1PEDA

Bacterial secondary alcohol dehydrogenase (apo-form)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
351
structure length
351
Chain Sequence
MKGFAMLGINKLGWIEKERPVAGSYDAIVRPLAVSPCTSDIHTVFEGALGDRKNMILGHEAVGEVVEVGSEVKDFKPGDRVIVPCTTPDWRSLEVQAGFQQHSNGMLAGWKFSNFKDGVFGEYFHVNDADMNLAILPKDMPLENAVMITDMMTTGFHGAELADIQMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKNGHIVDQVMKLTNGKGVDRVIMAGGGSETLSQAVSMVKPGGIISNINYHGSGDALLIPRVEWGCGMAHKTIKGGLCPGGRLRAEMLRDMVVYNRVDLSKLVTHVYHGFDHIEEALLLMKDKPKDLIKAVVIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADP-DEPENDENT ALCOHOL DEHYDROGENASE
publication title Crystalline alcohol dehydrogenases from the mesophilic bacterium Clostridium beijerinckii and the thermophilic bacterium Thermoanaerobium brockii: preparation, characterization and molecular symmetry.
pubmed doi rcsb
source organism Clostridium beijerinckii
total genus 117
structure length 351
sequence length 351
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 1995-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pedA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1pedA01
4P8RA 3KM0A 4LMPA 2EJWA 1UZLA 3OIDA 4E2XA 3INGA 4DVJA 3QV1A 5IN4A 2IEBA 3RVDA 2CDAA 4BNWA 4B7UA 4BNZA 4XQEA 1YL5A 5JPIA 1VRWA 4GMFA 4IQ8A 2BGKA 4PRLA 4A0SA 2HDHA 3G17A 2DTEA 4FJ1A 2ZTVA 1PWXA 2O4UX 4Q3DA 2O3QA 5KJEA 3AUAA 3OEWA 2O2YA 3RJ5A 2Y1OA 2ZB8A 4XX0A 4AJJA 1DC4A 1XCBA 2E49A 3ULKA 3B1KA 2O3UA 3MWEB 3MEQA 4BKPA 4YT5A 4M1QA 3WQQA 3OA0A 1D1TA 1WWKA 4DPKA 4FFPA 4PG6A 2P9GA 3GVPA 1GY8A 3V2UA 5AQ1A 3KSDO 2Q46A 3S8MA 4D79A 2C59A 1U28A 1H0KA 4R5MA 1EK6A 3F46A 3P7MA 1ZK4A 1WVGA 4J7UA 3NJ8A 5I7SA 3TZ6A 3ZNPA 4ROSA 4ZQFA 3PLNA 3OP4A 4D3SA 1PR9A 3KYBA 3RAJA 3BAZA 5G4LA 5F1OA 5TNXA 5HS6A 5ILGA 3VOSA 9LDTA 4H7PA 1DC6A 4D45A 1W8DA 4F6CA 3AFNA 3WBFA 3E8XA 3ZW8A 2J5RA 5CG2A 5IDXA 4O59O 1AE1A 1Y5RA 4XR4A 5TJHA 1I8TA 3T7CA 3GEGA 1SEPA 3U9LA 3PHLA 3LT4A 1B8PA 5EQDA 2VT3A 3OJEA 3ANMA 3RC7A 1Z6ZA 3PZRA 4BS9A 3GEMA 1ZVMA 1ZZEA 2TMDA 3OSUA 2C07A 2O48X 5EQFA 1E5LA 2J3JA 4BUCA 1U3UA 3GOHA 3SVTA 3WTCA 5TQVA 3PLRA 3DOCA 1M76A 3OICA 5L95A 4LMRA 4GX0A 3HFSA 2D3TA 1M2WA 4GI2A 4BOYA 3CUKA 3DDNA 3JQAB 5JYDA 3PRJA 5FWNA 2W2KB 5IXYA 5HM8A 4WCFC 3CEAA 2NACA 4XJTA 3NGXA 4WLOA 4YVFA 2VNAA 3FPCA 4R54A 4XYBA 3DBHA 1LSSA 1Y7TA 2EGGA 4IDBA 4PVCA 4BO6A 3GR6A 4OQYA 4ID9A 4XQGA 3NRCA 3CSDA 2NU9A 4UEKA 1NPYA 3A4VA 3WLEA 4A26A 3FCOA 4CLOB 1A9YA 1GQ2A 1ENOA 5A5EA 2YHIB 4LRTB 2AHRA 4RLSA 1SBYA 4XWYA 2NM0A 3QWFA 1YRLA 2J5QA 2ZJ1A 4FS3A 4B3JA 1MP0A 3ABIA 3H9QA 4KTVE 1B15A 2GUGA 3I23A 1PJBA 1R4MB 5TGDA 1JVBA 2PD6A 1CRWG 2JFFA 4GLOA 4BL5A 2YV1A 1BXZA 1E6UA 1Q0HA 1I36A 3VH1A 3ORFA 2EF1A 1DPGA 1A4IA 4D3DA 2D8AA 5DCUA 4J90A 3TFOA 3FN4A 2I66A 1GD1O 3ZNNA 4RVFA 3ROMA 5EN4A 4ND4A 4AJOA 4AICA 3ZWYA 1YE3A 4WEQA 3OJOA 1GYRA 4E32A 1UAYA 1LDMA 2X0NA 5EINA 1GEEA 1V3UA 1XYGA 1BMDA 3LZ6A 3K5PA 3LT2A 2ZIZA 2AMFA 4MVJD 2PD4A 7MDHA 1L1FA 1ZH8A 2BKAA 2FY8A 3I83A 5L4SA 1W73A 1RWBA 2B35A 4IJVA 1N9GB 4BO5A 1YQDA 4DPLA 5IDWA 4H15A 1CF2O 2QG4A 4IIUA 1JTVA 4FOSA 3UAGA 2Y99A 1X1TA 4BO7A 3KZVA 4ZA2A 4KWHA 5JE8A 4LCJA 2I3GA 3EYWA 3OQ1A 4IDEA 3MJ4A 3JQAA 4Z9FA 4BO3A 5B1YA 3EDMA 2W2KA 2GZ2A 4M49A 2TMGA 1HDYA 4QO7A 3M2PA 1D8AA 1E7WA 5G4KB 3ROPA 1LXCA 3ZU3A 3E03A 4EUHA 3OQ6A 1ZBQA 4YXFA 3G0OA 2FPGA 4HFNA 5JLAA 4WCFA 1ZFNA 4CUKA 1T1RA 4WLFA 3KYDB 1B14A 1EBUA 3COSA 4JX8A 4II3A 5IJZA 2WM3A 3ICPA 3TZHA 2Q1SA 1GZ6A 3HNPA 1Z45A 1NVMB 1R0KA 3RUDA 2D59A 1PTJA 4XZ3A 4DBVO 2WEKA 4R9SA 1E7MA 3DB2A 4L75A 4DWVA 2DAPA 1MXFA 1R4MA 1BTOA 4B4OA 2EV9A 1MXHA 1JW9B 4BKRA 4DLBA 5JW6A 2IZZA 4URFA 3BHMA 3QRWA 3K73O 4OXKA 2YDXA 1K5HA 1JKJA 2HJSA 1UDBA 1SOWA 4R69A 1GCOA 4PG8A 3KV3O 3GNTA 3S2IA 1ORRA 4RQUA 3PHIA 2Y93A 3PDJA 3IIEA 3LK7A 4CPDA 4FSHA 3ZNOA 3NKLA 2D4AA 4CM3A 5IZ4A 3DZJA 5HA5A 4EW6A 4RPGA 5KKAA 3IL2A 1U8FO 2CY0A 4MVJG 3RFVA 1T4DA 3QVXA 2X1HA 2AEJA 2VT2A 1PJQA 4LK3A 4MOWA 4YYZA 2VN8A 4PLVA 3JD2A 4GKBA 4R68A 2Q1TA 5AVOA 3PK0A 4FW8A 1I30A 3INTA 5CEFA 4N18A 4TRMA 1ISJA 4J16A 4CUZA 3DQPA 3SLKA 4G65A 1EUCA 4DIBA 2YY7A 5T67A 2EHDA 1P1JA 2Y0EA 5DN9A 4E30A 4NQZA 5G4KA 1YO6A 3AI1A 1YOVB 2A35A 2G0TA 2NVWA 3AM4A 5KJ1A 2JHGA 1ISIA 2OO5A 3PJGA 4ZQGA 1QR6A 1UXKA 4BNJA 4CLXA 3ETEA 4W99A 1IHYA 3B1JA 3C3XA 2QYSA 2VYNA 4NBRA 3I9JA 2AQKA 1ZO8A 3WNVA 1YDEA 1J5PA 3FI9A 3WBBA 3JQ6A 3I3OA 1ML3A 4KQWA 4L4XA 3D1LA 5KJCA 3EC7A 3H9UA 1DLIA 4IINA 5A9TA 2ZTUA 1JKIA 4J3FA 3TNLA 2Y1EA 3Q1LA 3ZGYA 3D4NA 2UUOA 5KOIA 3AK4A 2RH8A 1GV1A 3F5QA 2PLAA 3ASVA 1U3VA 1EEHA 1M6WA 2EJVA 4P38A 2NLOA 2HCTA 3IS3A 1GYQA 5GY7A 1RYEA 3PZBA 9LDBA 1MFZA 3WLFA 1EK5A 1C1DB 1QG6A 8LDHA 4AJPA 2WD8A 2PGDA 3HQ4O 3LU1A 4J43A 4BQRA 1B7GO 5DF1A 5CEJA 2O3TA 3LSYA 1HZZA 2B4RO 2NTVA 5JMPA 3AI2A 4J0EA 1UP6A 4Q3EA 5FI3A 4EUEA 1CIVA 3D3WB 4Z6KA 4R3WA 5A9SB 1A7AA 3A9WA 1H93A 1Z7EA 3ENNA 1E7RA 2OL4A 5EERA 3UGKA 4XJSA 1B3BA 1KS9A 4NBTA 1Y8RB 3E18A 3ZCXA 1ZXLA 3GHYA 2X23A 5FF9A 4Y98A 3OF2A 2V7PA 1LDEA 1SOVA 4D0RA 3KYCB 1PZHA 3KSZO 2Q1UA 1XIVA 1ZEMA 5BSGA 4XA8A 3WNQA 1V9LA 3PJEA 2BRUA 3WMWA 3GNQA 4K28A 1P77A 4IDAA 4OAQA 4OSPA 2GSDA 3DOJA 4L73A 1LC3A 2Q99A 4TKLA 2VCYA 1YBAA 2DTXA 3H4VA 3NTRA 5ITVA 5TIIA 2NTNA 3X2FA 1JWBB 3JQDA 3DHYA 1I2ZA 2WTBA 3TQHA 4AJIA 1A4UA 1F8FA 1U2DA 1W4ZA 3H3JA 4BGEA 1DIGA 3ROQA 1YVEI 1J49A 4NNJA 4B4UA 1WMBA 3KBOA 5CEEA 4ZRMA 4JBGA 1FF9A 3DFUA 2Q4BA 2PZJA 1JLLA 1L7DA 2VRBA 4ZD6A 4A7PA 2GN6A 4K26A 4HY3A 3DBRB 1A5ZA 3NDIA 5B4UA 1ZW1A 3ZWWA 4D41A 3VTZA 3TDKA 4B8WA 5JAZA 4YAIA 3HN7A 4RF5A 1LBEA 4CM6A 4CR7A 3VHRA 1UDAA 2I9PA 4WOJA 3R1IA 5B37A 4KWIA 1A27A 1C1DA 2X0RA 4R9RA 4P22A 3IC5A 4YDRA 2FP4A 3D4PA 1GUFA 1ADCA 5L7WA 1E7QA 1A72A 1AN9A 3GGGA 3OIGA 1HL3A 4ND1A 1Y1PA 4AJEA 4A03A 4CODB 4OXYA 1U5CA 2WWRA 1PZGA 4M55A 2Q2QA 2FZEA 3GMDA 3QVSA 3PGXA 4R01A 1LRLA 1MC4A 3JYPA 1XELA 2G5CA 4FFMA 1PJ2A 1QSGA 2X22A 3D3WA 4TRRA 3VZQA 5A9SA 4E5YA 2GYYA 1KBZA 2D5CA 4XB2A 2O50A 1NFFA 5LDGA 1NPTO 1QLHA 1ZEJA 4EI2A 4RPHA 1RJWA 1Y8RA 2UAGA 1HYHA 1P1HA 3DZGA 3E5RA 3TF5A 1OC2A 2EEZA 3KYCA 4RF3A 3JYNA 3RASA 2JAPA 4B8ZA 1BWSA 2Z1NA 3VKUA 2E48A 2DM6A 4BO9A 4WNCA 2GERA 4U0KA 1A7KA 2CVQA 1BXGB 5B12A 3C8MA 3PXXA 5TX7A 3FRJA 2HJRA 4ILKA 1QRRA 4K9DA 4BO1A 1T24A 1ID1A 3BIOA 3CIFA 3UFXA 2IXAA 4FD3A 1KVSA 1U7TA 4B79A 1Q1NA 1QYCA 4J7XA 4NFHA 4PCVA 3I9NA 3G1TA 1PJ3A 3H9JA 3FNEA 1AHIA 4ALMA 1D1SA 4YJHA 1O89A 4CMIB 1EFLA 4D0SA 1XHLA 3GPDG 3O8QB 3O4RA 2BGLA 3DAPA 4WE3A 3QWIA 2YUTA 4GQAA 3ONFA 4MINA 4CL8A 3MJCA 1GZ4A 1HDXA 3VPHA 1I5RA 2A9FA 2FRDA 2NWQA 3PP8A 3RC9A 3CTMA 2Q1WA 1Q2XA 4BO8A 5IG2A 6LDHA 4BO0A 3ZHYA 1EDZA 4C7KA 5K0ZA 1YJ8A 1QP8A 4B4WA 5T5QA 5C7LO 4IMPA 3DHNA 2JCXA 5F5NA 5C5IA 3SX2A 1LUAA 1WW8A 4I5GA 3AU9A 2XF8A 5GMOA 5K6AC 2JD0A 2ZYGA 4JIGA 1I3MA 3F3SA 5JAMA 1RM3A 4DA9A 5EIOA 3G1UA 3GPIA 1YKFA 3VH3A 5FEUA 4HUJA 2X58A 5KNLA 4OOFA 4DYVA 3F1LA 2BFOA 4RVDA 1UUFA 2XAAA 3GEDA 4OJNA 3U0BA 1NNUA 1NXQA 3G3EA 1TB4A 3DZIA 4Q3NA 2P9EA 4NK5A 3SLGA 4DUPA 5A3VA 4JJGA 1NHWA 2Y66A 4E13A 2HK8A 2P91A 4JNKA 1LU9A 3ZWOA 1SPXA 4J1NA 1LNQA 4CQLB 2WMDA 3TOZA 2CDCA 1RYDA 2P2SA 3OECA 2Q4EA 1V3VA 3ZWMA 4YACA 4LVCA 1T4BA 1M75A 5EESA 1MB4A 5ER6A 5DBGA 1OC4A 1I2BA 3L77A 2O3SA 2VZ9A 1DFIA 3RROA 4RORA 2YFHA 5CDUA 3FD8A 1U7HA 3INRA 3CINA 1PGJA 4M86A 4Z9XA 2AQIA 4YA6A 3GFGA 4CMIA 1KEPA 2BD0A 2VHWA 4KUGA 3O8QA 4RL6A 4J9VA 5TT0A 4IJKA 1F12A 2PV7A 5IF3A 1X1EA 1P9LA 1E7SA 2DBRA 3T4XA 4OM8A 3OQBA 2JD2A 1DAOA 3JD4A 3ZU2A 3GFBA 1K6JA 3L9WA 5ICMA 3RCBA 1S6YA 4RJTA 1ZSVA 1JAXA 1DO8A 4NJOA 4UAGA 4WNIA 3ZU5A 5I9LA 3GRPA 3NUGA 1QYDA 1TT5B 3WIEA 2RHRA 2O23A 1PJTA 1UXIA 1XU9A 4RO0A 1J6UA 1PZFA 3R3SA 4J4BA 4W82A 2H1SA 2EIHA 3V8BA 3PIDA 4UVDA 1LDBA 5HRUA 1DIRA 3NDJA 4ONEA 5K6AA 2HK9A 1DHTA 1NQAO 1K89A 3VZSA 5A3JA 5DOVA 3BMCB 3BXXA 1GADO 2QZ9A 2PFGA 1E1LA 2IYOA 2YFQA 3EAGA 4IS2A 1X0XA 5U9CA 2NV6A 2IYPA 4OKIA 3PHJA 1GFSA 3GVIA 3HDJA 4FN4A 4E21A 1BGVA 1PIWA 1EVIA 3K31A 2ZATA 1NAIA 3N58A 4ZQHA 2RAFA 4XKJA 4CM8B 3R6DA 4YQZA 5TS3A 3BMNB 5TJ9A 4UVIA 1YJQA 3HJAA 4AJKA 1QYXA 2Q2WA 4CM1A 3L6EA 3S2FA 4PLCA 4OKNA 4CV0A 4K1LA 2CMDA 4D46A 3NYWA 4A73A 2YQ4A 4J4HA 1IPFA 2JFHA 3QVOA 1F06A 3GH3A 4ZRNA 1EQ2A 1UXGA 3ZNQA 2AW5A 2VHZA 2PD3A 1DC3A 1C0IA 3QWAA 1WDLA 2GO1A 1X7HA 2FZWA 1ISFA 4NBWA 4PLPA 4WCDA 4JN6B 1GQQA 2DBZA 3EK2A 4Z3DA 3RUEA 4HFRA 4YWJA 4MVJA 4O1MA 4BNVA 1P0FA 4CQMB 4GX1A 3JQ8A 5HS4A 2BFMA 4N54A 4QX6A 2CUKA 4S1VA 3U5TA 1GR0A 3MJVA 1YB4A 5CAEA 2W2LA 1MG5A 2PH3A 4FFLA 4R3NA 1PGNA 4GVXA 3PWKA 1BXKA 2NADA 3ASUA 1TT5A 4NU6A 1DC5A 1JVSA 4BNHA 3C1OA 3ZWVA 3MOIA 5K1SA 1FDTA 3PFFA 1NPDA 2I3AA 4NDNE 2ZCVA 1QYVA 2YV3A 1PL7A 2DPGA 1K2WA 2GZ3A 3AOGA 3B1FA 3DMYA 4U6QA 3GZ4A 2Y1DA 3BMCA 3PHHA 1NP3A 2VWQA 3TSCA 3GVXA 1PEDA 4QFDA 4EGFA 1DLJA 4U7WA 3NGLA 2V6GA 1M67A 3BMOB 4E2WA 1H6DA 4QT0A 2B36A 4CM8A 2BFAA 4RF2A 3RWBA 3EY4A 4RPLA 3BMNA 3ADOA 3K96A 3KB6A 4IDCA 2Y1FA 4TRJA 4PZCA 5U4QA 4A27A 4RDIA 4DRYA 1KVRA 3QIVA 4Y6SA 3IP3A 5B4VA 1SB8A 3S2EA 2BGMA 3BTSA 3I6IA 4GX2A 3F4BA 3KETA 4F46A 2HUNA 3WFJA 4K6FA 1HYEA 1QMGA 3PQEA 3WIDA 3ZZNA 2ET6A 5EJ2A 1NM5A 3I1JA 1WXDA 1TI7A 4IXWA 1V6AA 3H5NA 4CM4B 3IDSA 2VOEA 1I01A 2C5AA 3AFMA 1YQGA 3W1VA 3EHEA 1LDYA 1OI7A 4BMSA 2EGHA 4YAGA 3OIFA 5EL0A 3MWDB 1FDVA 3VC7A 1PS0A 4RV9A 3V5NA 3W6ZA 3RFXA 3WGHA 1ONPA 2DU8A 1DFHA 1YB1A 2GRAA 1O0SA 4KMSA 5A5FA 5COBA 1R15A 4J49A 2Y68A 4DQUA 2RBEA 3DONA 5G0SA 2J3KA 4IIVA 1HRDA 3WXBA 4J9UE 2HLPA 5JO9A 1OMOA 1QV7A 1ENZA 3GVCA 3W4IA 2HMVA 3I9LA 1NVTA 4N7RA 5JYEA 4BV8A 5JAQA 2IRWA 2PK3A 4JBHA 1ZMOA 3T7EA 3B6ZA 1YXMA 3HZZA 2W4QA 3WOHA 2PKRA 1ZIDA 4Z0PA 4I8XA 3JYOA 3GG9A 3HADA 3U4DA 3D4OA 1T1SA 1U3WA 1HDZA 1EBFA 3W8DA 4PRKA 1PJLA 2V65A 3BMOA 4UULA 4O63O 1M6HA 1SO8A 3ANNA 5K9ZA 4BNYA 5BSEA 5EPOA 1HDRA 4W4TA 1HF3A 1O8CA 3P5SA 1MG0A 2LDXA 3HHPA 4YQYA 4YR9A 3TZQA 4PG5A 1EVZA 4YRBA 3QVWA 5TLSA 1I24A 1DAPA 1IZ0A 3BA1A 3L4BC 3P2OA 3LVFO 1E3IA 3QY9A 1H9BA 4NG5A 5CFZA 2HRZA 3ZHXA 4RQTA 1R0LA 2GZ1A 3HFGA 4WECA 4HKTA 1EVJA 2O3JA 5J23A 1B16A 3BHIA 2W2LD 3OETA 4L8VA 5ENVA 4JJIA 3UICA 4EYEA 1TXGA 5JO0A 1Z75A 3DR3A 2QRLA 1PU2A 3CZRA 3UCEA 2B4QA 1H6AA 4PLTA 4U8GA 4W6ZA 3VPSA 5T64A 3U49A 2VQ3A 5KCZA 3D5TA 2C7GA 3QWBA 4MKXA 3WTBA 3RUCA 1GPDG 3E9MA 3VKVA 4A10A 2I67A 2VRCD 4OOEA 4OO3A 5G2OA 2PZLA 4KUHA 2IE0A 3E9NA 3EGOA 3SXPA 3FR8A 3HE3A 3KO8A 3V2GA 3PEFA 3JCZA 1EQUA 1UZMA 4Z0HO 1TA4A 3NT2A 1NFRA 1DFGA 4NR0A 4CLOA 4DIOA 3AU8A 3KTDA 3SC4A 4CMEC 1C0PA 2YHIA 2FSSA 3TN7A 3DAGA 3WGOA 3MOGA 4MP3A 3FNFA 4HX5A 4Y8VA 4BNIA 2HKIA 1U4SA 3VTFA 3Q2IA 4AFNA 4B3HA 1PR3A 2PKQO 2Q45A 5I9NA 3M1AA 5B4TA 4IPTA 1JWAB 3H3FA 1FDWA 3DMTC 1HXHA 2QX7A 1HYGA 2X4GA 3KOUA 4Z9YA 2WD7B 4DPMA 4IM7A 1G0NA 1D7OA 1UP7A 5BNFA 3NX4A 4UUMA 2B69A 4GWKA 1ADBA 4MVJP 4QUKA 4HXYA 5C7IO 1ENYA 3FNHA 4EBFA 5MDHA 3RKUA 3RU7A 3TPCA 4IDDA 1BVRA 3S55A 2GN4A 5L51A 2VYVD 5CHEA 3PQDA 3UUWA 3JQBC 1FK8A 2JL1A 1P33A 5H82A 3FBTA 4FC7A 3E6AA 4OHUA 4TQGA 2ZTLA 3E9QA 1GTMA 5CPFA 3L4BA 4BNUA 2NSDA 2ZYAA 3AJRA 3GC6A 4CQMD 4DIFA 1Y5MA 1T25A 4NPCA 2OXIA 1GUZA 2A4KA 3I6QA 1N9GA 4IGEA 3WICA 1C1XB 3B70A 4BQPA 1IPEA 1ARZA 4JXKA 1LJ8A 5KTKA 4AJNA 1UH5A 3ETGA 1ZXBA 3G79A 3QQPA 3Q9NA 2IZ1A 4WASA 4XYGA 4QEDA 4E2ZA 3F47A 2VNSA 1E3WB 4GVLA 3E5MA 2YDYA 1GUYA 1F17A 1MX3A 3GAZA 3R0IA 3R3JA 5DP1A 4TZTA 4PG4A 2AA3A 1UXHA 1E3SA 3FTPA 4L74A 1ZUD1 3JQ7B 5I7FA 5JY6A 3H9EO 3DBLB 4R1TA 3DC2A 4MVJF 5IN5A 3KYDA 4PLGA 2VOJA 1Q7GA 3OJLA 5ENDA 3IJRA 2ZJ0A 2XXBA 4U0JA 2HRBA 3VZPA 1JA9A 3BYZA 1HKUA 1EUDA 2FPIA 3WS7A 3G49A 3OJFA 1JU9A 4MIEA 4CMEA 2J6IA 4YTEA 4WGGA 4HP8A 5BNTA 1IOLA 4HBGA 2VHVA 3H6KA 4AJ4A 3JD3A 2WD7A 5A02A 1LRJA 1X7GA 2HAEA 4PLZA 5EMHA 2GPTA 3BTOA 4EJMA 1O5IA 4ALKA 1ONNA 5GZ1A 3DMTA 1PJ4A 5HTOA 3ROKA 4ZHSA 3E82A 4MIYA 2R00C 2X9VA 2F00A 1AXEA 1WAMA 4FGSA 3WGQA 2ZB7A 2I6TA 4L9RA 3H7AA 4XDZA 4GLLA 4YRAA 2QIOA 3V2HA 3L6OO 3AY3A 4ALNA 1E3EA 4MO2A 3CZMA 2IDZA 1O95A 3I9OA 3JQBA 4UVEA 4D43A 1PX0A 2HU2A 3ZHZA 1R4NB 1B0AA 1U4OA 1ZMTA 2ZK7A 1N7HA 2O2SA 5KVQA 3TJRA 5AOVA 2QHXA 2UYYA 3CMCO 3WGGA 5L3ZA 3JQEA 4CMGA 3ONEA 1Q0LA 2JAHA 4WPGA 1F0YA 4PLFA 3WGYA 1XG5A 4PGFA 4BNFA 1XWFA 1YBMA 1CYDA 4E33A 2WE8A 3LDHA 3PPIA 1YOVA 3S2GA 3JQ7A 3MJEA 1DRWA 1NWCA 3DBLA 4NMHA 3H65A 3TL3A 1PSDA 4YEDA 3RUIA 1YGYA 1E6WA 1V0JA 1GL3A 4E2YA 1KC1A 1FJHA 1E1MA 2UUPA 1IZ9A 3ZV5A 5JFOA 1BW9B 3W8FA 2BH9A 4EITA 2QRKA 4WEOA 2OMEA 3QSGA 4O5OA 1B2LA 4CLRB 1U2GA 1OFGA 1PQWA 4KUEA 3FPLA 1DXYA 4RGBA 1DJNA 2QRJA 3GNSA 2C2XA 4QTZA 1BDBA 2VZ8A 5IDQA 4FFRA 4L4RA 2PKQP 1Z7BA 2C29D 3GUCA 2O4CA 3NAQA 5ADHA 1IHXA 2J3HA 1SEVA 3LC1O 1VI2A 2NU8A 3OHSX 1DSSG 3F4LA 5JCJA 4BKQA 4ZN6A 2Q3EA 1N8KA 3AUSA 4JBIA 3QHAA 3PFWO 1XLTA 4II2A 4MVJE 3GMSA 4G81A 1BDMA 1E92A 1SB9A 1E1NA 2R00A 4ESOA 3UOGA 1G0OA 3K9QO 3N74A 3L0DA 5F1KA 2FN7A 4NFSA 4MDHA 4ZQEA 5BR7A 1ZKMA 1T2AA 4AJHA 3WB9A 7ADHA 3WSVA 1R4NA 3SJ7A 1NQTA 1RKXA 2B37A 3KEOA 3WJ7A 4LSWA 4QXMA 5G0VA 1ZSNA 1W6UA 4NJMB 1HEUA 1DRUA 3TWOA 1N5DA 3ETDA 4XRRA 2O7SA 4NBVA 1MLDA 3IKVA 3WJAA 1MGOA 2C82A 4I5EA 4LISA 3WDSA 3Q0EA 1H6CA 3WWYA 1S7CA 1LSUA 3ZN2A 3EMKA 3OH8A 2BMAA 3UN1A 4ZICA 1E5QA 2NUAA 3GA0A 4QQRA 5IFLA 1CWUA 4PIVA 4XDYA 3C1AA 3WWZA 5AYVA 5ICSA 1MUUA 2EKPA 1ZSYA 3QJ5A 5CDSA 1BW9A 5KWEA 4BGVA 3GZNB 1E0DA 1F14A 4FIZA 5BQFA 1DIHA 1T26A 4FB5A 4CLRA 2NNLD 1UAGA 4WK6A 1PWZA 1DOHA 1MC5A 1KVTA 1NQ5A 3ONDA 1I33A 3WGZA 4LW8A 1HLDA 2EP7A 4TVBA 2VHXA 4KTTE 1CERA 3O26A 4GGOA 4BNMA 2X0JA 1U8XX 4IZHA 4TKMA 4J1TA 2I65A 4WLVA 4XEHA 3RC1A 4DGSA 5FI5A 5HBRA 3DBRA 2H6EA 3CPSA 3DZFA 1VLLA 1LLQA 1VL0A 4MP8A 2EKQA 1HE4A 2BI8A 4RVGA 4J4TA 4LGVA 2VWGA 1VKNA 5THKA 4TZKA 3ZV4A 5KVSA 4B3IA 1DBVO 3AW9A 4GGPA 1PJSA 5TSDA 2Z1MA 1P3DA 5AXCA 3KLMX 5A03A 2OHXA 2DQ4A 1HWYA 4H3VA 5F21A 2JCYA 3WQRA 1Y9AA 4DYDA 5JDIC 2NVBA 4R51A 2EWMA 3O9ZA 1P0CA 3I5MA 1X13A 4XGKA 3VPGA 1BHSA 5JC1A 3PTZA 1TVEA 4I08A 2GN8A 1P1FA 2JCVA 4LVUA 5DDIP 4XRGA 4CMKA 2JFGA 2AG5A 4WKGA 4C4OA 4WJZA 3VPXA 2PNFA 4UUNA 4W7IA 4YT8A 1NAHA 2GNAA 2WDZA 5IXSA 3A06A 5BSHA 1HETA 3PYMA 2P4QA 3HDQA 5A1TA 2C2YA 4OGWA 3AUUA 4CM9D 4JLWA 5JBIA 3WX0A 3KLPX 1BXGA 2EP5A 2PR2A 3KEQA 3O03A 3W4KA 3WR5A 3GZNA 2RIRA 4CMJA 4WLEA 2E6UX 4XQCA 5I7VA 5GZ6A 5A9RA 1HE3A 4CMCA 4GL4A 1R66A 2QW8A 2PZKA 3JTMA 1Q7BA 4B4VA 1M66A 2WJPA 5DCWA 2VWPA 4ZJUA 4PLWA 1SNYA 4Q3AA 5JCJD 4DMLA 1F8GA 3STHA 4ALLA 2NU7A 2HQ1A 3IQDB 5CG1A 3NTQA 1RM0A 4FOOA 4IDGA 2AEFA 1X15A 2YW9A 2OORA 4XIJA 2B0JA 1NVGA 3WGTA 1R37A 1ISHA 3HB4X 1X14A 4R16A 4AL4A 4P4LA 4BIIA 4EJ6A 2CF6A 4FJ2A 2OP0A 5BT9A 3DBVO 3PWZA 3ZI0A 2Y67A 4CR6A 2C0CA 2CF5A 2HMTA 2ZB4A 5JSFA 3AOEC 4B7CA 1QV6A 2H63A 2HMSA 3OBBA 5G0UA 4XD2A 5JS6A 4J2HA 1RM4A 1DIBA 3LLVA 1LLCA 1CJCA 1K0UA 4AG3A 4GBJA 3PQFA 3PVZA 2FR0A 4OIMA 3S1LA 3GAFA 2OFPA 1UXJA 2VUSA 3ZW9A 3DEYX 1A71A 2FWMX 1VJTA 3NEPX 1BRMA 3N7UA 1NX6A 1SZJG 3KRTA 3QE3A 5I8ZA 3VZRA 4CLEA 2VWHA 4PLYA 1XQ6A 4WUVA 2YHUA 4HNHA 3ZWXA 5CDGA 2E82A 4YT4A 5JDIA 4AJLA 1KYQA 3ZH2A 4D3FA 3CXRA 5FFFA 2WSBA 4IY1A 4RDHA 4PVDA 4CQLA 3RUHA 1ADGA 1I2CA 2B5WA 3UCFA 1PS9A 3I4FA 4ALJA 2RHCA 4F45A 2PGLA 2X7HA 4M8SA 3L9XA 3F6YA 4EJ0A 1BSVA 1TLTA 2O3RA 3TOXA 2FOIA 4M54A 4F6LA 1LI4A 3RQSA 3WSWA 4PLHA 1P31A 5L7TA 1YL6A 2J5KA 3BTUA 3JQFC 1GAEO 4DL9A 1KVQA 4U6SA 5FYDA 2GF2A 3OFSA 1YWGO 2H9IA 2CFCA 4TROA 3U62A 3UCXA 3VDRA 3ZV3A 4DQXA 3DZBA 3UW3A 2BLLA 8ADHA 1VL8A 2Z95A 3D5QA 3DZHA 3FWZA 4FJ0A 3CKYA 4RPJA 4YJGB 2HSDA 1MV8A 2DTDA 3KVOA 1TEHA 1O9BA 2QYTA 1Y6JA 4KZPA 2J8ZA 4E0BA 4E6PA 4BHTA 1A9ZA 3AM5A 4XGIA 5T57A 3RU9A 5L53A 3LC7O 1Z73A 3U09A 1OZAA 3BTVA 2EG9A 4R1NA 3Q11A 4IDFA 2X8LA 2DPHA 4NH4A 2FMUA 2AEMA 2E37A 1VKOA 4JROA 3K2EA 4BNNA 3AWDA 4L76A 2VRCA 3ENKA 3I9KA 3GLQA 3AOEA 3GN1A 1U9JA 5JDCC 1GV0A 2HMUA 5L9AA 4NK4A 5DZSA 4UEJA 1J0XO 3SJUA 4A5OA 1IUKA 1XQ1A 3DBHB 2WE7A 3WFIA 1DJQA 3ZWCA 4DMMA 1NFQA 4WLUA 3DXFA 4OQZA 1O94A 1I3NA 1PGQA 4CV2A 5L40A 4YAEA 2W98A 5H81A 1T2EA 2PY6A 2WYUA 3PJFA 5G0TA 1N1EA 4JP2A 4DC0A 4Q9NA 5T8KC 1ZK1A 1E3JA 1V35A 3GK3A 4TVOA 4N5LA 3JQ9C 5IAAA 4ND5A 4YAKA 4HWKA 4NZ9A 4FFNA 3A14A 3GGPA 3E1KA 3FSRA 4ZQBA 1CQJA 2IEDA 3EVNA 2VYVA 4DQVA 1R6DA 3W4JA 1JQBA 3DZKA 2Y0DA 2V6BA 2J3IA 1JKFA 1Q0QA 4QECA 4I9UA 4RLHA 2XXJA 1SCUA 2NTJA 4E3ZA 3JQFA 1KY5A 4CQMA 4YJGA 3SC6A 3FHLA 3GG2A 3PIIA 1VC2A 5TF4A 4CMAA 1H2BA 4CR8A 2V6MA 3HB5X 4BNXA 4QFCA 1HTBA 1XDWA 4INAA 3C85A 2GD1O 3RBVA 3IJPA 4GSLA 4J1SA 1EDOA 3DFZA 3LT1A 3I4CA 4LRSB 4XIYA 2D2IA 3C7AA 4DXHA 1OAAA 1P44A 2DC1A 4H16A 3H8VA 1WPQA 4FBGA 1HSZA 2XPCA 1XKQA 1EUZA 4PZDA 4Y9DA 4NIMA 3K6JA 5JY1A 3RC2A 3FR7A 4LSMA 4BMVA 3VH2A 1T2FA 5IDYA 3GT0A 4OSOA 5H83A 2DBVO 4IJUA 3RD5A 5KVVA 3Q3CA 2VUUA 3JYQA 3VVBA 3AM3A 2EERA 4Q39A 3TZKA 4BKUA 3NT4A 4G5HA 5JDCA 3T4EA 4WCFB 4YT2A 1GDHA 4BB6A 3DL2A 3RUFA 1IB6A 4AVYA 1DDOA 4E12A 4XYMA 4XYEA 5LCXA 2PA3A 1PQUA 3W8EA 1AXGA 1QYWA 1UR5A 4BNLA 5ITWA 3H9GA 3DAFA 1HDGO 2OP1A 2JJYA 5DULA 1E77A 5KJ6A 2VZ0A 4FQ8A 4EEXA 1WZIA 3D64A 3FWNA 3GRKA 3WYCA 2G17A 1YONA 3UF0A 4DREA 1Y8QB 5T8KA 3MJSA 4CM4A 2I76A 2C20A 5KVCA 3JQ9A 3KHUA 4CMHA 3NDRA 2GN9A 3FTNA 2A92A 5C7OO 3H2ZA 3VVCA 3EZLA 2AE2A 4FCCA 1YDWA 3HDHA 2ZQYA 2I5PO 3DOOA 3EVTA 4JP3A 5A04A 2BF7A 1N92A 4PZEA 1LQUA 3IAHA 1KY4A 3OMLA 2D1YA 1VE9A 1ULUA 2YV2A 1ZK3A 3UXYA 4YBZA 2PGJA 1PL8A 1GYPA 3LYLA 3GQVA 4I1IA 1EFKA 1VSVA 3A28A 1PQPA 1AHHA 3TFQA 3IMFA 2IXBA 1ZNQO 3GF4A 1ZCJA 3AY7A 3NJ4A 3F5SA 3C24A 4GPD1 2X5JO 4KQXA 3TRIA 2RH4A 4J1QA 3MTGA 3F1KA 2NQ8A 4Y6RA 3OEYA 5DOZA 5HWSA 4NU5A 2DT5A 3DTTA 2EW8A 3IUPA 4IQ0A 1LEHA 3FF4A 1D3AA 1JAYA 3BMQB 1I3LA 3I9MA 1G1AA 2X6TA 4C7JA 1XEAA 5TT1A 1ZK0A 3WYBA 4GAEA 1H6BA 1N1GA 2BHLA 4JQCA 2OBYA 4YJFB 1DB3A 5AXAA 1GZ3A 2R6JA 4P4GA 1FMCA 3PGJA 4GH5A 5T6BA 3DHEA 1PZEA 4I9HA 4FFOA 4OH1A 5IZCC 4CM7A 1HDCA 1WDKA 4CJXA 2B5VA 2P4HX 2W8ZA 3HN2A 2JKVA 4RF4A 1Y8QA 4ND2A 2Q50A 4N5MA 4OXNA 1KERA 1EMDA 4J91A 4JJFA 1HDOA 2DFVA 2FR1A 3TZCA 4X54A 3LT0A 4IMRA 1HZJA 1E6EA 1GU7A 2FHSA 4CV1A 1SMKA 4RVHA 4CUJA 2GGSA 2OGUA 4I5FA 5DBIA 4LCEA 1WP4A 4DC1A 1BG6A 2G1UA 3IOYA 1CETA 2Q49A 3E48A 2ZQZA 4OYRA 5ER9A 1D4FA 3ZHBA 4CMBA 1QORA 1NBOA 1YH3A 1IULA 1FDUA 3HWRA 1EZ4A 4IBOA 4MP6A 5TRTA 3SEFA 3ITKA 5COQA 4TSKA 3O38A 4BO4A 2Y1CA 1KOLA 1LDGA 3JQCA 4CLDA 5F1PA 3JV7A 4TRNA 1HSOA 2DUUA 4UEOA 1WZEA 5F5LA 2P68A 4M89A 4IS3A 4DTIA 1LQTA 2HO5A 5C37A 2D5AA 4TMFA 3MCVA 5TC4A 2V6FA 1MFPA 3H2SA 1E3LA 4ZGWA 2HMWA 4BGIA 3DTYA 4N5NA 3RJ9A 4BMNA 1SC6A 4HNGA 2RCYA 5F3RA 1E1KA 1WNTA 4Y67A 2WYVA 1EE2A 2CD9A 3BMQA 3GDOA 2GASA 5U1PA 5A06A 1KEVA 4UREA 2G76A 2GDZA 1CEQA 3QVTA 1PJCA 4YJFA 3LC2O 1FDSA 5G0WA 5LDHA 1WDMA 4L4SA 3LQFA 3MJTA 1H5QA 3OJ0A 3GGOA 1JDJA 1VPDA 1L7EA 4PN3A 3WYEA 4NBUA 1JN0A 1LX6A 2JD1A 4HFMA 3JQGB 2WYWA 3H5RA 1UP4A 3PI7A 5LC1A 2C7VA 5IZCA 2AG8A 3JSAA 2CVZA 4MVJH 3GVHA 3VDQA 5JC8A 4OL9A 4YRDA 5MGBA 2Y0CA 3L07A 1PGOA 4L0QA 3ZDFA 3BHJA 1C1XA 2HK7A 2P9CA 2UVDA 4RVUA 3RSHA 4ITUA 4YB8A 5DT9A 4MPDA 4RCVA 2Y1GA 1OOEA 3CE6A 2X86A 1YS4A 1GCUA 4CLHA 3QWHA 1NWHA 1E3WA 5AXBA 2X5OA 3RKRA 1P45A 4R41A 1X7DA 3EZYA 2X9GA 4XGNA 2FPPA 4MIOA 3JQAD 3JD1A 2ZYDA 4BB5A 5KJFA 1KVUA 3EW7A 1W0CA 2XOXA 1ONOA 3QP9A 4KDEA 4P4NA 2QQ5A 2YZ7A 1HE2A 1R12A 2P5UA 4YJDA 2GLXA 3CMMA 2ILTA 1T2DA 4BNKA 5I8WA 1N7GA 1HLPA 4CM9A 2IZ0A 3ZWBA 2OOSA 1LTHR 2CDBA 3FBGA 4UUOA 1E7YA 3HG7A 4E5MA 3WMXA 3U4HA 1P1KA 1ZJYA 2DLDA 3Q2KA 4Q3BA 1IY8A 3K2BA 3C7DB 4XQ9A 4BV9A 1AUPA 2DBQA 3GN2A 1KEWA 3I52A 3MZ0A 4E5PA 1GQYA 1OBFO 4E5NA 4PG7A 3K30A 4Z0TA 1GEGA 1P74A 3ZV6A 2QZZA 1NHGA 1YB5A 4YJHB 4W7HA 2EW2A 4ZVVA 2H5LA 4UUPA 3JQGA 1N2SA 3IP1A 3SBOA 4QSMA 2B4TO 3U4IA 3WQSB 3U4CA 5CP8A 4E5KA 2SCUA 4FPXA 1ZK2A 5GZ3A 4TWRA 2ZTMA 2UDPA 1K3TA 5JAIA 3RIHA 5KIAA 3RUAA 4R1SA 4FC6A 1LSOA 1I0ZA 2FSVA 5JCXA 5CDTA 4MJLA 4MKZA 2OUIA 1UDCA 4CV3A 2P5YA 5AXDA 3ON5A 2CZCA 1DRVA 3UHAA 4HADA 1VM6A 3GHHA 4RZHA 1XSEA 3U3XA 3V1YA 2POQX 2JHFA 3MTJA 1VL6A 1LLUA 4JCOA 2EXXA 3ZWAA 5I7EA 5COAA 4R5HA 4ZU3A 3HSKA 1TT7A 1NTOA 2CSUA 3AY6A 3D7LA 4G2NA 2W90A 2ZKLA 1K6IA 5C3MA 2AQHA 3F9IA 1H2HA 1EE9A 3K92A 4IXTA 4NFYA 4K6CA 4R4JA 1DIAA 4J7CA 3D0OA 4FDAA 5BNIA 4ND3A 2OBNA 1B26A 3Q9UA 5L45A 2FR8A 4W9NC 2PH5A 4I9NA 3TL2A 4KDFA 1QXSA 2VYND 1RM5A 3ANLA 2B83A 4ALIA 1QKIA 2AQ8A 3QLJA 1VSUA 4R1UA 3FNGA 1RPNA 4J0FA 2YQ5A 4E4YA 2IODA 4IGFA 2I99A 1WLYA 4S3MA 3Q6IA 3LLSA 5ES3A 2PZMA 2DVMA 3H5AA 2BI7A 2PTGA 2VTEA 2GR9A 2DUWA 3ITDA 2BELA 1H94A 4CM5A 2O7QA 3ZWNA 1XA0A 4GKVA 3VAZA 3LF2A 2C54A 4IZIA 4HV4A 3QW2A 4F3YA 1HE5A 3HDYA 4AJ2A 4Q3CA 3WGIA 1PGPA 3WG9A 1C0LA 1MA0A 3X2EA 4WLNA 3HUDA 5JXWA 1ISMA 4XR9A 5DP2A 4A2CA 3VPFA 1UJMA 4RZIA 4BNGA 1C14A 4KP7A 3KSUA 1XGKA 3AUTA 4LN1A 1KIFA 1IYZA 1HT0A 3PYLA 3V1UA 1IE3A 4E31A 1ADFA 4GSKA 4DLAA 4NJMA 1ISGA 4WOKA 4BVAA 3GDFA 4FR5A 2CVOA 1ULSA 4BGUA 4HFJA 3NTOA 3AI3A 1GPJA 1VJ1A 1EVYA 1R0SA 4GWGA 3C1TA 4OMUA 1YQXA 3P19A 3M1LA 4O0LA 4MVJI 2AE1A 3LF1A 3B20A 1DHRA 3PWSA 1LSJA 4D42A 3PDUA 2ZCUA 4BO2A 1C3VA 3M6IA 5I9MA 1I32A 5CDYA 2CNBA 3DO5A 3PJDA 4EZBA 3ADPA 4D44A 1QLJA 3NT5A 4GMGA 1DEHA 1X0VA 4EDFA 1B3RA 2NU6A 1Z74A 5BSFA 3PHGA 1T2CA 2E4AA 3ZWPA 4DBZA 1YL7A 1C0KA 3ST7A 1UZNA 4NI5A 5KKCA 2F1KA 4W9NA 1AGNA 5DBFA 4IUYA 4RVSA 1LRKA 2D0IA 4Y6PA 1WMAA 1Y81A 2YJZA 3GUYA 2Q2VA 3UH1A 5DNAA 1Q7CA 1B8UA 4FGWA 3ZU4A 4BKOA 4I5DA 2DFDA 1NQOA 4J6FA 4BNTA 2LDBA 5L4NA 3K8ZA 1LA2A 3EUWA 2EKLA 3DWFA 5A05A 3OA2A 2NVUB 2X5KO 5CPBA 4QO8A 1LDNA 3A1NA 3BZUA 1J4AA 2Y05A 4YAJA 4YPOA 3GY0A 3M2TA 4UVGA 3C7CB 3KUXA 1I10A 3CH6A 4D7AA 3JQ8B 2X0IA 2VUTA 4KOAA 4MVJM 3W6UA 3ICCA 5JNLA 4XCVA 1I3KA 3L4SO 1CQIA 3IUSA 1ENPA 1BVUA 4GX5A 4JK3A 4U5QA 1NR7A 4IQGA 5JMWA 2X9NA 2R2GA 1Z82A 3P2YA 2PWZA 4O6VA 3KXDA 3NV9A 4MKRA 5L7YA 2AXQA 1U1IA 1XU7A 1VJ0A 5A4DA 4AJ1A 1U3TA 2UV8A 2YYYA 4EUFA 3RBZA 2NQTA 1H9AA 2VTDA 1XR3A 3L6DA 2GCGA 3PYXA 3RI3A 1U5AA 1LLDA 4IJWA 4XYLA 1YBVA 5THQA 3UKOA 5L4LA 6ADHA 4PFJA 1PS8A 1FXSA 2ZB3A 1KEUA 4XB1A 4J2OA 1Y9EA 1NR1A 5ILOA 3RBXA 2VHYA 1P1RA 1G6KA 1KETA 5DCYA 1PL6A 2A94A 2C5EA 3OM9A 3RFTA 3V1TC 1P1IA 4YCAA 3VH4A 3D3EA 3IKTA 3JD0A 1LC0A 1SAYA 4M87A 1KC3A 3JYLA 1NYTA 1O6ZA 2G82A 4JGBA 4DLLA 1R16A 1B8VA 1NASA 2BFPA 4NHEA 4B7XA 1V3TA 1ZJZA 4Z3KA 1CDOA 4CL3A 1IL0A 3UVEA 2Z5LA 3GDGA 4EEZA 1V8BA 1K6XA 2OZPA 4UVHA 2NVUA 3QA9A 2DKNA 4RPKA
chains in the Genus database with same CATH superfamily
3ZLJA 1EVLA 5DASA 3K32A 1UF9A 4LF9B 4LMPA 4KI7A 2EJWA 5CVJA 1JMKC 1YIAA 3N0TA 1YUBA 1FEZA 4UOQA 2B8EA 3N0RA 5IKEA 2IEBA 1MF7A 3H5IA 1VZ3A 2X7JA 4URXR 5FX2A 1UOEA 2ECKA 2PVSA 4L8WB 3B6KA 3QXCA 4EZIA 1AKVA 4C22A 1KQGA 3GJ6A 4YJ2B 3IVXA 4GMFA 4QBHA 4ZO7A 4L50A 3I04M 4PBRA 2BGKA 3OZRA 4MUIA 3VVLA 5JROA 3IEMA 2DTEA 4FJ1A 4C2AA 1KKLA 3BULA 3R41A 5CXXA 1UODA 2Q3LA 4RHXA 5D85A 1NW5A 5D3MB 2GAAA 2O3QA 5KJEA 2HPVA 2JJ1A 4O2LA 3FGOA 5LR6A 2O2YA 1BVYF 3KQVA 3P0RA 3MMZA 4AK9A 2NU9B 4XX0A 1K27A 1TU4A 1OLUA 1R8XA 1DC4A 1W35A 3RAGA 1W5FA 4MUGA 3ULKA 3MWEB 4YT5A 1IPHA 3Q98A 3TDMA 2CFOA 1D1TA 2IHTA 1RE0A 4JA0A 2HL6A 4NJEA 4ZEMA 3ROTA 3GVPA 1TF5A 3UMRA 6REQA 1J22A 3WLLA 3QUAA 1Z4IA 2ZSJA 1U28A 4DUZB 5ESWA 1D4ZA 1DKPA 2IHVA 1VJCA 4J7UA 4CKEA 5I7SA 4B74A 4D3SA 1COWD 3OP4A 1CJSA 4XWTA 5FUYA 2ZRAA 3THXB 3Q4GA 5G4LA 1SCKA 4KQFA 4EYKA 5C1OA 3NIWA 5F2OA 9LDTA 4QNRA 4RUKA 4EPYA 3AFNA 4OQNA 4Y9SA 1NW4A 2C00A 2HF9A 4Q16A 3MWKA 5CG2A 3IP8A 1XZQA 3LDUA 2C5LA 5F5XA 5KSYA 3PUIA 4ZAFA 1I8TA 2FTKE 4DF3A 5IWCA 5BWCA 1GSOA 5F73A 3UMJA 4E2FA 3M6LA 4WI1A 3NASA 3BS4A 4H9GA 3SS9X 1CNEA 3PCRB 4KGDA 2C9MA 3QNUA 1B8PA 1F60A 1YIDA 3MN1A 4GFDA 5EQDA 2VSNA 3ANMA 1E1CB 3OJEA 1SKUA 1UMCB 1ZVMA 2OZLA 3UJ9A 4BATA 5EUQB 4IILA 4TT3A 1AK9A 2I1VB 2J0QA 1HOTA 3SVTA 1G4UR 4HNSA 4JDUA 1W9HA 2FEKA 4OUDB 4QC2A 2ZPAA 4QPPA 3U40A 5CYGA 4BLOA 5TQVA 1GG5A 3JWGA 4V1CA 4LMRA 3HFSA 2D3TA 1PX2A 5DVZA 1OA1A 1CT9A 1ZM7A 2OV4A 1SR8A 5GJWC 3MLAA 4WINA 1QGYA 1WDWB 4R7GA 5BP7A 5JYDA 2IHNA 1QCCA 3PRJA 2W2KB 1DAFA 3ICQB 3E2PA 3QHPA 1J0DA 5I7HA 4R54A 1JJIA 2W4MA 4FZ3A 2BMJA 2IELA 4IDBA 5JZMA 4LF6B 1WRBA 4OQYA 3U9SA 5ENZA 4ID9A 1PFVA 2PZAA 2WVJA 3G9QA 3M7IA 3MF4A 4RQAA 3V1KA 4F2DA 1IN5A 1G17A 3CSDA 2YVUA 1YC2A 2QTLA 3IEKA 3CH4B 4L5BA 3V7FA 4NU0A 3A4VA 3GNLA 3HCBA 1BHQ1 5KDDA 2QTAA 1ZMBA 1FNCA 2YHIB 4PAQA 1CUFA 2H1RA 4XOIA 4L72A 4DNXA 3DYVA 1KP2A 4FS3A 2CUZA 1NTRA 3T3DA 1XMXA 2E4ZA 2EFEB 5E8RA 3ABIA 3ZLUA 4C0XA 3IP5A 4KTVE 1B15A 2GUGA 3I23A 4W1SA 3I0ZA 3D2LA 2PD6A 2CB0A 3W3AA 1V8ZA 1CRWG 3A37A 4GLOA 4BL5A 1BXZA 1BQ4A 1Q0HA 1SCBA 4QPNA 4G5SA 5EJ6A 4K9NA 4R6XA 2FFRA 1MQ9A 3R7BA 3O4HA 5DCUA 3TFOA 1E4OA 3FN4A 2I66A 4M22A 2X1MA 5FTNA 4F93B 1IXKA 4PZLA 3JVDA 1U81A 4ZOAA 4AICA 3PJRA 2C9OA 3RS0A 3TW0A 4B2IA 3OJOA 4JZKA 1KZ4A 2ZRDA 2WUDA 3CEHA 5KOYA 1UAYA 3DF9A 2OCYC 4FQ7A 1XYGA 4B3FX 1RKQA 1NRJB 2OLEA 3K5PA 3ADDA 3CB4A 4BVKA 5F2NA 3PUZA 4BFUA 1QKJA 3AHGA 2ZRQA 4LXYA 2VTBA 1IHUA 2BEWA 4LTNA 2X1LA 2PD4A 2XUAA 3HYRA 4MVJD 2AV6A 2HV9A 1UJBA 2VP0A 4S1OA 2YJTD 3WO0A 4ND8A 1K5DA 5L4SA 1YVDA 1RWBA 4R1QA 2AZXA 1DCKA 1PP4A 4IJVA 4RK4A 4TPKA 3JVEA 3WK8A 1CF2O 5ESDA 2JC3A 2TMYA 2XADA 2XOKD 3UAGA 4LGCA 4BO7A 2IBTA 5ARDA 1A7UA 1V8OA 4NQRA 5JQGA 5DHFA 4KWHA 2JEZA 5JE8A 5AFSA 2WQZA 4EPTA 2I3GA 3EYWA 3HGMA 3OQ1A 3MJ4A 4IDEA 3AT1A 5LOVF 2XA2A 3RTBA 3FETA 3LPLA 3NS7A 4I99A 2OO5C 1KZ9A 5SY9A 2EFCB 5IBPA 4QULA 2WZBA 1D8AA 1E7WA 4M0PA 4KV7A 1PHRA 3ROPA 3ZU3A 4ZAYA 1ZBQA 1BE1A 3P4YA 5CYPA 3T9BA 1L9XA 2FPGA 2Z6UA 5JLAA 2B8TA 2Q29A 3BB4A 4RABA 4TLEA 4G84A 4CIYA 4WLFA 4LHEA 2QT1A 4AZ3B 4GS5A 2C77A 4RU1A 3JWIA 1CRQA 4DDWA 1VRCA 5IJZA 2BJWA 2WM3A 2XVZA 3ICPA 3KKNA 3PD7A 3RPEA 2FWIA 3A1TA 1TOAA 1T0JB 4JUFA 4JDPA 1Z45A 1VCNA 1PTJA 4DBVO 2RBGA 2D1TA 2A7XA 1E7MA 1QGUA 1Z0DA 3CLRC 5H0IA 3DFKA 1PLKA 3WWOA 1R4MA 4B4OA 2WU0A 4Q34A 2W2PA 5DHSA 2JS7A 3LUFA 1J2JA 1T3GA 4RJJA 3QRWA 3K73O 2PRZA 2QI9C 1TFRA 2VF4X 4ZARA 1X19A 3R77A 4R69A 3DLIA 3KV3O 3B9PA 4I9GA 1E63A 1ORRA 1RT9A 4F9FA 5B55A 3G23A 3KE8A 3PNBA 4WY2A 1K86A 5J63A 1HZZC 4CWAA 1YD7A 3IPCA 2CEAA 2HUPA 3GX1A 4OK5A 1FU8A 3DZJA 5AJUA 5HA5A 4D4HA 1QHGA 3BCHA 4RPGA 3T9EA 3TFWA 1Z08A 1MAVA 1UDXA 5AW1A 3IL2A 2V3WA 1Z2DA 1M2VA 4IOKA 5FYQA 2QVYX 3QVXA 2X1HA 4LFBB 1PJQA 3ZGXA 4KFCA 2UYOA 1BNCA 4K9RA 2FKAA 3EPPA 3EFEA 4RQBA 1DU4A 4IQFA 4C78A 2PTHA 1H2EA 4AKHA 4GKBA 1GNQA 1E9SA 2P3LA 4DDVA 1T2NA 5M34A 2IP4A 3INTA 5CEFA 1YS2X 3LCJA 4CG3A 4CUZA 1RQ2A 2R47A 2ZR9A 4KSCA 1B1CA 1N6RA 5HF9A 3SLKA 3OU6A 4FGLA 4KEAA 4D6XA 4DIBA 4OHMA 4ZAGA 5T67A 2ZSBA 3QA3E 5IM4A 3V7WA 1P1JA 3N0WA 4JJ4A 1YO6A 1LPMA 3F6EX 1S8NA 3OLWA 5DN6D 4TTPA 3SX4A 4BQSA 2BZ1A 1EK2A 4EGQA 1Z88A 4DJ5X 5BPHA 1U2DC 2HEGA 4IVPA 4CLXA 1WDTA 4W99A 2NX2A 4ER3A 1RBQA 2VYNA 3F7TA 3WGKA 1LY1A 5DWVA 5C1BA 5AW6A 3BG5A 5BWMA 4FEEA 1V5GA 3FI9A 2V4UA 3LA8A 4B6OA 3I3OA 1L4EA 4NOKA 2EKDA 1CHDA 4M53A 1I14A 1NZDA 3O8NA 3TQFA 3D1LA 3GIDA 3HA2A 5KJCA 1DLIA 3PVCA 4AROA 1UKVY 2ALJA 3D02A 1JKIA 2XGJA 3AR9A 4KOEC 2D7DA 1WXIA 2Y1EA 3DE0X 1JJVA 2ZRBA 3D4NA 3KPYA 2GEJA 5IJ0B 2XMQA 2DFNA 1G16A 1SOMA 2FUCA 2ZAOA 3O3CA 3C8DA 5D1NA 5T3UA 2I2CA 3G2PA 4DMHA 4L07A 4Y2RA 2BR3A 4O4IF 1G1MA 1VXOA 1OXXK 2HHLA 3OFKA 5B53A 1M6WA 4P38A 5TMBA 1NN0A 6CHYA 5AVTA 1UBLS 1QCDA 2GD6A 3PZBA 1GILA 1ZOOA 1WO8A 4NZMA 2OXTA 4BMPB 5DNYB 4DCMA 4QFBA 3ECCA 8LDHA 4OAPA 1K7CA 1VFNA 2AC4A 1N7JA 1RDFA 3D3NA 3DMFA 3GH1A 3Q7PA 3RS5A 2VAPA 1I4DD 1VG0B 1WV0A 4BWYA 3I2HA 1K8YB 2LCQA 5LZ4A 4GDMA 1YFKA 3JQQA 2PXAA 3DL0A 2CE7A 4XAQA 2H7YA 4OHOA 4UKDA 4EKEA 2XMGA 3OESA 5CLHA 1UP6A 2RCNA 3MINB 1NXXA 3AKYA 4Y3UA 4EUNA 4ER0A 4LPSA 1A7AA 1SHKA 4RESA 3C45A 1Z7EA 3ENNA 5BYAA 2PS9A 4X3PA 3UGKA 1BGXT 3AWIA 4XJSA 2E87A 4QYIA 1KS9A 4YO8A 4D9CA 2XUOA 1VE6A 1FRZA 1E62A 3E18A 3QPAA 4EFNA 1L9KA 2GAOA 4Y98A 2O0HA 4D0RA 2D06A 3VU1A 4HATA 1IJKA 3M1IA 4QWWA 1XDDA 2Q1UA 3MM4A 4MUKA 3A7DA 2J7KA 3PEEA 5KWIA 3OKFA 4PSKA 1QP0A 1TYCA 2WG1A 3BDIA 2B2XA 3GJ5A 3GNQA 1KZ6A 4HYTA 2GSDA 3OOJA 3UPTA 1F6DA 4L73A 3EZXA 3RF6A 4PS1A 4TKLA 2DTXA 3BZWA 1WF3A 2YJ4A 5HFJA 2NTNA 3M9XA 2H4HA 3CLKA 2FPOA 3O8RA 5ALPA 3TB4A 4YJ2F 3JQDA 2ZRNA 2WTBA 3TQHA 1A4UA 1F8FA 2REXB 1W4ZA 1BKDR 2B1JA 2XNHA 3G0IA 3L6BA 5JCZA 3ROQA 1YVEI 1J49A 3QFCA 1M6VA 3TNYA 1WMBA 3PL1A 2HWXA 3HR8A 3KBOA 2UZAA 3CO0S 4TV8B 1ZN2A 4KQ2A 3SVZA 5K3FA 3HYNA 4ZRMA 3K9FC 1FF9A 1NN5A 2W6IA 2VRBA 4C07A 5K5EA 1T4GA 3W6PA 1IN7A 5HNKA 3FHTA 3EEBA 5KOHA 3NBMA 1XEFA 1ZW1A 1C7EA 2FZVA 5HZKA 2QRQA 3TDKA 3VTZA 3QIAA 2Q6VA 5C8YA 2R6CA 2R8XA 1UMDB 1T9DA 3QNMA 3VGPA 4ACAA 1YZVA 3VHRA 3EOBI 1Q6ZA 3MGBA 4FMPA 3CF4G 3M4ZA 3NVKI 1A27A 1JNYA 2O1XA 4HUQB 4Q4CA 3IC5A 1QOPB 3VC3A 4TM8A 2FP4A 3D4PA 2QSUA 1ADCA 1JAHA 2HCFA 3ISVA 2CBZA 4N6OA 5L7WA 3TR6A 3T9CA 3ET5A 4A03A 2Q3FA 1Z28A 4CODB 2UXCB 1D0VA 2ADOA 2Q2QA 1RHQA 1TF7A 2W8BA 3PGXA 4HCJA 4LI3X 4UZEA 4LF8B 1XELA 5HDBB 1PJ2A 1QSGA 1W4BA 3D3WA 4DUGA 4B48A 4PX5A 1WQ3A 2B7LA 2BCEA 4HDRB 1KBZA 1OXBB 2K4MA 4HDKB 4RHCA 2P0YA 4QGSA 4O2BB 1CXZA 4TTJA 4A8PA 1US8B 2K7FA 1Y8RA 2SICE 3EWNA 3MB8A 2UAGA 4KXWA 4AMGA 3QGMA 2NUPA 3EZ7A 3WKDA 5JH7B 3RASA 4B0OA 2PANA 3QY0A 1HH4A 1EFRD 3KB1A 1QWSA 1VJRA 1ZWLA 2EZTA 4B8ZA 1B6RA 2GK6A 1BWSA 5KNDA 5AUOB 4KZKA 4UAUA 2WOOA 2BGIA 4WNCA 1M5RA 3C87A 4QJIA 5EFOA 1OX4A 1W5TA 4U0KA 4EG0A 1A96A 3HC7A 2GRUA 3C8MA 3FKSA 3PXXA 1LX7A 2ZE5A 3BJZA 3IB3A 3Q8XB 5TX7A 2GA9A 5CITA 5KNBA 2NVOA 1T24A 3FW1A 5AM5A 3IE2A 5AOAA 3CIFA 3WDMA 2PO7A 2ZSAA 3OEHA 2ZUVA 3AVTA 2Y4OA 1HNNA 3I9NA 3NHZA 1QO9A 3G1TA 4HF7A 1TYBE 3M5CA 1P72A 1JG7A 1YA4A 3HSSA 4RGVA 4BMOB 1QP7A 1EFLA 1MH9A 1ZRSA 3CQ9A 3CVJA 4D0SA 1OYWA 3T4PA 1IVYA 2XDQB 3T61A 4D4IA 4MW2A 3TOSA 1PNRA 5D51S 2YUTA 3Q1KA 4CL8A 4Q12A 3MJCA 1L7PA 4I4LA 2REQB 3OY2A 4UASA 3VJRA 1KZGB 2EEPA 3H5WA 2I03A 3FY4A 3STWA 1PNVA 1XTJA 4W1RA 3RVSA 4XFDA 4A1OA 1Q2XA 3TIGA 5G02A 4DHEA 3C3PA 1UEXC 2V5AA 3L7YA 3JZAA 1IVSA 4WSOA 2ZVJA 1EFPB 4HNAA 1LUAA 3AU9A 4ENWA 1H42A 2JD0A 2QLJA 4FHGA 4IYJA 5IAGA 1I3MA 1RM3A 1XZMA 2G5TA 4HNVA 5EIOA 2YZKA 3OU7A 2HZ7A 4O3FA 4MAAA 1CY0A 1TZ2A 2L18A 2GJKA 4UNQA 2FWNA 1VRVA 3GPBA 5CMLA 1EP3B 1M1XB 3FCUB 4HUJA 4KQMA 4HB4A 1QVZA 2JHCA 3L8ZA 2ZANA 1QRUA 1LPBB 3KJXA 3MLEA 1IJBA 1ISPA 3HUTA 1F9EA 3K0CC 4MX8A 1UUFA 2XAAA 1O5OA 4BMZA 1KKMA 2P2DA 4BLQA 3M1YA 3G3EA 2VCHA 1V2HE 1XO1A 5K99A 4Q3NA 5CNKA 1Z6XA 3NHBA 2QZSA 1TQDA 1GTL1 1WBJB 4GE3A 3NNNA 5ES4B 5I4IA 3AUYA 1GKUB 1NHWA 4QYMA 2Y66A 4ZZ0A 1M2FA 3AFHA 2EARA 2HK8A 4QDZA 3VVMA 1LU9A 1XTUA 3TL6A 1TYEB 2RB5A 1LNQA 2ATCA 5BV7A 4HUTA 4X85A 3OZCA 4DNQA 1QGDA 2CDCA 5C3UA 3V8QA 2Z6QA 5JG7A 4WY8A 4ZT3A 5HQ3A 5I9TA 4JLOA 2JGLA 3ROZA 3ZWMA 4YACA 2WHYA 3OCXA 1CJUC 1M75A 4FHZA 4OI2A 1MB4A 1FW6A 1KDOA 4FX5A 1OC4A 3STUA 3RKSA 4CETA 5FPYA 3X1MA 4B3TB 3G5TA 1DFIA 4K9KA 5LZ8A 1WL8A 3RROA 3EWSA 1MTZA 2H3EA 3HRKA 4JS0A 1T4CA 2KPOA 4NE9A 1BS1A 5JPDA 1PGJA 4KMMA 3E9DA 4Z9XA 2AQIA 3Q3HA 3ZX5A 1RZRD 3H2KA 4CMIA 2VHWA 4Z1OA 3KYJB 3FGNA 1NBAA 1R9NA 1R3DA 3GLSA 2BIFA 4IJKA 4KPEC 1F12A 2NZUG 2W2OA 3WMEA 1L4HA 5KEIA 1VMEA 1X1EA 1J5XA 2I4MA 2IUYA 2DBRA 2JFVA 2W48A 4WXMA 1E2IA 1N5IA 3VSAA 1A8IA 3GP8A 2ZVQX 3JD4A 4P4SB 2DHRA 3KQOA 1K6JA 3L9WA 4GD3Q 5HDQA 4M88A 3I73A 3Q41A 5E4JA 4NJOA 1DO8A 4UAGA 3JRNA 2C42A 3IBGA 1CRPA 4CKBB 2ZYTX 1K06A 3ZZ1A 1U8YA 4KAFA 1TEXA 3KZ1E 4IO0A 3HM9A 2CLCX 4H3SA 4B6QA 4PAMA 1VIDA 4M99A 2O23A 5B58C 2CJYA 3EE6A 1PJTA 3K0SA 1Z4QA 1PZFA 3R3SA 4RO0A 4J4BA 3O9MA 3NAMA 3OPQA 3C3KA 1RCTE 3C3MA 5ALHA 1RWWA 3E1GA 2EFDB 4UVDA 4ONEA 5KX5A 3TZLA 5CLJA 4X92A 1L4LA 2HWWA 3QUCA 5YASA 4QQKA 4JP1A 5FIUA 3SE7A 3VZSA 5JAHA 1GJRA 4UHFA 2FH5B 4D9JA 4HQKA 2IYOA 5F51A 2ZSUA 2GMWA 2Q4DA 2UZ1A 2XNCA 3PFBA 4V24A 2R7AA 1W581 3HDJA 3MUNA 4LBVA 4UMEA 2FFJA 3CSSA 2ZATA 1SPBS 3DXZA 1JIJA 2FE4A 3R6DA 5T3YA 5K8IA 5E7IA 5EKTA 3ZY4A 4JXXA 2WPDD 3AR8A 1AQUA 1UK8A 1Z13A 3BMNB 3I01M 2A5YB 2GLUA 4GC5A 4K40A 1U02A 3GFOA 1V11A 3MBOA 1SA0B 2PJDA 3L6EA 4CM1A 4U7FA 3FCEA 2WU1A 3ME5A 1EH5A 3ZE9A 1PV4A 4A0FA 4CV0A 4D46A 2ZSEA 3B9BA 2VP6A 2REOA 4RFSA 1IPFA 2IIVA 2JFHA 3WO1A 4D4JA 1F06A 2HYIC 3ZJUA 3GH3A 2JFWA 4P84A 1QZTA 5IT4A 2R65A 3ZNQA 4ZOBA 2PD3A 2QV0A 3FHOA 1DC3A 3UK0A 2QMQA 1QQAA 1NVXQ 3RVMA 1VHWA 2GO1A 1Z56C 1GGNA 1FTNA 1DARA 2PSSA 3VV2A 4WCDA 3GRAA 5EVJA 1FBNA 5FPSA 2QR5A 4RIGA 1GQQA 3EK2A 5EFZA 4GKAA 2PPLA 4INPA 4KNVA 3KS9A 3N1UA 4MWCA 1GZHB 1P0FA 2C7PA 3IODA 4O33A 4GPEA 2ZDGA 4TL7A 2PDAA 4OB8A 2WJGA 5DKFA 3CF2A 3L0BA 2BMWA 4S1VA 3AFIA 5B6IA 5AKKA 4J29A 1GFWA 5HE8A 4M9QA 2CVPA 4B45A 4L57A 2W2LA 1MG5A 1G7CA 4UNPA 2PH3A 1JGTA 4FFLA 1L4KA 2BGUA 5TB5A 3QPWA 1KKUA 2NADA 3KHTA 1TT5A 2I4TA 2H29A 2PXHA 2QN6A 3N8DA 1L7NA 3GEEA 1QK3A 1N57A 3RU3A 1JVSA 4EHIA 4M0KA 1JHXA 2B7CA 4JLSA 2OOKA 4OP1A 3QBTA 4YAIA 4MNTA 2YWCA 3LRXA 1XJCA 1J0AA 2P9ZA 3ZI4A 4N4AA 4O4IA 1X77A 2ODPA 2QUBA 4KH1A 2A1TR 2HBYA 1JIQA 3E7FA 4U9HS 2Y1DA 1GNPA 5D84A 1NP3A 2VWQA 1AHPA 3ZW7A 1PEDA 4HGOA 1OIVA 1V3QE 2H65A 5ELLA 3IQZA 4X84A 2R25B 4U7WA 3UC5A 1M34E 2V6GA 5MF6A 1C80A 4RTKA 5LM3A 2QPTA 1U0RA 3ZR4B 3I62A 3WLJA 1BJRE 1ATZA 3QUQA 1EDBA 4EB6A 4UTPA 2B36A 3R9IA 2FFAA 4NDAA 2P69A 3IV7A 2ODNA 5EJ9A 2QGZA 3CYFA 3L2OB 3HKEB 4TRJA 3F3YA 4A27A 2VK2A 5BOSB 16PKA 2HNBA 3T7IA 5EAIA 5K6RA 3JARB 1ABFA 1SB8A 2J6CA 4FKMA 1GTJ1 4XW2A 4GX2A 4IOLA 3FFAA 4NCIA 5TQ0A 3EQ9A 3ICEA 3SF8A 3IUMA 1OZ0A 3LHFA 1HYEA 2RGNA 1N2CA 3WFJA 3WIDA 1MJFA 3GLFB 1R50A 2IYTA 1R64A 4N3AA 3OURA 1WXDA 2WM2A 3G88A 4IXWA 4M1MA 1K1EA 1Q7RA 1PFKA 1U7UA 1V6AA 4M83A 4R2HA 3ZWQA 4B5KA 1V5EA 2QAGA 3S27A 1NG9A 1FFEA 4P33A 2E55A 3ZWKA 3GGSA 3W1VA 2B98A 2CHQA 1JHVA 1NOKA 4GI5A 2JJQA 4OATA 3AL0C 2FEPA 3HYTA 4YAGA 4R8SA 3RIGA 4RTLA 4IEIA 1J21A 1FDVA 4L4UA 1NF8A 4HDNA 2QMEA 4RV9A 1PK9A 3LX6A 3V2IA 4I6EA 1OFUA 1QNFA 2XZPA 5JVDB 3W6ZA 1KEKA 1P7WA 5IDVA 1DFHA 2GRAA 1O0SA 1FUIA 2WNHA 3FSEA 2YL2A 3K1TA 4KMSA 2V0GA 5A5FA 4RKRA 2JIZA 3ZGLA 2VTVA 1R15A 3IBSA 1YJBA 1BJKA 3E9RA 4CIAA 4ZWNA 2AR7A 2Y68A 1E1DA 3DF7A 1P2SA 5DPMA 4TV8F 4QHTA 3VM6A 5DHUA 1WG8A 2J3KA 3UJNA 3G2QA 1WR8A 5D3MA 2F62A 5DYGA 4BMYA 3WXBA 4DKJA 2XDWA 3LCUA 1LJUA 1OMOA 1U0EA 1EM6A 1UPAA 3VKFA 4OI4A 3BERA 3O5AA 3RM3A 3S2YA 2PUCA 4ZPXA 3HCFA 2C5GA 1V8PA 2YXBA 3CKMA 5DH9A 4BV8A 3KJZA 5IMSA 1L5FA 1S2DA 1ZMOA 2DMRA 5HCUA 2OBMA 2C9DA 1ZU5A 1MOPA 1ZD2P 3TNDA 3W9SA 4KIWA 5A0TA 2X5XA 1LS1A 2Z5FA 4DJFC 1YE8A 1K0FA 4I8XA 1E4EA 2V03A 1Z2PX 2OUKA 3LPDA 1N8SA 2GFHA 2WU8A 1N2BA 3HADA 4JL8A 1M2OA 2IPLA 3DTVD 5TR9A 2W6JD 1YS1X 1FMFA 1U3WA 3W7BA 1AQYA 3W8DA 5JECA 3BMOA 1YGPA 2H4ZA 2V65A 4QGGA 3UMYA 1YZTA 4Y2JA 5DNDA 2QN3A 4OU4A 3UA4A 5DNEA 2IPXA 1NA5A 3P97A 4YBRA 5H5JA 3H2JA 5CVTA 2QQGA 3ZDEA 2RBKA 3HHPA 2BGWA 1G2IA 4YR9A 1W4CA 4YRBA 4BZZA 2RI0A 2XMSA 4O2BF 4FEAA 1M2NA 1UOOA 4QUJA 4WMLA 3DEJA 3SYKA 3L4BC 5CFNA 1FS6A 2JFQA 1L2TA 3K7EA 2R60A 4EFKA 4HDCA 4OQFA 1QRAA 2JFUA 1ZYUA 4UE6A 1OI4A 5CFZA 1FYVA 1IATA 2WHPB 2B7BA 1E1CA 2ONZA 4RY9A 3HTXA 1WCXA 3C3BA 2GZ1A 3DLCA 4YP5A 2YY6A 3MHPA 5EZ6B 2CDRA 4HKTA 5FOSA 1TPYA 1EVJA 3AEZA 3PEUA 1B8NA 2O3JA 1C9YA 2CZQA 3IMGA 1CR1A 3BHIA 3OETA 2XSZD 2H7VA 2H11A 2QX8A 4TUYA 4WZAA 5A4KA 3Q9LA 2XWPA 4DRZA 1Z75A 3GCZA 2KMLA 2RHGB 3DR3A 3P96A 7REQB 3HU5A 3OUUA 1JI0A 3SZGA 1JEOA 2RHDA 2XQKA 4PLTA 3K0FA 3VPSA 3U49A 2YIVX 4HS4A 4IGKA 3D5TA 2R5FA 2C7GA 3HB9A 3QMMA 4Q47A 4D1YA 5KCZA 2PJRA 1RAHA 2FUNB 4JBWA 1GPDG 1OY1A 3HJRA 4JBLA 4A10A 3LC0A 3EH2A 2VRCD 4OO3A 5G2OA 3CNNA 3ZDBA 2O6HA 3AF0A 1E79A 2IE0A 2IYZA 3F0TA 3WDKA 1SU4A 2R9VA 3E9NA 5ALFA 2WWWA 4YWHA 3EULA 5CFRA 1HORA 1XTVA 3KO8A 5JXIA 2GEKA 2LXNA 2QT0A 3OQPA 1JR4A 5LU8A 4KR2A 1TA4A 3HJBA 1NFRA 2P7IA 5FUMA 1ODSA 2AR0A 1FCJA 1N33B 2N46A 3NKVA 4Z1MD 4L0MA 2YHIA 2FSSA 3TN7A 3OAAA 4Q9HA 4WZBE 3UKDA 4MRSA 3FNFA 4HX5A 4Y8VA 3FMGA 2HKIA 2QD1A 5K2OA 5CA0B 2H5IA 2WT4A 1Z68A 3M82A 3I5XA 1MHTA 1UIRA 2SHKA 3HLYA 3OX3A 2H2AA 3H2BA 3N7TA 4TTAA 2VP9A 1JWAB 3H3FA 5KSZA 1Z5UA 3DMTC 3H5TA 3LUJA 4S1WA 1NZFA 4A2PA 1HYGA 4NLLA 3USCS 1CR2A 1XDZA 2DR0A 5NULA 3COYA 1XMSA 3EZFA 2C99A 1DDGA 4OXIA 4YK7A 1ZXXA 1LBTA 2QVCA 2WFMA 4Z7NB 4BBJA 2BEJA 3DBOB 4MVJP 5FR1A 1S9HA 1NMSA 1T5HX 4HXYA 2VSFA 1EPUA 1OLOA 3MUOA 3RKUA 4OIFA 4PZUA 3E15A 4DR1B 4EKNB 2UVQA 1ECLA 1F6BA 2GN4A 1AZLA 2PX0A 1IBCA 4MR9A 4EMSA 2PQ2A 3LG2A 4WBXC 5DX8A 5CDTA 4GM1A 3ACCA 4IL5A 3JQBC 1FK8A 2JGJA 4IHAA 1JAIA 2F67A 3FBTA 1XCGB 1L7OA 1LV8A 3E6AA 1JZTA 4FC7A 3E9QA 4M0UA 3U1TA 5GJVC 2IE8A 3DEHA 2KSQA 3AJRA 2AX3A 4LJYA 5T4BA 1LFDB 2PLFA 4A6DA 1OFVA 3GUVA 4NPCA 4Q9LA 2KLHA 3H75A 4H3KB 3AVOA 1SBCA 2A4KA 4IGEA 4KIJA 4PYRA 1HUQA 2G06A 2OCBA 3PPWA 4JKOA 4R2KA 1IPEA 2J9GA 2H51A 4TXHA 4AJNA 5PNTA 2UU9B 3QOXA 2JZCA 5CFLA 1BU8A 1IHPA 5F2EA 3ZD9A 3E84A 3Q9NA 1KK1A 3FDFA 2NSLA 2PWBA 1EWKA 2IZ1A 3NHKA 1GRNA 3P1JA 3QXHA 4RWZA 3TX6A 2MTBA 3HXLA 3CR3C 1DQPA 3W2IA 1P9WA 1P18A 1TJ5A 2V59A 1JG4A 2Y8EA 3R3JA 4TZTA 4YRQA 4PG4A 2AA3A 1VQ1A 1YQTA 2I6QA 1KOFA 2G9UA 2MYUA 2PJUA 1NQWA 1QGOA 3EXEA 5I7FA 3PSAA 2G8LA 1TUGA 3WA7A 3AXSA 4MYDA 5JJBA 2VOJA 1U2GC 1IAQA 1ESDA 1OSNA 1DX6A 1WP9A 2FYTA 1Q7GA 1EGQA 1ZGZA 2OGTA 3OJLA 5CW2A 2ZJ0A 3RNOA 2XXBA 4U0JA 4ARIA 2FCRA 3BYZA 4MWBA 3OVMA 5D86A 4F56A 3OZBA 1HE1C 4EB0A 2ORYA 1O3YA 1ZVQA 1G291 3VR3D 2ACKA 2NUTB 2ENUA 3BILA 4EGAA 4EJFA 2CJWB 3OJFA 5D8DA 2VP4A 4BRWA 2C2MA 4CMEA 5CXQA 3S8EA 3ANTA 1VL5A 3CXUA 3OCWA 1UWKA 2FLKA 1IOLA 3VSCA 2GHIA 3KBBA 3KAQA 3C98A 1EX9A 2D13A 2PN1A 1LK5A 5A02A 1BDIA 1UK9A 4PLZA 2GPTA 3BTOA 4EJMA 1ULTA 5BWNA 4ALKA 1INLA 1MR3F 1NW9B 4O4JA 3WMGA 1MB3A 1GCAA 1PJ4A 3QX8A 4V0QA 4WNYA 4V39A 2GCEA 4MAFA 5CIWA 3E82A 5B3AA 2R00C 2H0RA 2X9VA 3GFSA 3IBFA 4URWR 1Z7YA 4WERA 3TMYA 3NTVA 1ZRMA 4WRRA 3PEVA 4FGSA 4Y2XA 4KXFB 2EL9A 1RKBA 1D7AA 2HXYA 3NOVA 3TTXA 4L1KA 5K03A 3BL5A 3V2HA 3ENWA 1CZRA 1TM2A 3AY3A 1VJDA 1L7XA 2VDVE 3GRVA 4ALNA 1E3EA 1DOZA 1TZCA 3HJTA 3H5OA 1O95A 3KL4A 4IH9A 4NSNA 1W0JA 1QFSA 2ZS7A 4FTWA 5KOJB 1JWLA 3FVQA 4KXMA 4WFQA 4XIIA 2CKMA 2ZK7A 4DR7B 3CT6A 4JB0A 3HJUA 1AGPA 5AOVA 2I7CA 2UYYA 4CF3A 3NPMA 3VR4H 4OHRA 3N05A 3ZY6A 5L3ZA 1P4HA 5JEEA 1O54A 1OWLA 4QSHA 3SIWA 2QE7D 2FW9A 4PCAA 1FB5A 2VT7A 3SSMA 3U4AA 2I7VA 4JI8B 3I5YA 1R8QA 3G8YA 1JSRA 1XG5A 4PGFA 4RA9A 2Q9CA 3CR7A 1YBMA 1Z8HA 4UATA 3CZAA 3QX3A 3WIUA 4R2LA 2NO4A 5AHWA 2ZXUA 4S05A 2XD4A 3JQ7A 4AY2A 3DGFC 4X20B 2NUAB 5K8JB 3O2QB 3H65A 2UZ3A 3A1VA 5AJWA 5HKAA 1YGYA 1CV2A 1NIPA 1VKZA 1V0JA 1MX9A 2ZYHA 3R3UA 1UPTA 3DNPA 1KC1A 3T7TA 1IZ9A 1TMKA 2QRVB 4DLPA 2BZSA 3EVAA 2GZSA 5CYFA 4TOIA 1XZLA 3UXHA 4EITA 1ZIXA 2V7EA 1OWMA 1Z0SA 4MA5A 4NMWA 4U2CA 3QSGA 5DGHA 3RHZA 1B2LA 4KO1S 4J1TC 4ZU1X 1LB1B 1M8GA 1PQWA 4KUEA 4CLRB 5IW8A 1VCOA 4I50A 4RGBA 3E05A 2XWSA 1DJNA 2QRJA 5GM2A 3GNSA 4UARA 5CDFE 5IK2D 3SP1A 1WXWA 1L5ZA 4EG3A 3TQRA 2FWRA 3PI6A 1L4FA 4E51A 3O4IA 4KGVA 5HFAA 5IJ0A 1Q1QA 1E0SA 1O7JA 1Z7BA 2C29D 1W0KA 3QBEA 4B47A 2O4CA 2KLBA 2C95A 3ESBA 3RWMB 2AN5A 3UC9A 4KU4A 1K68A 1UJNA 2JEYA 1D9ZA 2WIGA 4Y0NA 5HILA 1SEVA 3LC1O 2PX2A 4G0YA 2VQSA 4QRHA 1CY4A 1SIBE 4BKQA 2BTQB 1Z12A 3G2HA 2Z04A 4QOSA 3S1AA 3KJHA 4BLWA 4CTMA 4HBZA 3AUSA 4JBIA 3QHAA 3AF5A 3PFWO 5G41A 1XLTA 3L7BA 3SMQA 3GMSA 5FUBA 4ZK6A 2AN9A 2JLSA 4GM4A 1BDMA 1WUHS 3EJ6A 1PWEA 1CUJA 1XPJA 2HBQA 2HWYA 5DB4A 4I3FA 1HDEA 1YCFA 3R0ZA 3L0DA 4RXUA 2GCPA 3CRQA 3OD1A 3OQIA 4PC2A 2FN7A 1Y89A 4PPYA 1N25A 2BC9A 1WCV1 2Q5OA 5B1DA 3W5DA 2MIIA 1E9AA 4AJHA 1PUJA 3REQB 4RD4A 1IZ8A 1CR0A 1LBSA 2QL9A 1TDJA 4PO1A 1RKXA 3T0IA 5JYCA 5DW0A 3KEOA 4LSWA 2XCSB 2CT8A 2QMOA 5G0VA 3IAXA 1O08A 4NJMB 1DRUA 2F9FA 4HEQA 1N5DA 1PR5A 3HHEA 3SX0A 1G7RA 2C4UA 4ITRC 5EZYF 4NBVA 2P40A 2GCIA 1LPSA 1MLDA 3WV4A 3WJAA 4PO8A 1G4AE 1U5BB 4FKZA 2CMFA 3EGDB 4FR2A 1R6TA 1MT3A 2AJCA 3LKVA 3Q0EA 4RFLA 3WWYA 1Z18A 3WYGA 1C1HA 1TFUA 2LV8A 1S7CA 1Y3HA 2Q5FA 2IHYA 3EMKA 5AHOA 3ZZMA 1QAQA 4DILA 3JTEA 3GA0A 5IFLA 2QRPA 1M3SA 3MG9A 5JVDF 5JADA 1CWUA 3ZBPA 1NMQA 4XDYA 4DADA 1MUUA 5JZSA 1Z4JA 4BMDA 1RLTA 4HPXB 3RO7A 4Q9DA 4BGVA 5BSMA 3WRWA 3WGUA 4K9LA 3QEOA 4NCAA 2F59A 1OYOA 4QUIA 4UBLA 3VJLA 2RJ3A 4X63A 1MC5A 1VTKA 4D96A 3NC4A 4DZTA 1D2AA 1I33A 4TVBA 1HLDA 4EH1A 5IH3A 4TV8A 2JJ8A 5DSZA 4KTTE 1Z25A 3UQYS 4Q02A 2X0JA 1P61B 1ODLA 1SRRA 2YXNA 3NORA 4BX2A 1POXA 2I65A 2JGAA 2BBWA 3GFTA 2VT6A 1XQVA 5FHQA 5FI5A 2RI1A 2H6EA 2P4SA 1QPGA 3HDVA 4U5XA 5HBRA 3V8EA 4C4AA 1Q50A 4CDNA 5A7FA 1CZUA 2WJAA 3IVAA 3CUYA 1VL0A 2RGEA 1KEZA 3IX7A 1XZAA 3BQ9A 2ZXEA 4MW0A 2A6PA 1UBJS 1UM9A 3OPMA 3SM9A 2VWGA 2IGBA 1FP7A 1Y9ZA 2IYRA 2MDTA 4JENA 4JQZA 3TNJA 4HUQA 5KVSA 2XXAB 3B1YA 3EFOA 1MVLA 2OG1A 2WWXA 5FTMA 5EWJB 1BX0A 1E8DA 5AXCA 1G2PA 4ED9A 1L0BA 1ZAKA 3QLEA 5EPEA 2JGRA 4HXFB 1C4OA 1ZM2A 3BWVA 1Y9AA 3GROA 4JWTA 1S1CA 2RHJA 2CXHA 1H8ED 2NVBA 1TVCA 3PEWA 1C30B 2EWMA 1J0BA 2GAFA 4RH1A 4PTYA 3BWDD 3EEOA 1X13A 2WBLC 3GAMA 4NF2A 4HDKA 4XGKA 1BHSA 1P62B 1XDGA 2Q3HA 4LQ4A 4O2BA 3WYNA 5KC8A 3PTZA 4I08A 2GN8A 1K7EB 3RADC 2JCVA 4LVUA 1US8A 2I4OA 1NNI1 1PG5A 1V71A 1XVTA 4WOCA 4EMUA 3BREA 2DKOA 4P9NA 1MPTA 2QLBA 3ROFA 1AY0A 5BQ5A 3WHIA 1QCYA 4TKVA 1SELA 3IPAA 2WDZA 1D8TA 3GJYA 4YT8A 3EZ2A 5IXSA 5I5GA 4L5JA 3F9RA 1WXHA 1WUTA 4YUVA 5TVGA 5BSHA 5I8PA 3EA0A 3HDQA 1QDLB 1CVLA 4LDPA 4QU5A 4KRYA 3AUUA 2J0UB 2YXEA 1OV6A 3FBWA 5AKHA 4CKXA 4YDQA 2WTNA 3P0EA 1N9KA 2PR2A 3KUCA 3WP1B 1MABB 2ZVPX 2G25A 2B9EA 4X1YB 1XWWA 5FBWB 5B30A 3TJMA 3WR5A 3GZNA 4B9AA 1T2VA 2AFRA 2Z2XA 3CLVA 2XCQA 4CMJA 5I7VA 1LZLA 3VO1A 3F3MA 5IU6A 4CMCA 1X7ZA 3NDPA 1U99A 4DSUA 4QFMA 2PZKA 2BM8A 4Y2TA 5FPPA 1Q7BA 2V6IA 4LWQA 2FRXA 5EGSA 4NCBA 1WZCA 2WJPA 1U0FA 2WUGA 2XDQA 3FCCA 4AP5A 5HRCA 3QVGB 4HS9A 5ALRA 2VWPA 3ROXA 4ZJUA 1CUYA 3PT9A 1KI8A 1SNYA 3DTNA 3EGXB 4Q3AA 5JCJD 5JNWA 2HNAA 3V3TA 1OWNA 3L8MA 2REQA 2ORED 3AB7A 1BCSA 1XX6A 3O47A 5EWMB 4UNIA 4ALLA 4C7BA 3NW9A 4OGFA 4FOOA 3OPYI 2AEFA 2ZIEA 2OORA 1Y63A 4UNSA 3WGTA 4KVFA 3J81A 1XCJA 4L85A 1EJBA 1A9TA 3HB4X 2I3BA 3LXUX 4L5CA 1T8RA 4RVNA 2C98A 3WRVA 4BIIA 3AVXA 2OP0A 1R0ZA 3M89A 5BT9A