 1HDGO 2G82A 1Z75A 3HB5X 4CMIA 1LSUA 2V6GA 1HT0A 4WEQA 2TMGA 5FF9A 5C7LO 4DUPA 2O50A 3L6EA 4BL5A 3DHEA 3P2OA 3BMCA 4EEXA 3LYLA 3JQFC 3IIEA 1UR5A 1ZK1A 1O0SA 2RH4A 3TSCA 2Y68A 4Y8VA 4N18A 4YJFA 1SAYA 3K9QO 3ONDA 1FXSA 3IC5A 4UAGA 2C07A 1YRLA 4BNMA 5KWEA 1ISMA 4PG8A 2ZTVA 2PGLA 3WFIA 3LT0A 3MJVA 1P1RA 3G0OA 4E32A 3FF4A 2BD0A 1CJCA 2I65A 4IQGA 5L4NA 2HAEA 3JQDA 4MKZA 1E6UA 1LDNA 3UCEA 3ZHYA 4L76A 4CQMD 5B1YA 1QLHA 4JIGA 3ANNA 2X7HA 3B20A 2WYVA 3GN2A 3OHSX 4PGFA 3A14A 3UGKA 4WCFB 3WOHA 1KBZA 2BLLA 2DFDA 3JYNA 3RFTA 1W6UA 1E7SA 2GD1O 4PRLA 5C7IO 4BVAA 2J3IA 4R1SA 3VC7A 4L4SA 1FDVA 4NQZA 3FRJA 5ER6A 1P33A 1TA4A 1NPTO 3DBRB 4XZ3A 3VZRA 1TB4A 3B1JA 1TI7A 3VHRA 2IXBA 3RFXA 2OO5A 4J16A 3VOSA 1C1XB 3PI7A 1Z74A 5L3ZA 5KVCA 5G0SA 4RDHA 2W4QA 5DT9A 1PJ3A 5JY6A 3VKUA 4PG5A 3TL3A 1F06A 5IAAA 3ZWOA 2EP7A 3HB4X 2E6UX 3DFUA 4FJ0A 3VPXA 4LMRA 4JP3A 2RCYA 2WWRA 5F1OA 1U7HA 4IJVA 3DZKA 3TZ6A 4TRRA 3DOCA 1KERA 4BNYA 1EVYA 1HDOA 2DAPA 1M6WA 1CETA 3FI9A 2O3TA 3MJSA 5KIAA 4J9UE 1R37A 1IB6A 1I32A 3PQDA 5LCXA 2HSDA 2ZQYA 4DYDA 5ICSA 2PZLA 2P9GA 5JDIC 1DAPA 2ZB4A 1DXYA 3G17A 4DBZA 1Y8RB 1XWFA 1T1SA 4EW6A 1YBVA 1LXCA 1PR9A 3I9KA 4MVJH 3UHAA 4U6SA 1HKUA 4IS3A 1HE2A 4NJOA 1D1SA 5B4VA 3ROQA 5I9LA 4ESOA 3RIHA 2D5AA 1I2ZA 2O4UX 1UZNA 5A9TA 3HDQA 4J0EA 3ULKA 3WWZA 3DZFA 1GY8A 1RPNA 5JDCA 5EL0A 1VJ1A 2VRCD 1BRMA 1H6DA 4EUEA 1V35A 1HF3A 3WLEA 1EUZA 4Z0PA 3NDRA 1YJ8A 1ID1A 2NSDA 1ZUD1 4RVHA 4DC0A 3B6ZA 3IOYA 5C37A 4I1IA 2W90A 4D0RA 1BSVA 4J1NA 4NNJA 1LC0A 2AG5A 4BO5A 4OH1A 3VDQA 3EDMA 1E1KA 3RQSA 1DIHA 2AA3A 3PFWO 1KY5A 2I76A 3GVIA 3H3JA 4DYVA 1Q0LA 4FGSA 5TJHA 1YH3A 5A03A 4J2HA 3WICA 2HMWA 1V6AA 3DEYX 5EINA 1UP4A 4J1TA 1T24A 2E37A 3SX2A 3GY0A 3RC7A 3KXDA 4HNHA 1ML3A 2CY0A 2H1SA 5TF4A 1P1FA 3B1FA 4DQXA 4M89A 3SEFA 3ZNOA 4TSKA 3S2FA 3PJGA 2W2LD 3C24A 1LDGA 3WFJA 4G5HA 2YJZA 4YJDA 3RC1A 3DMTC 1LQTA 1WVGA 3C3XA 3JYPA 5CDUA 1B8VA 3LF2A 4BNXA 1GYQA 3H9JA 4MINA 5GY7A 3FD8A 2WD7A 1P3DA 1QSGA 1E7MA 2GLXA 5ITVA 4XRRA 2X9VA 3EMKA 4NU5A 1BGVA 3JD4A 3JQFA 1Q0HA 4IDBA 1T2AA 5A05A 1C0PA 4GLOA 4RZHA 4D3FA 4CLEA 3WMWA 1U5AA 1NYTA 5JLAA 3V5NA 3ORFA 1PIWA 2H63A 1B26A 2C5EA 1K6XA 1T2DA 3JQ6A 4FFRA 5C7OO 3JD1A 3RCBA 2QRJA 3L6OO 3WGYA 4UVEA 4BMSA 3UAGA 1GQ2A 4R3NA 3D4NA 4ZJUA 1AE1A 4FS3A 1GCUA 3RSHA 5CPBA 4XD2A 3PJDA 3ZWCA 4DLAA 2HU2A 4FB5A 1CRWG 3SXPA 3VPSA 4NDNE 3GMDA 1SEVA 1P74A 4O63O 1UDCA 3CEAA 2GDZA 3WQQA 5KJEA 1DFIA 2YV1A 2HDHA 3JQGA 1JU9A 2ILTA 3CXRA 3GEDA 4P38A 4Z9YA 5IDQA 4IBOA 1GFSA 5JMPA 3W4JA 1LLUA 1I8TA 3OQ1A 1LSSA 4QFDA 2C7GA 4NFYA 1BVRA 2UV8A 1P77A 4MVJG 2YY7A 4XGKA 1N7GA 2C54A 1CF2O 4RQTA 5FYDA 5A5FA 3MEQA 1UXJA 4KZPA 4BNVA 4A10A 4NH4A 4OSOA 4OMUA 2Y99A 5BSFA 4R01A 1ENPA 1JVSA 4TKLA 4WASA 3KYDA 1QKIA 3VPGA 2IEDA 3OQBA 4WLEA 5CDTA 1W8DA 1MV8A 3H5NA 4AJPA 3TFOA 2WDZA 1Y5MA 1MUUA 2B4TO 4CMIB 4LW8A 3UOGA 3WGIA 2EIHA 1O94A 3GVPA 4K6CA 3N58A 4GKVA 4OJNA 5TS3A 2Q2QA 1ZKMA 1PJCA 2PKQO 1SB9A 3BMCB 2JFFA 3KYBA 3H9GA 4MJLA 5DP2A 3QRWA 4OOEA 1XIVA 4GX0A 1ZEMA 4CLOB 1NP3A 2HRZA 4RPHA 1U7TA 5T64A 3Q9NA 4CR6A 2FOIA 1YL7A 5JDIA 4Q3DA 3GVXA 1I24A 3AUTA 4NBUA 4R9SA 3ADPA 3I9NA 4XYBA 3QY9A 4CUZA 4IM7A 3SVTA 5CEFA 1ZSYA 1R0KA 3VH1A 5JW6A 4QXMA 1O9BA 1H5QA 2VOJA 1HZJA 3C1OA 4WGGA 1A72A 3WYBA 2OBNA 5K9ZA 3HZZA 4CMCA 1M76A 3AUUA 1P1HA 2C59A 2GRAA 1LDYA 2IYOA 2YDYA 3EUWA 3JD0A 2PV7A 2OUIA 3AM3A 4R68A 4BGIA 3F4BA 3C85A 1MX3A 5IDYA 1GTMA 3HQ4O 2DQ4A 4C4OA 5JPIA 3PJEA 1U4SA 1Y8QB 1RWBA 2DKNA 5H82A 4XYMA 4KTVE 4XQGA 3GUYA 4P8RA 2JCXA 3RBXA 3G1UA 3AFMA 4UEOA 3GNQA 5G0TA 2GZ1A 4UULA 3UW3A 4RJTA 1DAOA 3LF1A 4TKMA 3RUIA 3PHHA 4JGBA 1QV7A 2VUTA 4FD3A 4IDDA 1Y9EA 5ILOA 4IDCA 2HCTA 3BMNA 1H94A 4F6CA 1ISHA 2VYNA 1O5IA 4BO0A 1HDRA 3E48A 1CIVA 1ZMOA 3INGA 3RAJA 4CQLA 2IXAA 3O9ZA 2XAAA 2BI8A 2EWMA 4DTIA 3KB6A 4OQYA 2QZZA 4DVJA 1MXFA 1LUAA 5COQA 3PHJA 3R0IA 4CR8A 1BDBA 4RF5A 4BQPA 2HKIA 4XIJA 1B16A 2YYYA 3D7LA 4FGWA 4PLZA 2DM6A 3NUGA 4HY3A 3NGLA 4XJTA 4TRJA 4YVFA 1EK5A 3LT2A 4WLVA 3FTPA 2AQIA 3PIDA 1PQUA 1UP7A 2UUPA 2YFHA 4XB1A 3DBHA 5F21A 3WIEA 3ZWPA 1YOVA 1D7OA 2NTNA 4B4WA 1E3SA 2C29D 1I2CA 4Z0HO 3RBVA 1C0LA 2OL4A 2PKQP 4KWHA 1UJMA 3L9WA 3OJLA 3QWFA 3UN1A 5TC4A 4OGWA 3K8ZA 1EUCA 1N1GA 1Y9AA 4RZIA 3U49A 1X0XA 4JN6B 3RASA 5F5NA 2IZ0A 3LK7A 2BF7A 2F1KA 4OKIA 3HADA 3TOXA 4AJEA 4CMHA 1GPJA 3AI1A 3WSWA 4PN3A 1WLYA 1DFHA 3I9MA 4RVUA 2IZZA 5A3JA 2FPPA 5TX7A 3UXYA 1FK8A 2XOXA 3ICPA 4GH5A 1X7HA 4HFJA 3QW2A 4IZIA 4JLWA 3T4EA 4MVJM 1MG0A 1ZK0A 3IKTA 3PHIA 4EI2A 4FN4A 5I8WA 3R3JA 1T2FA 5DBIA 1Z82A 4PLTA 1WWKA 3HHPA 2JHGA 2VUUA 1I10A 2XF8A 5HWSA 1J5PA 3IL2A 2P9CA 2X86A 4NR0A 2VHYA 5JCXA 3ETEA 5DBFA 1VE9A 1YWGO 4JXKA 1C0KA 3U4DA 4MVJI 3FCOA 2CDBA 3S8MA 1NFRA 3V1YA 5JY1A 5JAQA 5AOVA 3ZNPA 2WD7B 1KEWA 2GN4A 1SBYA 4MO2A 3LSYA 3KBOA 1YDWA 1DHTA 3FNEA 4D0SA 2VCYA 1NWCA 2O3QA 4HUJA 4MKRA 4LRSB 3TL2A 3ZHZA 1X7DA 1ONOA 1DC6A 1UP6A 1OOEA 3PHLA 3LZ6A 3UICA 3D0OA 5EMHA 5IJZA 5JYDA 3EW7A 1PWZA 4XGNA 3X2EA 1E3WA 2GZ2A 7ADHA 2C7VA 2J3JA 2BFPA 2WD8A 2PY6A 5DCUA 4QSMA 2HUNA 1YL5A 4WPGA 1U4OA 4DIOA 1Q0QA 2C5AA 2JAPA 5CG1A 3KM0A 2H5LA 1JKJA 1QYWA 4YRDA 2I6TA 4YRBA 1N9GA 3ASUA 1VKOA 3I9OA 3L9XA 2YQ4A 2Q1SA 2IODA 1L7EA 3AOGA 3D5TA 3DXFA 3JQGB 4ZQFA 4CMJA 1T4DA 3AU8A 1E92A 1NQOA 4DLLA 1BVUA 2VHWA 4CLDA 1C1DA 1E7WA 1BXZA 3U62A 2CF5A 3X2FA 1GZ4A 2GN8A 4B3HA 1L1FA 1B8PA 4BNFA 3BMQA 3ANLA 1UH5A 1SMKA 4GX2A 3QWBA 1CYDA 4YCAA 3LU1A 2ZATA 3PIIA 2CZCA 4AJKA 2JFHA 2VTDA 1J0XO 2G1UA 3H9EO 1NNUA 2C0CA 4R69A 3Q11A 3WX0A 1OMOA 1NR7A 1FDWA 1XSEA 3DAPA 3EHEA 4U5QA 4XB2A 1WP4A 2VN8A 1AXEA 4NI5A 1PJQA 1BW9B 5U4QA 3KYDB 2PLAA 3OEYA 4URFA 3WGHA 2O2YA 5CDGA 2AW5A 4KWIA 1WPQA 4WK6A 3CPSA 1E1MA 2FMUA 3MJTA 2HJRA 5BR7A 2X0NA 3GFGA 1DBVO 4D7AA 1NHGA 1NR1A 4IUYA 4D44A 4J0FA 4A03A 4CMAA 3K5PA 3TNLA 4AJ1A 1SB8A 1UZMA 4H15A 5THKA 4A2CA 2J5KA 3ZV6A 3TZHA 2AG8A 3CTMA 2RIRA 3L0DA 4JNKA 5TT0A 4RPKA 3RU7A 4BKQA 5JNLA 4A5OA 4BB6A 3A06A 1HTBA 3DBLB 3GDFA 3KZVA 1DFGA 1NX6A 4MVJD 3WG9A 4RF2A 3BAZA 4W7IA 1LDBA 4GSLA 2FR0A 3AJRA 4BV8A 4HBGA 1DPGA 4ALJA 2YZ7A 4AL4A 3DZBA 4WECA 3DFZA 4RQUA 5JDCC 4IXWA 3GMSA 4JBIA 2AEFA 2IDZA 3RVDA 2YHUA 2B4QA 2FZEA 5CDYA 4Z0TA 3IS3A 2AQKA 1HSZA 5JSFA 3F4LA 4K1LA 1MXHA 3SLKA 4YAEA 2ZTUA 1HEUA 2UAGA 3LLSA 5AYVA 3TFQA 5I7EA 4FFMA 3JQ9C 1P45A 1KEVA 4R1NA 5JO9A 3S1LA 4R9RA 1X13A 4PZDA 1OBFO 3WGTA 4CV3A 4J7UA 3RUCA 1O95A 5G4KB 3AU9A 1QYDA 2XXJA 2P5YA 4LK3A 4AJHA 5LDHA 4BNUA 3PHGA 2FHSA 3ZHXA 1WDMA 3OMLA 4ALMA 1OAAA 3RD5A 1FF9A 4GWKA 4HFNA 3O8QB 5KTKA 1JTVA 4Z9XA 5ITWA 3V2UA 3JQ8A 4F3YA 1LLQA 3QJ5A 2D1YA 3H65A 4GSKA 3HSKA 4IJWA 3ZNNA 2NV6A 2QX7A 5G0UA 1YBMA 1ZH8A 1Z7BA 5DOVA 3CZMA 1MLDA 2B5WA 3VH2A 1I30A 3UUWA 4CQLB 4NJMA 5L7YA 3SC4A 3EVTA 4OQZA 3GHYA 3Q6IA 4N5LA 4PVDA 2VYVD 2Z1NA 1PJBA 1I5RA 3ZNQA 5BT9A 2BFAA 2FSVA 1E3IA 3KETA 7MDHA 4G2NA 4J3FA 3HN7A 1M6HA 1NWHA 4ZU3A 5HM8A 1Y81A 1NQTA 3DOJA 4I5GA 4NMHA 1IULA 1J49A 4PLHA 4ALKA 4RLHA 3GDGA 3GPDG 1I2BA 4A27A 1O8CA 2Y1EA 5THQA 2J6IA 3BTVA 3TRIA 4B79A 1CQJA 3RJ9A 2SCUA 3CKYA 3Q0EA 1YOVB 1VC2A 3RFVA 2FRDA 3ETGA 1U8XX 2YV2A 4YWJA 4MIYA 1L7DA 1DIRA 4PG6A 1SZJG 1LDMA 3CMCO 1E77A 3IP1A 4I08A 4H3VA 4IIUA 3KLPX 4E5YA 1OI7A 2Y67A 5TNXA 3PP8A 4DIBA 1PU2A 3K2BA 4ND1A 2ZYDA 3TPCA 3DZIA 1XYGA 1XHLA 2O4CA 2PK3A 1RM4A 3ROPA 4JBHA 5JO0A 1ISJA 2VWPA 1PGNA 2XXBA 4OYRA 1LLDA 1BXGA 2NQ8A 4ZQEA 1HYHA 3EAGA 4L8VA 2NU8A 1QR6A 2EEZA 4DREA 1X0VA 2VRBA 3KUXA 4XYEA 3PGJA 4HX5A 4S3MA 3VKVA 3FN4A 1R4NA 3NTQA 4ZQGA 1H0KA 2CFCA 5T67A 1SNYA 1EVZA 1XU9A 4MKXA 1MC4A 2UVDA 3TN7A 1ISIA 3ABIA 1I0ZA 3GAFA 4Z3DA 1PGPA 3TZCA 2D5CA 1JKFA 2PGJA 4B4VA 2BH9A 3LLVA 3MOGA 1S7CA 1DB3A 4FDAA 1ZJZA 1YB5A 3AWDA 4TRMA 3ZWNA 2LDBA 3RUEA 4BNHA 4CUJA 2NUAA 2VT3A 1ARZA 4GBJA 4W99A 2Q46A 4FCCA 2ET6A 4BIIA 2QRKA 1Q2XA 3R1IA 4LVCA 4CM5A 4Y6RA 3MJCA 3HDHA 2JAHA 4LSWA 2GYYA 4E33A 3L4BC 4AJ2A 1XA0A 1GZ6A 4D3SA 4BO9A 1W4ZA 2EHDA 2HMUA 5LDGA 2VZ8A 1V9LA 4E13A 3FNGA 5KJCA 4W4TA 3ZN2A 4E2XA 4PG7A 4Q3BA 4RPJA 5TT1A 6LDHA 1BWSA 1GDHA 4HWKA 5A3VA 4TZTA 2JFGA 3GG9A 3COSA 4JROA 1OC4A 4Y67A 5A9SA 3ZWWA 1RM5A 4PLWA 1E6WA 4W6ZA 4J4HA 4NHEA 2W2KA 1EVJA 1BTOA 4Y6SA 2X8LA 4CL8A 3OF2A 1Z45A 3MJ4A 1PEDA 1HE5A 1KC3A 3U09A 2HJSA 4K9DA 2Y66A 1XEAA 3K73O 1R0LA 3W1VA 5HBRA 4CM4A 4D79A 4ZHSA 1HYEA 3MWDB 1ZK2A 3F9IA 4MP3A 1PR3A 1B2LA 1DRUA 1DJNA 3IMFA 2OHXA 2NVWA 2NNLD 3STHA 1TEHA 3LDHA 3RWBA 4R51A 3RUFA 4YPOA 3EZYA 1AHHA 2IZ1A 1R15A 3JQ9A 2VHXA 2X0JA 3DQPA 4XDZA 3S2GA 3DBVO 3N74A 4A26A 4JCOA 3DR3A 5JS6A 1JDJA 3INRA 1ORRA 3HDYA 3EY4A 3PGXA 1KVUA 4ZA2A 2PNFA 1B0AA 3OETA 3JQAB 1EDOA 2X1HA 1P1JA 3VVCA 3E5RA 4EUHA 4PLGA 1NVMB 3H8VA 1JLLA 5T5QA 2I9PA 1KC1A 4J4TA 3Q9UA 4EDFA 4RO0A 1R4MB 3BTOA 4XYGA 4JK3A 3IJPA 4OXKA 1MG5A 4L4RA 1DOHA 3U9LA 4U7WA 3WWYA 3AM5A 4M86A 4CQMA 1UZLA 3HJAA 5G4LA 3PRJA 2HK7A 2VWHA 4EUFA 2QHXA 4BV9A 4HXYA 4NG5A 4BNGA 4UVIA 4IJUA 2HRBA 1GEEA 4C7JA 4X54A 3HN2A 3AFNA 3PPIA 1GV1A 4GX5A 4LVUA 2I3AA 3WIDA 4EYEA 2G76A 2OXIA 1VL0A 2VUSA 2VZ9A 3S55A 3VTFA 5A04A 4JJFA 1UDBA 3WTBA 3K31A 4HFMA 4Y9DA 4HP8A 1H9BA 3AY6A 5L40A 1TT5B 2HK9A 3A1NA 4IS2A 4RF3A 2OBYA 1BDMA 2E82A 2EGHA 3QSGA 4CMEC 4BO2A 2NVBA 5ENVA 3P7MA 5G2OA 2DTDA 2BKAA 2O7QA 1TLTA 5U1PA 4J2OA 4H16A 1WMBA 2JD1A 4OL9A 4EITA 1E3EA 3D1LA 3H5AA 4HADA 1DC5A 1FJHA 3E9NA 3KYCA 1XDWA 4QT0A 5CEEA 3JQEA 4E31A 2CSUA 3NV9A 4OXNA 1GD1O 1ISGA 4K26A 1E7YA 5AXBA 3LC7O 4WOJA 3AY7A 3NT2A 4PLPA 1PGOA 3DO5A 3I23A 3FWZA 4XKJA 5F3RA 4WUVA 1NHWA 1YL6A 3ONEA 2W98A 1XQ6A 5FEUA 4K6FA 1LDEA 2PFGA 1DHRA 3PJFA 3HWRA 2YHIA 1QRRA 1PJTA 3VVBA 4NK4A 5L45A 4IJKA 2CMDA 4TRNA 1GCOA 1SOVA 2IEBA 4CMKA 4E5PA 2EGGA 1K5HA 1XU7A 1X1TA 1UAGA 5TSDA 1F17A 2FY8A 4IINA 3NEPX 1NAIA 3CIFA 3EC7A 1EQ2A 4UUMA 4D42A 2VRCA 3T7EA 1GUFA 2DFVA 2PWZA 1KVRA 3QWHA 1ZXLA 2ZYAA 5CHEA 2O3UA 3GFBA 3VZSA 4AJLA
chains in the Genus database with same CATH superfamily
1JLMA 4KMRA 4KFCA 3MJHA 4R54A 1JNXX 1RLOA 5IXSA 4UAUA 4Y30A 2H1CA 2Z5FA 4NPAA 3RGGA 3DHYA 4LXTA 1ISRA 1YK1A 2PIDA 2BGTA 5FO0A 5HE9A 2E5LB 2JJ1A 2EG5A 4RTPA 1ITZA 1I3OA 3EAQA 1UBGA 3NJ4A 1VI2A 1I0IA 3S2EA 1R66A 3LBIA 4KUHA 5H02A 1XRQA 1JXOA 3NBAA 5HKOA 1AQNA 1PK9A 1I7PA 2V0GA 4ESHA 3NUQA 4YJHA 2XMGA 1IWBB 1PT7A 3W6PA 4N9WA 4CEJB 2W6OA 5GVRA 5ALXA 3ESYA 5ADVA 1NFQA 5B7QA 2O3RA 3RRMA 1E99A 1IXYA 1CZUA 3UXHA 3MW8A 4G65A 1CY7A 4DUGD 3WNQA 3S28A 3A1UA 2P9HA 2QPLA 4FZ3A 1BKDR 4I6EA 2NM0A 5DP1A 4A1OA 2IOQA 1XF1A 2WF6A 2WTBA 4KRXA 4LHXA 2R6AA 4KQWA 2XVMA 2CV0A 2JGJA 2A78A 1FU4A 2XQVA 1APBA 3CVWA 2V55B 4PAQA 4AAYA 4GVXA 2W2LA 4IICA 3GV0A 4BKPA 1EFRA 3O1HB 4ZTUB 1I51A 3HKCA 1POWA 2ALJA 4YRLA 4C7BA 2E87A 2ROQA 4K3UA 4YUZA 1R0CA 2QKYA 3ZK7A 1A4XA 1FOEB 1N2IA 1WULS 1IMOA 3B1KA 4L15A 3PNPA 4IZ6A 4DY4A 1YONA 1Y3HA 4LOLA 2AE1A 2IY7A 1QH8A 2UZ0A 1R5OA 1A7UA 2PRYA 3RGWS 2HGZA 3HP7A 1NIJA 4IVQA 3TX2A 4AJNA 1EM6A 2D2XA 4E88A 1OZGA 4ZWNA 4ZVTA 1F0PA 4I8XA 3GZNA 1IM2A 1CVLA 4F92B 4UPDA 5IAOA 1ORTA 4NEGA 1P31A 3UG7A 2IH4A 1ZFNA 4PPGA 4ZD6A 1BU8A 3FJYA 1PR1A 4HKTA 2XMDA 1X15A 2AXEA 3I1IA 2C04A 3HR8A 4JOCA 5BNFA 1XQ1A 1PQ4A 4RPGA 5DDIP 1H2FA 2EJUA 1QIHA 4M1ZA 4FM9A 3KSUA 2VDNB 1G1MA 1Y4UA 3HEAA 3IEKA 5EOVA 2O8CB 4M21A 4RHFA 9LDBA 1LW6E 3H1AA 4OREX 2COEA 1RADA 2HYDA 1V1RA 1S2OA 4TKVB 2P78A 4XDYA 1W4RA 2PJUA 3SZOA 1SBZA 1L4YA 4YRGA 2F3UA 2HF8A 3SNKA 5F35A 2C1ZA 2VF5X 1FFGA 2VP6A 2X40A 1CLUA 4A92A 1P9LA 3N2EA 2ASEA 4Y2JA 1BN7A 2Q99A 2FCAA 2SECE 2ZQ5A 3D7SA 3TW6A 2J7KA 2XCTB 1SZCA 1AXGA 2QLLA 1SXHA 1TF2A 4CG2A 4BATA 1TPYA 3IUYA 3V7WA 1GDDA 4GLLA 4RVOA 5AK6A 3EG9B 2V1XA 2C5HA 1Z22A 3ZYCA 2V7WA 3D3EA 1XUOA 3L6BA 1CR0A 1MB4A 4LHEA 4YRKA 2E1RA 2ZCJA 1XZMA 5G0WA 1A9XA 1PG0A 2PUWA 2QTNA 2CVOA 3MLAA 4U2GA 2B0JA 3QXSA 4I1SA 3T9BA 5E0OA 4B5KA 1AB6A 1W36D 4EG6A 5A62A 1ETUA 1EHIA 1NBOA 1SR8A 1TW3A 1HTWA 1JX6A 1TZMA 1RMQA 3EQ6A 3EGWA 4PX5A 5FUYA 4F93B 2H1OA 1EIZA 4JBNA 3KXKA 4B7UA 4CMEA 1MEEA 3G82C 1KHTA 3FSEA 5DHAA 1Z3CA 2A7XA 1UMCB 1VJDA 3DW1X 2F3RA 2HDOA 3G23A 4ZO6A 3BFPA 1P0PA 3KEQA 2FZGA 2J67A 3C0KA 4KGXA 4NFSA 4Q4HB 4BMOB 5C8DA 2B36A 3KZCA 1XAGA 3PR2B 2QNIA 1E3JA 1BU5A 1C29B 2GM5A 1FL9A 3AESA 1PS0A 1LSOA 1JKXA 4RXMA 3VI4B 4LNAA 4MP6A 1NG9A 4YB8A 1RHKA 2GZHA 2XNJA 3AY0A 5CVDA 2G09A 3V42A 1U2EA 4N7BA 1S2NA 1K7EB 4OHVA 2V7UA 4EJ6A 1WXIA 1Z26A 4YREA 5JADA 4K05A 3UOAB 3KL4A 5CG2A 5BORA 4RK6A 4C05A 1SOMA 3R9XA 2VXOA 2E4UA 1UBOS 3CJRA 2PGXA 3CZCA 1T8UA 1E79D 1K8RA 2DX7A 5I7SA 3SJ7A 1T5LA 2C2BA 1NV9A 2CCJA 1GPAA 3JQAD 3SXJA 3MGBA 3OG9A 4NKRA 1B14A 3TZKA 1SU6A 1ZHHA 1JAIA 2NT3A 4KXXA 4AURA 4DMMA 1NIPA 2DHDA 5GV8A 4IGFA 4UZFA 3TIXB 2Y1GA 3RYFA 3CH4B 4DQ0A 5HIAA 3TG2A 1A97A 2H00A 2Y0CA 3OECA 3PPWA 2OAP1 4K03A 4BBPA 4NARA 4FC6A 4PX9A 2ZCVA 3C7AA 4G8JA 5AM3A 3PHBE 2DBRA 5K3BA 1BD4A 2MIIA 1B0UA 3OJCA 3RUDA 4HN2A 3PQ8A 3TQSA 5JUWA 3NORA 5CB4B 1OZAA 2XE8A 4XGQA 3UF0A 3HC7A 3UFBA 4QX6A 4IDAA 2VXCA 2AN9A 3H5RA 4DILA 2H5JA 3CWZA 2BHLA 1N2SA 1XCBA 2BFBB 3PRHA 3WGJA 5DZSA 2W70A 4NZOA 5HGJA 4KI7A 4KAFA 4XVRA 3SYRA 4YYEA 3IODA 4UBNA 2CLMB 3EASA 4B7XA 4UBKA 2B78A 1R50A 3AIOA 4S1TA 2E48A 2ZDHA 1HI9A 2WWIA 4IDGA 4RPIA 2J8ZA 1KDVA 3TPZA 4B4UA 4W5OA 2C95A 3QGMA 3ZWVA 4UHFA 1X1EA 4BOYA 3O8NA 4EAAA 1I01A 1JIUA 5FV4A 1FYWA 2YWDA 2Z6QA 1Y1SA 4YDRA 1X9HA 3PXCX 4Q4AB 1XRRA 3AVPA 4BFWA 1M9NA 5ICFA 1IHDA 4COKA 4KPYA 1W75A 1GM5A 3PZRA 2ZS7A 4EGAA 5AESA 3JQBC 1FU8A 2FN7A 4LWZA 1VSVA 1ZIDA 2IVZA 5BNZA 2WJZB 3PS9A 5F2EA 2QN8A 3EZ7A 4XB6B 1JEYB 4ZEOA 1AGNA 1M6YA 3KV3O 2WE8A 1KZ1A 3GUUA 2HMVA 4EG7A 3X3HA 1U02A 4QAJA 3V4FA 3ZE2B 4ZEWA 3CRNA 1XQYA 4HQLA 5HILA 3BJIC 3N86A 4LRTB 3FPCA 5AXAA 3W2FA 4EHFA 1AZSC 2JLRA 3TTTA 1EJBA 1ZEJA 3AY3A 4PZEA 3K0SA 2JGFA 3ELDA 3CVVA 4E21A 1BE6A 3IAHA 2JGKA 3KD3A 3CVXA 4D26A 4PLFA 3UHJA 5L4LA 2QI9F 1Y8RA 4JUDX 2CDRA 5JZMA 3NANA 2EJWA 3B6MA 4F6LA 3PLRA 4BB9A 3QWIA 1GQQA 2XOKA 2VDQB 3D31A 5HQ3B 2QLFA 4BO8A 1E61A 3O74A 1Q57A 3H2SA 4MVJP 3QPBA 2Q1TA 1Q7TA 4F6RA 3O4RA 2BGKA 1L7RA 1N5DA 1E1YA 5LPNA 1G21B 1Z8FA 2QRHA 2ODTX 1Q1ZA 4XXHA 4ESVA 2W7TA 4FKZA 4L57A 1PJ4A 1B8NA 1YIAA 2YDXA 4RCZA 3B82A 5J4KA 4KXVA 4YCSA 5AW4A 3IQDB 3VDNB 5FTWA 4HGOA 2HHCA 1NQ5A 4HMOA 4Q19A 5EC8A 3ZEIA 3N8GA 4GO1A 4KVAA 3UJNA 4DCVA 3ICWA 3LCUA 4P9NA 1W4CA 2H1FA 1OREA 3LVQE 1AUVA 3BXZA 3PT5A 4GKAA 4YWHA 1EHCA 1T5HX 2QR5A 2GAAA 2GK3A 3GUZA 4MSUA 5TGTA 3TZQA 2GWRA 3WLRA 1P6UA 2W8BA 3V55A 1J56A 4PIVA 2XCLA 2FW9A 2I5PO 2BCJQ 3FWNA 4YJHB 3H8SA 3LPLA 3R0XA 4PTZA 4CCSA 1AGRA 4ZV4A 2A86A 4GPEA 4QUEA 5KCZA 1FLDA 4L5JA 1BHSA 4E6PA 2ZTMA 3IBGA 3TRDA 2P2ZA 2PANA 4ENQA 1TF5A 4A2CA 1BOFA 2QIOA 2V0NA 4B5LA 2B35A 2R6ZA 2H59A 3PQFA 3OESA 3SQMA 1O08A 1VMKA 3L01A 4G5SA 3C4QA 4ON9A 1NJSA 1PWHA 2TRSB 1ML4A 3L79A 3BIOA 1QIKA 3KEOA 1XZ8A 1Y9DA 1JZQA 2R8ZA 5DF1A 5F2KA 5FL7D 3AL0C 3AK4A 2VAMA 4HLQB 4R6WA 3WQSB 2P6MA 1GAEO 4KIWA 1CY8A 2P30A 3KOWA 4PZPA 2RGXA 4RQAA 5AW0A 1W73A 1NM5A 2QW0X 1G0NA 1NPDA 2DPLA 2UKDA 3ZHBA 1L5VA 4WLFA 1QH8B 2I71A 4PGHA 5FL3A 1XD2B 2ZYIA 1QFYA 3ON5A 2JI9A 4ZT5A 3ZIDA 2QM7A 3RC1A 3Q10A 2PMDA 2R60A 1YVEI 1QNLA 1SCQA 3BS4A 1RTKA 2P91A 4JBXA 4QGFA 3UMGA 1RPAA 3GZNB 2D4HA 3GN1A 5F64A 1AA6A 3PICA 1HLDA 1Z3IX 1PDWA 2GR9A 4G5RA 1NNLA 4D4GA 2FVXA 4TMVA 5DHSA 2FEPA 1HE4A 4J90A 4IIVA 4OV6B 2WUDA 2R6GA 4C87A 4DSUA 1SM4A 3BERA 4ZPXA 5CB4F 2QORA 3OPXA 3H13A 3M83A 3ZJ4A 1GAJA 3HO8A 1OH8A 1XN1A 1V1RB 1Z4JA 3FCSB 1WF3A 3OJEA 4XQCA 2IHKA 5AVTA 5HKAA 1U9IC 3IR7A 4DPLA 2J3MA 4IPTA 3AF1A 1SHTX 3EMVA 5IZ4A 1FDTA 4CPDA 1G6Q1 1THMA 1GA1A 1P2TA 5EUCA 3WNCA 5CJJA 1FDRA 2XGJA 1YOBA 2VWQA 3F67A 4LHVA 4LJ4A 3SBEA 4XWYA 4ASUA 1MABA 1XA4A 4ZT6A 1N8SA 4LFAB 2BMAA 3IKVA 3LQRA 4J0DA 3VDXA 3IOEA 2PXAA 2Y1CA 4YXWA 2VPYA 3KOZA 4ENUA 1RBYA 4GI1A 1HE1C 1NLFA 3RKUA 2ZSBA 1ZC4A 4Q3EA 1FY2A 4KQIA 4PO1A 5EHQA 1G5FA 3WLPA 4GP7A 4KUGA 1V8BA 4ZYVA 3PEWA 1JHMA 4KO8A 3TDKA 2XVAA 1A9XB 4ND7A 3GAAA 4JP2A 5LKAA 4Z4GA 4UARA 3RABA 1JWAB 2DHEA 3V4RA 1T2EA 2F00A 1YI0A 3DBHB 3JZMA 3D7MA 2QP4A 3PCRB 2XIQA 3QHAA 4HH0A 4HLUC 4RY0A 2YV5A 4S35A 2IV2X 5KC8A 1I1HA 2ZE8A 3FZYA 4EWLA 3K9FC 5FI1B 1OH6A 2IHYA 3ONWA 5EMMA 3W1WA 4FYJA 4AKTA 1QO0A 1TKAA 4LOJA 4BO3A 1F6BA 3LUGA 2IBTA 3TBKA 3RIGA 4NZPA 4ZVKA 3V9AA 2BZSA 3B38A 2F3TA 5AW1A 2HHJA 2UZAA 2R00C 5KVQA 4E5KA 4KB5A 3PEEA 1W25A 3RROA 1T2UA 1S2DA 1IN1A 4DM7A 1RYBA 2OZLB 2X7XA 3JQBA 4LDAA 4MIEA 3JRNA 3RT7A 2EP8A 1I36A 2GZMA 2RBEA 3E70C 4ARZB 3EIHA 3FR7A 1MA3A 3AERB 1JQ5A 3UHPA 1UJBA 1N2JA 4BS9A 2PGAA 3ELWA 2IXGA 1XJCA 1JEAA 2QT0A 2XNSA 3FNQA 2H4HA 2X5JO 4B3CA 3WB9A 1SOAA 4YAOA 4J0JA 3PGVA 4PSDA 1NVGA 3GYBA 3LUKA 4JI6B 4LI3X 4AS2A 4X41A 1NVVR 3WKDA 1FBNA 3KJZA 5CMLA 3ORHA 4I4LA 4ZO8A 1GQRA 4HAUA 2D6FA 1CULC 1LJUA 3Q1KA 1ECFA 2I99A 2ZYTX 4IIXA 4KQ9A 4II2A 3OH8A 4MVJA 1FDSA 4YLGA 5IW8A 5BYJA 3IEMA 1TU4A 4OQFA 3R7WA 1IM8A 1FSSA 2XGGA 4FWIB 4GOKA 2ZR8A 3ZDAA 1RYYA 3U7GA 4MYTA 1HDCA 1TQ6A 3ZE6A 3B5EA 2JLYA 4AY6A 1PL0A 2VYQA 3DE7X 4F45A 4TTJA 3TF5A 3L8DA 2AN1A 2YXLA 5H83A 5JNWA 3JV7A 4PNPA 4N39A 5FJJA 4LBVA 2RHLA 4A0QA 4BO7A 1EZ4A 5ECGC 2C2XA 3GK3A 3HHEA 2VG8A 4UCFA 1UJ6A 3GRUA 3S0JA 1KJ9A 2QSUA 3X1YA 4NYJQ 3UZUA 5K1SA 1IPEA 1E9DA 2W8ZA 2Q3DA 2Q2VA 2XSZA 3QBTA 1YVUA 1LFDB 1Y1LA 3E5NA 1GRNA 1UWCA 4EG1A 4NV0A 3D6MA 4RMNA 1WKBA 5H0IA 1TO1E 4ZAZA 4LZOA 3Q6NA 3JYQA 4MAFA 4POAA 2AYXA 3ETHA 3IHKA 2R84A 5C5IA 4QULA 4OBBA 1N5IA 3LCVB 3RWMB 1Z0ZA 3TIVA 3L3BA 3ZU2A 5DNWA 3HUEA 1DOAA 1KO1A 1MFPA 2WDPA 1RRPA 1O6ZA 4YGXB 3DTTA 5IDWA 1ZESA 4PRKA 1ULUA 2ZW9A 3IP5A 3HUFA 2RAPA 2P1ZA 4DLUA 3VAYA 1B41A 1PLJA 1Y6QA 4MVWA 1VKHA 2BIFA 2LV8A 3OMWA 4EPVA 3ZLUA 2V6FA 1QIEA 4OJMX 5BSKA 3QG5A 1EQUA 1LWOA 3WXMA 3ZE9A 2VYVA 1G20A 1IHUA 4LOHA 1VM6A 2Q2WA 3COZA 5EZ5A 4A91A 4IDEA 2VDRB 5AJTA 1Q3HA 2BGLA 2EBUA 2XDQA 3BH7A 5F5LA 3C1TA 1ZR2A 2K5UA 1PI3A 3IQZA 1Z7EA 2CLIB 3CINA 4KFRA 1M54A 2X6TA 1R8XA 5GGYA 3F3KA 4J94A 5E1OA 5KAMA 4C3VA 4V0MA 5LOVA 5IVKA 4F3TA 1FFEA 2PJDA 3KQLA 1JSRA 4JSTA 2JZCA 1AK2A 1EUQA 1N2ZA 5GIPE 1GG5A 3BK2A 2ONYA 4TROA 3KWFA 1Z4PX 3OIUA 2IPAB 2V6MA 2WMOB 3DM5A 3GGOA 4MW2A 4MRSA 2VDPB 5DM0A 2VBGA 3TQHA 2WICA 3DF7A 1F14A 1GT91 1I4TD 3EQ2A 3NGXA 1BCRA 1PNOA 4ZDIA 1J8DA 1E3TA 1HLPA 1EBUA 3C3AA 1K0UA 1MU0A 3LUCA 4XM2A 5B4TA 1K2WA 1Z4NA 3TUZC 1TCVA 5TQ2A 1GAWA 3M6XA 1TLLA 1P61B 2DYKA 1B3RA 4NCJA 4JHLA 1N1MA 2Q50A 5KKAA 2W37A 2YMQA 4MKIA 2P4QA 2I1WA 5CK5A 2CLEB 2XA1A 3FSGD 2FUG6 2ZB3A 4ND3A 3T1VA 1PQWA 1RWOA 3PXAA 4Q7QA 5D8DA 5DISB 3RF7A 5I7OA 4EOGA 1N6HA 5KQRA 4EVIA 1SHZA 4NY1A 5EZQA 3E5MA 1L7AA 4UVDA 1XI2A 3DKPA 4QARA 1Y0BA 2VH1A 3V8BA 1C8VB 4HB3A 3AG5A 5K0BA 3GFPA 2CSXA 2HQ1A 4JEIA 5H4HA 4H1HA 4YJ2A 3WGOA 1PJ2A 3WXBA 2Q3LA 2LRHA 2Z8XA 1KEPA 1X86B 1YS4A 1VJ0A 4GRAA 2FW6A 5PGMA 1PT8A 3L5KA 4D97A 2VDWA 3ROMA 4FYXA 1PZHA 4ZCIA 4Y1RA 1XNGA 3LQKA 3ORSA 3CX4A 2H2HA 2E5FA 2OEPA 3V8MA 2FDRA 1BG6A 3I6QA 3VR6D 3TQIA 2Q3EA 1U80A 1U0EA 4HLUA 4BJ1A 1DCTA 2JD0A 3USCS 3O83A 4WKCA 2CHFA 2ZKLA 4CTOA 3U44A 2G63A 1P60A 3DLIA 1BS2A 1DLIA 5A0FA 5K99A 3COWA 3TGLA 2NZWA 4E1AA 2YNMC 4DJJA 4KQEA 3QA9A 2R00A 3UJHA 4HEHA 2B4YA 3NBFA 2NACA 3M6WA 3RSOA 1NRXA 1U5CA 3BZWA 3JCZA 4UUOA 1ZCBA 5CDHA 1Q2UA 2VOEA 5KJFA 2C42A 3Q8XB 1LV8A 1CFZA 2HLPA 2NYAA 1WB9A 3PQ7A 4XM1A 4GHWA 1JQBA 4CCWA 1QAMA 4DC9A 1Y5IA 1PDOA 3PR1A 3THOA 2FR8A 1Z5ZA 3NEJA 5F33A 3IVGA 3RANA 1Z6ZA 2MWMA 4KH1A 2DHCA 1NXWA 4W1PA 1Y63A 3NVDA 3OVMA 4HGRA 4N9QA 3ND8A 2QE7A 2IPXA 1A5SB 1JDTA 4IG9A 2IW3A 4JFRA 4KHZA 2YY6A 1P7CA 3VAZA 4BO1A 3B2EA 1YQEA 4IDFA 3NIDB 4UUNA 3BREA 1Z9BA 4BO4A 2HWKA 5IC6A 3U39A 1UQUA 3MWKA 4RC9A 1QQ6A 3D0QA 5KSOA 1PHPA 4KLNA 1HQDA 1QOQB 1K5DA 4NIMA 4YFYA 1EE9A 1EK2A 1I6MA 1LLFA 3K8YA 1RAEA 3VPFA 5KTOA 1P0CA 2AE2A 4CF5A 1U3CA 1A8QA 2JIMA 1BEEA 1W4BA 2DLDA 2JGDB 3HRIA 4OHXA 4UNNA 2JB9A 1MJGA 3PNVA 2QAIA 3U4MA 4HDCA 1M0SA 1U0GA 3EIQA 3UHFA 1NKSA 3QEMA 4RIGA 2QD1A 1UAAA 4L08A 4R1MA 1OZHA 4OSEA 2ORED 3A8TA 3HCAA 4JUCA 3O8OB 3WRVA 4FDUA 4D45A 3T5PA 4DR2B 4MIKA 1W9HA 3V8PA 5BQ3A 3C3EA 4EJMA 3UV3A 2POCA 3WLIA 2YJGA 5KWVA 4F85A 3O7MA 3COPA 4GMXA 3ABRB 4J0QA 4X97A 5JT1A 2OK7A 5IAEA 1AKRA 1YDGA 3DS8A 4BBJA 3KSDO 4DDVA 4B83A 2NYUA 2W6PA 2WM2A 5K01A 3FOEC 4U2EA 3DZ8A 1R0YA 1H0SA 4H2DA 2NU9A 3N6VA 1C8BA 4I9UA 2L82A 4L4XA 1X8JA 4U4AA 3WLOA 4ZYLA 3B51X 4V0QA 1BW9A 4RGBA 2O3JA 4ZZIA 5ICEA 4EP1A 3IBFA 4A0FA 4AM8A 5KNBH 3T7RA 2NP6A 3STWA 5L3QB 1JV2B 6ADHA 2G0NA 1ZI6A 3AG6A 4CEHB 1RQGA 2SKEA 1MGPA 2O05A 5D3KA 4MPJA 2Y1OA 3SHVA 3W6NA 1G55A 1E9AA 1PSZA 1ZMTA 2ZUWA 3QI2A 3SZLA 1PGJA 3GA0A 3A26A 4OUDA 5TPWA 2VQ3A 3EDRA 1ZA1A 4FJ0A 4XARA 3TTYA 2YRFA 3JZFA 2DEUA 3HH8A 1KETA 1GZSA 4JKIA 4KAJA 4BDTA 3V34A 2G9RA 1YFLA 1NGSA 3ZLBA 3WJ7A 2QEQA 1S2GA 1G9XA 4C03A 3M34A 4GW3A 1C3XA 4LFCB 4JYZA 2HJWA 2PS0A 4O5AA 1OTXA 4GOND 5CDFA 3TPFA 4PVCA 4U2FA 3ND7A 1AOXA 5HX7A 1R9JA 3ACCA 3B53X 3DBLA 3VUEA 5LYJB 4P4TA 1XZQA 3I8OA 4IFIA 1HQYE 1R4NB 3R7WB 3UA3A 3G1WA 5K3CA 3CKKA 3LQFA 4DPMA 2OC4A 3TSAA 4R4JA 2PL5A 1QWSA 4IX9A 3CUWA 1TJ5A 4LPKA 3GNLA 3VXKA 1U0LA 1C7FA 1M2EA 2G72A 1NVEA 3GAZA 3CTPA 3KSZO 5HBGA 1A9TA 2H1HA 3TZLA 1ECLA 5CNJA 3RNLA 4BFCA 3R40A 2GCPA 4MEJA 1RI1A 1J9GA 1OILA 4GZMA 4G86A 3BKXA 1PD1A 1RJ9A 4HO1X 2MCFA 3TL6A 3U80A 4NAUA 3CUKA 1N1DA 1IOVA 4DA7A 1FRZA 2R8OA 1OTYA 1QC5A 2DSNA 4KGZA 4C4AA 2FRXA 3IAS1 3FDIA 3MTJA 2NUAB 4CV0A 4R71A 1B74A 5E6UA 4HAXA 1WSDA 2AX4A 3E9RA 3OO0A 3PXUA 5JASA 4DL9A 1IU9A 2XODA 1MDBA 4MVJE 4MUKA 2VNAA 4J0CA 1ACJA 3WDSA 4DDHA 1AKNA 4J3NA 2H51A 5G4KA 2ZYVX 2CNKA 3U4CA 3OD5A 1XCPA 4JD5A 4JBGA 3VH4A 1E5VA 1ZD3A 3HXTA 5EI5A 5BQPA 4QOSA 3A1CA 1HDZA 3IT2A 1C7IA 1JHPA 1H22A 2F3QA 1KL7A 1A76A 2VH2A 4R7GA 4RDIA 4WBNA 4TWBA 1AHIA 1P1IA 1DQZA 4TXNA 2CN1A 4H7PA 1QB8A 3HNPA 4F7DA 2FLVA 1IBLB 3HA3A 1XF9A 2R97A 3QVJA 4IG4A 5I45A 1ZUNA 2XB4A 1JYFA 3CRZA 1LQUA 3N5KA 4DV2B 3HDTA 1DTEA 3C8MA 3VU9B 3BN3A 4GP6A 4H3HB 3R44A 3X1DA 3ZVKA 1A8IA 2C5BA 4L2IB 1U1IA 1XGKA 4DWOA 1VL1A 2AMLA 2JFNA 4M7PA 4ZK2A 4DV1B 2V58A 5GAJA 1U0TA 2XDQB 2YWEA 4CM4B 3H8JA 1EM8B 1JBQA 1NDUA 1RS0A 1SCUA 2G9UA 3HCOA 3K9WA 3WB2A 1KYTA 1T29A 2GPWA 3K9GA 5LOVB 1KK2A 1WL8A 3KPJA 5F3DA 1R27A 5JCJA 4EKEA 3HMKA 3PXXA 3PXDA 4JLNA 2DB3A 1G6KA 2YNMA 3G2MA 3PTLA 4P0PB 4OEHA 3PNKA 2QPAA 3I05A 4DQUA 4OP2A 4UEQA 1AN9A 3LA8A 4HGPA 1NDHA 3WQRA 2V9CA 3SKVA 2C4NA 2I2CA 1RAGA 3BIXA 1BYUA 8ABPA 5CGQB 2YQ5A 2JI6A 5A6VA 2GPAA 2YASA 3TXYA 3QLJA 1AK9A 1MB3A 5E9AA 4UMFA 1FUIA 2RSLA 4DGSA 2I87A 3DVLA 5EKUA 3SYLA 5TQ2B 3KQKA 3DNPA 2GARA 1XKXA 5AKKA 4MQ4A 3VR3D 1T91A 3MIZA 3W5BA 1QGZA 1ZGJA 2AR9A 1H2WA 2HRDA 2ZDGA 1ENZA 1SXGA 5T4EA 2F1RA 1L4KA 1NUUA 1Y1KE 4CM3A 1QG2A 2O2HA 5I9BA 5L3RA 3OA0A 1L5OA 4G0OA 1O58A 4ITRC 4MV5A 3DZGA 5G53C 4KYUA 4AFNA 1Z17A 4EHAA 1DQSA 1MO3A 3MT9A 3THYA 1D03A 3DT8A 1DXOA 1RIFA 3GLSA 5DHRA 4D8UA 1Z68A 2BM8A 4V39A 1QCCA 5IUKC 2IPNA 5G02A 4W5QA 3DMYA 3FNRA 4MQ6A 1RYMA 2ZJ1A 3G3EA 1UKYA 1PTJC 4YRMA 5IANA 4Y1RB 3T61A 1JFSA 2J7PA 4OI2A 2C4MA 4YP5A 5DSXA 1T6YA 5KSWB 2F48A 2LCIA 3DW3X 2JAWA 3DBRA 4X62B 5ALPA 1V39A 1CERA 2HU8A 4QFCA 4REQB 1PNRA 3QUQA 2QN7A 2C31A 2OBMA 5JE8A 2VYFA 5FBQB 2WJIA 3CX6A 3SYTA 1G5QA 1C1XA 4JI3B 4MV7A 4MVJF 1JR2A 4O4JA 1BRTA 3ZU5A 1XAHA 3NBMA 5LYJF 4AW9A 3U44B 1C9EA 2OBLA 2XUJA 4M0CA 5FUVA 3E2IA 4CF7A 1DIBA 1DS6A 1XELA 4D9HA 1AF7A 1GL3A 5E1MA 5JBQA 2RGYA 1NKVA 5C31A 3C14C 3MJFA 2DWUA 1NUHA 1QE0A 2XECA 4DG5A 5IFLA 4O4HA 5JATA 3EK2A 1JBKA 1XR3A 1YQDA 1PE0A 2OCXA 3ZH2A 1VQ1A 5FTKA 1IN5A 3DFIA 1GQYA 4DMKA 4DMGA 2G9ZA 3J7AC 3EW9A 2A1TR 3R8XA 3W2IA 4WHMA 1LA2A 1D5WA 1UOOA 2FSUA 2H7YA 3MJRA 5J9FA 2QTZA 4Q4CA 4KX5A 2AZTA 3W9BA 1CU1A 1JLSA 2HMTA 2YHIB 2EKPA 5CLHA 3EVCA 5C3UA 1E2NA 3LP8A 5JS7A 2BKUA 1CEQA 1VL8A 4A6DA 3I52A 1G8YA 3R3YA 3K0EA 5AD1A 5IKPA 3HB7A 4YXFA 4IDHA 5BW4A 1ZH0A 3KU1A 3TLCA 3NUZA 1IM5A 1VRCA 3PYLA 2WQ6A 1JFRA 4KWCA 4U9UA 1MPTA 1UOQA 5EHIA 2C8VA 1J39A 3Q2KA 1VYVA 4RWEA 2FJPA 2B2XA 1KFBB 2WZBA 3VBCA 4E5MA 5AW8A 3S2IA 4H08A 1SC1A 1T9GS 4CI0B 4UVGA 1RPTA 4LGCA 5D51S 1PG2A 2Q49A 3AI3A 5KNLA 1S3GA 5L53A 3C98A 1Z0DA 1JZSA 2HA7A 2HWUA 1CUWA 1NTOA 1NW8A 3UK1A 4MS1B 3VOBA 3OKAA 4AN0A 3SDBA 4U63A 4EB8A 4GR9A 2EC5A 2QX9A 5H7XA 1RHQA 1E2GA 2ODBA 5U4XA 4F91B 1KEEB 2QVLA 4F8EA 2M1XA 1JVBA 2WM3A 1D4ZA 2HK6A 1QYIA 2H0AA 3KB8A 3UNXA 2P9YA 1V25A 4QPDA 4BEBA 1YFKA 4J43A 1HYQA 3EGIA 4QO8A 5LOVF 1GADO 1CWUA 1EQAA 2HXYA 3D8RA 1M1NA 1GZ3A 3BTSA 5CCBA 1Y48E 2FQQA 2CHUA 3OTHA 2QAGA 4RVCA 5G1OA 5F4BA 4YCJA 4RORA 3PENA 3TE6A 2JIZA 4W8OA 5IK2A 1AK1A 3A3PA 3G5TA 3D4OA 4TZKA 4D41A 1EJ0A 2RH9B 1L4MA 2OBBA 2XLBA 5TPWB 2PD4A 3GMTA 1JE0A 4V1CI 4XYLA 3UJ3X 3A9CA 3LG2A 1WNTA 1FTGA 4RULA 1ZAYA 4RX1A 1II9A 2E55A 4GWGA 5SICE 5G40A 1EK6A 3NPMA 2AIRA 3RDPA 1Z25A 2XMQA 1WZNA 1L0BA 2HSEA 5FPTA 2GCGA 1L5NA 4DUYB 2WTXA 4WNAB 4B4OA 2H2GA 3A9RA 4B40A 3ES9A 3O9MA 4LYAA 4GYWA 2ZM5A 4WKNA 1CUDA 2I80A 5D5HA 1T1GA 2ETXA 3OPYI 3Q0IA 5BQFA 1JR6A 1QORA 1K66A 3SIXA 4KV7A 1XU4A 1N57A 1O97C 2CT8A 1NSTA 4JJZA 4JVSB 2IRWA 3T12A 1K68A 1Y4AE 5HA5A 1EVIA 2XB6A 5F5XA 3Q7QA 1S02A 3IULA 1WIWA 1MENA 4NZMA 4O4LA 2AFIB 5I4BA 1E63A 1PL7A 1CQWA 2XGSA 2YS7A 4KU4A 3MTGA 1PL6A 3P96A 3A9WA 5IT5A 4YJ2F 1JEJA 1GG9A 2V9ZA 3GJTA 1DAFA 1DBIA 1IZ0A 1F4VA 3TR6A 3R20A 3VOTA 1N0WA 3JTEA 3OZFA 3MCUA 2NTVA 2C8JA 2X4LA 4H60A 4IIDA 3SIRA 2EKLA 5CDFE 3QIVA 3MPOA 4A0GA 4DRXA 3ISVA 2JCVA 2OD2A 4OXYA 3V1LA 5FWYA 3EPHA 4KPFC 3RO7A 1WV1A 3BJEA 3M6MD 5AH0A 1Y6JA 3M6IA 2RBKA 3MYYA 3K8OE 2CVQA 5LQSA 1WP9A 4LC0A 4EEZA 4E2FA 2DXIA 4N3AA 4U2KA 4HV4A 2NU7B 1TM7E 4RFSA 2R9VA 3M2TA 1N5JA 1Y5RA 2AFIE 1EMDA 2TMDA 3HWX1 3R6GA 1K89A 1WJGA 3QG1A 4N5MA 1E5XA 5EQFA 3V8QA 2HQBA 3PJRA 4HNAA 3EVDA 4BLQA 1BOOA 5CFPA 2VP2A 3HYTA 3LCRA 2AJBA 3FMIA 3BL8A 3CN7A 3KAKA 1PTJA 4FDVA 4MV3A 3U7EB 3DMHA 1OX5A 1DG9A 1UC5B 1YJAA 4LJ9A 3T9CA 2H4JA 3NKLA 1I3NA 4X90A 5GGXA 1P2UA 3C39A 2QM0A 3K20A 4CM8B 1OASA 2YTZA 3L1UA 1KQGA 2HWXA 3QE3A 3ZY3A 2WOOA 2CXHA 1VI6A 4D9GA 3L43A 4EQ6A 5D3MB 4F9TA 1AT1A 1SKYE 4EFMA 1CXZA 3MUFA 2NGRA 5COAA 1NBWB 4GDMA 4CETA 1H9AA 3EULA 4YUYA 5TPZA 1KSFX 1K2VN 3PKZA 4IJ5A 3VHXA 2LW7A 3AYZB 1Z75A 2XQGA 5FTMA 4JJEA 1X1CA 2V6GA 3SC2B 1W0KD 2TMGA 3N6XA 3IHLA 3SZRA 4AZ0A 1HFEL 1G19A 4BL5A 2JASA 2LGJA 3GLHB 1QVAA 4DV4B 2ISSD 2QM3A 4P2GA 3UANA 2JLBA 3K0FA 4URHA 1UR5A 5AKXA 4PN7A 3EWSA 1EXNA 3NB0A 1IZ8A 4N18A 3KJXA 3LAWA 4IWYA 3IYLW 4YJFA 1SAYA 3K9QO 4S0XA 4HLCA 4RHCA 1YQUA 3DE6X 1FXSA 1L7BA 1WUKS 3DDOA 3DL4A 2C07A 1YRLA 1D2AA 2NSHA 4BNMA 4CHTA 1SBHA 2BBOA 4LXIA 5KDLA 3UOWA 2V54A 3HRKA 2XF2A 1Q0TA 5GJWC 1TCUA 3LT0A 3WFIA 3T4PA 1I3CA 3REOA 4KREA 1P1RA 1L5HA 2CUTA 3FF4A 1YACA 3LY7A 3LUAA 4U1RA 5ECYA 1WKCA 3L92A 3T35A 2X9QA 4IQGA 1XTQA 5L4NA 2HAEA 2IYTA 3IESA 4L1KA 4JKYA 4TWAA 1CZHA 3T3EA 5LXTB 3U9TA 4L76A 3EPLA 2HXSA 4CTNA 5B1YA 1UPBA 2MINA 3MAAC 3M9LA 4F2GA 3ANNA 3THYB 3KHKA 1XFDA 2FX5A 1YZUA 1USWA 1YU9A 4ABYA 2QL7A 3BE8A 4FDMA 2XKBA 3UGKA 2C4WA 2PN1A 1P72A 4ZAGA 3E1GA 4IOKA 2IP2A 2K7FA 1K4KA 1M2NA 2DFDA 3JYNA 4QLOA 4DV5B 2CGEA 2J3IA 3DA8A 1RHRA 3MSXA 1OBOA 3QFRA 4JODA 4IVNA 3EVGA 1GU0A 3VC7A 3WLKX 4DCOA 4NQZA 3FRJA 5BXYA 5ER6A 1JXMA 2ZXFA 1XRNA 3DBRB 1V71A 3QNUA 3VC2A 3DOHA 1JQEA 4FHZA 1TI7A 3TINA 4PPNA 3RFXA 5EJIA 1XPRA 2ZITA 3UGJA 1ULTA 1G6OA 2Q29A 1DARA 5DYGA 1C1XB 2NZVG 1Z74A 3PI7A 5F9MA 1FFDA 2XVYA 3AL3A 3ZQ6A 5DT9A 1XX6A 5EP4A 3TL3A 1F06A 1NX9A 3AB8A 5IAAA 2AB0A 3ZWOA 3HB4X 4WXMA 1CJTC 4JP3A 3VTKA 5E4FA 3NTLA 3ZQUA 3A3YA 4IJVA 4YRRA 4YR7A 4O4HB 3D6NB 3TZ6A 4C2BA 4MUNA 2FPKA 3PXBA 1IAQA 4DKJA 4JI4B 1M6NA 4L5BA 1S2MA 1F8UA 1EVYA 3VPAA 2QTFA 3RS7A 1LK7A 2FG6C 3CG4A 4EHKA 1M6WA 1CETA 3NEAA 5AW7A 2P7HA 1YULA 2O3TA 4C4ZA 4WH0A 1TM2A 2P3LA 3L7OA 3WHPA 3EIUA 1X2BA 1RCTE 3NS7A 4DYDA 5CBPA 5F7XA 1X9IA 5JDIC 2ZB4A 2HDNB 5JD4A 1MHPA 1CR1A 1K7XB 3QIAA 4I50B 1YBVA 1LXCA 2D2VA 5FUQA 3UHAA 4D8XA 2RK4A 4B46A 2VAXA 1M6VA 2KX7A 4IS3A 3TTUA 2SKCA 1F1JA 4PS0A 3LFTA 1YVRA 3ILXA 4IRMA 5CRIA 2O4UX 2XDYA 4ESOA 1CUFA 2JGNA 4MVCA 5JARA 3AGQA 4LOKA 5JJKA 5E9WA 2X13A 4J0EA 2COKA 1A8HA 1TLFA 4D74A 4WBNF 3E22A 1XFAA 1SUIA 4HXGA 3JWJA 4K9OA 5J1TB 4BN4A 5BR1A 1DU4A 1MORA 4L4ZA 1VJ1A 1O87A 4JMPA 2R8EA 5TVKA 5BV7A 1H6DA 2BBTA 2PAAA 4B47A 5A4JA 1EUZA 1K7CA 1ODCA 4DZTA 1EFHA 5JHGB 2IV3A 2NZ2A 1ID1A 1J2YA 2NSDA 1Q7RA 4RVHA 4PQEA 2Z2JA 3IBSA 2NO0A 5C37A 1CRZA 2JJ1D 5AM4A 4I1IA 3Q7EA 4G07A 4D0RA 2ECKA 4NCIA 2EFDB 3UJ7A 1RAFA 1BSVA 1IZZA 1RLMA 1Z6GA 2CC2A 1E1CB 2QN2A 4J1NA 3L0PA 4MNTA 4GPAA 1NVXQ 4TS3A 4ZT4A 4WN9A 5TGZA 4JVMA 5AW3A 2W4IA 1AQYA 1V4NA 4C4SA 3PVCA 1HFWA 2G07A 2VHQA 2A6PA 5IJ0A 3U1TA 1TCCA 2GJSA 3GVIA 3FZNA 1UJ5A 4FNMA 4E08A 1A5TA 1MAHA 2SBTA 1SXJB 4GOXA 5EP3A 2WJJA 1V6AA 4DLYA 1IXSB 2H2WA 3T5CA 5KX5A 1UP4A 4QRIA 2Q62A 2GHQA 3OCZA 2X7JA 1NP7A 5AVYA 4HNHA 1C50A 3OPVA 4AMYA 3DZDA 1ML3A 2GHIA 4PIMA 3GFRA 1IRIA 5EJ4A 3IJ5A 3PJGA 2XQJA 2W2LD 5B3JC 2YOGA 1LDGA 3BF7A 4BMCA 1D0IA 1EFRD 2YJZA 3ETCA 3G8AA 3IV7A 1WVGA 1J0AA 4GD3Q 3C3XA 3IAS6 4FNOA 4ZANA 4MQEA 1B93A 3IE0A 3WK8A 3C97A 2FG5A 3FFWA 3X1WA 4BDSA 2ZRMA 3RC8A 3I04A 1QVVA 3MINA 3TIFA 4MV0A 3ZYZA 2ISCA 1KA9H 2X3YA 4MI9A 1DMSA 1XZKA 2X9LA 5ALNA 1J1UA 5ITVA 3DYIA 1WXGA 1N34B 1ZM4A 2JIQA 5A4KA 4XRRA 5CT8A 4H6XA 2WWYA 4OYHA 3W6OA 5LQRA 1BGVA 3UKJA 3IELA 1WUHS 5A05A 4Q1CA 2H07A 1TJPB 4YMSA 4CLEA 3WMWA 2UZ1B 1KZ6A 3V5NA 2Z2KA 3ORFA 2H63A 3ZJUA 3L0OA 1M8FA 3IQEA 1Z4MA 3VR4H 2CL7X 5LQNA 1B6RA 3JQ6A 3K1ZA 2NPIA 5JS2A 3WGYA 4JELA 1FP6A 4YRQA 3QH4A 1S9DA