4DUPA

Crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
331
structure length
331
Chain Sequence
MSLPQEMRFVDLKSFGGPDVMVIGKRPLPVAGEGEVLVRAEAIGVNRPDIAQRQGSYPPPKDASPILGLELSGEIVGVGPGVSGYAVGDKVCGLANGGAYAEYCLLPAGQILPFPKGYDAVKAAALPETFFTVWANLFQMAGLTEGESVLIHGGTSGIGTTAIQLARAFGAEVYATAGSTGKCEACERLGAKRGINYRSEDFAAVIKAETGQGVDIILDMIGAAYFERNIASLAKDGCLSIIAFLGGAVAEKVNLSPIMVKRLTVTGSTMRPRTAEEKRAIRDDLLSEVWPLLEAGTVAPVIHKVFAFEDVADAHRLLEEGSHVGKVMLTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords quinone oxidoreductase
publication title Crystal Structure of a quinone oxidoreductase from Rhizobium etli CFN 42
rcsb
source organism Rhizobium etli
total genus 101
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dupA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4dupA01
3O4RA 2Q50A 4YT8A 2Q2WA 2V7PA 4BMSA 1WWKA 1P44A 2H63A 4FOOA 4E0BA 1T24A 4R1NA 1PJ3A 2FZWA 2W8ZA 4WJZA 1H93A 1B2LA 1FDVA 3RU7A 4RF3A 4OOEA 4R16A 1DAPA 1FF9A 4XR9A 3T7EA 2O2YA 1YL5A 3I9MA 1CEQA 1LRJA 2AE2A 3KRTA 3QIVA 2DTEA 1BXZA 1BW9A 3NT5A 2I3AA 4IIUA 1WAMA 2VOEA 4RORA 4EI2A 3ETGA 4RF4A 1MLDA 3I83A 2Y1GA 1OMOA 3O8QB 3RBZA 2FR8A 2WDZA 1CETA 3F6YA 3VH1A 2WYUA 2IZ0A 4EDFA 3U09A 3ZI0A 4MVJF 3KXDA 1PWXA 5JO9A 3C1AA 1R37A 1Y1PA 3HG7A 4YAKA 3AM5A 2YQ4A 4XKJA 1NQAO 2OP1A 1BSVA 1KYQA 4IM7A 4ND2A 1KBZA 1QRRA 1I8TA 1LDGA 2F1KA 4RQUA 3COSA 4AJIA 1D1TA 4YRDA 3TF5A 4P38A 3ETDA 3AUUA 1YWGO 2CD9A 1GPDG 3F5QA 1KEWA 1FJHA 3D7LA 1BVRA 3NKLA 1NAHA 1Q2XA 3FR8A 3Q11A 4PG7A 3RC2A 3JQ8A 2GLXA 1IZ0A 2V6GA 4PLWA 3GVXA 1C0KA 1HDZA 1DSSG 3VZPA 1WDLA 2C7VA 2JD0A 5COBA 4KUEA 3Q2IA 5JSFA 1E1KA 1M75A 1E7QA 2BI7A 3SEFA 1DLJA 1LSOA 4CM9A 4NQZA 4FOSA 3JQBA 1OBFO 3IC5A 1CIVA 1EUZA 4W9NC 3PQEA 4H16A 4FQ8A 2QRKA 1DHRA 2Q4BA 3MJSA 2D8AA 3KTDA 3SX2A 1DC4A 1ZK3A 4WE3A 2GERA 4XX0A 2OGUA 1LDMA 2BH9A 2P4QA 5G0UA 3KM0A 4BNNA 1E0DA 3F9IA 4J4BA 5HA5A 4CV0A 4NPCA 4DXHA 4FW8A 5IXYA 3P19A 1R6DA 3SLGA 4R1TA 2UAGA 2VWHA 3DOJA 5C7LO 7MDHA 2ZTMA 4II3A 4P4GA 2GZ3A 5B12A 2Y05A 4XB2A 5T57A 5KJ1A 4BNUA 1HWYA 4WCFA 3LYLA 2X86A 3BXXA 1SEVA 4OQZA 5ENVA 2OXIA 3WQRA 4OGWA 1EFKA 1QG6A 3WGZA 3K8ZA 1ARZA 1BHSA 3HNPA 3T4EA 3RFVA 1NFFA 3R6DA 3BMCA 2O2SA 4CM8A 1GEGA 1IOLA 3AK4A 1SB9A 3DAPA 4IIVA 1PGNA 3AU9A 3EAGA 1U28A 3ZV5A 1DLIA 2HRBA 1MC5A 4PLHA 3KOUA 3JYNA 3H2ZA 4FS3A 2PZJA 1LX6A 4OM8A 2Z95A 4CMCA 1C0LA 2AMFA 3OEWA 2BFPA 1E3EA 2EKQA 3G1UA 5DOVA 5EMHA 3C7CB 2IZ1A 2JFHA 4N7RA 4BNYA 1B8VA 4FFLA 4MVJM 3DDNA 3M2TA 4J90A 3GR6A 2LDBA 2C54A 2EHDA 4L4RA 5TQVA 5JW6A 3EGOA 4Y9DA 3P2YA 2O7SA 2P4HX 1XU7A 4L9RA 1WP4A 3BMNB 1A71A 3DBRB 4NMHA 3UF0A 1BXGA 1VJTA 4O5OA 4U0JA 3LT2A 4BMNA 3OA2A 1YO6A 2X1HA 3PJEA 1HLDA 4YJGB 2BKAA 2EF1A 2ZB7A 4NBTA 4YACA 3ZN2A 1ZK2A 3HQ4O 1V3VA 3JD1A 3LSYA 3MCVA 4MVJP 5IZCC 1PGOA 4DLBA 5L40A 2HQ1A 1OOEA 1HZJA 4G2NA 4M49A 5G0TA 1PTJA 4NFSA 3ZNQA 1I0ZA 4YJHA 4PG4A 1O5IA 3D64A 2Y1OA 1JVSA 5L53A 1V6AA 1IL0A 5B4VA 4L4SA 5TT0A 2W4QA 2VZ0A 1XWFA 2P68A 3QA9A 3KLPX 2WSBA 3E9NA 3RD5A 2X0IA 3WMWA 3LU1A 3U4DA 2PD6A 3FF4A 3JQAB 4E6PA 4LMRA 5JAIA 2BFMA 2DM6A 4LSWA 2NSDA 3ENNA 3X2FA 1X7DA 2J3HA 4DLAA 2ZQYA 1D1SA 1MG0A 2CVOA 2DC1A 1PQUA 1S7CA 2Z1NA 2JHFA 5A9RA 1MP0A 1N7HA 4EBFA 4DYDA 1B14A 3NJ8A 1ISMA 1GQYA 1IPEA 4L8VA 1TT5A 4P22A 4XQCA 3EY4A 1Z7EA 4BV8A 1DRUA 1H0KA 2VRBA 3GVCA 4IQ0A 3VTZA 3DBLA 3PHLA 5GY7A 4F3YA 3BZUA 3F4BA 4IINA 1J4AA 1R4MA 1QYDA 2Z5LA 1JDJA 4NBRA 5J23A 2J3JA 5U1PA 3ZW9A 4B4UA 1ONPA 2CVZA 1Q7BA 3LZ6A 3RVDA 3WTCA 3RJ9A 5KKCA 1PZEA 4GBJA 4AJKA 1FDUA 1ZVMA 3FR7A 3KZVA 4RGBA 1Y5MA 1YXMA 2PZMA 4JQCA 3TFOA 2YV1A 1LSUA 2WM3A 4ALNA 4QO7A 1MG5A 2ZB4A 2X6TA 3C1OA 5B4UA 4FDAA 4W4TA 1EFLA 4IQGA 4YXFA 4IS3A 5FF9A 1EVIA 3WSVA 4J1SA 4MVJE 4QTZA 1EBFA 4CR6A 3DC2A 3LC2O 1QYWA 3LK7A 5ER6A 3CMMA 1VM6A 1GCUA 1ZZEA 4RLSA 4BV9A 2X22A 3E6AA 1K2WA 4OXKA 3HJAA 1AXGA 3ASVA 5L4LA 1CQJA 4CLOB 5JAQA 1HDRA 2B4RO 3DB2A 2EP7A 4WLEA 2YFHA 3Q0EA 4W6ZA 4WLUA 3KYCA 3ZHXA 5K0ZA 3E9MA 3N7UA 4YDRA 1X1EA 2V6BA 5JC8A 1UP4A 3BTOA 5EJ2A 5I9MA 4CQLB 2YHUA 4DBVO 1YBMA 4Z0TA 3R3JA 4GGPA 4IGFA 4OL9A 4BVAA 2ZQZA 4MO2A 4CL3A 2CF6A 3JYOA 3FSRA 3OIFA 4K6FA 3JQEA 2X5KO 1Q7GA 5LC1A 2IODA 2JFGA 3AFMA 1E6EA 1YDEA 2EP5A 4WUVA 1GQ2A 4MIYA 2QIOA 1Y81A 2PGDA 5JLAA 5T5QA 1R66A 4TZTA 4MKRA 4BO7A 4EGFA 1HE4A 1LC3A 4FC6A 4HNHA 2JL1A 5FYDA 1SO8A 4D41A 3RUEA 3FBTA 2UV8A 4MP6A 3GA0A 3MOGA 4GWKA 3EVTA 1G0NA 1BRMA 5JBIA 3V2UA 3GZNA 3H5NA 1XU9A 1Z45A 2NACA 3HE3A 3QLJA 1AXEA 4FFRA 4PLCA 4Z0HO 1WNTA 1L1FA 3UGKA 2VQ3A 1HZZA 1UXJA 2CVQA 3H7AA 4YT2A 4CR7A 5C5IA 4Z3DA 2OBYA 2PGJA 5DF1A 4L75A 5ITVA 1IY8A 3L6EA 4I9NA 3RC9A 4WK6A 2R00C 2DVMA 4ND4A 2IE0A 3M1AA 4F45A 5KJCA 2I3GA 3QW2A 5F1KA 4XA8A 4ONEA 4HKTA 3FRJA 1ULUA 4IDAA 4B4WA 4DIFA 3EYWA 3PPIA 3KETA 2PH3A 3IQDB 1IB6A 1NFRA 1I24A 4CMBA 4I1IA 5AYVA 5TIIA 3I52A 1W0CA 4YAIA 4ZA2A 1NPDA 1QSGA 1DXYA 5G4KA 4FB5A 3PWZA 3HADA 1XG5A 1GCOA 3HDHA 3GH3A 1DFGA 1KC3A 1XGKA 2HMVA 2ZIZA 3ZZNA 1LNQA 2IRWA 4J0EA 4RVFA 3W6UA 5TC4A 4QUKA 5L3ZA 2BI8A 3DMTC 3MWDB 2HK9A 3IAHA 1FDTA 2XF8A 3JQ9A 4YEDA 4BS9A 7ADHA 5KWEA 2EXXA 2J5QA 3GQVA 1GDHA 2C5EA 3B70A 1JW9B 2FZEA 2BRUA 4LVCA 4ZICA 4EJ6A 5ICMA 1BXGB 4DIOA 1NWCA 1W6UA 2EKLA 2OFPA 3ONFA 1JA9A 2RAFA 2Y0CA 1X0VA 1GAEO 4NG5A 4JJFA 3EMKA 5DN9A 5L7TA 3VDQA 2PH5A 1KVUA 3GGPA 2NWQA 3FHLA 1DIHA 3JYLA 1LLUA 1HDXA 3ONDA 4XJSA 4D79A 1DJNA 3PDUA 3UW3A 3GK3A 1RM0A 4XQGA 2VHYA 3RUAA 3SLKA 1T2DA 1I3KA 4DBZA 2DPGA 3HZZA 3KYBA 3AUSA 4YQYA 4A27A 3LVFO 1O95A 4D0RA 3K6JA 2PR2A 3D4PA 5FWNA 3JQFC 5DP1A 2HSDA 5I8ZA 2DU8A 4CUZA 1XA0A 1NQOA 4BGIA 4RPLA 3QVXA 2NV6A 3VVCA 2GGSA 3DO5A 3E1KA 3F46A 2CF5A 4BKQA 1ZSNA 3A06A 3U4HA 1JWAB 4CL8A 1P1KA 3E8XA 3RUFA 4R68A 3WGGA 2QZZA 1N9GA 3ZWMA 4NFYA 3UFXA 2HLPA 4UUOA 4L74A 4YAJA 1ONOA 1U5CA 5JDIC 2DPHA 4CODB 4R51A 5ENDA 1O6ZA 5I7SA 3WYBA 2W2KA 4EUFA 4TVOA 3DFZA 3HN7A 2CZCA 2RIRA 4WOKA 3IOYA 4EW6A 1HL3A 1VJ0A 3P5SA 2VTEA 4IJUA 1GQQA 3WIDA 3PHHA 4NI5A 2NVUA 3VPSA 5A9SB 4EEZA 1NVTA 1PS8A 1CERA 1PJ4A 1YL7A 4CQMD 1UDBA 3VH3A 4YCAA 2OMEA 1NQ5A 2P91A 3TPCA 4AJOA 3E03A 3N74A 2FSVA 3QP9A 1YL6A 1LLQA 3H6KA 4XRRA 1AGNA 5ES3A 2O3QA 1NHWA 1UZMA 1X15A 1XDWA 1E7SA 2ZTVA 3G17A 4U6SA 4JJGA 2GR9A 2G82A 1QV6A 1U1IA 2X9VA 5AXDA 3EHEA 4KQWA 5COQA 3ZWAA 1T2CA 4ZQGA 4OXYA 3G3EA 4Y98A 3ASUA 1E3JA 2IZZA 1SOVA 2XXBA 1KERA 3OJ0A 1NP3A 4CMEC 4DC1A 4DTIA 4MIOA 4DPMA 2GUGA 3JYPA 4O0LA 3WMXA 1ENOA 1NASA 4PRKA 3JQGA 1XCBA 2C82A 3B6ZA 1A4IA 2QRJA 3UN1A 5DBGA 1LUAA 1XQ1A 3WJ7A 2O4CA 3IMFA 3BMQA 1WW8A 2VTDA 2PLAA 1JAYA 1Q0HA 2GD1O 4TROA 3U9LA 4MINA 2C29D 3D5TA 1JQBA 1H6CA 3KBOA 4FFNA 1A72A 4D3DA 3JQ7A 4O6VA 1YVEI 4E2YA 1LDNA 1J5PA 1F0YA 3QVOA 2YZ7A 4E33A 1E7WA 4ALMA 3HDQA 1R0SA 2VUSA 3FNGA 1H6DA 2UYYA 3CH6A 4CM4B 2Q99A 1E6WA 4WOJA 1ZK0A 3OQBA 4UREA 3GHHA 4PLZA 4ROSA 5I8WA 1A27A 3R1IA 5K9ZA 4J0FA 1B0AA 3WDSA 1U7HA 1H2BA 1P31A 1BGVA 2JHGA 3MOIA 2WWRA 2DQ4A 3C85A 3DZBA 3O03A 3ULKA 5AXAA 1NFQA 4EEXA 3RCBA 2VT3A 1SCUA 2VHWA 4U8GA 4J7UA 4GKBA 2P5YA 3W8EA 5A3VA 1QKIA 5F3RA 3GN1A 4IDBA 1KVQA 4ID9A 4AJ2A 1M6HA 1HYGA 2FPGA 1MFPA 1ZUD1 2CNBA 1MUUA 5THKA 4E5PA 5K6AC 1M76A 3HSKA 1GYQA 1SOWA 4UEOA 3S2IA 4DUPA 3GDOA 4WNCA 1NR1A 2GN6A 4MVJG 1E1LA 1GUZA 1Q0QA 1Y5RA 1GEEA 3WICA 1Z73A 2W2LD 4UUNA 2BHLA 4I5EA 4MKXA 4G5HA 4PG8A 4RZIA 4XYEA 1TA4A 2BLLA 5KVQA 3JD4A 4LSMA 2YUTA 4BNIA 1U5AA 2FHSA 4KWHA 4MVJD 4BNXA 1PS0A 3TRIA 1U9JA 3I23A 3AM4A 3QE3A 1NHGA 4J1QA 4ESOA 5L51A 2ZKLA 1RM5A 1YE3A 1YH3A 4II2A 1EEHA 1EVZA 3RUIA 4FBGA 3UCFA 2AXQA 2EWMA 1YS4A 1NTOA 4YA6A 5JS6A 4ZVVA 5TF4A 1LU9A 2Q4EA 4OIMA 3DZKA 3RASA 3ZDFA 1ADBA 1PX0A 1X7HA 2QRLA 3EZYA 2P9CA 4DMMA 2GN9A 3QJ5A 3ZU5A 4BNFA 1KVRA 8LDHA 2WMDA 5IZ4A 4BB6A 1Y8RA 1A5ZA 1C0IA 3OM9A 3U4IA 4IXWA 4GVLA 4M87A 5EQFA 3H2SA 3I4FA 3V1TC 1KETA 5A5FA 1UXIA 4W82A 2NQ8A 3JD2A 5IN4A 4RQTA 4CR8A 4K9DA 4MOWA 3VKUA 1H5QA 4R54A 1XSEA 1PIWA 1ZSYA 1ZK1A 3EK2A 1H2HA 1Z74A 1DJQA 4CQMA 2PKRA 4OMUA 3TZQA 3GVHA 1RYDA 3AOEA 3OSUA 3BAZA 4OYRA 1J49A 1PU2A 3WYCA 3A9WA 3NDJA 4N18A 1FMCA 2XXJA 4Y6RA 4B4VA 3ZCXA 3JQBC 1NWHA 1I30A 1B7GO 4IZIA 3PYMA 1P1JA 4YRAA 4OJNA 2WYVA 1C1DA 4KDFA 4NFHA 1F12A 2XPCA 3MZ0A 4DA9A 3MTJA 1Z6ZA 1YONA 4YAEA 2DUWA 2RHRA 3JQCA 4BIIA 3RWBA 5I7VA 3NTRA 2RHCA 3MEQA 1A7KA 1FDWA 4AFNA 3WXBA 4J2HA 3GDFA 3WG9A 4Q3AA 4CM3A 1EDZA 1Z82A 3PQFA 4CV1A 1WDKA 2HU2A 3QVWA 4GSKA 4CMIA 5KJ6A 3F3SA 1ZBQA 4WCFC 1TT7A 4P4LA 5CDTA 4F6LA 3BA1A 3VDRA 2Y0EA 4W7HA 2PD4A 4BKRA 4XJTA 5CEFA 5KOIA 5A3JA 3SJ7A 4J3FA 1TLTA 3W4KA 4CV3A 5JNLA 4E5NA 1Y7TA 2Q1SA 4ZHSA 4E4YA 2BFAA 5HWSA 5TLSA 4U7WA 5KVSA 1HE3A 1GYPA 1G1AA 2X5JO 3FI9A 2D1YA 3K2BA 5KJEA 1ZKMA 2IXAA 4ND5A 4BO8A 3RC1A 1R0KA 2FR0A 1T4DA 2AE1A 3AW9A 3K96A 1VKNA 4RDHA 3SBOA 1U2GA 3GN2A 1AHIA 2A94A 4J1NA 1YJ8A 3PEFA 1ZMTA 1OC2A 2HO5A 3DONA 4GLLA 2OORA 5T64A 1MA0A 4ZQBA 4RLHA 3CZMA 1V8BA 4OOFA 5DBIA 3ZWWA 1OC4A 3VVBA 3KEQA 4JBHA 4BNJA 3QV1A 4JGBA 4D42A 4J4HA 3RUDA 4KWIA 3O9ZA 4B7CA 4YB8A 2VUUA 2B35A 2YHIA 4XIYA 3RC7A 4CLEA 2C5AA 3IP3A 1HTBA 1U4SA 3RFTA 4OSPA 4E12A 4MVJH 4CM1A 3V5NA 2I66A 3D4OA 2W2LA 4MVJI 4AJLA 3ZHYA 3JQ7B 4L76A 1PZHA 5AQ1A 4RVUA 1XLTA 4XDYA 4ZQEA 3BMOB 3CSDA 3DTYA 2D3TA 3K73O 1JKFA 3PLRA 1LXCA 5TJHA 3H4VA 3A28A 4J91A 4HV4A 1EMDA 3AU8A 4IDGA 1N2SA 4MVJA 1I3MA 3ZNPA 3OICA 3JQ6A 4C4OA 2DBVO 5JMPA 3WTBA 1CF2O 5DZSA 2ZTLA 3H5RA 3G1TA 1H9AA 3DZFA 5JMWA 3W4JA 4KTTE 1AE1A 2NLOA 3DOCA 3TFQA 4AJNA 2YJZA 4IBOA 2DBQA 2Q49A 3TL3A 1H6AA 4BB5A 2VHVA 3FNHA 1GADO 5GMOA 1BDMA 4J9VA 4F6CA 3OBBA 4ILKA 4NJOA 2DT5A 4S3MA 4CLRA 3OJFA 2ZCVA 1UAYA 2E82A 4JCOA 2BMAA 3NYWA 3GAZA 5A03A 1PGJA 3INGA 2VHXA 3FCOA 2JFFA 3STHA 5TSDA 3WFJA 5KCZA 3LT1A 2NM0A 3SC6A 5BSGA 3NT2A 1MGOA 4NU5A 3HDJA 3W1VA 2EJWA 3FBGA 1R0LA 3FTPA 3B1JA 3IKVA 4BNMA 4KDEA 4IQ8A 1W4ZA 1NNUA 4NJMA 3MJVA 3ZU4A 1PJ2A 1GYRA 4LMPA 2PTGA 1ZCJA 4M55A 1I3NA 1KS9A 2OZPA 1GZ3A 3DBHA 1BG6A 1HETA 1YGYA 2XAAA 3ICCA 4NNJA 1U3VA 1O8CA 3DOOA 3L4BA 1R15A 4DYVA 2VZ8A 2CDCA 2EGHA 3OFSA 4K26A 4K28A 3G79A 4YYZA 5DP2A 1EVYA 1KOLA 5T67A 2UUPA 4TRNA 3WIEA 1GD1O 1AN9A 3CKYA 1UJMA 3WLFA 3SC4A 3TJRA 1ZK4A 2O3RA 2P9GA 4DQUA 5EIOA 1Y6JA 3E5MA 3O26A 4JX8A 4QX6A 2ZB8A 3PHGA 1B8PA 1VI2A 1R12A 4FC7A 4PG5A 2XOXA 5JE8A 4BKPA 4A0SA 1BW9B 4YJFA 5DCWA 2V65A 2Q2VA 4YAGA 1DRVA 2BGKA 4IZHA 3PZRA 1IHXA 4RJTA 3OQ1A 1L7DA 1HSOA 3GNTA 3LT4A 3O38A 2B4QA 1IULA 1DIGA 2PKQO 4IDEA 4ALKA 4MDHA 3ETEA 3BIOA 2DUUA 3LC1O 3RBVA 3ZV6A 2C20A 1TI7A 2Y0DA 5F5NA 4CMHA 3TZCA 5JCXA 2WE8A 4Q3NA 3INRA 3K31A 3ADOA 1KY4A 2WD7A 3D4NA 3IIEA 5GZ6A 2AQKA 4XGKA 3UXYA 3WBBA 3K9QO 4XYLA 4XIJA 1KIFA 1U3TA 3GFGA 1UZLA 3F4LA 3OF2A 2E48A 5JFOA 1SZJG 3AUAA 1XYGA 3ST7A 4TZKA 4A7PA 3DEYX 1I32A 3OMLA 3JQ8B 4E2ZA 1GY8A 2A4KA 2O48X 1MC4A 2WTBA 3FWZA 3Q3CA 1ADFA 3DQPA 2I67A 4YR9A 3WYEA 2HMTA 4B7UA 2PZKA 2DAPA 3GT0A 4UUPA 3RBXA 1EVJA 4RVSA 4CMIB 1WZEA 3FNEA 4BNKA 2G0TA 2X9NA 3T7CA 3GRPA 2H5LA 4GI2A 2O7QA 2PV7A 3LDHA 3ZU2A 3PJDA 1G6KA 2ZATA 2NTVA 1E5LA 3CIFA 3GGOA 4PVCA 4GH5A 5IDXA 1SMKA 4OO3A 2O23A 3PYLA 2LDXA 2EW2A 2EJVA 4B4OA 1C1XA 3QWFA 2X9GA 2YQ5A 4CMGA 4K1LA 4I8XA 1ZW1A 3R0IA 2R6JA 4EYEA 3D0OA 4RV9A 1PWZA 4KOAA 1LDBA 2FY8A 1XHLA 1LQTA 1D7OA 4WCFB 4DIBA 5K1SA 1F8FA 1ZSVA 2QYTA 4E2WA 5TS3A 4RF2A 1U2DA 4UVGA 5TJ9A 3JQ9C 2VT2A 3BHMA 2B0JA 4I5DA 3S2EA 3HHPA 4FPXA 1CWUA 4OQYA 2JAPA 3RI3A 3BMCB 1ADCA 4UUMA 4CM8B 1NAIA 3A4VA 1YQGA 3GHYA 1E77A 1GPJA 3I6IA 3CUKA 4I5FA 1LDEA 5HM8A 4DPLA 3D5QA 4ZGWA 2AG5A 1TEHA 5IN5A 3EUWA 3PJGA 1QP8A 1PJTA 2BF7A 2GN8A 4MJLA 4QFDA 5H82A 2J3IA 3HB4X 5A04A 1DIBA 3WNQA 4O59O 3GY0A 3KSDO 4N5NA 1QLJA 2PFGA 3GZ4A 3FTNA 3OETA 3ZW8A 4XRGA 1ZIDA 4GL4A 3TOXA 5MDHA 2BELA 4A10A 4ZJUA 2QG4A 2Y68A 1XEAA 2WJPA 1GTMA 4WLFA 1I3LA 4FJ0A 1N1EA 4PLVA 2E6UX 3AI3A 1SB8A 1F14A 3GUCA 3WJAA 3N58A 4I9HA 3JD0A 1PJCA 3WQSB 3LLVA 1GV0A 3NDRA 4EJ0A 4BO9A 1V35A 4NR0A 1OZAA 3U5TA 5TRTA 1D8AA 1NM5A 1Y8QA 3MJ4A 3PTZA 4R01A 4CLHA 3JTMA 5AVOA 1Q1NA 3BHIA 4LRTB 4BQPA 5AXBA 4E21A 1NVMB 3LF2A 3TZHA 2YY7A 3EVNA 4IY1A 1SAYA 2JKVA 2DBRA 4A26A 1B15A 1E5QA 1KC1A 4YJHB 3RKRA 3PQDA 4ALJA 1P33A 1ZH8A 5DULA 3PLNA 4IDCA 3TZKA 4BOYA 1PEDA 4FGSA 1PZFA 3NAQA 5BNTA 4GX0A 4L4XA 4E5YA 1HDGO 5IG2A 3NDIA 5DDIP 3ZGYA 1JN0A 4WLOA 1YOVA 3WX0A 5BNFA 4U6QA 3RKUA 1E7MA 2I76A 3KO8A 5CDSA 3PWKA 2JD2A 3L77A 3DL2A 4Z9FA 1V3TA 3I1JA 3F1KA 4J9UE 1IPFA 1YDWA 4R41A 3UICA 2NU8A 1UDCA 2AEJA 3DAGA 4CV2A 4J16A 5CDYA 4CJXA 2X5OA 1XQ6A 5JY6A 3FWNA 3PFFA 3V8BA 3I5MA 3CE6A 4ZU3A 2CSUA 4RPGA 2G1UA 4B3HA 1LSSA 2EEZA 5CPFA 3UUWA 1HXHA 4WNIA 2C2YA 3JQAD 1TT5B 4RCVA 3EZLA 2O3JA 3O8QA 1LTHR 2UUOA 2E49A 2JCYA 3DBLB 3GFBA 4URFA 3TDKA 3V2HA 5JYDA 2D59A 4QT0A 4ZQFA 3VHRA 1ZXLA 4HP8A 2PZLA 1C0PA 1R4MB 3ZWNA 4AG3A 5G0WA 1NPYA 2HMSA 4J2OA 5C37A 1EK6A 2X23A 1M67A 2NTNA 3V1UA 2TMGA 4FFPA 3DMYA 1C14A 1H6BA 3RUHA 4EZBA 3KV3O 9LDBA 2AEMA 4TMFA 3P7MA 4H15A 1HSZA 3WGTA 4M8SA 1CJCA 1HLPA 1I2ZA 4WGGA 3ZWVA 2I5PO 4Y6PA 6ADHA 3QQPA 1ISGA 1VSUA 1ZNQO 4IJVA 1N5DA 1EBUA 5BNIA 2P5UA 3UKOA 1K3TA 3I9LA 3KLMX 1X0XA 3BTUA 4WASA 4XGNA 5JAZA 3AI2A 4KP7A 5CFZA 1D4FA 5JDCA 3DXFA 2HMWA 4PRLA 1NVGA 1WMBA 3PIIA 4Y67A 4HFMA 3F5SA 1MB4A 1DBVO 4D3FA 2OO5A 1E1NA 2PY6A 5JCJA 4X54A 1E7RA 1N7GA 4TRMA 3TN7A 4FCCA 2HDHA 5CP8A 4BQRA 1PQWA 3AM3A 3BYZA 4KZPA 1E7YA 3EW7A 1JWBB 3DZHA 4IMPA 3KYCB 1V3UA 2VYVD 1KEVA 4I9UA 5ADHA 3MWEB 3AI1A 3GPDG 1E3LA 4UAGA 4FFOA 1LDYA 4R3NA 4UEKA 2BGLA 1VRWA 1P1IA 4LK3A 3AY6A 3Q1LA 4FSHA 3FPCA 4BMVA 2J5RA 2VUTA 2HK7A 3GVPA 1B8UA 3NJ4A 4UULA 4DREA 5A1TA 3AY3A 4ND1A 3UHAA 4E32A 3S8MA 4YRBA 2VNAA 3G49A 3C24A 1T26A 4HXYA 4R4JA 2YYYA 4IMRA 1DO8A 2NU9A 2FSSA 4QSMA 4OKIA 2Y66A 3GVIA 4W99A 3OJOA 3W4IA 1T1RA 1UAGA 3CTMA 4FD3A 3S2GA 5T8KA 3LF1A 4BL5A 1LLDA 1I36A 3D3EA 3PP8A 5DT9A 5EPOA 3KVOA 2GPTA 3AUTA 1YQXA 5IDYA 3GZNB 1OI7A 1DIAA 3SXPA 4BHTA 3FPLA 4JK3A 1MV8A 2FMUA 1HKUA 1E3WA 9LDTA 5JY1A 1FK8A 1U7TA 3PRJA 4RVDA 4HX5A 3WGOA 2JCVA 2ZTUA 4ZN6A 4R9RA 5L95A 1BWSA 1Y9EA 2Y1FA 3HFSA 4CUJA 1NYTA 4EUEA 1A4UA 1B16A 3GG9A 4IPTA 1QYXA 3ON5A 3PIDA 4KMSA 4AICA 5F5LA 3BTVA 4PN3A 3L9XA 4KQXA 5BT9A 2ZYDA 3BMNA 1QMGA 3LC7O 4J7XA 3AWDA 1RKXA 2B37A 2D2IA 5F21A 5A5EA 1XKQA 2ZYGA 4QFCA 3WWZA 3Q2KA 2Y93A 3PFWO 4M1QA 1LJ8A 2IYOA 4MPDA 2H9IA 4HFNA 1VKOA 3U0BA 1DFHA 1P1RA 2GF2A 2HKIA 1Q0LA 3EDMA 4HNGA 4N5MA 4UVDA 1I33A 4YJGA 1KVSA 1U8XX 5G4KB 4BNZA 3HWRA 3VH2A 1IUKA 1P0CA 5AOVA 4QO8A 4GKVA 1CQIA 1O0SA 3A14A 1PGQA 2W98A 1F06A 2QZ9A 3ITKA 5GZ3A 2CDAA 3I9JA 3PHIA 1P0FA 3FN4A 1J6UA 4BKOA 2H6EA 5EN4A 2IYPA 1E3SA 1ENZA 1J0XO 4FJ2A 5DNAA 2CUKA 2GCGA 2ZCUA 3IS3A 3I3OA 3WOHA 3AOEC 1ONNA 4U0KA 2DKNA 3UVEA 3JQAA 1Y8QB 2Q45A 1N1GA 4CMJA 1U3UA 5FEUA 2Y1DA 5H83A 3NGXA 1NQTA 4Q3DA 2AG8A 2HK8A 3TZ6A 4HWKA 2AHRA 4XB1A 2PA3A 2J8ZA 4QECA 4ZD6A 1PSDA 1PJQA 4TSKA 4CPDA 3KHUA 5F1PA 3MTGA 5HS6A 1GR0A 4EITA 3DHYA 4XCVA 3L0DA 4C7JA 3NGLA 4PLYA 2UVDA 4IUYA 5IF3A 3E82A 4EUHA 3H9EO 4GX2A 1ADGA 4S1VA 1E92A 3GUYA 1KEPA 1LC0A 3RAJA 3RU9A 5CEJA 1L7EA 3DBVO 1RYEA 3M6IA 3OP4A 4YPOA 1PL6A 4RZHA 1LA2A 4DQXA 4DRYA 4B3JA 3SJUA 1XELA 4YVFA 1N9GB 1UDAA 1GUYA 3VOSA 4CM7A 1DHTA 4CMAA 2B83A 1EQUA 4E2XA 3HN2A 4BGEA 2O50A 4RVGA 4MKZA 5L7YA 5JPIA 3IL2A 1A9YA 3ANLA 4R1SA 4LW8A 3WBFA 1T2FA 2VYVA 3GG2A 1ZEMA 1QXSA 2TMDA 3OQ6A 4C7KA 2I65A 3I9NA 1LRLA 2W2KB 2EERA 1EUDA 4XZ3A 3RSHA 1LEHA 4HFJA 2RH4A 3QWHA 3WGYA 2QW8A 1H9BA 5FI5A 1CDOA 1T4BA 3KB6A 3ZWPA 4J49A 1D3AA 3CMCO 4HY3A 4PIVA 1T1SA 4CLOA 4RDIA 4BGVA 3B20A 1QYCA 3SVTA 2NVUB 2PD3A 3L4SO 4OKNA 4INAA 4NK4A 4DQVA 3OHSX 4OH1A 1LLCA 3ZWBA 2UDPA 3VZRA 1K89A 2Q2QA 4E13A 1ZFNA 2G5CA 4CM5A 4CQLA 1ZMOA 1YKFA 2GZ2A 4Z0PA 3UH1A 1M6WA 1VLLA 4GX1A 1TVEA 2X4GA 1UR5A 3KEOA 3RFXA 3WR5A 2HCTA 4PLTA 4EJMA 2NUAA 3K92A 4H3VA 2DFVA 4BO4A 1MXFA 4A2CA 1JAXA 1RJWA 1UXKA 3GPIA 4QXMA 5U4QA 3WFIA 2O3TA 2OHXA 3TOZA 1G0OA 2WEKA 5LDGA 3ZHBA 1SEPA 4R69A 2VRCA 1ISFA 2QYSA 4I5GA 4JJIA 5G2OA 3DZJA 2IEDA 3DZIA 3S55A 4JBGA 4YT5A 2C59A 1O89A 5EERA 1GFSA 3JQGB 4NH4A 1YBVA 1PJBA 5BSFA 4FN4A 4XWYA 5HS4A 1ZEJA 4ALIA 3VPFA 1Z75A 4QQRA 2JCXA 5ER9A 1E6UA 2BGMA 1BMDA 3WS7A 3BMQB 3H3FA 4DLLA 2DTXA 3QWAA 3NV9A 1JU9A 1M2WA 2AQ8A 4M54A 2FRDA 4BO1A 4AJPA 4Q9NA 4IS2A 2CFCA 2GYYA 4W9NA 1QYVA 2GO1A 4E30A 3ABIA 3M2PA 4RO0A 1M66A 4TQGA 5A02A 4BNGA 1V0JA 2YW9A 3ANMA 4BO3A 1RM4A 5IFLA 2VWPA 4J1TA 3WGQA 1Q7CA 3BTSA 5CDGA 3MJCA 4JIGA 4PLGA 3D1LA 4TRJA 3E48A 4XDZA 4CM6A 4GMFA 4ZQHA 1WDMA 1QR6A 1E3WB 2E4AA 3H65A 2YV3A 3GDGA 5I7EA 5TX7A 1DFIA 2DTDA 5C7OO 5KVCA 4H7PA 4R3WA 1N92A 1BVUA 3FD8A 3KUXA 3C1TA 1JKIA 5B4TA 1VPDA 1P1HA 3UCEA 3VZQA 3L4BC 1P74A 5EESA 1HRDA 1HDOA 2CY0A 1HEUA 3GOHA 3QVTA 5EINA 1N8KA 3ZWYA 1VL8A 1AUPA 1DRWA 4NBVA 2JJYA 3AFNA 1T25A 3PHJA 2OBNA 4L0QA 1Y9AA 4LVUA 4XYGA 3ZH2A 4DVJA 3H8VA 1LQUA 1EZ4A 1YB4A 4M89A 4MIEA 4XYMA 1EDOA 3CINA 4WLNA 2B5WA 1I2BA 4RPKA 3BHJA 1PJLA 4KUHA 5TT1A 2A92A 3QSGA 3L07A 4GLOA 3IJPA 2D4AA 4K6CA 1W73A 1P9LA 3WLEA 4AJEA 4N54A 4AL4A 4A5OA 5ITWA 1U8FO 4HUJA 3NRCA 4TKLA 3OIGA 4OXNA 1SC6A 4PG6A 5EQDA 5DOZA 4IXTA 2VCYA 2RCYA 3TQHA 3ZV4A 5DCYA 5BSHA 1P45A 1X7GA 3F1LA 1DEHA 4AVYA 1PJSA 3PJFA 1UP7A 2IDZA 4JN6B 1GZ6A 2CDBA 3VPXA 4HADA 5B37A 1SBYA 3H9UA 4R5HA 1Y8RB 3IDSA 5IZCA 3PK0A 3DAFA 4NDNE 3IKTA 4DWVA 4D45A 4WPGA 1WXDA 2I9PA 5BR7A 2X0RA 1DB3A 4GX5A 1R16A 3GEDA 3IP1A 5DCUA 2PWZA 5C3MA 3C3XA 5KJFA 4D3SA 3E18A 4CQMB 1A9ZA 1DDOA 2JAHA 1TB4A 5L4NA 2RBEA 1F17A 1HYHA 4D43A 1HDCA 4JROA 4UVHA 3ROMA 4PCVA 2FR1A 2Q1TA 1U4OA 2C7GA 2Q1WA 3UCXA 3ZWCA 3K5PA 2Y1CA 4Q3CA 1B26A 1LRKA 1JTVA 4CMKA 3LLSA 2VWGA 5JXWA 5A9SA 1IHYA 4YT4A 3VPHA 1OAAA 1YQDA 1V9LA 1PGPA 1C1DB 2V6FA 2AEFA 3W6ZA 3X2EA 3TL2A 5G0SA 2O3UA 1UH5A 2I6TA 3LT0A 1I5RA 2VYND 5JAMA 1C3VA 8ADHA 1LSJA 1UXGA 1T2EA 2P2SA 2VHZA 3JV7A 3VAZA 3MJEA 5I9NA 3HUDA 2B69A 2B4TO 2AQIA 3H9GA 2ZJ0A 4BO6A 1PL7A 4DL9A 2SCUA 3WQQA 4Z3KA 1FXSA 1R4NA 4PLFA 3ZHZA 3ICPA 4PZDA 3CXRA 1X14A 2GSDA 1VL6A 2AA3A 2VNSA 4B3IA 4AJ4A 4B7XA 4J4TA 1ISHA 2Y1EA 4TWRA 5FFFA 2WD8A 4HBGA 4IJWA 4DPKA 4Q39A 3TWOA 1YB1A 4R1UA 3GC6A 3ITDA 1TXGA 1PL8A 1GU7A 3DFUA 4UVIA 2CMDA 3QWBA 3JSAA 2HRZA 1ENYA 2GN4A 3B1FA 3PGXA 1LI4A 2X58A 4RF5A 1U3WA 3HDYA 4ITUA 3I9KA 3DHNA 4PZEA 2Z1MA 5JCJD 4F46A 4B8ZA 2QX7A 3INTA 3NT4A 3V2GA 1E3IA 1IZ9A 1VE9A 3B1KA 5IDQA 1WLYA 5KIAA 1DC5A 1QORA 2J6IA 2FP4A 5ILGA 4CM4A 5IJZA 5ILOA 3H9QA 2YFQA 4FGWA 1RPNA 2DBZA 4I08A 2RH8A 5KKAA 1SPXA 1VSVA 1GV1A 2ILTA 3U49A 4A03A 1HE2A 4IDFA 4ND3A 3RQSA 2HMUA 3L9WA 4WKGA 2YHIB 3GEMA 4PGFA 1LBEA 1PR3A 3ONEA 4DMLA 2F00A 1BDBA 2YDYA 3RIHA 1HYEA 4RVHA 4YBZA 4BNVA 3D3WA 1YRLA 5EL0A 3KSZO 5CAEA 3HFGA 2NVWA 1B3BA 1PS9A 1E1MA 1X13A 6LDHA 3ORFA 4BNWA 4JNKA 1CYDA 4WLVA 4PFJA 4LCJA 3QHAA 4GVXA 4UEJA 3OIDA 1KEUA 5A06A 3PI7A 2X7HA 3H5AA 4NHEA 2NU7A 1EQ2A 3HB5X 4HFRA 2EGGA 2FPIA 2C2XA 4RPJA 4O1MA 4R5MA 1X1TA 2VZ9A 3VH4A 5MGBA 3UAGA 2X0NA 4TVBA 4XQEA 1P1FA 1W8DA 3OA0A 2O4UX 4ZRMA 3JYQA 2GDZA 4FJ1A 4P8RA 4Z9XA 4J43A 3RROA 5CPBA 5I9LA 4JP3A 3C7AA 1K0UA 3QY9A 1DPGA 4R9SA 4XYBA 2H1SA 4RL6A 5CG1A 4BNTA 1XIVA 1XR3A 3JQDA 1ZO8A 4W7IA 5JYEA 1UXHA 2HAEA 2FOIA 2R00A 4G65A 3WSWA 4CLRB 3VPGA 3WGHA 4RPHA 1H94A 5ICSA 2NADA 3W8FA 3P2OA 1WVGA 3OECA 4GMGA 1ZJYA 4IGEA 1YJQA 3UOGA 4OHUA 1BTOA 2OL4A 3KYDA 3JCZA 3Q9NA 4AJJA 4WCDA 4CLXA 4BNLA 3WB9A 5KVVA 1I10A 3H3JA 4XGIA 1Z7BA 3A1NA 3AY7A 3IUPA 3VTFA 2C07A 4PLPA 1ZXBA 1ML3A 3Q6IA 3ROKA 5LDHA 1NR7A 4NJMB 3K2EA 5L9AA 1P3DA 3OEYA 2ZYAA 4XR4A 5L45A 2IXBA 2AW5A 4WEOA 3U62A 3PDJA 4Q3EA 2OOSA 5DBFA 4DC0A 3DBHB 4G81A 3RJ5A 3TSCA 4U5QA 2NTJA 3VZSA 2B5VA 3DMTA 1F8GA 2JD1A 3CPSA 4NK5A 3S2FA 4AJ1A 4J7CA 1K5HA 4XEHA 2PNFA 4IDDA 2VN8A 3GNSA 3QVSA 2W90A 1UP6A 4Z6KA 2VYNA 4YWJA 4NBWA 5JDCC 4FR5A 1RWBA 4NZ9A 3OJLA 1K6XA 2PGLA 3DWFA 3KSUA 4YQZA 4BKUA 2QQ5A 1YB5A 2HUNA 3IJRA 3M1LA 2PK3A 1K6JA 1HT0A 4ZRNA 4CLDA 2G76A 2J3KA 3G0OA 3VKVA 3RUCA 4ALLA 1VJ1A 1YBAA 4JLWA 4Z9YA 5AXCA 1QLHA 1VC2A 3U3XA 2IEBA 1DAOA 4YJFB 3W8DA 3MJTA 3VC7A 4GQAA 1IE3A 2FPPA 3QWIA 1SNYA 2YV2A 3OH8A 3DTTA 4KUGA 4E3ZA 1ID1A 5IDWA 1B3RA 4LISA 3OJEA 3JQFA 2ZJ1A 1HDYA 3ZWOA 3CEAA 2NQTA 2BFOA 4QEDA 4E31A 3GMSA 4BNHA 3GNQA 1BXKA 3ROQA 2A35A 5B1YA 1GUFA 3V1YA 3GGGA 4YJDA 2HJSA 2V6MA 4WEQA 4XQ9A 1CRWG 5CG2A 5TGDA 2WD7B 3WGIA 2Y99A 1UZNA 3CZRA 4NIMA 4LGVA 4FFMA 3GF4A 4Y6SA 3PYXA 4MP8A 2Y67A 3T4XA 4D0SA 3ANNA 4JP2A 2A9FA 4FIZA 1NPTO 5T8KC 3ZWXA 2NNLD 4O63O 1JLLA 4PZCA 4TRRA 5JDIA 2C0CA 3JD3A 4GWGA 1A7AA 3NX4A 5HTOA 2EKPA 5U9CA 3ZU3A 4M86A 1EE2A 3L6OO 2VWQA 1R4NB 2Q1UA 2B36A 4P4NA 1VL0A 2GNAA 3C7DB 2D5AA 3I4CA 1FDSA 2WE7A 1WPQA 1DC3A 3DZGA 1NXQA 3WNVA 1ENPA 2Q3EA 2WYWA 1S6YA 1JVBA 3TNLA 3U4CA 1EUCA 5F1OA 3Q9UA 5JC1A 1NX6A 4J6FA 5A9TA 1JKJA 2D5CA 5BSEA 3AOGA 2QHXA 5HBRA 2GZ1A 5T6BA 4UVEA 3ENKA 5G0VA 3DR3A 4E5KA 5KTKA 1PZGA 5A4DA 1KVTA 1MX3A 5FI3A 5IXSA 1C1XB 1GZ4A 3LQFA 3I9OA 4CM9D 5G4LA 3GRKA 3S1LA 3WWYA 2EV9A 4GAEA 1EE9A 3GMDA 4JXKA 5A05A 1MXHA 1I01A 2ZB3A 2VRCD 5CEEA 3PGJA 3AJRA 1PR9A 4XD2A 4D7AA 3BMOA 1IYZA 3L6DA 4Q3BA 1ISIA 2EIHA 1DOHA 1HE5A 2DLDA 4WECA 3PVZA 4B79A 3PWSA 5L4SA 1WMAA 1ISJA 3NUGA 4NBUA 3EC7A 3ZNOA 4CMEA 4TKMA 4KTVE 2EG9A 2P9EA 1OFGA 1PQPA 3PXXA 4BO2A 5GZ1A 3ZV3A 2AQHA 3QRWA 4BO0A 1ULSA 4CUKA 4B8WA 4N5LA 1DIRA 3C8MA 3DBRA 3GAFA 1NBOA 2FN7A 3GEGA 5THQA 3PZBA 4LRSB 2NU6A 4Y8VA 2O3SA 1O9BA 2J5KA 2YDXA 3D3WB 3NEPX 4JBIA 4A73A 1DC6A 2I99A 2X8LA 1QV7A 2GRAA 4BGUA 3DHEA 4LCEA 5HRUA 5LCXA 4DGSA 1EK5A 5IAAA 5TNXA 4OAQA 5L7WA 2GASA 5H81A 2OUIA 1I2CA 2ET6A 2NVBA 2ZK7A 4IJKA 2R2GA 4L73A 3GLQA 5JO0A 4BO5A 2BD0A 2HJRA 1ORRA 4YTEA 5COAA 3NTOA 3ZNNA 5BQFA 2G17A 3E9QA 4E5MA 2D0IA 1UUFA 1WZIA 1MFZA 2EW8A 4PVDA 2E37A 2POQX 1O94A 3I6QA 1AHHA 3H9JA 2PKQP 3K30A 2X0JA 4GGOA 4GPD1 3IUSA 5I7FA 4MP3A 3ADPA 4D46A 3F47A 1K6IA 5CDUA 4OSOA 2Q46A 4BUCA 2FWMX 4LN1A 3NTQA 1KY5A 1P77A 1RM3A 4AJHA 1GL3A 2DFDA 3FNFA 4GSLA 2OP0A 5CHEA 1T2AA 5KNLA 1HF3A 4NU6A 3R3SA 2VOJA 1ZJZA 4D44A 3ROPA 5K6AA 3KYDB 5C7IO 3E5RA 1YOVB
chains in the Genus database with same CATH superfamily
2BKUA 4YT8A 1RW4A 1XZJA 3DMPA 4BMSA 1K9SA 2H63A 3COYA 5AOBA 3HPQA 5FFMA 3IR7A 5H02A 1F5NA 3WK8A 5A4IS 3F73A 3G8CA 1T9ZA 3PTLA 2JRLA 4R1NA 2MJLA 1Y4AE 3UHPA 1K3FA 4EFLA 4X44A 2QTGA 4N0QA 3U7HB 4OOEA 2UXBB 1XTSA 4MAAA 4IHAA 2QN3A 2C92A 3T5TA 1YL5A 3COWA 3I9MA 3ANXA 1FTGA 3QIVA 4H1TA 3ZLBA 4OGFA 2AFVA 5FOUA 4UUAA 5IDVA 4UTRA 5T6MA 1BW9A 3NT5A 2I3AA 4B2YA 4X6LA 4KN9S 1PR6A 4RORA 2P9JA 4LHEA 4EHAA 1XXHA 4RF4A 2P0EA 3K9NA 4GT1A 2Y1GA 3U40A 1YZTA 1B93A 3A3OA 4TV8A 4URYR 4D0NA 4EJSC 3O8QB 4Z2YA 3TTVA 1ZN7A 3QLUA 1CETA 4AZ0B 1U98A 1FDIA 2EAUA 1IN5A 3E35A 2WYUA 4P4TA 4EDFA 4EIWA 2WAAA 4ZT6A 2Y6VA 3ZI0A 5FWYA 4MVJF 4KFCA 1H5NA 1FUEA 1QHSA 1PWXA 4HCJA 4NU8X 4CEJB 4DV1B 1Y1PA 2Q1YA 1QCCA 4YAKA 3K0KA 3AM5A 5CLJA 2YQ4A 2OP1A 1BSVA 1V26A 2KJQA 1HFEL 1KO8A 2W4IA 2XNKA 2DFTA 4IM7A 4ND2A 1QRRA 4QPNA 1I8TA 4UFOA 1GT91 1SBHA 3OG9A 3K9HA 3WAGA 4MHTA 5J4VA 3COSA 1D1TA 4KFRA 2GJ4A 4GQIA 4YRDA 5KB3A 3KKMA 3PV0A 1R9GA 3JALA 2NO1A 2XHEA 2MOKA 1GPDG 3NKLA 2JFWA 1W5SA 2A58A 5H8WA 2GLXA 4D81A 1BKDR 1KWGA 3ZIUA 1KQFA 3EIFA 3HVKA 5L51A 2OILA 2H59A 1KI9A 4RMHA 1ZH2A 1QBKC 2PX6A 1MJFA 5KNBA 3DAYA 2G71A 2JI4A 4EFMA 1J56A 1T9HA 2JA2A 4YK7A 4YPVA 5AVXA 4MQMA 1SCNE 2G5PA 5F2NA 3DZDA 5LQDA 4QYMA 1VSQA 2W6CX 2IKQA 1U7UA 4I4LA 4M4SA 1L8XA 4DM7A 2DQSA 3H18A 4BJ5A 2FW8A 2BI7A 1KTVA 1P9NA 4UFPA 1LSOA 1CK4A 1NL3A 1H3NA 3R5KA 3WFZA 4G24A 4NQZA 4EGCB 2QN6A 4A2PA 3L8HA 5J40A 1CIVA 1EUZA 5A7HA 4M1KA 3UGQA 1N2HA 1MVOA 4RA6B 1HMYA 4TSRA 3RIMA 3TUZC 1D7AA 2ZWAA 5EIAA 2QRKA 4KFSA 2IS1A 5JMTA 4Q7EA 1U9IA 2WJIA 5K8LA 2D8AA 1VMDA 4J75A 2E5LB 2GERA 5K3CA 2BH9A 2D1RA 1Z34A 2WOJA 1E0DA 1Q0TA 4Q47A 5JARA 1RVV1 2C3YA 1HFKA 5AJUA 4DXHA 5IXYA 5HUJA 4OYHA 1R6DA 4LECA 3I39X 2ZPUA 2YJ5A 3EUFA 7MDHA 5FX2A 1YS9A 3KVYA 2VHJA 3LA6A 4II3A 1WG8A 3KL4A 5BPHA 5F7OA 3PX7A 3Q5DA 2GZ3A 4Z8XA 4Q9KA 1ANKA 3OCWA 1GRNA 5KJ1A 3EGDB 3IV7A 1NRJB 5C1PA 1Y1RA 3V4LA 4WCFA 5AW2A 4ZCSA 3G2KA 4DHEA 5K7SA 4YP7A 5ENVA 2X86A 3BXXA 1SEVA 5FBRB 3WQRA 2VPYA 2X14A 5FI0B 1EFKA 1P75A 4JC5A 3WGZA 3PKIA 1LPPA 1VXOA 1SK9A 2GEVA 2NU9B 3C39A 3RHSA 3EGXA 2PJZA 2VC2B 3RFVA 4DZRA 1ZGHA 3R6DA 3ZKWA 4KDRA 2O2SA 1NNI1 2MSNA 3K2QA 1GEGA 5AHXA 4CM8A 4ZDKA 1OGIA 3GRYA 1JHMA 1TVKA 1RJ9A 1PGNA 3AU9A 1NY5A 4I1UA 1U28A 2IF0A 2GOYA 3A3NA 1RPJA 3ABOB 1V1RA 2QSYA 3P96A 4PLHA 3V7YA 1ESMA 1K9VF 3EC2A 1MKYA 1Z22A 2FQXA 2PZJA 3ODGA 1CB0A 4P36A 2ZSAA 4UCQA 1K98A 5GOTA 1K7XB 2AMFA 2FB9A 2HT6A 4NECA 5B58T 5JRDS 2GAJA 5EIFA 1YCDA 3G1UA 5EWMA 3W5VA 2C7QA 2ZRKA 5AJVB 1XD2A 5D7BA 3VHQA 2UKDA 4C6SA 4UBLA 1Y6FA 4N6NA 1X3SA 1Z47A 4LZJA 3P9NA 5EMLA 1DEOA 3DV2A 1JBQA 3M2TA 2V0CA 2GCPA 3ZDEA 2Y2UA 5C4IA 2LDBA 2GRUA 5JW6A 5TQVA 3EGOA 3WIOA 1N2ZA 2XMQA 4Y9RA 2WWIA 5JSKA 4HQ6A 1SD1A 2Y2VA 3P2YA 4F3TA 3RF6A 5FCDA 4DE5A 2QE7A 3N75A 5IAEA 4L9RA 4XASA 1WP4A 4B83A 3AM1A 4JH0A 5LB2A 3JR3A 5JWOA 3DBRB 3G13A 5BW5A 1JH9A 3N9IA 4U0JA 2ETVA 3EG9A 1WZUA 5H70A 5BN4A 1YO6A 1W4BA 1MENA 4MGYR 5D5HA 4GYWA 1Y1KE 3RBAA 4UDXX 4CQNA 2BKAA 4RHCA 3P2KA 1UJ4A 2EFEB 2ZB7A 3HSYA 4YACA 5I9SA 4DMFA 1DAKA 2QRZA 3HQ4O 5IZCC 4DNPA 3LSYA 5JBQA 2NTYC 1CQIB 2ZFUA 4ZJYA 1XNJA 2HQ1A 2QVXX 3QUBA 3LBAA 4G2NA 3UKDA 4AUKA 1UC5B 1OASA 2RK3A 5TGTA 1XTIA 1JKMA 3LW7A 2WTMA 1EH5A 1JVSA 2PHZA 1I7SB 1IL0A 1T1GA 3MMPA 5B4VA 3NALA 4IIJB 4MUAA 1GJRA 3ZOKA 2FW6A 2VZ0A 3K6KA 4ZVMA 2P5TB 2ZT6A 4A6DA 3QA9A 2XMSA 4HMQA 3L82B 4ZI7F 3REQB 3RD5A 4RKQA 1U0TA 4ZZ1A 3KELA 3THYB 4ZZ3A 1W5FA 3BT7A 1UPCA 3FF4A 3JQAB 3R5XA 5FOVA 1OBCA 5ECYA 5L6LB 1LVUA 1DVRA 3HGTA 1ORWA 2IHKA 2R84A 2Z1DA 2BUAA 2QQ0A 5EZ5A 1A8UA 2ZQYA 1GAXA 1MG0A 3CRNA 5IJWA 1PQUA 4RKWA 2C9ZA 1J5XA 3NFYA 1S7CA 5DISB 2YWXA 4NU0A 4WACA 1N7HA 2HADA 5A9RA 3WLAA 3NJ8A 1GSIA 3QNUA 4B84A 3P1JA 3WV4A 1GQYA 3BH7A 4P22A 4DCUA 3UB3A 4UM9B 5KWJA 1L3CA 3A7DA 1AKVA 4UOZA 4MEBA 1N34B 3A4LA 3VVMA 4HR7A 4MPPA 2XIQA 2VUIB 3SZLA 4F3YA 3HL0A 1OWLA 4W5OA 2A1UB 3JSXA 2CJWB 2PRZA 4NBRA 2J3JA 5U1PA 1RLOA 1RT9A 2FQQA 4ALLA 4XB6B 2JJ2D 3GBVA 4QNRA 1W76A 1TM4E 4XIGS 4YLYA 2Y6UA 4KJXA 3WTCA 3A2MA 3D5EA 3LT5A 3B82A 2B2CA 4Y9TA 5KKCA 4GBJA 2Z98A 1GZHB 3KJIA 3LGXA 3H16A 4LYDA 1JLRA 3AIIA 1ORDA 1KI7A 4RMGA 2QRNA 4JQCA 2JKYA 2NT3A 4N9QA 2WM3A 2NOAA 1FLDA 2V5UA 2NNWB 1AKMA 4U2DA 4EG0A 1O95D 3H1FA 1NW5A 4U9HS 2FE4A 1MG5A 1QWOA 1XXHB 2C31A 3A2LA 3BWDD 2X6TA 3IERA 2BHSA 3F96A 4TV8B 4Y2UA 1JIQA 1JL3A 5B4UA 2Q5EA 4IQGA 5BN4B 1XE3A 4IS3A 1KSJA 1M1YB 1R9JA 2OCYC 5FF9A 3UXMA 2H54A 2ECQA 3IH5A 4J1SA 4NICA 4NESA 5EXSA 4W8HA 4AYXA 4RWZA 3LDGA 4ZODA 2QD1A 4CR6A 3DC2A 2JGNA 5C32A 4GMXA 4UM5A 3RNLA 3DF7A 5LVAA 1EFTA 1Z28A 3FUWA 1A69A 2V97A 2Z3VA 4RKRA 2GN2A 4UDYX 5MN5A 2CNWD 3BWBA 5K3BA 3PPWA 5I51A 4RD3A 3B7PA 1NRIA 4OHPA 4Z7QB 1HDIA 2YFHA 2ZJBA 3D43A 4W6ZA 4WLUA 1V4BA 4ZOAA 2O8BA 3AH8A 1BCSA 2ZZMA 4QQKA 5K0ZA 5B36A 1UL1X 2PPVA 3N7UA 4LXHA 4P1ZA 3VU9A 1N25A 2B2XA 4BDSA 1X7XB 4NXMB 4KYIB 2WVGA 5K6TA 1NYRA 4DBVO 3ND7A 1IBMB 1X80A 3EXFB 5F12A 4IGFA 1WSAA 4BVAA 5LSAA 5ALWA 4R8SA 2MDTA 2GJ8A 5JXGA 2DCUA 3R9IA 1SCAA 3UMYA 2Z09A 1SQFA 4NVRA 3NTUA 4Q3LA 4M83A 4UKDA 1ADJA 3T1TA 1PV4A 1E6EA 1RLMA 3VR2D 2HYDA 1C81A 3GU3A 2ZRQA 3LCJA 3ZCRA 4YAOA 3HB7A 2QF7A 1I14A 2I2BA 3C6MA 1PI3A 2G28A 4ZI2A 1SM4A 1Z8FA 4MKRA 1H2FA 4MRMA 4XDHA 4GKKB 1X92A 3UB4A 1QPGA 1LC3A 1Z0UA 4TOIA 2JL1A 4I1YA 2EC5A 5LD2C 1XJQA 4L22A 2BGGA 4QHSA 4QZVA 3VSCA 1QNFA 5HHTA 3CX8A 3SKYA 2ERYA 3Q3JB 4FLMA 2EEPA 1RQGA 2UV8A 3MOGA 4MP6A 5JBIA 2C58A 3TLEA 3H5NA 5IM4F 1U8ZA 2FX2A 3M81A 4HZGA 4FFRA 1AXEA 5LXTF 3PR2B 1WNTA 2XUAA 3P20A 1KP9A 2CVQA 3PGLA 3KSRA 1DCKA 1H69A 3R23A 5AVKA 1T3TA 4NJEB 2FWJA 5HIMA 3LYHA 4MMXB 4HLQB 4JLNA 1IY8A 2ZIVB 4FMPA 2PMEA 2DVMA 2VDWA 4ND4A 4PIPA 4WA8A 5FL7A 1VOTA 3V42A 1RXYA 2H4HA 2CL6X 2I3GA 2X8AA 1ZCBA 4H0FA 4RANA 4ACBA 5KQRA 3QW2A 1L5MA 1A50B 3EGXB 2W2PA 5CT4A 1N8NA 2Q21A 4HKTA 1R3DA 4MIKA 4PSDA 4B4WA 5JHHB 2YFYA 1CDZA 1F4LA 2W6NA 1T3SA 3EYWA 1ZI9A 1RKBA 3FAZA 3PPIA 1TVKB 3QVJA 3IQDB 4WK4B 1FP4A 1IB6A 1NFRA 1T9CA 3C15C 3QPAA 2OC4A 5K4AA 1O9GA 2CL0X 4I1IA 2PQ2A 2YVKA 5TIIA 1KRWA 2WUWE 2D1TA 2H9AA 3I09A 1PP4A 3RRFA 5B6JA 3DE7X 2BC9A 4EA9A 2G08A 1E4EA 2XWSA 3R5JA 1JAZA 4Q1CA 2ZE7A 3V8MA 3HDHA 3D6NB 4IEFB 1T2UA 4DA7A 5C1BA 1XGKA 1L5LA 2B1GA 1J23A 3G7SA 4N8SA 4OJQA 1XD2B 3TQQA 2ZIZA 5H0IA 4TVKA 4EK9A 3FLEA 4XLZA 5BXYA 5EKXA 4RVFA 4D8VA 3S1AB 2DHEA 4IRXA 5HQ3A 4TL8A 2BMWA 2BI8A 3DMTC 5KOJB 3IT3A 5JS1A 3ADBA 1HX7A 4QWMA 3KQNA 4M0CA 2GPYA 2I03A 4FQ7A 3WNZA 2C5EA 4ZICA 2FZEA 2XUOA 5FBQB 4CRWB 4GGMX 4DIOA 1NWCA 1T13A 3L06A 1W6UA 2C4KA 1BQ3A 2OFPA 2O2JA 1TAUA 4HXFB 4P4SB 5F52A 3EOAI 4I50A 1GNQA 1TCAA 4JJFA 2Q8QA 5KINB 1C41A 1QUEA 3DFKA 5DN9A 5FUXA 3VDQA 5L4NA 1RC8A 2PH5A 3PNBA 2NWQA 4O4HF 1DIHA 2G4CA 1LLUA 1M5RA 3R3YA 1QTNA 4K03A 4PEVA 4ZU1X 1NBAA 3KD2A 3L8EA 2ONYA 3S81A 1Z37A 3AJDA 1DO2A 1FVXA 3AQIA 3EZNA 4LRXA 3LFTA 1DDIA 3P94A 2HRDA 3UW3A 1YBHA 5C81A 4DN6A 2VHYA 3QVVA 3MSCA 2YUIA 1T2DA 1I3KA 3SLKA 5G3ZA 4DBZA 2DPGA 5HF5A 4JLJA 3KYBA 3MPUA 4A27A 4W9MC 4RHFA 1LW6E 2LVBA 3T94A 3JQFC 4EQZA 2HSDA 4V0ME 2AX3A 2W71A 3VXKA 1QGOA 1NW3A 3M70A 2I4TA 3QVXA 4XD7D 4FOPA 1YUBA 3HO1A 3DO5A 2F3PA 2CMGA 3I2YX 4TQ9A 1A1VA 1IBRA 2ZWVA 3BERA 3MTQA 1JI3A 2ODAA 2Q3LA 4Q7KA 5JFTA 4GEKA 5A3SA 4ZEWA 4ARVA 3TI9A 4FYVA 3U4HA 4B1FA 5CD1A 4CL8A 1RDFA 4ND8B 3WGGA 2GBFA 3DB1A 4NFYA 4F2DA 1PR2A 3AHGA 3R4CA 4WBXC 4ZYLA 1YS2X 1WLSA 4OJTA 1O0CA 1C8VB 3H99A 3TPZA 4KRXA 2P90A 4ZU6X 2I4IA 3OHMA 5HK8A 2DPHA 1N57A 4AD8A 2N0SA 1O6ZA 4LOLA 4IFEA 5I7SA 2AJTA 4AMVA 5JCOA 5JFGA 2H2DA 2FFHA 2HF9A 4UCXA 2XZTA 3B6JA 2M6KA 3GD7A 5ISMA 2OC9A 2A9QA 2WWVD 3C45A 4V38A 4WOKA 4C21A 4EW1A 4EVIA 2H1VA 3KKEA 4INOA 4HT3B 1JG2A 1KJNA 1VJ0A 3N8DA 3P5SA 4DA6A 3HB9A 1GQQA 3NHBA 2HMYB 1H5UA 2B7LA 2DBYA 2H2FA 4X65B 1R0ZA 2X9LA 4LHVA 4OLAA 1XTTA 3W5UA 1I5EA 3AEZA 4C22A 4ZO9A 1IM8A 2P1RA 4IHQA 3C3BA 3EG5A 3LBFA 3L7YA 3VH3A 2BMEA 2WIKA 1U0EA 5KYVA 2J6HA 2P91A 3L1IA 3VNRA 3LPCA 3E03A 3KEMA 3LQKA 4QE3A 1E59A 3QP9A 3P2JA 1ND6A 1FU8A 3CS3A 2CXHA 3H6KA 5ALKA 1GPH1 3QE0A 4TL7A 5ES3A 2O3QA 4AJ9A 5E4TA 5DK4A 3IT1A 1FC0A 2O0LA 2BFEB 2W2TA 3AERB 1U1GA 4JODA 4U6SA 3TO5A 1UFVA 4PZ0A 2BZ0A 5HF9A 4B82A 1XA3A 3OBIA 1DX9A 4K87A 3F7OA 5EAIA 2ZRCA 5L3SA 4D80A 2FN4A 3W06A 1OFVA 3ASUA 2IZZA 3O1LA 1HNWB 1FTNA 1T9BA 3WGMA 1TRHA 1UDWA 2IF2A 4QSHA 5BP7A 2O8BB 4DPMA 1JA1A 4XCQA 1BCSB 3WMXA 1DEAA 2KBEA 4PRKA 1OIXA 3DEFA 4JBXA 4RZ3A 5TXGA 5J3JA 1UM9A 4PZ9A 5AJTA 3WMRA 4GLFA 3MRXA 5D5PA 1RJFA 1CSEE 1E63A 1NI5A 1Z2NX 4F8JA 1TX4B 3N76A 3QMWA 1X80B 4WADA 4YJ3A 4LFBB 3K16A 3WJ7A 4FBLA 3IMFA 3NWBA 2VTDA 4IL5A 2P2DA 4TROA 1XQVA 2HY7A 3HBMA 5A0VA 5FV4A 2C29D 2IPLA 1TUGA 2VF2A 2EJCA 4A6XA 3VU0A 4FFNA 3NBYC 1L7PA 3ZY4A 1DBIA 1OH8A 3JQ7A 1VHDA 5J2UF 3QVGA 1RWOA 5IC6A 4E2YA 3V1KA 1GNTA 1LDNA 1F0YA 2PUGA 1E7WA 2WU1A 2D0OB 5L6MB 3HDQA 3UW1A 1XTJA 2VUSA 3FNGA 4CM4B 2UYYA 5BT8A 4QASA 1BN7A 4HAZA 2WTXA 2L2QA 3W2GA 1ZK0A 3MYYA 3OQBA 3HA2A 2GZRA 1FUYB 4ROSA 1A27A 1QC5B 2CD7A 4YRNA 3IVMA 2VLIA 4E15A 1H2BA 1P31A 1G2OA 4EPTA 3FPAA 1O94C 2B21A 3Q8LA 5CX1A 4RQAA 2OAP1 4R2WA 1VYTA 5HK9A 2I71A 3BQNB 2BFFB 4OVKA 5TVKA 4FXPA 1NFQA 2BEVB 2JS7A 2WP8J 4U8HA 4C0JA 2YS7A 4NABA 1EFPA 5F9HA 4MB0A 3L6UA 1D6MA 1AMOA 1DIOB 1QKIA 4Y2PA 3TLKA 5F3RA 2VDWB 2C2KA 4IXDA 1X7WA 5DM70 5LZ8A 3WGVA 4AJ2A 1Z0AA 4CFYA 1U0JA 2M2IA 2HOQA 4JBLA 4E5PA 3LD9A 1UCFA 3N0RA 1M54A 1M76A 2AHOA 3D31A 1PBTA 3IR5A 4FYIA 4Q1AA 1YZUA 3IJ5A 3C7KA 4UEOA 5TS2A 1OXBB 3WKCA 4WNCA 3WLJA 4CIXA 3N87A 1NR1A 4B43A 4MVJG 2EWVA 5FQNA 1E1LA 3WICA 3DAOA 2I3DA 1RE0A 4IDPA 5JPDA 4X95A 3SYRA 4I5EA 1E4EB 1SOUA 2FEWB 5KDLA 1YRBA 1VHJA 4B8YA 1N6LA 3TZBA 1TA4A 2A5DA 2G6TA 3FVTA 4K9MA 4DLTA 3N6RA 5KVQA 3PC3A 2PSDA 2A5LA 3ADCA 3T4UA 3FYUC 3OFVA 4EKDA 4F86A 4TL6A 2QLNA 2BSQA 2A9KA 1C1HA 3AR9A 3CWCA 3NIFB 3UYLA 4JAVC 2I4LA 3TBKA 4ESOA 2FX3A 2DULA 4EFKA 1YH3A 1E2LA 1A88A 4MI6A 1UBLS 1KDVA 3RUIA 3UCFA 3MJFA 1N2EA 3T06B 2B2NA 1QQ7A 1GA4A 3FGOA 1NTOA 4PPNA 4YA6A 2IPMA 4HC4A 5JTUA 2ZIWB 3BAFA 2O0MA 1YZKA 1Z8DA 4HH1A 1LU9A 4O4IF 4OIMA 3DZKA 4R6XA 3RASA 3RYHB 1OX4B 3EZYA 5IKOA 3HL4A 3WHIA 3DWEX 2GN9A 1NXOA 1T3ZA 3QJ5A 1JTFA 3U1TA 1H0RA 4ZJZA 1M2VB 3E3NA 3T7DA 4Q9AA 2WMDA 3VGPA 1D6NA 1G2IA 2QXTA 1Y8RA 4UD6A 3ZHOA 4G8BA 3SIXA 5IZ4A 4GVLA 4S2UA 5FBLB 5KI6A 2J6BA 3SHFA 2FWPA 4W82A 3JD2A 4E5UA 3L18A 4CG1A 1MH1A 1KWKA 4C4YA 4CIVA 4CR8A 4DLZA 4O02B 3EIQA 3A9UA 3WHLA 1RQ2A 2PEYA 3MCWA 2ILVA 2VP6A 3QFRA 2B8NA 4FZJA 3IP6A 4G56A 1DJQA 3RS4A 4MWZA 4OMUA 3HKCB 1H1LB 4KQMA 4JLUA 3QEKA 3H2HA 1RYDA 4LVNA 2FW0A 2WSYB 4XTRA 2I1VB 4LJ8A 1D9XA 3GJTA 4A0RA 4WBNB 1PU2A 4QRHA 4DSUA 3K6SB 4MQEA 3A70A 5JG7A 5IPFA 1VPWA 3COVA 1XKTA 4P84A 4Y6RA 1P0IA 1V8ZA 2ZBUA 3E70C 4P6VF 3ZCXA 4B4VA 2RK6A 4P9NA 5CB4A 3FCAA 1EEXB 1I30A 2BT4A 2B1JA 2RBGA 1YMUA 4IZIA 1P1JA 2ZI3A 2E6KA 1RWNA 2F64A 3T52A 1C1DA 5AKXA 1R0CA 4H31A 1RP1A 3NUQA 4L9SA 4RGVA 4E5DA 4DA9A 4ER7A 3MTJA 4ZGBA 1M6EX 3LNTA 3RYFA 3NHRA 3KXPA 3JQCA 2WSMA 4G0YA 3RWBA 3V32A 3IEUA 4AK9A 2AV6A 2FPPB 2HLDD 2J3QA 1K7CA 1JE1A 2Z30A 3B51X 3R0XA 4B6QA 3Q3VA 5IXJA 1V39A 3GDFA 3PEEA 3TECE 1HI9A 2ID7A 1QAMA 1Z4OA 2WILA 3M5WA 3V4FA 3PPXA 3TKAA 3C43A 4AU1A 4CI0B 3WV5A 3DVRX 4CV1A 5BMVA 3QVWA 4QYWA 1ZG3A 3CRRA 1NA5A 5ESWA 2WPDA 1ZBQA 1SG0A 5ALXA 2X1LA 3EWIA 3O2JA 5LWQA 2OGTA 4P4LA 5CDTA 1A7UA 2GF0A 2YYZA 4XWOA 5BYJA 4UE6A 3ZLTA 2H1IA 4MYSA 3VDRA 4W7HA 4YJKA 1TADA 5D8DA 3F6SA 3UWDA 4KPEC 4XJTA 3H5OA 5EJMA 5IYZB 2GILA 1ULTA 1GU0A 3NBUA 1R8XA 5CEFA 4RTPA 3LUBA 1SXPA 3Q12A 1TLTA 1GZ5A 4J3FA 4E5NA 1T8SA 2P2GA 4BUJA 3FFAA 5DNVA 4QGSA 1F2TA 2VRWA 5KVSA 1CULC 1HE3A 1EX6A 1GYPA 4RKYA 2P3LA 3FZGA 4ETIA 4Q9LA 3FI9A 4PZYA 3O8CA 1ZKMA 2VTKA 4ND5A 4BO8A 2DPMA 5JZVA 5J2TA 1UKCA 3EXHC 3S4YA 1VKNA 3JZMA 4R83A 4NS4A 1L9KA 5AM1A 1EK1A 2HV9A 1GLVA 2IVFA 3H0CA 4ARUA 4GE0A 4GHWA 2H5IA 3AG5A 1OC2A 5L3QA 3LWDA 3N8KA 4E11A 1S8AA 2FXVA 4D8WA 1NURA 3DEZA 2NX2A 3QFSA 2J59A 4NOKA 4ZQBA 1NSFA 1P0MA 2J5XA 4K3UA 4F4HA 3NHLA 4HB4A 1D8TA 3K8OE 3ZHCA 4JBHA 3NM6B 3UG7A 3QU5A 5KOYA 3GLHE 3GFQA 3DBIA 1J2TA 1C4WA 5LZ7A 3RUDA 1C4KA 4B7CA 1RWMA 4YB8A 2B35A 3FYHA 3LXRA 5DHUA 2DLCX 1JQAA 2C5AA 3A2NA 4W7SA 3D59A 4QU8A 1HTBA 4OHMA 2YJ4A 1MB9A 4BFLA 1IM2A 3KLNA 4KN8A 5EXDA 2WJ3A 3RC8A 5CW1A 1XMPA 3QE2A 1UFRA 1ZY2A 2W2LA 3B2EA 4AJLA 3JQ7B 2GVZC 4NCXA 3PC8A 4O2BA 2CHQA 1XLTA 2PLFA 3AEQA 2V6JA 2YNMA 3K2IA 3CSDA 3T1VA 1PTJC 4LXIA 3PLRA 4D4IA 4QU5A 3P27A 3R24A 5TJHA 1RBMA 2VSNA 1FW8A 4YO7A 3A28A 4NEGA 4EYGA 1H8HA 4C3VA 5JMOA 5LU9A 3NBXX 1JG7A 3E9EA 4IRUB 1EMDA 3RVPA 4MVJA 1DAGA 1CNEA 1SXHA 4EY6A 2NXEA 3FOBA 3JQ6A 3OICA 1TZMA 5JMPA 2ZT7A 1CF2O 3VSDA 5BV8A 4PAMA 2CYAA 1TF2A 2F62A 1U9YA 3F71A 2ZTLA 3H5RA 5KWIA 2FPLA 5LYJA 2YJNA 3K9CA 3EAQA 3R2JA 4I9GA 1E9CA 1NUUA 3H6GA 4KO8A 3WGNA 4UCFA 2DBQA 1ACJA 1BJTA 3LX8A 5DI3B 3TL3A 1FYWA 1GTRA 3CC8A 3X44A 3UK2A 4BB5A 3H84A 1TO1E 4TLLB 4J9VA 4LJLA 1X7WB 2PGOA 1R5BA 5BWCA 1IAQA 3F5MA 2JIPA 1JR2A 4S3MA 4LZAA 2J4FA 3JZDA 3P71T 3QYAA 2GBIA 4GOKA 3VYTB 5DYWA 4MQ4A 1UAYA 2E82A 2WUEA 5JZBA 1XL1A 2VJQA 4UXJA 3A4YA 2P8SA 3RTCA 1E4OA 2CBZA 3BSFA 3INGA 1SXJB 2GZMA 1T0HB 4OBXA 2JFFA 3STHA 5TSDA 1PX2A 2Z9DA 3EASA 5KCZA 1DWPA 4MCHA 4J0IA 2NM0A 3LPLA 2PGAA 5HOQA 1F4VA 4Z99A 5KYGA 3R7NA 4BJ6A 4CEHB 4L78A 4W5RA 7AT1A 1R0LA 3B1JA 3EGIA 1OROA 3FMGA 5EMMA 3ZJ4A 4BNMA 4KDEA 4X60A 5JECA 1KU0A 1BDHA 3FRHA 3IQIX 2XBMA 4KCGA 1WCIA 1N7JA 2PWAA 5IAGA 1SG6A 1N6HA 2PTGA 3UGTA 3SICE 2PA0A 4UOEA 1FNSA 4IHJF 4U2CA 4C0WA 2DWQA 4C0HA 1QHYA 1PJAA 3WRVA 1KS9A 5AT1A 5CGZA 4N3GA 3UK6A 3DBHA 3FUCA 1BG6A 3HYCA 2XAAA 4JLDA 2QW1A 1H2EA 4XFDA 4YRLA 1JPVA 1QOPB 1OI4A 1O8CA 4MROA 4BV3A 1J0AA 1N2JA 3ZVKA 2C9OA 4D56A 4UAVA 4K26A 2H08A 2OHVA 3G79A 1BN6A 4K28A 1XLWA 4O4LA 1KJIA 5CK5A 3CSUA 3O8OA 1POWA 1EVYA 4JI3B 3BWYA 5K8CA 2CUNA 1UJNA 4OP1A 4F9EA 2G9QA 4TRNA 3EPHA 3C3MA 3LH5A 2GM5A 5DM60 1FFXB 2F43B 1Q0ZA 1OE0A 4US1R 2A6PA 5AHWA 3BSSA 5DBHX 3RG8A 1ZK4A 4QEZA 3T7RA 4DQUA 3G6KA 1IWPB 3SU8A 5EIOA 5ADVA 2ZB8A 1GOTA 1QGUB 1U99A 2RG7A 5GIOE 2XCRB 3UFBA 1QHNA 1OLUA 2VQSA 4TXMA 3CR7A 4BKPA 1FS6A 1RAAA 1LJUA 4I6JA 2VPQA 3IEXA 2F90A 2V65A 4Q9DA 4A6PA 2OTCA 4QQNA 5KU1A 5AK0A 1H9CA 2Q2VA 4ZVKA 4R1QA 1DRVA 1T8YA 2IBTA 4RIEA 4CKBB 3IXMA 3RRMA 4JP8A 2H06A 5F73A 5U4XA 1XVLA 2XTJA 4G86A 1NX9A 2AFHA 1YRQA 2B4QA 3B6IA 2I2FA 3FYTA 5EGNA 1IULA 5HZKA 3M6VA 4S04A 3NIWA 2ZJFA 3IEKA 1PJRA 2IP1A 4ALKA 2QJTA 1DTSA 1DX6A 1YR3A 2GVNA 3LC1O 2C20A 1OAKA 2Y0DA 1QDLB 1XC7A 2OFFA 3ZZ0A 5F3WB 5F5NA 3QY0A 1SVLA 4KKXB 1JLHA 3K31A 3AGPA 3I04A 3TIIA 1GPMA 2Y1WA 4JL6A 3D4NA 3UXYA 2DHCA 2AQKA 3B6KA 4XGKA 5DTRA 3WBBA 4KITB 5TR9A 1U3TA 1MTZA 3GFGA 4C89A 2ZWMA 3D54D 4JKOA 4ER6A 5A4FS 1G9TA 2FMIA 1F2UA 5K8UA 4GXTA 1XYGA 1UQUA 3DEYX 1W0JA 2LBPA 3LG2A 2EX1A 2R6DA 4GF5A 5HYVA 3H11A 4E2ZA 4EGQA 4Z7OB 3PLAE 2O5RA 2XB9A 1SKBA 4DXAA 5IASA 3WYEA 3DT6A 2HMTA 1YRWA 4WY5A 4D6PA 1FTQA 1V11B 1JEAA 1EVJA 1QJCA 3AF5A 3I9V1 2H0AA 2CK3D 3NBZC 3FNEA 4H3SA 4QFBA 3T12A 1YI8A 3KG2A 4X1KA 3EC1A 3FJOA 3E7DA 3GRPA 1MNQA 1DAHA 4V02A 3PGA1 4XVQA 1MN6A 1E5DA 3ZU2A 4QJ5A 3OCUA 4QAJA 2ZATA 3MT8A 3W9YA 5A6SA 4K8RB 1K4YA 1IN8A 1OU0A 3QU4A 5E2IA 4LZZA 4Y1RB 3K9BA 3OWHA 2EX0A 5IDXA 1GU1A 2FOLA 1MIOA 1VLJA 4IJ6A 2O23A 1DZIA 1F2TB 2F3RA 3GLTA 4XX0B 3ZCSA 3VJKA 4B4OA 1A2KC 3QWFA 3ZXYA 4OHCA 2I2XB 3ROZA 2B4YA 4CMGA 4K1LA 2TMYA 2IDMA 2Q5IA 5E2AA 1NC1A 2AFIB 3KSMA 4L8GA 2EATA 1JNYA 1NOJA 2QTHA 4RV9A 5TDHA 3ICEA 2NYUA 3QENA 2FY8A 5D3MA 4JVLA 3QTLA 2RH9B 2IEYA 4I2NA 3IAS1 2JI8A 2P0AA 4WD3A 2X0KA 4E2WA 3HEBA 4F5WA 3GFRA 1U2DA 1RPTA 2VT2A 4C7BA 2B0JA 4LDPA 4TTPA 3RT9A 4KACA 4FE4A 4EABA 6PFKA 2PJRA 2JAPA 3OZXA 4TYPA 4EYKA 1SQ0A 1FSFA 3BMCB 3UGJA 1ADCA 4ZALA 2G7MC 2EFJA 3BGOS 2Q4TA 3A4VA 1BKSB 3I6IA 3GHYA 4A5SA 2VJMA 4XVUA 1K66A 1GUBA 2HLHA 4G9GA 1P5RA 5IN5A 2P2ZA 2IHNA 3LQQA 3OPVA 5H82A 4B6JA 4JS0A 2GN8A 4JXJA 2C2MA 2YVUA 2IV2X 5KCMA 4B7AA 2I8CA 2G9ZA 2J3IA 1UWKA 4J0HA 5BXQC 2AFHE 3GFSA 3DMRA 2UZ1B 3TTSA 5L3VA 3KSDO 1O6FA 2O2XA 1RBQA 1Y9ZA 2PFGA 3FTDA 1KHHA 3GZ4A 4PN7A 5B7PA 4FOTA 4M7PA 1X3LA 3SFVA 4Q01A 1XZFA 5MDHA 2W6PA 1S4QA 4H9GA 4UTZA 4F3CA 1N1MA 3MAGA 1IM5A 2WJPA 3OC0A 3REGA 4WN3A 3ZE9A 1OVGA 3T15A 3TNDA 1I3LA 2IC5A 3WVNA 4FJ0A 1N1EA 1PR0A 2ATIA 2W6QA 1SR8A 3DKVA 4C30A 5CYGA 1ZR4A 4PSCA 3AI3A 1O95C 1TQ2A 1Q19A 1Y33E 1KHTA 3JD0A 1NJ5A 3PD7A 1PJCA 4P0QB 3LWZA 1O4VA 1S5PA 4BO9A 1P6XA 4EG8A 1OZAA 3IHTA 4P86A 1JA0A 4KFTA 1M5UA 4LZOA 1CS0B 3MJ4A 5KYNA 1E3DA 2Z2JA 1DKUA 1KARA 2XE8A 1XD9A 3KPYA 3KZXA 4RVCA 8ATCA 4CLHA 3JTMA 5BYAA 1Q1NA 4BQQA 1G6OA 4LRTB 3U13A 5CH8A 3WBJA 3LF2A 2W43A 4JLKA 3EVNA 4DXDA 3MWGA 4HBZA 2DBRA 1WBDA 5FULA 3UJNA 1B15A 1GITA 1SN7A 1KC1A 3DCJA 3OZTA 4IOKA 3IGFA 3PQDA 4PQRA 3TZKA 1ZH8A 3EXIB 4TWAA 2FMXA 5EP2A 5KQPA 4JI2B 4FDLA 1E60A 4D96A 5IG2A 2WJWA 4CTKA 1RMYA 2FMHA 1VBKA 1JN0A 1ZICA 1YOVA 3GJ8A 4WLOA 4B31A 3FWHA 1SU6A 3L7NA 1FRZA 4QVKA 4MLDA 1Q7EA 4E4RA 3U44A 2I76A 2WMYA 4HNVA 5EPUA 1C2YA 3PWKA 1EE1A 1V3TA 2Q5OA 1MMFB 2Q3MA 4GPBA 2CHVA 3TVYA 1XAIA 3F1KA 4J9UE 1MF7A 4B6SA 1VP9A 1ZESA 1G6Q1 3KIPA 1PVVA 1TA9A 2B92A 2GCEA 3M9XA 2D00A 4YHBA 3UICA 5HGXA 3IUYA 3FPSA 4UTXA 3UJ7A 2FZCA 1AKNA 3BL8A 4M76B 4UTNA 5IT4A 3GGSA 2PPLA 3V8BA 3ZY3A 1L5HB 3KOZA 2QM0A 2CFOA 1NXTA 2GHTA 4FXOA 4RPGA 5K0JA 3T35A 1DU4A 2E1PA 2P5SA 5ALLA 1R5NA 5CPFA 4DCCA 1MV5A 2K4MA 5IM4A 3L4JA 4KIGA 2FSVC 2C2YA 2Z8YA 1TT5B 3JQAD 4GRDA 1SCQA 3JVUA 1X9HA 1V96A 1XA4A 3DBLB 2YMPA 5CA1F 2D59A 4QT0A 4N5HX 5BN3A 1PFGA 4A6EA 2RAVA 1C0PA 1CVIA 2ZJOA 3VUFA 3ACCA 3EVBA 4AG3A 2OZEA 3TNJA 1C7QA 2G0NA 4Y0AA 4PONA 1XOIA 4X7BA 2PIDA 5CM8B 1IY9A 5C1OA 6REQB 1NKVA 2NTNA 3UAYA 2H48A 3FFTA 4WDRA 4XUCA 4FFPA 3EVCA 4WHMA 5AKJA 2E2WA 4ZTBA 4G01B 3UWSA 2UUAB 2AEMA 4HNRA 5JSHA 4XVHA 4UM9D 1G3IA 2Q3DA 3VHXA 3GLFE 4N6OA 5EIXA 3I30X 1E2HA 2P9TA 4M8SA 3LIIA 3FWYA 3H17A 3KUCA 3CRW1 4Y2YA 2YHAA 2Z0MA 1GPUA 1M1ZA 4I4CA 5CVDA 3ZWVA 2Z9BA 4UTOA 1P9RA 3SYKA 2NXCA 4QDOA 4MRRA 1USKA 5EJ9A 6ADHA 3UZUA 4IJVA 3TNYA 5BNIA 1RHJA 4BRZA 2OLJA 3S0JA 5IHPA 4D9MA 3MGGA 3UK7A 3T5BA 2QX8A 3HM9A 4OA8A 4Y2GA 1Z15A 2E21A 5J1TB 2I4MA 3BTUA 4B9AA 1SXIA 1Y63A 4L6IA 2R44A 2XTZA 1WV0A 1G18A 1ZRHA 3CO5A 3P9SA 1P91A 3PQ6A 3QX7A 3C48A 5FORA 2R1VA 1JFRA 3EZ2A 5DM1A 4CCSA 4X92A 1G21E 3PG5A 3FIUA 2OO5A 5K0BA 3K70D 1E1NA 1CE8B 2NAPA 3TK1A 2ENUA 1DI0A 1N7GA 4KXFB 2IUTA 2MWMA 4TRMA 2VAMA 4IG9A 2HDHA 5PGMA 1SVNA 1NP7A 4M0FA 1KYYA 1PL0A 2PMWB 1W1UA 3EVZA 1H3FA 2QM3A 3FUUA 3CV3A 1F2UB 5CBKA 4I9UA 2MSCB 3E1GA 3V2IA 2WA2A 2ZTHA 3OM8A 3V46A 1WQ4A 2P2CA 4HVLA 1GKIA 2I91A 2CZQA 3EQ2A 1LDYA 3DO8A 2K7FA 4O4HA 2BGLA 3OE4A 4V0SA 1UANA 5FJIA 2GNOA 5KREA 4Y6OA 1P1IA 3AF3A 4D4MA 3F9RA 2NGRA 2CJYA 2QTWB 3BRCA 4L6AA 3BZWA 3Q8MA 3M3HA 1Z2OX 2W4MA 3DTNA 2VP4A 2X3FA 3H0EA 5HP4A 4TTJA 3MXOA 1D2GA 1J8QA 5FDFA 3NJ4A 1CYEA 5A1TA 3S8MA 2IW3A 1RD4A 2ZUSA 3MBIA 4UUQA 2VHTA 4ZI7B 2FFJA 5HUHA 5JTTA 5H1YA 4ZQIA 1K06A 1DO8A 2FSSA 3ICQB 1WQ3A 2XXAB 4JKYA 5H9WA 1QRTA 4W99A 4DKXA 2DEUA 1Y3IA 2NSJA 2ZREA 4FD3A 1SBQA 1DWUA 2UZ3A 2DJ5A 3B5JA 3LF1A 3GGJA 1PO7A 3EWAA 5JPCA 3VU8A 5DT9A 3D3EA 3KUUA 4DR3B 4LF6B 3KVOA 4P31A 3AUTA 5BV1A 1YQXA 3GZNB 1Z9BA 3DVSX 1CKEA 1OI7A 4RLFA 3C87A 2PX0A 3FPLA 3SSNA 3ZTWA 1DQRA 1X8LA 2OESA 1HKUA 4JWTA 2ALJA 1E3WA 4OFWA 1T0JB 4WCVA 4DBLC 1ZA2A 1PQ4A 2JCVA 2B9EA 4B73A 4R9RA 4C4AA 5L95A 3VGJA 3T3GA 2I4RA 3DYIA 3W6OA 4XH9B 4CUJA 1XRLA 1KI6B 2PZEA 2WB4A 3UMMA 4EUEA 3L05A 3EX7C 3GG9A 2FUCA 5E6SA