1PEDA

Bacterial secondary alcohol dehydrogenase (apo-form)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
351
structure length
351
Chain Sequence
MKGFAMLGINKLGWIEKERPVAGSYDAIVRPLAVSPCTSDIHTVFEGALGDRKNMILGHEAVGEVVEVGSEVKDFKPGDRVIVPCTTPDWRSLEVQAGFQQHSNGMLAGWKFSNFKDGVFGEYFHVNDADMNLAILPKDMPLENAVMITDMMTTGFHGAELADIQMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKNGHIVDQVMKLTNGKGVDRVIMAGGGSETLSQAVSMVKPGGIISNINYHGSGDALLIPRVEWGCGMAHKTIKGGLCPGGRLRAEMLRDMVVYNRVDLSKLVTHVYHGFDHIEEALLLMKDKPKDLIKAVVIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystalline alcohol dehydrogenases from the mesophilic bacterium Clostridium beijerinckii and the thermophilic bacterium Thermoanaerobium brockii: preparation, characterization and molecular symmetry.
pubmed doi rcsb
source organism Clostridium beijerinckii
molecule tags Oxidoreductase
molecule keywords NADP-DEPENDENT ALCOHOL DEHYDROGENASE
total genus 117
structure length 351
sequence length 351
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 1995-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pedA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1pedA01
4BNMA 1XQ1A 2EHDA 4J3FA 1ZSYA 1PS9A 4CQMD 4PLCA 1A4UA 4YT2A 2RBEA 4Z0PA 4OKNA 3GK3A 4FIZA 1FK8A 3DMYA 3D7LA 4RGBA 5JE8A 4HWKA 2J3HA 1ML3A 3H8VA 1IOLA 3E1KA 4R5HA 4CLRB 3VZRA 5ER6A 2O7SA 1KVQA 2EIHA 2PGDA 3KYCB 3W6ZA 1ZCJA 4P38A 1KYQA 3LK7A 4YJHB 5H83A 2HMSA 4ZHSA 2O2YA 3ZW8A 4NBWA 4RDIA 1I2ZA 2P4HX 5DBGA 4UVEA 5KVSA 5T64A 2O23A 2VYND 3HN2A 3K30A 3VZQA 2W98A 3JQGA 3VDRA 3QWIA 1E7WA 4NPCA 2QQ5A 3U0BA 2WSBA 5H82A 2AQ8A 1LLQA 1H93A 1EQUA 3AOGA 4CMKA 3WTCA 3JD3A 4Q3BA 1NHGA 1XLTA 1GCUA 4CV0A 4YWJA 2IZ0A 5EJ2A 3K9QO 1YOVB 1FDWA 1PR3A 2JCXA 2C29D 1TT7A 1ISMA 1SEPA 5KCZA 2BGMA 3LLVA 1ZZEA 3L4BA 4RVFA 3WOHA 1DXYA 4CMEC 4HFNA 2D59A 3B20A 3ZWCA 4WKGA 2Y0EA 1UXHA 2J8ZA 3TQHA 5B12A 1YOVA 5F1OA 1I0ZA 5JCJD 2NV6A 1HSOA 1NVGA 3BAZA 3PZBA 3RJ9A 1SB9A 5HA5A 1Z82A 4J91A 4JLWA 5G4KA 4OXYA 1HEUA 2Q1SA 1B3BA 2HSDA 4MINA 4S1VA 3C1AA 5DULA 3ZV4A 1YL7A 4RJTA 1F8FA 4P4NA 3Q3CA 2WD8A 2PGLA 4J1SA 1PJ4A 3IOYA 1SMKA 2GDZA 4PZDA 3KRTA 4FFOA 4LSWA 4C7KA 1R6DA 5A1TA 3EK2A 3AM4A 1BGVA 4JJIA 4Z9XA 3WB9A 2O3UA 2BGLA 2UAGA 2YDYA 3U4DA 1GU7A 4QFCA 4LK3A 5IXSA 1D3AA 2G0TA 4UVIA 3RFXA 4W99A 4WASA 1D7OA 2J3JA 5H81A 3H9JA 1WAMA 1DRVA 5BSFA 2ZTVA 1LTHR 4CLXA 1XA0A 1O9BA 4TVOA 3VTFA 4J1QA 3GR6A 2OBYA 1EUDA 4O6VA 5COAA 3L6OO 3CINA 4YQYA 1AGNA 3W8EA 5K6AC 2EEZA 3DHYA 4IDCA 4IIVA 2A94A 4YRDA 5FF9A 3H5RA 4UEOA 1YB1A 1T25A 1MV8A 4ITUA 5KJCA 1P1RA 1K0UA 1GADO 4CL3A 1ZK1A 4MOWA 3BMCA 3QVSA 3ZV5A 1TVEA 5GMOA 5THKA 1VKOA 2FZWA 5AOVA 2OBNA 4R3WA 1L7DA 2RH8A 1HDRA 4DQVA 2JAPA 5KJ6A 5DT9A 1LX6A 2TMDA 2X0IA 3JYPA 2WWRA 1DJNA 4BO2A 4R1UA 3RUCA 3OBBA 3OEWA 3TL2A 3W8FA 3G49A 3I4CA 1E7YA 1GEGA 3NT5A 4W6ZA 4DRYA 1HYGA 3AOEA 4LGVA 3TOZA 1HE4A 4ZU3A 4RQUA 1E6EA 1I10A 5C3MA 4IMPA 3VPHA 4G81A 4CV3A 1HETA 2ZJ1A 4WCDA 1H5QA 4RVSA 1T4BA 1B16A 1JQBA 3PQFA 4KUHA 4H3VA 2G17A 3SXPA 1U5CA 3S2FA 4XEHA 4DMLA 1ZKMA 3WWYA 2C54A 3S55A 5CEEA 4NK5A 2YHIA 2YHUA 1C1XB 5F1KA 4AJLA 5A04A 2HK9A 1PR9A 2EP5A 3W4IA 3CZRA 2HRZA 4TRJA 4XWYA 4UUNA 1GZ6A 3RBVA 2IZ1A 3V2HA 1HDYA 1KY5A 4HNHA 4E21A 3D0OA 2BFPA 3WQSB 4E5NA 2QIOA 5JMWA 2HMTA 1H94A 3N58A 4ZQFA 1U4SA 1HDGO 5BNFA 3NGLA 2VHYA 4BV8A 4B3IA 3LF2A 2B5VA 4D79A 1SBYA 4MVJM 4FB5A 3BHMA 3HWRA 1U5AA 4G2NA 2IDZA 5MDHA 4IGFA 4FGSA 4RPHA 3TN7A 1RM3A 1K89A 3AUSA 3PHGA 1Y8QB 1QRRA 4OM8A 4CLHA 3FI9A 4RF2A 3VH2A 1N9GB 1I36A 2EF1A 2Z1NA 5ER9A 2NVUB 2BD0A 5ICMA 5L51A 3ANLA 3JQAD 4OKIA 2VYVA 4D44A 3MJVA 3RJ5A 5JO9A 4PG4A 4TSKA 3JCZA 2RCYA 4JBGA 4RDHA 1LSOA 3GFBA 5B4VA 3IIEA 5DP2A 3CSDA 4L75A 5TRTA 4ZGWA 1DC6A 3WX0A 4BO7A 1DO8A 1ONNA 3K31A 4JIGA 2VCYA 1CIVA 5K1SA 1QMGA 1EE9A 1NPTO 2VRBA 4ND2A 1DIRA 1T2EA 4EJ6A 3C24A 1MG0A 1ADCA 5CAEA 3GH3A 1VM6A 4IJWA 1ZMOA 3MOIA 1A9ZA 3SX2A 4FFRA 4XJSA 4XYBA 4KDEA 3K2EA 1D1SA 2DKNA 4XJTA 3HADA 3DBHA 4DPLA 1VKNA 3I9KA 3KBOA 3MWEB 2FR0A 3DTYA 3MJEA 4ZQBA 3JYLA 1CETA 3DAGA 3H9UA 2UDPA 3FN4A 4Q3EA 1OI7A 5DZSA 1T26A 3MOGA 5LDGA 3LVFO 4BO0A 4QQRA 2GUGA 1NQOA 4XKJA 1LA2A 3AFNA 3WNQA 2EV9A 4IXWA 4JP2A 3PEFA 4NNJA 3TJRA 3TZKA 1ISHA 2QX7A 4A0SA 1XELA 1PJQA 1E6WA 1ZEJA 1T2CA 1GZ3A 4NDNE 1F0YA 1U28A 1ZK4A 5JBIA 2GLXA 4OSOA 1WWKA 2VTDA 1VE9A 1WXDA 3LYLA 4CLEA 1NQTA 1OFGA 1X7HA 3RWBA 2ZTUA 4M1QA 2YY7A 3AI3A 1B2LA 1KC1A 2P9CA 4W9NA 3T4EA 4FR5A 2O3QA 3PTZA 1LDYA 1MXHA 1KC3A 5AVOA 3CZMA 4LSMA 1HTBA 4E12A 3WGOA 3RUHA 5CDUA 3ZGYA 1J6UA 4IS2A 1W0CA 1JN0A 5COBA 4BNUA 1HDXA 4TRNA 3EYWA 3LT2A 5A3JA 4MKZA 4HADA 1DFGA 3PLRA 4IY1A 4AJPA 4JGBA 1XKQA 5KVVA 2I66A 4WNCA 2BI8A 3PJDA 1LLUA 1E3SA 3H5AA 1T1SA 3QVXA 1LQUA 4RCVA 4OHUA 3RD5A 3GGPA 3E5MA 4IGEA 4AJ1A 1KEWA 4E5MA 3ITKA 2LDXA 4WGGA 5TJHA 3ZNPA 3W8DA 5JS6A 3VPSA 4N5LA 4DGSA 1K6XA 4CJXA 4BNNA 4H15A 3UCEA 1LC3A 4R9SA 3PDUA 3OQBA 3AJRA 2QG4A 3K92A 3RIHA 1KVRA 2BFMA 1RM0A 4UULA 4CM8A 2RH4A 5JYDA 3DONA 3I9JA 1B26A 4J7CA 2VHZA 5ENVA 1I3KA 1EFKA 5T57A 4L74A 2VHVA 1VL8A 2DTDA 4NK4A 3JD1A 3RCBA 4DL9A 4D3DA 3FSRA 3B1KA 3EVTA 3ST7A 3D5QA 2ILTA 1DC5A 3G3EA 1PQUA 2WE7A 3H9EO 4FCCA 1E1NA 4ZQHA 1YS4A 5KKAA 3RUFA 5A4DA 5L4SA 1XDWA 5JPIA 5IZCC 2ZB4A 4BUCA 1YDEA 1PIWA 3INGA 5GY7A 4KQWA 4B3HA 1M76A 3AU8A 2FPGA 4LMPA 3UF0A 4E6PA 1VPDA 1YB5A 4OSPA 4I08A 1MB4A 3NTRA 3SBOA 2FP4A 4E3ZA 4ND4A 4PLHA 3HDHA 3U62A 3LF1A 4GX0A 5GZ3A 3PHJA 4K9DA 1NM5A 2HCTA 5CG2A 1YXMA 2EKPA 4YACA 1P44A 4JP3A 4PG5A 3EHEA 4I5EA 1XU9A 4R3NA 3G79A 1P0FA 4WLNA 3TL3A 2PKRA 4XYMA 3WMWA 2Q2VA 2X7HA 2I67A 2I65A 1HWYA 2VTEA 4PG6A 3OJFA 3Q6IA 4BNZA 1H6BA 2AHRA 1M6HA 1ENYA 2W4QA 5CEFA 2FRDA 4FJ1A 1J0XO 4N5NA 3V2GA 5ILGA 1GYRA 4E13A 3HE3A 5AXAA 4OJNA 1NR7A 3H65A 3MJSA 4MPDA 2B4QA 4Z3DA 1A9YA 2X5OA 4CM3A 3B6ZA 1CDOA 3F1LA 1PQPA 2Y1CA 2NADA 2PGJA 3KLPX 4GLLA 4RZHA 3RFTA 3O8QA 1J49A 1P0CA 2NQTA 4FFLA 3GNTA 4O5OA 3MJCA 3R3JA 1DIGA 4DLLA 4QECA 2R2GA 4RQTA 4HY3A 1QV6A 1DEHA 4XGIA 2VRCD 4HKTA 3E9MA 3OA2A 1RWBA 5JAMA 3JQAB 1UZMA 1EVIA 1HXHA 3OQ6A 5CHEA 4J9UE 4WLUA 1RM4A 2IEDA 3HHPA 1HDOA 3AY7A 4B8ZA 1IHXA 1H0KA 4YJFB 1GV1A 1XG5A 2DLDA 3RU7A 3BIOA 1E5QA 4L8VA 4LCEA 4E2ZA 1VRWA 3DZKA 3ON5A 4MVJE 3AWDA 2EKLA 3MJTA 2ZKLA 2BKAA 1M67A 1MUUA 3OJLA 3PPIA 4IDBA 4K26A 5DDIP 5JC1A 2Q4EA 1U4OA 3JSAA 4YXFA 4EUFA 1HE5A 3H9GA 3QJ5A 1ENPA 1NASA 1T2FA 2O3JA 3KYCA 5IF3A 3BTVA 2AEJA 1ZMTA 2EJVA 3L6DA 1K2WA 5COQA 2A9FA 4KQXA 1KIFA 1Z7EA 4B4UA 1Q0HA 1JTVA 4DVJA 4YQZA 2NLOA 1UDBA 4EJ0A 1A71A 2AEFA 4R54A 5G4LA 1IZ0A 5BSHA 3GFGA 2WYUA 2VYVD 2PFGA 5ADHA 3FCOA 1L1FA 2ZYDA 1X14A 2CMDA 2CZCA 1QYXA 2X8LA 4Q3NA 1BRMA 3BHJA 2X4GA 5FFFA 5CPFA 4YJGA 1E7MA 5I8ZA 1ZH8A 4DPMA 1NAHA 4XIJA 2PD6A 3TZQA 3MEQA 2DFVA 3QHAA 4URFA 4QTZA 4QXMA 1NYTA 1E3WA 3JQ8A 2V6BA 3NEPX 3UCXA 1B14A 3VVBA 2GNAA 1IY8A 4L0QA 1X1EA 3DAFA 4EITA 1DJQA 1PWZA 1U7TA 2G5CA 3UOGA 3C3XA 3ZHBA 1KEPA 3JQDA 3P2OA 4PLWA 3OIFA 4E33A 2B36A 5TLSA 1D1TA 2YV3A 3ZNOA 3H9QA 4WOJA 3JTMA 4CMBA 3AOEC 5JW6A 1NR1A 2R00C 4E0BA 2Q2QA 1SEVA 2EGHA 4KUEA 4MIEA 2GF2A 2WYVA 1TT5A 2I99A 3GVIA 4IINA 2FSVA 3A9WA 4RLSA 1JWBB 1KBZA 3SJUA 3F3SA 2OHXA 5FWNA 1LI4A 1U3UA 5CFZA 5TNXA 3DBRB 3PWZA 1LXCA 1Y8QA 3DBLA 1HKUA 2JKVA 3QVWA 4RVDA 6ADHA 1QP8A 1ZXBA 4O1MA 3ASVA 3FTNA 4EDFA 3FD8A 2O4CA 4FFPA 1LRJA 5L53A 1R0SA 2Q49A 1C0KA 3KO8A 2HJRA 4U5QA 3VZPA 3ZV6A 2DPHA 3JQBC 4W4TA 3D4NA 5L4NA 1O0SA 2YYYA 5IN4A 1A27A 1LRLA 1O94A 3DDNA 5F21A 3AM3A 2FZEA 5BSGA 1MFPA 3HZZA 3JYQA 4XB1A 4W7HA 4BMNA 3DXFA 4MVJI 1QLHA 4OQYA 4ZQEA 4J1TA 4PRLA 4BO6A 3F9IA 1DIBA 2BFAA 3GPDG 5FI3A 2C82A 3Q1LA 2VOEA 3ROQA 1KVSA 3CMMA 1VC2A 1A72A 1F14A 3KZVA 3HB4X 2JFFA 4EW6A 4YJGB 4H7PA 3LU1A 1JAXA 1NBOA 4Y8VA 5KJEA 4WEQA 1V3UA 2AA3A 3W4JA 2C5AA 4BL5A 5JAZA 3RC2A 3TFOA 5KWEA 5IAAA 4OGWA 2P9EA 3T7CA 1QKIA 3OF2A 1IZ9A 4DBVO 5LDHA 1KVUA 5ITWA 3OJ0A 2Z95A 4U6QA 5KOIA 1TEHA 5DCUA 4KMSA 1EQ2A 1JVBA 4FSHA 5C37A 3GQVA 1EFLA 5F1PA 4YVFA 3WDSA 5JY1A 4AG3A 3E5RA 4FS3A 2P9GA 4IDDA 4U8GA 2ZCVA 4PVCA 4GGOA 2IYOA 4GMFA 2VWHA 3AY3A 4CQLA 3Q0EA 4FQ8A 4BGIA 3DWFA 1DIHA 2NSDA 1RYDA 1S6YA 2C0CA 2XPCA 1E92A 1P1IA 1QLJA 4IDFA 3WR5A 5A9RA 3ZWYA 3NTOA 1BXZA 4D0SA 2BRUA 2O2SA 1P9LA 3SVTA 3QE3A 1LSUA 4RLHA 1Z7BA 4RV9A 4EUHA 5IDWA 2ET6A 1EMDA 4UVGA 4FD3A 2WDZA 2X9NA 3EZYA 1WDMA 1G6KA 4A03A 4NMHA 1UXKA 3L4BC 5CDYA 2Y0DA 3G0OA 5TX7A 1GPJA 2ZQZA 1TA4A 2AMFA 1YJQA 3PQDA 5C7LO 5L7YA 4A26A 3EDMA 2O4UX 3GUYA 2UVDA 1EUCA 3F6YA 1C14A 4IDGA 1DBVO 2X0RA 3NT4A 3B1JA 5CDTA 4XGKA 1YQXA 3IDSA 5B4UA 3AW9A 1PJ2A 4NQZA 1N7HA 4WE3A 2JD0A 2B4RO 3FBTA 3U09A 1QYVA 3C7DB 3DR3A 4BNGA 2I3GA 1PJTA 3FR7A 1YB4A 1GUFA 1EDOA 1YE3A 1EBUA 1H2HA 1PZEA 2D4AA 4IM7A 4J4TA 4B8WA 1YRLA 1XU7A 4J1NA 4O0LA 3ADPA 1ONOA 3ANNA 4N54A 4OOFA 4Z9FA 3ROMA 1OC2A 4OIMA 3ZCXA 3HDQA 2D3TA 5A9TA 2PKQO 4NIMA 1UP7A 2FPPA 1BMDA 4MVJP 3EW7A 3JD0A 4IQ8A 4JXKA 3RBXA 3E9NA 3ZNQA 4DMMA 2OP1A 2Q50A 4FW8A 4J4HA 4TRMA 2DBRA 4A27A 2DPGA 4MP6A 4XCVA 1H6CA 3TZCA 2ZIZA 5TIIA 1Z6ZA 4CM7A 1HLPA 1L7EA 4TZKA 3U9LA 5JYEA 2Y05A 3ZHXA 3AUUA 3A14A 3DQPA 1RYEA 4LISA 2LDBA 3JYOA 3HJAA 2ZQYA 2HAEA 3DAPA 4ID9A 4IZIA 3STHA 4AJ2A 2NU6A 3WNVA 3D4PA 3T7EA 1JLLA 4J9VA 4D45A 2D8AA 2PZMA 3LC7O 3DB2A 4NHEA 1U8FO 1AXEA 5CDGA 4IQ0A 4DYVA 1B8UA 3G17A 5BT9A 1Y1PA 1HE2A 3ONEA 1LC0A 2XF8A 3EUWA 1YGYA 4YCAA 3A4VA 1H6DA 2PR2A 2W2LD 3C1OA 3QA9A 4CMIA 3A06A 4CR6A 1YDWA 1ULUA 4JBHA 1FDSA 1SCUA 1LLDA 5JNLA 4IXTA 3S1LA 2OORA 3BYZA 1JDJA 2VNAA 2GSDA 1ZO8A 4KWHA 1U2GA 1YONA 3OQ1A 4OO3A 2AQHA 3ULKA 3VHRA 4AVYA 4ALNA 1TI7A 2QZ9A 3ITDA 4OOEA 1NWCA 1K3TA 4HX5A 1C0PA 5G0UA 2GYYA 4AJEA 2IRWA 3NT2A 1A7AA 4M54A 3QVOA 4DREA 2DTEA 3R3SA 1OZAA 4BNWA 3U4HA 5HM8A 3UGKA 1JKJA 4PLFA 5DCWA 4B4WA 3IUSA 2EP7A 2PH5A 2YFQA 3NTQA 1GYQA 2WM3A 2X86A 4IS3A 4N18A 1HL3A 4M89A 4BNLA 5K6AA 4UAGA 2VWPA 5JCJA 3JYNA 4ONEA 2FR8A 5EN4A 3RC7A 1U3TA 3M1AA 4WNIA 5BQFA 4PRKA 4XQCA 1GPDG 1ZSNA 3GRPA 3U4CA 4ILKA 5L45A 3DL2A 4ZA2A 5TSDA 1NFRA 3CTMA 3ZNNA 1RKXA 5A5EA 1NX6A 4LRSB 2HMUA 4OQZA 5FYDA 3F1KA 3GAFA 3PVZA 2PH3A 3BMNA 3VTZA 3LZ6A 5ITVA 4RO0A 4GX1A 3PRJA 1P31A 4KOAA 3ABIA 1XR3A 3BHIA 3JQFC 4BKOA 3GZNA 5A06A 1O8CA 4LVUA 1HF3A 3UICA 3IL2A 1QV7A 4XQGA 3C85A 5TGDA 4ZN6A 3GN1A 5EESA 3GZNB 4B4VA 4CMIB 1M2WA 4BS9A 3D64A 4CQMA 4BOYA 1ORRA 1NFQA 5A9SA 4YB8A 1JW9B 1UZLA 4E30A 3WBBA 2W2LA 1HSZA 2WD7A 1DLJA 4AJJA 4KP7A 3JD4A 3WS7A 5U4QA 5U9CA 3NUGA 3PJFA 4UEKA 1KVTA 3KHUA 2PZKA 3E48A 1QG6A 4ZQGA 3ZI0A 2X58A 3BTOA 4II3A 2X5KO 2FY8A 1R4NB 1CQIA 3HQ4O 4IMRA 3VPFA 4I9NA 1ADFA 5CP8A 1EK5A 2FHSA 3NDIA 1Q0LA 4N7RA 4BKPA 3WGZA 4FC6A 4BO4A 2J3KA 2VHWA 1JAYA 3AY6A 1E3LA 3QIVA 1GZ4A 3UKOA 1IB6A 5TQVA 1T1RA 1I33A 1E3EA 2V65A 3QW2A 2DVMA 5A03A 1N1EA 1P1JA 2DU8A 5AXDA 1XYGA 1C1XA 3WTBA 3WGHA 3AUAA 1HLDA 4NR0A 1KOLA 4B7CA 1AE1A 2X22A 2I6TA 3LT0A 3NDJA 1ENZA 3OHSX 3GG2A 4D43A 4W82A 4YT4A 2JD2A 4E2XA 4J49A 4ND5A 1LDGA 2G76A 4JCOA 1SOWA 5L95A 4RVGA 1P45A 3FWZA 4D3SA 4XYLA 4YAJA 1MA0A 4BNXA 1Y8RB 3JD2A 1IYZA 4DLAA 2Q3EA 3GLQA 4Q39A 3VH3A 4Q3CA 4AFNA 5L40A 3DOJA 2PY6A 1HDZA 4GGPA 2NVWA 3OIDA 3PWSA 5A3VA 4YEDA 1O89A 2HKIA 3BTUA 3RQSA 1E1LA 3GPIA 3GVCA 3ZWVA 4WPGA 4MIOA 3QWBA 4FGWA 4NZ9A 2DBQA 4AJOA 3PGJA 1W4ZA 3PGXA 1TXGA 5MGBA 5DOZA 1PX0A 4TKMA 1UAYA 2GD1O 3GRKA 3ONFA 1R0LA 1LLCA 3OMLA 4KZPA 3RROA 1MGOA 3KYDB 2EJWA 2H5LA 4FOSA 1IPEA 2R00A 3K73O 2Q99A 3UCFA 5AYVA 2X1HA 4CV2A 3VDQA 2Y1GA 1GL3A 4YPOA 1XEAA 4RL6A 4XB2A 3ZU5A 1ZJYA 3U4IA 3F4BA 2JL1A 1S7CA 4F46A 4QO7A 1DRUA 1WZIA 1Y5MA 3LC1O 5G2OA 1JVSA 5IG2A 1J4AA 1X7DA 5AQ1A 4MKXA 1FMCA 2VYNA 4ND1A 5IDQA 2B69A 4I8XA 5CG1A 2PA3A 3WQRA 4R1NA 3JQ9C 4DUPA 2VWQA 1U3VA 1IHYA 3INRA 1YWGO 3PIIA 3GN2A 2EW8A 5B1YA 3I1JA 2OXIA 3ZWNA 3FNEA 4NFYA 3NKLA 3PJEA 3H6KA 2ZJ0A 2OO5A 4CUJA 3DZHA 5THQA 5T5QA 4BKUA 1U7HA 1E1MA 2WJPA 1LDBA 1B8PA 4EBFA 3ZWMA 3WG9A 4YAGA 2WE8A 4JROA 1G0OA 2X9GA 3RUIA 1ZEMA 3NYWA 5JAQA 1K5HA 1PSDA 2VOJA 4RORA 4BB6A 4EZBA 4CM9D 3RASA 2ZB3A 3CKYA 3F47A 3WGIA 5KJFA 4JJFA 4U6SA 3NRCA 5CEJA 3NX4A 2W2KA 1DFIA 3ICCA 3A1NA 1GQYA 2ZYGA 3KTDA 3QQPA 4YYZA 1NHWA 2HJSA 3GHYA 4R1SA 1E7RA 1LDEA 3N74A 3DBLB 3E6AA 4BGVA 3BMQB 3KM0A 1YBAA 4P4GA 3FTPA 3NAQA 4DIOA 3C1TA 3LT1A 4RVHA 2VN8A 1Q2XA 1BXGA 1XHLA 3I9LA 4JBIA 2DBZA 5C5IA 4E5PA 4DWVA 1PTJA 2OZPA 2W8ZA 3IQDB 4CUZA 1VL6A 3L9WA 4CPDA 4AICA 4HUJA 4ZICA 2B37A 3SLGA 1U9JA 4J90A 3ROPA 3CUKA 4NFSA 1CWUA 3UAGA 2Z5LA 1U1IA 3WGGA 1U2DA 3WSVA 1E3JA 1JU9A 4Y67A 3WXBA 4WUVA 4CMHA 4ALIA 1WMBA 4E2WA 3F5QA 2EXXA 3QY9A 3DZFA 5JDIC 1B3RA 2F1KA 5JCXA 1WNTA 3IP3A 3TF5A 4IQGA 3U5TA 1P1HA 3H4VA 4O59O 3HB5X 3BZUA 4L9RA 4M87A 1PL8A 5JFOA 2FOIA 1MC5A 4MIYA 3MTJA 4IBOA 1ADBA 1PJ3A 2GZ1A 2Y99A 3CEAA 3I6QA 4Q3DA 4CV1A 4EUEA 1FXSA 1T4DA 4QFDA 1D4FA 1Y8RA 4BMSA 5IFLA 3X2FA 3OJEA 1SOVA 5TT1A 4OAQA 1E7SA 1LQTA 3QRWA 1UDAA 2HRBA 4YJDA 3TOXA 1WPQA 2O50A 3ZWXA 3PYXA 1QYCA 2OP0A 3FRJA 2HDHA 1R12A 2CF6A 3OICA 4U0JA 2UV8A 3KYBA 4JJGA 4PFJA 3GGGA 1GQQA 4J0FA 3I52A 2PWZA 2QZZA 3V2UA 1K6JA 5EIOA 4Z6KA 4NBUA 4PZEA 1BHSA 2Y1OA 4K6CA 4UUPA 3RU9A 4WLVA 3NGXA 3ROKA 3QWAA 4R41A 3IUPA 2YDXA 4MO2A 3BMOA 1FDTA 5JSFA 4GX5A 3FPLA 1Q1NA 3O38A 3P19A 4PG8A 5A05A 3E82A 1XWFA 2PV7A 3OIGA 4TVBA 1HT0A 1SNYA 4K28A 4N5MA 2O3SA 4PLZA 3WSWA 1WP4A 1DC3A 4GWKA 4DYDA 3LC2O 2DFDA 1M75A 4NJOA 3FWNA 4R69A 3HSKA 2CVZA 2VNSA 2BI7A 3HUDA 2DC1A 3RUEA 2X23A 8ADHA 1I5RA 1IULA 1R4MB 2P4QA 1KS9A 1N1GA 4ND3A 1T2DA 1EEHA 4HP8A 2PTGA 4CLOB 5ILOA 3JQAA 4NFHA 5ES3A 2EG9A 1ZVMA 3H7AA 3NV9A 4ALJA 4AJKA 3DEYX 3CXRA 3GVXA 2YV2A 3WICA 2IXBA 4GQAA 3RUDA 3GGOA 4GVLA 3EAGA 1GUYA 4NU5A 2POQX 3O8QB 5TT0A 3O4RA 5KNLA 4Z0TA 3ASUA 2BH9A 4INAA 3ZDFA 2Y0CA 4R01A 4XGNA 2FN7A 3INTA 2PNFA 2NQ8A 4IIUA 3FPCA 4NBTA 3GDGA 4IJKA 1BSVA 1PGQA 1ZJZA 3PHIA 2VZ8A 2DT5A 5DBFA 2DTXA 1X13A 1P1KA 1X15A 4RF3A 3EGOA 4WLFA 2CUKA 2B83A 8LDHA 2AXQA 1B8VA 1R37A 4TKLA 4XD2A 1GCOA 4FDAA 5JY6A 3TDKA 3GG9A 1MFZA 5L3ZA 3V1YA 1CERA 3UXYA 4F3YA 1LBEA 3DFZA 3WFIA 1PZGA 5G0SA 2IYPA 4IUYA 1E3IA 1E7QA 5JLAA 4XZ3A 3VPXA 4OXKA 4NBRA 2NU9A 3WGTA 4P4LA 4AJ4A 4ALKA 3V1TC 1YBMA 3H2ZA 3JQEA 1GV0A 4WJZA 4R9RA 1MX3A 3ZWWA 4BO5A 5JDCA 1RM5A 3GVPA 3PFWO 3GMDA 3Q11A 3PYMA 2NTVA 3KOUA 1R4NA 3RC9A 4UVHA 1FDUA 4J43A 4ZVVA 5C7IO 4E5YA 1PS0A 4DIBA 1Z75A 3KB6A 1ISFA 3RSHA 2GZ3A 4EYEA 3DO5A 2YHIB 2GN6A 3LQFA 1WMAA 2E6UX 3HNPA 3R0IA 1V3TA 3O9ZA 4DQXA 4G5HA 4M86A 2NWQA 2AE2A 2CD9A 4GKBA 2J5QA 4HV4A 1ISJA 5BNTA 1ZNQO 2GN8A 3EZLA 4DTIA 4OXNA 4CMJA 3PYLA 4GH5A 3JQCA 3ZU4A 3VZSA 1Q7GA 4L4SA 3GDOA 1V0JA 1NTOA 3PZRA 2I76A 1E1KA 1NVMB 3A28A 3F5SA 3PIDA 4CL8A 3I5MA 4Z9YA 5DBIA 5G0VA 3S2EA 5I7EA 2QW8A 2VHXA 1R16A 5ICSA 2I3AA 4YT5A 5K9ZA 4QO8A 3WWZA 4Z3KA 3P5SA 1DRWA 3K96A 3L4SO 4KWIA 3GVHA 3RFVA 3T4XA 2PD4A 4UUMA 4PCVA 5CPBA 1YQGA 3OECA 4J2HA 1TLTA 4R51A 2B35A 4X54A 4XYEA 3ANMA 1I3MA 4RF4A 4IPTA 1OAAA 5DP1A 4NU6A 3UW3A 4Z0HO 5JO0A 4RZIA 1LSJA 4BVAA 3ZHZA 1B0AA 2D5CA 3PQEA 4LMRA 4A10A 4CQLB 3ZW9A 1ZXLA 2J6IA 1KY4A 2GERA 2W2KB 2V6MA 5IDYA 1YBVA 4JX8A 2V6GA 3PI7A 1PGJA 2GZ2A 4ZRMA 1OC4A 2Q1TA 1C0IA 1F8GA 2OGUA 4TQGA 4K1LA 2CY0A 3CH6A 4MVJF 4MVJA 5HS6A 5ENDA 1MP0A 3GMSA 3RUAA 3D3WB 3ICPA 4R4JA 3CE6A 4P22A 4WEOA 1E77A 4QX6A 1I3NA 4EEXA 3UH1A 1YL6A 1BTOA 4KTTE 4L4RA 1NQAO 1EVZA 1ULSA 3L6EA 2P5UA 4D7AA 2XXBA 4BO9A 1LRKA 1N5DA 5G0WA 7MDHA 5DN9A 1E3WB 1PGOA 1V35A 3S2IA 5F5NA 1DAPA 1CYDA 1DIAA 1HDCA 4FFMA 4YDRA 4Y98A 4Q3AA 1DDOA 3LDHA 4GAEA 2D2IA 3DC2A 4E31A 4P8RA 2FR1A 2CDBA 3DTTA 4M49A 3MWDB 1QYDA 1FDVA 4QUKA 1O5IA 4YJFA 3I9OA 5DF1A 5A5FA 4A2CA 4CLOA 2NTJA 2FWMX 2HMVA 1IPFA 4WOKA 5FI5A 2O3TA 3KEOA 1FF9A 2VUTA 4PG7A 4GWGA 4BNYA 5EINA 2E37A 1F12A 1EE2A 3DBHB 4FJ0A 5KIAA 1OBFO 3JQ7A 2AQIA 1YQDA 1E5LA 1H9AA 1YL5A 1YO6A 3QLJA 2P5YA 5BR7A 2YV1A 1NNUA 5EL0A 1V6AA 2IODA 4BNHA 1Y81A 4PLVA 4XR9A 4F45A 1DPGA 1UZNA 4DIFA 3H2SA 1EBFA 4PGFA 3IC5A 4HBGA 4TWRA 3DZIA 1F06A 3TSCA 4XX0A 4PLGA 1DLIA 1I2BA 2D1YA 1WW8A 2NTNA 3AUTA 3GF4A 3OH8A 3V1UA 4BB5A 2EKQA 2VUUA 3GEMA 4BNFA 1DOHA 3FBGA 4C7JA 4HXYA 4Y6RA 3UHAA 5BSEA 2PZLA 4J0EA 4OH1A 5T67A 3D4OA 4D42A 3VAZA 3OETA 1LNQA 1U3WA 2DQ4A 3I83A 1ID1A 3JQGB 1MLDA 2NACA 4EJMA 2P68A 4PLTA 4XYGA 5GZ6A 4RPGA 3UUWA 3Q2IA 2Y66A 1H9BA 2CDCA 2NNLD 4GL4A 4BV9A 3KETA 1D8AA 5TC4A 2JD1A 1I30A 4A73A 3HDYA 4EI2A 5AXBA 4D46A 2Q45A 3S8MA 1BW9A 1QORA 1IE3A 2E48A 2VT2A 4NI5A 1T2AA 3GOHA 1PJCA 4UREA 1UXJA 4XIYA 1M66A 2Q46A 4R5MA 5HWSA 4YA6A 3FNGA 1Z45A 1X1TA 2CVOA 4UUOA 6LDHA 3G1TA 3ADOA 1Y7TA 2RHCA 3AI2A 1LDNA 4BHTA 3IJPA 3WLFA 1EDZA 2GRAA 4LW8A 3RBZA 5L9AA 3BXXA 1TT5B 1BG6A 5G4KB 3QSGA 2IE0A 2A92A 4L4XA 5EERA 2EERA 2BELA 4FOOA 4WLOA 2C7VA 1MG5A 4OL9A 3RI3A 3WIDA 3SLKA 4WLEA 2J5KA 1B7GO 4U7WA 1N2SA 1X0VA 2FPIA 4O63O 4BNIA 1WLYA 4CM1A 3VH4A 3ENKA 4DLBA 5I7SA 4NJMA 5I9NA 3IJRA 5EPOA 1SO8A 1FJHA 1JA9A 4RVUA 4Y6PA 4CM4A 2X9VA 1ENOA 4MKRA 2DM6A 4GI2A 2I5PO 3AFMA 2RIRA 3Q9UA 3H3FA 2HU2A 2E49A 4E4YA 4XDZA 4EEZA 4JK3A 1MXFA 5I7VA 4R1TA 1MC4A 4R16A 1SB8A 4WECA 2BGKA 4MP3A 1N8KA 3BMNB 1DHTA 4MDHA 2GASA 2BMAA 4Y9DA 2YQ4A 4WCFB 3QP9A 4XR4A 2UUPA 1AN9A 1JKIA 2PK3A 2BLLA 3D3EA 2Y1DA 3W6UA 1GDHA 3IKTA 4GPD1 4XRGA 1I2CA 4AJNA 4R68A 3PDJA 1NQ5A 5KJ1A 3DHEA 4BO3A 3LSYA 5F3RA 4E2YA 2E82A 1AHHA 5I9MA 5L4LA 1XIVA 1R15A 2AQKA 3FNHA 4ZD6A 3DMTA 5K0ZA 4Y6SA 3HN7A 1Q0QA 5EQDA 3X2EA 1BW9B 1UXGA 2TMGA 3GHHA 1WDLA 4C4OA 1ZBQA 2RHRA 1UP4A 2B5WA 3DMTC 5U1PA 2BF7A 1WVGA 4CR7A 3M2TA 1Y9EA 2HQ1A 3WLEA 4HFMA 5FEUA 3E18A 3RKRA 3PFFA 2NU8A 2Y93A 2HMWA 2VUSA 4TMFA 5JMPA 1ZK3A 1GY8A 1PEDA 5IJZA 1ADGA 1AHIA 3TRIA 3O03A 4YAIA 3SEFA 2XAAA 4QT0A 1UDCA 1VSUA 1GFSA 1WDKA 4EGFA 3PK0A 4MP8A 5J23A 1BWSA 3F4LA 3WFJA 2RAFA 5L7WA 3GEGA 4ROSA 2HO5A 4KUGA 1PQWA 4IDAA 4MJLA 4TRRA 1C1DB 3TNLA 3ZZNA 1GD1O 1LUAA 4FC7A 4B7XA 2Y1EA 2H9IA 3H3JA 2E4AA 2OUIA 4DBZA 2WYWA 4I9UA 1CJCA 1NFFA 5TS3A 4AJHA 3FF4A 4CQMB 1E0DA 1EVYA 1C1DA 3BMOB 2GCGA 3ETGA 5IZCA 4RPLA 5G0TA 1YKFA 1DFHA 3CPSA 4PZCA 4B4OA 1HZZA 4J4BA 1XSEA 3W1VA 3EVNA 4YTEA 2O48X 1XGKA 4NH4A 1PS8A 4PVDA 4J16A 3VPGA 4CMEA 3WYBA 3D1LA 1XQ6A 2X5JO 2DUUA 3EMKA 3SC6A 1KERA 4IDEA 3UFXA 3WGQA 4GLOA 1ARZA 2HUNA 4BNKA 3IS3A 1DAOA 4KTVE 4DXHA 1SZJG 1R4MA 2GR9A 5IDXA 5CDSA 2WD7B 4MVJD 4F6LA 3GC6A 2C07A 1W6UA 5T6BA 2ZATA 1PWXA 1WZEA 1LJ8A 1F17A 1HRDA 5HRUA 4QSMA 3KYDA 1O95A 2WTBA 3VVCA 4CM9A 4DQUA 3JQ6A 4W9NC 2GGSA 1OMOA 1C3VA 1Y9AA 5HBRA 4B79A 3AK4A 4F6CA 5BNIA 3PHLA 1ISGA 2AE1A 1NPYA 4HNGA 4PIVA 1UAGA 3RVDA 5LC1A 4CLDA 3B1FA 3HFSA 2G82A 1Q7BA 2YFHA 4ZJUA 1ZIDA 3K2BA 1A4IA 2JFHA 2AG5A 3GDFA 3VKVA 4FPXA 3PLNA 5GZ1A 2AW5A 4GX2A 2ZB7A 4RPJA 1W73A 2YW9A 1EUZA 1IUKA 4LVCA 2C7GA 2C2YA 4Q9NA 1G0NA 1PGPA 2CSUA 2HK8A 3U49A 3GAZA 7ADHA 3WBFA 1NXQA 4PN3A 3AI1A 1KETA 1VLLA 3M1LA 3QVTA 4BIIA 2DUWA 1EK6A 2VRCA 3KLMX 3KVOA 4CR8A 4YR9A 1SC6A 2GN4A 2YJZA 1ZSVA 3BMCB 3UVEA 4WK6A 3ZWOA 2ZK7A 2VZ0A 4RPKA 5B37A 1Q7CA 2P2SA 4LCJA 4BQPA 5HS4A 4ALMA 5I7FA 1NPDA 3JV7A 1X0XA 1BXGB 2OOSA 3K8ZA 3TZ6A 5EMHA 3WYCA 5B4TA 1X7GA 1ZK2A 3WJAA 3BTSA 2H6EA 3NJ8A 1GTMA 3ZWAA 2HK7A 3WIEA 1JKFA 3S2GA 2JCYA 2CVQA 3MZ0A 5I8WA 4MVJG 2JCVA 2UUOA 1NP3A 3AM5A 1UP6A 1M6WA 2FMUA 3E03A 1PL6A 1CQJA 1GYPA 2JHGA 3I3OA 4YAKA 3DOOA 2DBVO 3HG7A 3L77A 2NUAA 2Y67A 4G65A 1LEHA 3C7CB 3VOSA 3KSDO 3ZWPA 4XQEA 3GZ4A 3NJ4A 2YUTA 3IAHA 1Y5RA 2IZZA 1CF2O 3KUXA 5T8KC 1G1AA 3W4KA 1PU2A 1O6ZA 2B4TO 1GUZA 5DNAA 1V9LA 5T8KA 4CMGA 3QV1A 5JDCC 3ZWBA 1K6IA 4NG5A 4BNVA 1Z74A 2R6JA 2VQ3A 2UYYA 4E32A 4U0KA 2IXAA 1T24A 4II2A 1VJTA 2O3RA 4CM4B 4XQ9A 4BO8A 2BFOA 4CM6A 1UH5A 2EW2A 4M8SA 2A4KA 2F00A 1HYEA 2VT3A 4L73A 1PJSA 4CMCA 2QHXA 2OL4A 3D5TA 2D0IA 3ORFA 3FNFA 1ZUD1 3UN1A 3I9NA 4BGUA 4DPKA 2JFGA 3BMQA 1I32A 1N9GA 5I9LA 3DHNA 1JWAB 1H2BA 2ZYAA 1NAIA 4XA8A 5TF4A 4GSKA 3TPCA 5JXWA 4D3FA 4I5DA 4B7UA 1LSSA 4IJUA 5LCXA 2QYSA 1I3LA 2SCUA 2JAHA 2X0JA 4FN4A 3TFQA 1GAEO 4BKRA 1H6AA 2ZCUA 1DC4A 4RF5A 4YRAA 2EGGA 3G1UA 1BVUA 1R66A 1NVTA 4WCFC 3OEYA 3LT4A 2J3IA 4J6FA 4JN6B 4BO1A 4YRBA 1VJ1A 3MJ4A 3SC4A 1GQ2A 4FFNA 4YJHA 1R0KA 3FR8A 3ZH2A 1YVEI 2J5RA 3SJ7A 1UUFA 3KV3O 3K6JA 3PWKA 1HYHA 3B70A 4MVJH 1V8BA 3PHHA 1DHRA 5A9SB 2QRJA 4GBJA 2XOXA 3OFSA 3KEQA 5KTKA 3HDJA 1EZ4A 3DBVO 2D5AA 1QSGA 1OOEA 2VWGA 3M6IA 2ZB8A 3AU9A 4CUKA 2C2XA 4BQRA 4J2OA 3ZHYA 1P77A 1CRWG 3V5NA 2CDAA 3E8XA 4A5OA 1KEUA 2Y1FA 4CODB 4OMUA 4I1IA 4ZRNA 3R6DA 1ZK0A 1QXSA 2QRKA 3NDRA 2ZTMA 3N7UA 4QEDA 4XDYA 4BGEA 3WMXA 4YBZA 4B3JA 5A02A 1UR5A 2WMDA 3QWHA 1AXGA 2NU7A 3TWOA 4YAEA 5AXCA 5DOVA 1TB4A 4CLRA 1RJWA 1P74A 4UEJA 4PLPA 2B0JA 3IMFA 3L0DA 3I9MA 1I8TA 2CF5A 3JQ8B 4IZHA 1VI2A 3I6IA 4LN1A 3GEDA 5JAIA 3COSA 3QWFA 1DB3A 3ZV3A 2GO1A 1ISIA 1IL0A 2Y68A 1SAYA 3DZBA 2JHFA 3O26A 4JNKA 3WQQA 1UXIA 5JDIA 2JJYA 4GKVA 1PGNA 4ESOA 3CIFA 3P2YA 4K6FA 5KKCA 3ETDA 2C5EA 2X6TA 2V6FA 1AUPA 4FJ2A 3JQ7B 5F5LA 1GEEA 4FBGA 4PLYA 1ZW1A 2V7PA 9LDBA 3ZN2A 3OM9A 4I9HA 4I5GA 4S3MA 4JQCA 2FSSA 3DZGA 3EY4A 1QYWA 2PKQP 1P3DA 1B15A 5TJ9A 1NWHA 4AJIA 4AL4A 1BDBA 4M55A 1PZHA 3JQFA 2W90A 2CNBA 3PXXA 3WJ7A 1LDMA 2C59A 3DFUA 1YH3A 4J7UA 3U3XA 1HZJA 3OP4A 1U8XX 3M2PA 3BA1A 1E6UA 3GNSA 2YQ5A 2ZTLA 3HFGA 2EWMA 2PLAA 4YT8A 1PJLA 2A35A 1CEQA 2H1SA 4D41A 3C8MA 4H16A 4UVDA 3Q2KA 4DC0A 1P33A 4CM5A 3ZU2A 3L07A 3ETEA 2NM0A 2OFPA 3VH1A 4ALLA 3GT0A 3RAJA 4L76A 5IXYA 2GN9A 2I9PA 4KDFA 4BKQA 4GSLA 1W8DA 3R1IA 4E5KA 5EQFA 3WYEA 2C20A 2GPTA 1PJBA 2Q1UA 4NJMB 4DC1A 1UJMA 3KSZO 1SPXA 1VSVA 3IKVA 4NBVA 4D0RA 3VC7A 5KVQA 3TZHA 1DSSG 3MTGA 2Z1MA 2PZJA 1J5PA 2CFCA 2XXJA 3GA0A 3K5PA 4CM8B 3JQ9A 1YJ8A 2Q4BA 3FHLA 3GNQA 3I4FA 2AG8A 1LU9A 2QYTA 4HFJA 5HTOA 2H63A 3OA0A 2BHLA 3JQBA 4I5FA 3H5NA 1ONPA 4J7XA 3WGYA 4TZTA 5C7OO 3PP8A 3DZJA 1I24A 1Z73A 4W7IA 2DAPA 4BNJA 2O7QA 1Y6JA 3DBRA 4HFRA 1PZFA 5KVCA 2HLPA 3L9XA 4OYRA 4GVXA 3MCVA 3EC7A 1VL0A 3P7MA 4LRTB 5DCYA 1VJ0A 2G1UA 5IN5A 2Q2WA 3DOCA 4GMGA 3GY0A 1EVJA 4XRRA 2YZ7A 3D3WA 4BNTA 4A7PA 2AEMA 1GR0A 2P91A 2PD3A 4DA9A 3LLSA 2QRLA 3OJOA 4WCFA 2WEKA 5IZ4A 3Q9NA 3ENNA 1A7KA 3I23A 2NVUA 1C0LA 3IP1A 2X0NA 3VKUA 1A5ZA 3ZU3A 3ONDA 1BXKA 3GUCA 4IJVA 2NVBA 1HE3A 3KSUA 3PJGA 3RKUA 1QR6A 1PL7A 2OMEA 2Q1WA 3C7AA 3E9QA 1BDMA 2VZ9A 3V8BA 1V3VA 3KXDA 3OSUA 3F46A 1ZFNA 3CMCO 1I01A 1P1FA 3RC1A 4CMAA 9LDTA 1RPNA 2IEBA 4TROA 4BMVA 1BVRA 5L7TA 1N7GA 5JC8A 1KEVA 1XCBA 1N92A
chains in the Genus database with same CATH superfamily
2BR5A 2YASA 2FX5A 3REOA 2JA1A 2UVPB 5M34A 1ZVQA 4BB9A 5JPDA 3DKIA 3WE7A 4DVGA 4OHCA 4EECA 4F6RA 3UNXA 3UUGA 2O8BB 2OD9A 4FZJA 2PZGA 2WSSD 1RAEA 1FK8A 1BCSA 1FMFA 1R8QA 1COWD 1NMSA 3D7LA 3N28A 4RVCA 1VJRA 1EDBA 4I66A 1VHLA 4PYRA 1OV6A 5DKFA 4JL6A 4PV7A 2QWXA 3H8VA 4BWYA 1FP1D 1NUPA 1FJGB 3ZIDA 5D01A 4CLRB 2J4FA 4BTEA 4F4HA 1D0SA 3U4QB 5IRCD 1Z63A 2PGDA 1ZCJA 2WIFA 3FX2A 2HH9A 2VHUA 3LK7A 1ZD4A 4ESEA 1QH1B 1N2CB 4PCAA 3PDHA 1AUXA 3LQ1A 2I4NA 4HZGA 4YRQA 1G20A 1MC8A 2P4HX 3CLVA 3Q7IA 5E38A 3TQOA 4Q12A 4UVEA 3TYXA 1YFZA 2R4QA 2H4FA 2J85A 3N2KA 1Z5PA 4QQ8A 1OWOA 2J5BA 1QRDA 1U8UA 3VISA 1NRWA 2EZ4A 3G2JA 2IY8A 2V0NA 3QJGA 2W98A 4N5DA 3VZQA 5KOHB 2BM0A 4NPCA 1JEJA 3KPJA 3KG2A 5JTTA 2WSBA 4KX5A 3PQ2A 3PVCA 4OBWA 1LLQA 1H93A 1OA1A 2R60A 4LNUB 4QPCA 2AJLI 4TKUA 1J2EA 4HB3A 2NW6A 4CV0A 1OZGA 5EJ2A 3IMEA 4DRXB 1U90A 1UDRA 2D1SA 4FYKA 2AD5A 1ISMA 1ACMA 3TUJC 2EGUA 5JALA 3LLVA 3NVDA 2IZ5A 4XWKA 1JNYA 1DXYA 3GYBA 3R5JA 2LR0A 1UDWA 3RV4A 2AMJA 5K0FA 1HQDA 1U2PA 2J8ZA 3HYTA 1BKDR 2V6IA 1YOVA 4IMJB 3OZFA 5JCJD 4BCBA 2IS4A 2W6IA 1HSOA 3J80A 3H86A 2C03A 2CSXA 2NYVA 4BX3A 1ORDA 1RU3A 5EMKA 5IBPA 3HKCA 4JLWA 3NNSA 5SZKB 1B3BA 2HSDA 4MKHA 3AONB 4RJTA 1EDDA 1QZUA 1EFAA 2O2JA 2YZ2A 4PPGA 4BPRA 1BEEA 2ZIGA 3HP1A 4PZDA 4NF2A 4F7DA 4KVZA 1REQA 1JZTA 1QK3A 4IIJB 4LSWA 5DM60 1WZNA 5HZKA 3EK2A 3AM4A 3C3WA 1W4AA 2ANCA 1ZHFA 4GD3Q 2V0CA 3U13A 4RTJA 1PFQA 5DM2A 1Z29A 5IXSA 1D3AA 4AMYA 3HA5A 4IOKA 3AEKA 4R2JA 4EPRA 5JQGB 4YO8A 5MFPA 1F3LA 1XZJA 5CB8A 5IVPA 4UNRA 5TPZD 5EZ6B 1BQEA 1NNI1 4JB2A 1MH1A 2ZTVA 1QP7A 3EZXA 3WMEA 2K4MA 4U6NA 3A32A 3AEUB 4G23A 1NBHA 4CLXA 4AMGA 3GR6A 2RCNA 2CNWD 4JC8A 5COAA 3L6OO 3BFJA 3CINA 1AHNA 1AGNA 1GFWA 3MS4A 5ECGC 3ZOKA 3HNRA 3L7BA 1YB1A 3ICVA 4JT8A 3U6BA 4ITUA 1SCNE 1TFRA 3CH5A 5FTNA 2QTCA 1OLOA 4OGGA 3WL7A 1IBLB 5E7JA 3DTVA 1GADO 5KX5F 3ONVA 3SP1A 3QVSA 5AIBA 4GI1A 1KZ1A 4HMOA 3LWNA 5GMOA 1THGA 2OBNA 5DHPA 5IHXA 4ZAXA 4WUTA 1N0UA 3IUNA 3SIRA 3TSZA 1QUEA 1LX6A 3FNQA 2YWXA 3HU2A 3RC3A 4BLTA 1YZTA 1QDUA 2DJIA 4R1UA 4BO2A 3RUCA 4EHNA 4MJ3A 3OBBA 3OEWA 3RVJA 3TL2A 2FSGA 3UT0A 1SHJA 1Z06A 5FBWB 3G49A 2F3SA 3TOZA 3I8XA 2OCIA 3RVRA 5E1DA 3CVOA 1WEKA 4IMPA 2MSWA 2AXNA 3IJEB 1H5QA 4UCFA 1XNHA 1T4BA 3NBUA 4DQ0A 1Q5PA 2GKGA 2ZJ3A 2AN9A 4HQOA 4O2RA 5B7GA 1IXZA 3S2FA 1SHLA 3CKLA 4XEHA 2ZJOA 3DE1X 3HB7A 2XBUA 5LUAA 2UUAB 3MMXA 2NXWA 1C1XB 3EULA 3T0FA 2HK9A 3WAJA 2YXDA 5DRTA 2OQIA 3QIAA 2PH7A 5BN4A 5JHHB 1UINA 4ZXPA 4TRJA 4XWYA 5DRYA 3RBVA 3VDXA 4Y2SA 1S3FA 2IZ1A 1HDYA 2YINC 1ZIXA 2PGNA 3I05A 2CXHA 4LJLA 1U9YA 4OAOA 5CLLA 5ESDA 2BFEA 4ZQFA 3CRZA 1HDGO 1XAJA 2P8SA 4HDCA 4F84A 2HUPA 4BV8A 4KW7A 4ZJYA 2F3TA 1T4CA 1XLUA 1V1JA 3JALB 3TR6A 4D79A 1SBYA 1TW3A 3LG2A 1E1QD 1I7PA 1ZVVA 1KYWA 1CUUA 3HWRA 3S1SA 1U5AA 3KVNA 3HJUA 3DZCA 2YFYA 1D6JA 5EQTA 4FGSA 3QM1A 4RPHA 4RGQA 1HMYA 4Q7MB 5EJ4A 1DAIA 1Y8QB 4OM8A 4R1OA 5IVDA 1AQUA 1C5KA 3L2OB 3A10A 4ZGBA 5JPCA 4G63A 2O07A 4LX0A 4W1PA 3OOEA 2NVUB 2BD0A 5ICMA 2O2IA 1E5TA 2WMYA 4OKIA 3CJTA 4YJ3F 5AW7A 4PR3A 2CUTA 2R4TA 3CCFA 3RJ5A 3DGEC 4PG4A 1N33B 1EHIA 5GV7A 5IK2D 3OG9A 3QPWA 4BNDB 3FUVA 1ZI6A 3EMBA 2CW5A 3AQ4A 3QEOA 4JBGA 2CYBA 2Z58A 4DILA 1G55A 3PUWA 2L17A 2H00A 2PWBA 3OWHA 4ZFNA 5B4VA 1FTQA 1FSSA 1SXJB 1XZEA 2QTRA 2ZUBA 3CSDA 3UMRA 4EM6A 1DC6A 1UIRA 3PFGA 1JDPA 3RB8A 1L7PA 2J09A 5LSAA 3D3QA 3WYAA 4BO7A 3QY0A 1TVKB 3C8UA 2MR5A 2Q5OA 4NABA 2ZRNA 4JIGA 4EG0A 5KNDD 5K1SA 1CNEA 2ZIXB 4F97A 1EE9A 3R7BA 3T4XA 4F7WA 5D7NA 3T1NA 2HRQA 2IBSA 1QIHA 2RC5A 2WJHA 3LKZA 4ND2A 5T4EA 2VFAA 2ONJA 2R6DA 4D4LA 1B43A 5FPPA 5KSPA 5BN1A 3N5CA 4DDTA 3BXFA 4P0QB 3JVDA 3VPCA 4JYMA 4DLYA 4AUNA 3MOIA 3SX2A 1H0RA 4O4LA 3LL4A 3ZLVA 421PA 2VP9A 4FFRA 4NBNA 3CRNA 1NMYA 2DKNA 4JBHA 4NWIA 2G7MC 3R0XA 1ESZA 1DQZA 3HADA 1NVFA 4H27A 1VKNA 3QBJA 1M34E 4FNOA 1E4YA 1IN1A 1JSXA 1IOZA 3A0RB 3MWEB 1V4BA 2FPKA 3RFUA 1USIA 1WZCA 2QRHA 1OXKB 3DOHA 1JEAA 2XNCA 3A9SA 3MJEA 4ZQBA 2F62A 2OHHA 1T36B 3RC8A 1H2RS 3FB4A 3NHFA 2AOVA 2IWHA 1JR3A 1XYVA 3ZZ0A 1FFDA 3N2LA 3T3NA 1NQOA 2EV9A 2MYTA 1DKNA 1G1MA 2Z5VA 3CTPA 2IXEA 3FVRA 2QX7A 5GGYA 1K88A 4HNQA 1H66A 2H8KA 1P4RA 1T2CA 4KLNA 1SXPA 4X8LA 2WJYA 4C0QC 3EYAA 1GZ3A 4NDNE 1F0YA 1ZK4A 5DYWA 1R5OA 2ZVQX 4BN4A 2P2ZA 1J20A 3AKDA 5C3UA 1O57A 1VE9A 2OV8A 2VPYA 1GDTA 2A5GA 1NLYA 2H7CA 1WXDA 2QSJA 4BU1A 1QRAA 5K0JA 3CUYA 1NQTA 2Q6TA 3V8RA 3WB2A 3DKVA 2UYOA 4DLSA 4JOBA 4FVTA 3AI3A 1B2LA 4Z86A 3HO1A 3T4EA 2C7QA 3G2HA 4FR5A 3ZKWA 4GMHA 3I64A 3PTZA 3GUUA 3GMIA 1NDHA 3EZNA 2GKSA 1J21A 4WFIA 3PNMA 3BCUA 1NXWA 3SIXA 3UJBA 3JAKA 2HTEA 3AR9A 1PYDA 3NS7A 1W0CA 3O7WA 4M37A 3MTEA 2FAXA 1LZLA 5U4XA 4BNUA 4BVBA 1C4XA 4J0GA 2BGWA 4JWTA 2OO7A 1HDXA 3G2IA 4TRNA 2BMVA 3EYWA 4XOIA 2F4NA 3LT2A 4MKZA 4HADA 3R5KA 3N6VA 4REMA 4ZCQA 3TIGA 4AD8A 1M0SA 4LXTA 4RTNA 4IY1A 1N5KA 1Q0RA 3KR1A 2IH5A 2CCJA 3HP4A 5KVVA 5HVNA 1BWQA 1ZN9A 1OF1A 2BI8A 2P0YA 3IHKA 1LLUA 2GTPA 5ALJA 1W5FA 3ZXSA 1E3SA 3H5AA 1T1SA 2RHMA 4YRCA 4RZQA 3UIEA 2D2EA 4NL4H 3K7EA 4UFPA 1XDSA 3RD5A 1RHMA 1TPZA 4IGEA 4D9IA 2QR3A 2YIDA 4EI8A 3ITKA 5C4GB 2AK3A 2LDXA 3VTAA 3RWMB 4GYKA 1AKMA 3GJ8A 4BNNA 3CZQA 4MCAA 4NPHA 3CX4A 4IYJA 2F8TA 3DR5A 2QG4A 1WSWA 1T9BA 2XCOA 4WWHA 1H2ZA 3M3PA 3HLTA 3ELYA 4GRAA 1E9FA 1ZH0A 4J7CA 5CNKA 4FILA 1NNEA 1QKKA 1SJ9A 4NZYA 4PYOA 4YMLA 4L74A 5H1YA 2VHVA 5DYIA 2DTDA 4NK4A 5DX8A 3JD1A 3T8YA 2XOEA 2HGZA 1NUAA 1U8AA 2JGMA 2R5FA 3LW7A 3GT3A 3QI2A 4LVNA 2C96A 3OLVA 4K8OA 3D5QA 4DE5A 5C2JB 2BEVB 3O95A 1A2OA 4OAPA 5ARDA 3G3EA 1PQUA 4F3TA 4FCCA 2JEYA 4M3NA 3RUFA 1DWQA 2PO5A 5JPIA 4P9NA 1HFJA 2VI5A 4TKVB 2DBYA 4B4KA 3EPJA 2YWGA 3OPQA 2CVHA 5GVSA 1X7XB 1SGWA 1DNPA 1V7QA 1DBSA 2FV8A 3ORRA 1FVHA 4KQWA 4KXUA 4B3HA 4OTZA 1YB5A 2GHIA 3ESCA 5CYFA 2H1VA 3F8SA 3CEMA 2FUEA 1AN0A 3ES9A 4I08A 4OSPA 2FRVA 5D3KA 1CIPA 2HD4A 2IUYA 1QONA 2LRHA 3M9LA 1TEXA 5AM0A 4EB8A 5JD5A 1AGRA 1RVDA 1ZD9A 4ND4A 4PLHA 2WZBA 3U62A 4TYPA 2I71A 1MOZA 4PU0A 3OLQA 3IUMA 2I54A 1ZGZA 4DV4B 1YCFA 1YXMA 3D2LA 3NANA 4QIHA 4I5EA 2AUMA 1TD1A 4R3NA 1WCIB 4X8MA 3PU6A 4WLNA 2R1UA 3DTVD 4H1VA 1RQ7A 4XYMA 5G41A 4KODA 3TL3A 5BXQC 5EYPB 2A5DA 4JMLA 1KMHA 1NVUQ 1CKEA 3CF2A 3HCPA 4IIEA 1B00A 1AD2A 4I55F 3U56A 4QLOA 1PK8A 3K35A 3K1TA 4YC7A 2ZBVA 1JEDA 2H1HA 1WY7A 1FMJA 1PR5A 2YJGA 1Q21A 3I73A 4ND8A 4ZO4A 3S28A 2I7XA 5FL7D 4S24A 2PSEA 4HWGA 2XNKA 1BWRA 5FB3A 3E2PA 4FJ1A 4N5NA 4QJIA 3FE2A 5ILGA 1P4SA 1PG0A 3HE3A 3H75A 5F52A 1ETHA 2YIMA 5DW0A 4ZYWA 3AVVA 2XT0A 3K6SA 2FMKA 4EJSC 2JAWA 3M82A 4MPDA 1XJWA 2ZBDA 2B4QA 4PE5B 5D6OA 4Z3DA 1JMVA 4UOQA 1KWKA 5IM4F 3UBTA 2X5OA 3TIFA 1ZD5A 2AX3A 2PBLA 1OBHA 3JVVA 5F7JA 4EG5A 1CR0A 4CL2A 3M3HA 3D43A 1FC0A 1TYEB 1VGVA 2IHUA 4I4TA 2WHPB 3RFTA 3WNZA 3DVQX 4G1UC 3OMXA 2VNJA 4KYIB 4J1TC 4S2EA 4IVPA 2CXOA 2FWAA 1JDSA 2J4CA 4RQTA 1M6EX 4RETA 4DLLA 5ISMA 1JDBB 3P2IA 4M7PA 3QU9A 1OVMA 1Z37A 4GI7A 4HKTA 4QU0A 2HSEA 3B5JA 3OA2A 3ETHA 2Q6IA 4P5PA 1RHUA 1Z2EA 2C5HA 4A92A 3C1UA 2CEAA 4FWBA 1XDBA 1Y4DE 4GI3A 4CHGA 1OPXA 3QKUA 3EQ8A 1DXHA 1VOTA 1H0KA 1J90A 1N4DA 1QQAA 2X1MA 2E4ZA 3G9TA 1R6VA 5H7XA 1E5QA 3LA8A 4LCEA 2YYAA 4TUYF 2G1AA 1YKGA 4MVJE 5KQLA 3FCUB 3FWYA 5DDIP 1ODSA 1SKAA 3C7KA 1TF2A 4YAWA 3QOFA 3X1JA 3LFHA 3JSAA 3MSXA 3VSAA 3ZXXA 5AUOB 3SQMA 5F23A 3TQSA 3VI3B 3L0BA 3H9GA 1ENPA 1P7CA 1RMQA 2YRXA 3ESXA 3GFFA 1ZLXA 4UTZA 5JG7A 1Y4UA 3QE2A 4WA7A 3A6ZA 1M2NA 5COQA 2SHKA 3GU3A 5D1HA 3RSLA 3T06B 4DRXA 3NUQA 1YZFA 3SY8A 4YQZA 2GD6A 3INNA 3QSYA 2O8CA 1C9KA 1XZHA 3WRYA 1VHJA 4LZJA 4MUBA 2DHQA 1IZ0A 4D3ZA 5BSHA 4GM1A 2I03A 1RIIA 1R6BX 3LJKA 1SH7A 1ULHA 3TW0A 2PFGA 1QG4A 5ADHA 3FCOA 4ZDJA 3G8DA 4GRIA 3ZGNA 1SUPA 2CMDA 1RSZA 4JELA 3K9CA 2C4HA 4Q3NA 5B7QA 4JQOA 3KFXA 2ZI4A 4ZVMA 4JBXA 2J9RA 3VVMA 1E7MA 2A84A 3A1EA 2V7WA 5I8ZA 1BVHA 1Z6XA 4FB4A 4O2BF 1NAHA 1NT2A 1ORWA 2BC9A 3C8HA 2PD6A 3TZQA 3LKDA 3WWDA 2X6QA 1JYEA 3KOWA 3QHAA 4MEBA 3HUUA 1R0ZA 1PNVA 5FTKA 1FSPA 1E3WA 3D7KA 2HA4A 2V6BA 3NYRA 3UCXA 2GPAA 2P8JA 1NX9A 1SUDA 1W19A 5HIMA 2KMLA 2CXSA 3DAFA 4Z51A 2GNPA 4E2FA 1E9VA 5JNSA 3P2OA 5DHRA 1WBJB 1D1TA 1NN3A 2YV3A 2B6HA 1VHTA 3JAWB 3VYRB 3F3YA 1UWKA 4GC9A 3ZNOA 3K16A 4WOJA 1VZ3A 3FYUA 3NBYC 3EH2A 4BP1A 1M2VA 2ZRJA 4EF4A 1W88B 5EWJB 1I13A 2EGHA 2XT9A 1GNVA 2K6GA 5DEIA 4V1CI 4MIEA 5EE0A 1TO2E 4HMPA 2I99A 1Q2UA 3KJGA 3A9WA 2QGFA 1PFWA 3QX8A 4IINA 3FYSA 4YMGA 3V8QA 4R0MA 4FFWA 4MMZB 1FIUA 4DV5B 3VR4A 3EC1A 3TLMA 2FPUA 4KPYA 4C7OA 3MXOA 1LI4A 1P2DA 2XODA 3I34X 4KO3S 1QYRA 2CV1A 2HEIA 4IFEA 4IRXA 3S7ZA 2COEA 121PA 4B35A 3QLUA 1VXRA 3A1VA 1BN7A 1OBCA 3Q3HA 1QP8A 6ADHA 1N8NA 3KQYA 3N8NA 4ILEA 1Y37A 2VSFA 1V1MA 3BK1A 4GFDA 1P6XA 5L53A 2FN4A 5D3MB 4Q7JB 4MLDA 3DWIA 2HJRA 3ZV6A 1LD3A 4TWAA 1N2XA 2GQ0A 4W4TA 3MGGA 2YYYA 3VA7A 1A27A 1LRLA 1VE6A 3EY9A 5DWDA 1S3GA 2DPLA 2JASA 3OY2A 3JRNA 2OFWA 3R75A 4C4XA 4D96A 1PNRA 3HZZA 4KXVA 4BMNA 3QFFA 5TB5A 4MVJI 5JCPA 3SHFA 1K08A 1VQ1A 1ZHHA 2AKAB 4ZQEA 2J0VA 1MJGA 1SELA 3RTCA 4BO6A 3HUEA 2ONKA 1AB6A 1HRKA 3F9IA 2XRFA 2R86A 4RA6A 2OZEA 1P2UA 2C82A 3CT6A 5FBVB 1VSBA 4MV0A 1YU9A 3CMMA 4G8CA 1VC2A 2NAPA 2WKWA 1OZ0A 2JFFA 1HNZB 1G8PA 1ICIA 1EWYA 1GPBA 3FAKA 3LU1A 4LKRA 1CUAA 2HRDA 1C7EA 3GLIE 1YZYA 2C5AA 4R40A 1AGPA 1W4CA 5GJVC 3HJCA 3I09A 3MA0A 4OHMA 3UJNA 3O9MA 4I50A 5EY5B 4YCCA 1QKIA 2P6UA 3WI7A 1X80B 4WAUA 3URMA 2C9BA 4ME6A 5LDHA 4KO1S 3ZGYA 5AO9A 3V8PA 1KVUA 2BBOA 2IYYA 1K7EB 4HAYA 4O5AA 5AVVA 1AZLA 3ZCRA 1PR4A 1A1SA 2BEKA 2VJKA 3HJTA 4LYHA 2ZUVA 4FSHA 3Q10A 5TPWB 1CUVA 3CEJA 3HL0A 3UUEA 3JALA 5K8TA 5D5HA 5K8UA 1E2GA 3KS9A 3W3AD 5TQ2A 4L8WB 4FS3A 4U8GA 5FPQA 1T15A 4AAYA 5LBIA 5HIAA 1J56A 1QJCA 2FZ4A 4DLNA 1C4KA 4FMDF 1S2NA 2XQKA 4GGOA 4TM8A 3PXAA 5IMSA 4NZPA 4UAJA 1EVEA 1SFRA 5LKAA 4FQ8A 1BYIA 1U0FA 3DWFA 4L51A 1AKVA 1DIHA 3QNUA 2NSDA 5EJAA 3ZX5A 3MPUA 1Z36A 4X45A 4DJFC 1JIKA 4LZWA 6YASA 5CFRA 2RGRA 1MABB 2PUVA 1XCGB 3FXAA 1QLJA 4IDFA 3LS2A 1W85A 4NBLA 3AEYA 3G2LA 3ZWYA 5FNVB 5JJBA 2HSGA 3WRWA 3EVCA 3AIIA 2BTEA 3HJNA 4B3BA 1JDVA 5DXJA 3W5BA 1XVUA 4EUHA 4AC9A 1INLA 2BEUB 2R6FA 4CQJA 1W36D 3BVPA 5H59A 1QU3A 2HFKA 2X9NA 4HJRA 2BFCA 4DLZA 4NMWA 4URUR 1Q6ZA 3FOAA 3HVJA 3BXPA 4NMHA 4BCDA 3AESB 4GLFA 5D5PA 5K8VA 3G0OA 2I2AA 3C3JA 1GPJA 4BWFB 5GIOE 1JU4A 1TA4A 3BDIA 2FQWA 4TLCA 4BQNA 4IWYA 2ZRGA 3OE5A 3F8TA 1T5LA 2Y92A 16PKA 3PNYA 3GUYA 3PD7A 3AG6A 1OILA 3EWAA 3IESA 4DA7A 4HTFB 3SIPA 2J6BA 1BNCA 1F4VA 4IDGA 2HCRA 4P0TA 4WFQA 3NT4A 2RGNA 2GZMA 4DCCA 4ER5A 1R0BA 2V3WA 1G9TA 3CBQA 4ZVNA 1Q0PA 5JARA 4JITA 4NOLA 2G04A 3IDSA 3AW9A 3TXAA 4NYJQ 4E7PA 1N7HA 2H9YA 3QLVC 3FBTA 5HF6A 3C7DB 1L1RA 1WETA 2WIKA 3E9ZA 1YB4A 3RRNA 3MF4A 3TTYA 1EDOA 2IJGX 1EBUA 1PZEA 2D4AA 1PW5A 3NTVA 4IM7A 2WFLA 4KK3A 1VRCA 3BJRA 3U40A 1ZG3A 2H85A 4L5CA 3ROMA 1OC2A 1YS1X 2LPMA 1SK9A 2WV9A 2D3TA 4REQA 3TH5A 3W0LB 2EFGA 4N4AA 1QUFA 3LP6A 1E2IA 3D3JA 5ICCA 3IELA 2JJ2A 3N2ZB 4JXKA 2R96A 3E9NA 3ZNQA 1KH3A 2PKYX 2L19A 5EUQB 3UAXA 4GR9A 4J4HA 3V4VB 2DBRA 5KO2A 4K87A 4EYKA 3LBNA 1TO6A 3VMFA 4GGMX 5JVDA 3ZCPA 3M6AA 5IHPA 3BGSA 1DQPA 2ZM6B 5TIIA 4G0OA 2H11A 2BVNA 4F2GA 1A8PA 5JYEA 3V48A 2BBSA 4D8VA 5AJYA 4YUZA 4LISA 1L8QA 4DG5A 3X2SA 4Z49A 5DX0A 1RABA 1Y9DA 4OHKA 1NVAA 2Q3MA 3LYHA 2XJ4A 2HAEA 2WOOA 3AHCA 5B3AA 4JMPA 2YMQA 4XVRA 3T7EA 1E89A 5HDBB 3T0GA 2C2GA 1HE8B 1GR1A 3DF9A 3EVEA 3EBPA 2D8AA 1LBQA 1LK7A 1RLMA 2PZMA 3DPIA 3NBFA 1U8FO 1AXEA 1AUQA 4IQ0A 3AXTA 2XA2A 4KVFA 3CLSC 2ZU6A 1O96A 3ONEA 4EBBA 2G3YA 2XF8A 3CZAA 4ZI7B 1SU7A 3AZOA 3A4VA 1MVOA 3EXEA 1H6DA 2JLSA 3GV0A 2B78A 3C1OA 3N2KB 2OM2A 2G4VA 3CZ9A 5IBQA 5FX2A 1YDWA 1ULUA 4OM7A 5HIIA 5T4HA 1R4ZA 3DOFA 5A7GA 2OORA 1TQHA 2FQXA 2AXPA 3BK2A 3EXG1 3BEOA 1KEZA 3ZZ1A 1ZO8A 3CVVA 4RKYA 3TKLA 4EG1A 4OO3A 1L1EA 3ULKA 3GIWA 1N6HA 3DDHA 3VHRA 3W34A 1E96A 2AFIE 1YZQA 3JSXA 4YV7A 2Q5QA 3GLUA 4EH1A 4WZBE 1U0OC 1M7HA 2NUPA 3UQYS 2DQSA 1K3TA 2AC2A 3RTEA 3HBNA 2XB8A 4QFMA 3K70D 2GYYA 1PV2A 1BD4A 1UFOA 3SDSA 1L4GA 3QPBA 3O8NA 4HZUB 1XE3A 3QVOA 4X6YA 2ZUCA 4O3MA 1ZOSA 5HKKA 4X1KB 3U4HA 2FLWA 2GTHA 3H18A 1V5GA 4M7RA 1QVAA 4KKXB 4BTLA 5HM8A 2PUDA 3BULA 3A6PC 2YY6A 1JDBC 2VJNA 4U2CA 5D85A 1I4WA 4RIIA 4Q47A 2I33A 2R7AA 3R3WA 2WM3A 2X86A 3HM2A 4B3FX 3A26A 2QR2A 1K4YA 1RPZA 2H2IA 5DISB 1CDDA 1VMDA 4Q4AA 3N2EA 4G25A 1GRRA 4PSCA 1U3TA 1OWMA 2HW8A 2IP1A 2WFAA 1M2OB 2XGSA 3L8ZA 4PRKA 4XQCA 5BQFA 3U4CA 1IM2A 2D7DA 1C1YA 1NIJA 2Z2KA 4ZA2A 4JLMA 6GPBA 3V9AA 4C6TB 2VNIA 3RSCA 4JU9A 4D9KA 1RKUA 1Z28A 1WXFA 1JXQA 1NX6A 2ZSFA 4UMFA 4ZVKA 2HMUA 2OZLB 3FOCA 3UJHA 2YJ6A 5GONB 1DDGA 3Q6MA 4L9AA 1DOAA 3GAFA 2PH3A 4FYHA 5FYDA 3LZ6A 5C5CA 3OIWA 4MUAA 4CKEA 2IHNA 4GX1A 1B73A 1P31A 4NPAA 4I3HA 1F2VA 1PEAA 2KBEA 1XR3A 1RWXA 3ABIA 1SG9A 3BHIA 3KZOA 2CE7A 2WKRA 4BKOA 3GZNA 1P2FA 1T5TA 4G1FA 4C3OB 3G6KA 4IHJA 1EX9A 4OK3A 1MT3A 1AF7A 1CLEA 2PQ0A 2EIXA 3R24A 4QJ4A 4WY5A 4D4IA 2QLLA 1UMDB 4ZKDA 2O1WA 4KMOA 1E60A 1XQXA 3HS3A 3MUOA 2ACEA 5EESA 3CN7A 4ND8B 4PAGA 4HYTA 1LJUA 621PA 4CQMA 4BOYA 1ORRA 4OYLA 2DY0A 4YMWA 1K8QA 1W46A 5AW4A 2JI4A 3WBBA 2W2LA 4AZSA 2XW6A 5F64A 1TM2A 1T3GA 4KYUA 4AJJA 4MLCA 3WS7A 2JNWA 3CCCA 3VYWA 2AFHE 2FRXA 5FDFA 4AKHA 3V7YA 2BFCB 2JVIA 4RHCA 2ZXEA 2BGIA 2PX8A 3EGEA 4F04A 1JHQA 3R74A 1ID8A 2X5KO 3T3MB 1CQIA 3V2IA 4BC0A 2XMSA 2Z5FA 1LJLA 4KSBA 3U26A 2UU9B 1RXCA 1XN4A 3WL6A 3BD9A 5KMGB 1U6KA 1X74A 2ZIUB 1AT1A 3JXEA 4NJEA 4H1UA 2M1ZA 2J3KA 2C3PA 3I76A 5DSTA 4GKKB 3QIVA 3LQRA 1YZKA 3RK4A 3BF7A 2WIGA 1I14A 3STYA 5IJ0A 4DLVA 3UMSA 4FFBB 1MB9A 1OFTA 1E3TA 1ZH6A 2BBTA 2V65A 2ZSEA 3RLFA 5MFZA 2ZULA 3GPBA 5A03A 3OWOA 1N1EA 1P1JA 2OO3A 2H4JA 3RAFC 1A2QA 1C1XA 3MAAC 1HLDA 4L72A 5JT1A 4Z4GA 1AE1A 3E81A 1IY9A 2YZMA 2FPSA 4RD1A 4UC0A 1ENZA 1KQOA 2QJRA 1LFAA 3OHSX 4OFZA 4QOHA 4FOPA 3HJFA 4LJYA 4W82A 4YT4A 3HCCA 2V9PA 2WJGA 4J49A 1T0IA 1UEJA 2AOXA 3D8TA 3Q3GE 1FFWA 5L95A 1P45A 4F91B 5IAOA 4F5DA 1LVUA 4BNXA 1YR1A 1T4CB 3GLQA 4AFNA 1TZCA 3DOJA 2NVWA 4Q19A 3PWSA 4G67A 5A3VA 4DM4A 2PIDA 5CLQA 1O89A 1T9DA 5C31A 5EKDA 3UKJA 4DWJA 4EY5A 3GPIA 4Y6LA 2WOJA 3ZX4A 3VGJA 2XECA 5CD9A 1F38A 1M8GA 3EXHB 3KTOA 2G5TA 3PGXA 4PINA 5DOZA 4TKMA 1LCIA 1UAYA 2GN0A 4JA0A 3KQMA 1KQGA 1QF9A 3ONFA 3TXYA 4JXXA 2R1TA 3OMLA 3AKZA 2CCGA 1CUBA 1WZ2A 4FR2A 3JARB 4DOMA 2OAP1 3DW1X 3NIDB 2H5LA 3WKBA 4AKSA 2HNBA 2F9LA 3K09C 1U0GA 1IPEA 2JHCA 3E7WA 1WVIA 4UCWA 4PICA 5CHEA 3GFSA 3IULA 5KSZA 4IV0A 3J81k 3W5AA 5AYVA 3WLAA 4EY6A 4FE4A 3ZCSA 3EBOA 2P27A 1X7ZB 3VDQA 4QAJA 4CGYA 2KHZA 3O3MB 1GL3A 2OGWA 1DAEA 1GCAA 4RL6A 1ZJYA 4CI9A 2YN4A 3TX2A 4F46A 1WZIA 4MZXA 3PX2A 3VR6A 5L6LB 4X8HA 1X7DA 3SKVA 1ABEA 3R5XA 3LWBA 2NO7A 4R2WA 1BCRA 4NV0A 5LM3A 2XEXA 4ND1A 1V5FA 3ANYB 4NU0A 5IDQA 4DZZA 4JYZA 3JWGA 3BE6A 4V1CA 3L92A 4RLFA 2NV2B 2YN2A 2WVAA 4GS5A 4DUPA 4QKQA 2HBZA 4X20B 1PZNA 2AR0A 1IHYA 2CL5A 1PTJC 1TZMA 2XUKA 2WUDA 3LTEA 5B1YA 4U3JA 3I1JA 4GPTA 4CF4A 1UC8A 1A88A 1IXRC 4X1KA 1P4AA 3Q88A 3EB9A 2CLOB 3UAZA 1RJEA 4EPYA 2JJ2D 3JWIA 4GT1A 2GPYA 4TLAA 4BKUA 1OQAA 1U7HA 1ZBDA 2WJPA 3MWEA 3HA3A 3T61A 1OKKD 5E9QA 5FFMA 3VC2A 1E9BA 3E84A 4C1BA 1G0OA 1GWNA 4Q1AA 1L5QA 3KAQA 1HQCA 5FT9A 3RUIA 1ZEMA 3IT3A 2QS9A 4YDQA 4DR7B 1STOA 3GRRA 4V0MA 2J3EA 1U04A 4KE6A 1C7RA 2PXXA 4DA4A 5TY0A 4XVHA 3ICQB 3WGIA 1YAHA 2PRJA 4FM9A 1LVHA 5CEJA 2C9OA 2QAIA 2W2KA 3NX4A 4UFOA 3U4GA 4AMVA 3HY6A 3A1NA 1GQYA 3HUFA 1NHWA 3GHYA 5DGCA 4YMIA 1LDEA 3N74A 5J5VA 1SD2A 2O0KA 3NJRA 4ICIA 1J7JA 2W83A 3KM0A 3P9IA 4P4GA 2GCPA 2R7NA 5KX5B 1XZFA 5JH7B 2ZWVA 4O0MA 2EC5A 2EZTA 4A8JA 1RJFA 3ZBTA 3MXTA 1AU9A 2HA2A 2X19A 5JLJA 3JARA 3E58A 3COPA 3HJRA 2MHCA 1PTJA 2OZPA 2W8ZA 3IQDB 4DWVA 2CXPA 4MQEB 3L9WA 2BFWA 2VF2A 3H83A 4AICA 3QMWA 3SLGA 1U9JA 4C4TA 2H31A 2XGGA 3D3KA 1G3UA 3RVPA 1PNTA 1X7ZA 3E7FA 4EZBA 1YRBA 4X0EA 3ZK7A 4Z9BA 4ON9A 2ZRMA 3WGGA 1EVLA 5EJIA 3WSVA 4YJ2A 1Z3IX 3GPCA 4WUVA 4CMHA 3L7MA 4FT2A 2J41A 3TNYA 1XTUA 4ALIA 1HO3A 2QNBA 4C4YA 3V4RA 1PYGA 3WADA 4ZO6A 4F4DA 4LY6A 4XX1A 4YYEA 4DJTA 5DN6D 3AGPA 1Q44A 1ODCA 4EKDA 5JCXA 2D2VA 5LOVB 5AVKA 1DXOA 4MO9A 4DZRA 4KK4A 3NVAA 1NLZA 3NPAA 3QTTA 2JDIA 4IGAA 4AO6A 4G86A 2HIGA 3NHAA 1O0BA 4M0CA 2J0UB 2H57A 3KHKA 4DMCA 5K8LA 2FZVA 5FA6A 3HB5X 3HDVA 3DEKA 1OJ7A 4KGVA 2BIFA 4LJ8A 4QYSA 1T8UA 2YNMA 4JS0A 4M7WA 3MJHA 4RD0A 4YH1A 3GZTB 1PL8A 3N8GA 1MC5A 3MTJA 4YJ2F 1N6KA 1PJ3A 2GZ1A 4LYGA 5JNLA 4K6MA 1HLFA 2GBGA 4DV7B 3SYLA 1E2PA 1W85B 1FXSA 4W5QA 4TL6A 2V0GA 5CT5A 2SNIE 4WZBA 2B8EA 2RMKA 1D4FA 1Y8RA 2HU8A 3O21A 4P5DA 3UWSA 3OJEA 4N7MA 4V2IA 1P8JA 1SOVA 2QD1A 5TT1A 2B1JA 2OVBA 2X4IA 4JCCA 3N7AA 2DECA 1QG2A 2I87A 3F90A 2BEUA 1U6JA 2Q28A 1WPQA 3F78A 3PYXA 1F6WA 3IODA 1P9RA 3USZA 2ON6A 2JAOA 2YXNA 4EFKA 2CLHB 1R12A 2EU8A 1FSGA 3SHVA 4JD5A 4CKWA 4JJGA 4PFJA 1GQQA 2H54A 4J0FA 1YB2A 3PGKA 2PWZA 1NLMA 3OC6A 1MRNA 5H9WA 3K9NA 1LPSA 1GT6A 4N7JA 4NBUA 3ROGA 1BHSA 4WY8A 4K6CA 4LG1A 2XMBA 3MYRA 2ORVA 3DAYA 3LL7A 2ID4A 3IPYA 2YDXA 3IUPA 3L46A 2VH5R 4Q0MA 4ERNA 4K9QA 4RKEA 1EFVB 3F6EX 4POAA 3EFOB 4B3GA 2XQIA 4K9MA 1QRUA 2PT5A 1XTRA 2PV7A 4PZLA 4KQMA 1A9QA 1Z88A 4CFSA 3X1ZA 2O3SA 3ZS9A 1HEIA 1FNNA 1Q22A 1WOYA 3WSWA 2QD5A 5FHRA 2VIIA 2OY0A 4GWKA 4MUYA 1JQDA 3W5UA 2Z8ZA 2HA0A 4PO1A 4UUQA 2O06A 4UATA 5HKAA 3BXEA 3IMKA 4X92A 1W4RA 2ZYTX 2VNSA 4LOAA 2XCIA 3QXGA 3OE4A 4Q82A 4ZYLA 1AKRA 5EJ9A 1DU4A 2VATA 1ABBA 2OXRA 8ADHA 1WA5A 2WDPA 1KBQA 1XK7A 1XMXA 2DE0X 2EBUA 2A0UA 5CW2A 1L1QA 1PL0A 4NCJA 1AK2A 1IIRA 4M8IA 4ZZ1A 3LUHA 3N1UA 4NFHA 1BKYA 2B5OA 3LXRA 4PHFA 4TVKA 5ILOA 2F48A 3HB9A 3ZDQA 3IVCA 5HYVA 3GRCA 3RHSA 5AUNB 4ALJA 1VGRA 2BHSA 3CXRA 2VYCA 3GP5A 5G4LA 2H2AA 1V5EA 3GGOA 1TGVA 1E2JA 1QP4A 2QVZX 5DTQA 4NU5A 5TT0A 4NZNA 1SU6A 3KT0A 1W59A 1CQXA 1EXDA 4RZUA 3CG0A 5E0OA 2PMDA 1HC7A 5K4HA 4JHLA 4NE2A 4HH4A 3U31A 3CA8A 3LCMA 2X0EA 2AFHA 3INTA 2ZBGA 5SZIA 1VPTA 1FX0B 3LRTA 4D9FA 2QNRA 3H87A 2H18A 4F1KA 1VCOA 2H5JA 1FS5A 1RAGA 4O8CA 1H69A 1BSVA 1Q11A 1Y3HA 2WHRA 3LM8A 3Q8MA 1GN9A 1OLUB 1ZJZA 3PHIA 2C7OA 3S3TA 4N8EA 2G06A 4ITRC 2FZ5A 4WY2A 1D4OA 4K81B 1L7AA 1M6NA 3FKSD 4YR7A 3Q40A 3L7CA 4MWGA 8LDHA 4K1XA 1Z56C 3FI0A 3WZMA 2C9ZA 5B3JA 2HJVA 2UZ3A 4FDAA 5HZHA 1JU3A 1I6MA 1KRXA 5JY6A 1E4EA 3RF7A 1BDJA 2AKYA 2UXDB 1CZHA 1D1PA 1YR2A 1C1HA 1PVVA 3WL8A 1SOUA 2HQSA 1PZGA 5JWRA 3SC2A 2IYPA 5KVAA 1U7UA 3A3OA 4IUYA 4E5SA 1E7QA 5F7OA 4ZAZA 3ZBPA 5AJXA 4XZ3A 4QGSA 1Z0FA 3AYZB 1H5NA 4D81A 3PXGA 2BLNA 2NU9A 4G3XA 3TUIC 2GLUA 4UJ5A 4ALKA 1YBMA 3PD0A 3H2ZA 3JQEA 2D0PB 3KZCA 1QHHA 1NL3A 1G63A 4FSDA 2CZQA 3BQMB 1BRTA 1TUEA 3GMDA 3KOUA 4P7JA 2A7XA 3D1JA 1R4NA 3JVEA 4MRPA 2FPXA 3ELBA 4ZVVA 3DNMA 4MS3B 5EPEA 2IYSA 3PQ4A 3C45A 1G4UR 4GOMD 5FLKA 3PJRA 1EESA 1GQOA 3NHYA 1Z0AA 3FPHA 3OU7A 2WVHA 5DGXA 3SDZA 3O93A 4FIDA 5HHTA 3VVLA 5AK4A 1JG3A 1WMAA 3JWJA 4D4HA 2LIVA 1TIBA 1Z0SA 3R0IA 1V3TA 4DQXA 4CKBA 4UD2A 2C7RA 1GPNA 1EP1B 4EYSA 3ZEIA 2CD9A 1AMUA 2QTFA 5AI0A 5BV1A 2M6KA 4TM7A 3M5DA 3HGQA 1KWGA 2J32A 4GOKA 4YO7A 721PA 1E8NA 4C3UA 1N2GA 1GTZA 4PGHA 2GVZC 2GYVA 4DUGD 2PO7A 2ZYUX 2C92A 2F43B 3KLBA 4OXXA 5C8YA 1KY3A 3JQCA 2VQFB 4EQ6A 4MVXA 4DKJA 5INTA 3GDOA 3VJKA 1NTOA 2V6JA 2XQFA 5LQJA 3F5SA 1WEHA 3HWWA 3NHKA 3PIDA 1E58A 5H3CA 4XJVA 7MHTA 1GKLA 2Q62A 3H1BA 2VSYA 5G0VA 3B85A 1FX0A 1U8TA 2ZAOA 3B3FA 3G5LA 4DDWA 1M6YA 4JGIA 3MWJA 1QX3A 1QVZA 2GM3A 1BX3A 3K96A 3RFVA 1IQPA 3G82C 3RV3A 3G2OA 1AKEA 3AIMA 3C3AA 3O8LA 4UUMA 3RK0A 3SF8B 1QFXA 4P86A 2FPWA 2AZMA 4IDOA 5JFGA 2DGDA 1M5TA 1TLTA 2C78A 3KZMA 3HKDB 4R51A 2NUTB 3ANMA 3UW3A 4LF8B