1H2BA

Crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
343
structure length
343
Chain Sequence
KAARLHEYNKPLRIEDVDYPRLEGRFDVIVRIAGAGVCHTDLHLVQGMWHELLQPKLPYTLGHENVGYIEEVAEGVEGLEKGDPVILHPAVTDGTCLACRAGEDMHCENLEFPGLNIDGGFAEFMRTSHRSVIKLPKDISREKLVEMAPLADAGITAYRAVKKAARTLYPGAYVAIVGVGGLGHIAVQLLKVMTPATVIALDVKEEKLKLAERLGADHVVDARRDPVKQVMELTRGRGVNVAMDFVGSQATVDYTPYLLGRMGRLIIVGYGGELRFPTIRVISSEVSFEGSLVGNYVELHELVTLALQGKVRVEVDIHKLDEINDVLERLEKGEVLGRAVLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of an alcohol dehydrogenase from the hyperthermophilic archaeon Aeropyrum pernix.
pubmed rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
molecule keywords ALCOHOL DEHYDROGENASE
total genus 112
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2002-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h2bA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1h2bA01
1DEHA 3OQBA 3C1AA 3GDOA 3A14A 4NBTA 4TZTA 4UULA 4CLDA 3GVIA 4Z9FA 4M8SA 3R3JA 3H9JA 3PWZA 5TIIA 1ZSNA 4CMBA 4DLLA 4L8VA 4J1QA 4C7KA 3AUSA 3S2FA 4N54A 1V8BA 3JQ8B 2VOEA 3PEFA 4WLFA 2GDZA 1MFZA 1HE2A 4NJOA 5KVVA 1HDZA 2R2GA 3NV9A 5KJ1A 1IE3A 1XLTA 2Y1DA 1GPDG 2AE2A 4CV0A 5JC1A 3WBBA 3IKTA 4CLXA 2W8ZA 1ISJA 1LC3A 3JQFC 3P19A 4EUEA 4PCVA 2WJPA 5TT0A 4M49A 1ZK1A 5KKAA 3HWRA 1CYDA 1GU7A 4BQRA 2VHXA 2C2XA 3OP4A 4I5EA 4N5MA 2AW5A 3GDFA 3CH6A 3ON5A 4ROSA 4J90A 4UVEA 3NGLA 4DREA 2VTDA 1CDOA 4RPKA 3AY3A 3JTMA 1R0KA 3WG9A 5JCJD 4BNGA 3D64A 3GPIA 4XIYA 4DIFA 4RGBA 2BLLA 2YFHA 2C7GA 3QP9A 3U3XA 3O38A 4JP3A 4DA9A 3I9NA 2VCYA 3UOGA 1DIRA 4RV9A 4CM4B 3TZKA 4TRMA 1YBVA 3GUCA 3TRIA 4F45A 1Z7BA 4LCEA 1KC1A 3GRPA 1MG0A 1PZHA 4XJSA 4WCDA 4Q39A 2VRBA 3ASVA 2I67A 2JD0A 1EMDA 2O3QA 1D1SA 1KVRA 1SOVA 4IDGA 2IYPA 1ENZA 4YJDA 1YONA 1LDEA 1A4IA 1YQGA 2QYSA 3Q2KA 3U09A 1QV7A 4IQ0A 3HDQA 4B7CA 2NSDA 4WEQA 4XX0A 1XEAA 1Y8QA 4J7XA 4XGNA 1GR0A 3KLMX 3ROKA 3DL2A 4X54A 1R12A 4R5HA 1ISIA 2B5VA 4RPJA 1HDRA 1PJ4A 1Y9AA 1EE9A 3X2EA 4BO0A 3WGQA 3IS3A 3JYQA 2Z1NA 3PQFA 4AVYA 2DBRA 3IIEA 3I9LA 3OBBA 4JROA 4CQMB 3OMLA 1E7YA 4TRNA 1WW8A 5HM8A 5COBA 4FJ0A 3WNVA 2Q4EA 4J2OA 4J0EA 1P1RA 5F1KA 4E3ZA 1ENYA 3Q0EA 5TNXA 2W2LA 4TQGA 3MJVA 5A3JA 2I6TA 4AJLA 1PSDA 4XQEA 1YE3A 1YWGO 3R1IA 3GAFA 1HWYA 1Z73A 4FFRA 5EESA 1IUKA 4OYRA 1HE4A 3Q9UA 5CPFA 3NUGA 3OA0A 5TGDA 2PWZA 3LLVA 4PG8A 5BT9A 4EJ6A 4A2CA 1WXDA 2HRBA 4R41A 3JQDA 3Q9NA 4KDFA 5JMPA 3DBHA 4RDHA 3RUFA 1WZIA 1JWAB 2CSUA 3RAJA 2P9EA 5HTOA 1AXGA 1KEVA 1JAYA 3GAZA 2DUWA 1KVSA 4ZQHA 2ZYDA 4BS9A 4W6ZA 4PLFA 2AEJA 4PG7A 5L45A 5T57A 1D1TA 4Z3DA 4AJIA 2D2IA 2A35A 3H4VA 1Z45A 4MVJA 4B4WA 3B6ZA 1F8GA 5FI3A 4NJMA 1HSZA 2HMUA 3BYZA 2BHLA 1U7TA 3RFXA 1X1EA 2ZTVA 4RF3A 2NU8A 2Q2WA 1CERA 3PK0A 1DJQA 5CFZA 5IN5A 3GNTA 3H2ZA 1VKOA 3IUPA 1NX6A 3ZV3A 3WGHA 4R16A 3HFSA 5F21A 3NGXA 1D3AA 1P3DA 5DCWA 4NMHA 4Z0TA 1W73A 3B20A 3GEGA 4AG3A 3AY7A 4UUNA 3TOXA 3PWSA 1I3LA 3E5MA 5ENDA 1ADCA 4CM5A 1T2AA 2AQHA 1G1AA 1ZNQO 4D3SA 1E6EA 4IQ8A 5EERA 3UHAA 3VC7A 3QWBA 1W6UA 3HHPA 5BNIA 2ZTLA 2DPHA 4EITA 5G0VA 4DBZA 3SC6A 1BRMA 3WYBA 2TMDA 4IY1A 3SXPA 4JCOA 3CE6A 4BGUA 1U3TA 5JDIA 2V7PA 3FWZA 2WYUA 4BO4A 1TT5A 4WUVA 2HSDA 1JKIA 2YW9A 1WPQA 2NM0A 3LT1A 1RYDA 4CMAA 6LDHA 3N7UA 3JD1A 1VJ0A 4IJVA 3EZYA 1NHWA 3DOJA 2E4AA 4PLYA 4L75A 2EP5A 4L4RA 4HBGA 3I23A 4OXNA 5T64A 3TPCA 4EEXA 2FR8A 2CDBA 4HWKA 5L7WA 2VYVA 2B4RO 3JYPA 4FS3A 2BKAA 5T8KA 1ML3A 4YWJA 5G0WA 2GN9A 4E32A 1EFKA 1YL5A 1PQWA 1Q0HA 4DC1A 3ONFA 5BQFA 4PLHA 4D42A 1QXSA 2X9GA 4FGSA 3V2GA 2OMEA 3CMCO 4DYVA 2ZCVA 4Q3AA 1C1DA 4E4YA 2C54A 4BGIA 3E6AA 1KY5A 5CG1A 4WNIA 3FNHA 4JBIA 1IB6A 3QRWA 4Z0HO 2BGMA 4YT5A 4YRAA 2GN6A 1MXHA 3MEQA 4MPDA 4QFDA 4TSKA 4F3YA 4CR6A 3DZBA 4IMRA 3L4SO 4QQRA 2AEFA 3BMCA 5B1YA 2IXAA 1BGVA 3F6YA 1I36A 3AU9A 5JW6A 1E1KA 4GLLA 2GD1O 4CMJA 1U3WA 3RC2A 4CMIA 4QO7A 2NVUA 3IJRA 1U5AA 4XD2A 5GZ3A 1PL8A 2CZCA 4PRKA 4W9NA 3RUEA 4B7XA 5IXYA 1C1DB 4J3FA 4HADA 3TN7A 2VOJA 2ZB8A 3DWFA 1C0LA 3OJLA 3D5QA 3DZFA 4E5NA 2JCXA 1Y8RA 3H5AA 4KP7A 3IQDB 4MJLA 1HYHA 1N1GA 5U9CA 3DZHA 3F1LA 1RYEA 1YRLA 1YO6A 4XRGA 1P33A 2A94A 2QYTA 3MTJA 5AYVA 3OEWA 4R4JA 4YACA 5TLSA 3VZSA 1P31A 3K6JA 3PFFA 4YJFA 1NVTA 1S6YA 2Q1UA 3ZWYA 1GQQA 3S2GA 3SC4A 4BNYA 5C5IA 4NU5A 3C7AA 3FNGA 1E0DA 2GYYA 5DDIP 1NHGA 3ORFA 1PR3A 2G1UA 1W8DA 3NJ8A 1VM6A 3P7MA 3PJGA 4KMSA 1HL3A 1L7EA 3ZDFA 2IEDA 3D7LA 5U4QA 1HZZA 4K6CA 4FN4A 4XQ9A 1QV6A 2O3TA 4BO3A 3GHHA 1KVTA 1NFQA 1VL6A 1Q0QA 2EJWA 4DC0A 2O50A 4PLVA 1YOVB 4YAJA 1XHLA 3UH1A 3VZQA 3KTDA 2OXIA 4JNKA 3CUKA 3A06A 4NH4A 2YDYA 4C7JA 3L4BA 1XR3A 3B1FA 3HFGA 4GPD1 5ES3A 3C8MA 3KSZO 3CINA 2RAFA 3I6IA 2O7QA 4MIOA 4BMVA 4I1IA 1HDCA 4R54A 1LTHR 1T2FA 3NT2A 5CDYA 2NWQA 2G76A 1DFIA 4CLRA 2GLXA 3Q3CA 1CIVA 5TC4A 4D41A 2PZKA 5DCUA 4IDCA 1I3KA 1E7WA 1JVSA 3U9LA 4FCCA 1FDWA 1HLDA 4NBUA 1HRDA 1M67A 5KVSA 1LU9A 2YV3A 4A10A 5U1PA 3VPXA 3IKVA 2LDXA 3MCVA 4YCAA 7MDHA 4HXYA 1DJNA 4NHEA 3ONEA 3JQ7B 5COAA 4WGGA 5DP1A 2VNSA 5A4DA 5KJFA 5FEUA 1HETA 4N5NA 1PQPA 5A02A 3AUTA 2V6GA 3ICCA 2O7SA 2NVWA 4GQAA 4MVJG 1R4NB 4JK3A 1T4DA 5JYDA 3DTYA 2J3HA 3O26A 1O9BA 3WIDA 5AVOA 1R16A 1DHRA 4GVXA 3NTQA 2OGUA 1KEPA 4HP8A 4HNHA 3K5PA 2J5QA 3WICA 3I9KA 4UUOA 4Y98A 3QSGA 4CMGA 4UVDA 4BKRA 1YGYA 5KJEA 3OFSA 4R5MA 3P2OA 1KS9A 2VWPA 1LLDA 2PA3A 2AA3A 2W90A 3VKUA 1E3SA 2EKPA 3ETEA 4RDIA 5LDGA 2PGJA 1KBZA 4E2ZA 1BXZA 4GKVA 3H3FA 1HXHA 3D5TA 5ITVA 1U1IA 3R6DA 2VNAA 4DL9A 4KWHA 1E1NA 1SNYA 3HN2A 1JN0A 3OQ1A 4P4LA 5TQVA 3BMQB 3RSHA 2X0IA 3ZWCA 3F4BA 1U3UA 3DAGA 4E30A 1I33A 3O4RA 4AJPA 1X0VA 1PS0A 3O8QB 1SCUA 1X14A 3M1AA 4YQZA 1I2ZA 1JVBA 4P38A 4BL5A 2Q46A 1SBYA 4NK4A 4GAEA 4IDEA 1PJLA 2CF5A 3F3SA 2DFDA 2EV9A 1XKQA 4WCFB 5EINA 1Q0LA 4XZ3A 1NM5A 2EKQA 2ZTMA 4CQMA 1ZK2A 1BSVA 1C3VA 4U0KA 5IZCA 1PJ3A 4NR0A 1A9YA 2CDCA 3ETDA 2P9CA 3KHUA 3U0BA 3JQAB 5IZ4A 4OH1A 4I8XA 1WMAA 4KOAA 4CLRB 1GZ3A 3JQ7A 1P9LA 2FZWA 4O1MA 3S2IA 1A7KA 3WGYA 3EAGA 2B4TO 4PVDA 2R00A 1HDGO 3QWAA 1UXGA 2WDZA 1RPNA 5H83A 4BNTA 5B12A 2PLAA 2CD9A 2PV7A 1PS9A 5A9SA 2D5CA 2V65A 4Y6PA 4TVBA 2CDAA 3V2HA 3LQFA 2WMDA 5JAMA 1IHYA 3PZRA 4LSMA 3ZWMA 3UXYA 3PQDA 4BV9A 5G0TA 2VZ8A 1NFRA 3D3WA 3VDQA 1N5DA 3K2EA 3L6EA 1J4AA 2YYYA 5DOVA 1XSEA 3ADPA 2NNLD 4PG5A 4RZIA 1IYZA 1V35A 2J5KA 4WOKA 3VZRA 1NYTA 2W2KA 4PZCA 2ZB3A 3PHLA 1LJ8A 4E2WA 4D44A 2D1YA 3JYNA 4CM7A 4FGWA 1O95A 3RFTA 3JQBC 5K1SA 3M1LA 1IZ9A 3TZHA 1SPXA 4FDAA 1R15A 2VZ0A 3VH4A 5A5FA 2YHIB 3FSRA 3TZ6A 1J49A 2EIHA 3PVZA 4MKXA 1XA0A 5L4NA 4OSPA 3MJEA 4LRSB 1PJ2A 4OHUA 3I3OA 3ST7A 4J16A 2BFPA 3P5SA 3DQPA 5CPBA 3ZH2A 3ITKA 1O94A 1ZJZA 1I3MA 1H94A 3NTRA 5TJHA 4DLBA 4RORA 2XXBA 2WM3A 4WLNA 3WXBA 1ZCJA 5A9TA 3RASA 2O4CA 3GQVA 4XR4A 1T26A 1YDEA 4N18A 3FI9A 4AFNA 3DXFA 1IY8A 3W1VA 1N9GB 1AE1A 4FFOA 4FFPA 4RO0A 1GUYA 1RM4A 3N58A 1QLHA 4E0BA 5IZCC 4H15A 5A3VA 4E31A 1B8VA 3DBLA 1G6KA 5ILGA 4B79A 4XWYA 2VUUA 3ZWXA 3GR6A 1PTJA 3WGOA 2DTEA 2RBEA 4WLUA 4WLVA 3GT0A 3CXRA 1VSUA 5TSDA 1E77A 2ZQYA 3MWDB 3NDJA 4FR5A 1IHXA 3L9XA 1EQ2A 2B69A 3Q2IA 1Q7CA 5JO9A 2UVDA 2C5EA 3U4CA 3SEFA 1LLUA 4M54A 4CUKA 1YH3A 3RJ9A 3NT4A 4AJJA 3GVPA 1E1MA 2OHXA 3QWHA 2GZ2A 1SB8A 3I9MA 3OSUA 4ZRMA 3OEYA 4RVDA 1JAXA 3JQFA 3RUCA 1X0XA 1I3NA 1XIVA 3F9IA 3K73O 4L0QA 3WYCA 2VHWA 5CG2A 4RF5A 4AL4A 4DMLA 1XYGA 4GX2A 2GPTA 3DHEA 3QW2A 1OAAA 1ZSYA 1PGJA 3GVHA 4LCJA 4U6QA 3EVNA 4FBGA 4ZRNA 4ALNA 4MVJH 3EW7A 2ZKLA 1SAYA 1P1FA 2WEKA 1OC2A 4UREA 1DIHA 2R00C 3WQRA 1MA0A 4ZU3A 3B1JA 1ZIDA 3PHIA 2OZPA 2QG4A 3ZGYA 4NFSA 3PHHA 3WFIA 5IDQA 2HLPA 3WB9A 2ZQZA 1A4UA 3KYDA 4L9RA 3ZU3A 3GMSA 3D4OA 5KIAA 5KVCA 3DTTA 3JQGB 5AXAA 3O8QA 5JCXA 2GR9A 4J6FA 4BNUA 1SC6A 1GYPA 3VHRA 3V1UA 3ZWOA 2X9NA 2X6TA 3BHJA 3GHYA 1P44A 1Y81A 4CM9D 3I4FA 1QKIA 1KVUA 5FFFA 1NR7A 2VT3A 5IN4A 4LMPA 4I9HA 2VT2A 4BB6A 4RVHA 3ZWPA 1HLPA 3TSCA 4N5LA 3GY0A 3JQEA 1EQUA 3WBFA 2FZEA 1EVIA 1E5LA 2G82A 1Z74A 3ANNA 2D3TA 3OETA 5FF9A 1XQ1A 1X7HA 9LDTA 1E3WA 5DZSA 1I01A 2WWRA 2C0CA 2D4AA 4W7HA 4CM8B 4W4TA 1MX3A 3RC7A 2ILTA 3WSWA 1EEHA 4DRYA 3HZZA 3PZBA 5T67A 4CLOB 5JSFA 1XGKA 2VWGA 3PTZA 4J7UA 2Y1EA 2NU7A 4W7IA 1LNQA 3BTVA 1RJWA 1EFLA 2IXBA 4KUHA 4FPXA 3K30A 3TZQA 3GC6A 4B7UA 2OP0A 5EPOA 4WKGA 2O23A 4MIYA 1ONPA 4PZDA 4U0JA 4INAA 2JAHA 4R3NA 1EVJA 4UAGA 1ADGA 4GWGA 2B0JA 4Q3BA 1WVGA 4Y6RA 3VOSA 3MOGA 5KJCA 3SVTA 4ZQGA 4AICA 2YFQA 5JFOA 1XCBA 4DXHA 4Z3KA 2GNAA 2UUOA 2EERA 2VTEA 3KYCB 1H6DA 3WJAA 4AJ4A 1VL8A 2VWHA 1MC5A 1RM5A 4CV3A 3EVTA 2Y05A 3INGA 4EJ0A 1UXKA 3C85A 3DO5A 3DR3A 4NI5A 3E9QA 1LDYA 3GMDA 3QE3A 2EGGA 2W2KB 4OOEA 3S55A 1PZGA 1X13A 1PWXA 1LSJA 1UDCA 2Q99A 5GMOA 3EMKA 4XEHA 3H3JA 1MFPA 1KY4A 4A5OA 3F5SA 3BTOA 4OXYA 1C14A 1Q7BA 3DZGA 3KVOA 1Q2XA 3FTNA 4IJWA 2LDBA 4B3IA 3JSAA 3AY6A 1YB5A 1X7GA 1DB3A 3DBRB 3W4IA 1Z6ZA 2HJSA 8ADHA 5MDHA 4HV4A 4WJZA 4K6FA 2IE0A 4NFYA 1LX6A 4E5KA 3OJFA 4DUPA 4QECA 1SB9A 2HMVA 3CSDA 3PDUA 4R1NA 5T8KC 5TRTA 4KUGA 5AOVA 2IDZA 3DBLB 4OKIA 2G0TA 4PLWA 3TL2A 2G5CA 1QMGA 3GNQA 5GY7A 1NQTA 4K28A 1VJTA 3FN4A 2HMWA 2FRDA 3H5RA 1EUZA 4I9NA 3LDHA 1I24A 5JNLA 2CMDA 1R4NA 3DAFA 2OFPA 5GZ6A 1T24A 2PZJA 2NTJA 2E6UX 3VPGA 1EE2A 1B3BA 3DC2A 1PGQA 2GCGA 4ND3A 2O3UA 5L40A 2AE1A 4ND5A 2VWQA 4FQ8A 5L95A 2PY6A 4FOOA 4KZPA 4B4UA 4AJNA 2FWMX 2GUGA 1PR9A 2IZ1A 1B14A 5A04A 3WGZA 4TRRA 4XGKA 3HDHA 4KTTE 4DPKA 3GFBA 3DDNA 1X1TA 1G0NA 1VLLA 2X5JO 3RC1A 3RUHA 1GZ6A 1PJTA 2BH9A 4RLSA 5HS4A 1ADBA 2DQ4A 3WJ7A 4LMRA 4MO2A 4CLHA 3FF4A 1ARZA 3ANLA 2RH4A 4O6VA 1E7SA 1M76A 2FN7A 4FD3A 4EZBA 4P22A 4W9NC 2O2YA 3WOHA 2Q45A 4PLGA 1EVYA 3FRJA 5TF4A 1DLJA 1GADO 4EUHA 5CDGA 3I52A 3VTZA 3ABIA 1BW9A 4HFJA 3QV1A 3NRCA 2X5KO 3INRA 4LGVA 2X7HA 4OAQA 4EI2A 4JGBA 3JD2A 1WDKA 3QIVA 4IIVA 1YL6A 1SEVA 4NNJA 3TWOA 3ZHBA 3FR7A 1ZUD1 4BIIA 3VH3A 3RWBA 1P1IA 5IAAA 4CL8A 3COSA 2NTNA 1AHIA 2OUIA 1R37A 4IS3A 4KUEA 2Y99A 2V6FA 1ISHA 1OFGA 2B36A 4W99A 3PGJA 1NWCA 1MG5A 3ENKA 5JAIA 3M2TA 1ZFNA 3H6KA 3DBRA 1NXQA 1VJ1A 4CV1A 4OQYA 4BO8A 1I10A 1C1XB 2X22A 3B70A 3G17A 2FHSA 1EBUA 1GV1A 3PFWO 4GWKA 1B0AA 2EKLA 3ZWVA 2AQ8A 4RVSA 3HQ4O 1CQIA 5AQ1A 3V5NA 2VRCA 5A05A 2PD4A 1JDJA 1IULA 1H6CA 4ZGWA 5JLAA 3OECA 1IOLA 2C07A 1BWSA 2DUUA 3GEDA 2GASA 2YUTA 4PRLA 5B4TA 2O3SA 3GDGA 4CUJA 1FJHA 1YQDA 2CFCA 3T7EA 2WE8A 1M2WA 1LDMA 1DPGA 2Z5LA 5THKA 5BR7A 3IJPA 5DBIA 1G0OA 1NNUA 2Q1WA 1WP4A 5BSEA 4KWIA 5KJ6A 3OF2A 5I8WA 4J7CA 4S3MA 3ROMA 2O4UX 3AM5A 3NX4A 4J0FA 4Y67A 1NQ5A 5HS6A 5EQDA 5GZ1A 4O0LA 1I2CA 3NT5A 2OP1A 2NV6A 1O5IA 4R1SA 4HFMA 1GUZA 2I3GA 1L1FA 2FR1A 4FJ2A 4YAKA 3E18A 1HT0A 1Z7EA 3DHYA 1ISFA 1F14A 4I08A 4DTIA 1U2DA 5TJ9A 3GH3A 2GZ1A 1V3VA 4BVAA 2GN8A 3W6UA 4BNZA 3LT0A 5LC1A 4XGIA 1PX0A 2PKRA 1WZEA 1FDUA 1GD1O 3CEAA 1ENPA 1E3EA 5KKCA 4FIZA 4CR8A 1YOVA 1QR6A 3AFNA 4MOWA 1DXYA 2O48X 3LLSA 1GDHA 2CVOA 3G1UA 2UV8A 2Y1CA 4MP3A 1J5PA 3FNEA 4GBJA 4UEKA 5BNTA 2TMGA 1F12A 3RIHA 3TZCA 5JCJA 3H9QA 3PI7A 4LN1A 2BF7A 3K8ZA 4I9UA 3GN1A 2J3KA 4TRJA 3EDMA 3FBGA 4YB8A 5I7FA 3RD5A 3HB4X 3JCZA 1Z75A 3VDRA 4ALIA 3LVFO 4RPGA 4IDDA 4TKLA 3DBHB 3X2FA 3EGOA 3FPLA 1ZK4A 1S7CA 4M86A 5H82A 4YT8A 2Y0EA 3T7CA 1B16A 4PN3A 3S8MA 4Q3NA 1TI7A 2GF2A 1KOLA 4CM1A 4EBFA 4JIGA 3WTCA 4GL4A 1N7GA 3DAPA 1R4MB 3E9NA 3IAHA 3GG2A 1V3TA 3WR5A 4XRRA 1PQUA 5C7OO 3RC9A 3DOOA 4D46A 2EW2A 5CDUA 1U7HA 1ORRA 5CP8A 4WASA 2PR2A 4IDBA 1EUCA 4ZICA 4XDZA 5ENVA 4Q3CA 4XYMA 4ZQFA 4YA6A 3H65A 3ZU5A 4MKRA 1SMKA 1DOHA 1K3TA 2I9PA 4GX5A 4G65A 2DT5A 3F47A 5JAQA 1LI4A 4II2A 2HQ1A 3VAZA 3RROA 2NQTA 5JC8A 1EDZA 4NBRA 4QEDA 4BNXA 2HCTA 4BKUA 1U2GA 4UEOA 1O89A 1K89A 4FFLA 4GX0A 1ZMOA 4E33A 2ZJ0A 3D0OA 1GYQA 4URFA 3GZNA 1QRRA 1OZAA 4U5QA 3E48A 4ALLA 2OO5A 1O8CA 2YHUA 3H9UA 2NUAA 3KZVA 2DVMA 2Y93A 1SEPA 3GLQA 2BMAA 2NU9A 3KEQA 4XA8A 4AJEA 4MVJD 4NBVA 4FJ1A 2XF8A 2BELA 2DBVO 1I8TA 3AI3A 3PXXA 5EMHA 1CJCA 1KC3A 4B8WA 4DQVA 4HY3A 4RPHA 4M55A 2I66A 3JYOA 4GSKA 4BQPA 4L73A 4IJUA 1DFGA 1RWBA 1GUFA 4J4TA 4CMHA 3WMWA 3FBTA 3BTSA 3K9QO 4JBHA 5TX7A 1CF2O 3I83A 5EIOA 1ZBQA 5LDHA 3PYXA 1L7DA 4W82A 1LSSA 4GI2A 2F00A 3KO8A 3HSKA 1UR5A 1NPDA 1K5HA 4OSOA 5JDCA 3RCBA 1ISGA 1RM3A 1H6AA 4L4SA 3RBXA 1ZJYA 3EHEA 3JD4A 1WDLA 4RVUA 1X15A 2XXJA 4BO6A 2Q1SA 3TQHA 2C59A 4DIBA 2A4KA 3I9JA 2DC1A 3PQEA 4QFCA 3MTGA 2Q1TA 4QT0A 3NJ4A 3WYEA 2VUTA 2IEBA 4AJ2A 4I5DA 2UUPA 1HE3A 5G4LA 1J6UA 1JU9A 1D7OA 1ZXBA 4HKTA 4RZHA 4TROA 2X58A 1VKNA 3AJRA 5DT9A 1HSOA 1KETA 1ZO8A 4MP6A 1TEHA 2SCUA 1BMDA 3QWFA 1A71A 3T4EA 2D0IA 2O3RA 4RVFA 2FPGA 2Y1FA 2DBQA 2O2SA 3KXDA 3PIDA 3ULKA 1UDAA 1Y7TA 4HUJA 4G5HA 3VKVA 2FY8A 5ER6A 1NPTO 2AMFA 4YTEA 4ND2A 2EEZA 2X86A 5DULA 2Z1MA 1DAPA 3MJ4A 4J43A 2JD1A 4WPGA 3LK7A 4XYLA 4PVCA 1ZEMA 1ZK3A 1B7GO 4A7PA 2EJVA 1A72A 1GV0A 1UJMA 4Q3DA 1UZLA 2QZZA 2D8AA 4FC7A 2RHRA 3AFMA 5FYDA 3FNFA 3G1TA 3TFOA 4ITUA 1F17A 1QYCA 4CLOA 3AUUA 2FSVA 2Q2QA 3AI1A 5JY6A 1DFHA 2OBNA 2B35A 2X0NA 1O0SA 1YB1A 2RIRA 3A9WA 2H6EA 5ICSA 3D4PA 2JD2A 3EC7A 3GZ4A 4LSWA 3WGGA 1E7QA 3AOEC 2NTVA 2C5AA 1MGOA 1C0IA 1DRUA 2YY7A 5JPIA 2BFOA 3BMNB 4I5GA 4IJKA 4DLAA 1UXIA 1E1LA 2J6IA 4B4OA 2IRWA 4YJGB 4J1TA 3W4JA 3KEOA 5C37A 3E5RA 1U8XX 2X0JA 2CNBA 1IL0A 1UDBA 4BNNA 3KBOA 3QVTA 4CV2A 1WMBA 2QHXA 5IJZA 2Y66A 3OA2A 4YT4A 1K6IA 4PLTA 3ZZNA 5K6AC 1B8UA 4GGPA 2WSBA 4AJ1A 4B3HA 3HNPA 4XJTA 4O5OA 5L7TA 4JX8A 2X1HA 4R9RA 4YXFA 1K6JA 3OJ0A 5JYEA 3K96A 4XR9A 5KCZA 3B1KA 3QJ5A 4XIJA 2WYVA 1Z82A 5G4KB 1A27A 4GKBA 2VHVA 1AUPA 1DC3A 1NWHA 3QVWA 2VRCD 4S1VA 3TL3A 3TOZA 1DLIA 1T1RA 3FWNA 4DYDA 3H9EO 4M89A 4CLEA 2C29D 4OKNA 4OJNA 1JKJA 5TT1A 3UCEA 4CMEA 4YRDA 1PJSA 4DQXA 4A26A 4CJXA 1UP7A 2HUNA 1UUFA 1LA2A 3EUWA 1OMOA 1JQBA 2ZK7A 4IQGA 2YQ5A 5ADHA 3U4IA 5DP2A 3F5QA 2JL1A 2Q2VA 3JQ9A 3ZWAA 1N2SA 2J5RA 4UUPA 1ZEJA 4BGVA 1E3IA 4ALKA 5L51A 1UP4A 4CUZA 4UVGA 1LRJA 1ISMA 1E6WA 5A5EA 5L53A 1CWUA 4KTVE 1GYRA 3FR8A 4PZEA 4QUKA 5LCXA 3ADOA 1VC2A 1BXGB 1V0JA 1V6AA 4YYZA 1CETA 1TA4A 2WTBA 3W6ZA 4E21A 1M6HA 3T4XA 1R0SA 4PLPA 5BSGA 1OI7A 1H0KA 3PP8A 2HU2A 2FPIA 5C7IO 1SZJG 3UICA 2CVQA 3OIFA 4EYEA 1F0YA 1OOEA 3RFVA 2FP4A 3BMOB 1H2BA 1YL7A 4A73A 4YPOA 2PD6A 4CM4A 3L6OO 2HK7A 3C7CB 2DPGA 2P5UA 3JQCA 1NVMB 1R0LA 4JP2A 4GX1A 3ZWBA 4OO3A 1QG6A 1HKUA 3AM4A 4DQUA 1KVQA 4CMKA 4WCFC 2IYOA 3D3WB 3RQSA 3VH2A 5CEJA 3H8VA 4Y6SA 3GFGA 4WNCA 3S2EA 5T5QA 2X5OA 3E03A 4ND1A 1DO8A 1LQUA 2Y0DA 3ZNOA 4Z9XA 4WECA 4Z0PA 3Q6IA 3ZHXA 1QYXA 1YVEI 3D4NA 4AJHA 1N1EA 2I99A 4WLOA 3UFXA 4BGEA 2QX7A 1C0PA 2E82A 2BFAA 2NQ8A 4P8RA 4O59O 2A9FA 4D43A 5ICMA 3PJEA 2IZ0A 1E92A 4XYGA 4ZA2A 2ZJ1A 5A1TA 4OOFA 3KYDB 4CMEC 5A03A 2PKQP 4EW6A 1GAEO 3FCOA 3AW9A 3KYCA 4IGEA 1LQTA 3UKOA 3K92A 1DRVA 2HAEA 2VYNA 4RLHA 1BDMA 4YJHA 5COQA 4BKOA 4CM3A 1U28A 2XPCA 1LDGA 2WD7A 3WGTA 1DIGA 3DMTA 1P0CA 1UAYA 3GZNB 4ONEA 2JHGA 3A28A 4D79A 4G81A 1HDXA 2VYVD 2CUKA 2Y1OA 3OIDA 4R9SA 4RCVA 3LF1A 4BOYA 3QVSA 2JAPA 4IIUA 3ZNNA 4C4OA 2DKNA 4A0SA 2AQIA 3DZJA 3GK3A 5K6AA 4GMGA 5IDYA 3WLFA 3UCXA 3SLKA 1C1XA 1DSSG 1FMCA 1HYEA 2OORA 3WGIA 2O3JA 1J0XO 4U6SA 1LBEA 1MXFA 2GERA 1YS4A 3ZU2A 2EP7A 1Q7GA 1DHTA 4BB5A 4XDYA 3V8BA 2V6BA 1LLQA 4IUYA 1BG6A 4IZIA 3QWIA 2B4QA 4NIMA 3V1TC 2DLDA 4YT2A 5G4KA 3ZV6A 3MOIA 1V3UA 4Y9DA 8LDHA 1T2DA 1K6XA 1TXGA 1ADFA 3ROPA 2DTXA 4RQUA 1FF9A 5CHEA 4NPCA 1N8KA 3PRJA 1GCOA 1YJQA 4YJFB 1TT7A 2VHYA 3UF0A 1QYWA 1Y8QB 3G79A 2WYWA 1HTBA 2P91A 1NFFA 3LC7O 5CDTA 2JHFA 4MVJF 3L0DA 2A92A 4I5FA 3RKUA 2YZ7A 3SJ7A 5JMWA 3WTBA 1LXCA 4GSLA 3UUWA 1NASA 3PYMA 3C1OA 4BUCA 2E49A 5JY1A 4CQMD 3HUDA 3QY9A 4YAGA 3UAGA 2RH8A 1ZSVA 3V2UA 1HZJA 1WNTA 5IF3A 4H3VA 4YJGA 1VE9A 3LZ6A 3Q11A 1TLTA 1YBMA 2GRAA 3TFQA 1A7AA 3BIOA 3LSYA 1DBVO 3C24A 5HRUA 5I7EA 2JCVA 1IPFA 5G0UA 3ZCXA 1MC4A 2UYYA 4R3WA 2Q4BA 5K0ZA 1AN9A 4F6LA 2ZATA 3H9GA 2GSDA 1TB4A 1PWZA 3OICA 1E5QA 4M87A 4D3FA 1I0ZA 3RUAA 4K9DA 1KIFA 2DAPA 3N74A 3NAQA 3NDRA 2FSSA 1PZEA 3GGGA 3ZV4A 1GTMA 3FHLA 1XWFA 1PJCA 4Q3EA 1NR1A 4OMUA 2EG9A 2NU6A 4D0RA 5KWEA 3GUYA 4E12A 1NP3A 3OJEA 3WQSB 4B4VA 2D59A 2ZCUA 4WEOA 4WOJA 4TMFA 3DONA 4JJFA 5F5LA 1K0UA 4NBWA 3BHMA 4HFNA 2WD8A 2YV2A 1H9AA 4ZN6A 3ZHZA 1PGNA 5HWSA 1EDOA 2X4GA 1NAHA 3SX2A 4L4XA 2E37A 4JJIA 3WQQA 1N92A 3GNSA 5C7LO 7ADHA 1F8FA 1W4ZA 2JFHA 4Z6KA 3PPIA 1WDMA 4MVJM 2HKIA 4R68A 4UVHA 4KDEA 2VUSA 1P77A 1W0CA 4R1TA 3U4DA 1IPEA 2ZIZA 4ZD6A 3BMNA 4J91A 4NK5A 5DBGA 4HNGA 3U4HA 1FDVA 4YAEA 1PU2A 1MV8A 1U5CA 5L3ZA 4BNIA 3MZ0A 5MGBA 2QRLA 3E1KA 2Y1GA 4MVJI 4FFMA 1GQ2A 1VI2A 5DN9A 1LEHA 2BRUA 2X9VA 3MJSA 1N9GA 1R4MA 5DCYA 3SJUA 3ZN2A 3C3XA 3KB6A 5G2OA 2RCYA 4LRTB 3PWKA 3UCFA 1N7HA 5KNLA 2JFFA 3VVCA 1E7MA 3ZWWA 1SO8A 1EZ4A 1DIBA 3KLPX 4CQLB 3EYWA 4LK3A 4Z9YA 2IZZA 5H81A 5ILOA 3D3EA 1FDTA 1H5QA 3HDYA 3WLEA 4CMCA 2JFGA 2Q50A 4BNMA 3E9MA 1AXEA 5L7YA 4E6PA 3JQBA 5A06A 3V1YA 4CMIB 2EXXA 1U3VA 1MUUA 3PJFA 1GY8A 4KQWA 1OC4A 2PH5A 4E2XA 2Y0CA 3GOHA 1P74A 3H7AA 3OJOA 3VPHA 2PD3A 1B15A 4J1SA 2JKVA 3W8DA 4BNKA 4BMSA 1NTOA 1PJQA 3PDJA 3FPCA 4K26A 5EQFA 4E5YA 3AOGA 2EF1A 1LRKA 3RBVA 5F3RA 1ONOA 3NKLA 1GEEA 4OL9A 1YJ8A 2AG5A 4XKJA 2DFVA 2D5AA 2G17A 5B37A 2EW8A 3PLRA 1WAMA 1EUDA 3EK2A 3HADA 4H16A 1ULUA 4IINA 5FI5A 4PG4A 3IOYA 1H2HA 5BSHA 3ITDA 4PLZA 4B3JA 1GL3A 3QVXA 3BMOA 3VVBA 4U8GA 4YRBA 5AXCA 1CQJA 1CEQA 1RKXA 1VSVA 4DIOA 3F4LA 5I9MA 3RUIA 2BGLA 4CR7A 1JW9B 1XDWA 1PGPA 1BVRA 3DOCA 2QZ9A 2WD7B 4IM7A 4XQGA 5EJ2A 5JDCC 4YJHB 4ALJA 1ZMTA 1H6BA 1HE5A 3HN7A 3CPSA 5KVQA 2BGKA 2FMUA 1R66A 5I7SA 3L6DA 5HBRA 1U8FO 2Z95A 4A03A 3QA9A 4NG5A 4UVIA 2ZYGA 3DFUA 4NJMB 4PGFA 1VL0A 3ZV5A 3UGKA 3CZRA 2DBZA 3G49A 3I1JA 2Y67A 4PFJA 4D45A 1B26A 2AHRA 1ZW1A 3UW3A 3FTPA 5ITWA 1UAGA 1LDNA 1EK6A 1K2WA 1KERA 3IP1A 3W8FA 1RM0A 1PIWA 3W4KA 1GPJA 5B4UA 1CRWG 4BNFA 2B83A 3RVDA 1XU7A 4DWVA 3U5TA 1I2BA 4J2HA 2E48A 2FPPA 1YB4A 4H7PA 2P5YA 1JWBB 2P4HX 5EL0A 5I9NA 2V6MA 4MIEA 4DMMA 3LC1O 1NVGA 3H2SA 3AWDA 3VPFA 5JBIA 3K2BA 3AUAA 3VTFA 5IXSA 4EUFA 4IMPA 3KYBA 3NEPX 4F6CA 4YVFA 3ETGA 4IXWA 1FDSA 1LSUA 1TVEA 2HO5A 1NQOA 3WFJA 5KTKA 1BTOA 1D8AA 2C20A 3D1LA 4QSMA 3RI3A 4FSHA 3JD3A 4RJTA 3BZUA 4MINA 1E6UA 3PHGA 1EK5A 4DBVO 5CDSA 4LW8A 4QTZA 2VYND 5HA5A 4IGFA 2X23A 1IZ0A 1GZ4A 5JE8A 1HF3A 2BI7A 3GF4A 3RUDA 2UAGA 2AXQA 4BO5A 1MP0A 3GG9A 4ILKA 3M2PA 3RBZA 1U4OA 2EGHA 3E82A 3QHAA 1E7RA 4CODB 2GN4A 1MLDA 3PHJA 3IDSA 3ZNQA 4DPLA 2H1SA 5BSFA 2PK3A 3AK4A 4ALMA 3WWYA 3OIGA 1X7DA 1JKFA 3GGOA 3JQAA 1UP6A 4QO8A 9LDBA 2QRJA 3JYLA 4NZ9A 3DZIA 1PZFA 5AXBA 4OM8A 1KEWA 3PIIA 4R01A 1PS8A 2UDPA 2YDXA 3ENNA 1D4FA 1ZVMA 2H63A 2B37A 1XQ6A 3A1NA 3NTOA 1M66A 3ZU4A 1M75A 4LVCA 5I9LA 3UVEA 1H93A 5CEFA 1B2LA 3NDIA 4D7AA 5DF1A 1DDOA 3L77A 3H5NA 3WMXA 4L74A 2GZ3A 3KETA 1YXMA 4BNWA 2P68A 1GEGA 4PIVA 1LC0A 5G0SA 4ZQEA 5FWNA 1GQYA 4JXKA 4II3A 2PZMA 1LDBA 2P4QA 2P2SA 4G2NA 3ZW9A 1DIAA 3LU1A 4BKPA 1DC5A 2I65A 1M6WA 4XB1A 1QYDA 3PGXA 2QIOA 3MJTA 1I5RA 1E3JA 3BMCB 3L07A 3AM3A 3G3EA 3GEMA 4QX6A 4Q9NA 3HE3A 3U62A 3E8XA 1DRWA 4YEDA 3ZI0A 3LYLA 4ZQBA 2PH3A 3HB5X 2NVUB 2RHCA 4L76A 3ONDA 1BW9B 4U7WA 4FW8A 4WLEA 4E13A 5DNAA 3CMMA 4IDFA 2C2YA 5A9RA 1YDWA 1ONNA 3TJRA 1BXGA 2ET6A 3DMTC 4R69A 3I5MA 1HDYA 3JD0A 5L4LA 1WWKA 1UXJA 4J1NA 1YBAA 2NADA 3R3SA 1ULSA 1Y5RA 2AG8A 4Y8VA 3EZLA 4ESOA 1DC6A 3C7DB 4KQXA 5F5NA 4K1LA 4ZHSA 1P1JA 2XAAA 1DAOA 2QW8A 1P1KA 3JQ9C 2Y68A 3G0OA 3SLGA 4CL3A 1A5ZA 3W8EA 5JO0A 3TF5A 2AEMA 2NACA 3GPDG 1P1HA 1U9JA 3LF2A 4RPLA 1Y1PA 5DBFA 6ADHA 3FD8A 1YQXA 2DTDA 2BFMA 1PEDA 3U49A 4UEJA 2CY0A 3GA0A 4BNVA 5JDIC 3WNQA 3EY4A 1XG5A 4TVOA 3BXXA 3BTUA 1BDBA 4HFRA 2DU8A 1Q1NA 2HK9A 1FK8A 1ZXLA 4BNHA 4RF2A 4WCFA 3I4CA 2BD0A 3C1TA 3CZMA 4EEZA 1TT5B 3VH1A 2FR0A 4E2YA 2H5LA 3HJAA 4ND4A 3DB2A 4CPDA 2OBYA 4WK6A 3ANMA 3KSUA 1LSOA 3RJ5A 2BI8A 5F1PA 4XYEA 3HDJA 3L4BC 2CVZA 2HMTA 3F46A 5T6BA 4AJKA 4F46A 3LT2A 1QLJA 4OQZA 2ZB7A 4JJGA 1NPYA 2J3JA 3MWEB 3O9ZA 3OM9A 4IDAA 3IMFA 3QQPA 4RF4A 1E3WB 3KM0A 2YV1A 1C0KA 1I32A 3S1LA 3R0IA 5IDWA 4PG6A 2VZ9A 1JLLA 3L9WA 1NAIA 4IZHA 1BVUA 4RL6A 1P0FA 4CM6A 4XQCA 4EDFA 2PKQO 4JLWA 4DPMA 1R6DA 2GO1A 2W98A 4UUMA 1BHSA 3CIFA 2GGSA 4GGOA 1HDOA 5F1OA 3QVOA 3IP3A 3IC5A 4LVUA 4R51A 3O03A 2IODA 2VQ3A 1P45A 1XELA 3DBVO 1SOWA 4MVJP 2J8ZA 1E3LA 2I5PO 5C3MA 5THQA 1ZK0A 1T4BA 4JN6B 3RU9A 3UN1A 3ROQA 1ENOA 3SBOA 4FFNA 2C7VA 3DMYA 1QORA 3AU8A 2W2LD 3LT4A 2C82A 1WLYA 3DEYX 4OGWA 1T25A 1HYGA 4GH5A 1QP8A 2DM6A 4DVJA 2POQX 2NLOA 4BV8A 5I8ZA 3OQ6A 4JQCA 2YHIA 4IBOA 5CEEA 3INTA 3ZHYA 1EBFA 1OBFO 3ICPA 4MVJE 3PJDA 4B8ZA 3MJCA 1O6ZA 5DOZA 1DC4A 1AGNA 4ZJUA 2Q49A 3F1KA 4BKQA 4DGSA 3KV3O 1AHHA 4BO1A 1PJBA 1LUAA 4XCVA 3TNLA 3AI2A 4HX5A 1ZZEA 2VN8A 1B3RA 4R1UA 2JCYA 4M1QA 3STHA 1ID1A 4CM8A 5JAZA 1LLCA 4BMNA 3PYLA 3BHIA 4BO7A 2ZTUA 2P9GA 2JJYA 4ID9A 1Y5MA 3KSDO 1UXHA 3A4VA 4NQZA 1I30A 5JS6A 1UZNA 3RU7A 3Q1LA 4AJOA 2X0RA 5IFLA 2PGDA 1PL6A 4IS2A 2PZLA 1A9ZA 2I3AA 4D3DA 5EN4A 4RVGA 1JA9A 4YQYA 2HDHA 1ZH8A 1Y6JA 3JQ6A 3JV7A 2XOXA 1GCUA 4J4HA 2PFGA 4YDRA 5AXDA 3WIEA 5BNFA 2I76A 2R6JA 4O63O 3WX0A 4MDHA 4RQTA 4XB2A 3K31A 1F06A 4PLCA 5I7VA 3GVXA 2PTGA 2ZB4A 3BAZA 4FOSA 4YAIA 3GN2A 1YKFA 3GGPA 4XYBA 2EWMA 4GVLA 1B8PA 2OL4A 4MP8A 4EJMA 5J23A 1KEUA 5K9ZA 1NQAO 1PL7A 3KOUA 3M6IA 2HJRA 4YR9A 1FXSA 3WS7A 3ZW8A 2HK8A 3P2YA 1H9BA 4CQLA 1PGOA 1XU9A 1V9LA 2H9IA 3GRKA 5ER9A 3WSVA 4E5PA 3HG7A 5L4SA 1HEUA 4CM9A 2F1KA 4FC6A 4J9VA 2YJZA 2CF6A 3AOEA 3OHSX 4OIMA 3GVCA 1MB4A 2QRKA 2J3IA 1ZKMA 1UZMA 4N7RA 3VZPA 1T2EA 3KRTA 1GFSA 1Y8RB 4BNLA 3ZNPA 1BXKA 4YBZA 2QQ5A 4FB5A 5IDXA 4GLOA 3TDKA 3BMQA 1U4SA 1VRWA 4ZVVA 3LC2O 3OH8A 3QLJA 3PLNA 3RKRA 1JTVA 5IG2A 1KYQA 4NU6A 4NFHA 4GMFA 4IPTA 2HMSA 4D0SA 4J4BA 1LRLA 1QYVA 3DHNA 1VPDA 1NBOA 3JQAD 2AQKA 3WDSA 2B5WA 4P4NA 4QXMA 2Q3EA 3BA1A 2OOSA 3KUXA 4TKMA 3I9OA 3CTMA 5B4VA 1T1SA 5L9AA 3JQGA 4BNJA 3NYWA 4JBGA 3VPSA 1QSGA 4J49A 4OXKA 1T2CA 4LISA 2VHZA 5KOIA 2W4QA 2PNFA 5CAEA 4WE3A 4TZKA 2ZYAA 4BHTA 3DFZA 4E5MA 4NDNE 4TWRA 2NVBA 2HRZA 3JQ8A 4BO9A 2YQ4A 1EVZA 2FOIA 3WWZA 4P4GA 2EHDA 5TS3A 5A9SB 2WE7A 5JXWA 3ZWNA 3IL2A 4A27A 4MKZA 4EGFA 4J9UE 3ASUA 2X8LA 3CKYA 2PGLA 3DZKA 3IUSA 4BO2A 1Y9EA 1UH5A 4IXTA 3I6QA
chains in the Genus database with same CATH superfamily
2X2PA 1PHRA 1DEHA 2XTMA 3OTHA 1UKCA 5HVNA 1LWOA 1P61B 2BMWA 3OQHA 4F7DA 2GXSA 4FU0A 1THGA 1XXHE 4NBTA 4TZTA 5CB4B 4QOIA 2HW8A 3O82A 3ZX4A 1SKBA 1U7OA 3E15A 4RH0A 5TIIA 2ONCA 4WZBB 4PR0A 2RGWA 5I7HA 3OCUA 3KJXA 2FX2A 4LWZA 4JBNA 2PMFA 4CMBA 4DLLA 3ZDBA 3QVUA 1RYZA 4FZ3A 4L8VA 4C7KA 3S2FA 3KSBC 4PCLA 5C5DA 5JNVA 2IH4A 1F0KA 2RJOA 5DK6A 3TTWA 3I01A 4D9HA 3P26A 1QJ4A 3OUTA 1HE2A 1R4ZA 4HB3A 4UOQA 5DNUA 4EHLA 2H54A 2VJNA 2QX9A 4R2HA 3E7DA 4DSZA 4MPJA 1BS1A 5JC1A 2GDJA 1FA9A 2EZTA 2JIQA 2EF0A 3LO8A 3D2AA 3GLGE 4QXRA 3MRSA 3I73A 4BX0A 2FPIB 1C2TA 3P19A 4QUDA 5H7XA 1NMXA 2V58A 2J9FA 3I5UA 3OX1A 4PCVA 4CTKA 4Z51A 1YIOA 1Y82A 1ZK1A 2JFYA 2JIZA 4FI3F 3HWRA 1QGAA 3SQWA 2WUFA 4BQRA 4F1JA 2C2XA 1MX5A 3OP4A 4Z0NA 2CV0A 3FM9A 4LZWA 4V0OA 4CGZA 2ZUSA 3P4YA 5BNZA 5DTIA 2D1TA 3HCRA 3FWKA 4RPKA 1RHRA 1KZ6A 4UC0A 4R31A 3COVA 4XIYA 5K8UA 2BLLA 4IIYA 1G60A 1TUBA 1TZCA 2YFHA 3MCZA 2C9YA 4G0YA 3CKKA 3AF2A 3LDFA 1VGQA 3ZDXB 4JP3A 1L7MA 4JVMA 4F7WA 2VCYA 4ZVTA 3O4HA 4JUFA 1GN9A 2CCKA 2QL9A 4QDOA 3UANA 5CDFE 3ELYA 2RGAA 4MTLA 4PSCA 4EYOA 4ETNA 1NXPA 5AP9A 3KX2A 2ISCA 3UHAA 2C4UA 3V4VB 2Y0PA 1T8RA 1JRLA 2XQIA 4Q39A 5BN5A 1Q16A 3FDXA 4MWDA 3UMYA 1E6CA 1GNSA 3TGLA 4ZVUA 1O6GA 5B53A 3RYFB 2J3DA 1D1SA 1KVRA 4GZ3A 4A91A 1ENZA 2HNAA 3T9CA 4IWXA 3IE0A 1A4IA 1YQGA 4LYJA 1QV7A 3KQWA 1QHEA 3EOZA 3C4VA 2H0RA 4W6QA 2NSDA 4WEQA 4XX0A 3VVMA 4B7CA 3Q3EA 3J81A 4KNYA 3DQZA 3CZ9A 2XE7A 4DJDC 5FPSA 3DE1X 3CUTA 4NL4H 4Q02A 3E58A 3II6X 3KLMX 5EHQA 3WP1B 4R5HA 1ISIA 1H3FA 1PX2A 1W1IA 5KTRA 5CK4A 1PJ4A 1KNQA 4WXRA 3RFCA 3KQYA 1GNTA 3A58B 1XZDA 2DBRA 3DLPX 3RO7A 4CE6A 2DBYA 1RKVA 2WUWE 3WAKA 3QYAA 3JARA 1OLSB 1WW8A 2ZWPA 3VRHA 5COBA 4W8HA 1HOTA 4FJ0A 3SHTA 4TVSA 2QORA 4NCAA 2WQ6A 1GLGA 4AP9A 1P1RA 4PQGA 3EG9A 5DFAA 4D4MA 1ENYA 2AI2A 4AYXA 2QE6A 3RHTA 3MJVA 4V03A 3VC3A 1DEAA 5HUJA 3I76A 2KJQA 3WK8A 3QM1A 4RJKA 1PSDA 1M72A 1YWGO 4B46A 2DFKB 4Y6LA 4MUIA 3H2GA 4AKSA 4DEYA 3BFJA 1HWYA 2EQ5A 5A7GA 1Z73A 4RHEA 4MV1A 1YVPA 3NRBA 1JV2B 1W96A 3AR6A 5EKDA 5AFSA 4MI9A 4B6GA 1TPZA 2LP4Y 3C15C 1I0IA 3MLEA 3PT5A 3L0BA 4EYQA 4QGFA 3G8YA 2VQ6A 3MILA 2CNWD 2WWVD 4DNQA 4A2CA 2WUDA 4R41A 4BUZA 1ZIPA 4KAXA 4G4JA 4CG1A 3Q9NA 5A2GA 3RUFA 1EVLA 4KR0A 3HCOA 2IU4A 1JWAB 2BR3A 2MSCB 4N9WA 2RFLA 3V32A 4D6YA 1TKRA 2OZKA 1KVSA 4BS9A 1K3FA 3KR0A 1O9GA 3DFFA 5EXSA 5EZYF 2VP4A 3KQOA 3ODGA 4MV3A 5H4HA 4LZAA 4HWPA 2VDPB 2D2IA 2FZGA 2L2QA 2VP0A 3PUXA 4TX1A 1D2HA 2Y77A 5DHTA 2H1WA 5H59A 4B4WA 3NS7A 1SUPA 5CT6A 3JRNA 2IUSA 3AUXA 4O25A 3GJ6A 5BW5A 1W7AA 1A9PA 3QMPA 5B6PA 4PHGA 1X1EA 3K53A 2ZTVA 3QU9A 3RFFA 4D0NA 4MCAA 3L0IB 3A9UA 1N8NA 2A6PA 4WXEA 4QYSA 5IN5A 2P6NA 2YN0A 1TM5E 3PRYA 1A88A 1PFKA 3WGHA 4R16A 4NYMQ 4J3FA 1D3AA 2EWVA 4ZVKA 5DCWA 4N5HX 1D6MA 1Z5UA 4NMHA 5TMEA 1W73A 3B20A 3GEGA 4MLPA 4D0LB 2CJXA 3AHJA 3CONA 3O2QB 4LJAA 2OGTA 3AY7A 3PQ3A 3TOXA 3PWSA 2HV8A 1NVDA 5H9WA 3TB6A 5K3CA 1WBBA 3KE9A 1JLLB 1ADCA 1SA0B 5EXEA 3M9XA 3NEJA 4CM5A 2AQHA 4MGHA 2JANA 3IODA 5BVHA 1BO6A 3IBSA 4WDQA 2RHBA 3WNCA 1WCWA 1U2EA 3QA3E 4DY4A 5IYZF 3UC9A 3L7BA 2AN4A 2CHVA 1CUAA 1G21A 1UM9B 2HM7A 3KZ1E 2I62A 1UKZA 2NPIA 4R81A 4N7MA 4XJVA 3T5DA 3ACDA 4EABA 1RSZA 2ODBA 2VK4A 2QT1A 2DPHA 3NBMA 5DH9A 3SQMA 4DBZA 3SC6A 4LPSA 4L0DA 1U2DC 4ID3A 4N82A 1W0JD 4YAWA 5DBHX 5CURA 3W9BA 2FF7A 4GEGA 3HKDB 3DV0B 2VJBA 4JCOA 5JYBA 1PD1A 3VZCA 5JDIA 1Q3TA 1R0WA 2V7PA 3USZA 1G18A 4DBLC 1PVVA 1TT5A 4WUVA 3F8WA 1YHZA 1J22A 2QLJA 5EIFA 2FEWB 2VQSA 1JKIA 1CDDA 3BH0A 3TW8A 4G63A 1ESMA 1FBTA 4JX9A 3LUHA 6LDHA 2A3NA 5A3SA 5BVGB 1KMMA 3GH1A 3FIUA 4LOJA 1KGSA 5TB5A 1UADA 2ADMA 1NT4A 4IJVA 4X92A 1NHWA 3DOJA 2E4AA 4X7RA 2R8PA 3W6NA 2O8CB 1JIXA 3LHDA 3Q41A 3QEOA 4OP3A 2Z2YA 5K8TA 4EW3A 1WUHS 1X1AA 1FSFA 2DX7A 3I23A 3CUEF 3MELA 5T64A 3ROEA 3UXHA 3VPAA 3ZZTA 3U44A 2CDBA 4LJSA 3SLRA 2GAIA 3IUBA 5K0EA 4FS3A 3HKBA 1RPJA 4BBPA 4KBYA 4LXQA 2D1QA 4J6EA 3CEJA 4GGMX 4DAOA 5DNYB 2VQEB 3QOFA 1FTWA 3K72B 1MZVA 1PQWA 1GPUA 2W6ZA 3BFPA 3ONFA 4Q15A 4FLEA 4DCMA 2ZRFA 3OTGA 4FE3A 1AV7A 1FUIA 3KKZA 3BDIA 3VAAA 1YB2A 1HQKA 2C83A 3MHPA 4JYPA 1JB9A 1OX4A 1VMDA 2X41A 2VPQA 4YP1A 1XVAA 3MYYA 4DYVA 3ZD9A 1YV9A 4Q3AA 1BC5A 2L42A 3SXJA 4DADA 4BGIA 3KXPA 4W1SA 1A5SB 3GU3A 3FNHA 2EAUA 1Q0UA 1TEXA 3QXJA 5FTNA 5TGZA 3O8BA 2WWWA 3D31A 3IVCA 3Q8WA 4JC8A 2BGMA 1LK7A 2Q8PA 5BP7A 1P17A 2GN6A 3WDKA 1N6RA 1MXHA 3MEQA 4DWJA 2FH5B 2GXAA 1T35A 4MPDA 4FX5A 4QDXA 2PBZA 4F46A 4LF7B 1Z5WA 4LFBB 3K6KA 2IXDA 3JQRA 1JEDA 3COZA 1RD4A 1CUWA 3A4NA 2AEFA 4P7JA 2BKXA 1Q92A 1OX4B 5HQ3B 1L2TA 2C2HA 3C8DA 4WMLA 5BR8B 4OFBA 2VKTA 5AW2A 3SZLA 1Y48E 1TNDA 1UDWA 3SQDA 5LQAA 4RA6A 5GQSA 1R64A 1T2NA 1X7XB 4H1TA 1MCZA 2GD1O 4CMJA 4ZEOA 4KQHA 4IJMA 4IOLA 4REMA 3UIEA 4DOMA 1XDDA 4QO7A 3EXFA 4GNKA 4DDTA 5GWXA 1U5AA 4CIAA 3FPJA 4XM0A 1AX9A 4PRKA 4W9NA 3ZE2B 2J4DA 1YI1A 5AKHA 4B7XA 5KYXB 1JMYA 5BOSB 2ZB8A 3D5QA 3CNNA 4IHJB 3H5AA 3FMVA 2BGGA 2WF9A 2AHOA 2IY9A 3HJNA 4JKOA 4Y0NA 5BQOA 1KRWA 2A7QA 2IKSA 2V98A 1N1GA 3RKSA 1N75A 5U9CA 3GCDA 2JGRA 3F1LA 2RH5A 1P33A 2A94A 2NT3A 2QYTA 3OHPA 4YRJA 2HU7A 4R4JA 2AZDA 1CSEE 3SGLA 2Q5QA 2W6IA 4YACA 3E7FA 1KPIA 2EX4A 3CZCA 5HZMA 3STYA 1NVTA 1XTTA 3U1TA 2NSJA 3IQFA 3UT6A 1E9DA 2CNLA 4NC9A 4Q19A 1JFFA 1L7OA 3K94A 3NM4A 1Y7HA 5A2QA 4PAMA 2X9QA 3CZAA 3ODPA 4HTFA 4P5PA 4TTAA 3BFXA 4UHEA 4Q7MB 1G8MA 2IYSA 4AKIA 2GYYA 3LLMA 5EUQB 5CFPA 4WESB 2Q3CA 4DSOA 3T0FA 4JITA 3JPWA 2O8BB 3H1AA 3GEEA 3D1JA 3AHHA 5HG0A 2B21A 1L4MA 3P7MA 3PJGA 4ADSG 4C78A 4ZTUB 1G6HA 1PVDA 3MB8A 3Q1KA 4FQ5A 2FNAA 3D1VA 3RK0A 4BNDA 4KMSA 1N32B 1SKUA 1L7EA 1JEYB 4NULA 2Z30A 5TQJA 3SE0A 4BE4A 2XITA 5U4QA 5A71A 1SHUX 4CEJA 1YIAA 1H85A 5K3FB 3PCRB 821PA 2O3TA 3HKDA 5B7PA 5M5BA 2PO7A 1BDJA 4TS1A 1Y3BE 2PBRA 1KVTA 1A98A 1PNOA 3LIIA 1J9GA 1YOVB 1IN6A 5KC9A 2X1VA 3CPJB 4KN8A 5M34A 2WBLC 1QHYA 3H83A 3KG2A 1CRPA 3UH0A 3PQ7A 2FJPA 2XE8A 2YDYA 2EHJA 2HHCA 1GZVA 3HCAA 1PFVA 1XR3A 3B1FA 3HFGA 1K5GA 3C8MA 2VF8A 3AVYA 2B94A 4QHSA 4BMVA 1DARA 4I1IA 1G2OA 3GO4A 1V41E 3DO6A 3PNLA 5KYTA 1VCMA 4LEIA 4LE1A 4C7XA 1J42A 2XT9A 3R3UA 2XMGA 1ETHA 4U8HA 2XSZA 2OZEA 3KVNA 1U0NA 2QX6A 4HPWA 4HSGA 4ZIRB 4INZA 1CIVA 1Z0JA 2I2AA 4KLZA 4ZOLB 2ZSKA 3C3MA 5DCUA 4EPWA 4IDCA 3SD7A 4IZOA 1JVSA 1M83A 4KIWA 3U9LA 2YZKA 4FCCA 1C81A 4NBUA 5J47A 4DNXA 1DJMA 4A10A 4PAGA 5U1PA 16PKA 1R2QA 2GK7A 2BE7A 2V55B 4DLNA 4A6EA 1E98A 4FR2A 5LFAA 2P7HA 2R6ZA 7MDHA 5AW9A 5LWQA 1DJNA 3H17A 4WGGA 5FT9A 3E3MA 2VPYA 4KPGA 5LIRA 5JMTA 4N5NA 1PQPA 5A02A 3QEBZ 3AUTA 2JLUA 1GAQA 2FQXA 2QD1A 3HH8A 5TARA 3KS9A 3L7IA 4MVJG 1APBA 1T4DA 3C16C 1WTCA 1JHZA 2HNBA 4JJ6A 4ZHQA 3GLIA 1EFPB 4DZTA 1CJVC 3WIDA 5BVHB 1OXMA 1DHRA 1L5KA 4X66B 2EGUA 1SC1A 4K9NA 1KEPA 3ZBTA 2VDQB 1DTWA 1GGEA 2J5QA 5JU6A 3K9CA 3T5PA 1K08A 4Y98A 2P8JA 3M4NA 5CJJA 5SY4A 2P27A 4C2TA 3E7WA 2FB9A 1YGYA 2XUZA 3JPYA 3PUHA 3QXGA 5KJEA 3QU5A 3SVLA 4MJXA 5AK4A 3P2OA 5FUWA 3UATA 2AA3A 1H05A 1Z6YA 1EGVB 4PS0A 5KHAA 3WO0A 3ETEA 2QTFA 4RDIA 5D1NA 4AX4A 2ZIAA 1U8YA 2PGJA 2OHOA 2BGJA 3CQ9A 4HZUB 4NEQA 3P2KA 2D1FA 1BXZA 1JH9A 1K98A 1HXHA 1OLUA 4FYVA 1AHNA 3N2KA 2LIVA 2QN7A 3OZ7A 3T7TA 4Z86A 3IERA 2FTKE 3OQ1A 1V6CA 3AXSA 4HLCA 4MQFA 3BMQB 4GI1A 1WHTB 4MYCA 3F4BA 3DAGA 1Q0TA 2N47A 4AJPA 2JHAA 1EI9A 2Q6IA 4CKCB 2WHQA 2P9ZA 1XMVA 1SCUA 2R8XA 4K9KA 1W76A 4U3JA 2OG2A 3M1AA 3MG9A 1NBAA 1XNJA 1Z4OA 2RGBA 1H2ZA 2ICAA 3JQPA 4BKMA 1UBMS 3DAYA 4CDGA 5CNJA 1XF9A 2JH9A 2NU6B 2Q46A 2ZSDA 4NK4A 1H8EA 2IE8A 2MR6A 4GAEA 2P69A 4O4HB 4RENA 4Q4DA 2DCUA 5HFJA 1FNNA 2XTAA 4GRDA 4NZOA 1NM5C 4XZ3A 1GN8A 1NM5A 1VPLA 3RT1A 4TZ0A 1X80B 4X84A 1XWIA 3AR4A 3UA3A 1ZK2A 4M7RA 3BFVA 4LJ4A 2CDCA 4ZAXA 2P9CA 4H6XA 3U0BA 1G8GA 1EFHA 3JQAB 5IZ4A 2AN3A 3O3CA 4CLRB 4BX8A 2VJDA 1A7KA 3RIMA 4AQDA 4PVDA 2QD4A 1WF3A 4XCQA 2HCFA 2H8KA 2XMCA 4PRYA 3X1XA 4IX1A 2J7PD 4JLMA 5T3YA 4C87A 1OXTA 5FX2A 4FHZA 2PMDA 2B5OA 5ECGC 2YXNA 5A9SA 5GJBA 2XOKD 4Y6PA 3V2HA 4DIKA 3B1ZA 2GPSA 2OYCA 2IH2A 1WMSA 1VCIA 2BFDA 4JYCA 3FA2A 2Q2OA 2ZYUX 2DUJA 4J94A 1KZYC 1R5NA 4BAGA 3D3WA 2JFWA 3K2EA 1DL5A 4QWWA 3L6EA 1U9ZA 5EI5A 3WC4A 5B64A 1XSEA 4FLFA 1JG1A 1Z39A 2V4UA 3DZCA 4H1UA 1NI4A 2AOVA 1SCKA 2J5KA 3FHTA 4HH4A 4DIEA 1XL0A 3P0RA 3ISTA 3C3EA 4Q4HA 1LJ8A 1Z0DA 1YQWA 2DPYA 2MT9A 2OQ2A 3R5JA 3TW4A 2FFAA 1DCFA 4M1EA 1O95A 4CM7A 4EHNA 4J2TA 5C53B 4GXRA 2FZLA 5F2OA 1MB3A 3TJZA 1ANKA 5EPEA 2H18A 4E5SA 3R4VA 2NO5A 3MM4A 1N5MA 4YMLA 1T5SA 2XVYA 3Q8KA 2VZ0A 1KMHA 3VH4A 4GPAA 1PYDA 1LBIA 4RGYA 4LYHA 3TZ6A 1F6DA 4RTJA 4CKBA 1J49A 3R44A 1ZUIA 2Z2JA 3DOUA 1CRZA 4OSPA 3AJAA 5LOVA 4AI6A 4UAUA 1AS0A 1R8YA 4ME6A 4KREA 3OZVA 1B1CA 1H5NA 1W9HA 3P5SA 2C2OA 2PS9A 4BMYA 1QKJA 2M1XA 3KTOA 1H1LB 2P9TA 4M36A 5TJHA 2O2IA 4QEZA 2A9JA 1ZD5A 2F1IA 4LF9B 1UWKA 5A9TA 3KKQA 1N5JA 2IHKA 4S1NA 4XR4A 5AO9A 4NV3A 3SYLA 3T4PA 3RJZA 1XRSB 2QPLA 3NBQA 4BBJA 4AFNA 1RCFA 5FTMA 1N9GB 1AE1A 1R0XA 1RQRA 4FFOA 3P2EA 4FFPA 2G0AA 4E0BA 2Q9AA 3PQ5A 1QLHA 1Y42X 5EIWA 2FOXA 4E31A 5EJ4A 4LCBA 3WKCA 2DRIA 3K9HA 4X24A 3C6QA 5ILGA 5LUAA 4XWYA 1EWTA 1QFZA 2AZTA 3OEEA 4XD7D 2VUUA 2IW3A 1AKYA 3EPLA 1GFWA 3O4IA 1Z12A 5C18A 4BXOB 3KWMA 2ZQYA 3L1HA 4FR5A 4AUEA 3FMFA 4FYJA 4PYRA 5IKXA 1J06A 3BXZA 1KQOA 3PUKA 3DMDA 5JNSA 1V45E 2WLSA 4KFTA 2ZWOA 4YAOA 2FWAA 2A1UB 2HQBA 2JA1A 2UVDA 4MUBA 3UHJA 4CUKA 3OPVA 1ZOLA 3RJ9A 3NT4A 2I55A 4FEGA 3ZIAA 3M3PA 4CRWB 2YC4C 3ET5A 1BX0A 2FW8A 2Z5FA 3GEBA 5TQ0A 3P0JA 2HSZA 1QQBA 4IO1A 2IWRA 2FX3A 2I87A 4ZOEA 5JSQA 3EE6A 1Z0ZA 5FNZA 4XDHA 2VATA 3QX8A 4BCDA 1M8JA 1X0XA 3F9IA 3K73O 4Y1EA 1L7VC 2G28A 3TEMA 2BFCB 3DKKA 5DRYA 4RF5A 3LQQA 1XYGA 2GPTA 3NWBA 4Q0MA 3DHEA 3K4QA 4HX2A 3V4SA 1RJEA 3VHXB 3H42B 4C0SA 3M1YA 4GP6A 3MTEA 2Q27A 3GVHA 1QS0A 3MNFA 1U8TA 4NFLA 3FFWA 3SN6A 1UQRA 4C0JA 3U1BA 2WUGA 3V1MA 3N5KA 1SU7A 2GQ0A 3H4TA 4GFDA 1GRCA 3C43A 3BRCA 2ZKLA 3N2NA 2QL5A 2TS1A 3S28A 1OC2A 1Z5VA 4LTMA 1GA6A 1V7QA 2R79A 1U90A 4KDCA 3RRXA 1U1EA 3WLHA 4ZU3A 4JR0A 4NMMA 3LBAA 3NXSA 4GOLD 2QG4A 4K9LA 1QP7A 2C99A 3ABSB 5T4FA 4CDNA 4G1BA 5LN1A 2H00A 3F8SA 4IDHA 1E2HA 1UBOS 5HKAA 2CXUA 3D4OA 2F8SA 1SQ6A 1XRNA 3S7TA 2IZ6A 3ZHVA 3JWEA 3DTTA 3ESRA 4G3XA 2X2OA 4WXYB 3O8QA 5JCXA 5F1YA 4EPTA 1QU2A 1EK0A 2JJ2D 3WNDA 3ZQKA 3T9AA 2SKEA 4RDCA 4WJLA 2GZHA 3W77A 2X6TA 3ZWOA 5K8LA 3BHJA 1R5OA 4C5BA 1XMIA 3N2KB 5BYAA 1RCUA 5FFFA 1E2QA 1X1DA 3IP6A 4DUYB 3QLTA 2CWWA 1B42A 4I9HA 4TTPA 5H3LA 3TSCA 2DLNA 1MR3F 3DVAB 1ZA2A 2FPOA 4D96A 3TJMA 4IOKA 1JSZA 2FZEA 2P6UA 4D9JA 1EFRD 3Q9SA 2J1LA 1WD7A 3L7CA 1J2JA 3JQQA 2G82A 3ANNA 3O1JC 5DZSA 4UMFA 4X94A 1TCCA 1EAYA 3E53A 1AQ6A 1UBUS 2RHDA 4I8IA 3QE0A 4W7HA 3RC7A 4ZV4A 5C1PA 1DTWB 1OWNA 2ILTA 3K20A 1OUMA 3FOEC 2OEPA 3OPMA 3PZBA 4AMZA 5G1NA 1XGKA 2IHYA 1QH1A 4DA4A 1E9RA 4X00A 4FEYA 1KOJA 2Y1EA 3C3AA 4HXEB 3RTDA 1LNQA 2BZ1A 1EFLA 3DDOA 3RHFA 2JGDA 4Z7NB 2ZUFA 2J0VA 2ZWIA 3NBFA 5EKXA 5HZKA 4B7UA 5CX1A 3BRSA 3GC6A 3U3RA 2XAUA 3CVWA 5LU9A 1AT1A 2AOUA 1BYIA 1UJNA 2OP0A 5FI1B 2UUBB 4B6FA 2C95A 3HP7A 4RA9A 3FYCA 2BMDA 3RYIA 4WKGA 3SSNA 2PX2A 5M2QA 3WA6A 1J24A 4UM9B 4PZDA 5BQ3A 5HK9A 3GOQA 2DY1A 3LWNA 1ADGA 1TKAA 1YHNA 4GWGA 3SVTA 4YCNA 1P2BA 3MOGA 1JLMA 1YU9A 2CFOA 4KACA 4M9RA 4HNSA 1S96A 4QVGA 2YFQA 2OK8A 4RZ3A 4DDVA 1T9KA 1ZZGA 2K6GA 1WU7A 2FPRA 1VG0B 2I34A 2ST1A 1SY7A 3CEPB 1K97A 3OTIA 2XYGA 3AONB 3QEJA 5CLIA 3K0EA 4IF4A 1YQUA 5IU6A 5ARDA 2C4NA 4HN4B 1P2UA 1IWPB 4JVNA 1IG0A 3O3MB 4MJ3A 1TUGA 4ZYTA 2I2WA 1UXKA 2V03A 2D0PB 4KXVA 4NI5A 5CM2Z 3I2KA 5A3RA 4GOMD 4RU1A 1DCKA 3QE3A 1YR8A 2JG3A 1W5EA 3I1IA 5DHPA 1I6WA 4IH4A 1PWXA 3I9FA 4HAIA 3H16A 1LSJA 2WHYA 3U9SA 4JI4B 2GD0A 4RJIA 4PX9A 2ZI4A 2WD9A 4XEHA 4Y1GA 1MFPA 4KVAA 5E2IA 2DWPA 3UOWA 1U63A 3F5SA 1XCJA 2YIJA 1OXXK 2LD4A 3LS2A 3THWB 3PSAA 3KVOA 5EFOA 3P94A 1S8NA 4BVGA 1SA0A 2JFOA 3H7IA 4B3IA 2OBBA 1EVKA 1YB5A 2HA3A 2L18A 1O8BA 3L0PA 1XTZA 1G59A 2M6LA 3HRHA 3DBRB 4NS4A 2XMBA 3AHCA 3A6KA 4ZMSA 1NNLA 1Z6ZA 2GD2A 5I5GA 2QENA 8ADHA 3T61A 1Z6XA 3QVKA 2QG9A 4O2BF 4DMCA 2AT1A 3AT1A 1OI4A 3DLHA 3IDOA 1LX6A 1Z2OX 4D99A 2DWQA 2P35A 3B5IA 3IEVA 4QL3A 4QYIB 1KDYA 1ESZA 4TMWA 5HE8A 2HMVA 3CSDA 1MIHA 2J30A 5T8KC 1Q83A 4KUGA 3PNVA 1W75A 4OKIA 2K4MA 2PMWB 1NJ1A 2IYLD 3H1BA 2G5CA 4WVFA 4LPKA 1KH1A 3H5IA 3ZY2A 3FN4A 4WKPA 2HMWA 2FRDA 1EUZA 2F48A 1MU0A 3AEQA 3F90A 3LDHA 1ST2A 3TOVA 1NXXA 3AF3A 4AU1A 4B48A 5L6MB 5JNLA 3DAFA 3MT8A 5GZ6A 1RW4A 3ZDAA 5L3SB 1M5UA 4LZJA 2UZ1A 3ICEA 3VPGA 1NJ5A 3PWTA 3DC2A 3FSGA 2H7YA 2GCGA 4HNRA 5L40A 5ERYA 4FQ8A 5FPYA 3EVCA 2PY6A 1E4EA 4FOOA 4DT1A 2WHPA 5KJFA 4G5FA 3UMJA 2I7VA 3OT4A 1PR9A 4X1YB 3BK2A 5AVSA 2VSFA 3WYGA 5D84A 1CS4C 4NHOA 4XGKA 3GMIA 3I0MA 2JEZA 3FKJA 5F9HA 3QX7A 2FUCA 5SZKB 3C8ZA 2P1ZA 1G0NA 1M6NA 2X5JO 1UM8A 3K2QA 1ML4A 4GD3Q 4RA6B 2OFFA 1XZMA 3RC1A 2WKWA 3KJIA 1ODIA 2BH9A 2DHQA 1ADBA 2C9CA 2DQ4A 2HWUA 3G89A 1UJ5A 2AG0A 4JA0A 1KZHA 4AZVA 1JHPA 4TYNA 3DSRA 1LJUA 2H1FA 4HDAA 3ROGA 2BR4A 2BMVA 1BAPA 1ARZA 1J21A 1ZJJA 1RABA 2FN7A 2YOHA 3FF4A 3GLHB 1NN5A 3PE4A 4FD3A 1QVAA 5DYIA 4YRPA 4OLBA 1N6KA 3B3QA 4Q3OA 2BYTA 2C9ZA 4HEA6 3FRJA 2EBFX 5BR4A 4EVIA 4EUHA 5AW7A 5K2OA 3ABIA 1D0VA 4LRYA 1FXUA 3UWPA 1SUEA 1SVWA 1OASA 2DE0X 3A7DA 1Y1SA 2X7HA 3NZEA 4RGVA 1AA6A 3A3YA 1NBMD 1E2KA 1VLMA 3BD7A 1WDKA 4JGBA 3QIVA 4UKDA 1YL6A 4JB3A 4NNJA 3RRNA 1PTJC 1RT9A 1ZUD1 5FBRB 4BIIA 1YQTA 3F74A 2GKGA 4CL8A 1DKLA 1NF2A 3COSA 1N2EA 4G4GA 4XWTA 1AHIA 1QAQA 3HDVA 2OUIA 1CIPA 1R37A 2IYTA 2QN1A 1Q14A 4HRYA 2DQYA 3VTAA 1OFGA 2B36A 2BGIA 5IK2A 4U9IS 1YAJA 3HB1A 1JI3A 1NWCA 1QPZA 4OLAA 3ENKA 5JAIA 1TF2A 3M2TA 1ZFNA 4JVLA 2Z4TA 2QW0X 1VJ1A 5JISA 4TMKA 1GZSA 1K5DA 4YRLA 2NSYA 4MRVA 4YO8A 3I39X 1I10A 2IOFA 1C1XB 5DU2A 1YJCA 1Z7GA 3SYTA 2YRWA 3S2SA 1EBUA 1GPAA 2F43B 4H3SA 3R3WA 3W90A 1B0AA 2OAQ1 3ZWVA 4UDNA 1T10A 2ZUDA 2QA5A 1T9AA 1JHYA 3B78A 3QKIA 2Z4SA 3V5NA 1Y8ZA 2PD4A 1JDJA 2OZLA 4GYJA 4ZGWA 1C41A 4HDNB 4OHZA 3H4IA 2VDWA 4WFKA 1JL3A 1GPNA 1W0KA 3V4LA 3EVGA 4GZMA 2O2EA 2YHBA 5KNDA 5IVKA 4HO1X 2XMDA 4D92A 2GASA 2I54A 2QK4A 3TTUA 4G1CA 2OT3B 2CLSA 1SURA 2WHPB 1E3TA 4MI6A 3MGAA 2C7PA 2WE8A 2ZDQA 5THKA 5BR7A 4UU8A 3BULA 3LCVB 3IJPA 3BSYA 1TIBA 1G0OA 4KMRA 4AQYB 1KDOA 3FTEA 5BSEA 4KWIA 1D2RA 3INNA 5KJ6A 4G5YA 3ZLTA 1GAWA 1Z0AA 2GPAA 2R6CA 3NAZA 4AO8A 5CBPA 1XZPA 4L08A 2O4UX 1IG3A 3G9XA 2H2IA 2ISSD 4FMDB 4J0FA 4M9XA 1NQ5A 5HS6A 4C0BA 3FSEA 4O0LA 4CKEA 3NT5A 3O3NB 4TTSA 4XGQA 4ZK2A 4MITA 1JHAA 4BATA 1JLHA 1WCV1 4L02A 2ENUA 1FRZA 4NBNA 1T6YA 1W1WA 3CF6R 1QE0A 3R5XA 3R7LA 1XZAA 3V2IA 4XX1A 4YAKA 4DTIA 3LW8A 2YBEA 3H6GA 1U2DA 1XJ5A 4I1RA 3PEVA 4M9ZA 1JEAA 1M2KA 1IUNA 3D0QA 5ALMA 3U16A 3C0KA 3U3KA 4BFYA 1Z4LA 1PX0A 2PKRA 1E2PA 1EUDB 3IQZA 1Q0SA 4MRAA 5AKIA 1E5DA 1MQSA 4P33A 3CEAA 1ENPA 3TIFA 1I6KA 3K0HA 3LI2A 1RXEA 2P3LA 2VNIA 4S1WA 4BVFA 5SZHB 1VHDA 2XWPA 5CA0A 4CTJA 4WZBA 3T8YA 1YOVA 2HADA 2Q5FA 3EGIA 3AFNA 4CZ2A 1CULC 2O48X 1P1CA 2K2QB 2E4ZA 3A10A 1FYEA 3KV1A 3SHQA 4GKJB 1SVMA 3G1UA 4U4AA 3A1VA 3O74A 2R8YA 3D9QX 5HQTA 1E64A 3U7RA 3GL9A 1JDSA 3H8WA 3OOEA 2O8DA 1U0SY 4NE7A 5CH5A 1F12A 1ZC3A 1S4QA 4P31A 5JCJA 3H9QA 2G40A 2K7ZA 4F72A 2PLNA 3AVUA 2JB9A 3Q7QA 1GP2A 4PX2A 1SVKA 5B57C 4FSXA 5I7FA 1F0NA 1FX1A 1MC1A 3HB4X 3VDRA 4BLPA 2VH2A 5IAGA 4F04A 3KUCA 4CIBA 1AH2A 2AJDA 5B7QA 1M10A 2VAPA 4PIPA 4KWTA 4TS9A 5B1SA 1FIUA 3FPLA 1IIRA 3L7DA 3T7CA 5HR5A 3AIOA 3HUTA 2XZOA 2GYVA 1XQWA 2Y92A 3NHBA 4NEHB 3THSA 2R66A 3NOOA 4JJ8A 1T5BA 5AVTA 3DF7A 2IY8A 2P0AA 2O1WA 3N05A 4RK0A 3HR8A 1DKUA 2IKQA 4LWOA 1SVSA 1UC5B 1N7GA 2VBIA 1F8YA 4QDZA 1G20B 1WB4A 2WPDA 1JEJA 3FPBA 3DMRA 3CIOA 1EXDA 3BSWA 1GZ5A 3SS8A 3V3TA 4D8WA 1MVNA 3ECCA 3LVQE 5ICFA 3OI7A 4M0FA 3RC9A 3ZOZA 2BVNA 1U04A 3DOOA 4FZJA 3ZBPA 4EYGA 1EYZA 2EW2A 1NYRA 1ESNA 3EPKA 1ORRA 4ODIA 3EIUA 4W5WA 2H5EA 3IA2A 4HYQA 1IN7A 1O96A 2SKCA 1AQIA 1Y5IA 4Q3CA 5ALTA 1AO0A 1C2YA 3SBXA 1RYHA 4YA6A 3UB2A 3UJ3X 4MKRA 2GEJA 4YNBA 5JARA 3OZXA 4DMUB 1N33B 2WWGA 3B3JA 4G65A 1EJ0A 1JR3A 3AESB 2M9MA 3ILXA 2I8CA 3JAWA 2NQTA 1GQSA 2ZJAA 4KRXA 1C8KA 4RK1A 2XCIA 1P6UA 2BTQB 1WV0A 4RK4A 3PD1A 3OIVA 4BKUA 3EEIA 1KHTA 4ZFNA 3SZOA 4DSTA 5B58T 1AG9A 4QTXA 2Q5CA 1ZMOA 2XZDA 4XW2A 2JK0A 1GRQA 4CBVA 1YFLA 1USUA 5EIAA 1GYQA 1IVYA 4DC9A 1KZ7B 3W5CA 4DJJA 1GL9B 2YMQA 2J0UB 1OZAA 4U5QA 4ALLA 2ORIA 1OLSA 4QBHA 2IS1A 2YHUA 4ZRDA 5EC8A 1FS4A 1SULA 1H4VB 1XFDA 3UWMA 1H3EA 4QC2A 2BMAA 5C3UA 3F6CA 3UYKA 4MH0R 5AJZA 1VJRA 4IYRA 2QB5A 1ECFA 1KC3A 5CH8A 3NJRA 1CUSA 1SBCA 1JKMA 1BWPA 2F1OA 3PR3A 1X1BA 3LRXA 4GSKA 4D9BA 4Q1FA 3R6GA 4TQUS 1NRJB 2EU8A 1DFGA 4FS8A 4UBOA 3WB1A 3WGJA 1AQYA 3GUUA 3RRJA 4JCCA 1G8YA 3E9DA 3HV2A 4JBHA 3Q12A 2C9OA 3R7SA 3EJ6A 3SZUA 5IUJC 3PQ4A 1UEIA 5LDHA 3OFJA 1L7DA 4TLMB 4C01A 1FTGA 5HJEA 5HK8A 4XCXA 1V5WA 2L17A 1CNEA 3A1SA 3HSKA 1YGPA 1Z7YA 3ILVA 4LJLA 1NJFA 2GXQA 5J5AA 4MB6A 5ICGA 1ZUNA 3QU7A 1IWOA 2GRUA 4L4SA 4QICA 3C3BA 1VTKA 3EHEA 1CLEA 3ZHRA 5IUKC 4F3KA 3EDQA 3EVAA 4BO6A 1RP7A 2G5TA 3NHLA 3LNTA 4LVOA 2GHTA 2DFTA 1KPGA 2A4KA 2QXUA 3PQEA 5K99A 3MTGA 1EK1A 4L5CA 3K9FC 4QT0A 3TKLA 3WYEA 2VUTA 1T4GA 1NG9A 2UUPA 4TROA 2O5RA 2MR5A 1QG0A 1UANA 2X58A 4BAZA 2Z8XA 2AN9A 1IEVA 4BTEA 1JH8A 1TCVA 3HBAA 1E8NA 1E1RD 1LNSA 1ZO8A 3IALA 3MOSA 3WL5A 1TEHA 4YJ3F 1BMDA 4EB3A 1NUPA 2YZ2A 1IQUA 1L1EA 4IVNA 4RVFA 2FPGA 1O87A 1XEXA 3TM5A 1SCDA 3WK4A 3GLFE 5J58A 1K0FA 2HPHA 2NAPA 3UHFA 3H2HA 3ULKA 5KTMA 3FFBA 3MWEA 3LCCA 4HUJA 2NOAA 2VPIA 5GVSA 4LF4B 2WK1A 5DW0A 3VKVA 5DYNA 3IT2A 1NPTO 4IFIA 4QXAA 3RB8A 4B9AA 5AW0A 2WFLA 1VKJA 3IVMA 4YTEA 5JSUA 2EEZA 4DCPA 3QF4A 5FL7A 3E2PA 1T8UA 3LFTA 2NN3C 4GPBA 3HYRA 1MJHA 1XTJA 1J0CA 1DAPA 1NJ2A 2OKGA 3MJ4A 2JD1A 1SN7A 3DC7A 3LK7A 2PQ6A 3VPDA 1N6IA 3D6VA 3A3KA 1G4UR 4QDJA 3HBFA 4A7PA 2EJVA 2VF5X 4ZMBA 3AF0A 4Q3DA 1CJSA 3FUTA 2QZZA 3UXEA 4FC7A 5TEWA 4QGSA 3G68A 4XTCS 2QRHA 1X38A 4WA8A 3VR3D 3GBSA 1KMHB 3CRQA 2V4MA 1F1BA 1RWWA 4MRMB 4DF3A 1P60A 2AG6A 1Z36A 4RTSA 2FSVA 4X6LA 1SVLA 1K8RA 4EZEA 5JY6A 2HRQA 2B35A 1YZVA 5AI9A 2RIRA 4TM7A 1C50A 5ICSA 2BIFA 1B74A 1I2MA 2BEVB 3EC7A 1YD7A 4QQ8A 3A9VA 3IV9A 4Q3LA 3U7GA 4QHYA 2IVFA 3CZQA 3P9CA 3L0YA 4UMEA 4PE5B 2QTHA 4RJJA 1C0IA 3M70A 3RAFC 3GDHA 2BFOA 3ZHOA 4I5GA 3ZDQA 3KP1A 1UXIA 2J6IA 4DLAA 3PB3A 1MHTA 4PX5A 4YJGB 3RQIA 1QU3A 4N6GA 1L5MA 3W4JA 5FTWA 2ODEA 4Q34A 1XVIA 1A82A 4RA9B 4OB6A 1NL3A 2GWHA 1VSQA 2FSUA 3NKFA 4OREX 1LPOA 4BNNA 4F5WA 3QVTA 4UJ5A 1T36A 4ZZ3A 1K4KA 4AT1A 2O5EA 5J4LA 1WMBA 1GKYA 3L7AA 3OA2A 3ROZA 1DDGA 1QWSA 3NWEA 5FDFA 5E0KB 5K6AC 1B8UA 1M54A 4GGPA 1M5TA 1I1OA 5UKDA 2AJCA 2CXSA 2ZSIA 5K2MA 1Z2CA 3U48A 3D8TA 1IY9A 4G0UA 5EFZA 1WZUA 4YXFA 1T9CA 4JJEA 4JYAB 1X42A 3WGKA 5BV7A 1MOSA 4OA8A 4ZC8A 3FJ1A 4KXYA 4H7KA 2WYVA 3TCKA 5G4KB 4KR9A 4AQ7A 3P9KA 1DC3A 2JLYA 4S1VA 3TOZA 4JXXA 1T1RA 1U11A 2BFDB 2VJPA 3PUWA 1XTKA 5ALIA 3UB4A 3TLGB 1JKJA 3UCEA 1T3TA 1OTYA 2CZQA 1WP9A 1PJSA 3NLLA 4XVHA 4DQXA 4OJMX 1UUFA 3OESA 2CNWA 4BZXA 1QRDA 1SHTX 2VDOB 3AM1A 1T15A 1C7EA 1Z4MA 2Q41A 1A5BB 2VNHA 4AUNA 2Q2VA 3SU8A 4IICA 4ROTA 2LCQA 1KFEB 2A9VA 3TR6A 3SKVA 1AURA 1ZEJA 2A86A 4Y7CA 1Z17A 1E3IA 2A5LA 2SBTA 4JGIA 2J0SA 1UP4A 1Y3IA 4CUZA 1LRJA 4UZSA 4KTVE 1H66A 3FR8A 1JYSA 5LMZA 5GIPE 2YXLA 3ADOA 1TYCA 3AKEA 1V6AA 4LNUB 4YYZA 3UUFA 3GLRA 3DLIA 3O2NA 1N9KA 4E21A 4KE7A 1KJIA 1V1MA 1K9VF 1X94A 1OJ7A 3I09A 1R0SA 3T4XA 3ZTWA 4TL7A 1H0KA 2PV0A 2P6OA 1CQXA 5TVKA 4S04A 1XRQA 3TLGA 3RS4A 4EKGA 4GQIA 3RM3A 3QVJA 3ZJVA 3TRJA 4P4SA 3OIFA 3WJ2A 1F0YA 2ZBVA 4XE5A 2YOGA 3BMOB 3RFVA 4ED9A 2PX5A