1PEDA

Bacterial secondary alcohol dehydrogenase (apo-form)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
351
structure length
351
Chain Sequence
MKGFAMLGINKLGWIEKERPVAGSYDAIVRPLAVSPCTSDIHTVFEGALGDRKNMILGHEAVGEVVEVGSEVKDFKPGDRVIVPCTTPDWRSLEVQAGFQQHSNGMLAGWKFSNFKDGVFGEYFHVNDADMNLAILPKDMPLENAVMITDMMTTGFHGAELADIQMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKNGHIVDQVMKLTNGKGVDRVIMAGGGSETLSQAVSMVKPGGIISNINYHGSGDALLIPRVEWGCGMAHKTIKGGLCPGGRLRAEMLRDMVVYNRVDLSKLVTHVYHGFDHIEEALLLMKDKPKDLIKAVVIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADP-DEPENDENT ALCOHOL DEHYDROGENASE
publication title Crystalline alcohol dehydrogenases from the mesophilic bacterium Clostridium beijerinckii and the thermophilic bacterium Thermoanaerobium brockii: preparation, characterization and molecular symmetry.
pubmed doi rcsb
source organism Clostridium beijerinckii
molecule tags Oxidoreductase
total genus 117
structure length 351
sequence length 351
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 1995-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pedA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1pedA01
3D5QA 5G4KA 2XOXA 2BI7A 2X22A 5AOVA 1E3WA 4E2YA 1KYQA 2NM0A 5IF3A 2X0RA 5A5FA 2AXQA 3JQAD 5DZSA 4OHUA 4UVGA 4PG6A 1M75A 4FD3A 3KSDO 3OEWA 2DPHA 1B15A 3FR8A 1G6KA 4F3YA 1P1FA 4WASA 1MG0A 3B20A 5A02A 3PHLA 2B69A 3KYCB 3NT2A 1I2CA 3KSZO 4R3NA 5JAQA 3JD1A 5C5IA 2DBQA 3MJCA 1KVUA 4J2HA 3S2FA 5HM8A 2Y1DA 3C3XA 4H3VA 3TSCA 4DPKA 4Q3BA 1WDLA 1OOEA 4GMFA 5A9TA 3LT2A 2OL4A 1ORRA 1OBFO 1LXCA 1Z82A 5JNLA 3HDJA 1QMGA 3DAGA 3PI7A 2EIHA 2V65A 4RVDA 4XCVA 2O23A 2ZJ1A 3GZNA 3O8QA 1PJSA 4Q3CA 4WPGA 5EIOA 1XQ6A 3OJFA 3D3WB 1BVRA 1YDWA 5I7EA 2JHGA 1DIBA 4IJUA 4AJ4A 4Z6KA 4Y6SA 1ONOA 3QWHA 2Y0EA 5GMOA 4PZDA 3WR5A 4E5KA 5B1YA 2YV1A 2ET6A 4DREA 5G0VA 1UP6A 2X58A 4JXKA 3L4SO 5LDHA 4PVCA 2Y66A 3PXXA 5JMWA 1Z75A 4CV3A 1JKFA 1Q0QA 1S6YA 4MIEA 1YBMA 1FK8A 4IXTA 1GD1O 2Y1EA 4RZIA 1EVZA 2EXXA 4D43A 3IUPA 3NTRA 5A05A 3RVDA 1P1HA 4XX0A 4BNUA 3GHHA 3ICPA 3V5NA 2D8AA 3FBGA 2FSSA 3GPDG 2Q1UA 1MUUA 3KEQA 3SX2A 4D44A 3OM9A 1GCOA 4MOWA 4YT8A 3QVSA 4Z0TA 3OJEA 3MJTA 2G5CA 3GVIA 1LLUA 2PKQO 4XJTA 4PCVA 4ID9A 2GN4A 2P91A 3P5SA 1GZ6A 2EKLA 4RF3A 1LDGA 1JN0A 1ZXLA 5A5EA 1HXHA 3LC1O 4QTZA 5T6BA 2NQ8A 3BHJA 1H0KA 4CM4B 3MWDB 4WJZA 2WM3A 1DDOA 4RF4A 3WTBA 1DFHA 1D3AA 5CP8A 4ZQEA 3U49A 2E6UX 4CMGA 4GLLA 4JJFA 5KCZA 3HG7A 5DNAA 4XQGA 5DT9A 2B4TO 3B1KA 4B4OA 2YHUA 4BNMA 5ILGA 3NYWA 2Y0CA 3PFFA 3DFUA 3JQBC 3H9UA 4UUNA 3FCOA 4YJGB 1GDHA 3UAGA 2E82A 3X2FA 2I99A 2Q46A 4B7XA 4D46A 4KOAA 5KIAA 3OICA 2I76A 2ZB4A 2B5VA 5ER6A 1A71A 1IYZA 3I5MA 2DUWA 1Q7GA 3KBOA 2PV7A 3VTFA 1ZK1A 5CEFA 4YCAA 1Q0HA 2ZJ0A 3QWIA 2G76A 3PHJA 2VT2A 3C7AA 4CMIA 4MINA 1YQDA 2GF2A 5GZ6A 4XYLA 2OMEA 1WP4A 3K8ZA 2Q3EA 4GX1A 3CMCO 3PHGA 5DBFA 3COSA 3KYDB 4LSMA 1KVSA 4Q3EA 4CMCA 3ZV5A 1GUFA 2VRBA 3DHEA 3KVOA 1DC4A 1E6UA 2D3TA 1LDNA 2X5OA 4A27A 1B16A 1R4NB 1T1RA 2LDBA 3S55A 3IS3A 4A03A 1FXSA 4O0LA 4FFLA 2J8ZA 1VC2A 3PP8A 4DYVA 4LMPA 1WWKA 2PK3A 4NZ9A 2HU2A 3ZW8A 1JKIA 1GZ3A 4I5DA 2NADA 2P4QA 3DTTA 3JD3A 3PVZA 2OXIA 2FPGA 3CIFA 1X15A 1E3IA 4I1IA 1U5AA 1I3KA 1X7DA 2IZZA 4IDFA 5DOZA 2JKVA 4IUYA 1P31A 3WG9A 4RO0A 2QYTA 3KRTA 3ZWXA 2GNAA 4GVLA 2VNAA 4RV9A 2UDPA 2O7QA 1E7YA 2NTVA 4JJIA 2POQX 3ST7A 3O9ZA 3H3FA 4XDYA 3ZW9A 3ITDA 5EPOA 4IGEA 4DPMA 1MFZA 1UXHA 1AHIA 4FQ8A 1DAPA 1AXEA 3SJ7A 2JCYA 4DGSA 3WIDA 2CDAA 1CIVA 3KHUA 1ISJA 4U6SA 4CMAA 4OMUA 2PD6A 4R68A 2Y0DA 4M1QA 5L51A 3Q2KA 1Y8RA 5JC1A 5KVQA 4B7UA 2V7PA 1DRVA 1LDMA 1X1EA 3E1KA 4XB2A 4OGWA 4Y6PA 4ZQBA 3ZNNA 4B8ZA 5BNIA 5CEEA 5HBRA 1ONNA 1KVQA 3NJ4A 4ALKA 2C07A 1QP8A 4ZJUA 5HTOA 3UF0A 3DMYA 4WLFA 2PKRA 1U7TA 4E30A 2J3HA 3V1UA 1E6EA 4XYGA 3BAZA 3IKTA 1EQUA 5DF1A 2OP1A 3ZU3A 1WZIA 2J3JA 3DDNA 3D4NA 3E5RA 1MXFA 1AE1A 5JO0A 1QG6A 1SMKA 5JMPA 2ZQYA 4RVFA 3RC1A 4UULA 2PGDA 2YHIA 4OXYA 4BQPA 3RC9A 2F1KA 4MVJH 5C7LO 4CQMB 1GADO 1E1NA 2Y68A 3OEYA 2WTBA 1RM0A 1Q1NA 4RVGA 4IMPA 1JDJA 2Y1GA 3B1FA 1KY4A 2WMDA 4IPTA 4GQAA 4NIMA 1IHYA 5H83A 3M2PA 5JCJD 1ULUA 4II2A 5AXCA 3I6QA 3H2SA 4M8SA 4RJTA 4YYZA 2G17A 3LU1A 5EESA 4RPLA 3GGOA 1E1KA 3JSAA 1LDEA 1VE9A 2BF7A 2B36A 1SCUA 3FNEA 1K6XA 3EAGA 2CF6A 4DUPA 4S3MA 4GI2A 3HZZA 1DHRA 2EERA 2A94A 1P44A 3GFBA 2W2KA 2NU8A 3TJRA 5ITVA 4P38A 2VHXA 4GH5A 1XWFA 4Q39A 1QLJA 3GVHA 1UJMA 1E1LA 3QW2A 1MA0A 4XQCA 4BS9A 2PZKA 4EBFA 5FI3A 2PH5A 2YV2A 2WD7B 4LSWA 4B3IA 3IP1A 2O3QA 4MVJP 3KM0A 3UKOA 5LCXA 1T25A 1ZXBA 3JQCA 5FFFA 3CZMA 3M6IA 5COQA 3GN2A 2WJPA 3I1JA 1L7EA 4Y67A 3WQQA 4BGIA 3E9QA 5FI5A 1PS9A 1LI4A 4EJ6A 2JD0A 3S1LA 3FNFA 4KUHA 3TZQA 4O5OA 2B4QA 1V3VA 5JY1A 2FR1A 1CWUA 3VZPA 1NQ5A 5CFZA 1ZUD1 3CKYA 2DAPA 3AFNA 3GAZA 3WGYA 2ZTVA 4CM8B 4E0BA 3KUXA 4PG8A 1ZJYA 1YL7A 4K9DA 1Z7BA 2VHYA 4KUGA 1A4UA 3IOYA 1T1SA 2I5PO 3UCFA 2B35A 4MVJD 3NRCA 2RIRA 3CINA 4JJGA 3INRA 4MPDA 1GV1A 3CEAA 1YQXA 3JYQA 4W4TA 1VPDA 1ZSYA 4BL5A 3OMLA 3UCXA 3GH3A 4BB6A 4L74A 2YQ4A 2JFFA 1JA9A 2CFCA 2WDZA 4ESOA 3K9QO 1PTJA 2FY8A 3E9MA 4QSMA 3VH1A 3DL2A 5TSDA 1LQUA 1I32A 1K6IA 3K31A 1I3MA 2UVDA 4IINA 4WEOA 4NFSA 2HMVA 2EW2A 3E8XA 3LF2A 3DC2A 3RIHA 3ANLA 1P77A 4D0SA 4CLDA 1M76A 2Q1TA 4NJOA 5DCWA 3C85A 1JVSA 1YJ8A 4AJEA 1DJNA 4YT5A 1NXQA 1U1IA 1GY8A 4BKQA 4E13A 3MOIA 1M66A 3CPSA 1CF2O 1QV6A 3PDJA 4RPHA 2PLAA 4DQVA 4KWHA 4MP3A 1P3DA 3NDRA 2WSBA 4YAIA 3W4KA 1DEHA 2JHFA 3DZKA 3KV3O 4RLHA 5FYDA 4DLAA 4CMJA 1NASA 4IDAA 4QT0A 4RGBA 5MDHA 3ICCA 1ZEMA 2VUTA 1BTOA 3GVCA 2ZB8A 2HMTA 2PD4A 4DQUA 2DBZA 4AJLA 4Q3DA 3UICA 1ARZA 3BTUA 4XB1A 3I9NA 4AL4A 5F21A 3ZI0A 1H9BA 2CZCA 2I3GA 4CLXA 1OI7A 3QVWA 3JQ9A 4UVDA 3E6AA 2AE2A 3EVNA 2FOIA 5GZ1A 4ZQHA 3Q3CA 3IDSA 4L9RA 1KVRA 4J4HA 3GHYA 3RFVA 1XHLA 4PN3A 3EGOA 3ZV3A 3GK3A 3Q6IA 4RPKA 4WCDA 5JS6A 3GGPA 1DC5A 4TKMA 3WLEA 1I36A 5B4UA 3H6KA 3ADPA 3GVPA 1CDOA 3QWAA 1YRLA 4OXKA 1PJ4A 4BNNA 1DC6A 4HFNA 3ABIA 1UXIA 3OP4A 4CLOA 2HDHA 3H2ZA 3ZN2A 4BO3A 4QFDA 4Z3KA 2OBNA 3AUTA 1ENZA 5L4NA 5G4KB 2GR9A 1E3WB 4Z9XA 1MG5A 3OA2A 3WOHA 1IZ9A 1H2HA 4FW8A 3K73O 1NQOA 1YOVA 3KB6A 1LDYA 3GF4A 3LDHA 3OBBA 2VWHA 4K6CA 5L7TA 4M86A 3SVTA 4E2XA 1NVMB 3IAHA 3OHSX 1PSDA 5TIIA 4JIGA 2FZWA 4K26A 3DO5A 2CY0A 4EEXA 4LW8A 5GZ3A 4YT2A 1RYEA 4L4RA 4BNZA 2XAAA 2V6BA 4CLEA 2Q4BA 5B4TA 4E21A 2X0IA 2P5YA 5CEJA 2OP0A 1WPQA 2ZK7A 1UZMA 1YVEI 4TRRA 3WBBA 3C1OA 1ZJZA 4U7WA 1ISHA 1PJ2A 3B6ZA 3L6EA 5I8ZA 2G1UA 2JCVA 1JAXA 5THKA 4EDFA 4BGVA 1LC0A 3ZWNA 3O8QB 1SOWA 4P4GA 1E7RA 4J7CA 1BMDA 5JCXA 1U3TA 2V6GA 4NH4A 1MLDA 1YGYA 2H9IA 3G17A 3QVXA 1ZIDA 1IPEA 2Z1MA 3WYCA 1MV8A 3GC6A 3VZQA 3GZ4A 1LTHR 3F1LA 3ETEA 1B2LA 4PZEA 3FD8A 4A2CA 4DIOA 3JD2A 5TQVA 4IGFA 3PEFA 5TT0A 4FOSA 5MGBA 2VT3A 1XLTA 3MJEA 4D0RA 3UHAA 3S2GA 3HHPA 4BNVA 3U62A 1VSVA 4KQXA 2VTEA 3ZWAA 2Y93A 1QKIA 2BFPA 1KETA 4NBWA 4UVHA 3TOXA 4E2WA 1Y81A 1FDSA 2TMDA 1E7SA 4GWKA 3S8MA 2O7SA 3K2BA 4ZHSA 4BO0A 5ICSA 5BSEA 1YQGA 3MCVA 4FGSA 3EVTA 4IM7A 4CM3A 1R6DA 4J16A 2X5KO 1OZAA 2DU8A 2HRBA 1PL7A 3D0OA 4XYBA 3TPCA 1WDKA 5AXDA 1ID1A 9LDBA 1J4AA 4DA9A 1IOLA 4R5HA 3ZNOA 5IDQA 2BKAA 2CNBA 4P4LA 4XRGA 2X0JA 5U1PA 1Y5MA 4E12A 1A9YA 1N8KA 3GY0A 1KEUA 5K1SA 1MFPA 2XXBA 4PLHA 4BO9A 4DXHA 3LC7O 1B3BA 1PZGA 2RH8A 4Z0PA 1CERA 2ZTUA 1HYEA 1DXYA 2PZJA 3HDQA 3RC2A 1H9AA 3JV7A 5IFLA 1N92A 3EHEA 1PR9A 2JD2A 1WVGA 3R0IA 3QHAA 1ENPA 2UUOA 5U9CA 3UOGA 3STHA 3DZGA 1ML3A 5DULA 4D45A 4H15A 1HT0A 2HKIA 3PZBA 4HUJA 4L75A 1BDBA 4DLBA 1VL0A 2TMGA 4M87A 3IMFA 4B4WA 4W7HA 2YFQA 1RM5A 3A4VA 3V1YA 4CUZA 5KJCA 4J1QA 4ALMA 3ULKA 4ND2A 3VH2A 1ADCA 3H7AA 2VRCD 4OL9A 3T7CA 3ETDA 5A9SB 3U4HA 4BNYA 5F1PA 4CMIB 2DVMA 1HYGA 1LNQA 4IS3A 3GN1A 4PLPA 2NLOA 3BIOA 4CL3A 3H65A 3AWDA 1P1KA 4N7RA 1QYDA 4AJJA 1H6BA 2QRLA 3GQVA 3ROQA 3TZHA 4PFJA 5TC4A 2FSVA 4YVFA 4WGGA 2CVQA 5DP2A 1ZK2A 1HZZA 1PWZA 2QZ9A 2QYSA 4NHEA 3JQ7A 3AK4A 3BTSA 3BHIA 5DCYA 1T2FA 3L6OO 3TDKA 3TL2A 2AQKA 2RCYA 4GVXA 1LBEA 1ZMTA 4MDHA 5CDTA 1TT7A 5FF9A 1U9JA 1PJQA 2FPPA 1FDVA 2VTDA 4ZQFA 2VYVA 3DFZA 1TA4A 1FDTA 3FNGA 1NTOA 4XA8A 3VVCA 4DRYA 4N5LA 5COBA 3EW7A 3G3EA 3UVEA 4O59O 2X7HA 3BMOA 2GZ3A 1SO8A 2HRZA 3ORFA 4K6FA 3WDSA 4AVYA 4AFNA 1ISFA 3MZ0A 3RUEA 2Q1SA 1U2DA 1BGVA 3G49A 4NBRA 1IHXA 2VQ3A 3ZV4A 2YJZA 5TRTA 2GN9A 2Q50A 1C0KA 1DLJA 2Y1FA 4XJSA 3OJLA 5A04A 4ZVVA 4Q3NA 3HQ4O 3CXRA 3AUAA 4HP8A 1NAHA 5IZCC 2Y05A 4AJKA 1NVGA 4R5MA 4CM9D 4AJNA 4Y9DA 2GGSA 1Y8RB 3F46A 4QECA 2GSDA 3JQAA 2PGJA 1B3RA 1ENYA 5JO9A 3UCEA 3O26A 1K6JA 4EUHA 3ON5A 4YWJA 3WFIA 4A0SA 3F5QA 5LDGA 3U9LA 2ZATA 3U0BA 3VKUA 2EJWA 5BSGA 5IDYA 1WLYA 2X0NA 2XPCA 1IPFA 1FMCA 3QVOA 4AJ1A 3RFTA 2C54A 3NJ8A 1JU9A 3FPCA 1EMDA 3I9MA 3GUCA 2IYOA 1PQPA 2IEBA 2PD3A 3WMXA 3GEMA 4BNXA 4RF5A 2JFHA 2P9EA 2NU6A 5ES3A 3IJRA 3AY3A 4IDBA 2QW8A 2YHIB 3FRJA 4TRNA 4PZCA 2BGMA 1PZHA 1U2GA 3DMTC 3CE6A 7MDHA 4BNTA 2RH4A 3BZUA 3JCZA 4LISA 4YAJA 3DMTA 4EITA 3P2OA 1L1FA 1CQJA 4OQYA 4IDCA 4AG3A 2BH9A 1EBFA 2J6IA 1Q2XA 4CUJA 5JE8A 1YBVA 3VPSA 3DONA 4CM7A 2O3RA 4W7IA 1GFSA 1DJQA 1UP4A 3WGZA 4I9HA 3EMKA 1LC3A 2BGKA 3CUKA 4NMHA 4LCJA 2ZYGA 4XD2A 3WNVA 4XR4A 3VPXA 2AEJA 1VLLA 2DFVA 2Y1CA 2EWMA 1I24A 3DAFA 3SXPA 2G82A 1CEQA 3ZWWA 5JDCC 5IG2A 3QWFA 3KO8A 2NVUA 2OO5A 5JDCA 3DB2A 4PLGA 2W2KB 1NFQA 3KZVA 3L77A 4RDHA 5G0UA 3FTPA 1DFIA 4W9NC 5L3ZA 1NYTA 5JY6A 4QQRA 4W9NA 4HX5A 2YZ7A 4WOKA 4TWRA 4K28A 1WAMA 1E7MA 3WWZA 1I8TA 4OYRA 4IBOA 2G0TA 3GDOA 3MEQA 2YQ5A 3JYLA 4FJ1A 4IDGA 4L8VA 1O95A 2WYVA 3TZ6A 1XDWA 1PR3A 2ZKLA 4GKBA 4HBGA 4JLWA 4ZICA 5C7OO 5F1KA 5TLSA 1DAOA 5EQFA 2I67A 3SC6A 3I9OA 1GZ4A 4IJVA 4YAKA 3GEGA 4IDEA 2HUNA 2YDYA 4W99A 5BSHA 3SLKA 3IKVA 3RCBA 2BFMA 1I2BA 3V8BA 3D4OA 2NV6A 4CPDA 2WYUA 2DFDA 2IYPA 4M54A 3RROA 3TFQA 1C1XA 1TT5A 1UXKA 2C20A 4JNKA 3WX0A 4K1LA 3RU9A 3EDMA 2NU9A 4O6VA 4KP7A 3JQBA 3FN4A 3U4CA 2VNSA 1NVTA 3E18A 2W98A 3C8MA 4DL9A 3GOHA 4L4XA 1CETA 2Y99A 3IJPA 3H9JA 4FN4A 3UFXA 5IDXA 3TRIA 4LVCA 3I52A 4YJFA 1A72A 3PJFA 4C4OA 1NBOA 1BHSA 1IZ0A 1PGPA 4HKTA 4NBUA 3KSUA 4OKNA 4Z0HO 5A9SA 2DC1A 4I5EA 1M6HA 2C2YA 1Z6ZA 1BDMA 3ETGA 3ZGYA 1KBZA 2A92A 1QRRA 4UUPA 1HE5A 1T2AA 4FR5A 2QQ5A 3PPIA 4OIMA 2VHWA 3S2IA 2PR2A 5THQA 3TFOA 1M2WA 1HE2A 1BG6A 4IS2A 1HWYA 3GNSA 5KVSA 1NPDA 4HWKA 3DZHA 1QLHA 1E5LA 1EVJA 3MJ4A 4MJLA 5TS3A 1OFGA 3TF5A 1GPJA 1LSSA 1MC5A 1MX3A 4WLNA 1EE9A 1LX6A 2VZ8A 4LN1A 4XZ3A 4JGBA 2WWRA 5JAZA 3ENKA 2Q45A 3H5RA 4D79A 1O89A 3FWNA 4TMFA 5B4VA 2ILTA 4NJMB 4CM5A 4L73A 1WNTA 4PG7A 3B70A 2Y1OA 4BNFA 1XG5A 3G1UA 4BNHA 3IC5A 4GMGA 4J1TA 1R12A 3VAZA 4R54A 4BHTA 4QEDA 1PGNA 3RWBA 4FSHA 1C1DA 3VH4A 2VYND 3I4CA 4G81A 2QZZA 3ZU4A 3KETA 4E4YA 4YT4A 3OECA 3EZYA 3INGA 2B4RO 3PIDA 1OMOA 4NBTA 1UXJA 2PZLA 3AI1A 5JYEA 1X14A 2HK7A 2O3UA 1GYRA 2AQIA 4BO8A 1YH3A 3T4EA 4WLEA 1PIWA 2E4AA 3AY6A 3TL3A 5K0ZA 3PWKA 3PDUA 2AMFA 2ZTMA 1HDZA 1B0AA 4A5OA 1X7GA 4M49A 1YL6A 3GDFA 1IL0A 5BQFA 1EDOA 1VL8A 2HJRA 4HNHA 4EW6A 3NTOA 5JDIC 3CH6A 1UAYA 2IEDA 4CLOB 4CMEC 1HDGO 5JDIA 3EK2A 4CMEA 4IZIA 4OJNA 2Q2QA 1EEHA 4D42A 2RBEA 3WFJA 3NGLA 2GRAA 3A28A 4YTEA 3PLNA 1LLDA 3WYBA 4OOFA 1U5CA 3HB5X 2VHZA 4NK5A 1YOVB 3ZWBA 2VUSA 4W6ZA 4CV0A 1YE3A 3QJ5A 3AOGA 5HA5A 1GL3A 3ZHZA 1KEVA 2CDBA 4PLCA 2D2IA 2YW9A 1HLDA 5EL0A 3RUCA 1SC6A 1H6CA 4BNLA 3MOGA 3IQDB 4J4TA 4TRJA 4IJKA 1ONPA 1WMAA 4G65A 2PWZA 1V3TA 4YRAA 5L9AA 4ZGWA 3MTJA 1W73A 2O3TA 1MB4A 4FGWA 5JCJA 2X9GA 4YR9A 1N7HA 3K6JA 2ZCVA 2O4CA 3HFSA 1F14A 1EZ4A 3BHMA 1WZEA 4RPJA 3V1TC 4RVUA 1NQAO 2X5JO 5KOIA 1P9LA 2P9GA 1B8PA 4XYMA 1F0YA 4A73A 3T7EA 1ZW1A 1E3JA 2NVBA 3VHRA 5ENVA 3VC7A 3W4JA 4CLRA 1DFGA 1HDYA 1C0LA 1P45A 3LLSA 4J7UA 1FF9A 4BNIA 2LDXA 2WE7A 1HDOA 1KIFA 3BA1A 1Y9AA 3FNHA 2BFAA 3TNLA 4EYEA 1HZJA 3O03A 3W1VA 4ZU3A 3ZWPA 4J3FA 2D1YA 3VDRA 1H6DA 3PIIA 1VJ0A 3NEPX 3INTA 1X7HA 1N9GA 5G4LA 3H8VA 2C5EA 1O94A 4URFA 1QR6A 1QYCA 1K0UA 2H6EA 5L7YA 4TQGA 2OFPA 1XU9A 2GYYA 4YACA 3F4LA 3UXYA 1I10A 5BSFA 4ALIA 1ISIA 2DPGA 2ZYDA 4TVBA 3PYMA 2P4HX 4U6QA 4CLHA 1I5RA 1A9ZA 3F9IA 4R1UA 4E33A 5JBIA 4KUEA 2VZ9A 1H5QA 1LUAA 3VPFA 4MVJA 2BHLA 4J0FA 3WGIA 2OGUA 4L76A 3VKVA 2C2XA 3BTOA 3V2HA 3TQHA 3GA0A 2VWPA 1NX6A 1V9LA 4IZHA 2HMWA 4FOOA 1QORA 3K5PA 1D7OA 1NAIA 1EE2A 5JFOA 2DT5A 2D59A 2H1SA 4I5GA 5ER9A 4BQRA 4RQTA 4U0JA 4DMLA 1SB9A 3OQBA 1IUKA 1WMBA 3JQFC 3JD4A 2DLDA 2FHSA 3JQFA 4YA6A 3ADOA 1PX0A 1TEHA 3IL2A 3H9EO 2FWMX 3VZSA 2BFOA 5BT9A 2P2SA 4WNIA 4YAGA 5GY7A 1D4FA 1NNUA 2CVOA 4YJHA 2EG9A 1F12A 3HE3A 3A1NA 4NJMA 3GUYA 4R69A 4YQYA 2NVWA 4DLLA 2X4GA 3VZRA 3PRJA 4RORA 3ROMA 4J9UE 1AUPA 4R01A 2NWQA 3GG9A 4XEHA 4F6CA 3DZIA 5DBIA 4J6FA 2WE8A 3ANNA 2X86A 3W6UA 1E7WA 3R6DA 4C7JA 2C7GA 3Q9UA 4A10A 3QSGA 2IZ1A 3JQ7B 4ND1A 4CM6A 4PLYA 1PQUA 4TROA 3RUHA 5DDIP 5I7FA 1IE3A 1KVTA 2AG8A 3R3JA 5KJ6A 4BNWA 3WGGA 3HB4X 4J4BA 3JQ8A 4I5FA 3PHIA 1P0FA 2O3JA 1RM3A 5U4QA 3E9NA 8ADHA 4JBGA 4AJOA 1I3NA 4KWIA 1E77A 2JL1A 3HADA 3BMOB 5TNXA 4BOYA 1T2EA 4E32A 1F8FA 3ZDFA 1EK6A 3AJRA 4E5NA 3PJDA 1XQ1A 3UH1A 1A7AA 4IQGA 3RQSA 2HO5A 1GR0A 1AXGA 2J3KA 4YDRA 5ENDA 1TI7A 4E31A 1R0KA 4WCFC 1HYHA 3VH3A 5J23A 1ZH8A 4FIZA 4HV4A 4N5MA 1LLQA 3NX4A 1NQTA 3BYZA 2ZYAA 5G0WA 3DTYA 3JQAB 1CQIA 1K89A 1XU7A 1PL8A 5A4DA 4U5QA 1BVUA 1T4BA 3AOEC 4PLVA 2CSUA 3O4RA 4PGFA 3AOEA 5KJFA 2D5AA 1ZBQA 1BW9A 1FDUA 1R0SA 2DTXA 4TVOA 3WGQA 4KDFA 4CQMD 4RQUA 3WB9A 1JAYA 3WWYA 2OHXA 3I3OA 3QP9A 1SB8A 1U8XX 1F06A 1PJTA 1SZJG 5IN4A 3ZHBA 1DIHA 4O63O 4CM1A 3HUDA 2GN8A 3H9QA 3A9WA 4IY1A 1ZK0A 3K96A 3ZNQA 3OF2A 2BLLA 2H63A 5K9ZA 1GEGA 3OIDA 3GNQA 2J5KA 3FPLA 1T4DA 1W6UA 3DOOA 1UDAA 5A03A 4NU6A 3RUAA 2PKQP 3QIVA 2GASA 5HWSA 3D5TA 1U4SA 1DRUA 1JKJA 1RPNA 2IXBA 4HXYA 4F46A 1W0CA 1TXGA 4CV2A 1P1JA 4XDZA 3AFMA 1MC4A 3WBFA 3WICA 2CF5A 3NKLA 4IQ0A 3DQPA 4JN6B 4BKPA 4FJ2A 3VPGA 2Z1NA 3DHNA 2NVUB 1VKOA 3RJ5A 1SAYA 4DIBA 1VJTA 4KTVE 4M55A 2ZB3A 5BNFA 3DOCA 1D1SA 3ZWOA 3AM4A 3BMNA 2AG5A 3ZV6A 1HDRA 2C29D 5ITWA 3PJGA 4MIOA 4XYEA 3BTVA 1U8FO 2HSDA 1LRKA 1PL6A 3C7DB 4N5NA 1BXKA 4XIYA 3T4XA 4PLTA 2X8LA 5F5LA 4PVDA 1UUFA 2R2GA 4DMMA 3GR6A 1C14A 4J2OA 2X23A 6ADHA 1ISMA 1C0PA 2UAGA 4MVJF 4DIFA 1GU7A 3OIGA 2YDXA 3FF4A 1ADGA 2A4KA 2O4UX 1PZFA 4ROSA 1ZEJA 5IN5A 2V6MA 1YXMA 3QV1A 4FC7A 1GQQA 3AUSA 3RSHA 1T26A 4JCOA 3UW3A 2ZIZA 2IZ0A 5HRUA 4YEDA 3JQEA 3UGKA 3ZZNA 4TRMA 5KKAA 4D3FA 4DYDA 1X13A 1SNYA 1E7QA 2Q2VA 1I0ZA 3TZCA 5C37A 1C1XB 1TT5B 4UUMA 3L9XA 5IDWA 2BGLA 2Q99A 4R41A 5AXAA 3TOZA 1JVBA 1E92A 1PJLA 2YUTA 5JW6A 1WW8A 1N2SA 4GBJA 5A06A 1GQ2A 4IJWA 4BIIA 1LJ8A 3NDIA 5LC1A 3NT5A 1Z73A 4YJFB 5L53A 2ZB7A 4WE3A 3RUDA 3JQDA 3WS7A 2BMAA 2VOJA 4KTTE 2DM6A 2BRUA 1Y1PA 4WEQA 2GUGA 3PYXA 4QUKA 1GCUA 1CRWG 4E2ZA 1PJCA 3H5AA 2VRCA 4NNJA 1NWCA 3HWRA 4PRLA 3WGTA 1LQTA 7ADHA 3NUGA 3KLMX 4NU5A 2W8ZA 4JBIA 3RUIA 1Q7CA 1V6AA 1YB4A 4ND4A 4UVIA 2NU7A 3C1AA 1AGNA 4NI5A 1RKXA 3HN2A 1NHGA 4R51A 1Y8QA 1K2WA 2C59A 5F5NA 1MP0A 5B37A 1UP7A 4BO5A 5HS6A 2ZQZA 2O50A 5TX7A 2VWGA 1YS4A 1ZZEA 4KZPA 2DKNA 4EUEA 4MVJI 2NACA 4ZRNA 3K30A 4OO3A 4FBGA 1ZSNA 1DC3A 1O9BA 4B4VA 3OFSA 3L9WA 3N58A 1BXZA 1SEVA 1U4OA 3OETA 4BO4A 2DBRA 2D0IA 4MO2A 4LK3A 2W2LD 4ZRMA 3NAQA 3EY4A 2EV9A 1C1DB 3I6IA 2Q2WA 2OBYA 4JQCA 1BRMA 5JYDA 3SLGA 1UDCA 2UV8A 3PK0A 1MXHA 4M89A 1KC3A 4NDNE 1NP3A 2EP7A 2VUUA 3GDGA 3KOUA 3LYLA 3PWSA 3LK7A 4RPGA 3DZFA 5IZCA 1EVIA 4PLFA 2PY6A 1XGKA 5KKCA 2JFGA 4EJMA 2PFGA 4WLVA 2X9NA 1ZNQO 1YB5A 4CM9A 4D3SA 1NFFA 4GLOA 1O8CA 1ZMOA 3QQPA 4WOJA 3D1LA 4IIUA 4KDEA 1PJBA 2Q49A 3GRKA 1I01A 1NFRA 3E82A 4J43A 4II3A 4MP6A 1OC4A 4Y98A 4J0EA 4FC6A 1DLIA 1NPTO 4WK6A 1PGOA 3JYOA 3PLRA 1Y9EA 1GTMA 2FPIA 1LSJA 4R4JA 4FPXA 3R3SA 1ZKMA 4OKIA 3W8EA 4GX2A 4YJDA 1X0VA 3W6ZA 3W8DA 1QXSA 3FHLA 5JAIA 3HDYA 2CMDA 4B8WA 3I4FA 3IIEA 1R66A 2EJVA 2Y67A 1H2BA 3OIFA 3LC2O 4KMSA 3F4BA 2EF1A 3AU9A 5DOVA 5I9LA 1DHTA 2Q4EA 2QRKA 3OJ0A 3VVBA 2HMUA 3DR3A 4UUOA 5FEUA 5CHEA 4BMVA 3U09A 1ZSVA 3LQFA 4YXFA 5FWNA 2WEKA 1DSSG 3KYBA 4BNKA 2GCGA 2Z5LA 4YRDA 2RAFA 5DN9A 3LF1A 4YRBA 2EEZA 5ILOA 9LDTA 3K92A 1E3LA 1C0IA 3ZU5A 3WYEA 1AHHA 1K3TA 4I9UA 5CPFA 1V35A 5DP1A 3FI9A 3KEOA 3V2UA 5I7SA 3VDQA 1GEEA 3DBRA 4QXMA 4RVSA 1VRWA 5TJ9A 3PGJA 1YONA 1B7GO 3H9GA 4AJ2A 3BMQA 4XIJA 4YAEA 2HMSA 4W82A 4JROA 1B14A 3PQEA 3RBXA 4HFRA 4CJXA 1E3EA 4JP3A 4UVEA 2PNFA 1E1MA 1XYGA 4FS3A 4J1NA 1ADFA 4BMSA 4CODB 2FN7A 2R00C 4CV1A 4CLRB 4EZBA 2R00A 5ICMA 4O1MA 4P4NA 4EEZA 4NBVA 1N7GA 5L7WA 1HE3A 4XRRA 1UH5A 3BMCA 1Z74A 3DBHA 5G2OA 2EHDA 4IXWA 1Q0LA 2RHCA 5L4LA 3TZKA 5L95A 2E48A 3PQDA 4J1SA 1PWXA 1B8VA 4MKZA 3W8FA 1Y6JA 1YWGO 1N9GB 1O6ZA 1NHWA 3ONEA 4CQLB 4FB5A 2FP4A 1PQWA 2B0JA 5CPBA 4J91A 5CDSA 4BV8A 1BXGA 1R16A 4U0KA 3RKUA 3RD5A 2CD9A 3RAJA 4LRTB 1UDBA 4H16A 2NSDA 3U4DA 5CG1A 1DIAA 3PQFA 4BNGA 2D4AA 3DBLA 1VI2A 4EJ0A 4ALNA 3EZLA 4J90A 1IULA 2UUPA 3OQ6A 2R6JA 2BD0A 3ITKA 1GQYA 3GPIA 3HFGA 3B1JA 4ZD6A 1E0DA 1A5ZA 2I66A 4E5YA 3GAFA 2FZEA 4MVJG 5CDUA 3FSRA 4CMBA 3I83A 4E3ZA 4BO2A 5IXYA 1CJCA 1KEPA 4GPD1 4JBHA 3GNTA 4UEKA 4X54A 1GYQA 2AE1A 1ADBA 2FRDA 1PS0A 4DQXA 1NM5A 3DEYX 4TKLA 4B3HA 3RFXA 4DBZA 1HL3A 2VN8A 4ND5A 3OJOA 5T5QA 1CYDA 3L6DA 3F3SA 3WJAA 1Z7EA 2GDZA 3JQGA 3WSWA 2CVZA 5KWEA 5JPIA 5KNLA 1EUCA 1GUYA 4YJHB 2HAEA 4R16A 3LZ6A 4CR8A 5CG2A 1YBAA 3V2GA 3RASA 2HK9A 3HNPA 2NUAA 4BO1A 1T2CA 1N1EA 5T67A 4ZA2A 4LRSB 4EI2A 3QA9A 5JAMA 2AEFA 1QV7A 2F00A 3NGXA 4YQZA 2AW5A 4DBVO 3RBVA 2IDZA 1DIGA 4GWGA 3WJ7A 2DBVO 1M67A 3JQ8B 1GAEO 3ZWYA 1N1GA 2VYNA 1E5QA 3WGOA 1F8GA 4NFYA 3JD0A 3N74A 4PIVA 1QYVA 1XSEA 2QRJA 3D3EA 1UZNA 4P22A 2BELA 1BWSA 2B5WA 1WXDA 1U3WA 3NDJA 4N18A 2ZCUA 4WECA 1I3LA 3MWEB 4FJ0A 4ZQGA 1GPDG 1DIRA 5JSFA 1UXGA 4NK4A 4LCEA 3ONDA 4RF2A 1ZK4A 4XQEA 3LSYA 3JQ6A 3JYNA 5H82A 3WIEA 3C7CB 3P2YA 1DPGA 4NQZA 5G0TA 3OA0A 1TLTA 3GGGA 1GUZA 4HFMA 5H81A 2YY7A 2V6FA 5A3VA 1LLCA 3OQ1A 4UEJA 4WCFB 2YFHA 3LT1A 3GG2A 3KYCA 1U7HA 2I9PA 1Y5RA 3SBOA 3D64A 1KEWA 3ASVA 1HLPA 1UR5A 2IODA 5TGDA 1R0LA 1B26A 3C24A 3MJVA 4JP2A 2PZMA 2VOEA 2Z95A 5TT1A 1SBYA 3TWOA 1LSOA 1HSOA 1G1AA 5I9MA 5B12A 1GV0A 1GYPA 1BW9B 1XR3A 4A7PA 1J6UA 1N5DA 3FWZA 4WKGA 2IXAA 1VSUA 5TF4A 3ROKA 4J49A 3DWFA 3RI3A 3WGHA 4RDIA 1P74A 4B3JA 2AEMA 3D3WA 4R1TA 3ONFA 4GGPA 1ULSA 2X9VA 4ALLA 3D7LA 2GZ1A 4DWVA 4PG5A 4BGUA 4OXNA 1LA2A 4CMHA 2HCTA 3F6YA 1RYDA 5IAAA 3OSUA 1QYWA 1U3UA 2WYWA 1PU2A 4FDAA 3GT0A 4UAGA 4QO7A 4I08A 3AU8A 5G0SA 2NTNA 3GLQA 4ILKA 3QVTA 4QFCA 4EUFA 2HJSA 1EQ2A 3N7UA 4Y8VA 3L07A 4FFNA 5L45A 2HLPA 4B4UA 4XGKA 1AN9A 3AW9A 5DBGA 5AQ1A 5A9RA 4IQ8A 4BUCA 2GERA 3UN1A 4INAA 4YBZA 2GN6A 3VPHA 1OC2A 2GLXA 3ENNA 2A35A 1XA0A 3BMNB 1D8AA 4U8GA 4TZKA 4CQLA 1YL5A 5BNTA 3WSVA 4NFHA 4N54A 4D3DA 4WNCA 4OQZA 4Q9NA 5T57A 4P8RA 1E6WA 4L4SA 2AA3A 4L0QA 5EINA 3WQSB 4G2NA 1HTBA 1NWHA 2YYYA 4HADA 4S1VA 4B7CA 2C82A 5AYVA 5F3RA 4ITUA 2W4QA 1EDZA 4GSKA 3ZHYA 1B8UA 4CM4A 2AQ8A 3PTZA 1M6WA 2GPTA 5JXWA 5A1TA 1J0XO 1BSVA 1OAAA 2JAHA 1H94A 1QSGA 1O5IA 5I7VA 5CDGA 1LEHA 1P0CA 1HKUA 1EVYA 1ZO8A 4F45A 1SOVA 5EN4A 4YJGA 2CUKA 4WLUA 4XGIA 3Q2IA 1R37A 4DC0A 3ZWVA 4UREA 1KS9A 3K2EA 4MKXA 4ZN6A 3CZRA 4D41A 3MTGA 2E49A 1C3VA 2B37A 4CR7A 3P19A 1H6AA 3WQRA 4WUVA 2ZTLA 3QE3A 5F1OA 4TZTA 1YB1A 3UUWA 3ZWMA 1HDXA 1RWBA 1FDWA 3KYDA 2X1HA 1LRJA 4OSOA 1X0XA 2P5UA 4OH1A 4IMRA 2Q1WA 3I9KA 1R4NA 1G0OA 2GD1O 3IP3A 4BVAA 3NT4A 4NG5A 5CAEA 1JLLA 3JTMA 4B79A 1G0NA 2PA3A 3P7MA 3Q9NA 4RLSA 2I3AA 2YV3A 3NTQA 1P1RA 3L4BC 2OOSA 2GZ2A 3HSKA 1HRDA 3KXDA 1DO8A 3L4BA 1QYXA 4HY3A 5AVOA 4AICA 1O0SA 3QY9A 4Z9FA 1VL6A 3GMDA 4BKOA 4FFOA 4XQ9A 1NPYA 1Y8QB 3EUWA 4PRKA 3ANMA 3PFWO 4LMRA 1PGJA 1R4MB 1ZCJA 4NPCA 4IDDA 4R1NA 2IE0A 4FFPA 3ZCXA 4PLZA 4DC1A 1P1IA 3CSDA 5EERA 2I65A 4FFMA 5KTKA 1YKFA 4RCVA 4RZHA 3ZH2A 1D1TA 4GKVA 3ZHXA 1PZEA 3M2TA 1HE4A 3TN7A 3JQ9C 1PGQA 3HN7A 1DOHA 1VKNA 2JJYA 3QLJA 4J7XA 1X1TA 4GL4A 1ZK3A 3KLPX 3S2EA 1A7KA 4Z9YA 2J5RA 2DTDA 3PZRA 1XKQA 3M1LA 1YDEA 4R9SA 3DOJA 4FFRA 1Y7TA 3DHYA 6LDHA 2VZ0A 3RUFA 3G1TA 1DBVO 4BGEA 1EFLA 3SEFA 1P33A 1KERA 1DRWA 2FR0A 3L0DA 4ND3A 4BB5A 4WCFA 3Q1LA 4A26A 1SEPA 1JQBA 3G79A 4LGVA 1SPXA 2P9CA 2QG4A 1HEUA 4ONEA 1H93A 3DAPA 1Z45A 3H3JA 1T2DA 2XXJA 3FR7A 5KVCA 5EMHA 1HETA 1NR1A 1JTVA 3H4VA 1VM6A 1ZFNA 1ZVMA 2XF8A 3D4PA 3C1TA 2JD1A 4AJHA 2HQ1A 3DBVO 1R15A 5KVVA 3F5SA 1EUDA 2HK8A 3EYWA 3GMSA 3LVFO 1YO6A 3DZBA 1W8DA 4CQMA 2EKQA 3PYLA 1KOLA 3U5TA 3Q0EA 2NTJA 8LDHA 5ADHA 5L40A 1TVEA 2DTEA 4RVHA 4CL8A 4MIYA 4PG4A 5C7IO 2VCYA 3LLVA 3AY7A 3DZJA 5T64A 3SJUA 2QHXA 5HS4A 2I6TA 3PHHA 2J5QA 2EW8A 3ROPA 1V3UA 3RJ9A 1DB3A 3RKRA 3U3XA 4E5MA 2JAPA 4BMNA 4I9NA 5K6AC 5K6AA 3A14A 5A3JA 4ALJA 1FJHA 2W90A 4KQWA 5EJ2A 3ZNPA 3U4IA 3SC4A 1RM4A 3PGXA 3GZNB 4D7AA 1I33A 2H5LA 5AXBA 3X2EA 4MKRA 4G5HA 1LDBA 3PWZA 2A9FA 2EKPA 3E5MA 1TB4A 3WXBA 3QRWA 5EQDA 2NQTA 1LU9A 5KJEA 3DBRB 3I23A 2VHVA 3OH8A 1UZLA 4CUKA 1L7DA 3ZWCA 1JWAB 4JK3A 3WNQA 1PJ3A 3BMQB 2WD7A 4XR9A 1XEAA 2GO1A 2O2SA 2RHRA 3GEDA 3CTMA 1NR7A 3M1AA 1XIVA 3WMWA 3HJAA 3Q11A 1K5HA 4H7PA 4HNGA 1WDMA 1J5PA 3AM5A 4AJPA 3IUSA 4BNJA 4MVJE 1HSZA 1VJ1A 2PGLA 1IB6A 3AM3A 3BMCB 2JCXA 1HF3A 3DBHB 2PTGA 3FTNA 1PEDA 1ENOA 2FMUA 4DVJA 5I9NA 2IRWA 4LVUA 4GX0A 4CM8A 5C3MA 4YPOA 4Z3DA 1V0JA 1F17A 4OM8A 3GRPA 5TJHA 1HDCA 4QO8A 2NNLD 4QX6A 1UAGA 3WTCA 3F1KA 3H5NA 3VOSA 2VWQA 1LRLA 4XWYA 2OORA 1BXGB 3BXXA 4BO6A 4GAEA 3LT4A 1I30A 4BV9A 3GVXA 4DPLA 3EC7A 4BO7A 1IY8A 2C5AA 4FCCA 1EUZA 1A4IA 4GSLA 3AUUA 4HFJA 3DBLB 2B83A 2SCUA 2EGHA 4RL6A 4OOEA 3E48A 4F6LA 4R9RA 5IXSA 1EK5A 1MGOA 2AQHA 4NR0A 4C7KA 4E5PA 2AHRA 3QWBA 4WLOA 5IJZA 5DCUA 4BKUA 3FBTA 3WLFA 2QIOA 4IIVA 3ZU2A 2E37A 3RC7A 4I8XA 3GFGA 3I9JA 3VTZA 5I8WA 4BKRA 2BI8A 4OSPA 5T8KC 1JW9B 4GGOA 2UYYA 2WD8A 5T8KA 4DTIA 1V8BA 2QX7A 3W4IA 1ISGA 2O48X 3I9LA 2P68A 2OUIA 3DXFA 1XELA 1KY5A 1U28A 2D5CA 2X6TA 5CDYA 1EBUA 5BR7A 4UEOA 2CDCA 3KTDA 1LSUA 1R4MA 4TSKA 2EGGA 2FR8A 3JQGB 3AI2A 1EFKA 1S7CA 3RU7A 3CMMA 3LT0A 2PH3A 2EP5A 4OAQA 1U3VA 2O2YA 3F47A 1I2ZA 5COAA 4MP8A 4MVJM 4PLWA 4YB8A 4EGFA 1XCBA 1KC1A 1YJQA 2O3SA 4XGNA 4CR6A 2J3IA 2VYVD 3MJSA 1W4ZA 3G0OA 4GX5A 4Q3AA 5L4SA 5IZ4A 3HDHA 3O38A 4XKJA 5JLAA 3R1IA 1PS8A 2OZPA 5JC8A 1JWBB 2C0CA 4R1SA 1RJWA 1Q7BA 1A27A 1T24A 2DQ4A 2W2LA 4CMKA 2C7VA 3A06A 4J9VA 3JYPA 4AJIA 5KJ1A 1E3SA 3E03A 4E6PA 2DUUA 3ASUA 3RBZA 4Y6RA 3NV9A 3PJEA 4JX8A 1J49A 3AI3A 4R3WA
chains in the Genus database with same CATH superfamily
1MOQA 2YNMD 5AOVA 1N7JA 1XRPA 1RE0A 2DFKB 4LQ4A 2NM0A 3BFPA 3SOPA 3ZHOA 4U7DA 4AQYB 2AXQA 2JAQA 3B36A 3T1HB 1RYHA 2ODAA 4OHUA 2C94A 2NPIA 4PG6A 3RSGA 3WXMA 4EO4A 4JC4A 4FD3A 1K86A 4ENSA 3SQWA 3OEWA 1ZINA 4ZKDA 5CB6A 2G5TA 1B15A 4G2TA 4G0VA 3CEPB 1YJXA 5DWDA 3JAKB 4GRIA 3VO1A 2Q3DA 1G16A 3SJBA 4TV8A 4M9XA 4CL2A 4GU5A 1O97D 3URKA 4R3NA 2R6AA 3PR1A 3N0VA 2UYQA 4COKA 2QLMA 3DEZA 4J2HA 4BLWA 2W6JD 1KK3A 1I6KA 1ZHHA 2Y1DA 3C3XA 4DPKA 3I6MA 5HM8A 5KTTA 4CEIA 1WDLA 3O82A 2XODA 5A9TA 3LT2A 5AHXA 1TM7E 1ORRA 4DLYA 4FYHA 3UZUA 2PJDA 5ES4B 2VPTA 4I55B 1T6BY 4P7BA 4DV7B 4KNYA 1JT9A 2WRZA 1N4DA 1BU8A 2ODBA 4CCSA 1QMGA 3PI7A 1OXXK 2V65A 4MI1A 4XCVA 3OQHA 4HWTA 1ML4A 5IKXA 2YICA 4BNDA 2XJ4A 2OSBA 1TF2A 5K8TA 3LBYA 3I61A 3FDXA 1BVRA 4DDUA 4YCBA 1QONA 4HDQB 3IP9A 1DKOA 4DV2B 1Z38A 3CA8A 1ONOA 4ZVQA 5GMOA 4N65A 5CB4B 3HB9A 4BWYA 5JIBA 2YV1A 1HR0B 5KNBA 2ET6A 3LECA 1NUHA 2XLBA 4KG7A 2G4CA 3L4SO 4CKWA 5KSPA 2NTEA 2A9PA 2Q6LA 3PFIA 3L4EA 3SNHA 4O0MA 4P58A 2BUCA 1FK8A 3C3CA 4RHUA 2Y1EA 5DHTA 2CLMB 1XZNA 3RYFA 4HLQB 2H00A 1YV9A 3C4QA 2EXXA 4ZAGA 5J2UF 3F7TA 4B45A 3R8FA 3COJA 5EIFA 2Z8YM 2XCLA 3A1WA 4YRZA 2AW3A 5CFLA 3RVDA 1PEYA 2TECE 1TAHA 2HYDA 5F7OA 2C2KA 1RYNA 3GHHA 3EG9B 3AV3A 3ICPA 4GVPA 1MF7A 3LWDA 3K5IA 3OPYA 1HH4A 4US2R 4KPUB 2DY0A 1FFCA 5LA6A 2ZETA 1GCOA 1XBTA 4YT8A 2ZM6B 4M7PA 3MOSA 5CW1A 3TKAA 3MJTA 4GT1A 1MOSA 2JNWA 1H05A 1EX6A 3RK0A 3GVIA 5KYUB 1L4YA 4RD6A 4ZRDA 2GAIA 2ZPAA 1YJCA 1G20E 1HTWA 2B94A 1DINA 5HUJA 3DBIA 2FW6A 4BGDA 2IZ5A 3OIVA 2XCQA 4IMJB 2GN4A 5I4IA 4WOPA 1NLFA 3OAAD 2WUFA 4ND8B 2O8DA 3BXOA 4ARZA 2YY5A 5C80A 3C3DA 4DJ5X 3MWLA 5SY6A 3QXSA 3UMJA 4K88A 4TTTS 1MO4A 1MX5A 2F48A 1ESNA 2PKWA 3SDSA 4QTZA 5A71A 821PA 4MVCA 3CLSD 3B8EA 1H0KA 4YDHB 5DX0A 1KU0A 1IJFA 2AS0A 1DFHA 3FLMA 5CP8A 2C3OA 4UJ3A 1WHSA 2E5FA 3U49A 3N1UA 4YP1A 5JCOA 4GLLA 3V6MA 3H11B 3UOWA 2YY6A 2V3VA 4XQGA 3BD8A 5MN4A 5DT9A 4GI3A 2EBHX 2J46A 4HNVA 1BDJA 1S2MA 1W1IA 1CUVA 2BFBA 4RK5A 4BNMA 3RJTA 3PFFA 3UPTA 1YIDA 2L19A 2XNCA 3H9UA 1GTG1 2C4VA 4UUNA 4V1CA 1L5QA 4G1BA 2R97A 3BQ9A 2XB2A 3VYTB 2V9PA 4FINA 1OLSA 1UDRA 3UANA 3WWDA 4B7XA 4A0GA 2OENG 3EIEA 3SSAA 3I5MA 2PVSA 4RZ3A 3AFGA 1RI5A 2NO1A 3U44B 1IZ8A 4NE2A 3UJAA 5CK4A 4HWGA 3ZJTA 2G76A 4AO7A 5IARA 3EQ6A 2XZPA 1ZAYA 4CMIA 1FSPA 1GQOA 2PQ6A 3KPJA 221PA 3O5AA 4DRZA 1PR1A 4KLRA 1JZTA 3IP6A 4V0RA 2DRIA 3UHFA 5DBFA 3OQMA 3B6KA 1NDHA 1U80A 2F67A 4OQ4A 3TXAA 1CUAA 4ZQCB 2A0WA 2VRBA 3L82B 4MWDA 1L5GB 4GP9A 1AQJA 1UJ5A 2D3TA 4FHEA 3O3CA 2P8SA 4PR3A 2X5OA 3DFIA 1KI8A 1B16A 3RTEA 1G6HA 2XV1A 3VV3A 1FXSA 3H9CA 1XVVA 2Q4OA 2ZR0A 4O0LA 2BFCA 2A5FA 5ITZA 4B17A 3TBKA 1Z63A 2NADA 1R88A 4BRSA 1RZ3A 2WV7A 4B84A 4QDKA 3TSYA 1G9TA 2FPGA 2HA2A 3QBTA 1ZGBA 3CIFA 2AEEA 2WJGA 4CIXA 1B0ZA 1I3KA 3HZHA 3AONB 4MUAA 3CB4A 4Q16A 1YDMA 3P27A 5DOZA 3T34A 3V8RA 3ZYZA 4B2YA 2Q6TA 3QF4A 5K03A 1BA3A 5J58A 1YT5A 1XRRA 1L4KA 2GNAA 5AJUA 1JHXA 2QN3A 3LS2A 5K3FB 2UYCA 5ALXA 2C9YA 3ST7A 1RC0A 1GFZA 3H3FA 2QPAA 4JYPA 1LBTA 1NBMA 3ITDA 1SY7A 4IGEA 2C96A 4TVSA 10MHA 1MJHA 4FQ8A 4LV5B 1R5OA 1Q1EA 3GL9A 3K1AB 2OPHA 1RT9A 3SJ7A 5TS2A 4MLDA 4BFVA 4DGSA 5L3QA 3F97A 2V6JA 3QXHA 1YVPA 1F2DA 4PE5B 1PWEA 2QM7A 1UINA 4U6SA 1L6IA 2XWSA 4OMUA 2E2WA 3FDZA 2HF9A 4CMAA 4MW5A 2WQ6A 3ZGZA 3PUHA 4ENWA 1IBKB 1TW3A 3R5TA 5KX5B 2I03A 5LBTA 2VQFB 3HDVA 1Y8RA 2HK6A 5CNKA 2OWEA 5GONF 3LCVB 2V7PA 3C87A 2GH1A 2QNRA 1LDMA 4XB2A 5KVQA 4Y6PA 3U9TA 3ZNNA 3SI7A 3SBOA 2GWRA 2ORWA 3CIOA 2UVPB 3LX6A 3HMKA 5E9QA 1XWIA 4XGQA 2FE1A 3WK5A 3RPEA 2AX3A 2ETXA 1AN0A 2BKXA 3O94A 4X45A 2Y4NA 5F7JA 5ITSA 2E4ZA 2IL1A 5GM2A 4R7GA 4JT9A 2XLCA 4KOEC 5CU7A 3C8UA 3EXAA 3UF0A 3ILHA 4LYJA 5FBVB 3HJCA 5KCMA 1E6EA 3K9HA 3WAJA 1Q12A 1HOTA 4JJ6A 3VC1A 1GLGA 4O4LF 4CEHA 3ZPXA 4AP5A 3E2PA 2XBUA 1DKPA 5LP6A 3T1QA 3GAMA 2RGYA 1RI4A 3TXYA 2VQ6A 3KQPA 5IKEA 4ISCA 2QVCA 4FMPA 3ICQB 4YECA 3FKSA 4HB2A 3VJKA 3AINA 1EUDB 1SMKA 4L4ZA 2ZQYA 3RC1A 1IK4A 3A25A 2PGDA 3AFOA 4OXYA 2VBIA 2OK8A 4PQGA 4MICA 4Q1VA 3WDSA 5F23A 1LK7A 3IPLA 2CT8A 3LO8A 4O33A 2ATCA 4QWWA 3QUQA 4WN9A 4XLZA 2NPOA 1T3GA 2FV8A 4UXIA 2ON6A 1Q1NA 4KYVA 4LXXA 4RVGA 3D4IA 4URUR 1KI4A 2COEA 2I6SA 3AT1A 3JATB 4YCCA 1XDSA 1AO3A 5H83A 3I5XA 1IHYA 3NWBA 3SSNA 2A0YA 2WIFA 5AXCA 3I6QA 2HUPA 3H2SA 4DG8A 4A4DA 1SELA 3MQ2A 2L0XA 3GGOA 4PXSA 1E1KA 5EIXA 3IQHX 4JDUA 3Q8KA 3G5AA 3FNEA 2FQWA 2J9RA 1OLXB 1E99A 2CF6A 1K27A 3CZ5A 3HB1A 4QDOA 4GI2A 2GAAA 3ZK8A 3V34A 1GGEA 3HPQA 1DUIA 2VAMA 3QEJA 2WAMA 2JI4A 4YP0A 1DHRA 1PT9A 1R0CA 2J4CA 1UWLA 2WJ4A 2W2KA 5ITVA 1PD1A 2BM9A 2VDWB 3PGA1 2Z4RA 3MAGA 4M4SA 4UCQA 5DK4A 3R44A 2WFMA 2I71A 1JQKA 4KITB 3IAUA 5EHIA 2BHRA 5UKDA 1C9JA 5LBUA 1FNMA 1UJMA 1YULA 3NATA 1UKBA 2GLTA 2GTHA 2MSWA 2X42A 3H2BA 2ERYA 1H23A 3D6FA 2PH5A 2YV2A 3LVBA 3SQMA 1KI3A 4LSWA 4U7JA 2ZI4A 3IP1A 4HC4A 4MVJP 2P3LA 1O57A 5LCXA 4FKMA 4DQDA 5CBKA 1T25A 2NNWB 1GNPA 1RYFA 3SYLA 4ZEMA 2XGMA 2NZ2A 3EBPA 4I19A 4Q6BA 1XXHB 4LGCA 3E3NA 3WB1A 3CZMA 2EVWX 1ULHA 3LXUX 1L5SA 2FWBA 3WADA 3GN2A 2IXEA 4ZI2A 1SBHA 1JDUA 4RTQA 3EPKA 3LUHA 1KDVA 3ZJYA 2AFIE 4RE5A 4F72A 1IY1A 2AXNA 5F7ZA 4KUHA 4NCAA 1V3VA 4Q9KA 5HFNA 5FPQA 4MGYR 3HGTA 4KDCA 2H2FA 2YBEA 1RRPA 1CWUA 2P4EA 5BN5B 3OEEA 3UENA 1R0ZA 2EKZA 5JATA 4WZAA 1R8XA 1ZUD1 4FZJA 2LNDA 2DAPA 3RAPR 3GAZA 3HI6A 2JC3A 3KJHA 3WGYA 4E0BA 3FTQA 3SJZA 4PG8A 1JMKC 1TF5A 3L92A 3T3PB 1D2EA 3RIGA 1WUKS 3VNRA 4KUGA 3AEUB 3CGWA 4B71A 3G82C 5DV9A 2I5PO 3RC3A 1EVEA 3P96A 4MB2A 3NRCA 5AIAA 4EI8A 5IABA 2XT6A 2GMWA 3INRA 4MPDA 5DIFA 1GV1A 2CLEB 1S3SA 4ZV7A 4G1MB 2OZVA 2WU0A 3TB6A 3OI7A 4TS3A 5H9WA 4S1TA 2NUTA 3ND5A 5JVDF 3AVPA 1B2RA 3IEUA 3GH3A 2FSGA 3KFVA 1A2BA 1E59A 3ZC3A 1JA9A 4F3NA 5C7YA 5K99A 1PTJA 2CW5A 2J9ZB 2R79A 3JQRA 1KO7A 4GGMX 3W90A 1I32A 5EIEA 3H5VA 3Q3JB 4QSHA 3V3TA 1X9HA 2Q3CA 1G5QA 5AJYA 2B25A 2PRIA 2HMVA 2XUZA 4ZI7F 3T9EA 5IAJA 4ZMSA 4WA8A 1NVDA 2VP9A 3E8XA 3DC2A 1KE1A 3UB3A 4DHWA 3QMWA 1FW8A 2Q1TA 1XDGA 3BULA 1M0EA 1YFZA 2IIPA 4EJ2A 3QUBA 2RCNA 4AJEA 1SQGA 4M1KA 2XKKA 4YT5A 2Q3BA 1NXQA 3R7WA 2H4JA 3N76A 4BKQA 1BHO1 2PPVA 3PDIB 4CT5A 4BP1A 3CPSA 3QELA 1JHYA 4FNOA 2CXRA 1QV6A 4PQYA 1V1RB 1IBCA 1EFPB 1JBKA 4KWHA 4MKIA 3MUFA 5JSQA 1XZMA 2D7CA 4RVCA 4WAUA 3W4KA 2JHFA 4BJ3A 1QP4A 4G4IA 4JU9A 3X43A 1UWKA 4QT0A 1FUUA 3RIEA 1ZEMA 5JI2E 1ZH2A 3UICA 1M34B 2ZBGA 3BTUA 3LA6A 1KDOA 3KB2A 1JG2A 1TM5E 3BREA 1X86B 3ZI0A 3JARA 4KMOA 2CZCA 2I3GA 4CLXA 4F9TA 5ADVA 4CDGA 5H3HA 4EOGA 1YDGA 1FDRA 4OF4A 4ER5A 2FOIA 4QPPA 5GZ1A 1RBZA 1FSZA 1IM8A 3Q3CA 4B9AA 4I2NA 3U39A 2P3OA 4D9FA 4L9RA 5CR9A 3VTKA 3FVRA 1BKSB 4J4HA 4C2TA 3GHYA 3BD6A 3GGSA 4NESA 3EGOA 3SSOA 3L18A 3KZXA 3JRWA 3SLRA 1SU6A 1DC5A 1P0IA 3K1TA 4TKMA 3WLEA 1E69A 2ZJ5A 1EK1A 3SU8A 3H6GA 4LDNA 2JKYA 1CDOA 2WYOA 1CIPA 1XZFA 4X0EA 4X85A 4GUAA 4UM8B 3IAAA 4HDNA 3E9EA 3U3DA 2L18A 5H8WA 4D3ZA 1Q92A 2WHYA 4RAQA 1PKXA 3H2HA 3GYGA 2Y1WA 2W6MA 1E3WB 3KHTA 4Z9XA 1MG5A 3D7MA 1JIIA 4G4SO 2WLSA 1CE8B 3WOHA 5AVYA 4D9BA 1NQOA 4MA0A 4HBZA 4FBLA 1KDPA 4B83A 4AG5A 4DSNA 1YOVA 3KB6A 2X3YA 2J0SA 2HXGA 3NH9A 4DM7A 2YS6A 1PL0A 1IEQA 4K6CA 3LUCA 4FFDA 2I4TA 3IAHA 2XYQA 4C0SA 3OHSX 4YV1A 1YJAA 5TIIA 1ONSA 5KNBH 1SN7A 2JLCA 2PZBA 3DO5A 2CY0A 2AG0A 1TKBA 4G8BA 3UK0A 4EEXA 2B61A 1RYEA 4BNZA 4YCNA 1Z5ZA 1W2GA 3C98A 3I45A 1ZP6A 4FYKA 5ARDA 5B4TA 2WVAA 1RAAA 2Y4OA 3FWYA 5IHPA 4QGHA 3UM9A 5J47A 3N8NA 3TTWA 4KIGA 2IOQA 1LVUA 2Q0HA 3WO1A 2QRNA 2VBGA 1E5VA 1L5ZA 2QX6A 2HZBA 1B8NA 5DHPA 3O3OB 4NICA 4P3NA 1RQGA 4UHFA 4YHBA 1XD9A 4K5QA 1ISHA 5I6DA 5I8ZA 4QYXA 1OIXA 2CK3A 1L5YA 3AERB 2QEQA 3N2GB 3ZWNA 1XL0A 3QE2A 1RAHA 1SOWA 3FZGA 3BGWA 4MEJA 1E7RA 1NLYA 2OHIA 2X1LA 4IR7A 5JS7A 1WUHS 3R5FA 4YWHA 5ARBA 1U3TA 4NH4A 1WM1A 1Z25A 4XWKA 5JSUA 1C3XA 3QG5A 4PRZA 4Q3OA 1X1BA 2RC6A 1BFKA 2WTXA 3IE2A 3P9YA 1CQJB 4YIKA 5JJKA 3OKAA 1IPEA 4MR8B 3OZAA 4QNRA 1MV8A 4HRYA 4F4HA 1M8KA 2IXTA 1TX4B 3GZ4A 3TLGB 4LRXA 3WA7A 2FPKA 4GYWA 1AS3A 1RWOA 4YJKA 4DIOA 1AF4A 5TQVA 1XLTC 3EVGA 3O83A 4MEBA 3LWNA 3PEFA 5TT0A 3ADCA 2VT3A 3MJEA 5AI0A 2LGJA 1PNQA 4TKUA 4EY8A 1VE6A 3V33A 4RX1A 3HHPA 1WJGA 4EY6A 2EBUA 4QYIB 1GLVA 2RE8A 3G7NA 1W2WB 3BZWA 2HHLA 4NZPA 5DO9A 1EGHA 3RI3A 4B3XA 5I7RA 2Y93A 4XWOA 4NBWA 1S4QA 2AFHA 5DCYA 3FFAA 1Y81A 3IUYA 4LK2A 3PE6A 1AZSC 2AR7A 1K8RA 4EF6A 4II7A 2Z8ZA 3GUVA 3OU6A 2RHTA 2TMDA 3GFTA 2IPXA 5B53A 1E7SA 5BVHA 1J5EB 3O90A 3IBFA 1HQCA 1XEFA 2NO5A 4CM3A 4J16C 4D4LA 1G2PA 5F51A 4GOMD 5HNKA 2YZMA 1OZAA 2JIZA 1PL7A 3G85A 4XYBA 1IXKA 1XOIA 2WWWA 3HB0A 4Y9RA 5AXDA 3VC2A 4DAEA 2EATA 5ANRB 4E94A 2XOKD 1ID1A 2HU5A 4P3OA 3N05A 1FLAA 1MVLA 3I2FA 9LDBA 2YKGA 1IOLA 3ZNOA 5KNBD 4YYEA 2CNBA 3GD5A 3JWGA 4AWBA 2X0JA 1QS0A 1P5FA 2Q9AA 3EVBA 1C80A 2C7BA 1JHVA 5C8YB 2GEJA 1KEUA 2YZKA 4PLHA 1NXXA 4DXHA 3NOOA 4EO9A 5HKAA 1HYEA 3WI7A 4ZOAA 2GESA 3F4KA 3RC2A 1H9AA 5IFLA 1W5TA 1USVA 1XQYA 1PR9A 3F71A 3Q4GA 4KWEA 4HGOA 4L15A 4IIJB 1A9SA 1UFRA 4ME6A 3AP3A 4G24A 4N8EA 1VTKA 1F3OA 3S8EA 3FUWA 2HB6A 2UUOA 3LCJA 3E8SA 5FPTA 3I05A 1V8ZA 3VO2A 5M2QA 4FMBB 5FRDA 4NYJR 4CG3A 1ILEA 3BWDD 1QP7A 3PZBA 5AR1A 4DLBA 1J8QA 4LNHA 1Q2UA 2YFQA 4I2VA 4KYTA 1RM5A 4WZ6A 2FNAA 2MHCA 4X20A 4NZOA 4CUZA 3OUZA 5FA6A 1KYXA 3VSCA 4ARAA 3IOEA 4J1QA 1JDBB 1VG9B 4ALMA 2OPBA 3NASA 4ND2A 1P9RA 3H7AA 5A9SB 3M7IA 4WVFA 2H4HA 4S04A 4B5KA 2RAPA 3DYVA 1LNQA 1Q5PA 4IS3A 1ORHA 3R5XA 4AKTA 1T8TA 1ZIYA 2HQSA 3H65A 5CJJA 4N7RA 2QRUA 3VKFA 4OHXA 1NGSA 2DSTA 1MO5A 2BN4A 1P18A 3IT3A 3OJCA 2AVDA 1NUQA 3F9CA 3TZHA 2AOUA 1GNQA 2EZ9A 4GO1A 2FSVA 2JJ2A 1IHUA 5LKAA 1T3LA 1Z6PA 3BIFA 3WGJA 3VR3D 2QYSA 3PD0A 3CM0A 4KI7A 4PBTA 1KJWA 5FV4A 1BXRA 1NXVA 3VNAA 2AYYA 4JKYA 1OFHA 3BTSA 4P7GA 2Q8PA 2HD4A 3EUAA 3D0QA 2V03A 3DQQA 2G40A 3TL2A 3TVTA 2JGFA 2RGEA 3EZ6A 2PKCA 2V7UA 3NVMB 1O08A 4NJEB 2BEWB 2EWVA 2WKPA 4GMHA 5CDTA 5FF9A 4DUGD 3K94A 1U9JA 1PJQA 4IIDA 3HYLA 1HURA 4XA8A 1FDTA 3VVCA 2HO4A 1M0WA 1R1DA 4IIEA 4A15A 2XMQA 1AZLA 3M0EA 5COBA 5ALTA 3UPUA 3EW7A 3E9YA 1G4UR 1KR2A 2Z43A 3ORFA 1U2DC 4H9GA 3A4YA 5ILQA 1ISFA 3MZ0A 4Q37A 4ZPJA 3RUEA 2Q1SA 3V7YA 4GZMA 1L1EA 2YINC 4MUNA 2VQ3A 1ZD5A 2A84A 2OLJA 4O02B 1KDZA 3DLCA 2C2GA 4DN6A 4QA9A 1JP7A 3CUYA 1I7SB 4O4HB 3SYTA 3A9RA 1FJGB 3I76A 1JIXA 3H8JA 2GS9A 2YIMA 1TVKA 4G9EA 1UF9A 4ZVVA 3ZUPA 4Q3NA 1M2KA 3VAYA 5A5VA 1XD2A 1SXGA 2P2YA 3JZMA 1ZM7A 4L28A 4ZIRB 3PT5A 2FZKA 4R5MA 5HRCA 3EPHA 4CM9D 1ZJJA 2YCLA 1WF3A 1XYYA 3HJTA 4YDQA 1R0YA 5KYUA 1Q0TA 3JQAA 1SM4A 4REQA 3UCEA 1K6JA 1D07A 4AROA 3WFIA 4EKDA 4A0SA 3U1BA 3RC8A 2G70A 1QCYA 3V8QA 5TMDA 3BGDA 1G42A 2EJWA 5EP2A 5LL6P 2DHQA 3CVVA 1TDJA 1JJ7A 2W48A 3CEHA 5CX1A 4UMFA 2DHDA 4RA6B 6ABPA 4P5EA 2XQGA 2XTJA 3GUCA 3SOZA 2FUKA 3AG5A 3GEMA 1ECPA 1R0RE 1AH2A 3AC0A 2DBYA 1Z37A 2C8KA 4M2LA 2VKTA 3SN6A 4DA0A 1O9GA 4M9QA 3IJRA 1EFDN 1IY0A 4IJ5A 1YRBA 1OPRA 1R27A 3PF8A 3R4VA 1N3IA 4QL3A 3W1WA 5L3SB 4G8DA 4JITA 4LWPA 2TRSB 1UJBA 2FGKA 3ZE8A 1FFXA 1PZHA 3I9FA 1RWVA 3DMTC 7MDHA 4CWAA 1VB5A 4RKYA 3JCZA 2E21A 3ROXA 1NVVR 3HZRA 1ZISA 3P2OA 1OR8A 2W93A 4EITA 4OQYA 3WHLA 3PLAE 3OQPA 1NYQA 2BH9A 1DZIA 3KT6A 2ZJAA 4ABYA 2J6IA 5DWQA 3K6KA 1N2IA 3NI2A 2J33A 2WWGA 3QKRB 5HVNA 1TYCA 2B1RA 2XNHA 1QTIA 5IXJA 3L1JA 2BZGA 2X2EA 1F6BA 1P6UA 3SWWA 4NMHA 5J59A 3GEHA 3WNVA 4FYWA 5ALRA 1BMQA 3VPXA 2C95A 2DFVA 2XITA 5DGIA 2CFRA 2EWMA 1L8XA 2IA5A 4TTSA 3GXBA 1CEQA 1EYZA 2Z5VA 4KNVA 3GDHA 3KO8A 4F91B 1X1QA 2OCLA 3ZLUA 4OMCA 1UBNA 4M1OA 2Z98A 4XR4A 4YS6A 5LQKA 2B6NA 3U6KA 3HH8A 3FRHA 3EY9A 3BWEA 3F2IA 1E5DA 5E4TA 4HX5A 5IVKA 4DJTA 2WIAA 4FDTA 4OSEA 1G3QA 3I2GA 4QDUA 2OAP1 4WOKA 5FT9A 3RFFA 5GIPE 1P2BA 2UXDB 1TYDE 2EOAA 4R8VA 2IUYA 4R1PA 3KV1A 4OYRA 3L4KA 1FS4A 2G0TA 4EATA 2YQ5A 3VUFA 4YRIA 4RKQA 4KFCA 4UHKA 1G3UA 1ZJ5A 2EZ4A 1V16A 2W6CX 1O95A 3ESZA 4FCTA 1ZY2A 1XDWA 3NIFB 3RVKA 1OX4A 3G6WA 4P98A 4IH9A 5F1KA 4YI5A 1KZ1A 4QUAA 2GCPA 3ZCVA 2QAIA 4I3FA 3I9OA 2NXCA 4NCBA 3CWQA 1E6MA 5ABPA 3KKZA 4KR3A 3GEGA 4IDEA 1HNWB 3F8WA 3RCBA 2JJMA 1I2BA 4MH0R 5KEIA 1AM4D 2BHNA 4FW9A 1VPVA 3OZVA 2E4UA 4RS4A 4ENTA 3EBOA 4QXPA 1BJRE 2VPWA 4RA9A 2IYPA 4I6GA 1Y0BA 2W42A 4ARSA 3RTAA 4OVKA 1DEAA 2C20A 3DCIA 2DPMA 3QFSA 3B85A 4OHBA 1RTTA 4K1LA 4PYMA 3IA2A 5TVKA 3WJ1A 5FQOA 5AW8A 5I5EA 5NULA 3WK7A 1VDMA 3FN4A 5IANA 1HT2E 2C1EA 4O2BA 4TLCA 5JWRA 3E18A 1JQLB 3AKYA 3BRWA 4MYUA 1W19A 2NIPA 4BMPB 4B48A 1VYVA 1CETA 4DLZA 1W93A 5A2QA 3TRIA 3HU3A 3CCCA 4HZGA 4MPTA 2ZS8A 3PR2B 3I52A 4JR0A 1Z62A 2NGRA 3IKLA 4N3NA 4R8SA 1Q84A 5DM60 2YVLA 1PGPA 2AZMA 3K09A 1XMXA 4UUAA 5DNCA 5AKLA 3PQ5A 1N36B 1L4HA 2UVQA 1ESMA 4DEXA 1U1FA 2BR4A 2FPXA 2QPLA 1V8FA 3ETGA 1KBZA 2A92A 1QRRA 3DUFA 2E3JA 4KLNA 5CT4A 4ZMBA 3PQ4A 2QQ5A 3S2IA 3F3YA 3TX2A 5THQA 2XI4A 4NL4H 3ITNA 3TUJC 4BMZA 3TFOA 3KSAC 1Q16A 3VFDA 2FQ1A 4KWTA 1OD6A 3IDQA 4MW4A 4NG4A 4EUNA 4FNAA 3RHTA 2XKJE 3DGFC 1SXJC 3JS5A 4HWKA 3Q7QA 1NVFA 1JEAA 3AWIA 2GK6A 2O0LA 3KUDA 2C8JA 4S05A 1PEAA 3LTNC 5K8JB 3R5KA 3NBUA 2BJWA 3LCUA 5TS3A 4EO7A 3O4HA 1AX9A 4ZJZA 5KHOC 5KYXB 1QPGA 3HVIA 1Z4KA 1EE9A 5LQJA 2I4OA 4U3JB 3K0FB 2R7AA 3ENKA 3H5RA 1ZC4A 1E3QA 1G5TA 1FFWA 1O89A 2QNBA 4TMFA 5BR8B 2RG1A 2W83A 1V5WA 4NJMB 4RMIA 1WNTA 3VC3A 1D04A 1L5LA 3VGPA 4XJXA 2NYVA 2ECKA 3R41A 4J1TA 1FB5A 3V97A 2NSJA 4ZYZA 5FWXB 1Z0DA 3OY7A 1Z13A 2JIMA 4IICA 1LD3A 4B6PA 2YV4A 4WZBB 2IX3A 2O1WA 4G81A 3N53A 3OLYA 4YT4A 3OECA 3EZYA 1YJBA 4UTXA 2HIAA 2PXHA 3ZDQA 1W35A 3COYA 2YOGA 1CR4A 1UXJA 4ASUD 3AI1A 2VF5X 5DGXA 1ZMXA 2O3UA 3DPSA 3THOA 3WL8A 3T4EA 2ZIEA 4WLEA 3ZDAA 2JLAA 4Z49A 3W6PA 5CD1A 1U1GA 5LQNA 3C70A 3TBFA 4PHHA 2AMFA 2Q2NA 2F3SA 1N5IA 3OE7A 4R2HA 2WMNB 4RIFA 1VPWA 2BSQA 2FVYA 4QRHA 4WCVA 1YU6A 4HNHA 4EW6A 5ALPA 2QW0X 1UAYA 4QTYA 3IIMA 4GIBA 3EVAA 3EXG1 4CLOB 4YRNA 5IPFA 2VP5A 4PZUA 1K5PA 2PSHA 3EK2A 5JAHA 1M9NA 1L7XA 1ZX1A 3LQYA 3N2EA 1ORIA 3KXPA 3R6GA 3WGVA 1C4OA 4KQ1A 4D42A 4EVIA 2HQRA 3WFJA 3BWCA 3AHGA 2OHFA 2P9YA 5KNCA 3UJBA 5CT5A 2ZT5A 4YTEA 3PLNA 3WYBA 4A91A 1U5CA 1II8A 2C4HA 2MINA 3DHWC 3KQOA 4BP3A 1WDWB 3DCJA 1ZUWA 2V0CA 2XEDA 1O3YA 3GUUA 3I73A 4MKFA 2YN2A 1L4FA 4DMUB 1YE3A 4QTXA 2BKVA 4HEA1 4JUIA 5HA5A 4EUSA 1YJ5A 5GGXA 1Z56C 4LHEA 2QY6A 3MXOA 4K87A 4B0PA 4BLVA 5MFZA 3ZHZA 1KEVA 4RQBA 1YBHA 2CDBA 1S4MA 1AU9A 5LD2C 4OTZA 1D9XA 2J07A 5B30A 2B2XA 1XZPA 2YW9A 1HLDA 4FMDF 2DQYA 2PUJA 3RUCA 5L6MB 2DFLA 1P5HA 4NY1A 4OHZA 3AGQA 1Q1QA 2IC5A 2F8LA 2XUHA 3RGGA 4JV5B 2Z5FA 1N2EA 1VPTA 1V3TA 2PWZA 4G65A 4HVLA 1TUIA 3H1TA 5L9AA 1E1CB 1W5SA 3WL7A 4ZGWA 2O3TA 1MB4A 2O8BB 3LQ2A 4UC0A 4YR9A 3TG2A 4TZ0A 1IM2A 1DAHA 1JG6A 3T06B 2ZUFA 4K1XA 1DBPA 2O4CA 4FYPA 3HA3A 4TMTA 3AB3A 4ZP1A 1XXLA 4C4PA 1U3FA 9GPBA 1H1LB 4RVUA 4QFMA 3QKIA 5JU6A 1NQAO 3ZI7A 1KZ9A 2VZLA 5FNVB 2Q8QA 1FTWA 4MS1B 3Q41A 1U7UA 1TYZA 4UUBA 1NW8A 1T8PA 3L79A 4M53A 4XYMA 3ZBUA 2Y9PB 1Q3KA 1U8CB 1Q19A 1WU7A 2AB0A 3I9V6 4R6WA 4YROA 4B34A 4C0LA 4C5CA 4QQ8A 3VHRA 1E2BA 3W4JA 3LGXA 1DFGA 1BMFA 5JJ5A 4BLPA 1PZXA 3FFBA 1EAMA 2DULA 4J7UA 2COUA 4IYJA 1QF9A 4PEVA 2GVDC 2FUG6 2WE7A 3G8YA 5EGSA 4X62B 4V3CA 1EM8A 1HDOA 3MD0A 3OURA 1Y9AA 3SDZA 4EYEA 4HNUA 5IMBA 3ZY6A 1IQPA 1QQ5A 1V4NA 1NI4A 2GRJA 5BWOA 3DD5A 5EWJB 4MPRA 5EE0A 4EECA 4JMPA 2VBFA 1E8DA 1H6DA 3IPXA 3W3AA 1EP2B 1YI1A 3BORA 3USCS 4B44A 4DGQA 5CBPB 1CEYA 2C9CA 3INTA 4HATA 3T35A 1N9GA 1A9OA 1O94C 3P0HA 3UG6A 5HR5A 2O5EA 3DO6A 4X24A 5JDIC 1FVXA 5A2GA 3LDAA 3R6LA 4QKQA 5KWSA 3VDMA 4IUBS 2XTMA 3W1EA 1QYCA 1QR6A 2H6EA 3HVHA 1QGED 5L7YA 4TQGA 1XU9A 2GYYA 2A9JA 2NO7A 1QIFA 2UUBB 4IL5A 1N0IA 2XXAB 3WKDA 1JNXX 1LVHA 3U7RA 3H1GA 4EARA 3PSAA 4ALIA 3FNIA 2OCIA 2Y3IA 1L3IA 2YYSA 2ZOSA 3PYMA 4GR9A 4HH3C 4J0JA 4LXYA 1UM9B 4U6QA 4ES6A 5EE3A 4KUEA 3AIKA 1YC2A 3J7TA 4B3CA 4ZOLA 3PUJA 5IC5A 1F6DA 3NM4A 3S68A 3CGGA 4L76A 3BTOA 1N34B 1Z5VA 2F1JA 2QB5A 3LKBA 1L9KA 4IZHA 2HMWA 3RM3A 3ZE1B 1Y8AA 3A1TA 3HCEA 5IU6A 4MYDA 2UYOA 1NAIA 1NW4A 1OXKB 3MINA 1JILA 1QGOA 4ZC1A 4YAUA 2OV4A 1YHZA 1KO8A 3L7BA 2Q5LA 3G2PA 1P4SA 4BQRA 3ESDA 5AHOA 5B36A 3D3JA 3MT9A 4MTCA 5CXUA 4BQNA 2BZSA 1IUKA 2WG0A 1F7UA 4Q4JA 2DQKA 4V0LA 1JFRA 4KGDA 2NXNA 3JQFA 4LFCB 4YK7A 4H7HA 4AKSA 4LC9A 1L7RA 4MW0A 3MT8A 2CXNA 1U3GA 3PXUA 1EUYA 2FWMX 2ONZA 3N2IA 1N0HA 2QVZX 2P2SA 3DL7A 4HR7A 4LBZA 1JJAA 1ACLA 4L95C 4WNIA 3DDSA 4EJSC 2AR9A 5EXEA 1K06A 5GY7A 2AC2A 2AXEA 5BN1A 3USES 1CU1A 1XVIA 2EG9A 4S1OA 1USUA 2WFLB 3WLOA 3JVEA 3REQB 3WDLA 4BE4A 3IILA 2E5WA 3NC1C 4R7TA 3IERA 5BV2P 3PPXA 2B82A 3PRJA 3NKVA 1MRSA 4A6EA 1ZHOA 3RYCA 4U9HS 2PXCA 3ROMA 4J9UE 5AO9A 3UGJA 3ZQ4A 2WTUA 5B7QA 4F6CA 2P2CA 3HCFA 2BUBA 3UY4A 1YCGA 3W6UA 1JTFA 2C7GA 3N8IA 1WUTA 3QSGA 3JQ7B 4A10A 4CM6A 1C2YA 1PQUA 4PLYA 4AMZA 4YP5A 1RI1A 4R84A 1UJ6A 5GV8A 5I7FA 3L1KA 4RFSA 1ODIA 5KJ6A 3DVAB 3CISA 3HGMA 1E0AA 5I9SA 4TXNA 1PJ8A 1B74A 1KF0A 3IAM6 3U7QB 4YR7A 4TV9F 1M3SA 1Z16A 3OZTA 1RCFA 1I94B 1W44A 3BH6A 3OBIA 4S24A 2NUPB 3VDNB 3WLHA 4E15A 5U4QA 3ZOKA 3BE6A 8ADHA 4AJOA 1SHZA 4QOGA 5T4FA 3LI2A 4AG6A 4YN3A 2DLNA 4JVMA 3ABQB 2FSUA 1XEXB 1M10A 5TNXA 1N6NA 1ZW6A 1IG3A 1T2EA 2NQ2C 2V74B 4BOYA 1ZH4A 4F3CA 1Z8HA 1OX5A 3Q3GE 3B6EA 4ENRA 4ZMRA 1NZJA 3ZDFA 4GEKA 4N6GA 4ISBA 3UXMA 3AIIA 2J0UA 3EE6A 3EMBA 1CUDA 2Q27A 4B87A 2C98A 3WNCA 3RQSA 2W4MA 2FF5A 3ZCPA 4DLRA 2HO5A 2YMPA 4OK5A 3ADBA 3GRCA 2XAUA 4YDRA 1SUDA 1U63A 3DB1A 3GXOA 4R98A 3TTUA 2NXJA 3LUGA 3ET5A 2DR2A 1W9MA 3U4QB 1AVTA 3VH3A 4F3RA 1Q21A 1KJ9A 2IY8A 2IYAA 4HTFB 4EBBA 1AK9A 2WD9A 1LLQA 3NBZC 4EHHA 5GVSA 3BKWA 4RXMA 4YUAA 2REQA 5FBZA 3BA6A 4L9SA 2WJVA 4UCXA 3KWJA 1AGPA 1CDEA 2WJHA 4JJ4A 1K89A 1T9AA 1XU7A 2OGWA 3L1VA 4ZOQI 1H4VB 3OC0A 4U5QA 2YMLA 5JECA 1H3NA 1RC1A 3DOFA 4PAOA 2H07A 4EUKA 2GZAA 1FFEA 1RI2A 2GAFA 4M0LA 3FTFA 1OLOA 3A6HA 3G8CA 1XTJA 2D5AA 3OQVA 4MPJA 4BLTA 5GTDA 4Y1RB 1IOWA 1E2NA 3NIWA 2YQZA 1QQBA 1BJTA 4TVOA 1Q44A 5FBWB 1YMQA 4KDFA 4CQMD 2Q5EA 3DJFA 4RQUA 4EX7A 2C2MA 5EHNA 1U4NA 5SZJA 4F5YA 1Z3IX 1LK5A 3I3OA 3QP9A 1U8XX 2LCQA 1F06A 2YJ6A 4KK4A 2H52A 3HUDA 4HQ0A 1UDXA 2GN8A 5EWLA 1II9A 3V46A 2GXSA 1YZHA 3PFNA 3OF2A 2IEAA 3BL5A 3W5CA 1GEGA 1YGPA 3EIWA 3GNQA 2Y9MB 1W6UA 4U00A 1LQ2A 1UDAA 4HXFB 4OFXA 5IF9A 2PL1A 3UAYA 1S2OA 3SX4A 1PUXA 4EDHA 3AJ8A 2A7XA 1BGXT 2PKQP 3QIVA 2GASA 3NFYA 1ZUNB 3EXHC 2LD4A 4YRSA 1A50B 2IYNA 3C8DA 2CV2A 3I2YX 4GQIA 2PM8A 2IXBA 4AJ9A 1GQSA 4F46A 3MRXA 1W0CA 2VC2B 4GHWA 4NOMA 2QSYA 2XMPA 1XCLA 4WH0A 1P1JA 1QAOA 3ZG6A 4Q02A 1GLNA 4MV1A 2ZJ7A 3QKSA 4YP9A 4IQ0A 3DQPA 4FJ2A 2K6GA 1CB7A 2QUIA 4WZAE 2Q6OA 1QHSA 5HIMA 2NVUB 1QGDA 3L7LA 3MJHA 3OZFA 3I3SR 5TQ0B 5JARA 3RS8A 1OB5A 1GXSB 4PYLA 2FYTA 3AM4A 3OKFA 3WQBA 3GUHA 4H2DA 1E9FA 3L8DA 2OZEA 5ITWA 1W96A 4G67A 5IJXA 1U0NA 1Z2NX 5CVTA 1Y1TA 3FOBA 4N5NA 1BXKA 4XIYA 3PWTA 1EAYA 3BN3A 1W0JA 2X8LA 4IVPA 1ZGZA 3MJRA 4ENQA 1UUFA 1E2JA 3EDOA 1CEEA 3HYNA 1P4JA 3DE7X 3GR6A 5FPSA 3HKEA 1QYRA 1RAFA 4EM6A 1XPRA 4DCOA 4MVJF 3OO0A 2HNKA 2FMHA 3OIGA 3ZI4A 4DIFA 2VDKB 4DR3B 1ZAKA 4FT2A 1FU8A 3NORA 3W2IA 3HCOA 3DKPA 3QV1A 4OV6B 3AIMA 1E6LA 1N8TA 2H3EA 4Z2YA 4GOXA 2D1RA 2WJYA 4MVXA 3RSHA 4UFPA 2P8JA 1H85A 3ESCA 1A5TA 1JR3A 3PT9A 3PNOA 1RFGE 3PC7A 3T5AA 2IK8A 3DE0X 1WLSA 3PRKE 1ZL0A 3AUKA 3WYFA 5KOHA 4JI0B 3ZBPA 3N6RA 5HEKA 4GLJA 3VSAA 1E7QA 1I0ZA 2GJ8A 4UNRA 3T7SA 2BMWA 3FPAA 1QTQA 4YCSA 1RYYA 3SGLA 1TT5B 5F33A 2YN4A 3J81A 3V32A 3WLPA 4R41A 3B78A 1JVBA 4RADA 2H4ZA 1M1XB 1TU0A 5TEVA 5B64A 3WLNA 2JLXA 3ESRA 1NV9A 1PJLA 2WA2A 3IIJA 3II6X 1NSYA 1OPXA 1URPA 3UFXB 3WWPA 2GYVA 2Z4SA 3BFJA 4Q12A 3NT5A 5L53A 4YJFB 4Z8YA