4DUPA

Crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
331
structure length
331
Chain Sequence
b'MSLPQEMRFVDLKSFGGPDVMVIGKRPLPVAGEGEVLVRAEAIGVNRPDIAQRQGSYPPPKDASPILGLELSGEIVGVGPGVSGYAVGDKVCGLANGGAYAEYCLLPAGQILPFPKGYDAVKAAALPETFFTVWANLFQMAGLTEGESVLIHGGTSGIGTTAIQLARAFGAEVYATAGSTGKCEACERLGAKRGINYRSEDFAAVIKAETGQGVDIILDMIGAAYFERNIASLAKDGCLSIIAFLGGAVAEKVNLSPIMVKRLTVTGSTMRPRTAEEKRAIRDDLLSEVWPLLEAGTVAPVIHKVFAFEDVADAHRLLEEGSHVGKVMLTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords quinone oxidoreductase
publication title Crystal Structure of a quinone oxidoreductase from Rhizobium etli CFN 42
rcsb
source organism Rhizobium etli
molecule tags Oxidoreductase
total genus 101
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dupA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4dupA01
4FGSA 4BV8A 1P1HA 3DB2A 4IDEA 4MJLA 5GZ1A 2FMUA 3INTA 2QZZA 1KETA 2FR0A 1HE5A 5JAQA 5CDGA 3ZDFA 4A0SA 1VL8A 3LT1A 4F6CA 1LDMA 3U62A 3WICA 3CIFA 3UOGA 3WIDA 1V6AA 4B4WA 1DAOA 1DC4A 4CL3A 1JLLA 3MJ4A 4XIYA 1DO8A 2B83A 1GR0A 4FOOA 2NVUB 4CLXA 3VVBA 3K2BA 1GEGA 4ZJUA 1B16A 4K28A 3ZW8A 3PGXA 1E3EA 2Z95A 1GL3A 4YXFA 3AUAA 3DBRA 3GF4A 1NASA 3PHGA 5HTOA 3R6DA 4HXYA 1WW8A 1T2AA 1R12A 2WYVA 1F17A 3F1KA 1EQ2A 1NXQA 3MJVA 3NT2A 4BKOA 3AY7A 1E3LA 2Z1MA 2D1YA 4E2ZA 2FY8A 4Z9YA 3D3EA 3INGA 3MWDB 2O7SA 1I5RA 3UAGA 1GPJA 4D43A 2EV9A 3KZVA 3I5MA 2JFHA 4J16A 3ROPA 3T4EA 2ZB3A 2ZKLA 1JQBA 3PPIA 4BGIA 1Q1NA 3ZN2A 4C7JA 2A9FA 2H1SA 5ITVA 2BFPA 2GCGA 4P4NA 2EF1A 1W0CA 4OL9A 4XKJA 1ISFA 4BMNA 4FBGA 3BMOA 1J49A 2WYWA 1JKFA 3F4LA 4BNTA 2ZTLA 1YBAA 5K9ZA 1PZHA 3ZV4A 3AUSA 6LDHA 1P3DA 3V2GA 1GCUA 4BNZA 1FMCA 3RJ9A 2O7QA 4FFLA 4BNMA 3VPGA 5BQFA 3HN2A 2DTDA 1LSSA 5JC8A 2Y66A 3TOXA 1ZK1A 5T64A 4NR0A 2E4AA 3OBBA 4KWIA 3JYLA 3KYDA 2D5CA 2H63A 1QR6A 1NP3A 3DFZA 5CG1A 5DBFA 4OXYA 5LCXA 2O4UX 1N9GA 3HADA 1HL3A 2ZCVA 3LC2O 4F46A 1NVTA 3WX0A 1UH5A 4EUEA 4CV0A 2AQHA 5H83A 4I9UA 4E13A 2W2LD 4L0QA 3PQEA 1EDOA 4YQZA 4YT5A 3X2FA 1Y7TA 4Q39A 1ZK3A 2BRUA 3H8VA 3OETA 3JQ8A 1DLJA 4WLNA 2Q1UA 3LK7A 1YJQA 3A9WA 1B15A 1Z7EA 2DFDA 3KV3O 4GQAA 2Q1TA 2HCTA 1M66A 3VTFA 1U8XX 2VTDA 1OAAA 1J0XO 2HMVA 2Y68A 2VZ0A 3INRA 1YQDA 2ZYGA 2UUPA 3D5QA 1KY5A 3WIEA 1BW9B 3RFXA 1ZO8A 1T2EA 4L75A 1Q0HA 4FC6A 3SEFA 4J1QA 4AJPA 1YH3A 4R9SA 1PL8A 4GKVA 2C5AA 5TIIA 1WP4A 2NU9A 4QUKA 1PS0A 1BRMA 4L4SA 2CDBA 1T4BA 1ISIA 4QFDA 3WLEA 3PHJA 3GVHA 1HF3A 1P74A 1V8BA 4CM5A 2QRJA 2UYYA 2FSSA 2YHIA 3ZWPA 2AW5A 2DVMA 3WB9A 4W6ZA 4CM7A 3F6YA 1PWZA 1UAGA 3QWBA 3RC9A 2Q49A 4FFNA 4EBFA 3OH8A 1VSUA 3VZSA 3DMTC 1ZMTA 5KIAA 2HRBA 4Q3DA 4D41A 2B4QA 4ILKA 3M6IA 2EIHA 1SOWA 1UXJA 1X1EA 2OP1A 3OQBA 4O6VA 3LT0A 2WSBA 3ZWCA 4IXTA 1XKQA 2HMUA 2WM3A 3V1UA 2J3JA 4BIIA 1MG5A 2EGGA 1R4MB 3MJTA 3O38A 5L95A 4PG6A 4ZD6A 1GUYA 3I1JA 3LQFA 1AXEA 4YCAA 4FGWA 1HE4A 5THKA 3IDSA 1D7OA 1Z75A 4CM4A 2RHCA 4ITUA 4P8RA 4LSWA 1KVSA 4OJNA 4CJXA 4NQZA 5IDWA 1OZAA 3TL3A 1QYXA 2BF7A 2W2KA 4XYGA 2CVOA 1GYQA 2DAPA 3D4NA 1N5DA 1ADFA 1ENOA 4E33A 2FR8A 4Q9NA 5KWEA 2IEDA 4II3A 1U9JA 4RPHA 4ZU3A 4BO1A 4BHTA 1NAHA 1DIAA 3LC7O 2FP4A 4R16A 1XQ6A 1K2WA 4FOSA 5G2OA 4CLOB 2O3SA 4MIOA 1C1XA 4AJKA 4I5GA 1CJCA 3JQEA 4RV9A 3DZHA 1IHXA 3Q2IA 4PLFA 2WDZA 1KC3A 3EW7A 4RVFA 1A72A 4OIMA 4XJTA 2D4AA 4UEOA 1XG5A 2VWQA 1R66A 3GRKA 5JYDA 4RO0A 2I3GA 1HSOA 4E2WA 1YKFA 2Y0DA 4HX5A 1JDJA 3HWRA 5F1KA 3GVCA 4BNWA 1O6ZA 3ETEA 1ZZEA 5KJFA 1Y5MA 4JLWA 5AXDA 3OA2A 3ZU3A 2ZTVA 2C2YA 3WG9A 2ZJ0A 3TL2A 2EHDA 4IQGA 3VZRA 4JQCA 5KVQA 1IE3A 4BNYA 3F1LA 1NQ5A 4NZ9A 4OSOA 1HWYA 4E12A 3AWDA 2FPPA 3H7AA 3D1LA 4IZIA 1NBOA 5MDHA 4MVJM 2VRBA 3GUYA 1AUPA 4JP3A 4ZGWA 1IOLA 4R1NA 3HDQA 3A06A 1HLPA 1EVJA 1LJ8A 1EFKA 1KVTA 5JDIC 4R1TA 3PLNA 3B1FA 3GDGA 3C7DB 1QORA 3OMLA 5A9SB 3WMWA 5AOVA 4J7XA 2B5WA 3PP8A 1BTOA 3VPXA 1EUDA 1XGKA 3WXBA 2NSDA 2X0JA 2R2GA 4RGBA 3AUUA 1F8GA 4CR8A 4OOEA 5TC4A 2AHRA 3PQDA 5JCJA 3H2ZA 4B7XA 4TROA 3PJDA 4IS2A 4BQPA 4AJ4A 4W7IA 4OXNA 2YHUA 3RIHA 3PYXA 1JW9B 4XRGA 4O63O 3FR8A 1IB6A 4CM3A 3I9LA 1EK6A 3FI9A 3IC5A 3P2YA 2DPGA 2GO1A 1NQOA 2WEKA 3D0OA 5DT9A 4AL4A 3JQCA 2E82A 2YW9A 1V9LA 2GGSA 2IEBA 1LRKA 1PWXA 3JYPA 1HXHA 2B4TO 5EQFA 3A4VA 1VM6A 1QXSA 2DC1A 3WS7A 3PWKA 3ABIA 7ADHA 4EEXA 3WJ7A 3S1LA 1IPEA 3KYCB 4K1LA 2FR1A 3ZWWA 2QRLA 4ZICA 1H2HA 2Y1OA 4WNIA 1PS8A 1QV6A 4I1IA 1CDOA 3GEDA 1N7GA 3JD2A 3DMTA 1B2LA 1DOHA 4UUMA 1QSGA 3GGPA 4A7PA 1X13A 5I8WA 1EEHA 4E31A 4A26A 5B1YA 4WEOA 1ZEJA 2C0CA 4J0FA 3DL2A 4IDBA 4D79A 5FWNA 1B3BA 2VYNA 3T7CA 4YT4A 4YJGB 4WECA 4EUFA 3IQDB 3TFOA 1PZEA 3NDIA 2IZZA 3GR6A 1TVEA 3MEQA 4M8SA 4CM1A 3HNPA 4YJFA 3WGIA 4NK5A 1R15A 3QVOA 1R16A 1UR5A 3LF2A 3RUAA 1JAXA 5IXYA 4JBIA 5CDUA 2D59A 4OAQA 1VJTA 1E5LA 3WSVA 1WNTA 5TT0A 1LC0A 1NTOA 1UP7A 4NG5A 3U4IA 3QWFA 2FPGA 3BXXA 3ZGYA 2JHGA 2Q1SA 4B7UA 3GFGA 3BTSA 2VUUA 1E6EA 2BH9A 5FFFA 2PFGA 2RHRA 3WYCA 5KVSA 1LDYA 3HQ4O 5H82A 4YPOA 4PG7A 1RJWA 3BTUA 4RL6A 1C0LA 4WCFB 2GNAA 3KBOA 4LVUA 5KJEA 4CQMA 4D0SA 4ZQBA 1HDYA 2GN9A 3K6JA 2PH3A 4PIVA 1C1DA 2R00C 3JD0A 3MOIA 4PLPA 2Y93A 2HKIA 1B26A 3CZRA 5G0UA 1M76A 4DIBA 1YDEA 5IZ4A 4O0LA 1MXHA 4ALIA 1B7GO 4XQ9A 3LDHA 3JQDA 3WTCA 3W4IA 2VCYA 1C14A 1BMDA 1G1AA 1O89A 4ZN6A 2X9GA 3PXXA 3FNHA 2OXIA 2PTGA 4EJ0A 5TS3A 2V7PA 2O4CA 1LU9A 1U3TA 3E5RA 1GQYA 4RPLA 2PD4A 4MP6A 1Z82A 3FWZA 5JSFA 3DHYA 5TX7A 2OBYA 4XB1A 4BGEA 2YUTA 2G76A 1ULUA 5ADHA 1VKNA 4I5FA 3G0OA 4GSKA 1KYQA 4LK3A 1ZKMA 5CHEA 3DHEA 5U1PA 2GZ3A 1NFFA 5COQA 2OBNA 1LEHA 3OFSA 3V8BA 2NVBA 1I3NA 4NFSA 4CM9D 4INAA 5JDIA 4UAGA 3D64A 3UHAA 3AI2A 4ONEA 3ORFA 1UZNA 2OZPA 4AJOA 1H9AA 2I9PA 4AJIA 4E4YA 2VWHA 1U5AA 2WE8A 5ER9A 4CV2A 3QRWA 2NACA 1EVYA 3VH3A 2YFQA 1EVIA 1SMKA 3RQSA 4Y98A 4PCVA 3C7AA 1NAIA 1LLUA 1HYEA 4MP3A 1DSSG 4CPDA 3Q2KA 3RUIA 1NNUA 1SPXA 1XDWA 4RDHA 4KUGA 3OJ0A 2Q99A 1E1LA 2YQ4A 4CMIA 1XU7A 1VRWA 3GZ4A 2NNLD 3SBOA 1F8FA 4XJSA 1WDMA 4FFRA 3CMCO 5JO9A 2JD2A 4NHEA 1Q7GA 2O23A 1MV8A 3VVCA 4DIOA 4FIZA 4W9NC 2PZJA 4NJMB 3NTRA 3R1IA 1Z74A 4J9VA 5JY6A 4DMMA 1QKIA 4NFYA 1DAPA 2YDXA 3C7CB 2D5AA 2BKAA 1ONPA 1SZJG 2HMWA 3EUWA 3E5MA 4O59O 1GCOA 3LLSA 5I9MA 2Y0EA 3D4OA 4R3NA 1E0DA 4IIUA 3DBLA 3TQHA 4L9RA 1WVGA 4L8VA 1PX0A 4HUJA 3FHLA 3KYBA 3GLQA 1YS4A 1PGOA 1IULA 1FXSA 1AXGA 1X7HA 4ROSA 3S8MA 1R4NB 3RKRA 1K6XA 1EQUA 3EAGA 3IJRA 3L9WA 5JYEA 2HQ1A 2BELA 5FF9A 4GL4A 3Q0EA 1XR3A 3I9OA 4B4VA 3QE3A 1U2GA 3WJAA 2Q4BA 4E5KA 4J1TA 2X7HA 3B20A 3H9GA 4IGEA 1D8AA 2NV6A 1N1GA 1YB4A 2G5CA 4YTEA 4RF2A 4YEDA 1I0ZA 3MCVA 1HLDA 1YGYA 1LSJA 5HA5A 4W7HA 1PL6A 2NWQA 1CIVA 4U6QA 2NU6A 4BNLA 4BB6A 4F45A 1SC6A 4A73A 3F47A 3NAQA 2CD9A 1L7EA 2NVUA 5BNTA 2AQIA 1QYCA 4NBRA 4MKRA 4ND4A 3QSGA 4IJWA 2RH8A 4GPD1 1GD1O 4ALKA 1S6YA 3QHAA 5DBIA 1X1TA 2HK8A 4GWKA 1GQ2A 2R6JA 2V65A 3DC2A 3FWNA 5L9AA 4ZQFA 1A9ZA 4B3HA 1ISHA 3DBHB 4F6LA 3NJ8A 4AICA 1ZBQA 4S3MA 5JNLA 3TDKA 2FN7A 2VRCA 1LLDA 4LVCA 2EW2A 3ONFA 3KHUA 1N92A 1EBFA 2DFVA 3STHA 4CUZA 4R68A 4PZCA 3EGOA 5A5FA 2P5YA 1BVUA 1DIBA 3BHJA 3KSDO 4BS9A 3BMCB 4XDZA 4R3WA 2JD0A 1HDCA 5KNLA 2VOEA 4J0EA 3WGGA 2OP0A 1ZVMA 2X4GA 4OO3A 3U49A 4CODB 1H6DA 4YB8A 3U4DA 5I9LA 1U4OA 3GC6A 5F1OA 2YV2A 1P44A 2CY0A 2NQTA 2GSDA 2J5KA 5I7SA 1W73A 2VUSA 1TT7A 2BFMA 2J3IA 1A7AA 1CETA 3VDRA 2FWMX 4RF4A 3JCZA 1RKXA 1YQGA 4OKIA 3WYEA 3TN7A 2JCYA 2OUIA 5TRTA 3QVSA 1L1FA 1ML3A 3JQAD 1ZCJA 2PZLA 3DMYA 2PGLA 4G65A 2V6FA 5C3MA 3HDYA 4I5DA 4FFMA 5DP2A 4BOYA 4CLRB 5JDCC 1KEUA 1LDEA 3CMMA 1BWSA 2EEZA 3GMDA 4B3IA 4GX5A 4GI2A 2J3HA 4J2OA 4YRBA 1PQUA 3UH1A 4OGWA 4BO8A 3IOYA 3QV1A 3UFXA 2IXAA 1LQTA 4NJOA 3IMFA 3ON5A 3S2EA 5GMOA 1ENYA 4LGVA 2AG5A 4EITA 1R0LA 4DLBA 4W9NA 1SB9A 3FD8A 3JQFA 2CVQA 1K3TA 2D0IA 4MOWA 3Q3CA 5F5NA 3QWAA 4FW8A 4DTIA 3DXFA 3SC4A 3IP1A 1BW9A 2HUNA 3WBBA 1GV0A 1OC2A 4K6FA 2BI8A 5JCXA 2O3TA 5TF4A 1KY4A 3L77A 4IINA 3M1AA 1IYZA 4BNHA 4ALMA 1ONOA 1E7RA 1OC4A 1JN0A 4W82A 3C85A 2C20A 5BSFA 2BGKA 4RPKA 1GU7A 2ZB8A 4FFOA 1ZSYA 3TRIA 1HRDA 4CR6A 2A4KA 1Y8QB 2OO5A 1WMBA 2AQKA 2NVWA 5IDXA 1VJ1A 4EI2A 3OHSX 2D2IA 1P1FA 3IKVA 1IUKA 1GPDG 1HDRA 4JNKA 3AM4A 5BT9A 2X9VA 3VPHA 4CQLB 2LDXA 3IJPA 4AJ1A 3VKVA 3U9LA 1V3VA 3KO8A 2O3UA 4DC0A 5A05A 1GYPA 1B8UA 1R4MA 3AW9A 5K0ZA 3PHLA 4FB5A 3I23A 2HMSA 3B6ZA 4JX8A 4QT0A 4XX0A 2B35A 2PGJA 3F4BA 3GUCA 4CUKA 5A9TA 3WGTA 4H7PA 3WFIA 3NGLA 1MP0A 2ZIZA 1ZXBA 1E7QA 3I9JA 1IZ0A 4XYBA 4MKZA 4TRRA 2PKQP 4M86A 1WPQA 1NR1A 4R69A 3U09A 5G0WA 2OL4A 1MC5A 1SBYA 2PKQO 4OM8A 1PQPA 2CMDA 3E8XA 1ADGA 4RVUA 1DRWA 2X86A 2GRAA 4AJEA 3CZMA 2ZTMA 1TXGA 3FSRA 5JY1A 3PHHA 5CP8A 2EJWA 2NQ8A 2RBEA 3HE3A 4WEQA 3W1VA 4CLOA 1WXDA 4DBVO 2IRWA 5DCYA 4R01A 2CVZA 4WCFC 3SX2A 3RC7A 3JQ6A 4YJHB 1B3RA 1W4ZA 4LCEA 3ULKA 2ZB7A 1EE9A 1E77A 3UF0A 2B37A 1XU9A 1C0IA 1EVZA 4GMGA 4PLYA 3PQFA 5CPFA 2G1UA 4HWKA 4ZVVA 4TZKA 3VPSA 2D3TA 3EYWA 1NWCA 3CXRA 4FFPA 5C7OO 1GV1A 4GMFA 1XLTA 2OFPA 1WAMA 2QG4A 5L7YA 4JJIA 1RYEA 3GY0A 1XA0A 3BHMA 4Z3DA 5GZ3A 3DEYX 3BHIA 3Q1LA 3QLJA 4HKTA 3CKYA 3GK3A 4DYDA 2IE0A 4FQ8A 3GG9A 2Q1WA 3C3XA 1UJMA 1VE9A 4N5LA 3WFJA 1JWAB 3DOOA 1SOVA 3UVEA 4MKXA 5L4SA 2O50A 4BKUA 1P0FA 1QMGA 3ZWYA 4FSHA 4YBZA 2VNSA 5A9SA 4J3FA 5JDCA 4MVJG 1FDVA 2JL1A 3BMQB 3WQQA 4DPKA 4EUHA 4WLVA 3SLKA 3AI1A 5TJ9A 4CUJA 2EGHA 2X6TA 3OIFA 3NEPX 4IXWA 5ES3A 4BNNA 1T24A 3TZHA 1IHYA 1QYDA 3EZLA 4BNGA 1I30A 2RIRA 4U8GA 5L7WA 1SEVA 2IODA 5HM8A 1TA4A 2YQ5A 3H3JA 4UVEA 4FC7A 4ID9A 1I01A 3CSDA 4GLOA 4U7WA 3WGZA 4DL9A 3AY3A 1PU2A 3ZWOA 1EDZA 1KEVA 5JMPA 3FBTA 4RVDA 2VWGA 1L7DA 1PGQA 2OHXA 2NU8A 3IIEA 4PLWA 3DDNA 1QV7A 1LQUA 4XA8A 5I9NA 3KYCA 2QIOA 4YAEA 6ADHA 2Q2VA 5AXAA 1Z6ZA 2J6IA 2Y1FA 1YQXA 1TT5B 3A14A 3WGYA 4J2HA 3KTDA 4BO2A 5ICMA 3H5RA 4B8ZA 1YE3A 4Y6RA 5EERA 3OIDA 4WJZA 1QLHA 1B0AA 4BB5A 2VNAA 3EHEA 4W4TA 1M6HA 1HT0A 3QIVA 2AA3A 3K96A 3K73O 2QW8A 5DCWA 1GY8A 4YJGA 4RVGA 3DZFA 3RFTA 5A02A 1UUFA 3UGKA 3UUWA 4JROA 1JU9A 2X8LA 3E9NA 5I7FA 4B4UA 1ISJA 1GEEA 1Q7BA 2EG9A 3CTMA 1D1TA 3KSUA 1YDWA 5A4DA 3ROQA 3VPFA 3GG2A 4XZ3A 1K6JA 4PVDA 4GSLA 2VHWA 4TVBA 1ARZA 3F3SA 4UUNA 5TSDA 2B4RO 1ZIDA 4TRJA 4YRDA 2ZK7A 4PLGA 3S2FA 4ALNA 4L74A 1YJ8A 4DA9A 1HYHA 4R41A 2EJVA 4JBHA 4IS3A 4TZTA 2JCVA 4BUCA 1A27A 3PZRA 3DONA 1YVEI 1P9LA 3GEMA 2X1HA 1CEQA 2AMFA 3KEQA 4WCFA 1G6KA 4EJMA 3ROMA 1ZMOA 4P4GA 1BG6A 2C59A 3R0IA 3GOHA 1I10A 5AQ1A 3F5SA 1KERA 1O0SA 4R1UA 1PIWA 2PD6A 2X5OA 3QVWA 3IKTA 1RM3A 3NTOA 5CFZA 5T8KC 4J7UA 4BNFA 5CEJA 3ITDA 1TI7A 4M87A 5DN9A 3L0DA 1YXMA 1KVQA 3DQPA 3QY9A 4BNXA 2XXJA 2GZ2A 3GGOA 3ZCXA 2X22A 4E32A 3I6QA 3PJGA 3ZNOA 4D3DA 4RF3A 3MTJA 1E3JA 3DHNA 4EYEA 2P9GA 3KETA 3E9MA 2VHZA 3HN7A 4YRAA 9LDBA 4KTTE 2P4QA 1NQAO 4L4RA 5DZSA 2HDHA 3ZWMA 3ZZNA 1U1IA 3GRPA 3AUTA 1S7CA 4QTZA 1U4SA 2W4QA 4CMBA 3KLMX 3RU7A 2EW8A 3ST7A 5L4NA 3TNLA 3ZH2A 1YO6A 1LLCA 4RJTA 3LF1A 1BXGB 1GUFA 2I99A 2JFGA 4XGKA 4XWYA 4YVFA 3BA1A 3G49A 3WSWA 4YAKA 1PGNA 3ITKA 4LISA 4UVIA 4BO6A 2Y1DA 1YBMA 1YL7A 2HU2A 3GVIA 4B4OA 3W4JA 4NU6A 4XGNA 4BMSA 1P1IA 3W8DA 1DPGA 1ZK2A 5CDYA 4TQGA 1H0KA 1TLTA 1WDKA 2PWZA 2AE2A 3HZZA 4GKBA 1X0XA 4CM9A 3FTPA 2GF2A 3WNVA 4TWRA 4KDFA 3WWYA 4CMGA 3DTTA 1M2WA 4XCVA 4MO2A 4YWJA 4XYLA 3GHYA 1EUCA 3IL2A 1BXZA 1R0KA 4J7CA 2PA3A 5ER6A 5HS6A 5F21A 4NJMA 1ENPA 4TVOA 1FDUA 4WASA 3ICCA 1ULSA 2P91A 4ALJA 3EVNA 4Z0HO 4PLCA 2ZYDA 3PRJA 1AHIA 1DBVO 1T2FA 2B69A 1KEPA 3PFWO 3ZHZA 1LDBA 3JTMA 4R5HA 3PI7A 1SEPA 1VL6A 3D4PA 3KUXA 1H2BA 1VPDA 3K30A 9LDTA 5CEFA 5JW6A 2VYVD 2JJYA 4E2XA 1R4NA 3U3XA 3OP4A 4N18A 3KB6A 4GGOA 3IUSA 1V3TA 1KVRA 5I8ZA 1PJSA 4M49A 5EPOA 1TEHA 4E3ZA 5ILOA 4RLHA 5TNXA 3NT5A 4AJJA 1Z7BA 4GVXA 2DT5A 5B4VA 3S2IA 3ASUA 2Q2QA 3ADOA 3GMSA 3BIOA 4S1VA 1U28A 4CMHA 5KJCA 1LDNA 3GEGA 4ZQGA 4EGFA 1EMDA 2PKRA 2YDYA 3TZKA 3VHRA 1VJ0A 4KWHA 4UEJA 3G1TA 4HNHA 1OI7A 4I9HA 4DPMA 2A35A 2BGMA 4L4XA 3T7EA 3ZWXA 2JKVA 3HUDA 4AJLA 3VOSA 3TSCA 3RI3A 2HJRA 1F06A 5I7EA 3RWBA 5JE8A 4MVJD 3WQRA 2GUGA 1HDZA 2Y1EA 3I9MA 3V5NA 2EP5A 2GZ1A 4IMPA 1E3SA 3JD3A 4WGGA 3RC1A 1WMAA 2C54A 2AEJA 4OKNA 1J5PA 2EKQA 1LBEA 2A94A 3ZNQA 5T8KA 4D45A 3DBHA 2CSUA 4L73A 3WWZA 4P38A 5KJ1A 2CUKA 4J90A 5A9RA 4ZRNA 1PZGA 1A5ZA 3DTYA 4UREA 4DWVA 2O3RA 4B79A 5U9CA 4QX6A 5C7LO 1XSEA 5JCJD 2CNBA 1LX6A 3K8ZA 3QP9A 4KQWA 2OOSA 1VI2A 2Y1CA 3P5SA 5EN4A 4MVJE 5BR7A 2JCXA 4PLTA 4RVHA 3NT4A 4C7KA 1VL0A 2V6MA 3BMCA 5DOVA 3RBZA 3VH1A 1LRLA 3BTOA 4YYZA 1JVSA 1DJQA 3HB5X 3C1AA 3HDHA 4WPGA 4XIJA 4II2A 4MINA 3OQ1A 4MVJP 4I8XA 4FPXA 5JS6A 1PJTA 1ZUD1 5JFOA 5JO0A 1B8VA 2JD1A 4UULA 3AJRA 3FRJA 4I5EA 1MA0A 1NPYA 2GD1O 3V2HA 3TJRA 3D3WB 3GZNB 3GAFA 4NU5A 2O2SA 3UCXA 2Y1GA 5JAMA 4MDHA 5TT1A 5ENDA 2HK7A 2X5KO 2PZKA 3F46A 3NRCA 5IF3A 1HE3A 4HY3A 4EDFA 4EZBA 2ZQYA 4BV9A 3I9KA 4U0JA 4U5QA 4OYRA 1KIFA 4Z9FA 1FDTA 2JAPA 1Y8RB 4BNIA 1O95A 2VOJA 4CLRA 3JQFC 1SAYA 3QW2A 1U3VA 2X0NA 5IXSA 1CRWG 3HSKA 3OJLA 2WWRA 4GH5A 4HFMA 2VYND 4HFRA 2F00A 3BTVA 4BGUA 1JA9A 4NH4A 2Z5LA 1PR3A 5KTKA 2Q46A 2CZCA 1BVRA 3P2OA 1P1KA 3ZV3A 3V2UA 5IDYA 4DUPA 4I08A 5IN5A 3AFNA 3ZWVA 1ONNA 5DNAA 4TMFA 3FPLA 1RWBA 1J6UA 2VT2A 3W6ZA 2P2SA 2C07A 1LNQA 1EFLA 3PWZA 1ORRA 3S55A 5JAIA 4OHUA 3R3JA 5A1TA 1HETA 4R5MA 4YAIA 5H81A 1AGNA 1H5QA 3DAPA 4GX2A 3ETGA 1GYRA 1RPNA 1UXGA 2X9NA 1V0JA 4BO4A 4J4TA 4J4BA 2XAAA 1WWKA 3WNQA 1Y8QA 1OBFO 2RH4A 3AI3A 5T67A 5TQVA 4B7CA 1SB8A 3EC7A 1UP6A 4MIYA 3ZU4A 2HAEA 3BMNB 5F3RA 3Q9UA 1I2CA 4IIVA 4U0KA 2E48A 3C1TA 4CQLA 2Q45A 1N2SA 4RQTA 1MXFA 4H16A 3LYLA 4BNJA 5FYDA 1PR9A 5DOZA 2EXXA 2VZ9A 3UN1A 1C0PA 1CF2O 4WLFA 3C24A 3FR7A 4JIGA 2GN4A 1N7HA 4O5OA 3OJOA 4D44A 4XQGA 1E5QA 4XQCA 3KOUA 4ND2A 1E1NA 3ASVA 4FN4A 4IUYA 1DIGA 3KEOA 1GZ3A 2UDPA 2I66A 4U6SA 3RJ5A 1CYDA 1F12A 2HJSA 2B0JA 4GBJA 1PL7A 1C0KA 2TMDA 1I33A 3FF4A 1K89A 1E6UA 4DXHA 1PS9A 3ZU5A 2HO5A 2BFAA 3FTNA 4Y67A 4D46A 4IJVA 1FK8A 5EIOA 3PDUA 1U3UA 1GZ4A 1H6AA 4RZHA 4BO9A 5BSGA 2UVDA 5HWSA 1CERA 1MFZA 3PJEA 4JCOA 3WLFA 1GTMA 1E3WB 2PD3A 4J1NA 3TOZA 3IUPA 4YT2A 4JJGA 4YJHA 1PJBA 3RSHA 3K2EA 2JFFA 4QFCA 2V6BA 1LI4A 1HYGA 1X7GA 2BMAA 3L6EA 3WMXA 1YWGO 4GLLA 4HFNA 3W6UA 2Q50A 5C7IO 5L45A 1YBVA 2Z1NA 3BZUA 5LC1A 3G17A 2E37A 4NBVA 4ND3A 4Y9DA 1P31A 3K9QO 2CDAA 4R9RA 2VQ3A 1QYVA 1D1SA 8LDHA 4CM6A 2D8AA 2J5RA 1UXHA 1ZSNA 3K5PA 1DJNA 2O3JA 4WLUA 3FNEA 1RM0A 2PNFA 3RUDA 2Y0CA 1A9YA 3B1JA 2CDCA 2DBQA 4HP8A 1K6IA 4LMPA 3JQGB 5K1SA 1GAEO 4E21A 3GH3A 2DUUA 1PJ3A 5DULA 1T2DA 3AOEA 3DAFA 3O26A 2DQ4A 2GASA 2VN8A 3OEYA 1X7DA 1AN9A 2W8ZA 1EUZA 3ZWNA 4DLLA 3DZBA 3BMQA 4P4LA 3P19A 3QA9A 5AXBA 1LDGA 3JQAB 3ZHXA 5HS4A 3EK2A 4PG8A 3B70A 3Q9NA 1B8PA 4NDNE 2QYSA 4RLSA 2EERA 4OXKA 2ZB4A 3LVFO 3UXYA 4DGSA 1HDXA 3WYBA 2O48X 4GGPA 1DFGA 2YV3A 4JGBA 2YJZA 3O4RA 4J1SA 2W2LA 4JXKA 1NPDA 4ZRMA 4CMKA 3JQ7B 1LC3A 1ZK0A 3O8QB 1KEWA 1XCBA 2DLDA 3NJ4A 4MP8A 1YB5A 4CMEA 3ROKA 4XQEA 2AXQA 5COBA 1PGPA 3AU8A 3EVTA 1E7MA 4X54A 2POQX 5EJ2A 3QWHA 3DOJA 4XEHA 5CEEA 3I83A 4KQXA 4E5YA 1F14A 1X15A 4RQUA 1KBZA 1ZEMA 3BAZA 4QECA 2VHYA 3ZHBA 3NKLA 2H6EA 1GZ6A 1ZW1A 3O9ZA 3GA0A 4BNKA 3H6KA 4YR9A 1XELA 3CH6A 2WD7B 2DBRA 2EKLA 4XDYA 4PN3A 1I24A 3TPCA 1CQJA 1YOVB 1TT5A 4QQRA 4RZIA 1Y81A 2BGLA 2BLLA 3JD4A 1U8FO 3W8EA 1YONA 5BNFA 3RKUA 4LRTB 3V1YA 1F0YA 1U5CA 2HLPA 3N74A 3QJ5A 5A5EA 4D3FA 3AM5A 5EESA 5DP1A 2FOIA 1IZ9A 3WOHA 1GQQA 4RVSA 3KVOA 5F5LA 2NTVA 2VRCD 2XF8A 4YAJA 5G0SA 1OFGA 1GUZA 3QWIA 1OMOA 4QXMA 3TF5A 2GYYA 4Q3CA 3L9XA 3L07A 1I8TA 4PLZA 3ZWBA 4RF5A 3Q11A 1PSDA 3DZIA 4LN1A 4PZDA 2VHVA 4E2YA 4IDAA 2QRKA 1Q2XA 2HMTA 2VUTA 4KUEA 1T1RA 5T6BA 3DWFA 3H2SA 2TMGA 2O2YA 1V35A 2YZ7A 4Q3AA 4E5PA 4WUVA 4DIFA 3T4XA 4Q3EA 3A1NA 3C8MA 4JP2A 4CMJA 1ZNQO 1ENZA 3LC1O 4IJKA 2HRZA 5BSHA 4WE3A 1X0VA 3N58A 3M2PA 5T57A 1O9BA 1NWHA 2G17A 5ENVA 4R4JA 1ZK4A 4BQRA 4DPLA 1AHHA 4N54A 1R37A 3LSYA 2ZYAA 3NDRA 4YJDA 2I76A 3H5NA 3HB4X 5KOIA 1LSOA 5TJHA 1PJCA 4BGVA 3GN1A 3PJFA 2GR9A 1I2ZA 1ZJZA 3Q6IA 5IFLA 1I3KA 1ZXLA 4PLVA 2IZ0A 3AM3A 2VWPA 1WDLA 1Y9AA 3JQBC 3I6IA 3NDJA 4QSMA 4NK4A 4OOFA 1DB3A 3AOGA 3JQ9C 3AY6A 2NLOA 1T2CA 1G0NA 2FHSA 4IY1A 4NIMA 3TWOA 5FI5A 4BO3A 4R1SA 1WZEA 4H3VA 3EZYA 5DF1A 3H9QA 4E5MA 4IGFA 2J5QA 3ANNA 2ZTUA 3GVXA 3RROA 1MX3A 1PJ2A 3GPDG 1XYGA 3SJ7A 1HSZA 4M54A 1BXGA 1DFIA 1U2DA 4LRSB 3L4SO 4AJNA 2JAHA 4PRKA 3RVDA 3TFQA 3OECA 2X5JO 4CMCA 4DLAA 1Q7CA 3GN2A 4Z9XA 3H9JA 1NFRA 5IZCC 3PEFA 2IXBA 2ZJ1A 1PJ4A 4CLDA 1H94A 2P9CA 1DLIA 1HDGO 4IMRA 3BYZA 3HDJA 1T1SA 3G1UA 3V1TC 4JN6B 3GHHA 3ZV5A 2Q3EA 4Y6SA 4H15A 1VKOA 3E1KA 1NFQA 4UEKA 3GDFA 3WR5A 5KKCA 3H4VA 3RUFA 1JKJA 3ZI0A 3E6AA 1DIRA 4J91A 4WCDA 3R3SA 2BI7A 2BHLA 4DC1A 1Q0LA 4Z0TA 3DZKA 4AVYA 5JXWA 3OQ6A 3ENKA 1GADO 3H9UA 1P33A 3ZV6A 3O03A 4NMHA 4LSMA 1J4AA 2EWMA 4J49A 2Y99A 2C29D 4ND5A 4PG4A 4TKLA 3LT2A 4BKPA 4LW8A 2I3AA 1QP8A 3ZW9A 3RC2A 2QHXA 1DC6A 3NX4A 2PLAA 5CPBA 2DTXA 4IDFA 3PGJA 5BSEA 4IQ8A 1QLJA 3LZ6A 3CPSA 3DBRB 1A7KA 4NPCA 2PR2A 3EY4A 2C7VA 1IPFA 3U4HA 1BHSA 4G81A 2J8ZA 1EK5A 4UVDA 5KVVA 4RCVA 4DVJA 5B37A 4J4HA 3JV7A 2CF6A 2RAFA 3FPCA 4EW6A 2NU7A 3PK0A 1HKUA 3D5TA 3F5QA 4WKGA 3RASA 5TLSA 2IZ1A 2Q2WA 5MGBA 5IJZA 2P68A 3L6DA 4XRRA 1H9BA 3NYWA 3WGQA 3FNGA 2EP7A 2C82A 5HBRA 1UXKA 2VYVA 3A28A 1ZJYA 1SNYA 4IDDA 3BMOB 5B12A 1DC5A 4A2CA 3PHIA 3ANLA 4PFJA 2CF5A 3KM0A 3GPIA 1T26A 3JYQA 4HBGA 1M6WA 2A92A 4DYVA 3GQVA 1UZMA 2X0IA 3CE6A 5EMHA 2WD8A 4N5MA 2H5LA 3DFUA 4IZHA 3KYDB 3GAZA 4QO8A 2DM6A 2DKNA 5EL0A 1MGOA 1P1RA 2GPTA 4FJ1A 2XPCA 3KXDA 1N9GB 2H9IA 2UUOA 5L4LA 2OORA 3QVXA 5A06A 1KS9A 3VAZA 3VC7A 1P77A 3MJSA 4OQZA 5FI3A 4CL8A 1Z45A 3JYNA 1BDBA 4EJ6A 3JQBA 2C7GA 4KDEA 4MVJA 5COAA 3JYOA 4YA6A 3WTBA 4EEZA 5KCZA 3JQ9A 4J6FA 1RM5A 2W90A 4FCCA 4AJ2A 3JQ8B 4PG5A 3VTZA 4WLEA 3RBVA 1UDAA 4HADA 4R54A 2VHXA 1I3MA 2X58A 3UICA 4JK3A 3L4BC 3GNSA 1UXIA 1JWBB 3K31A 3I4CA 1NVGA 4HV4A 5L40A 3D3WA 3GZNA 5IG2A 2UAGA 2WYUA 5IAAA 1PZFA 2UV8A 2ZATA 4WOKA 2WTBA 3IAHA 1GDHA 1P45A 1PGJA 2W98A 1PTJA 5B4TA 1E1MA 4HNGA 3OM9A 1JTVA 2AG8A 2ZQZA 3PIDA 1I32A 5IZCA 3PIIA 4MPDA 1NM5A 2YHIB 1EE2A 1ID1A 1H6BA 3G79A 4TSKA 3QVTA 5BNIA 1JKIA 4ESOA 1Y8RA 4TRMA 1DRUA 3HG7A 3GDOA 2YFHA 1R6DA 1VC2A 3EDMA 4ZA2A 3C1OA 4YAGA 4FJ0A 5KJ6A 3ETDA 5K6AC 3FCOA 5B4UA 4R51A 2BFOA 1XWFA 2V6GA 5HRUA 2DUWA 3OA0A 1NR7A 4QO7A 2NTNA 1UP4A 3KRTA 3L6OO 2G0TA 4E0BA 2GDZA 5FEUA 3SVTA 3K92A 3OICA 2VTEA 3IP3A 5TGDA 3KLPX 1TB4A 1YB1A 1B14A 2OMEA 4Q3NA 3W8FA 4OH1A 5ITWA 4GAEA 4XYMA 1AE1A 1PQWA 5U4QA 1JAYA 4CM4B 2JHFA 5IDQA 4IM7A 4FJ2A 1SO8A 1Y1PA 1Y6JA 3ZU2A 1DFHA 1N1EA 4J43A 2YYYA 2W2KB 1ISMA 4TKMA 4CV1A 1BDMA 2IYOA 3MWEB 4D42A 3MOGA 2QZ9A 2IYPA 4PGFA 2GN6A 4UUOA 1BGVA 3VDQA 3PZBA 4M1QA 4PVCA 3RCBA 4ALLA 4L76A 2WE7A 3RUHA 4D3SA 1K0UA 1P1JA 4DMLA 1C3VA 4FDAA 1LRJA 4XYEA 3S2GA 1DRVA 1E92A 3BMNA 2FRDA 3DO5A 1C1XB 1E3IA 4Q3BA 1UDCA 2DBVO 2I67A 2BD0A 4J9UE 4A10A 4IJUA 5AVOA 3RUCA 1GFSA 4IDCA 2QYTA 4ZQHA 1QRRA 2OGUA 3RBXA 4N7RA 4YQYA 2F1KA 1HE2A 4RPJA 1I2BA 1XEAA 3ONEA 2I6TA 4OSPA 5A03A 1FF9A 2QQ5A 5CG2A 4XR9A 3I3OA 4ND1A 3FBGA 1EBUA 4I9NA 4TRNA 3OEWA 1O8CA 3QQPA 2X0RA 2AE1A 1LUAA 1QYWA 1EZ4A 2SCUA 5G4KA 3ANMA 3UW3A 1FDSA 2DU8A 4XGIA 1E7WA 1M67A 4G2NA 5G4LA 4JJFA 5L7TA 3ZNNA 4ZHSA 1H6CA 1NQTA 3HFGA 5JC1A 4URFA 4Z0PA 5L51A 1ZFNA 4FS3A 5J23A 3F9IA 4NBUA 4K26A 3WGHA 3PVZA 1U3WA 5JPIA 4OMUA 3WGOA 4BO5A 3I52A 2I65A 3LU1A 1JVBA 4GX0A 3E18A 2FZWA 3ZNPA 4G5HA 1E3WA 5A3JA 1XHLA 3NTQA 3N7UA 3UKOA 4NBTA 1E1KA 8ADHA 3IS3A 3GNTA 3OSUA 4UUPA 2I5PO 3RAJA 4A03A 2LDBA 5JBIA 1WZIA 3JSAA 3SC6A 1O5IA 4PRLA 1HZZA 2DBZA 2C5EA 2O3QA 3KSZO 1ISGA 2EKPA 3FN4A 3SLGA 2FPIA 2PV7A 4LCJA 3ADPA 3H65A 4WNCA 4Z3KA 2C2XA 3PWSA 4M89A 2Y05A 2HSDA 5ICSA 1W8DA 1OOEA 3AK4A 5GZ6A 3SJUA 4RORA 3L4BA 3AOEC 4E30A 4IBOA 2NM0A 4PZEA 2PZMA 5C5IA 5KKAA 4N5NA 2P4HX 1HEUA 3ONDA 4CR7A 1UDBA 2ZCUA 2IDZA 4KP7A 3JQGA 5THQA 1YL5A 1Z73A 1DHRA 2VZ8A 3D7LA 4BVAA 3OJEA 4WK6A 2DTEA 2QX7A 4UVHA 2ET6A 5CAEA 3E48A 3W4KA 2B5VA 4IQ0A 1DHTA 3PFFA 3JQAA 4CM8A 5K6AA 4PLHA 2GLXA 1KOLA 1QG6A 2PY6A 2XXBA 3RUEA 4CMEC 2AEMA 4GWGA 3GT0A 4D7AA 1MUUA 3LLVA 1XIVA 3PYLA 4Y8VA 1E6WA 1ZSVA 4GX1A 1IL0A 1H93A 1T25A 2Y67A 2GERA 3MJCA 4CLHA 5JAZA 2XOXA 3CUKA 3MJEA 3JQ7A 3E9QA 3H9EO 3TZ6A 3O8QA 1WLYA 1SCUA 3B1KA 3NV9A 2VT3A 4KZPA 3VZQA 1ADCA 3I4FA 3HFSA 3U4CA 4ZQEA 2B36A 3P7MA 1YL6A 3UCEA 4YJFB 4K6CA 4YDRA 3FNFA 2FSVA 1CQIA 5DDIP 4NNJA 4AJHA 4LMRA 4CQMD 4AFNA 5A3VA 4E6PA 1KVUA 3COSA 7MDHA 3ZHYA 2YY7A 5CDTA 3RFVA 4KOAA 4FR5A 4XR4A 1NPTO 4CMAA 5C37A 3H3FA 3AFMA 3E03A 4GVLA 1CWUA 4E5NA 1K5HA 1P0CA 2E49A 2WD7A 3LT4A 4MVJI 4RPGA 1O94A 1YOVA 3DZJA 3GNQA 1LXCA 2NUAA 5AYVA 2NADA 1Q0QA 3DZGA 1DC3A 4WOJA 5AXCA 4BMVA 4CQMB 1LLQA 1NHWA 3OIGA 5G4KB 1BXKA 5F1PA 1A4IA 1C1DB 1ADBA 1I3LA 1NHGA 1NX6A 2G82A 1YRLA 4MIEA 1MFPA 4OQYA 4BO0A 3WBFA 2J3KA 4NFHA 3CINA 1HDOA 1NVMB 3E82A 3WDSA 1M75A 3HJAA 1D3AA 4BKRA 5GY7A 5JLAA 3RU9A 4D0RA 4B3JA 1T4DA 1MC4A 3I9NA 4WLOA 2R00A 4P22A 1R0SA 5G0TA 3VKUA 5DBGA 4A27A 1X14A 4M55A 3NGXA 4UVGA 5DCUA 3GVPA 4A5OA 1W6UA 2NTJA 1A4UA 2FZEA 1Y5RA 4MVJH 3ENNA 5A04A 5EQDA 3DR3A 4BL5A 4BNUA 3VH2A 1DIHA 2WMDA 4K9DA 1ZH8A 3GFBA 5I7VA 3M1LA 3CEAA 4BO7A 3VH4A 4CLEA 5JMWA 4YT8A 2RCYA 4DQXA 3PLRA 4AG3A 3PDJA 3G3EA 4F3YA 5KVCA 1LSUA 2PH5A 1V3UA 3OJFA 4W99A 2Q4EA 3MTGA 3RD5A 1KC1A 3PTZA 4XB2A 4NI5A 1FJHA 2E6UX 1D4FA 4RDIA 2WJPA 4B8WA 1A71A 4QEDA 3H5AA 5LDGA 3UCFA 1FDWA 2AQ8A 1LTHR 4Y6PA 4CMIB 5T5QA 4KTVE 3DAGA 5EINA 4Z6KA 1MB4A 1VSVA 3NUGA 1I36A 1U7HA 3DOCA 2GN8A 3GGGA 1DDOA 4FD3A 4KUHA 3ZWAA 4DBZA 4KMSA 3WQSB 3PYMA 4HFJA 2PGDA 3M2TA 1RM4A 4CM8B 1HTBA 1MLDA 1PJQA 4DQVA 3OF2A 2P9EA 4YACA 2ILTA 1E7SA 4IDGA 3SXPA 2AEFA 4O1MA 5G0VA 1G0OA 2DPHA 1PJLA 3AU9A 4DRYA 1XQ1A 5L3ZA 4XD2A 4IPTA 3U5TA 2PK3A 1U7TA 4BNVA 3ICPA 3TZQA 4CV3A 1DEHA 3U0BA 1HZJA 1E7YA 3MZ0A 2CFCA 3DBLB 1DXYA 4JBGA 4BKQA 4DREA 3X2EA 5CDSA 2P5UA 1UZLA 3EMKA 3TZCA 1VLLA 2X23A 3VZPA 4DQUA 1LA2A 2HK9A 5ILGA 5L53A 5IN4A 3HHPA 3DBVO 1NYTA 1BSVA 2YV1A 4C4OA 5LDHA 4NBWA 3JD1A 1MG0A 1RYDA 1IY8A 1N8KA 1UAYA 4MVJF 1PEDA 1Y9EA
chains in the Genus database with same CATH superfamily
4MCAA 2P6PA 4HD8A 1P1HA 4IDEA 1YK1A 3KSRA 1NONA 4FZJA 4PE5B 1E79D 1DQYA 4B2PA 3SP1A 2OV1A 3EZ2A 4GKKB 3INTA 2FR0A 4K9PA 5JAQA 3OQJA 4DLKA 5AM5A 3ZDFA 2Z4SA 2A9RA 1DVRA 1USKA 2JLCA 3NHWA 4A0SA 1Y5NA 2QD4A 4Q3LA 4NCAA 3PGA1 5SZJA 5KBYA 3AVXA 1GVNB 2B1IA 4B4WA 1DAOA 3IBYA 1NLMA 3OHMA 3PNBA 1RFGE 4HDKB 4C0LA 3Q9SA 1JLLA 1L2TA 3EOBI 3ICOA 4WACA 2ZITA 4PNHA 1Z68A 4A5SA 1GKLA 1GGMA 4L08A 4Z8XA 3R7DA 4M53A 4ZJUA 5CDFE 3RT1A 2NT4A 3MMSA 3GAMA 3U81A 2Z95A 4EIWA 5JCZA 3OKAA 4MLDA 3AUAA 3GF4A 4OU5A 1NASA 4OHFA 3BFKA 1GL7A 3COWA 1QRDA 3TQRA 2ZXFA 2GX6A 3BRSA 3OOHA 1ECGA 1F5NA 3MJVA 3NT2A 2Q6LA 3LUCA 3T5GA 1K5PA 1E3LA 2Z1MA 3AY7A 3ZH9B 5CFOA 4IUBS 2OK8A 4OQ4A 1FLDA 1JFVA 1COWD 3MWDB 4PFSA 3HKDB 2YASA 5CD9A 1QH0A 3A1TA 4KQ9A 4TN1A 2ZSKA 4JD5A 1DJPA 3I5MA 4D43A 5DNWA 4B3RB 3PPIA 1JQBA 4JKIA 4KGVA 4AULA 1BEUB 2GM4A 1T6YA 2UYHA 4R6WA 2H1SA 4C7VA 2GCGA 2ZIWB 1T0PA 1CRQA 3TLKA 4BV3A 2WFMA 3K2IA 2REXB 1O03A 4LZLA 4N3GA 4Q66C 1W0CA 5FL7A 3EXFB 1GSIA 4OL9A 4OXXA 4XKJA 1RXVA 1ISFA 4BMNA 3N0WA 4I55B 3E23A 1LLFA 1DKOA 3SE0A 2J0SA 4H77A 3C3WA 2IGBA 3F4LA 3UZUA 2ZTLA 3PPXA 1U7OA 2FW1A 3GMTA 3PWTA 3AUSA 2H1FA 1P3DA 1QLWA 4A6XA 1S2LA 3NNNA 3PCRB 4D4HA 2OFXA 1M1XB 5AK3A 4FFLA 3TD9A 3VPGA 3T34A 4DDMA 4F5WA 1HFJA 3PUXA 2J9XB 1O6BA 5BQFA 1LSSA 1Z8DA 1CUZA 3NBZC 5JC8A 5HFJA 3DA8A 4YP1A 3FB1A 4NR0A 1Y5IA 5BSVA 1UBEA 1VECA 2E4AA 3V9PA 1E8MA 3SDSA 2D5CA 3KPJA 1QR6A 2WHPA 1SKMA 5CG1A 3OE4A 2P90A 4MV3A 4NDZA 5F5XA 5LKRA 3FROA 4QYIB 4TYWA 3PEEA 2A6PA 3EH2A 4LK2A 1YR3A 4QXAA 4HX2A 5CB0A 3PSHA 1M5TA 2O5EA 3WX0A 1HV8A 3T1OA 3O3OB 4V24A 3FUVA 5DU2A 3QUQA 3VR2A 1PSWA 2KS6A 2AQHA 2R5FA 3A26A 5JG7A 2O19A 4RTRA 1ID8A 1SWWA 3K1JA 5F9MA 4ML3A 1OFHA 2WJ6A 2W2LD 4L0QA 3PQEA 3LT5A 3X2FA 2IKQA 2I55A 1YCHA 2XB6A 4WZAB 2I80A 3CRMA 3RDPA 1G21A 3KAQA 2HTEA 1H5NA 4V02A 4ED9A 4BMCA 2XXAA 5EHZA 3LK7A 4UMVA 5F73A 3GP5A 4MW4A 5AUOB 3AVYA 3DBOB 5F35A 1WQ4A 1XQWA 4ZYWA 2HMVA 5AVVA 1QRTA 4PSAA 2I7DA 3OQVA 2Y68A 5HDBB 2VZ0A 3INRA 3VHQA 1CS4C 3FIJA 2UUPA 1KY5A 3IBGA 4MQEA 3PC8C 2CFIA 4M22A 1XRNA 3RFXA 2EFYA 4L75A 1Q0HA 1YKGA 3ENQA 4MLZA 4ZTZB 4FC6A 4JR1A 2FAXA 3PNOA 2QUZA 4R9SA 3WYNA 4BGDA 4Q1CA 5HGXA 1J7JA 1PNVA 3RM3A 3U9SA 4KVGA 1NURA 2MSDB 1LJLA 1ISIA 3JZMA 3WIVA 4RQBA 1R3DA 1KMHA 2VQ6A 3ESAA 1Q1ZA 3K9LA 4O4JA 1P74A 2QRJA 1IHUA 1K7YA 5CJJA 2DVMA 3I12A 1BEZA 1XV5A 5BSMA 4CM7A 5B2ZA 3A31A 2FEMA 1J0BA 5JH7A 3RC9A 4MDFA 2Q49A 4GYYA 1V47A 3J81A 3PUJA 2ZUUA 2ZI3A 1O54A 3CLUD 3OQPA 3OH8A 5ADUS 4I4CA 3U56A 1QIHA 1QQ5A 4JS0A 2HRBA 5KIAA 3PL1A 4X64B 4KXFB 2GZSA 4ILKA 2VH2A 3M33A 2UYOA 1SOWA 4KFTA 1FUEA 4MWZA 4O6VA 1LPSA 2WSBA 4UHBA 1H0SA 2ZI9A 3ZWCA 3DDSA 3EZ6A 1XKQA 5CXSA 4EWLA 5BUZA 1GAWA 1F2DA 2EGGA 1JYEA 1XWIA 2FW9A 2IYQA 1Q21A 3O38A 4H6WA 4O3MA 2IHBA 5DEOA 1GUYA 3LQFA 4L8FA 1AXEA 4QUDA 4XX0B 4YCAA 4D80A 5BWBA 2O8DB 2RHCA 4ITUA 4WNYA 2ZWIA 4ACAA 4HDSB 2OHHA 4TLCA 2AFHB 5K6RA 2VR1A 4LSWA 4B43A 4KQJA 1QYXA 2BF7A 5TEVA 3GFVA 3E7WA 4D4GA 4DR6B 2IEZA 2RK4A 3ZDZB 1MNQA 2J3DA 2FR8A 4D8VA 1BE0A 5IUJC 2IEDA 2YOFA 1JEQA 3ETNA 4LX0A 4RKYA 5FRDA 4ZVMA 4BB0A 4REOA 3ZJUA 3G88A 3L3BA 2GK3A 4BHTA 1UAAA 1UMCB 1DIAA 1DTEA 2XAUA 4GD3Q 4D82A 4QOIA 4TV9B 4QOJA 1K2WA 2MOKA 4W63A 3JVDA 3C3CA 4MIOA 4PSKA 1G5HA 3ZVRA 4KPYA 4AZ0B 1CJCA 1G8JA 1P2BA 1RP1A 3A6DA 2AXNA 3AH8A 2R1VA 3CKKA 3REQB 1I0IA 4OFZA 3EW7A 4RVFA 5BOSA 3ZJTA 2FFJA 3D6HA 4OIMA 4XJTA 1NOJA 2D1SA 1O97C 1S9DA 4UEOA 3CBGA 3G8BA 4BMOB 2VWQA 3AEZA 1TYAE 2IK8A 3PT9A 4MR8A 1NVFA 5JYDA 1HG0A 1K4KA 1CUAA 1M34E 4HX5A 4E2WA 1OH7A 3HWRA 3P8ZA 4JH0A 2PBRA 5F1KA 1MO6A 2BHTA 2FPLA 1O6ZA 1MRSA 4JUIA 5CGQB 4BNWA 5C46F 5HW0A 3WO1A 2IDKA 3HO6A 4O1HA 4TTIA 4NJEB 4P7GA 1YNOA 2ZJ0A 4H1TA 1ECFA 5G3YA 4RFVA 2H51A 4IQGA 2CJXA 5HIIA 1UWCA 4LXHA 4LSZA 2HQOA 3SGLA 2WLSA 5KVQA 4MJ7A 7YASA 1U1FA 3V97A 1T4GA 2A5FA 4EM6A 1TC2A 2VPIA 3NHAA 2RB4A 3D3QA 4A6EA 2XA1A 3AWDA 2ZRGA 4WKBA 2FPPA 1PNQA 5MDHA 1UFKA 5D5QA 7GPBA 1P5HA 3OE7A 1IOLA 6LDHA 2EL9A 1D0IA 2C98A 2IUFA 3I6ZA 4R1NA 3M6UA 1HLPA 1Y3DE 2HRRA 1KI3A 3ZCVA 1LJ8A 3QLVA 1KVTA 5JANA 5GADl 4TQ9A 2XGOA 4WGFA 4AF6A 1RC8A 2ZIAA 3CF6R 1H1TA 3PLNA 3GJSA 2P30A 3GDGA 3RYHA 1IFXA 3NIDB 3H05A 3OMLA 1QORA 5DM1A 3MILA 3TOVA 3G7NA 1MKYA 5BYBA 5E7JA 5GGXA 5I7RA 3R4CA 3U4MA 3VPXA 1EUDA 1WD5A 2IXDA 2ZAYA 4JGIA 2C3YA 1YC2A 4U6SA 4LTNA 4LJ4A 4ATNA 4XPIA 2AHRA 1OFVA 1S2GA 5ERYA 2NUTA 4GZ3A 3PJDA 4IS2A 1V4NA 5ES4B 8MHTA 4ZMBA 2YHUA 1UQTA 4KE8A 3HO1A 1M2VB 2PLNA 4O63O 5I4BA 3Q85A 1IB6A 3FE2A 3GJ6A 5J5VA 3GW8A 2IHVA 2JFBA 4CM3A 1SCDA 2V7VA 4QE3A 1CJSA 2DPGA 4RTPA 4W8OA 4RXTA 3WIOA 1E2KA 1NQOA 4L50A 1T3ZA 1Z17A 1V1RB 4P3NA 1Q83A 4RSMA 2YW9A 1AGRA 4YHHB 2GGSA 2HNAA 3ILHA 1LRKA 1ULZA 4QHTA 4DAOA 4DHWA 2QI9F 4OP3A 3UC5A 3CKLA 1HFWA 3GRAA 2FZVA 3ESBA 3AUJB 2XQVA 4J0GA 5EQFA 4YO7A 1RWXA 1VM6A 2I22A 2EWVA 2PSEA 4II7A 2GZMA 2CHQA 4G5GA 3U7QA 4EB8A 4YCNA 2NU8B 1QFXA 4D9IA 4DYHA 2KBEA 3IT1A 4QOEA 3HLTA 3S1LA 1D2MA 2FKNA 4JUAA 3TLEA 4L7QA 3KYCB 4A9AA 1YR2A 3ZWWA 1F2TB 1T6NA 1SD5A 2JAXA 3KKNA 2QT9A 1KDRA 2Q62A 3K5IA 5SY4A 4CEJA 5J2TB 1V43A 1QPBA 1CDOA 4F4JA 2QY9A 4UUMA 1LQ2A 1IK4A 1YR9A 2X1LA 3L93A 4A7PA 4IHJB 1XROA 1K0FA 1EEHA 2XMPA 2YZ2A 2AD5A 4UMEA 4WEOA 1G16A 5AI5A 2C0CA 4J0FA 4Z1MA 5B1YA 4CIWA 1VYUA 4IDBA 3HWWA 4M1SA 2H4WA 1LBTA 3SF0A 4D79A 3EGXB 5FWNA 2ZREA 2VYNA 4LXYA 2QS9A 1U7UA 1AKYA 1WABA 1L4HA 4KXWA 2PL1A 4P86A 3K3PA 4TLMB 4C05A 2ZUFA 1M10A 1RC0A 1DDGA 5BYKA 2IZZA 2O2IA 3GR6A 4Z4EA 4HVCA 4F91B 4M8SA 2J59A 3ENZA 4QHYA 4LYYA 3WGIA 3K0SA 4NK5A 3B82A 4UPDA 3HY3A 3O95A 1FA9A 2XT9A 1SY7A 1R15A 2I1LA 1R16A 3PQ5A 5BO5A 4Z8YA 3CEJA 2BKLA 4N0MA 2D59A 1VJTA 1VHDA 2PZFA 1EXWA 3KPYA 3LP6A 1LK0A 1UP7A 1N5OX 4IIJF 4MA4A 5CW1A 5FADA 3QWFA 2PL9A 1E1DA 1V16B 3L1UA 1TF2A 4N8SA 2C9MA 4B7UA 2ECQA 1P9NA 3GFGA 2RJNA 3ZCTA 3IAS6 2VUUA 2Z3WA 3PUWA 1LPPA 2BH9A 2Q6KA 3O4FA 4JUFA 4PSDA 5EUQB 5FFFA 4BFLA 2JLZA 3HQ4O 3ZLVA 3FMVA 4PG7A 1BE1A 2F43B 4RL6A 4NZYA 4K81B 3I72A 4WCFB 4A8JA 1E9CA 4JI6B 4F8JA 3ZPXA 4ZQBA 5BV0A 5JD6A 1Y7HA 3A1CA 4EVSA 2W6OA 3PSAA 1PSZA 4PLPA 3U1VA 2XUOA 1OXVA 1WCIB 1M76A 2O8CA 1YDEA 5IZ4A 3W3ZB 4UOQA 1NRIA 4PY2A 3R5FA 4OFBA 2X0DA 1B7GO 1FSFA 4ALIA 3LDHA 3QYJA 3S1AB 3WTCA 3YASA 1HG1A 1BDIA 3LY5A 1BMDA 1O89A 3N28A 3QIAA 2OXIA 2XBLA 4JWKA 4ON9A 1U3TA 1ZN8A 3PGKA 4QYXA 3GT4A 4RPLA 1L8OA 1N34B 4MP6A 2FP3A 3FWZA 1J2UA 5JSFA 3BIFA 5AKZA 1QCDA 1Z7GA 2FPOA 3DMHA 1MJFA 2YUTA 3ZK8A 2G76A 1ULUA 3F5FA 1WY7A 5C9ZA 2C9OA 1A3CA 5U4XA 3T3OA 4QRHA 1FUUA 2OBNA 4OLFA 1E4EB 3OFSA 1OLUA 3GD7A 1IN4A 1I3NA 3L84A 4CM9D 1KI9A 5DYYA 1SUBA 1JR3A 4E11A 3ORFA 1T1GA 2OZPA 2I9PA 2CWWA 4E88A 2WE8A 3SKVA 5C8XA 5ER9A 4TTJA 4CV2A 3QRWA 1KMCA 1SU6A 2VDNB 1QHYA 3AUXA 4YASA 1DMRA 3UMVA 4EW1A 1VSTA 2II6A 3AW8A 4DRXA 1Q0TA 3SC2A 3K0CC 4P6VF 4C0HA 1T8SA 4JVMA 2O2EA 2R48A 1M1YA 5DNYB 1DSSG 3AMVA 3HY6A 3EPLA 1SPXA 2OM6A 3AKZA 1QFYA 5JTUA 2OLJA 4UFPA 2Y0PA 4A2QA 1Y48E 3JQRA 3B36A 3E61A 4ZI5A 2AG6A 3JQPA 3RODA 4ENRA 2AXPA 5IAOA 3AX6A 5CTAA 2JI8A 2YS6A 3VR3D 2R25B 2A9PA 4TUYB 2BTEA 4QJBA 2I7CA 3F3KA 1V8DA 1Q7GA 1TM2A 3MYRA 4UQOA 3NP7A 2ONCA 1R8SA 1E3TA 3KR0A 2VK4A 1WJGA 3L1HA 1XD8A 4YJ2F 5AK6A 1ETHA 3Q6NA 2FSUA 3VVCA 3D1JA 4G0OA 5KI6A 4DIOA 5BNZA 4B75A 1GSAA 3IVCA 3B2QA 4NFYA 1DAPA 4DMMA 2H2HA 4NBLA 3C7CB 2D5AA 1GTZA 1ONPA 4KE7A 1J97A 4RTMA 3EUWA 4QZVA 1A50B 2JF0A 1KFCB 1RHJA 2Y9PB 4GO1A 4TV8A 5CM8B 2ZIXB 5FCDA 2FF5A 5AHKA 4MRNA 4R2JA 5HJ7A 3D4OA 5K6AC 1E0DA 1LS6A 1PFUA 3DBLA 3TQHA 1AGXA 4P34A 7REQB 4F4HA 4I50B 1K98A 5REQA 3KYBA 2OOKA 1YS4A 5FPTA 1YI1A 4OQMA 1OREA 3WB0A 4UE6A 3HZRA 3MB5A 3CY6A 5EY5B 3RKRA 4AD8A 1MMFB 2AI1A 2BUCA 5HR5A 1GGNA 5HQTA 5JYEA 5DNCA 5DGCA 3ZI4A 1UBFA 3EMDA 4PO3X 3V33A 1H4QA 1A04A 1I1HA 2EARA 3JWHA 3FJOA 1X9IA 3R44A 1KDZA 3WL7A 1XR3A 2E9SA 3D6UA 1U2GA 2G9QA 2Q4BA 2ZR7A 4MEJA 3RGWS 4HZUA 4BEJA 2ACVA 3H9GA 1D8AA 1KYYA 2RAUA 3QU5A 5HM6A 2FWIA 4LE2A 1G7SA 3TIGA 1IU9A 3N2NA 5TQ2A 1ZUNB 4Q4HB 4KFUA 1JIJA 1E9FA 3EVDA 2R9VA 1HLDA 1YGYA 5HA5A 4HTAA 2C8KA 2QMQA 4N8EA 4NL4H 4LYAA 3BERA 3ABRB 1IN5A 1LPMA 4BNLA 4BB6A 2ZUBA 4A73A 4E6EA 1QGDA 2WF8A 3F47A 2CD9A 4FWBA 4HATA 3RSZA 3JZAA 1L7EA 4XI9A 4WXHA 5E4FA 2V58A 1BH6A 3DV0A 4RA9B 4QDJA 4HQOA 4LRXA 2G4LA 3KYIB 4OQEA 2DERA 1KPIA 2O14A 4IEFB 4NKRA 4S1PA 1UANA 1S6YA 1IEQA 2CNDA 3DQQA 3TPZA 1DKRA 3QHAA 4BMXA 1O9HA 3C3DA 1QH9A 3OLQA 4I1OA 3DYIA 1DO0A 3VAAA 1HMYA 4H1UA 2W43A 3N2KA 1F7UA 1AM4D 2XMSA 3OQOA 3DC2A 3NHZA 1YR1A 2QX9A 2YBEA 5K2MA 1JHQA 5JZMA 1A9ZA 3W34A 3IGFA 1ISHA 1PWEA 1UC9A 1AUQA 3N6VA 3DBHB 4IKOA 3R7FA 3NBMA 2JLQA 4JOSA 2OYRA 3RTEA 5JNLA 1N6OA 2X42A 2ZRMA 1P6QA 1LLDA 2H54A 4GYJA 1DNPA 2EW2A 2HT1A 3GFSA 3WL5A 4YRLA 2GPBA 2O1XA 2H18A 4PYMA 3WWOA 4R68A 3QXCA 5A5FA 5HK8A 3FJYA 5J4HA 1BVUA 3BHJA 3BWYA 4LMBA 2EFHB 4ZVKA 2EJBA 1WBDA 2E2WA 4R3WA 2JD0A 4ERXA 5IWCA 1EFAA 3RGGA 2VOEA 3DD1A 4J0EA 3OSZA 5EJ9A 1TD1A 2X4GA 4W5QA 2G1JA 4LYDA 5DBEX 4IVQA 1HM5A 2OUKA 4OO3A 1H6DA 2ZRAA 2LV8A 4F5DA 1U0TA 1IRIA 5AHRA 5KINB 3IHWA 2ZI7A 2E4YA 5A7GA 4LHXA 3A4TA 1A97A 3GC6A 1KXJA 5F1OA 3T7TA 2YV2A 1DTWB 1ONSA 4FGLA 2RI1A 4Q5IA 4NCKA 4WZBE 3ZEIA 4KYTA 5J2UB 3GCDA 2WAAA 4JT2A 3WLHA 4BMPB 1UBKS 3PR2B 1JHXA 1OWMA 3T1TA 3H4TA 4ZIRB 2FWMX 1VDMA 4RF4A 4C4TA 1Q0RA 1RLTA 2WUGA 3TCNA 1YFZA 3A11A 3VR1A 2I4TA 3TN7A 5BNWA 3W6PA 1TQ4A 3QVSA 1L1FA 1ML3A 2PBFA 2WU4A 3QKSB 2JHAA 3ZD9A 1FTYA 4MYDA 3UMYA 2FRXA 4G65A 4W5WA 4DHEA 4LC1A 5HKLA 2XOKA 1W1IA 3GLUA 5LDDC 5JDCC 2PZ8A 1SCNE 2VC2B 4B3IA 5IM4A 3ED5A 1UKAA 4GX5A 5HCNA 2I1VB 1G7CA 1NQUA 3K9BA 4J2OA 4AYWA 4DNFA 3UH1A 2Y27A 3QV1A 1YT5A 3G89A 1NJ5A 3NUQA 1LQTA 3OPNA 1MF7A 4OMCA 5JR3A 2AF4C 3G68A 1RLIA 3LGXA 2ZQ5A 3S2EA 3BXFA 3W2FA 1R0LA 2HIGA 3CLTC 4FNAA 4W9NA 3P9XA 2WPDD 1PVDA 3RTBA 3RW9A 1KGDA 2CVQA 2O0HA 2D0IA 1PV2A 5F5NA 4IOMA 2GKOA 1MZPA 4ASUA 1T3LA 3DXFA 3P9QA 1M33A 5CVEA 5ECGC 1D2GA 2FLVA 2HUNA 4U7JA 3MFQA 1GV0A 1Z8FA 2OB1A 1XO1A 3O4HA 5IM5A 1KY4A 2PHZA 5GJCA 3M7IA 3M1AA 4QWMA 4BNHA 1QP4A 4ALMA 3DT9A 1NUHA 1IBCA 3EAFA 3TRJA 2ZPTX 1UWLA 1IZ8A 5LFAA 1E7RA 4IF6A 1GRVA 1CS0A 2IOFA 4DG5A 1U9ZA 1CX9B 4LJKA 3ICQB 2C20A 3P0EA 3OLXA 2BGKA 2PKWA 3DW1X 4FFOA 4JEMA 1AMOA 1KKLA 3A1VA 4MGKR 1T3TA 2VPZA 2AQKA 4DANA 5FXMA 1TIKA 3PDWA 4UTVA 4DV0B 3PG5A 3A05A 3OHSX 1M8GA 3HXPA 1VMAA 1AK1A 5JQWA 1GG5A 2XR1A 4P0PB 1IUKA 4JNKA 4U7GA 2CLCX 1G5RA 5FPHA 4CQLB 5LR6A 5KUTA 1Z5PA 2D0DA 3O8OA 1TZ2A 4AJ1A 3VKVA 1V3VA 2O3UA 1Z33A 3L0CA 1GYPA 5A05A 4DIDA 3PRKE 1B8UA 1RNLA 1R4MA 3AW9A 3HXLA 3PHLA 4YREA 4J3NA 2HA2A 3F8WA 3WRXC 4D02A 2NW6A 1Y3IA 3ZY6A 3ELYA 3R7LA 5JASA 4XTRA 3F4BA 5CU7A 3SYRA 1G7TA 3ZU6A 4UARA 2QRUA 4XLLA 5AKYA 3WGTA 4H7PA 4OP2A 3WFIA 4D4MA 5FT9A 2JKYA 5JSYA 4H31A 5AFSA 2HXGA 1JFFA 4NESA 1NXOA 1GNQA 3H2YA 4MKZA 5ALXA 1E1YA 4CI9A 3ESZA 4GOND 4HDRB 4QPZA 1E2IA 4CTNA 1FVFA 5DVZA 1NR1A 2ZRCA 3MRTA 1FX0B 5DWDA 3U09A 2J9YB 3MYYA 2PKQO 4OM8A 4FBMA 4LSGA 3AESB 3T06B 3ZCSA 4JQYA 3RAGA 1DRWA 3MTAA 4M0PA 2KBFA 1QIEA 2GRAA 3EDQA 1W9HA 3QYPA 2ZTMA 3I2JA 3PS9A 5JY1A 3LX5A 5BV2P 4L3VA 2EJWA 3R7WB 1Q17A 3A2NA 4DBVO 1BE8A 3BPSA 3DL7A 4NE7A 4R01A 2HX1A 1O0CA 2CVZA 4PC1A 1UKZA 2AR7A 1DUSA 2YUIA 2QW0X 4WOCA 4EO4A 2XCTB 2F90A 2HUPA 3JQ6A 2FJPA 2OBMA 3NTUA 2BUBA 3EXEB 4B31A 1WKVA 1E77A 3UF0A 4BQFA 1M34A 3QU7A 4QVKA 5DISB 1DQSA 4PGHA 3RH0A 3PXAA 4LHWA 1UWVA 4PLYA 4INPA 4J2TA 1P4SA 3TBHA 4EKIA 1XZFA 3UH0A 5CPFA 2G1UA 1TVCA 3K70B 1KORA 1ZLYA 1KYZA 4JLKA 4TZKA 5KB3A 3EYWA 3H9CA 1XZCA 1NWCA 1WA5A 2I4MA 3CXRA 3CVUA 4KR2A 5LA6F 1JHVA 1XLTA 5HHTA 3KOMA 2OFPA 3H2HA 4JJIA 5ARDA 1IUOA 2HD4A 3UMGA 1RYEA 5JEDA 1HQDA 4Z3DA 1GPYA 1R6BX 3AP1A 2V5AA 3BHIA 3MTQA 3T1QA 2Z2YA 4BFUA 4L7VA 3QLJA 2I4RA 1TECE 4RTSA 5K51A 4DYDA 4EVIA 2RGYA 1Z36A 3UJCA 2Y76A 4FOLA 2LCFA 3U1TA 3QUAA 1AY0A 3U17A 4DA7A 1NNSA 3RRZA 2WNSA 2HZ7A 2IPAB 4JUCA 3ZHQA 1RYZA 4DQKA 4LJ5A 1JWAB 5KAMA 5CNKA 1KSJA 1TGVA 4MA0A 3UVEA 4H08A 5L4SA 2O50A 4PM4A 1QMGA 2ORWA 2AX4A 3AXSA 4FSHA 2BLNA 4JY7A 4MARA 1YA4A 2G06A 2VNSA 4FT4A 4MULA 1VPLA 3G7UA 2JL1A 1XFAA 3MIIA 4QXRA 2ZYIA 1N3BA 2QN7A 3C1UA 5TJ9A 3KKZA 4CUJA 2OHGA 2NX2A 1H2WA 3OIFA 3NEPX 3B9RA 4Y2PA 3RU2A 5ES3A 4AWAA 3AWIA 3TZHA 5C3UA 3O1HB 1UKCA 1ZL0A 4LYEA 1I30A 4BNGA 4KIWA 1IONA 1IY9A 1KR2A 1GLNA 4Q6WA 3E27A 4ZKDA 3GU3A 3BXPA 4QFBA 5L7WA 4NBSA 4XM1A 3LXMA 3N9IA 3B7GA 4F3NA 2XUFA 4FSXA 4I3HA 5E8JA 3ZKAA 5IMSA 4FC7A 3CSDA 5EZSA 2QTMA 4L9AA 5BYAA 2VIIA 3P2EA 4GLOA 1JDSA 3MTBA 5A71A 2EGUA 4MAMA 1WX1A 1CJVC 2V03A 3AXTA 3LIIA 4KRGA 1EDZA 3ZHRA 4AKHA 5GTDA 4IHQA 4WJKB 1JHMA 2CC2A 5D00A 2BE9A 1L7XA 2HEGA 1V25A 2J33A 3EC1A 3UJ8A 3USCS 6PFKA 3MJDA 1NBHA 2VWGA 1L7DA 3KXIA 3S68A 4BLSA 4JX9A 3IIEA 2NV0A 2ZLBA 4GLJA 2BDUA 3Q3GE 3NMUF 2ACKA 4PYIA 1I1NA 5I9NA 3HHEA 4XVHA 2ATVA 4TKVA 1WPXA 3C3AA 2OHJA 2PWYA 2Q2VA 3GLTA 4IYRA 4XJXA 4U4AA 1IJBA 1FIUA 3L0BA 1VMDA 1AO3A 4R2HA 1OE0A 4UFNA 4IGIA 2WR8A 4MS3A 5D85A 1J8MF 4YRCA 2VL7A 1CYEA 2FG7C 2C5FA 1F0NA 3HB0A 4G4IA 3OFVA 1MC8A 4WJZA 4IOKA 1N3IA 1UM9B 2FJ0A 4YONB 1Q7EA 3CLKA 3QIVA 1DWQA 3KKPA 1J22A 4X8LA 2FUEA 2HHLA 4GF5A 4K9RA 4Y6QA 4YJGA 3UT5A 3HS3A 5FTMA 3OQHA 2XVAA 3RFTA 3UUWA 1CXZA 4JROA 2AOTB 5B53A 3C6XA 3HXTA 3OT1B 2FZGA 4BFTA 1GEEA 2QVXX 1D1TA 4QLOA 1YDWA 4DMKA 3QEBZ 1RP7A 9ATCA 5EJ8A 3GG2A 1K6JA 1KMIY 1QIJA 3B3GA 3AR3A 3MCUA 4PVDA 2B4YA 3DE2X 2QTNA 1SXIA 3GWGA 4TVBA 5E0OA 1LK5A 1UOPA 4M6WB 1Q7TA 1U5BB 3ISVA 4C0XA 4ECAA 1C30A 3AVVA 4A8JC 2XTZA 3IXLA 1U0JA 1M6VB 3T7IA 4PLGA 1KP9A 2A5YB 3BJRA 4N4AA 1II9A 1YJ8A 3L7BA 3G82C 2VSFA 1IMOA 4XWAA 3AIKA 2VBGA 4JBHA 4R41A 3G9QA 1D5WA 3IUEA 4PEVA 3HL0A 4R2KA 4X1OA 4ZCMA 1QIGA 3WGLA 4BUCA 1WUYA 3DONA 3M82A 5DX0A 5AI9A 5SV2A 1C4KA 4JA0A 1GTVA 3ITEA 4UATA 5A3QA 4C3UA 3KEQA 5ALLA 4ZT6A 3VZCA 3ROMA 1YD7A 4MS4B 3VGJA 2WPNA 1BG6A 2PYZA 1RWOA 3F67A 3OZFA 1A95A 1O0SA 2ZETA 4OQQA 3T0IA 1BDJA 2PD6A 4KAFA 4LRYA 1T6XA 3QVWA 4JI3B 1RM3A 2QRPA 3MTDA 5M2QA 5T8KC 3FY4A 5LQUA 5CEJA 4EG7A 1CEYA 1DJMA 2C8LA 3D59A 4P33A 2F3TA 5DN9A 1E66A 1ZY2A 2HEIA 1KVQA 4DJ5X 4XVCA 3DQPA 4PX3A 4JR2A 3DWIA 3KLBA 3ZCXA 5B58T 2OV2A 3HU1A 3B78A 3E7DA 3GGJA 3I6QA 3N05A 4NZOA 3OFNA 3NV7A 4YUWA 2VF4X 5LU8A 2W83A 2M6SA 4HR7A 5ALWA 4R0VA 3AF2A 1E3JA 3BSFA 1J2EA 2XIJA 4L4YA 2P9GA 1U3DA 4AKIA 4RDXA 4RABA 3GRZA 4KTTE 2P4QA 1ADJA 1YHNA 3LYUA 3ZWMA 4UE2A 1FZTA 1JP7A 1RAFA 4EJSA 2DH6A 4B74A 1J8VA 3GRPA 4MICA 3AUTA 4KFCA 5IANA 3VSAA 1U98A 1VPVA 3EFEA 4ZK6A 3MXOA 5JNWA 4CMBA 3ST7A 3C3KA 3ZH2A 1LWOA 2PCLA 1XUOA 1DPFA 2GI4A 4YVFA 4XGKA 2Q3HA 2IYTA 3JQQA 4BAUA 3GRVA 3PX3A 1PGNA 1XAGA 3ITKA 4IX9A 4JEUA 2Y1DA 2HU2A 4MJXA 1P7VA 4NU6A 3TZLA 2Q9UA 4XGNA 4BMSA 5J43A 2K4MA 3W8DA 4LV6A 3VAYA 1DPGA 5AW4A 5FWXB 1TUEA 5A6VA 3SWWA 2BTQB 3OE5A 3QITA 2E55A 3GNLA 4IO0A 5JV5A 1QQAA 3UJNA 3KZKA 4V0QA 1OAKA 1N78A 4GNKA 2AE2A 1VL2A 2JRCA 2WJHA 4EY5A 4PYQA 5WRFA 3FTPA 2GF2A 4G0NA 1DEXA 3O1IC 4M1ZA 1OTHA 3S27A 2XGGA 1ZNWA 1G3MA 1M9NA 3GHYA 4LXGA 4MITA 2JBAA 1FPQA 3MGAA 1JKJB 1EFPA 3OFKA 1QF7A 3ACDA 4QELA 4L0DA 4RIFA 1BXZA 4BLQA 3ZDEA 1R6AA 4EFLA 2WKQA 4RUKA 2HBRA 5HS6A 2F55A 3DXXA 1H8ED 5F21A 1Z4LA 3U6KA 4RM2A 1R9MA 1ENPA 4NJMA 2X5XA 1FB5A 3KTAB 3S8EA 1YOBA 1ULSA 4MUKA 4ALJA 1E0SA 1WB4A 3EVNA 4GBGA 3W77A 1XPJA 1NT2A 2KQUA 2ZYDA 4C2UA 1AHIA 1RC1A 1T2FA 1YDMA 4GYWA 4IWYA 5HRAA 1KEPA 1GG9A 3QPBA 1VHWA 2XCOA 3FOWA 3ZHZA 3AJEA 1F3LA 4I7EA 4P92A 5SYNA 2AYZA 5HPYB 1OWPA 3CZ9A 3I6BA 4YLEA 2E6KA 4EA9A 1Q3HA 1SEPA 1VL6A 3GPLA 3A9CA 4XD7D 1L4FA 1U2GC 1V4BA 4Q4AB 4LZJA 3DVAB 1KDVA 4MUNA 3LCCA 4DJJA 4C76A 3DNFA 3I53A 1QVZA 2W71A 4IX1A 4B87A 4UCXA 2HJVA 2KI5A 1IEXA 4G5SA 4LI3X 1R4NA 3LLCA 2PRKA 2RH5A 3OP4A 3QE2A 4N18A 2H3HA 1ZVQA 3DWGA 3K1ZA 1FBTA 1KVRA 3C5VA 2NU7B 3I6YA 4OBWA 4KHZA 3B85A 2DH5A 4M49A 3B1WA 1TEHA 1UQUA 2JFXA 4X5OA 1ABEA 5DKFA 1U2TA 2EX0A 2PLWA 3VV3A 3U37A 3VTAA 1YNSA 4D92A 2V74B 2VI5A 2JH8A 4MRSA 3CZ4A 5AK5A 1F6WA 1XXHE 4EB0A 1CR6A 2R8EA 2RC5A 2GVNA 3NLLA 4CMHA 2X1VA 4FTWA 3GEGA 3SPXA 3CV3A 4EGFA 2YDYA 2PKRA 2O54A 2GB4A 3N07A 1EK1A 1VJ0A 3EFHA 3LGSA 1CZLA 3G1TA 3L8HA 3PC6A 2MYPA 3C74A 1OI7A 5DBHX 2BGMA 3KT6A 3LJKA 4EARA 5A4FS 5IVHA 3ZY2A 4DZZA 2GXSA 3LL7A 3TRHA 3WK6A 5IYZB 3PQ8A 5ESDA 5JXJA 2YVQA 1GGEA 2R5NA 3AL3A 3EULA 2FOLA 3HUDA 1KXZA 3EOAI 3PXCX 2VJCA 4RMHA 2VHTA 4PS1A 3IODA 5I7EA 2HYIC 4MVJD 5HGJA 3WQRA 1A8QA 1HDZA 1RFLA 1VP3A 2HA7A 4BQIA 3HKCB 4ETNA 4ZDIA 1DO2A 2P62A 4QRIA 4COKA 5FKJA 4D2IA 1E3SA 1U8UA 2ZKIA 5FX2A 1AURA 3O2JA 3KSBC 5ED4A 3G0IA 1M83A 5K7SA 4GNRA 1LBEA 3OEHA 1P4RA 3KK0A 1AC5A 2WUWE 4YP5A 3TAUA 1JIXA 2VT7A 4NCBA 2ZUVA 1C3OA 4ZRNA 3NH6A 4G4SO 4DWVA 1HT1E 4UREA 1YDGA 1ATZA 5J47A 5KQRA 3FPBA 1J99A 1XSEA 2CNBA 1TIPA 1KPGA 4N0DA 4Q7JB 2MHCA 4OIFA 3QP9A 4EB6B 1DG9A 3NVMB 2OZKA 4FMCF 5EN4A 4PAQA 2JCXA 4BE9A 4ZCRA 3HVUA 1TTQB 3NT4A 4X6XA 4C7KA 5DOVA 2FFQA 2WV7A 1Z6QA 3U26A 5HIKA 3QVVA 4YYZA 1Z6YA 1JVSA 1DJQA 1MOQA 3GXBA 4RK1A 4W9RA 3C1AA 3HDHA 4WPGA 4ZVUA 3SIWA 1K3UB 3OOWA 1O6FA 1ILWA 1K7FB 2XQFA 4ZOEA 1JFSA 2FYTA 4GI7A 5JS6A 3RC8A 2CKMA 2WJYA 4F86A 4RMNA 1W35A 2ZSIA 1B8VA 3BK7A 3KG2A 3SG0A 4WZBA 1XAJA 2H3EA 2JGJA 3P2MA 3W3AD 3D3WB 5F2EA 2O2SA 1UBOS 1L6RA 5IKXA 4Z3OA 4DUZB 1TDJA 2WVHA 5CLHA 1X3LA 1GGFA 4F9GA 2ZR0A 4JI0B 3NETA 4KBGA 3REGA 2K5UA 1HE3A 1L3IA 1W5TA 1W5SA 4HY3A 5CLQA 4EDFA 4EZBA 3TGPA 2ZQYA 5BUSA 2OHVA 3HJGA 3I9KA 2H48A 1PL0A 5K8LA 1HNZB 1D07A 2EFJA 3PC7A 3NXKA 2A1TR 1Y8RB 4B40A 5DGTA 4BNIA 1BEEA 5CA1A 1N6RA 1Z88A 1C9MA 5FUYA 1T0UA 2XH8A 2QSJA 3UAYA 1BXRB 4A1OA 5IXSA 3ZCUA 4LF6B 1QRAA 3N2EA 1C8BA 3OJLA 1F3OA 1KIAA 3PEWA 2QMHA 3BTVA 3OLWA 4Q9AA 4U3JB 2OFFA 3WFZA 1PR3A 1QVVA 1Y89A 2CZCA 1OX4B 1C9DB 3CUVA 2PUTA 5JJIA 1ZXXA 2XVYA 4I08A 4ZP1A 1I9CA 3ORQA 1KOJA 3AFNA 2YWXA 5JCPA 5ALHA 4IV8A 1NOKA 3B5JA 3EA0A 2VT2A 3WJ2A 1SKUA 3BF7A 2WQ7A 1ESMA 1G5IA 1U8AA 3RIXA 3S55A 4D9KA 4IOJA 5MHTA 4G36A 2BI4A 3K53A 4BWYA 3BSYA 4CCSA 2QRNA 4ABYA 1XD2A 5TPZD 3C4QA 1P17A 4D0LB 1ORIA 3CRW1 4ZMRA 3EVEA 3DLBA 2CYCA 1N7JA 3U9TA 1WIWA 1AGNA 2YWFA 1RCUA 4HQNA 3JATB 4BO4A 4D8TA 2ENWA 2JJMA 5T41A 1EFRD 5ESWA 1O6GA 1KK0A 1Q15A 2IELA 1W87A 3AR7A 3OIWA 2WLTA 1KARA 3GT3A 3PFIA 2PMFA 4I9GA 2PRSA 2QBYB 1XCJA 3IIMA 4AZVA 1QRUA 2XQIA 4KLNA 1OBFO 4M38A 5TQVA 4KLZA 1KEEB 3ZU4A 1ECBA 1R6TA 2HAEA 3BMNB 3E22A 3HCOA 1KAOA 2FWBA 2WM8A 3M6WA 5F2KA 5F3RA 3VU9B 5JI2E 4LC9A 3HR4A 4REQB 4YJ3A 3FPSA 3IB3A 4H7DA 4B1FA 4DOMA 3SZ3A 2E48A 1TUBA 5LUAA 5HVNA 4HRXA 3U7RA 1JXQA 2J6HA 5TGZA 1PR9A 1TLFA 4EATA 1XJ0A 2EZTA 1C0PA 1SVIA 4OAOA 4WLFA 2YXPX 1WU7A 3FR7A 2GN4A 1N36B 4DZTA 3T1VA 1QBKC 4K9QA 4FCTA 3R3VA 1GUAA 1E79A 4D44A 3RR2A 5K8CA 2WB2A 2J0QA 4WK2B 1IY2A 3ZIUA 2Q7DA 5L8VA 2A7XA 3SS9X 1T9AA 3G0CA 1ZU4A 4DAEA 2JDIA 4KLRA 1PR1A 3RJ5A 4KVAA 3MT9A 2SCUB 4LWZA 1M1UA 2BTOA 4Q12A 4GBJA 1MA3A 1PL7A 4L4ZA 4Z1OA 2P9ZA 4C0WA 1I33A 2Y71A 3FF4A 3W5DA 5EIWA 3SYNA 4DXHA 4MB2A 1PS9A 4FHGA 4X1YA 4CU2A 3DXYA 3EDOA 3FTNA 3HCBA 3QE9Y 1XRMA 3DLTA 3H4IA 3K1AA 3M83A 1RZRA 2CFRA 4ZOLB 4DJDC 5L3SB 5EIOA 4F4UA 1R4AA 1U3UA 3U40A 2ZRIA 3DKVA 3UO8B 1GG8A 2OCLA 1SHKA 1Z4NA 4FR0A 3HEAA 1IQUA 1QHGA 3M6VA 4P3PA 1TM3E 3M4JA 4NATA 2E7ZA 3T5DA 4QYMA 5HWSA 1EWYA 1G20E 1MFZA 2YWCA 3PJEA 3MW8A 3Q0IA 3CF2A 2I3BA 2YXLA 3DUFA 3G2LA 4WSOA 1JJFA 3WLFA 2JIOA 2QR5A 4XFJA 3H5IA 3OU2A 3DHVA 3V6LA 4LKRA 2P69A 1D03A 3TKYA 3SF8A 2JFFA 3Q7QA 1APBA 3GA5A 3K15A 4A23A 1XKTA 1YWGO 2I4OA 4G5RA 4GWLA 1XPUA 2FZCA 4MRMB 7AT1A 2BSQA 2Q50A 1NBMD 2OM2A 4XFDA 1QGED 3KHSA 4GM1A 3VA7A 5BYJA 1O9GA 5LC1A