1PEDA

Bacterial secondary alcohol dehydrogenase (apo-form)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
351
structure length
351
Chain Sequence
b'MKGFAMLGINKLGWIEKERPVAGSYDAIVRPLAVSPCTSDIHTVFEGALGDRKNMILGHEAVGEVVEVGSEVKDFKPGDRVIVPCTTPDWRSLEVQAGFQQHSNGMLAGWKFSNFKDGVFGEYFHVNDADMNLAILPKDMPLENAVMITDMMTTGFHGAELADIQMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKNGHIVDQVMKLTNGKGVDRVIMAGGGSETLSQAVSMVKPGGIISNINYHGSGDALLIPRVEWGCGMAHKTIKGGLCPGGRLRAEMLRDMVVYNRVDLSKLVTHVYHGFDHIEEALLLMKDKPKDLIKAVVIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADP-DEPENDENT ALCOHOL DEHYDROGENASE
publication title Crystalline alcohol dehydrogenases from the mesophilic bacterium Clostridium beijerinckii and the thermophilic bacterium Thermoanaerobium brockii: preparation, characterization and molecular symmetry.
pubmed doi rcsb
source organism Clostridium beijerinckii
molecule tags Oxidoreductase
total genus 117
structure length 351
sequence length 351
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 1995-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pedA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1pedA01
3ANMA 3DZIA 4I9UA 3UF0A 4RV9A 2DM6A 4WK6A 4YJFB 1E7SA 1EBFA 4ND1A 3U62A 3FRJA 5L53A 5CDGA 4ALJA 1QP8A 1YDEA 3U0BA 3D64A 4F3YA 1QYWA 2HKIA 4YJGA 1HE4A 3PDJA 1BHSA 1LNQA 4P4NA 1NWHA 5L4SA 3GEMA 4NU6A 3E9NA 3DAPA 1NVMB 2ZB3A 3GLQA 1E7YA 3WQRA 5HWSA 1PR9A 1WZEA 1KOLA 4MVJM 4P4LA 4XYBA 1YDWA 3PGJA 2EIHA 1LSUA 3B20A 5COQA 3UCEA 2Y0DA 2ZKLA 5THKA 3KETA 2Q49A 2VWQA 2WD8A 4XRRA 3VTZA 1Y9EA 1KYQA 1R4MB 4CMCA 1E6EA 3ZGYA 3Q2IA 3FNHA 5AQ1A 1BMDA 2HJSA 1EVIA 2P5UA 1V3TA 2X22A 4XZ3A 3U4DA 1DC6A 1E1KA 1B2LA 2W8ZA 3ANLA 3LT1A 2FY8A 2IYPA 3GDGA 2O3TA 2LDXA 3RUEA 1EQUA 1ORRA 4YAGA 3PJGA 5F21A 3HUDA 1XU9A 2VRCD 1SCUA 2VNAA 2BELA 5GZ1A 2WD7A 5CAEA 3OP4A 3A14A 3T4XA 2BRUA 2B4QA 3KOUA 4XQEA 2HRZA 1F8FA 3GN2A 1DO8A 1B0AA 3DZJA 1PS9A 4CM6A 3RAJA 1MLDA 4MVJA 3M1AA 5DNAA 1E6WA 4RLSA 4PG7A 2HUNA 1RYEA 4BNKA 2WE7A 4WNCA 3TPCA 3A06A 3C1TA 4I5GA 4JCOA 2JCVA 3LQFA 5JDCA 5IN5A 5THQA 2IXAA 2JFHA 1Z6ZA 4P8RA 2YQ4A 3NT5A 4J0FA 3MJSA 2XPCA 1DC5A 5KCZA 5JDIC 1H6BA 3SEFA 5CG2A 4QXMA 1KEPA 2O3RA 2GD1O 3AOEC 2NLOA 3LK7A 5KVQA 1XA0A 5TT1A 3W4KA 4KTVE 4NMHA 4E3ZA 1MFZA 3SX2A 3QIVA 4CQLB 2JL1A 2R6JA 3MTGA 4RPHA 1D1SA 1YXMA 4CR7A 4FFNA 4HKTA 2D1YA 3I9LA 1YH3A 5JW6A 1DDOA 4BO4A 3I5MA 2Y05A 1E3EA 1ULSA 3DDNA 5EESA 3DZGA 3C1OA 2Y1GA 3C8MA 4YJFA 4G81A 3ZW9A 4Y8VA 4HFRA 4CM3A 2Y1FA 1ISIA 1I33A 1FDVA 1DSSG 3ORFA 3FD8A 1QYCA 4QX6A 2PD6A 1E5LA 4BV9A 5DULA 1K0UA 4R54A 3LC1O 1B15A 5IG2A 1LRJA 3PRJA 3F1KA 3JQBA 3TZQA 2EKQA 2DU8A 1IE3A 2CD9A 3PLRA 3WB9A 1Q7GA 3IDSA 2NVUB 5KJEA 4YT2A 1KVSA 5JO9A 5JAIA 4MVJF 4E2XA 3V2UA 5CDYA 4PLYA 2ZTMA 4KMSA 4XGNA 1ISGA 4TKLA 1R4MA 1O8CA 2DPHA 3KEOA 3OJEA 1GYRA 3C7CB 5T8KC 3JQ7A 3L9WA 4XX0A 2NSDA 4FB5A 3SXPA 3DC2A 1V35A 9LDBA 3HDHA 1I30A 4QO8A 5A5FA 1ZFNA 2ZQYA 4OXYA 4CUZA 3JYNA 5LC1A 3NTOA 5LCXA 1T2DA 2O2YA 3Q9UA 2POQX 4CMIA 5A9SB 2IODA 4J0EA 2AQ8A 2FWMX 5L51A 1SB8A 1I3NA 3VAZA 3KHUA 4RORA 3TZ6A 5CHEA 3GR6A 5T67A 4DMMA 1HRDA 1VRWA 3RUDA 1WAMA 3F47A 4DC0A 1PZGA 3GHYA 1X0VA 1GFSA 2Y66A 3ZU2A 2DPGA 3AM3A 1TEHA 3AK4A 2DTEA 2IRWA 2VWGA 1PJ2A 2XOXA 3FWNA 1ADCA 3O4RA 1W0CA 2X23A 3RUIA 1A71A 1ZK1A 4GWGA 3PYLA 1ZXBA 2QZ9A 1JAYA 4UREA 4U6QA 1E92A 3RASA 2FSSA 1TB4A 4U0KA 2VN8A 4FJ2A 2VZ9A 3NKLA 3FTPA 1LX6A 2ZYDA 3JD4A 5JDCC 1J0XO 3GVXA 3DZBA 3GUCA 4OMUA 1C0KA 3B70A 1U5AA 5BSHA 4MVJI 2Q45A 2VRCA 3FCOA 4CODB 5I7FA 4CQLA 2O2SA 1YB5A 3OJLA 1W4ZA 1NPDA 1ISMA 1OZAA 2WEKA 3GDOA 3GQVA 1ML3A 3TZCA 2DBQA 5KJFA 6LDHA 2GASA 1EZ4A 4BNXA 5I9NA 4BO6A 1Y1PA 3CMMA 4Z0TA 3K30A 5A9RA 3ITKA 3H9QA 3TFQA 4CMEA 1KVUA 2FPIA 1YB1A 3PIDA 1EDZA 1N92A 2QW8A 2DC1A 4HWKA 1H6AA 2XAAA 3VDRA 4TVBA 2Q4BA 2VZ8A 3TZKA 3RROA 5KJ1A 3WLFA 3D5QA 1EDOA 3EHEA 1A9ZA 3TOXA 3WQQA 1I3LA 2I6TA 4TVOA 3FNGA 2NVUA 4BNLA 5EQDA 3MWEB 3ZZNA 3DAGA 5C3MA 1F14A 2BGKA 1XR3A 3CINA 5LDHA 4Q3AA 3DWFA 1LDMA 3KUXA 4PG6A 1ZMOA 3VH2A 2J5QA 3HADA 2IYOA 1BVUA 4FS3A 1ID1A 4TQGA 4AJOA 3WWYA 1KY4A 3OEWA 4HBGA 5IJZA 3ZU3A 3EZLA 3Q6IA 2XXBA 1AHIA 4E4YA 4H3VA 2E49A 4E5MA 2FR1A 1E3WB 4N7RA 3BMNB 4E2YA 5HBRA 1PJSA 4ALNA 2HK9A 4FW8A 6ADHA 1HZJA 5BNIA 1DJQA 5AXDA 4N5NA 2Q1TA 2R2GA 4XDZA 1H6CA 2W2LD 2QRKA 4YEDA 2NNLD 5TGDA 3ULKA 4E5PA 4PLTA 4XQCA 2QQ5A 3SJ7A 2I67A 3WJ7A 3G1TA 3I4FA 5T6BA 5K6AA 2AG8A 1EUZA 3IUPA 2X8LA 3BTOA 1ISJA 4WUVA 1U1IA 3E48A 2CDBA 1P9LA 5ITVA 1B8PA 1C0PA 2VTEA 3WGIA 5JY6A 2WM3A 1B7GO 3NJ4A 2IEBA 1LDEA 1IUKA 3GMDA 4WEOA 3H3FA 2C29D 3GA0A 1HEUA 5JAZA 3DXFA 3L07A 2JD1A 4RF4A 2H5LA 1UP4A 1SC6A 2RBEA 5T64A 2YV1A 1H93A 2C7GA 4YVFA 1MP0A 3GRKA 4LMRA 4K26A 1FDSA 3ZWXA 1WZIA 1U2GA 3BA1A 3I9JA 1IZ9A 1KBZA 3VDQA 3IQDB 4PFJA 4W9NC 3ROQA 3ICPA 1VPDA 2DFDA 3HWRA 4YAKA 1PJCA 1DLIA 4JBHA 3PJFA 2G1UA 3JV7A 3KEQA 3NTQA 4I5FA 3K2BA 3IJPA 3GZ4A 1G0OA 1CJCA 3ZW8A 4BNJA 2CFCA 3RBZA 1IOLA 5U9CA 3W8DA 3WYEA 3QE3A 1WMAA 2OO5A 4DIBA 4UVHA 1WPQA 1TXGA 1BXGB 4CL8A 1JU9A 4CM4B 5F3RA 1WDLA 3S8MA 4FGWA 3T7EA 3IOYA 4TRRA 4XYEA 4RDIA 1I01A 2WMDA 1GD1O 2JJYA 2B35A 5DBGA 4OJNA 3H5RA 1BXZA 3OM9A 2CUKA 3KYCB 1PTJA 2GRAA 2ZK7A 3CZRA 3W4IA 5TC4A 2OORA 4W82A 4BOYA 2PZKA 2EEZA 4Q3BA 3D3EA 1U9JA 1ZKMA 2JAHA 1N1EA 4JJGA 3VKUA 4C7KA 1UUFA 4BNGA 3OMLA 4WLFA 3U9LA 1YQXA 1WDMA 4OQYA 3H2ZA 3KTDA 3RC7A 3JD1A 3PHJA 5BSGA 1E3WA 3RQSA 3BMNA 2ZCVA 1UXIA 1YS4A 4WLUA 2CVOA 2PV7A 4B4OA 2VWPA 5HTOA 3ZWBA 1HT0A 5DP1A 4DXHA 3CSDA 2GERA 1PQPA 5A5EA 1RM5A 4B4VA 2X5KO 2P68A 1LEHA 4EUHA 3CZMA 4Q3CA 2GO1A 4NPCA 4ESOA 2QG4A 4PRLA 3V5NA 4GI2A 2Q46A 1I24A 3WGTA 4R4JA 2E37A 4RL6A 4E31A 4QTZA 2WJPA 2FSVA 3FSRA 4J4HA 2EV9A 2H63A 1HYGA 5K6AC 3ZV6A 4BNWA 3OA0A 2EERA 3JD0A 1PJBA 4XJSA 3WBFA 4PZEA 3CTMA 5KKCA 3VPFA 3W8EA 3BHJA 3QLJA 4S1VA 1PZHA 3WJAA 4RZHA 2P9CA 2YHIB 1MG5A 5CEEA 2G17A 5AVOA 1ADGA 4XIYA 1X14A 3ETGA 4BO5A 1H94A 4OHUA 4WCFB 2I65A 2X6TA 5GZ6A 4KDEA 3INRA 1NX6A 4IQGA 3K8ZA 2W2LA 3RU9A 1UXKA 1LLQA 3VH4A 4E2ZA 3OJ0A 4YQZA 2DQ4A 4PN3A 1P1KA 5C5IA 4KZPA 1U4OA 4Z9YA 5GZ3A 1NBOA 4CMGA 4R5HA 3HDJA 2RCYA 5BT9A 1YQGA 2GN9A 1PL7A 3OJFA 4ZGWA 3VH1A 4I1IA 3TQHA 3ZHZA 1BXGA 4CLOB 3ROPA 5JC8A 4CM4A 2NU7A 1WP4A 1BTOA 1R0LA 5IF3A 4J6FA 1R6DA 3W4JA 2BH9A 4CUKA 3I9NA 4GKBA 1NPTO 4F45A 4R1NA 3UAGA 1N1GA 3KYCA 3PHIA 3VOSA 4H15A 1J49A 3B6ZA 4ZVVA 2C20A 1UJMA 1PJTA 1UDAA 2V6FA 4IY1A 3GAFA 3L77A 3ONFA 4B8ZA 4RJTA 5KJ6A 2B36A 4L4RA 3GG2A 4DIFA 4YAJA 1A7AA 4NFHA 4L4XA 3SBOA 1U3UA 1VLLA 4CMBA 1GPJA 3FNFA 1P3DA 1HDOA 3GVHA 4QECA 4WLOA 3H65A 4ZRNA 1L7EA 1WNTA 2NV6A 5DDIP 2F00A 1CDOA 1FK8A 2DKNA 2UVDA 4XCVA 4BNIA 4M55A 4EITA 1RYDA 2GYYA 2YY7A 1O89A 4J91A 3RC9A 2GNAA 2BI8A 5KNLA 3E03A 2J5KA 2AEFA 5G4LA 1PQUA 1QRRA 2DBVO 5A06A 1O0SA 4CLRB 3WNQA 4C7JA 3AU9A 4EUFA 4RVHA 3N58A 2OOSA 2D5AA 1P1HA 4JP3A 3UW3A 1YKFA 1H0KA 1MC5A 1E6UA 1CERA 5EL0A 1MB4A 4LISA 3NT4A 1GTMA 2YHIA 1OAAA 3C7DB 3JQGB 2HSDA 4XQ9A 3DEYX 1LSJA 4YYZA 5U1PA 4TRMA 5A04A 4WCFA 4ZU3A 2Z5LA 2SCUA 4EBFA 1DB3A 1MX3A 4Z9FA 3JYPA 4YCAA 2YV3A 3ZCXA 1F8GA 3M1LA 2B5VA 4BKQA 4CMAA 3I4CA 4IXTA 1C1XA 2YFHA 4BB6A 4BNFA 2RHRA 5G0UA 3UUWA 2GZ2A 4GX5A 3AUUA 1KVQA 3HFSA 1IY8A 4CLOA 2FOIA 4GX0A 4RO0A 2EP5A 3PYMA 4DRYA 2VYND 5G0SA 5L95A 5B12A 4M87A 3U3XA 2HMWA 4Q39A 4IDFA 5JS6A 5U4QA 3RI3A 3H3JA 3O8QA 5ITWA 2JFFA 4DPMA 5TRTA 2D5CA 3DBHB 3QV1A 1UXHA 1ZCJA 3DHNA 1GUFA 2I9PA 3H9JA 1Y7TA 4XD2A 2Q1SA 3H9EO 1Y6JA 2VZ0A 4U6SA 3HHPA 2DT5A 2BHLA 4FFLA 4M54A 4OSPA 3VZQA 4OSOA 3BMOB 2JD0A 2Y1OA 2HLPA 4ONEA 3DHYA 4K6FA 4YQYA 5ILOA 1ISFA 3LC7O 4YAEA 3EC7A 2VWHA 2O7SA 1NVTA 1HSOA 2C54A 5JSFA 5TIIA 4RPJA 4WLEA 4OKIA 1A4IA 4CMJA 1GCUA 5HA5A 1T4BA 4WKGA 4B79A 3CEAA 1BXKA 1GUZA 1T24A 4ZD6A 1P74A 2PH5A 3UHAA 3CH6A 3E5RA 1QR6A 4GL4A 3GNTA 4CMHA 3UKOA 3IL2A 4MVJE 4DIOA 3DOJA 4RQUA 3PYXA 2NTVA 4FBGA 1LDBA 3QHAA 1KIFA 3HZZA 2Q3EA 4IQ0A 3E6AA 5HM8A 1P0FA 1PSDA 4CLRA 1HZZA 3QSGA 3CE6A 4ZA2A 1I8TA 2RIRA 4WJZA 2IXBA 3TJRA 1NFRA 2PZJA 2RAFA 2I3GA 1RM0A 4Z0HO 1HDRA 1XU7A 1E77A 2PKRA 3JQGA 5CPBA 1VJ0A 4DLBA 1PGPA 4Z9XA 1AN9A 1HLDA 1GEEA 4ALKA 1VKNA 3UCFA 2B83A 1R4NB 4BQRA 3AM5A 3QJ5A 4BMVA 3I9OA 3PPIA 2ZB7A 3VHRA 2CVZA 1WW8A 1C1DB 1XQ6A 3BHIA 1TT7A 5G0TA 2QIOA 3P19A 4IDEA 1SNYA 1BWSA 3T4EA 5EMHA 2DBRA 3EGOA 4TROA 3F9IA 3PXXA 2AW5A 1I2CA 2X58A 5C7OO 4BO1A 1C0IA 4NFSA 3F1LA 1K6IA 5TS3A 1YOVB 2CSUA 3V2GA 2B5WA 1LA2A 1NWCA 3KLPX 3INGA 1GPDG 3DBHA 5TQVA 3HSKA 4NBTA 1BVRA 3Q3CA 2X9GA 2EW2A 4BVAA 4LVCA 1JTVA 1LJ8A 3AM4A 1ONNA 4LMPA 1JKIA 3ZHBA 1G0NA 1NPYA 3KXDA 3OQ6A 5L45A 5TLSA 1EUCA 4IGEA 1GR0A 3JQEA 1KC1A 4PCVA 3IS3A 4QFCA 1LDNA 4RVSA 3GT0A 1B3RA 4UVEA 2V6GA 4BHTA 1EK6A 1BSVA 2GN6A 3BMOA 2J5RA 2UV8A 4CUJA 2PGJA 3TF5A 1R15A 4D0SA 3AY7A 3MJEA 3GRPA 4JBGA 2AE1A 4XJTA 1DIBA 3DHEA 1E7QA 4WE3A 2PK3A 3LLVA 3NDIA 3OH8A 3Q2KA 1HYHA 1E3JA 2XXJA 2VYNA 3OICA 3VKVA 2NVWA 3DOCA 4NJOA 4CLXA 1VJ1A 1T4DA 4FOSA 2V6BA 1DBVO 4JROA 1NYTA 3WYBA 4LGVA 2FR0A 1K2WA 1P1FA 1AGNA 5EPOA 4AICA 2J6IA 1HYEA 2BFMA 3ABIA 1XG5A 4CV3A 4J7CA 4O63O 3QVOA 4G5HA 4XGKA 4ZQFA 3KYBA 3PQEA 2X0NA 3Q1LA 3FNEA 3OECA 3QP9A 4FC6A 4BO8A 1QYVA 3IMFA 3ZH2A 4R5MA 4NZ9A 3WIEA 2VUUA 4G65A 4MIOA 4UUMA 1KY5A 4BS9A 2A35A 1O94A 3KSUA 5BR7A 2UAGA 1HLPA 1LC0A 2DUWA 3K2EA 3PFFA 1NM5A 1P1RA 3IAHA 5F5LA 2DFVA 3TRIA 5JYDA 3ZHXA 4XGIA 3STHA 1QV7A 1R4NA 2C07A 2HAEA 2RH4A 1E3LA 1NHGA 4Q3EA 2HK7A 1A27A 1GAEO 4FN4A 3K5PA 4CPDA 3ASUA 3ONEA 4XYLA 1C1DA 4A5OA 2ET6A 3DR3A 2YDXA 1YO6A 3E18A 3EVTA 3OF2A 4RQTA 3M2PA 1ZJYA 3RU7A 4D3SA 2NACA 3PZRA 4PG8A 1OFGA 4XYGA 3R6DA 1YOVA 2C5AA 1UP6A 2Y99A 1M6HA 4URFA 1QXSA 1UR5A 3WYCA 3R3JA 2EG9A 1DC4A 2X4GA 4J2OA 1FDTA 4II2A 2O48X 4YXFA 2P9EA 3G3EA 4BMSA 3NDRA 4W7IA 2NQ8A 5FWNA 3CUKA 5F1KA 2VT2A 1ZSNA 4IZIA 1IPFA 4G2NA 4MOWA 1I32A 1MFPA 4L75A 4GGPA 4YA6A 2D2IA 3X2EA 1GQYA 4AG3A 2Q2WA 3EDMA 4A73A 3FHLA 4GVXA 4N5LA 3NGXA 4RLHA 5MDHA 4KUEA 4YBZA 1DHRA 3ADOA 4J49A 3PWSA 1E7WA 5L7WA 2AEJA 4R3WA 5DZSA 1Z74A 2VHYA 1ZBQA 3KZVA 3WMWA 3WICA 4BL5A 2WSBA 3DTYA 2V6MA 4B4WA 1GYPA 5CDSA 2HK8A 4NU5A 3V2HA 3WGGA 3S2GA 3E9QA 1Y5RA 5TNXA 3UFXA 1TT5B 3FR7A 5JFOA 2Y1EA 2X9VA 4RPLA 5KIAA 3S1LA 1CETA 1T2EA 4D41A 3GH3A 1KETA 3AI3A 1HDYA 1FMCA 2V65A 1PGOA 4B3HA 3DO5A 2ZYAA 5TF4A 4TSKA 3HB5X 4XRGA 2H1SA 1BGVA 3VC7A 1EEHA 1ZSVA 4NFYA 4H16A 2O3JA 2P91A 1WMBA 3H4VA 2VHZA 3S55A 4W6ZA 4D44A 2FPGA 1S6YA 2Y68A 3K9QO 2HMTA 2ZTUA 3GY0A 3AU8A 4BNNA 3QWAA 3W1VA 4DUPA 4R41A 1GQQA 4IJUA 2ZYGA 2X86A 5IDYA 1TA4A 2VUTA 4R1SA 4MVJP 5TSDA 5HS6A 3U4IA 4MJLA 5B4UA 3VTFA 4RZIA 1O6ZA 5I9MA 2RHCA 5IAAA 3ZHYA 4IMPA 4ZQBA 5H82A 4BV8A 4F6LA 4PLPA 2Z1MA 4JQCA 4PLFA 5L7TA 3FBTA 3JQDA 3GGGA 1LRKA 4UVIA 4YACA 3JQBC 1M66A 4OOFA 4EJ6A 1N5DA 1MC4A 1DRVA 1K6JA 3UH1A 4RPGA 1BRMA 1U7HA 1GCOA 4ZHSA 3P5SA 3PHLA 3JD2A 4WPGA 3HDQA 5KKAA 3ETEA 1Y8QB 5CEFA 1E0DA 5JC1A 1VE9A 3HN7A 3OBBA 2GR9A 3UXYA 3IC5A 2AHRA 5H81A 3I23A 3V1UA 3COSA 3ZV3A 1NHWA 4R69A 3QVSA 1LLCA 4IJWA 1XSEA 3F5QA 4CM5A 5A9SA 2AMFA 5G2OA 1LBEA 2Y93A 3VVBA 3RUHA 4HFNA 3NRCA 3OIDA 4DTIA 3D7LA 5A02A 1U3WA 4AJEA 4XWYA 3VZSA 4Y6RA 2JHFA 1ENYA 3NX4A 4LN1A 1EUDA 4AL4A 1LSSA 4R1TA 3Q11A 4TZKA 3BYZA 4L8VA 1HL3A 1KVTA 2WE8A 1Z75A 2Q4EA 3PZBA 1PGQA 2J3JA 4NHEA 4B8WA 4DMLA 4B3IA 1R0SA 1JAXA 1SB9A 4R01A 5K1SA 1H5QA 2I5PO 3G1UA 3RFVA 2TMGA 3NV9A 5ICSA 4GLOA 3I6IA 3NGLA 4TKMA 1I2ZA 2Y0CA 4L74A 4BNVA 2OGUA 1TT5A 1H9BA 4HNHA 4Y6SA 3HJAA 1J4AA 2CNBA 3GC6A 4B4UA 2E4AA 1JWBB 1M76A 4BQPA 2O3SA 2YJZA 3WXBA 5L4NA 1C14A 4EGFA 3AI2A 1DFIA 4YRBA 4IZHA 1ZXLA 2FMUA 5KVVA 5L40A 3ENNA 1YJQA 3DB2A 1GV0A 1WVGA 4INAA 5I8WA 3JQ6A 1JN0A 4FR5A 5DP2A 4CL3A 4DBVO 1P45A 1ZEMA 5FF9A 1E5QA 2CF6A 4U0JA 3GK3A 1DRWA 1DIRA 2PA3A 4J9VA 5JXWA 4H7PA 4ID9A 1DHTA 4PIVA 1I3MA 3QY9A 1J5PA 2O4CA 5G0WA 4CV1A 4WOJA 4ND3A 3RWBA 1HDCA 4MINA 4XEHA 1T25A 3ZNOA 4CMEC 5TT0A 5ILGA 4JIGA 1OMOA 4IPTA 3F3SA 1EBUA 2W98A 4DPLA 4BB5A 1U8FO 3PGXA 3S2IA 3GHHA 4GSLA 4JP2A 3GGPA 2VTDA 3SVTA 4XKJA 1ZZEA 1WWKA 4CV0A 2I99A 3CPSA 4YT5A 2W2KB 3D4NA 3K73O 5A4DA 2HMUA 4E6PA 3GVCA 3E1KA 4M86A 4QSMA 4GPD1 3VH3A 1QV6A 3R3SA 4EYEA 4PG5A 4RGBA 1GEGA 5JCXA 5IXYA 4PLCA 1ADBA 4ND5A 1Y8QA 2C2XA 4JNKA 1K5HA 4FFOA 1IB6A 4RF5A 5G4KB 1MV8A 1GDHA 2EJVA 2C2YA 2J3IA 5JPIA 4QEDA 1A7KA 4J90A 2AQKA 3TWOA 5I9LA 1NR7A 1YJ8A 3GNQA 3ANNA 1E3SA 4IS2A 3H7AA 2FN7A 4W4TA 4YJHB 5JAQA 2X0IA 2FP4A 1B16A 2VT3A 4OXNA 2B69A 1HKUA 3L6EA 2WDZA 4J16A 5FI5A 3BZUA 1B8VA 2HO5A 3ZDFA 3JYQA 4O59O 2YW9A 5IXSA 1KVRA 4IDDA 2JCXA 1CYDA 2ZJ0A 4FPXA 3ZWOA 4C4OA 1CQJA 3IP1A 2QYSA 1N2SA 3N7UA 3O9ZA 4J9UE 4I8XA 3LSYA 1N7GA 2DTXA 1MUUA 3DMTA 4JJFA 4R9SA 4AJPA 1JDJA 4FCCA 1Q2XA 2J8ZA 5COAA 3WIDA 2Y1CA 1H2BA 4CLDA 4ZQHA 4EW6A 4U8GA 3R1IA 2C82A 3D4PA 4O1MA 2QHXA 1LUAA 4FFPA 3IJRA 5EINA 2ZJ1A 1ISHA 1YE3A 1T1SA 1HXHA 3JTMA 4MKXA 2W4QA 4BGIA 1XWFA 3KBOA 1P44A 1EVYA 4A03A 3KB6A 1JKJA 2BF7A 3PK0A 4K6CA 3LC2O 3MOIA 5IDWA 2QYTA 4DYDA 3ZNNA 3RJ5A 1HTBA 1VM6A 3W6ZA 3ONDA 5B1YA 5ICMA 3K92A 2AQIA 3EUWA 4P4GA 3KSZO 4WNIA 5AOVA 1U5CA 3AY3A 4B7XA 4KTTE 1GZ3A 3WG9A 3X2FA 3ZWCA 4YT8A 1U3VA 4A26A 2FPPA 4DL9A 1P31A 3L6OO 4W99A 4RCVA 3GPIA 2B0JA 1ZH8A 4J1TA 2OUIA 4YR9A 5IZ4A 1Z7EA 1C0LA 3WTCA 1UDBA 4P38A 4UEKA 3HDYA 1EQ2A 3HE3A 3HN2A 3DBLB 1Q0QA 3T7CA 2UUPA 4X54A 3HQ4O 5FYDA 3WX0A 4D42A 3GZNB 4GAEA 1F0YA 4ZRMA 3V1TC 4BGVA 3OETA 3U4CA 4OM8A 4E0BA 1F06A 4UUPA 4Y67A 4MP6A 2Q50A 3RFXA 3ZI0A 5G4KA 1MA0A 1ZMTA 3AUAA 4AJ1A 2DVMA 4EEXA 5DCWA 4FJ0A 1M67A 1YRLA 4BNTA 4A27A 4JXKA 2ZQZA 3DFZA 5EN4A 5JYEA 3U4HA 1Z7BA 3LF2A 4YJHA 3ZNQA 2O7QA 4L9RA 4NH4A 1LLDA 1TVEA 2QRLA 3EY4A 3PWKA 1LQTA 4GQAA 4RF3A 1K89A 4ALLA 1A9YA 1F12A 3OQ1A 4A7PA 3CIFA 3ZWNA 5JBIA 3H5NA 4HP8A 3PHGA 2ZB8A 3GOHA 3L4BA 1YBVA 2X1HA 5H83A 1FF9A 1LSOA 4DC1A 2JD2A 5CDTA 4ALMA 1P0CA 3ST7A 3VZPA 4HFMA 2JAPA 1QKIA 3RD5A 4ZQGA 4CV2A 2ZB4A 1SOVA 4FFMA 3RBVA 4YWJA 3ASVA 3GGOA 1D3AA 3IKTA 3RKRA 1DPGA 3DMTC 3JD3A 5T5QA 2YYYA 3LYLA 3GG9A 5LDGA 1GZ4A 2IDZA 2PKQO 3KSDO 4IIUA 2JFGA 1UZMA 1TLTA 1V3UA 5HRUA 1HDXA 1BW9B 3TSCA 4NNJA 1VC2A 4CJXA 5COBA 4BKOA 3DZHA 4IINA 4DYVA 1MGOA 3LT0A 4MPDA 1B26A 2PD4A 9LDTA 1YWGO 2GGSA 3WBBA 4KQXA 1Y9AA 2IZ1A 4BUCA 2B37A 5ES3A 3VVCA 3LF1A 2GF2A 2OFPA 4L73A 4TRJA 3WSWA 7ADHA 1TI7A 1K3TA 1WDKA 4Y98A 2CF5A 4OOEA 2ILTA 4I5DA 4ROSA 1R0KA 2O50A 1MXFA 3KV3O 3DBRB 4PVDA 4MVJG 1EE9A 4M8SA 4QFDA 5TX7A 4CQMD 4LSWA 2YUTA 1WLYA 5JE8A 4GMFA 3DBLA 1JA9A 5ADHA 4PG4A 3MJ4A 3GZNA 5JCJD 4BO3A 1K6XA 2BFOA 3OEYA 4UAGA 1ENPA 3FTNA 4HNGA 1U7TA 1PR3A 5CPFA 2OHXA 4MKRA 2H9IA 4ND2A 5FEUA 4R68A 3JCZA 3ZWVA 3AW9A 1G6KA 1Q1NA 1SZJG 2Q99A 2DUUA 3MJTA 4WCDA 4BNHA 1T1RA 1PGNA 3QRWA 4BNUA 3BTVA 1IHYA 4CLEA 3JQAD 2FRDA 1PL8A 3U5TA 2LDBA 1YB4A 1ENZA 1JWAB 1U8XX 3PEFA 2CMDA 2OXIA 4BO0A 3UICA 4E5KA 3PHHA 4UEJA 3OA2A 1XCBA 1FDWA 2E6UX 3R0IA 4UEOA 4KWIA 1DXYA 3H6KA 1A72A 1IULA 2HDHA 3IIEA 5CDUA 3M2TA 4NJMB 1O5IA 2Z1NA 2FZWA 4CM1A 1HDGO 2OP0A 3E9MA 3I9KA 1R66A 4CQMB 5IDQA 4LVUA 4DWVA 5KVSA 1I0ZA 4MP3A 3GN1A 4IQ8A 2VHXA 5C37A 4N18A 4LCEA 4J2HA 2HJRA 4XR9A 4BKUA 4D46A 1PS0A 3CMCO 1T2FA 3BTUA 3DQPA 3LT2A 4AVYA 3D5TA 4PZDA 1LDYA 1XYGA 2YDYA 4FJ1A 4YPOA 3W8FA 3C3XA 3JYLA 3Q0EA 4B7CA 1NR1A 4FOOA 2ZIZA 2A4KA 2C5EA 2WYVA 4UVGA 1HF3A 1JLLA 4WEQA 2E82A 5IZCA 4DVJA 2C0CA 3JQAB 1BW9A 3GFGA 1LTHR 5JMWA 2Q1WA 3DOOA 1GV1A 2D3TA 3ICCA 3MOGA 3QQPA 3VPGA 5TJHA 4WCFC 5J23A 5DN9A 5KTKA 3GFBA 2NVBA 1HE5A 1PZEA 3HB4X 5ER9A 4OAQA 4HY3A 2BD0A 1X0XA 8ADHA 1T2CA 4OH1A 2PTGA 4MKZA 4I08A 4AJIA 4O5OA 4WGGA 4F46A 1CRWG 1UZNA 3Q9NA 1QMGA 1AXGA 1U2DA 3PWZA 3AI1A 1AHHA 4XB2A 1ADFA 2YHUA 2YFQA 1DFGA 3WGZA 2V7PA 3DBRA 2EF1A 3ITDA 1M2WA 3JQFA 4J4TA 2C7VA 3C1AA 4NBWA 4A0SA 2NU8A 4BO9A 3A9WA 2J3KA 2J3HA 2PWZA 5T57A 3ZWAA 4AJ4A 1HETA 3G0OA 3EVNA 2NU6A 2A9FA 2PZMA 5T8KA 4D45A 1MG0A 2A94A 3ZNPA 2BFPA 3SLKA 3RUFA 3TL3A 4ALIA 3TNLA 3PDUA 3WMXA 3JQ7B 1RM4A 3EW7A 3OQBA 1DEHA 1U4SA 4D3FA 4O6VA 2HU2A 4OKNA 4J7UA 1N7HA 2AG5A 2EHDA 2VHVA 1F17A 1Z45A 1XGKA 5A3VA 7MDHA 1SEPA 1KEVA 1EMDA 4GGOA 4XIJA 1H2HA 4CMIB 3NUGA 4L4SA 1PEDA 4KUHA 1Y5MA 1YBAA 1Q7BA 1ZEJA 4GX1A 4LW8A 3WSVA 3MJCA 3QVWA 3NTRA 1HDZA 3EAGA 3IKVA 3NAQA 4EUEA 1S7CA 4NJMA 4FC7A 2OBNA 3PJEA 4U5QA 4CQMA 4NIMA 1Y8RB 3BMQB 3H2SA 2D8AA 2GZ1A 5JCJA 2Y1DA 2IZ0A 3C85A 4NDNE 4BGEA 2QX7A 3JQ8B 5EJ2A 4D79A 3LLSA 2PGLA 1GU7A 4EJ0A 3QWFA 2NU9A 3P7MA 3G17A 1SO8A 1GL3A 3PLNA 3U09A 1Q7CA 4QT0A 3JQAA 3AWDA 4ZICA 3IP3A 3ZU5A 3D3WB 4DLLA 1D8AA 3DMYA 4RVUA 4BKRA 1LC3A 1GZ6A 5BNTA 5IZCC 5ENVA 1SPXA 1R16A 1NXQA 2JCYA 3L0DA 5ER6A 3DL2A 4FSHA 4AJHA 2VUSA 1MXHA 3LVFO 3KRTA 4GSKA 4LK3A 4CM7A 1N8KA 1U28A 5BSFA 1SEVA 1ARZA 1A4UA 4KWHA 3PP8A 1LXCA 3HNPA 5CP8A 2OZPA 3D4OA 3GPDG 3QVXA 1V9LA 2HMVA 1OOEA 2BI7A 1DAPA 2EKLA 3EMKA 4YB8A 3BTSA 3WFJA 4E30A 4ZQEA 1EFKA 4R16A 1CQIA 4XDYA 2Y0EA 2CDAA 2R00A 2WYWA 3JQFC 4DBZA 4EJMA 5F1OA 2OMEA 4Y9DA 3UCXA 4Z6KA 1Z73A 1W73A 4HADA 1XEAA 4TZTA 4UULA 2OP1A 1KC3A 4PLGA 1H9AA 1KEWA 2PKQP 1T26A 1I5RA 3GEDA 1CEQA 1CIVA 2YV2A 3OIGA 1SAYA 1DIHA 3O38A 5B4VA 3ZWPA 2ZTLA 3FR8A 1NTOA 2G5CA 1I2BA 2OL4A 3PQDA 4PRKA 4D43A 5A1TA 3D1LA 3WTBA 1PJLA 3WR5A 3C7AA 3D0OA 3SJUA 1L1FA 4I9HA 1ZW1A 4FQ8A 2G76A 4OIMA 4BO7A 1ZO8A 2I76A 3I6QA 4AJNA 5K9ZA 1IL0A 3MTJA 4M89A 3S2FA 4DQXA 2VRBA 1LI4A 4IDBA 5MGBA 1SBYA 1Y8RA 3AFMA 3FI9A 5DBFA 5AXAA 3WS7A 3BMQA 2DLDA 1JKFA 2BGLA 3K96A 4Q9NA 3GMSA 4PZCA 1Q0LA 1VSUA 2Q1UA 2OBYA 4MIEA 1Q0HA 3BIOA 5ENDA 3JQ8A 5A9TA 4OXKA 1PS8A 3I3OA 3JSAA 5IFLA 1UXJA 3JQ9A 2PNFA 4NBRA 1W6UA 2DBZA 1RJWA 2BMAA 2QZZA 4PLWA 1FXSA 3D3WA 3HFGA 4W9NA 2IZZA 2Q2VA 3B1JA 2YQ5A 3DAFA 4OL9A 4CM9D 4DQVA 3GAZA 4KP7A 4QO7A 4NK4A 1DFHA 4IJKA 4AJJA 2UDPA 4O0LA 4HFJA 3TDKA 3RUAA 2CZCA 3G49A 5JY1A 4MDHA 2EXXA 1ONPA 2O3UA 4II3A 5CFZA 3DZKA 4FDAA 1M6WA 3SC6A 5BQFA 3QWBA 1VKOA 4R51A 2GN8A 5EIOA 5CEJA 2PFGA 1EVZA 4GBJA 2NQTA 3PVZA 5G0VA 1DRUA 1EK5A 4RVGA 2EWMA 1WXDA 1PGJA 3ROMA 1D4FA 2GZ3A 2BKAA 2PD3A 3PI7A 1NQOA 5IN4A 2RH8A 3I9MA 1AUPA 1V8BA 1E3IA 1YGYA 1OC2A 5JO0A 1UAYA 4W7HA 5A3JA 1DLJA 1B3BA 1QYXA 3SLGA 3A4VA 2PH3A 2R00C 3QW2A 1C3VA 2X5OA 1I3KA 4ITUA 3WLEA 1GY8A 5L9AA 2UYYA 3N74A 3MJVA 3PJDA 5EERA 4Z0PA 2Y67A 3VPHA 4AJLA 3TFOA 3K31A 4QQRA 1E1NA 4I5EA 4E21A 4J7XA 3K6JA 2P4QA 3LZ6A 2PLAA 1NAHA 5I7SA 1NFFA 4PGFA 1PQWA 4L76A 1EE2A 4FGSA 4R9RA 3FN4A 1X7GA 1B14A 3GVIA 4F6CA 2GUGA 3O03A 3WQSB 1X7DA 1NVGA 1RM3A 5DCYA 5BSEA 4P22A 2HRBA 5IDXA 3KLMX 3EZYA 1XIVA 3F4LA 3MEQA 4RDHA 4GMGA 4N5MA 3WWZA 4Z3DA 5A03A 3AUSA 3RCBA 1XKQA 3KYDB 1E1LA 1DAOA 3GVPA 2EGHA 2YZ7A 4UUOA 4E5YA 4JBIA 1NAIA 3VPSA 4IUYA 3QA9A 1FJHA 1V3VA 5I7EA 3RVDA 3V8BA 4TWRA 3TOZA 5B37A 1ENOA 1KS9A 1YQDA 4KQWA 5AXBA 4LRTB 1JVSA 4RF2A 5I7VA 4E33A 3ZN2A 4DPKA 1CF2O 1DC3A 1ZSYA 1PU2A 1HWYA 1RWBA 4MIYA 4IDAA 1SMKA 1ZIDA 5GMOA 3UVEA 1YL7A 5L7YA 5F1PA 3V1YA 5KWEA 1VL6A 1KERA 4HUJA 4YT4A 3RIHA 2IE0A 1M75A 3JQ9C 3GNSA 5DCUA 3WGQA 3QWHA 3WDSA 3EK2A 4AFNA 1ZNQO 2BLLA 1J6UA 3F6YA 1G1AA 2BFAA 4UVDA 4J4BA 1HE2A 2D59A 5KVCA 1BDMA 2P2SA 4NQZA 2VYVD 2PY6A 4OO3A 4NK5A 3RSHA 2GLXA 4KUGA 3SC4A 2JKVA 1ZJZA 3I1JA 4LCJA 2XF8A 4CLHA 1PX0A 3QWIA 4JX8A 2D4AA 1OBFO 5BNFA 4E12A 1QYDA 1P77A 4IM7A 4XA8A 3F4BA 4IBOA 1CWUA 4D7AA 3DONA 3H9GA 3MWDB 4IIVA 1NQAO 2B4RO 2Q2QA 1PWXA 1O95A 1UZLA 2PZLA 5L3ZA 4AJKA 2O23A 2HMSA 4GWKA 4WLVA 3F46A 4S3MA 2ZTVA 4IDGA 4E32A 4EEZA 3JQCA 3S2EA 2EJWA 1YL5A 5JAMA 3TZHA 4CM9A 1NQTA 4XB1A 2Z95A 2FR8A 3AOGA 4R1UA 1YBMA 3CXRA 4FD3A 1IPEA 1ONOA 3RFTA 3TL2A 3VZRA 4A2CA 1PIWA 4Q3NA 3UOGA 1L7DA 1IYZA 1YL6A 1GADO 1E7RA 1OI7A 4E13A 1H6DA 1JW9B 2EGGA 3W6UA 2CY0A 3GF4A 1VSVA 4YRAA 4LSMA 1D7OA 1LQUA 1UXGA 1ZVMA 1VL8A 3P2YA 1NQ5A 1NNUA 4CM8B 3KYDA 5AXCA 5HS4A 1NASA 3E8XA 4E5NA 2FHSA 1R37A 2AA3A 4NR0A 1V6AA 5DOVA 1LU9A 3NYWA 5JMPA 2PGDA 2UUOA 1XELA 3ZWMA 4UUNA 2NADA 4QUKA 4OQZA 1GUYA 4RVDA 2P5YA 2A92A 5GY7A 4I9NA 1LLUA 4BNZA 1UAGA 4YRDA 1Y81A 1JVBA 1ZUD1 4LRSB 3O26A 1PWZA 3FBGA 1N9GB 2O3QA 1QG6A 3E5MA 1HE3A 1A5ZA 2WWRA 4YAIA 1B8UA 3KM0A 2H6EA 4WLNA 4GLLA 4CR8A 4BNYA 4BGUA 3H9UA 2W90A 1ZK4A 5DF1A 4PLVA 3OHSX 2VOJA 5DT9A 1BG6A 3L4SO 3PIIA 1RPNA 2E48A 1DOHA 2BGMA 1LDGA 2NM0A 3BMCB 1C1XB 4BMNA 2W2KA 4BNMA 5CG1A 4A10A 5K0ZA 4ZN6A 4PLZA 1PJ4A 2QRJA 2X5JO 4JLWA 1FDUA 4PLHA 4K28A 4BKPA 1YONA 2TMDA 4J1SA 1PJQA 4J3FA 2G0TA 1AXEA 1LRLA 4KOAA 5FI3A 3RC1A 3DBVO 3ZV4A 3WNVA 1AE1A 3P2OA 4IDCA 3MCVA 3O8QB 3ROKA 3RC2A 1P1JA 4DA9A 2NTJA 4NI5A 4ILKA 4NG5A 4D0RA 1U3TA 2AEMA 1X1TA 2NTNA 2P4HX 3OJOA 2P9GA 3WGYA 1OC4A 1IZ0A 5AYVA 1I36A 5JLAA 3E82A 4GVLA 2VYVA 2DAPA 2GCGA 1UH5A 3ZV5A 4K9DA 4R3NA 2VCYA 1DJNA 3LT4A 1NFQA 3NEPX 4NBUA 5TJ9A 2ZATA 1E7MA 3AUTA 4N54A 3VPXA 1XLTA 3JYOA 1XQ1A 5EQFA 4U7WA 3H5AA 2B4TO 8LDHA 4DQUA 1V0JA 3H8VA 4MP8A 1E1MA 3AY6A 3ZWYA 1PL6A 1UDCA 2VHWA 1X15A 4GKVA 2C59A 3L6DA 3NJ8A 1GQ2A 1EFLA 1W8DA 4BIIA 1XHLA 4CM8A 1PJ3A 4OGWA 3RBXA 2GPTA 2WTBA 1ZK0A 4JK3A 4ND4A 4OYRA 3UN1A 5B4TA 1I10A 1X1EA 4CMKA 2NWQA 3BAZA 3U49A 1O9BA 4BO2A 2HCTA 2X0JA 5C7LO 3A28A 3GUYA 4TRNA 3UGKA 3TN7A 3RUCA 4E2WA 1Z82A 3QVTA 3F5SA 4GH5A 4RPKA 2EW8A 4YJDA 4XQGA 3ZWWA 3OFSA 3WFIA 2IEDA 3NDJA 5KJCA 1KEUA 4B7UA 3C24A 3ON5A 1N9GA 3FPLA 3BXXA 4MO2A 4HXYA 1QORA 4KDFA 3PFWO 1T2AA 3EYWA 3KVOA 4MVJH 4YJGB 4M1QA 1BDBA 2I3AA 4TMFA 4YTEA 4AJ2A 2WYUA 4IS3A 1YVEI 3ETDA 1P33A 1QLHA 2G82A 3IUSA 3KO8A 2HQ1A 2O4UX 1GYQA 3OSUA 4Z3KA 1SOWA 1HSZA 5L4LA 3BMCA 3FPCA 3NT2A 4DGSA 2FZEA 2F1KA 4MVJD 2DTDA 2EP7A 2VQ3A 5DOZA 4WASA 4J43A 3AJRA 4DLAA 2GN4A 3OIFA 3GDFA 1QLJA 4IJVA 5F5NA 1D1TA 4K1LA 2X7HA 3PTZA 4IXWA 1X7HA 2VNSA 4XR4A 4NBVA 5I8ZA 2CVQA 1ZK3A 4FFRA 4EZBA 4B3JA 2AXQA 3A1NA 4JJIA 3PQFA 2EKPA 2NUAA 3B1KA 4EI2A 2D0IA 3I83A 3L9XA 2X9NA 3DFUA 4J1NA 4L0QA 4M49A 3ENKA 2GSDA 2JHGA 5A05A 3FWZA 2WD7B 1X13A 3RKUA 3LDHA 1VI2A 5KOIA 3HG7A 1ZK2A 4IGFA 4JN6B 3WGHA 2VOEA 2I66A 4HX5A 1IHXA 3M6IA 4HV4A 1XDWA 3L4BC 2GDZA 1R12A 3INTA 4Q3DA 1DIGA 1VJTA 5C7IO 5JNLA 1UP7A 3ZU4A 3WOHA 3B1FA 4JGBA 5DBIA 3I52A 3BHMA 1EVJA 3RJ9A 5JDIA 5FFFA 1RKXA 4WECA 1NP3A 4YDRA 1P1IA 1ULUA 3AFNA 1VL0A 4XYMA 2AE2A 3WGOA 3AOEA 4IMRA 4CR6A 1QSGA 3G79A 4WOKA 4ZJUA 1DIAA 4EDFA 4Y6PA 1PZFA 4J1QA 2ZCUA 4DREA 4PVCA 3DZFA 3LU1A 2AQHA 2PR2A 3ADPA 3GEGA 1JQBA 3MZ0A 2CDCA 2X0RA 3DTTA 3FF4A 4GX2A 4FIZA 3CKYA 4RVFA 4D3DA
chains in the Genus database with same CATH superfamily
5JRZA 1VECA 3ANMA 3DZIA 5JNUA 3SHQA 3HTXA 1QQBA 1EBFA 2IYVA 2Q1YA 4LDNA 4ALJA 4HNVA 3UUFA 1TOAA 3BJZA 3HJCA 4FE4A 1C9EA 5AJTA 2HKIA 2WIAA 1LNQA 4R7GA 1JZSA 1NWHA 3GEMA 3E9NA 3W5IA 2JK0A 4IDNA 4X24A 5FBRB 1E7YA 2ZITA 3CLHA 2QYHA 3GT4A 3HVIA 5LB4A 1MCZA 5FPHA 4INPA 1LWNA 1T0UA 3C8DA 4LGYA 4LV5B 4MVJM 3U7RA 4ZOLA 4DNPA 5JHGB 3OLQA 2EIHA 4RK6A 5ISMA 4CIXA 1LPBB 3SZRA 1RTKA 3WYAA 1NYQA 5HK8A 3U7QA 3B20A 3MYYA 3HRHA 2V4UA 3MAAC 4PFSA 4CN8A 1H9CA 1YHNA 4ZCLA 1T0BA 5KQSA 5DNDA 3D8SA 3RNOA 3RSSA 3W06A 1OU4A 3VTZA 2AC7A 4ZEMA 1BEZA 4CMCA 1K08A 2ZBRA 2AT1A 2CYCA 4X85A 2GSWA 2JGDB 1ESMA 1GZSA 2FEOA 3VNSA 2W7TA 5JMOA 3FNHA 2V7VA 2Z2YA 4X44A 3PQ8A 2HJSA 2P5UA 5I3ZA 1RJ9A 2X22A 3WIOA 1O58A 4PYOA 4Q9KA 4CKZA 1DC6A 1I3CA 1B2LA 2W8ZA 3ANLA 3MWGA 1K8ZB 4V0NA 1APBA 2IYPA 1VB5A 3HCDA 3HCNA 1KZ7B 4IDQA 2ZJ5A 4R2HA 4ZAVA 4ZVRA 3I61A 1EQUA 1OYVA 3U40A 3HUDA 1YZUA 1XU9A 3HGQA 1NSYA 4HXFB 1Z0ZA 4C7BA 2CNDA 3UOWA 5FT9A 1L4KA 2BELA 3G2OA 4FEAA 5FBWB 2WD7A 3HV2A 3A14A 3O83A 3FYHA 2PQ0A 3T4XA 4AP5A 2B4QA 4BWVA 3KOUA 4NRDA 1XAGA 1Q92A 1MDBA 3WKCA 1F8FA 1W30A 1DO8A 2ZXUA 2OQRA 2V7QA 4KQCA 3DZJA 1DMRA 2CL0X 2IA5A 2VHTA 4CM6A 4JEHA 4HYEA 1YDHA 1LNSA 3BPSA 3N6XA 3NIGB 1D6MA 4HDRA 4PG7A 5ESWA 5JR3A 3P45A 3VR3D 2J9FA 2AF3C 2WE7A 2VHUA 2EDCA 3ILHA 2BPOA 4L0MA 2HBZA 4OJMX 3K6SB 4YRPA 4AZ0A 5AMXA 2QVLA 3TW8A 4XDHA 1RMYA 1JQJC 2JCVA 2QT1A 2Q8NA 3AEUB 3ND8A 5WRFA 5HYVA 2UKDA 2ORWA 3B2EA 4L4YA 1M5RA 4RMNA 4NZPA 5J4HA 3GJ4A 2RGBA 3LDFA 2JFHA 2P9TA 4BLOA 1PEYA 4P8RA 5HK9A 2IP4A 3DE0X 1Z3CA 1ZOIA 2XWJI 4MLPA 5C46F 4LF6B 3FTCA 4DLVA 3LV8A 2ACWA 5CFQA 4HN4B 1WKVA 4QXMA 4FKZA 4DCMA 3W4KA 2FZVA 1XA0A 1O97C 4KTVE 2AXNA 1JA0A 4AAYA 4JL6A 4US1R 1TCAA 4MR9A 3SX2A 2AOUB 2XMGA 2ZR8A 3CLSC 3CLVA 1JIQA 1KSJA 2H7CA 1I51A 2I55A 2R6JA 4IQ4A 2VJMB 1EQAA 3I9LA 2REOA 1HQDA 1RLUA 5D84A 4BO4A 1ULSA 1X9GA 5EESA 5JALA 1RQRA 1N2CB 2Y1GA 3QPAA 4G81A 4YJFA 1C9NA 2RI6A 2J31A 4CM3A 4Q1AA 2HWKA 2Y1FA 5FBLB 1XZMA 1IDN1 1L3CA 1ZUWA 5IKOA 5I51A 5TMPA 4DY4A 4V2IA 2QLLA 3ORFA 3VNBA 3AF5A 4TS4A 2CFOA 2J48A 3LWDA 3N05A 5CK5A 4BV9A 2XHZA 3PXCX 1EINA 4FEGA 5IG2A 2JJ2A 3DFIA 3ZXXA 2PKCA 5CA0F 3TIVA 1NBHA 1YZTA 3L5KA 3MELA 3PRJA 2EKQA 2DU8A 3MMPA 1ABBA 3PLRA 3TCXB 3WB9A 3FOEC 1UT6A 4WFQA 1Q7GA 3IDSA 1CS4C 5KJEA 4YT2A 2HWYA 4MVJF 4BU1A 5EWJA 1HTTA 3BG5A 1SQGA 3CKKA 4EA8A 1L6IA 2OD9A 2RC6A 3GYGA 4Z9AA 3VNQA 4D9NA 3KQLA 3AM1A 4XGNA 2I1VB 4TKLA 2BDTA 1ZW6A 2ODBA 3OMWA 2EBFX 3KEOA 4HEA1 3WBJA 3C7CB 3IQWA 3LQKA 1XD2B 1C29B 4FE7A 3T7SA 3ETJA 3L9WA 3PUVA 1X2BA 3LNCA 2NPFA 2RGCA 5C81A 5FTLA 1P75A 4YI3A 1V35A 3HDHA 4IX9A 3CUEF 3OO1A 3DLTA 3SF0A 4GGMX 4CUZA 3RAEC 1YJBA 3GJ3A 4II7A 3WNZA 4CMIA 2POQX 2QL7A 1MAAA 3PDCA 3ESAA 1SB8A 1I3NA 3HYLA 5I4IA 3VAZA 3W5HA 2CV2A 2BEUA 2W6OA 3LRPA 3TZ6A 2GB4A 2VQ6A 3OZUA 2V7GA 4DDHA 2WJYA 4DMMA 5LQDA 4C29A 1N9ZA 4C21A 1YZNA 2ZBGA 3TQRA 1R9MA 2ISQA 1BE8A 1A8IA 1YZFA 1P29A 4F97A 3GJ7A 1PR1A 2OHHA 2Y66A 4Y6GB 1G4HA 5GGYA 4OU4A 4FX2A 3ZKWA 2QUIA 2E4UA 1TEHA 2WU0A 2DTEA 2VWGA 2Y4NA 1LTQA 2Z4RA 2ZBQA 3QOWA 4IUDS 2ZI3A 1ADCA 3RUIA 3UAOA 2C4HA 1K75A 2X23A 4I4TA 4YQEA 5JISA 2ZE6A 3WLIA 1WTCA 5TQJA 3VI3B 3PYLA 1GKKA 2QZ9A 2R6CA 3OHPA 4UREA 4U6QA 1XQWA 4X7MA 3X43A 5C8XA 2C7OA 2EJTA 2J3EA 2O57A 3BGOS 2WHQA 3AR4A 4FJ2A 4QWWA 2OFFA 1M33A 1O95D 2HF7A 1OFTA 3EQ9A 3NKLA 4K9MA 3RR2A 5A5GA 5CDFA 5FWDA 3JD4A 1FFDA 4TWBA 2B1IA 3GVXA 4IFTA 2WQ7A 2A58A 2JLYA 4W5NA 4LHXA 1PV1A 2AYXA 1GCAA 1VJ5A 1BEEA 1U5AA 1YT5A 3KPYA 3D7NA 4LV8B 4Z53A 4XFDA 3RVMA 4CQLA 1YB5A 1LQ2A 3IB3A 4HDSA 4F7WA 3D8RA 1ILWA 5BOSA 1XQ9A 2BC9A 2IU6A 4S1TA 3ZE6A 3C3EA 2GAIA 4C9BA 1ZWLA 2A4MA 5KJFA 4UM8B 1TUBB 1FYVA 2FMFA 3UMJA 4BNXA 5IJ9B 2WQZA 4R81A 5DKFA 2H29A 1V8DA 3KJIA 1PJAA 2NIPA 4FCVA 4LE1A 4W8OA 1KVUA 2B5OA 3W2IA 4EF5A 2E6KA 4D98A 2EX1A 5AW7A 3Q5DA 1H6AA 1LPNA 3A1DA 1DINA 1E9SA 3TZKA 2CJFA 1U8UA 3WLFA 3VU0A 1A9ZA 3DKVA 4NH0A 2V4MA 2Q5LA 4E2FA 2VHJA 1C7FA 1I3LA 3TIGA 3NHSA 1LY1A 4IHJF 1QAQA 1BX3A 2KJQA 2HB6A 4KFTA 4BNLA 5EJEA 3KCNA 4DC9A 3B53X 5C3MA 3T3DA 2CMFA 2JI4A 3Q40A 3R5XA 5JNRA 2HWUA 2V9ZA 2DWPA 3T0GA 4C0SA 5LDHA 2YMLA 1RU3A 1FFXB 3DWFA 2FF7A 4WWHA 1LDMA 2ZT7A 1LKZA 3ADKA 3DL7A 4L22A 3I0ZA 4AXXA 1SVKA 4BLPA 1EWQA 4TQGA 2V03A 4DNQA 4UBMA 1KY4A 5FHRA 1JHVA 3ETCA 4TTVA 4Y2VA 3SC3A 5KU7A 1DC7A 4FYVA 2JZOA 2VSFA 2IHKA 2XXBA 3H8SA 2V7BA 2SECE 1Z08A 2E49A 3CRQA 4UJ3A 1A2KC 5IBQA 5BMVA 1Y7HA 5HBRA 4BJ6A 5BNIA 4MQBA 2LCFA 2AN3A 4N5NA 5J2TF 1FRFS 5GOTA 3GV0A 1HRKA 3E7DA 5TGDA 4HB3A 5B58T 4E5PA 4XQCA 3FWHA 1RJEA 2GUWA 2QQ5A 3EOZA 3G13A 2YWBA 2V5VA 4BX9A 4C1BA 4B43A 1XX6A 1ETUA 1Q0RA 1U0EA 1XZGA 2D7JA 2AL7A 4KACA 4RKEA 2R6DA 3NATA 5IKEA 4KZKA 1AX9A 1C0PA 2XRFA 2VTEA 4DJ5X 3WGIA 5JY6A 1B7GO 4QYMA 3ET4A 2L69A 4OTZA 4H1HA 1K1EA 4EI8A 4F4UA 3FTFA 3MWYW 3MTAA 5EZ5A 2QRHA 3LP8A 3DXFA 1GZ7A 3HBAA 4L5BA 3L07A 2RGGA 3HC7A 3K0FA 2OAGA 3V1NA 3P9NA 4CKBB 3H9BA 3WLHA 2GZMA 3UAZA 3D6FA 2EWVA 5E6RB 1MP0A 1T8UA 1ZWKA 2IELA 3H2IA 4LMRA 4DN6A 4J3NA 1QKKA 1TZCA 2GPWA 2LXNA 3B48A 1LD3A 3WY9A 3ZWXA 3I32A 1D6JA 1FLNA 3G9XA 3PGKA 1WZIA 3BWBA 3SFZA 3V48A 3GGJA 2YZMA 2PA0A 2Q5IA 4QWMA 4PFJA 2M32A 4W9NC 4N7BA 2BBWA 1UZAA 2OPHA 4C76A 4YAKA 1DLIA 3U4MA 1GPKA 2G1UA 3LP6A 3M5PA 5HFNA 3IJPA 5IEJA 1C1HA 4BNJA 3VBEA 4RKFA 2V4ZA 1KZ4A 5TXGA 3DOFA 4M1EA 4GUAA 3QE3A 5IAKA 3WYEA 1WMAA 3H75A 2ALJA 4DIBA 1H66A 3GXOA 5A4KA 5JXGA 4JI8B 1BXGB 3BH7A 3HYTA 4MQ5A 2NU7B 3DTNA 3X1WA 1E4VA 3OU2A 3P0EA 4ZI7F 3FDZB 2W6QA 5KYVA 4QLOA 3LFHA 4JT4A 1I01A 4PPNA 1JYSA 2GXUA 2WMDA 1ZNXA 4HXEB 5EJ5A 3HP4A 2B35A 1LX7A 3JWHA 3O0DA 1E4OA 2OLEA 4LJAA 4LSGA 4RESA 4ZTBA 4BJ1A 4HLUA 1G21B 4EY5A 1KFCB 1F60A 1QNLA 1IBKB 1SXJA 3FNBA 5AIAA 2F3RA 1BXRB 4EAAA 1CG6A 3H11A 3ODPA 1QE3A 4WINA 4JYBA 1E5DA 4W82A 2EJUA 4EY6A 2IHUA 2NSHA 3DEFA 4Q3BA 3DL4A 3D3EA 1E8MA 3IVGA 2WKWA 3BCUA 1T36A 4HDKA 1N0HA 13PKA 4QYTA 4TV9F 3VKUA 4CCWA 1ACLA 4C7KA 4Z4IA 2ZJFA 4BLSA 1NVWQ 4U7HA 1W5BA 4RADA 1YQXA 2ZBUA 3R3HA 3TO5A 4D97A 3H04A 3B89A 3BWCA 2VDNB 5HMMA 2J46A 1OH7A 5GJVC 2ZCVA 1QE5A 4REMA 2CVOA 1G41A 1NBEA 4L9WA 1B41A 4B4DA 3BSYA 4MUJA 1JR3A 4GM4A 7REQA 1FNMA 2PX0A 2H57A 2QTAA 5A5EA 1CV2A 1JEAA 3HCOA 3RYTC 4B4VA 1NUQA 5CYPA 5BN3A 1NF2A 2OB1A 2QN9A 5ESRA 3TEJA 4EUHA 3CZMA 4PAOA 2R62A 3FGPA 4PRLA 4WKCA 3V5NA 4A8JA 2XW6A 1UODA 1XP8A 2E37A 2Q8PA 4RL6A 3MXOA 2RK4A 4QTZA 3WGTA 2QD2A 4BC0A 4E31A 2ADMA 1A0OA 2H63A 5SY4A 4W5OA 4ATNA 3EJWA 1TUGA 4RMHA 2KW5A 3OA0A 1G18A 2EERA 4F2GA 2FZGA 1PJBA 4XJSA 1G8YA 4JQZA 1YZHA 2R68A 4LRUA 2V3WA 3HKEB 3VKHA 4HI0E 1O4VA 3O1HB 1N2JA 3VPFA 1CP3A 3U26A 5IT5A 2RK6A 3OZCA 3N2KB 4U4AA 5ICGA 1WVMA 3WJAA 3DCNA 2VTVA 2P9CA 4B5KA 4WXYB 4OF4A 4JLOA 3ZE8A 4KB5A 4X93A 1XLUA 4BO5A 2BZ1A 3B9BA 1U0OC 2CLDX 3VU1A 2X6TA 4M0CA 1JZTA 1D1QA 2QIPA 3INRA 3CUVA 2W2LA 2CLKB 2GPJA 3DVSX 4NBLA 1LLQA 2AJBA 1ZVQA 1P1KA 3WWPA 2WUWE 3M34A 3AVXA 1PR6A 2JARA 4KEAA 5GZ3A 4R5HA 1M8FA 4JL5A 1PL7A 3HM2A 4LCBA 4MR8A 3A7EA 4CM5A 4D4LA 3OFNA 1E2IA 2VBCA 2A1IA 3BWVA 4WVFA 2KHZA 3ZHOA 3QVKA 3IP8A 2IDJA 3AG5A 2FSFA 3AL2A 4KHPB 1MIHA 3CRNA 4J94A 2UU9B 4DF3A 3PX7A 1DX6A 4RJLA 1NC1A 2ERYA 2O7VA 4KQIA 2G9RA 3L79A 1ZY2A 1R6DA 5CCBA 1FP6A 2A0YA 2BH9A 3ZYCA 2OBXA 3TTWA 1MO2A 1NPTO 4ZARA 3RRBA 3NR2A 3BILA 4P9NA 3PHIA 1KI4A 1RRCA 4QASA 4ZVVA 5IMSA 4L3VA 3QV2A 1P4GA 4RENA 1UJNA 5IX8A 3L7KA 1VHLA 2GI4A 1UDAA 1VPTA 2V6FA 2OCLA 3FKSA 4IY1A 4W63A 2IYYA 2G0AA 3ONFA 1RADA 4BEBA 1CU1A 3VQTA 4NFHA 1RC1A 1NVUQ 1BHJA 2JFPA 4L4XA 4PSUA 3SBOA 1U3UA 3X1MA 4CRWB 4DLNA 3QVVA 4WY5A 3RHZA 1AOXA 4IV8A 4KCGA 1LK0A 4D3XA 1P3DA 1HDOA 2QXUA 2RHWA 1A5TA 1R74A 3CCFA 3EMVA 1FVOA 2ID4A 1GHTA 1OF1A 4X6LA 3P0JA 3SN6A 1WNTA 3RK1A 4AY5A 1PHRA 5DDIP 3U81A 4BLQA 3T9FA 2YWDA 4HZIA 1E4YA 1KQNA 1CDOA 4G26A 2UVDA 4XCVA 2O59A 1UKCA 4RFSB 4I36A 2GYYA 3IELA 1RRFA 1M0SA 4RS3A 2EEPA 4UXHA 2QSJA 4JCCA 3V6LA 4LYGA 2FPWA 3RC9A 2R79A 3E03A 3LL7A 1QDEA 4OMFG 1JHPA 2AEFA 1KOFA 3FH0A 1TZJA 2Q9CA 5K4GA 2FEPA 1PQUA 3WA6A 1UEIA 2A5LA 3Q1KA 2J3MA 1U7WA 4N1AA 4FZVA 1UPCA 2QD5A 3EVDA 3QH4A 2FSVC 3C8HA 3IMGA 3NOVA 4RVHA 3N58A 1F4LA 4EUFA 2YWCA 2D5AA 4JP3A 1PG2A 2WIKA 1CERA 2IPAB 1JHOA 5SYAA 2V0NA 1YJCA 1YFZA 4I66A 1QU3A 4YRZA 5FORA 4LISA 1E94E 1I4LD 1GTMA 2XEDA 2EFGA 2GTHA 3G0GA 3LHFA 4F0JA 4DM7A 4XQ9A 3GLIB 1AKRA 3P0RA 2Z2KA 4YYZA 2CUTA 5U1PA 3O4VA 1V1RB 4RA6B 4B84A 4ZYTA 1M8PA 2HN9A 4DMKA 1GPBA 1S1CA 1SG0A 1XRRA 5KYGA 1THTA 1NJ1A 4E15A 4EBFA 5K8VA 3TXYA 1QFYA 4DB4A 2FMTA 1V45E 1Z0DA 1MRZA 3JYPA 4YO8A 1XD9A 2YV3A 2XNDD 1ZI8A 3ZCXA 4BPRA 3M1LA 4BKQA 5M04A 1QG4A 1KNQA 2WK1A 3M4JA 3QYJA 5CLQA 1MRSA 4JLJA 3PPXA 3FKQA 2VF5X 1IY1A 1E69A 4HZUA 5CLHA 4QG3A 1C1XA 1XL1A 4C6HA 2WHRA 4BNFA 1X1DA 5FH9A 5G0UA 1N6LA 1DS6A 2GZ2A 1JB1A 2GPSA 4D0NA 1NN1A 2G67A 4AG6A 4Z5XA 1VBMA 2GN2A 2FOIA 4MWTA 4CL0A 3JVUA 4UHEA 3GLFB 5G0SA 5EKDA 3H6GA 4M87A 2HMWA 5CTAA 3GB9A 4Q39A 4QPCA 3RI3A 3H3JA 2A7XA 4DMCA 2HADA 1VPWA 3IRUA 5LUBA 1PP4A 3RODA 4G37A 1TVMA 4J0HA 2PRIA 1RVV1 1UXHA 2LRHA 1E9VA 1GUFA 2I9PA 4PHHA 1RS0A 1TIBA 4Z9BA 1GPAA 3H9JA 3RV4A 4XD2A 3PRHA 1VE3A 2R5NA 2Z5FA 2NZJA 2BGJA 4PHCA 2Z4TA 5EIBD 5FBHA 2LUOA 3HHPA 4NS4A 1SK8A 1XHEA 4ZQCB 2BHLA 4FFLA 4OSPA 4R05A 3VZQA 3AQ4A 1W2WB 2G3YA 2G5PA 4O4JB 3COYA 1K88A 5K3SA 3KQPA 3DHYA 3HEMA 5ALUA 1ZCBA 4JUAA 5JOQA 4UEWA 3LC7O 5LP6B 5KB3A 1KQPA 3PF8A 3BQNB 3RYIB 3EC7A 2VWHA 1VJRA 2PDAA 3KJEA 2O7SA 4OP1A 3RS7A 4C08A 2G83A 3DDOA 2C54A 3EOBI 5SZJA 5JSFA 4WLEA 1A4IA 4EX6A 5HA5A 2QDXA 5BUQA 1XHFA 2WOOA 1BXKA 1T24A 1KSGA 1P74A 2Z43A 4RFVA 5KHAA 3CX7A 3BOSA 3K9CA 5HZHA 3LBYA 2JEYA 3GNTA 4JODA 2OTCA 4A3SA 4AZ3B 3W3AH 1GR1A 2OYSA 5JADA 2PIAA 4OHZA 5IP5A 4IIJA 2CNLA 2NUPB 4XWOA 2FWNA 3HZZA 2XYRA 4IQ0A 3E6AA 4BZQA 4S1PA 2P4SA 4DY6A 1C50A 3QSGA 4ZA2A 4J7AA 4F4FA 1MH1A 2A9VA 4M36A 5LQCA 1I8TA 3PDIA 3TD6A 4DCCA 2IXBA 2JLXA 4H0CA 3DKKA 4P2GA 3SSAA 1H85A 2PZJA 2RAFA 2A0FA 3H0KA 3U7GA 4PXSA 2XTJA 4XD7D 4Z0HO 2QTMA 1RACA 1P81A 2NZWA 3SQNA 3QUBA 2QLMA 3EWAA 1JXMA 3IVCA 1VJ0A 1Y6ZA 5ITZA 1AK9A 5F78A 5TR9A 1GXSB 2AJCA 5BNWA 4KGDA 1GEEA 3RG8A 5CYGA 4LDPA 1VG9B 4WDRA 4UAVA 1X2EA 1PX2A 4WERA 3UCFA 3WGNA 5HCIA 3DPSA 5DK4A 3M49A 2Z6UA 5LP1A 1S02A 4BMVA 3PPIA 1E2PA 3R9KA 3WE7A 1FPQA 2CVZA 3B60A 1QGZA 1C1DB 1V1MB 1XQ6A 2J6BA 3OZGA 4B4KA 1ZIPA 4E03A 2EC5A 5AKEA 5FPKA 3EQZA 3FOAA 3JAWA 4LZJA 5G0TA 1DXOA 3P19A 2P9YA 1FXWF 1IATA 1SNYA 2JAOA 2QW0X 3N8IA 4IDEA 4QYSA 2C5HA 3TLZA 5M34A 4P7JA 5BSMA 4TROA 5EKXA 4NCJA 1Y4ZA 4MV5A 2I34A 2RBGA 3F1LA 1K6IA 5TS3A 3D7KA 3ZK7A 1Y6QA 1YOVB 1KRWA 3V2GA 3SM9A 2IZ5A 3CJQA 2CXXA 2JGLA 2PRSA 4HDQB 2PH1A 4FR0A 3B6MA 4EHLA 3DBHA 2I2XB 5T41A 5JWHA 3T5AA 1BVRA 3AGQA 4BVAA 2MINA 3ML1A 4LVCA 4P7GA 3AM4A 2BFDA 1ONNA 4QNRA 4GSYA 1OFHA 4QXQA 5F7OA 1SRQA 3MT8A 2BEKA 3KXDA 3OQ6A 3SSOA 1KTVA 4AMGA 4AS2A 1EUCA 3OKPA 4IGEA 3JQEA 4O4IB 4BFLA 3IAM1 4QFCA 3IS3A 3HBFA 4R2WA 5KNDA 3GT0A 4LXUA 1B3RA 3WVNA 2V6GA 4QULA 3ZI4A 1BJRE 4BHTA 4DSTA 1BSVA 2C2BA 5LQKA 1OAOA 4CUJA 2ARKA 1XMPA 2UV8A 2ZUSA 5IBRA 2HJHA 5C8YB 1R15A 2RGDA 3SYMA 1GQOA 2A3NA 3MJEA 3O2NA 4WRRA 1HBJA 3WMGA 3O95A 4JBGA 3CWCA 4XJTA 1EJ0A 3MAJA 1LK7A 3UY4A 4OQPA 2YMQA 4ODIA 5IFKA 1TYDE 5FWAA 3NDIA 4YRNA 5BV8A 1HYHA 4DLUA 1GUDA 4LXHA 1E3JA 1FTYA 1IHUA 1RXUA 1T29A 5CRIA 3X1YA 1NMZA 2DFLA 2VXCA 2QA5A 3EFBA 4NJOA 1WZ2A 3RS0A 3OU7A 4HAVA 2HNAA 4FOSA 4BE9A 1AD2A 1DARA 3LHIA 4JROA 5JEEA 1GN8A 1GLVA 1IQRA 1MD9A 2WVGA 4OL0A 4LGVA 3UFXB 4CEHA 1PNVA 3OTQA 3FVVA 1P1FA 1U7XA 2F1JA 2JIZD 3ELBA 4CEIB 1IUOA 3LXRA 1GVNB 2FSGA 4BMZA 1U3CA 4BLTA 1L5HA 4HNUA 1MO6A 3SAJA 2AX4A 1ZJWA 1BDJA 3DUWA 3GDHA 3AH8A 3VNUA 3BAFA 4G5HA 4N3BA 5BQOA 2DPYA 3EQ6A 4C43A 5K4AA 5KWJA 2FMKA 1QU2A 4NDZA 3BWYA 2A5JA 5B3AA 3WIEA 3TIIA 2HA0A 1YZGA 4DCGA 3L04A 3VR5A 3TRDA 4P0PB 1KY5A 1VG1A 3H13A 4O4LA 3ZWQA 4NY1A 4LYDA 4QLBA 2LIPA 1WHSB 2Z57A 3UIEA 2DUWA 5CA1F 2DOKA 2YJGA 4NCIA 2A1UB 3FCEA 4Q4DA 1CW2B 3S2UA 1R4NA 2HAEA 4YMLA 2O2DA 1UBTS 3MBOA 4F06A 2PT6A 1JEEA 3GW8A 2HK7A 3HY6A 3DR5A 1GAEO 4FN4A 5J9FA 4CPDA 1DZIA 3NC4A 4XJVA 2W0SA 1HQCA 4AZSA 4YUXA 2YDXA 1IOVA 4LNHA 3EVTA 3E18A 4QXAA 4UNSA 4RTMA 2DFNA 3OAAD 5BWBA 3K8OE 1ODTC 3RE1A 1PWEA 3FSGA 4QPZA 4D3SA 4YAFA 3AHHA 2JDIA 1RRMA 4V39A 4ZV4A 3UAYA 2J0UB 1U0RA 4F12A 2GZAA 3EQ2A 3K15A 3NNNA 5IVIA 3SIWA 3R3VA 1TGVA 2Y99A 2H16A 3FUUA 1IMJA 1M6HA 4GWLA 5CB4F 4URFA 3IIKA 4R2XA 5CTJA 3UK6A 3HU5A 4O8ZA 3GT7A 2QVCA 3DDHA 4YJ2F 4J2OA 4IFBA 2Q7XA 2O48X 4II2A 4LGMA 1DTEA 3G3EA 3QUQA 4FTWA 4JBLA 2DE0X 4F8JA 3F3YA 2NQ8A 5AI4A 3UMRA 2IPOA 5FWNA 3HKDB 5F1KA 5A2QA 2YIMA 2VFAA 5I7AA 2PYZA 1P9RA 5P21A 3PE6A 4Z51A 1IPFA 3OURA 3OZDA 4G2NA 1MFPA 4G1MB 4LZLA 1NW4A 3V4ZA 3VV2A 2GD2A 4FEYA 3X2EA 4ENUA 5C18A 5J3JA 2QSUA 4AG3A 1E0AA 1JGTA 3EDMA 1WW3A 4R7TA 5IW8A 5TMDA 1NZFA 2ZS8A 3TAXA 5K05A 4KUEA 4YBZA 3DULA 1KORA 3ADOA 1KBOA 2QLFA 1VA4A 2YRWA 3PWSA 5CB8A 3EZ9A 4D8TA 4P7KA 3SDBA 1OVGA 1P2DA 2H11A 2VHYA 1MB9A 1YA6A 3QFHA 1GYPA 1GPYA 3AVVA 5CJJA 5I9SA 5BO5A 5DHQA 1CRPA 3N2YA 1TUEA 3E9QA 4BRSA 1CJMA 3FNIA 1PNTA 3IKLA 1VYHA 1NDQA 4DLRA 5KSZA 1W48A 2B61A 1CETA 4KRYA 4Z7OB 3L4KA 3A1EA 3GH3A 4F60A 1GFZA 3BFXA 1FMCA 1NXXA 2V65A 4HMQA 2ZT8A 4PSDA 1I1QB 5ALGA 1C30A 5HIAA 1RQPA 2ZYAA 4TSKA 2F3SA 4XRGA 3EDQA 3VC7A 1MB0A 1ZSVA 4AD8A 3H4MA 3UXHA 1CNEA 4UUQA 2RGXA 3ZE7A 2FU5C 1QGDA 4TXNA 3S55A 5H3HA 2B82A 5EUCA 2M6RA 1YNSA 1X7YB 1EX7A 1PN3A 3LS2A 2FPGA 2Y68A 3K9QO 4BNNA 4K9RA 2PMCA 4DUGD 3L3BA 1OGJA 1QIKA 4H6PA 1WHTB 5HZGA 4MVJP 1ODCA 3VU9A 1GPMA 1IZZA 3U4IA 1RWVA 4RIIA 3BL8A 1KZYC 3UO8B 2BMVA 5FUQA 4LQLA 3KC2A 4RZIA 4C30A 2WHXA 5BSVA 4GRIA 4RETA 2HCFA 3DE7X 5A3QA 3QW4B 4OBWA 3H9CA 2FLWA 2VQEB 6REQA 3ECSA 2XHEA 5L7TA 3JQDA 3GGGA 2PRJA 3THWB 1LRKA 2XDQB 3FFWA 4OSEA 5DHFA 3WK4A 5GJCA 1G2IA 1X9HA 1T5LA 1N5DA 3ESRA 3PVCA 5CVTA 5GINE 1U9IC 3E4DA 1C2YA 1BRMA 1N8NA 2F3TA 2B3DA 3JAKB 2D6FA 2BL4A 5EGNA 4H6WA 5D1HA 4NZNA 3KTFA 1AMOA 3C39A 4FMCB 1XXLA 5EE9A 3EGWA 1EGAA 4U7DA 5ALOA 1P3Y1 2HEIA 3MA0A 3U7FB 1SXJE 2G71A 3OBBA 2GR9A 3UXYA 1VFNA 1OROA 5H81A 3V1UA 2C4UA 3COSA 3QKTA 1NQWA 4R69A 1GKIA 2E7ZA 3ZV3A 2IHZA 4IJWA 2PAAA 3F5QA 3LWZA 1ZD2P 4MEBA 3O3NB 1SD2A 2W6MA 4OV6B 2Y93A 3V7YA 3SJAA 3NRCA 3RSOA 3AHCA 3VNVA 4IHAA 5EJMA 2I22A 7MHTA 4BYGA 1QIHA 4DTIA 1JFFB 3D7LA 5A02A 1E96A 1ZLYA 5G1PA 2P0AA 3W2FA 3WLJA 5LXTB 2XJ9A 3PX3A 2FP4B 2XRYA 3AQIA 3MN1A 2ZG6A 3QVLA 2JHFA 4Y6RA 3UBTA 2FOXA 3KHKA 4OHRA 4C07A 3VZBA 1LSSA 2WG2A 3MBIA 4MV9A 1IBLB 1BQ4A 1W8IA 4TL8A 2I2DA 1HL3A 4EYGA 3RBAA 3PZBA 1RPTA 3AUKA 1PGQA 1JR3E 3GCGA 5ALFA 4B8WA 1ZGAA 2VDRB 1BMFA 1R0SA 4NMWA 2O8CB 3ECCA 5K1SA 1H5QA 1P4AA 3TQOA 3UV7A 2C83A 3NV9A 4IXNA 5ICSA 4HDMA 3NGLA 2UYQA 4K9SA 5E38A 1U8YA 2OGUA 3A04A 5H3CA 4Y6SA 3RF6A 3ZY5A 2RHMA 3H84A 4XWWA 2H1OA 3G5UA 2MSKA 2O3SA 1G9XA 4Q05A 4BQPA 3JWJA 4EGFA 5TMBA 3DTVA 4H27A 2NUTA 2EHJA 1HFEL 3B3GA 1ZXLA 4IZHA 4YRBA 5KVVA 4ILEA 4CT0A 3CC8A 2YN0A 4KI7A 4U5XA 1J8QA 2YV4A 4DLYA 1DG3A 1Y3DE 2TSYB 3C7KA 1NRIA 3IT3A 4BMDA 5DP2A 4FR5A 1Z35A 2QAIA 5I8WA 1OPXA 2LVBA 3WBKA 2J6HA 1P45A 1KE2A 3JW8A 1A8UA 4H0NA 2OHOA 4F6RB 3KTOA 1CUEA 1H42A 3GK3A 1EM6A 1OR8A 5C32A 1XZPA 3M6XA 1R6TA 5C4IA 5LR6A 1QHSA 4WOJA 1HDCA 4XEHA 4OI0A 1T25A 3HY4A 4CMEC 2IQ5A 5KQLA 4BEVA 1OPRA 2WUDA 1SHKA 1TJ3A 5LKRA 2XMZA 3S2IA 3F49S 4JL8A 1ZKDA 3DOHA 1F2DA 2QEQA 1FYEA 2BUAA 1I4WA 1H3FA 4QUEA 2FUG1 4PC2A 4BN4A 4YT5A 5FP0A 4CV0A 4FMBB 3K73O 4MIKA 4LV6A 1SULA 2HMUA 4D74A 3A10A 3E1KA 5JXIA 5B6PA 1L9XA 2GEJA 3CEMA 4BRUA 5K8UA 1KMMA 1NX9A 3GP8A 4EYEA 4OP3A 3W79A 2B4AA 4PG5A 1GEGA 4L27A 2XR1A 3WP0A 4EAQA 1ADBA 1AKQA 2BFFB 2CYAA 2EZTA 4JUFA 2ES4A 2R6GA 4QBIA 1MV8A 3G2PA 2FUCA 3HO8A 4IF4A 3S44A 3TWOA 4M8IA 1S8NA 1FX1A 3JR3A 3AKCA 2VF7A 3Q72A 4ID3A 3AVUA 3GJ5A 1W25A 2F43A 3OQJA 1CUXA 3EUFA 4GOXA 1XDSA 4YJHB 3GPLA 1MJHA 1UM8A 1FQOA 3LJKA 1XRNA 1R0XA 2AZMA 1W85A 3V32A 1IY2A 5TMEA 5F3DA 5CBPA 1JBQA 2B69A 2HPAA 2XCTB 1HKUA 3L6EA 2PLWA 2WDZA 4J16A 1RYHA 2O8VA 4W9MC 4LJRA 1B8VA 1OVMA 2HO5A 4HLQB 2VPXA 4TKVA 5EYPA 2ZJBA 3TLXA 3M6FA 4IOJA 4CKEA 3EY9A 1JFSA 1A9OA 1KVRA 5LKAA 2JCXA 2M9MA 1K86A 1A95A 2WJ3A 4E6EA 3EVFA 4G5SA 3N7UA 1N2SA 5JECA 1NDUA 2QN1A 4LVOA 3LSYA 1QP4A 1AQJA 1G59A 1M34A 2BM1A 2W6IA 2PCLA 4R1OA 3I8OA 1QX3A 4CU5A 3Q2OA 5CLLA 5JZMA 2WB2A 3BE4A 3F8SA 3HXLA 1SG9A 2Y1CA 4MYDA 1H2BA 3WIDA 2JJQA 4U8GA 5BMOA 4Z4GA 2XKJE 4NAUA 3RYFA 3LMKA 2BSAA 4FFPA 4M7WA 1AA6A 2LE0A 5KYXA 2ZJ1A 1ISHA 3BEOA 1BA3A 3C6YA 1T1SA 2GXQA 1TMOA 2JI6A 1D7AA 3GGCA 3K4QA 1NVVR 3THRA 4DEXA 3RAPR 5EA2A 1COWA 3L8CA 4MKXA 4V1CA 5JRDS 3AB8A 2F55A 2EU8A 2FQXA 2QYTA 1RZRA 3NPMA 3BE6A 4DV0B 2EARA 3DAYA 3F78A 1HE1C 3W6ZA 1XNGA 1UJ4A 4PQFA 1E9EA 2R60A 5B1YA 3KFLA 4N01A 1H2YA 1OFVA 3AJEA 3K92A 4DZTA 4I55A 4BFTA 4BEJA 3VX3A 4P4GA 4DSAA 3HN6A 3E2MA 2YY5A 3IV9A 1X94A 4JLUA 4H7HA 1CFJA 3PGLA 3T61A 1WUJS 3E5NA 3DBIA 2FOLA 2FPPA 4ML3A 1L5NA 1IK6A 1AK1A 2OAEA 4W99A 4E5UA 2FQWA 3EDCA 5B5SA 2I03A 1UBMS 1YI1A 3R0XA 4BECA 5TS2A 2YXEA 3UJCA 1ZGZA 4R2KA 1Z7EA 1V37A 3AF4A 3I3SR 1DEKA 2XE4A 4R9UC 2OXCA 4UEKA 4RZXA 5B1EA 3PC4A 2PZ8A 3HE3A 4HDNA 4IOLA 1QH1A 3EVBA 1Q0QA 2C4MA 2J9RA 2V7XA 4IL5A 4ISBA 3HQ4O 1Q3KA 1IH8A 5AJUA 4D42A 1KJZA 5CVCA 2NZYA 4DNXA 4QNNA 4BGVA 4TMXA 4MHSA 1Z62A 4OM8A 2PZFA 1WOYA 2BKVA 4UUPA 4MP6A 2C9MA 1ZOLA 5EQJB 1TEZA 1MA0A 1TLLA 4EUNA 3EXG2 4PQGA 5KWVA 4GEKA 3TAUA 1GO2A 1L8QA 2GAFA 2F90A 3BMXA 3FMPB 5DCWA 4IRXA 3C4QA 4RV4A 1NMEA 2QENA 1ZI6A 3SD7A 2ZQZA 2C00A 3DFZA 2HPHA 4LE2A 1EDEA 2JIMA 3V4PB 3U4HA 1RKQA 5JYEA 3RFUA 5EHXA 2DCMA 4NH4A 5C0OE 1LLDA 1YQQA 3QHPA 3EY4A 2NPIA 1HYBA 4JWTA 5F9HA 1TM5E 1K89A 4FMPA 4ALLA 3B36A 1WZUA 4ZAXA 2IV2X 3E7PA 1S2GA 2ZAYA 3HBLA 4PICA 1ZRHA 5LZ8A 4BQSA 2DH5A 4AECA 1NJFA 2YVAA 1TTHA 2PSHA 5D00A 1LSOA 2UZ0A 1F0KA 4UTNA 4ALMA 1P0CA 1Y1RA 2FW8A 2JAPA 4G8DA 4QHYA 1W35A 2GEDA 1BOOA 1FMJA 1G5HA 2NZ2A 5FI1B 3GFTA 5FNZA 1QRTA 4GC9A 3RBVA 3DZCA 3L40A 3GGOA 2HSGA 4TLEA 1TYZA 2VJKA 4OATA 1V16A 4IGIA 4X3CA 4ACAA 4C4TA 1HV8A 3VSAA 5BV1A 2WJ6A 5IANA 5J4YA 3TL6A 1KK2A 3W5BA 1N5KA 2CSXA 1TLFA 1SBQA 4G0PA 5C52B 2ZVJA 4Q5IA 3JD3A 2FKAA 5LA6A 3H5VA 5L3VA 5LDGA 4PX3A 4EPVA 4MB2A 3KSDO 4RPCA 1JLLB 4MS4B 4OUKX 4EG0A 2I4TA 1BJTA 1CJUC 1SG6A 1V2GA 1V3UA 3NHWA 3K0AB 1BE1A 4INZA 4D4HA 3RS9A 3EPHA 2GFHA 1V8ZA 4AI6A 4J03A 2R9VA 3BRWD 4TS9A 4A0GA 1MGOA 3O3OB 2VHEA 4PINA 5DB4A 4QYIA 3R9IA 3KZXA 1YWGO 1CLUA 1JEQA 1QP7A 3RS8A 1KI2A 1COZA 3IBSA 1PW5A 2ANCA 2EAUA 1QH9A 3NWOA 4KQXA 3VR6D 3K32A 3ORHA 3HU2A 3SE0A 2B37A 2XVMA 1GAWA 3SZUA 2CJYA 3G2HA 5ES3A 3REQA 2GF2A 1GL7A 4B75A 2Y27A 2XOKA 3QBDA 4TRJA 4DJAA 1UAAA 4YGYA 4G1EB 3A1CA 4EL0A 7ADHA 1WDKA 1IN5A 1EDBA 4Y98A 2AG0A 1NATA 2HO4A 1R0KA 4MW2A 1RWXA 2O50A 4I1VA 2HX1A 1AS3A 1OXBB 2F1IA 4OHYA 2EZ8A 4FYMA 4YMTA 4EO4A 4Z2YA 3RG2A 3LYUA 5JJLA 4D9FA 4PVDA 4N0QA 4MVJG 4Y2HA 5GTDA 5TX7A 4PSCA 3A2LA 2B0CA 2YZGA 4RHCA 5K45A 1WLYA 3DBLA 4YN3A 2BY4A 3SIRA 3EGDB 2ZUCA 4ESHA 1C8KA 5EE1A 4QBFA 2NU6B 4BMOB 2JK1A 3B2NA 3G2IA 4IJQA 2YV5A 1GG9A 1K6XA 1KGDA 2BFOA 3H99A 3NHLA 1MW8X 1XVIA 4IIXA 4DARA 3PQ7A 1GU0A 2OHXA 4L8YA 3UA4A 4EVRA 3OX3A 4R68A 3JCZA 5EZYF 2YW2A 3AW9A 4B3DA 4HR7A 1Q1NA 2WV9A 3IUYA 5CITA 5F35A 3L7NA 4H6XA 4ER3A 1FUYB 4G1UC 2WZCA 4Q02A 2JFOA 2M1ZA 1T1RA 1PGNA 4ZU1X 5JJCA 4CLEA 3NH9A 4AUMA 5KWEA 1KQGA 3AJAA 1EH5A 2FQYA 1PL8A 2C88A 1YB4A 1U8XX 1JWAB 5EXXA 4BO0A 2CMDA 4Q19A 4G1VA 3UICA 4CI0B 2VUIB 2C9ZA 2ZFUA 1E6LA 4UEJA 4FWTA 2FX3A 1A98A