1H2BA

Crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
343
structure length
343
Chain Sequence
KAARLHEYNKPLRIEDVDYPRLEGRFDVIVRIAGAGVCHTDLHLVQGMWHELLQPKLPYTLGHENVGYIEEVAEGVEGLEKGDPVILHPAVTDGTCLACRAGEDMHCENLEFPGLNIDGGFAEFMRTSHRSVIKLPKDISREKLVEMAPLADAGITAYRAVKKAARTLYPGAYVAIVGVGGLGHIAVQLLKVMTPATVIALDVKEEKLKLAERLGADHVVDARRDPVKQVMELTRGRGVNVAMDFVGSQATVDYTPYLLGRMGRLIIVGYGGELRFPTIRVISSEVSFEGSLVGNYVELHELVTLALQGKVRVEVDIHKLDEINDVLERLEKGEVLGRAVLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALCOHOL DEHYDROGENASE
publication title The structure of an alcohol dehydrogenase from the hyperthermophilic archaeon Aeropyrum pernix.
pubmed rcsb
source organism Aeropyrum pernix
total genus 112
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2002-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h2bA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1h2bA01
4YJHB 3SXPA 1LLUA 1YO6A 3GEDA 2B5VA 4MKZA 1ISIA 1YBAA 2Y93A 4QT0A 4B8WA 2YHIB 1AXEA 1QRRA 1ZEJA 2F1KA 2YV1A 4NBTA 1JKFA 1E77A 3WBBA 4Z6KA 2JHGA 5C5IA 1K6JA 1HLPA 4CR6A 2BD0A 2DAPA 4CPDA 3ZNNA 3JQDA 4XEHA 4L0QA 4O59O 1QXSA 4BNHA 5G2OA 3ZHZA 2PV7A 2ZTUA 3JD1A 5DOVA 2XXJA 4Y6RA 2E6UX 4CUZA 1NFFA 4NBWA 3HN7A 4XZ3A 3UCEA 5JDCC 1M76A 4EEXA 5BQFA 5KJFA 1MB4A 3EZYA 1GR0A 5K0ZA 2OP0A 2FZWA 3DTTA 4GH5A 5DN9A 5G4LA 3S2EA 5KTKA 1UAYA 1GV1A 4W99A 5MDHA 3EW7A 1ORRA 2FR0A 5JAMA 4I1IA 3V1TC 1CYDA 3LC7O 4FGWA 2VUSA 3RAJA 4CMGA 5L51A 1H0KA 1M75A 1XKQA 2V6FA 3X2EA 4FSHA 2GZ3A 4W4TA 1NQAO 3E9QA 3V2GA 4MINA 1RM3A 1WZIA 2GO1A 4N5MA 2F00A 1S6YA 5JNLA 3WX0A 2Q99A 3OHSX 2HO5A 1CETA 2ZIZA 2BHLA 3D5TA 3JQ8A 1ENYA 3UCXA 2CF5A 1YOVB 3MWDB 3ITDA 2VT3A 3FRJA 2GGSA 4WPGA 4BKUA 2ZYDA 1MG0A 3GF4A 4LK3A 4BO6A 5KWEA 1T26A 3JQAA 1TVEA 3W8EA 1XIVA 1HETA 3KYBA 1I10A 4N5LA 2POQX 3E5MA 2JJYA 4RPHA 4CMCA 3DXFA 5AVOA 4WASA 3U3XA 2PNFA 4JJGA 1BDBA 1Q1NA 4HFMA 3D5QA 4LW8A 3FR7A 2C5EA 4ALNA 1HYHA 4EW6A 4FJ0A 3GHYA 5I8WA 2EJVA 3EC7A 4DPKA 5G0WA 1C1DA 3QVWA 1SEPA 3CTMA 1X13A 4CMIB 3H2SA 4GQAA 4PFJA 5IDYA 2HRBA 4J6FA 5IDQA 3I6QA 1GQYA 4CM9A 2DPGA 3HADA 3AUAA 3DBLB 1J4AA 2OBNA 3H9EO 5AQ1A 4CLOA 1PL7A 4FC7A 4YVFA 5JY1A 2AMFA 1VLLA 4FPXA 1N5DA 4QSMA 4XRRA 3D4OA 3ZU2A 3L6EA 3DHEA 4IGEA 4UAGA 2DM6A 4GLLA 2BRUA 1E7MA 4XGIA 1PJ2A 1E5QA 2C07A 1F0YA 4KTVE 4YAKA 1BTOA 4P8RA 3WG9A 3RFVA 1GY8A 4EDFA 3HE3A 1BDMA 5THQA 3IDSA 4J91A 5KVSA 1EUZA 4GKBA 5IFLA 2CDBA 4YB8A 3MZ0A 2IE0A 3OA0A 2OP1A 1U5AA 2ILTA 3Q11A 1OC4A 4MVJA 1QSGA 1EUCA 1YB5A 3L6DA 2BI7A 4HNGA 3WYCA 4OAQA 3Q9UA 2QG4A 2VTDA 4PGFA 3DMTC 1BXGB 4YPOA 4J2OA 1UAGA 2X1HA 4RCVA 3PDJA 1UP7A 5TSDA 1GU7A 4IZIA 4R1SA 3IJRA 2E82A 2DUUA 3INTA 4R41A 4BGEA 4PG8A 2GDZA 3H7AA 4B4WA 3T4XA 3C1AA 3JQBA 1NYTA 1AHIA 2DFDA 3GFBA 1DO8A 3ADOA 1I2ZA 2O7QA 5A1TA 5DNAA 4B7XA 2DTDA 1LLCA 1P74A 1EZ4A 1UP4A 3G1UA 3RU7A 5GMOA 4BVAA 2W2LA 3D64A 3JSAA 2VHWA 3BMNA 4IJUA 2G5CA 3ZH2A 3WSWA 1VKNA 1A4IA 3D7LA 3UH1A 1FXSA 4J9VA 4Y6PA 5HRUA 2X0JA 3JQCA 1JAXA 1ISHA 1GZ6A 2DLDA 3PJEA 4NJMA 5DP2A 5JAZA 5I7VA 1ULSA 2D59A 1WDMA 2P5UA 1VPDA 4IXWA 1YDWA 4U8GA 4IS2A 1GPJA 4FN4A 2NWQA 1PZEA 3S2FA 4R51A 4FGSA 1B2LA 3DZBA 3INRA 4CQMD 4EBFA 3DR3A 4OKIA 1YGYA 3FTNA 4EJ0A 4HKTA 1Y1PA 5J23A 4I9HA 2Y0CA 1RM5A 1VJ0A 4BKOA 1LC3A 2UYYA 3C7AA 4D44A 4UVDA 1LDEA 1HDZA 1WW8A 4MIEA 4B3HA 2X5JO 3PTZA 4EUFA 1E5LA 2Q46A 3TQHA 4CMJA 3GZNB 1P1JA 3WWZA 2E48A 2QYTA 1R0KA 2JD0A 4MVJM 4RVGA 5DP1A 4YJDA 1ZCJA 1GV0A 4GI2A 4TQGA 5G0SA 1NVTA 1GEEA 4WNIA 1HDGO 4E3ZA 2D5CA 2O50A 4KQXA 3B20A 2DPHA 1I2BA 4OQYA 2XAAA 3PFWO 4JK3A 3GN1A 4TSKA 3E9MA 1LDYA 4FJ2A 3W4IA 1K5HA 1BW9A 2QYSA 4BNLA 1HE3A 4OSPA 3U4HA 1N8KA 4ZHSA 3H5AA 2VWPA 3AK4A 2PGJA 3IQDB 1DJNA 1T2EA 1UZNA 1U4OA 1ID1A 2D4AA 4WKGA 5G0TA 1TI7A 2VRCD 4U5QA 3VZQA 2H5LA 4PZDA 4RJTA 3VH2A 4IXTA 4J1TA 2V7PA 4XGKA 3ZWNA 3SEFA 2GCGA 1HDXA 2O3RA 4R1UA 1T4DA 2VN8A 3RUIA 3T7EA 4P22A 1DAOA 1YQDA 2OGUA 4XGNA 1H2BA 1HSZA 2HUNA 3C7CB 5ITWA 3JTMA 4UVGA 2PH5A 2Q49A 4FIZA 3KBOA 4ZVVA 3ETEA 4B8ZA 1XR3A 1KETA 3WDSA 5CP8A 5DBGA 1Z74A 1JWAB 4CMEC 3DBHB 4GWGA 1E7SA 1KVTA 3R6DA 3OH8A 3AY6A 4TROA 3G3EA 3DZIA 4W82A 1HDYA 3PGJA 5JS6A 3KSUA 3NX4A 3ZV4A 3D1LA 3I83A 3NT4A 1YONA 4U6SA 2XXBA 2AXQA 1GYPA 5IN5A 3IMFA 3JQ7A 1HT0A 3L0DA 3WGHA 1N1EA 1AXGA 4CR7A 1NPTO 1GYRA 1UZLA 2WM3A 3Q1LA 3ONFA 3BAZA 1NP3A 4DL9A 1NXQA 3I9LA 4YBZA 1GPDG 1WNTA 2CDAA 4IY1A 5KJEA 3KVOA 2EXXA 4OGWA 1FJHA 1XQ6A 3DTYA 4YJFB 3LC1O 1MV8A 4AJKA 3I4CA 2FPGA 3VPSA 3TFQA 3NKLA 3ANNA 4D41A 4L9RA 1EFLA 2J8ZA 2HK7A 1FMCA 2RAFA 4PG4A 4BNXA 4RPGA 1CIVA 4NU6A 4CLRA 3JV7A 1V8BA 4WLNA 5JCJD 5I7EA 2YJZA 2JKVA 3ORFA 4PG5A 3AU9A 4MPDA 1ZXLA 2JAPA 4E33A 5COAA 2GRAA 4Z0HO 4FC6A 4AJIA 4ND4A 4WLEA 3CPSA 3VDQA 1I3MA 1YB4A 1ZK2A 3DZGA 1GUZA 2HK8A 2WE7A 5DCUA 5JLAA 1R0LA 1R12A 4CLXA 5CDYA 3NEPX 4GX1A 4JGBA 4RZHA 3DZHA 5JW6A 1FDWA 1T24A 1MGOA 2EGGA 2VYVD 3EVNA 3JYPA 2YUTA 3RUAA 2WJPA 4BMVA 2BFOA 2EW8A 1B16A 2ZTLA 2AEJA 4YQYA 4CM1A 2DBVO 1U8FO 4CLDA 1PJSA 2Q1WA 1HYGA 4I5DA 1PZFA 1PQUA 5HS4A 3WB9A 4YAEA 5KNLA 3ZWAA 2BI8A 1I36A 1PGNA 5IZCC 1R15A 1SCUA 1ZSVA 3ZDFA 3NRCA 4RQTA 1P0CA 1K0UA 3KEQA 3CINA 2A94A 5A04A 1O94A 3CXRA 3H9GA 5JPIA 5IG2A 1SO8A 3LT0A 4NR0A 1WDLA 1YL5A 3KEOA 5L4NA 3DMTA 4FOOA 3UFXA 2UUOA 2X86A 4TRJA 1NHWA 2I5PO 4BMSA 4MVJE 2P91A 2CF6A 1MXHA 1E3JA 1KBZA 2VYND 3K96A 2FPPA 4WGGA 4XKJA 4Q3AA 4H7PA 4E31A 4RF3A 4AFNA 3SVTA 1HE4A 2UVDA 1Q0LA 1JW9B 5AXCA 1R4MA 1PWXA 1N1GA 3KTDA 3ZNQA 1HKUA 1PJBA 1U1IA 3AY3A 4FCCA 4GBJA 3OEYA 1E0DA 4RPKA 3PIDA 2C2YA 4WLUA 2NU8A 3EY4A 3GVIA 3OJLA 3SX2A 4BO1A 4DRYA 1LQUA 4NFHA 1ZNQO 2QQ5A 3GVPA 4QX6A 2V6MA 5F3RA 5CEJA 1VL0A 5GZ3A 4XYGA 4TKLA 1BG6A 3C3XA 3WGIA 2GERA 2UV8A 4JCOA 4JP3A 1E92A 2PZMA 1O6ZA 1GZ3A 4R9RA 2O7SA 1U3UA 4Q39A 4LMPA 4DIOA 2IDZA 2B4RO 4KDFA 3WQSB 1T25A 4ND5A 3RASA 3FSRA 1JAYA 5ER9A 2RCYA 4BO3A 2ZKLA 2Y0DA 3CZRA 4L74A 4O63O 4BNVA 3JQAB 4XQCA 1NWCA 3K6JA 1B3BA 5L4LA 4IUYA 1U2GA 2HKIA 2Q2WA 1WAMA 2VHXA 2WWRA 3SJUA 2WYUA 4TMFA 4U0JA 2QIOA 2O4UX 1U3TA 1ISMA 1RWBA 3NTQA 4DC1A 1I01A 3G0OA 4URFA 4CJXA 4MVJP 1Z75A 4ND1A 1SZJG 1YE3A 4L4XA 4M86A 1LBEA 1EBUA 3IOYA 4D79A 3P2YA 1TT5B 1DIGA 1MFPA 1SB8A 1UDAA 2EEZA 4Q9NA 4QTZA 1DJQA 5JSFA 1KVQA 4CLOB 1ISFA 1XA0A 1YL7A 2CD9A 1XGKA 2O3SA 1TB4A 4X54A 4YJGB 3V2UA 1DIBA 3H9QA 3ZN2A 2CUKA 5K9ZA 5THKA 5COBA 3ZU4A 4D3FA 1PX0A 2OHXA 3ROQA 3RJ9A 2C29D 2X7HA 3BTSA 4IJVA 4AG3A 4E32A 4EEZA 1QP8A 1LSJA 3U4DA 1J5PA 4BNJA 1CDOA 4WECA 3HDJA 5HM8A 3DMYA 3WJ7A 1KVSA 2W90A 3OIDA 2CZCA 1HEUA 3ZI0A 3KLPX 4A2CA 4E30A 3O26A 4DA9A 2NVWA 4OIMA 3FTPA 3DO5A 3VH1A 4YAIA 1PGPA 2AE1A 2AQKA 4YT5A 3OJFA 4XR9A 1J0XO 5JC1A 2Q4EA 3INGA 3TRIA 5ADHA 3OM9A 4S3MA 2C82A 3BYZA 1IHYA 1LQTA 3I3OA 4Q3CA 5CEFA 4CMEA 4WCFC 4YEDA 2IYOA 3QWIA 2YFQA 3GVCA 3HHPA 1PR9A 1L1FA 4D43A 4I5EA 1BGVA 2Q1TA 2W4QA 4NQZA 1EBFA 3TWOA 3OJ0A 3VVCA 4WNCA 1H6DA 3QE3A 4PLZA 4WJZA 1W4ZA 3PZBA 3VAZA 4CV2A 4ID9A 4BNGA 3AM5A 2VOJA 2PKQP 4UREA 1WXDA 3UCFA 3ZGYA 2DVMA 2EKQA 5BNTA 3BMNB 1KIFA 4F6CA 4YAGA 2FMUA 2FSSA 3BIOA 4J7UA 3KSZO 2I6TA 3ZZNA 1XELA 4NJMB 1SOVA 1I3KA 1F8GA 3H9JA 3F46A 4M54A 1ZMTA 4FFOA 3GR6A 3WLFA 5EINA 1XLTA 3IUPA 3ON5A 3F5SA 4W7HA 1ENOA 4Y8VA 2GN6A 1R4NB 2ZJ1A 2ZTMA 1Q7CA 4QEDA 2RH4A 4DLLA 2CNBA 4DWVA 3AY7A 3RBZA 4RVDA 4CUKA 3I9NA 4BL5A 2DTXA 5IAAA 2HK9A 4DLBA 1ADGA 1WZEA 3IC5A 4I5FA 5JFOA 1UP6A 1L7EA 4FFLA 5L40A 3A28A 4CM4A 2EV9A 5G0VA 4CM8B 1DFHA 2OUIA 4CMBA 4CLHA 1HSOA 1KY5A 2XF8A 1CQJA 4CM5A 4GX5A 4HY3A 1M6HA 1QLHA 5F5NA 2ZB4A 3KSDO 1DDOA 4BO4A 1YBVA 1HE5A 5BSGA 4RF2A 5DBFA 2VWGA 2EKPA 3EZLA 1E1MA 3L9XA 2GSDA 3DBRA 3K9QO 2UDPA 4R16A 2YHUA 1GD1O 4Z9FA 1LEHA 4R5HA 1HWYA 1E6WA 3VPXA 4AJEA 4O5OA 1E6UA 3KXDA 2DC1A 2G76A 2JL1A 3KO8A 1UJMA 3PGXA 5HWSA 4HWKA 3RFXA 2W2KA 2WD7A 3GFGA 2WYVA 3LYLA 4RVUA 5JMWA 1EVIA 1H94A 1P9LA 2X0RA 3O8QA 3U5TA 5LC1A 3VZRA 1GZ4A 4A7PA 3RKUA 2P4HX 5IDXA 1P1HA 3WYEA 2OMEA 1ENZA 3F5QA 3PWSA 4M1QA 5G4KA 3PHHA 3H4VA 4FQ8A 3BMQA 3DHYA 1LJ8A 4E5PA 5TC4A 3QP9A 1CJCA 4GGOA 1F06A 3DB2A 3DL2A 3PYLA 4OXYA 1K89A 4R54A 3AFMA 2A9FA 3D0OA 1M67A 1LA2A 1PWZA 2ZJ0A 4LMRA 1LLDA 2OORA 1WPQA 4XRGA 3ST7A 3Q6IA 3RD5A 4IDBA 1UXHA 2DUWA 4OYRA 4R3NA 3A4VA 5L9AA 3PJGA 4YWJA 2IZZA 2X23A 1ENPA 1XEAA 3WOHA 3E9NA 3GPIA 5CAEA 5DOZA 4KUGA 3RI3A 4CLEA 3GY0A 3EUWA 4PLYA 5L53A 1HE2A 4L4RA 4NH4A 4RQUA 1V3VA 3PXXA 3JQ7B 5L7TA 1Y7TA 5I9LA 2QHXA 3JQAD 1PQPA 2ZB3A 1YQGA 4ILKA 5A9RA 1L7DA 1LRKA 4AJJA 4YRBA 4RVFA 5TX7A 1QYVA 3GOHA 3K8ZA 3PZRA 4RLHA 5KKCA 4PRLA 4BNIA 1GQQA 1ZMOA 3TZHA 3BZUA 9LDBA 4RL6A 3GDFA 4J90A 3V1UA 4FOSA 4E4YA 4IDGA 5F21A 5EJ2A 4J0EA 1VI2A 3OSUA 4CLRB 4CM9D 2IZ0A 3F1LA 4LVCA 3ZWXA 5C7OO 1UDBA 2QRLA 2WEKA 2NNLD 2YW9A 3QWBA 2BFPA 1ZZEA 1EK5A 3QWHA 3WR5A 5IN4A 1JN0A 1LNQA 3E6AA 1ZSNA 3GUCA 4CMKA 5FWNA 3DAGA 3GGOA 3HDQA 1HZJA 1DB3A 3X2FA 3ONEA 2PD3A 2HJSA 4BV9A 1RJWA 4YTEA 4OXNA 2C7GA 3ZV6A 4E2WA 4GKVA 5JC8A 2FP4A 2CMDA 4LISA 5L3ZA 4KDEA 4WE3A 3UVEA 4EUHA 3LT1A 4WCDA 2Y0EA 4B79A 1R0SA 3C85A 1TEHA 1VM6A 3RU9A 4II3A 5B4UA 3L9WA 1FF9A 2AA3A 4HP8A 3CSDA 1PZHA 1T2AA 5HTOA 1D1SA 1DC5A 1X7DA 4ZQEA 4P4GA 2CDCA 1QMGA 3Q2KA 4XYMA 3OQ6A 2JCYA 4BKPA 3IKVA 1SPXA 3I9MA 3JQ6A 4XYLA 1P31A 2EW2A 2FPIA 1D8AA 2D1YA 4EUEA 3DONA 4MKXA 5B37A 3WNVA 5G0UA 1DRVA 2HU2A 5KVQA 1DRWA 1F12A 3FI9A 3DZJA 2BGKA 2AEFA 5DCYA 2W2LD 4CL3A 1PL8A 4J7CA 4JIGA 3U49A 4F3YA 5IDWA 5F5LA 1QR6A 2AHRA 5TQVA 1T2FA 4WCFA 4GX2A 1PS0A 3BTVA 3QRWA 4CUJA 5MGBA 1E7QA 3RC1A 1IYZA 3BMOA 3H5NA 4AVYA 3PQFA 1Q0HA 2RIRA 1PL6A 4M89A 1XCBA 5TRTA 4FDAA 2JFFA 1D4FA 4J49A 2BH9A 1B8VA 1P77A 1CQIA 1DC3A 2VWQA 2D5AA 3SBOA 3I1JA 3VVBA 2PY6A 1P33A 1ZXBA 2Q2QA 4P4LA 4TWRA 2VQ3A 4Y6SA 3WGYA 3ZW8A 4D46A 4XB2A 3JQFC 1O0SA 1QYWA 3GK3A 1U5CA 1NVMB 3EAGA 1DC4A 2OBYA 5CDGA 3A9WA 4HNHA 3ZU3A 1SAYA 3EK2A 1JKIA 4Z3KA 3W4JA 4DQVA 1NQTA 5T8KC 3WXBA 2DU8A 3Q3CA 2GD1O 4ZQHA 1GUFA 1TA4A 4CV3A 3AM4A 3KLMX 3ABIA 1ZJYA 4N5NA 3OA2A 5F1OA 4BNUA 5KIAA 3RUFA 2IXAA 4J4TA 3WJAA 5EMHA 3LLVA 3ONDA 3RFTA 4OMUA 4WLFA 3VDRA 1LRJA 1PJ3A 1Z82A 2WD8A 4E6PA 1V9LA 4NG5A 1RM4A 3AUSA 3UGKA 1QKIA 2NUAA 1EE2A 1FK8A 1JVSA 1NAHA 1SNYA 1Y5MA 2IXBA 4HBGA 4RVHA 3TL2A 3TNLA 5FFFA 4Q3BA 1C0LA 3GNQA 3HUDA 2B4TO 1XQ1A 1K6XA 3B1JA 3VPFA 4J3FA 1ZVMA 1ZK0A 3BXXA 2J3HA 5DT9A 5DZSA 5JYEA 3JQEA 2I99A 3PP8A 4XCVA 3VKVA 4DGSA 3STHA 4E21A 2HDHA 1C3VA 1DFIA 1KVUA 4U0KA 1O9BA 4CMAA 2R6JA 1DFGA 3WS7A 1J6UA 4IZHA 1JA9A 3P19A 2ZQYA 4P4NA 1TT7A 5I7FA 3WQRA 3S8MA 4RDHA 4DMMA 1LSOA 4E2YA 5KCZA 2H6EA 4ESOA 1W6UA 1GTMA 4YAJA 2A4KA 2X5OA 5A03A 3ANLA 5GY7A 1U28A 2BGMA 4CQMA 7ADHA 4BNTA 3NDIA 4ZA2A 3HN2A 3GA0A 3GG2A 3VHRA 4WLOA 1O95A 3LLSA 4N54A 4A27A 2AG5A 4IPTA 1R66A 2EP7A 1C0KA 3N74A 4KWHA 4PCVA 1BXKA 4ZICA 5A02A 1EK6A 1SB9A 2QX7A 3H9UA 1WVGA 1ADCA 2CY0A 2I76A 3PRJA 4CQLB 4OHUA 4JX8A 3LDHA 3ZWMA 5TLSA 4CM7A 1PSDA 3OMLA 4Q3DA 1PGOA 1D7OA 5EL0A 1NASA 3O4RA 4BO7A 5TS3A 4LSMA 4YJHA 4LVUA 3TJRA 4CM3A 3I9KA 1K2WA 1E3IA 2ZCVA 1ZK1A 3QJ5A 4QXMA 5JDCA 2OOSA 3TZQA 2O4CA 3WMXA 3WYBA 1IE3A 5U4QA 4BGUA 2I66A 3KB6A 5A9SA 2Y1GA 2Y67A 3PFFA 4KWIA 5GZ6A 5CFZA 1VSVA 1CF2O 5A06A 2EKLA 1UUFA 1LC0A 4JJFA 1XDWA 1XU9A 3D3WB 3PWKA 3QWAA 3TOZA 3TF5A 3AJRA 3BHJA 3GGPA 2X58A 1W0CA 5JDIC 3F6YA 5EERA 3KHUA 4WEQA 2X6TA 3P5SA 4NMHA 4BNZA 4BO5A 2FY8A 1O89A 3C1TA 3PI7A 2O3UA 4QECA 5A9TA 2G82A 1QYXA 2YDYA 5BSFA 1EVJA 1JWBB 2E49A 5H81A 4QQRA 5JMPA 3G49A 1LSUA 1B14A 1X7GA 3QV1A 1I3NA 3NTRA 3ZHXA 2ZTVA 4UUOA 5TF4A 3HFSA 1N9GA 5JO9A 4H16A 3R0IA 3T7CA 3R1IA 2QZZA 1B15A 1YBMA 4UUPA 1TXGA 5KKAA 4A26A 1UR5A 2V6GA 4B4OA 3QSGA 4HFJA 1U7TA 1NFQA 3FN4A 2C54A 4MVJH 3TZ6A 1N7GA 3JD0A 2J3KA 1GUYA 2EF1A 4LN1A 4E0BA 1IHXA 3D4PA 3WNQA 3UXYA 2ZB8A 4NZ9A 3RKRA 3OICA 4UUMA 3RQSA 1Q7BA 4GVXA 3K2BA 5EIOA 2Y1CA 3ETGA 4H3VA 3UF0A 4CM4B 3HB4X 3EMKA 4I08A 5IF3A 1E7RA 5L4SA 3TFOA 1TLTA 3CZMA 5A5EA 2Z5LA 3OJOA 1E7YA 5L7YA 4MVJI 1OMOA 3ICCA 1DPGA 3HQ4O 4E5NA 4XIYA 5DF1A 4HV4A 4K26A 1HLDA 3F9IA 4J43A 1T1RA 3V5NA 3FPLA 4KUHA 4OXKA 2Q1UA 1D3AA 3B1KA 4YACA 2YZ7A 3VKUA 1DC6A 2CVQA 3GDOA 4XDZA 3AI3A 1XG5A 3CH6A 4DC0A 3H8VA 3QQPA 2W2KB 2X22A 2ET6A 4RDIA 1M66A 2B69A 5C7LO 1ZO8A 4FFRA 2ZK7A 4LRSB 5FI3A 4ALLA 1KVRA 1MX3A 1OC2A 3O8QB 3GMDA 3S2IA 1BVUA 2GZ2A 3ULKA 4MOWA 3PHIA 4LCJA 1ZH8A 2EGHA 4DREA 3NDRA 5G4KB 1I5RA 2WSBA 3TL3A 2ZQZA 2IRWA 1U3WA 1CWUA 3BMQB 5AXAA 5T6BA 3ICPA 2G17A 4I5GA 2C0CA 2RH8A 5I7SA 4Z9XA 4EJ6A 3JQ9C 2VHYA 3PJFA 1GQ2A 1GL3A 2BKAA 2ZB7A 2OZPA 4KZPA 2NACA 3NT5A 3MTJA 1KEWA 4RO0A 1IUKA 2VUTA 4UVIA 3PHGA 3P2OA 4BGVA 4IDDA 1HF3A 2AQHA 4NFSA 3E8XA 3W4KA 3G79A 3QA9A 2PGDA 3VPGA 1HDOA 2Q50A 4FB5A 3OIFA 4BO2A 3BA1A 2RHRA 3JD2A 5IZ4A 4IDAA 3JQFA 3U62A 3OFSA 1BXZA 1KEVA 1DBVO 1NPDA 2HAEA 2V65A 2WDZA 4J9UE 4K28A 5ENVA 3PQDA 5TIIA 2LDXA 4JBHA 4PIVA 1N92A 4JROA 8ADHA 4IGFA 1I33A 5T8KA 3E18A 4C7JA 1H93A 5C7IO 3NAQA 2QRJA 3DDNA 3IUSA 4JBIA 1MA0A 2C7VA 3OECA 1YVEI 4E2XA 1Z6ZA 2GNAA 1FDSA 3CEAA 1FDTA 4AJ1A 3JQ8B 3A1NA 1LLQA 1XWFA 3UICA 2PK3A 2IZ1A 4UEKA 3WGOA 4B3IA 2D2IA 2PD6A 4RF5A 4ROSA 1DOHA 1OOEA 3KZVA 3QLJA 2E37A 1T1SA 3RWBA 4R1TA 4DYDA 3ZV3A 4O1MA 4C4OA 2WE8A 3MJCA 2DFVA 2JD1A 4L4SA 1KY4A 2VZ0A 2GUGA 2HQ1A 4A73A 4LCEA 4NK4A 3GPDG 3IS3A 5F1PA 3MJSA 4BGIA 1LXCA 2GF2A 1VL8A 3CIFA 1C1DB 3KYDA 1Y9EA 3PVZA 3L07A 5EQFA 2D0IA 1LSSA 1AGNA 3LQFA 4UVHA 5KOIA 1QORA 2P9CA 4GSLA 3HJAA 1FDVA 3OP4A 2A35A 2P2SA 5CEEA 3K5PA 5BNIA 3GZNA 3AUUA 1RM0A 4J16A 4J1QA 1O5IA 4AJOA 1VSUA 4BNKA 3ROKA 4PVDA 4A0SA 2X9NA 1WMBA 4HFNA 1MC5A 1A71A 3KRTA 1Y5RA 4PVCA 4NIMA 5CPBA 3KM0A 4O6VA 1NHGA 4HUJA 4YYZA 5U1PA 3MJ4A 4MIYA 3I9JA 3KV3O 3WTCA 1VJ1A 2DBZA 3GC6A 3OIGA 4XX0A 1O8CA 3ZHBA 4NI5A 3RBXA 2HRZA 1RYDA 1DLJA 1MFZA 3GZ4A 3WFJA 4DVJA 3C24A 5AOVA 1KEPA 3B6ZA 2CVOA 1QV7A 1BSVA 3TOXA 4J4BA 4OQZA 1B8PA 1GADO 3E1KA 3ZWYA 3QHAA 2J6IA 4OOFA 1NAIA 4QO8A 2VZ9A 5ICSA 1KS9A 2HMSA 3LZ6A 3PHJA 4NJOA 3O9ZA 1ONOA 3GH3A 1EE9A 1P1FA 5JY6A 2GYYA 3BMOB 3LVFO 4HADA 3V1YA 3DOCA 2BLLA 1ULUA 2G0TA 2J3JA 2J5KA 3U4CA 3IKTA 3L6OO 3LT4A 1DEHA 4CMHA 1EDOA 2P5YA 1MG5A 5JAQA 4FW8A 1E1NA 1GFSA 5JDIA 3GNSA 5AXDA 4Z0TA 1IY8A 3BMCA 2VZ8A 3TZKA 3SC6A 5ITVA 4II2A 3WGTA 1PJLA 3BHIA 1NVGA 1A5ZA 1E1KA 3COSA 4MO2A 1EQUA 2YQ4A 4PZCA 5HBRA 1RKXA 2GN9A 4BQPA 3AM3A 1UDCA 1D1TA 2GZ1A 1IL0A 2EG9A 5EN4A 3IP1A 1I30A 2OXIA 2HSDA 2AG8A 3DOOA 3FNGA 1CEQA 4AICA 1H5QA 1UXKA 2O3TA 4ZRNA 4IQ8A 1OAAA 4ALKA 1PGJA 3V8BA 3LF2A 3CKYA 4DPMA 1UH5A 4TRMA 1LDMA 2PFGA 2UAGA 1ZK3A 2O2YA 3K2EA 3H65A 4M87A 3VPHA 1YRLA 2P68A 2HMTA 2VCYA 4BNYA 5B12A 3UOGA 1V6AA 2Q45A 2B35A 3DOJA 3O03A 1KOLA 1ZUD1 3ZWBA 1LDGA 3SLGA 4BKRA 4ZN6A 1QG6A 1E3SA 3KYCA 4W7IA 5CDTA 3W8FA 2DBQA 4DQXA 3DAFA 1BWSA 2JCVA 1E1LA 2VUUA 4DBVO 3UKOA 4D42A 1I24A 3ENKA 6ADHA 3RCBA 5JCXA 2WYWA 4GVLA 3DFZA 1ML3A 2AW5A 3FNFA 2Y05A 1BW9B 4Y67A 4DIFA 4HFRA 2FR8A 2PZJA 2NU7A 5ENDA 3RUCA 3AW9A 2FHSA 2NVUA 1ZIDA 4RLSA 5KJ6A 1HYEA 4PZEA 1DSSG 2PWZA 1IB6A 1S7CA 5IZCA 1HXHA 1YH3A 1PJ4A 1BMDA 1AN9A 2B5WA 4YT4A 4BQRA 4QUKA 4OJNA 5BR7A 5I8ZA 3QW2A 3W8DA 4GGPA 1I0ZA 3ZNPA 3NJ4A 3NTOA 1ADFA 1R16A 4FBGA 3W1VA 1PJTA 4NK5A 4BIIA 2IEDA 1QLJA 2TMDA 3SJ7A 1RPNA 2VNSA 1DHRA 2FN7A 3JQ9A 2YV2A 3UUWA 1OFGA 4HX5A 4BNWA 4KMSA 5FYDA 2Y1DA 3EGOA 5JO0A 3VTZA 1C1XA 1F8FA 5BT9A 3WLEA 4B7CA 2D8AA 1B7GO 1C0IA 2J5QA 4CV0A 2PH3A 1H6CA 2VOEA 3GEMA 5A9SB 2YYYA 3GT0A 1NTOA 2B4QA 1P1IA 4IIUA 1LRLA 3M2PA 5L7WA 5ILGA 2R00C 1P3DA 1P1KA 3KUXA 4BHTA 2DTEA 3DHNA 4PLFA 5BSHA 3VOSA 1C0PA 3HB5X 3V2HA 3PJDA 2DT5A 3BTOA 3QVOA 1KYQA 3PDUA 5JE8A 4A03A 1I3LA 1HDRA 3JYQA 3AUTA 3EYWA 4N18A 1G0NA 3KETA 4FJ1A 5ER6A 1YWGO 2IEBA 4ZQGA 5EPOA 1EEHA 3RUEA 1G0OA 5B1YA 1YXMA 4KOAA 3WICA 2RHCA 3RC7A 4JJIA 5GZ1A 1LX6A 2NSDA 1KC3A 2FOIA 3WMWA 3PK0A 4LGVA 1N9GB 1OBFO 2P9GA 5AXBA 4PG7A 3H3JA 3BTUA 3GVXA 1SMKA 2YY7A 4TVBA 1U2DA 3N58A 3NGXA 4L8VA 2FR1A 2O3JA 1PJQA 4M49A 3ZWPA 1I2CA 1X1EA 4GX0A 4DPLA 4XQGA 2O3QA 2PZKA 3VH4A 4KTTE 2V6BA 1XU7A 1EMDA 2QW8A 4B3JA 4UULA 4A10A 2CFCA 5CG1A 3TSCA 1LUAA 2B0JA 3H3FA 2NTJA 2VT2A 4INAA 4K6CA 1GCUA 3QVSA 1U9JA 2LDBA 1WWKA 3F47A 1Y6JA 3NYWA 3FF4A 1VC2A 1R6DA 4LRTB 3C7DB 3ZV5A 4QFDA 3ZCXA 5JBIA 4MP8A 3B70A 3PWZA 2XOXA 4W9NC 3FWNA 4MVJD 2I67A 4OKNA 1ZW1A 4XD2A 2P9EA 2Q1SA 5CPFA 5HA5A 5TT1A 2VHVA 2OFPA 4J4HA 5ICMA 1PS9A 1DIRA 1Y8RA 3OBBA 3ZWCA 5C3MA 1JQBA 1X0VA 1KERA 1A27A 1TT5A 8LDHA 5EQDA 3K31A 4CR8A 4FFNA 3HZZA 3JQGA 1PJCA 1ONPA 1ZFNA 5A3JA 1P45A 4PLGA 3AU8A 1V3TA 4R01A 3RUDA 4YJGA 1MXFA 2P4QA 1HZZA 3FCOA 3GHHA 3OF2A 4I9UA 4BS9A 2Z95A 4WOJA 5A5FA 4JNKA 4JXKA 4D0RA 4D7AA 2ZYAA 3DC2A 2EIHA 2QRKA 3R3JA 3VTFA 4FFPA 4G2NA 4H15A 1JKJA 3R3SA 3I23A 1F14A 3WBFA 4BB6A 1HL3A 4QFCA 1YQXA 3A14A 3ETDA 3JD3A 1W8DA 2G1UA 1E3WA 3GNTA 1YJQA 4NBUA 1GCOA 1JVBA 3DZKA 3CMMA 4IDEA 3ROMA 1ADBA 5FF9A 1FDUA 3AOEC 4BO9A 1I32A 4NHEA 4K1LA 1PTJA 5LDHA 1R4MB 3N7UA 1U4SA 1E7WA 4D3SA 4PLWA 2B83A 2FZEA 2YV3A 1G6KA 2CVZA 3VH3A 1WDKA 1H9BA 2Q3EA 3GAZA 1PZGA 3MEQA 2IYPA 4PG6A 4BB5A 2H63A 2HLPA 3FNEA 2UUPA 4E5KA 1R37A 4Y98A 3ZW9A 3VC7A 3W6UA 5BSEA 1ZEMA 2O23A 3L4BC 3GDGA 2Y1OA 4TZTA 3PEFA 1NWHA 4AJLA 4DMLA 3DQPA 5DULA 1PS8A 5KVCA 1Z73A 5TNXA 4ALIA 1W73A 1X14A 1N7HA 3ZWOA 3E82A 1NR1A 2QZ9A 1BRMA 5JAIA 3M2TA 3ZU5A 4Z3DA 5LDGA 3GG9A 3IP3A 4P38A 1IPFA 3OEWA 1Y8QA 4RV9A 2XPCA 1LTHR 2HMWA 1NM5A 3ITKA 4YQZA 4BKQA 4DQUA 5COQA 3KOUA 2PR2A 4IMRA 3IIEA 1GAEO 2NTVA 4Q3EA 4I8XA 1H6AA 3DAPA 2PD4A 2NVBA 4R69A 4XQEA 3GN2A 3FBGA 4IINA 4EITA 4NU5A 1JU9A 2BGLA 1R4NA 4TKMA 4GWKA 4ITUA 4MDHA 1E3EA 3FHLA 2PKRA 1JTVA 3UN1A 4GSKA 2X4GA 1ONNA 3UHAA 1BHSA 2IODA 5A3VA 1ISJA 3KYDB 3ZHYA 3E03A 2NQ8A 4YXFA 1MLDA 3Q0EA 1QYCA 2J3IA 1A4UA 4FR5A 4ND2A 4IDCA 4E5MA 4YRAA 5K6AC 5ILOA 1VKOA 1IOLA 4CM8A 1T2CA 3PYMA 3RJ5A 2GPTA 3RUHA 4ALJA 3NT2A 4DTIA 3U0BA 4GPD1 4PLPA 4G65A 3GAFA 4EJMA 3F4BA 1P44A 3RIHA 3AFNA 1NQOA 2A92A 3HNPA 5BNFA 3TPCA 4M8SA 3UAGA 3M1AA 2TMGA 2PLAA 4XDYA 1Z45A 3L4SO 2JAHA 2Y66A 4R4JA 4XB1A 4ALMA 5IXYA 1HDCA 1A7AA 3E5RA 2PA3A 1Z7BA 2D3TA 3FWZA 5JYDA 4XWYA 1A9YA 4AJHA 3ZWVA 3PLRA 4U7WA 3NV9A 2B37A 4BO8A 3F3SA 4YT2A 3FBTA 2YHIA 3HG7A 1ARZA 4IQ0A 5FEUA 2BFAA 4GAEA 3EDMA 4NBRA 2EERA 4RPLA 4UUNA 2W8ZA 2JHFA 3U09A 4MJLA 1F17A 3NJ8A 2RBEA 2R00A 4GMGA 4WEOA 3RC9A 3FNHA 5T64A 4R68A 1NR7A 4U6QA 3WGGA 2VRCA 5ES3A 3BMCB 4N7RA 2Y68A 3HDHA 4MP3A 3I6IA 2EWMA 3AWDA 1IZ0A 3CE6A 5IJZA 2GASA 3HDYA 3RROA 4CODB 4R5MA 4A5OA 4RF4A 3HFGA 2Y1EA 3PYXA 2OL4A 4ONEA 2ZYGA 4D45A 4ZJUA 1NPYA 4E5YA 1WMAA 3QY9A 1ZJZA 2VRBA 4CM6A 1Z7EA 3LF1A 1A72A 2YDXA 2AE2A 1MP0A 2CSUA 3C8MA 5L95A 3WTBA 1YJ8A 3B1FA 4ZGWA 2SCUA 2E4AA 3A06A 1QYDA 3ASVA 1Y9AA 4OH1A 5H83A 3S1LA 4NPCA 1NFRA 3RC2A 1EFKA 1PU2A 2WMDA 1DIAA 3I5MA 1C14A 1Q7GA 1HTBA 1NQ5A 2X5KO 2VHZA 1YOVA 4XIJA 4WLVA 4XYBA 3K92A 4D3DA 4HXYA 3KYCB 1PGQA 4G81A 1B8UA 3AI1A 3LC2O 1E6EA 2C20A 3P7MA 1X7HA 4KP7A 4O0LA 4RORA 4S1VA 5FI5A 1B3RA 2W98A 3TN7A 5TGDA 1Q2XA 3DBRB 4PLHA 2ZATA 4W9NA 3T4EA 4FFMA 4Y9DA 4C7KA 5T57A 4B4VA 3JYLA 1WP4A 1VRWA 4GLOA 2JFHA 5F1KA 4CMIA 1Y81A 2NVUB 5TT0A 3NUGA 2DQ4A 4NFYA 2WD7B 1J49A 4IQGA 5JCJA 4F6LA 3IL2A 2H9IA 2OO5A 3DBLA 2PGLA 3DWFA 3LK7A 1IZ9A 3FR8A 3VZPA 3JD4A 1Q0QA 5DDIP 1ZSYA 4YA6A 3WGZA 1MUUA 2X9VA 4L75A 3LSYA 3U4IA 3MJVA 4BNFA 1LI4A 4F45A 2PKQO 4OOEA 1YB1A 4BNMA 3AOGA 1BVRA 4YR9A 1DAPA 4UVEA 4YDRA 1DHTA 3MTGA 2GLXA 5CDSA 3IJPA 4J2HA 2WTBA 2I65A 1V3UA 2Z1NA 4YRDA 5B4VA 1M2WA 2I9PA 2Z1MA 4RZIA 3H6KA 4EZBA 3I4FA 3WQQA 2NLOA 1DLIA 3PIIA 5HS6A 1U8XX 1YKFA 3JYOA 3H2ZA 5DCWA 1C1XB 1JDJA 1SOWA 4PLVA 4D0SA 5TJ9A 2VYVA 3AOEA 3S55A 4BO0A 3U9LA 3OETA 4MKRA 5LCXA 1BXGA 1N2SA 2PTGA 2EJWA 5T5QA 3BHMA 1OZAA 2O2SA 1K6IA 3WFIA 4BOYA 3G17A 3D3EA 3WIDA 4EI2A 4OM8A 2YQ5A 4AJ2A 2X0NA 3L4BA 4OSOA 4CV1A 3MOGA 4RPJA 4FD3A 4ZQBA 1AE1A 4EGFA 2B36A 4ZU3A 3HSKA 4MP6A 4AL4A 3EHEA 3ROPA 3MOIA 1ZK4A 1YDEA 3OQBA 2FRDA 4Z9YA 1LU9A 5I9NA 5KVVA 4J7XA 2I3AA 1JLLA 2VYNA 1EDZA 5EESA 1DIHA 3O38A 4YCAA 4IBOA 3MCVA 4DXHA 3OJEA 2HCTA 2NTNA 4PLTA 4XQ9A 2BMAA 2NADA 4ZD6A 1PQWA 3PLNA 1X0XA 3DEYX 4IJWA 4IM7A 4OL9A 3F1KA 1UZMA 4KQWA 3NGLA 2X8LA 4PRKA 1K3TA 2EP5A 5K1SA 3JYNA 3VZSA 3Q2IA 2VWHA 1P0FA 2GR9A 4TRRA 1NNUA 2C59A 4JLWA 2BFMA 1KEUA 2C2XA 2EHDA 3WSVA 4E12A 1ZBQA 3GLQA 3K73O 3MWEB 3RSHA 5A4DA 1EUDA 1NBOA 3ZWWA 3GUYA 1AUPA 2NU9A 3ASUA 4XJSA 2BELA 3LU1A 4IJKA 5K6AA 4AJ4A 3MJEA 1PEDA 3WWYA 3QVXA 3M6IA 3SLKA 3TDKA 4AJNA 1PR3A 3I9OA 2HJRA 1X1TA 4PN3A 5B4TA 4DYVA 4TZKA 5L45A 4IMPA 1Y8RB 5TJHA 4Q3NA 3S2GA 1SBYA 2H1SA 4UEJA 3GVHA 3JQGB 7MDHA 1GYQA 4M55A 5A05A 1U3VA 4L76A 1H6BA 1UXGA 2Y1FA 1EVZA 2I3GA 3WIEA 4J1NA 2GN8A 3W6ZA 3AI2A 1UXJA 2PZLA 4ND3A 4UEOA 4QO7A 3CUKA 4R9SA 2JCXA 4I9NA 1M6WA 4R1NA 1PIWA 1ISGA 4DUPA 2AQ8A 4WCFB 3L77A 2JD2A 3UW3A 3Q9NA 4J0FA 4CQLA 4GMFA 1E3WB 2Y99A 4NNJA 3CMCO 1X15A 3H5RA 5AYVA 5KJ1A 3QIVA 4EYEA 2JFGA 2FSVA 1VJTA 4DIBA 2NM0A 4XYEA 1CRWG 3I52A 1T4BA 4ZRMA 4Z0PA 5KJCA 2DKNA 1RYEA 1V0JA 4FS3A 4DBZA 1A9ZA 4TVOA 4IDFA 1G1AA 3DBVO 3DBHA 4IS3A 4DLAA 1U7HA 1YL6A 4G5HA 3D4NA 3FD8A 2HMUA 1P1RA 4MVJG 2AEMA 1T2DA 3IAHA 5H82A 3JQBC 4B7UA 1I8TA 4JBGA 5T67A 2DBRA 1IULA 2Q2VA 3EVTA 3D3WA 2HMVA 4F46A 2BF7A 4MVJF 4PLCA 3GQVA 3M1LA 5IXSA 4ZQFA 3C1OA 3SC4A 1CERA 4WOKA 3PHLA 5CDUA 5DBIA 1B26A 1Y8QB 4JQCA 1HRDA 2ZCUA 4KUEA 1SEVA 3GMSA 3WGQA 1YS4A 3ZNOA 1NX6A 4RGBA 2C5AA 1OI7A 3DFUA 3E48A 3QWFA 4YJFA 4J1SA 1WLYA 4JP2A 4AJPA 9LDTA 1ZKMA 5JXWA 2AQIA 3TZCA 2NQTA 2NU6A 4XA8A 2NV6A 1E3LA 3HWRA 2Q4BA 3NDJA 1GEGA 4RVSA 4BUCA 1A7KA 3F4LA 5CHEA 3ANMA 4CL8A 4E13A 1EQ2A 4WUVA 2VTEA 2VNAA 5I9MA 1DXYA 3G1TA 4IIVA 1V35A 3GGGA 4L73A 5C37A 3JCZA 1XYGA 3MJTA 2O48X 1AHHA 1LDBA 4BMNA 1VL6A 3ADPA 2FWMX 3GEGA 1MC4A 1H2HA 3FPCA 4BNNA 4GL4A 4YT8A 1KC1A 1EVYA 1VE9A 4CQMB 4BV8A 3OQ1A 4JN6B 1SC6A 1IPEA 1LDNA 1XHLA 1B0AA 2X9GA 4NBVA 4B4UA 1DRUA 3RBVA 1XSEA 4LSWA 5CG2A 3PQEA 3QVTA 4WK6A 1GDHA 3RVDA 2R2GA 4R3WA 4XR4A 4K9DA 3DZFA 3ENNA 3K30A 1H9AA 2GN4A 2J5RA 2YFHA 3GRPA 4MIOA 4NDNE 4W6ZA 1QV6A 2X0IA 4TRNA 1UXIA 6LDHA 4XJTA 4E2ZA 4K6FA 4OO3A 3GRKA 3LT2A 3PPIA 5U9CA
chains in the Genus database with same CATH superfamily
3NTLA 3N07A 2FPKA 4G97A 4QRIA 1K63A 1LLUA 5HUQA 1M6YA 4BYMA 1M74A 4H08A 1W8IA 4KPEC 3L6BA 1AXEA 3MC1A 3NHPA 2D8MA 4C05A 5EIXA 1JT2A 2NSHA 4HOYA 4NBTA 1ZAKA 1Z18A 2BMJA 2G25A 4IDHA 3RBAA 2JHGA 3WMRA 2B25A 4Z6KA 5HSGA 4CR6A 1BOOA 2BD0A 4IIHA 3EBOA 2FDRA 4CPDA 1KPHA 1YI8A 4QDUA 4TWZA 5LIPA 3KUKA 2PV7A 2ZIGA 3ABSB 2N1BA 3A6PC 2HWUA 1JHOA 1OLUA 3OIYA 2W2NA 3GEHA 4X7BA 3QVJA 2IV7A 1NC3A 2GXSA 4EVQA 1QP4A 2Q6OA 1QX4A 2XMSA 3LOUA 4TL6A 3UCEA 4DMUB 3KZMA 5BQFA 5CJ2A 4ZYXA 1KGSA 3QK7A 1KKUA 4G1UC 5K0ZA 4YCMA 2RB4A 2VHEA 3C8DA 3UWDA 3CEHA 5F7XA 2F64A 4PX9A 1NXWA 1Y3BE 2OM6A 3R09A 4GNKA 5G4LA 1D2GA 4Q7QA 1G2QA 3S2EA 1N3YA 2RCNA 3TS1A 4K0KB 3RAFC 2CHFA 2O1WA 4ND7A 3OLXA 4WBSA 5MDHA 1MJ5A 1OX4A 3EW7A 4FCVA 2NO5A 2WIAA 2Z56A 2ZWMA 3B8EA 4HGRA 3T61A 3RAJA 4P81A 4ZCPA 4JC5A 3HKBB 3W5HA 4CMGA 2M6RA 2VXYA 1W7AA 4LIPD 5IMSA 1CUGA 4COOA 4W4TA 3E9QA 1QE5A 4DEVA 2GO1A 1VE5A 2F00A 2JKZA 3HLYA 2IWHA 5D3QA 3EQ6A 1ZM7A 1VHQA 2NZWA 2ZJFA 4JEHA 3OHSX 4LY6A 2JPDA 1V43A 1N2ZA 1D7AA 1EB9A 1W48A 1BH6A 4JWTA 4C0WA 3TQQA 3KJQA 1B93A 4G1VA 5C0OE 1MX5A 3VKHA 2VT3A 1IN7A 2GGSA 1W36C 3GF4A 3WKCA 4BO6A 1CUVA 4WBXC 1OIXA 4WT7A 2M9MA 3W8EA 3UMJA 2D13A 4IIFA 1HDEA 2QXYA 3TKAA 2WB2A 4M98A 2POQX 2Q5QA 3E5MA 5FOWA 2JJYA 4RPHA 3P94A 1R0ZA 1ZH6A 2QL5A 1TPYA 4WASA 2PO5A 2YWDA 2PNFA 1Y9JA 3DE6X 2PMKA 2ZRKA 2OLJA 1Q1NA 4UEQA 3Q1KA 4KHZA 3FR7A 4LW8A 4MQ6A 4W6QA 4ALNA 1OXXK 1R88A 1ZW6A 2KBFA 1XTQA 4FJ0A 1REQA 3GHYA 3UV3A 5I8WA 2NUTB 4A0HA 5K5EA 3SHOA 2FVYA 1W88B 5FBWB 3QVWA 2L69A 3LHIA 3CTMA 1GKLA 2D5IA 3H2SA 4GQAA 1NATA 2A9OA 4RMJA 4KQKA 1PR2A 2JFYA 1NVVR 5EWLB 4F06A 5F77A 3RYCA 3PEUA 1WB5A 4IJ5A 3DBLB 4E5SA 3O9MA 3OO0A 1H8HA 1Z38A 3H9EO 3LTEA 5AQ1A 1QK4A 2DHRA 4IKOA 4CLOA 5JNTA 3CVXA 4BVHA 1PL7A 3IHTA 4FC7A 2RJOA 3I45A 3O7MA 5F7ZA 4DY4A 2K6GA 5JY1A 5LKRA 1VLLA 1N5DA 4QSMA 3D4OA 1H69A 1TU4A 1JPNA 1JV2B 2J46A 1NOIA 4IGEA 3EVAA 1A50B 1DOAA 1E7MA 1F2TA 2CV2A 2UYQA 2C07A 3W5JA 1GT6A 1F0YA 3KKPA 1NN1A 2IPXA 4P5PA 3VMMA 5FX2A 4MW4A 3WG9A 5CFQA 2OPBA 1OVMA 2WFLB 1HL7A 2FW0A 2Q5HA 3HE3A 3KJFA 1JPVA 3IDSA 4J91A 2SICE 2ZPTX 3D4IA 3AVOA 2V5VA 3OSZA 1HORA 5F3DA 2CDBA 3N7AA 2I4OA 4YB8A 1JZQA 1Y9DA 3MZ0A 4QOGA 5TE9A 3CX4A 2ILTA 3AF4A 3AEXA 3Q11A 3UB2A 1OB2A 1KP2A 4B6QA 1IJFA 1OC4A 4MVJA 2RIPA 3IPXA 4C6SA 3CZAA 5JMTA 2FXVA 1ODCA 3WYCA 2QG4A 2ZYWX 4N6GA 4J2OA 3GEBA 4M53A 1QFYA 1MB0A 4RCVA 4F4JA 1UP7A 1EDBA 3LUDA 4FE3A 3INTA 1JFVA 3IVCA 4BEWA 3T52A 4DQDA 2VP5A 2V3WA 2GEDA 3EQ2A 2PQ6A 5CB4F 2BWJA 5DYTA 3NYQA 5KNDH 4B4WA 1QVRA 3PQ4A 3C1AA 4UPDA 2FNAA 5HE8A 2G1AA 4RDCA 1CZOA 1NYTA 4JBWA 2M6LA 4M6WB 2WBLC 1IG3A 2YXPX 3VYRB 3AILA 5KX5A 4B7XA 3BXPA 5FKJA 3UZUA 2UKDA 1LLCA 2D2XA 6Q21A 1EZ4A 4N39A 5FBQB 3H5WA 1GLGA 3RU7A 2I3BA 4I4TB 1L5ZA 3V8PA 1U6JA 2VG8A 3JSAA 2V8BA 5BR1A 3NLLA 4Y6OA 1MBZA 3BMNA 1G64A 4UE2A 2G5CA 4IHJB 4KIUA 1VKNA 3K9CA 1Y1TA 3WSWA 1X70A 3QKUA 4WOBA 1UK6A 4UFNA 2X0JA 3BCHA 5EPUA 4N7JA 3A31A 3WLOA 3NDBB 1SXGA 3AUKA 4NJMA 1EE1A 2DLDA 4GEKA 5K05A 5GIOE 5DP2A 1G63A 1LY1A 2FGKA 2WJGA 3D7SA 2FG5A 4WL0A 3CEPB 4JX9A 1DCTA 4EJ2A 5DGTA 1CUCA 1ZUNB 4MS1A 2HV8A 4G1EB 1Y6ZA 4G86A 3BG5A 1TU3A 1PZEA 2C83A 2CXXA 2RAPA 1B2LA 2X7XA 2PBFA 4JI6B 3TR5A 3NANA 4OKIA 3CXUA 4JSTA 3KXIA 5J23A 4I9HA 5CFPA 5HIAA 1JJIA 1PQYA 3HXMA 5KSYA 2FLWA 2FPOA 2QLNA 4XPZA 2H18A 2VDKB 3OIWA 4QNMA 4FM9A 2FQWA 5D6NA 1D2RA 2NUPB 3HXTA 3PTLA 4MIEA 2NU9B 4PINA 4QJ3A 4B3HA 3ZDAA 5K3FA 2HBQA 5F5XA 1S96A 2R1UA 4BFSA 2IF0A 1I4DD 3DBOB 1E5LA 4UMFA 1O0BA 1EA7A 2Q46A 4MR7B 1S3FA 1WM1A 2H51A 3I0NA 4MVJM 3N0WA 1R0KA 5HBGA 1JIUA 1V5FA 1ZCJA 3G2NA 5IX8A 1O1YA 4X65B 4YRKA 3B38A 5KTOA 4KFTA 1NVTA 3DLIA 4R1QA 4W5QA 3EUAA 4RKRA 2O50A 1D07A 2UYOA 4ZC8A 3V1LA 4U9UA 4AXBA 1YJBA 1M54A 4AMVA 3V46A 1YDHA 2WSLA 2ZCJA 5K03A 1UJCA 1OX5A 5SYNA 3VUEA 3W4IA 5AKXA 2V0GA 1K5HA 3KWMA 4GXQA 4BVFA 2V6IA 4CTNA 1BW9A 2DCUA 2CNDA 4MGEA 1N1DA 1YVDA 4BNLA 4Q5IA 1N7IA 3PE3A 1J06A 3SHWA 3RT7A 1SZCA 4IIYA 3ZPXA 2XKJE 1N8KA 2ZAMA 3DV2A 4UM9D 1D4OA 1RTTA 2BCEA 2FFRA 1FTYA 2PGJA 3ZE9A 3C3AA 3IQDB 3VKWA 4DUYB 2B82A 2X5NA 1T2EA 1UZNA 1JHDA 5FV7A 4JAVC 1T6ZA 4H3HB 3UJ9A 3LOQA 1SU6A 2D4AA 1ORHA 1TI7A 4S2EA 1ZGJA 4PZDA 2B7CA 5C34B 3W9YA 3X43A 4YV0A 4MUGA 4XUCA 1DQNA 1QG0A 3CF4A 1ANKA 4TUYA 2Z6AA 3ZZUA 4P22A 1DAOA 2YZKA 1YQDA 3EFOA 3M6AA 3AJ9A 2OGUA 4XGNA 4DZZA 3K71B 2HUNA 4HDKB 2VATA 4TKUA 1QQ7A 1CR2A 3FCUB 3JTMA 4UVGA 2GXUA 2PH5A 1FPMA 2JCGA 3R74A 4ZVVA 3BL6A 2P65A 5ALIA 3Q8WA 1BDJA 4V0SA 1A8HA 1KETA 3VR0A 1JR3A 4H7IA 1BD3A 1C7JA 1NUHA 2QOEA 4X97A 4OMCA 5CP8A 3HY3A 1HMYA 3IEPA 1H4QA 1XV5A 1FFCA 3DE0X 4CMEC 4MTCA 1CP3A 4UBOA 1TUEA 4GWGA 3PJRA 4LG1A 1HUQA 3M4YA 3D6HA 3O1LA 1RQLA 1YS2X 3GH1A 3H2IA 4RD3A 2XWSA 4CTKA 1KEZA 3N87A 4MR8B 3PRKE 5KZMB 4PYLA 1SIUA 4YRGA 1UZUA 3PGJA 1GA4A 5EZ5A 3N3BC 2RG1A 5J43A 4M2LA 1MB2A 1NDHA 2AXQA 4UJ5A 3UK2A 2CL6X 4DV3B 1JFSA 1XA4A 1H3NA 2Z3VA 3IMFA 3TGWA 2FFBA 4CR7A 1AXGA 2XAUA 1NPTO 3UH0A 2E18A 1NP3A 2Q62A 1PEAA 2QVCA 4NTZA 2QQ0A 4O3FA 2WJHA 5I3CA 3ICVA 2FDXA 3FCSB 3I9LA 3QE2A 1WZ2A 3L5OA 5IEJA 1LPAB 1GPDG 1WNTA 1N57A 3NPAA 2WUEA 1V47A 1GKIA 3U60B 1QVVA 4OGWA 2AN9A 2PFKA 3UMYA 3DTYA 4BBPA 1R6AA 4QBHA 3HWX1 4N5IX 4HN9A 1E20A 3VPSA 1UF9A 3DD1A 5AJZA 3CW2A 4D41A 4L9RA 4F1WA 1EFLA 5K8IA 4B71A 2JGDA 1X1DA 4P7BA 3JQRA 4BNXA 4C0QC 3DZ8A 4CVNA 3JV7A 1V8BA 1VIDA 5BN3A 4LV6A 2YJZA 4FFDA 5G3ZA 2JKVA 3ORFA 4PG5A 3VC3A 3PQCA 4AQDA 4TTAA 2NXJA 3WNBA 4BJ3A 4YP7A 4C03A 3W5DA 4E33A 5KHLB 3DWIA 4S24A 1GHTA 4IEEA 1UJNA 4HJRA 5FWDA 1A69A 3A37A 1BRTA 3CPSA 2FA9A 1I3MA 1T2NA 2WAYA 4K9NA 4OLJA 3RNOA 3B5IA 3DZGA 4BZWA 5HW0A 4B4KA 3QPAA 5DCUA 3EDRA 1Z16A 1R12A 4M7RA 2PXXA 2TECE 3NEPX 5CYOA 5PGMA 4NENA 3TLAA 3M1YA 4C5CA 4ILEA 2O6LA 4RH1A 4RLFA 4DS3A 5ICCA 1RRCA 3DZHA 5JW6A 1FDWA 2EX1A 2YNMD 3L0SA 2IEGA 1NVAA 2GI4A 2FE4A 3QKIA 3C16C 3O2QB 1LJUA 4OA8A 2EW8A 3DLHA 3L82B 2DBVO 3TCXB 5JQGF 2C9BA 3DL0A 3T15A 4IW3B 4MYTA 4RHXA 2WJJA 3H11B 2EZUA 5DGXA 1P7VA 4EHKA 1NSFA 5KNLA 1JFFB 2DYKA 3UGQA 3PICA 1SCUA 4RD4A 3KQPA 2CFIA 4WZAA 2JAXA 5D3KA 5IWAB 2I6FA 1BKSB 3P97A 5ILQA 1NNSA 1L9KA 3SC3A 5A04A 2XGMA 4WJLA 2JZNA 2ECPA 3CXRA 1D0SA 1SO8A 2BVNA 3LT0A 1YL5A 1YC5A 4FOOA 3UFXA 1P9OA 1WBJB 2UUOA 4OGKA 4TRJA 4AYXA 2I5PO 4GUDA 5DGIA 4MVJE 2C5HA 2P91A 3I73A 4UMEA 4K3VA 3D6JA 3L0BA 2WSSD 4MB6A 3T12A 3TQRA 2YIDA 1GTRA 2JRCA 1M73E 4MWOA 5AWFC 2VYND 3K96A 2FPPA 2WHPA 1QIDA 2G4LA 2P27A 3BDIA 3D6FA 3FDJA 4LI3X 4ZVSA 3KKMA 2CNKA 4E31A 4EH1A 1GGJA 4I3GA 4C22A 3QX3A 2UVDA 1Q0LA 2HQBA 2JGKA 3H2JA 2XMBA 3EN0A 3II6X 3QUBA 5AXCA 4CFSA 1QHSA 3K1TA 3UAWA 4L85A 3SE7A 4QT4A 1PJBA 2HNKA 1J23A 1B2RA 4L7VA 5B55A 4MNTA 4Q6BA 5B6IA 3PIDA 4LBZA 1RAGA 1WQ4A 1ML4A 1TM4E 4JKIA 1EDDA 3EY4A 3GVIA 2IV2X 2W70A 1LQUA 3KKNA 4Q4AA 2XJ9A 1VB5A 4NFHA 4UHJA 3GVPA 3QM1A 4DWWA 2V6MA 4AZ0A 3B9BA 1QAQA 5IABA 1LK7A 2WZCA 3CUTA 4OI0A 4EY5A 3VYUB 1ONBA 1QHHB 1VL0A 1ODKA 4BTVA 1L5HA 2ZE8A 2XNDA 2PYIA 3V48A 3C3XA 1IUPA 4ZMSA 2ZSDA 2XSZA 3WGIA 1GZ3A 1T8YA 4QIHA 2O7SA 1DKRA 3ZY2A 1Q19A 5T6MA 4Q39A 3H5TA 3N2ZB 5ED4A 3B9PA 2QK4A 4L0MA 4OJYA 2IDZA 3QF4B 5EIAA 2B4RO 1TGYA 4KDFA 5I3ZA 1EESA 4ZO9A 1SU8A 2NGRA 2PJRA 2O2JA 2BHRA 3B3AA 1NMYA 2HMYB 3RLIA 4H2DA 1ELOA 4JLVA 3D0RA 5ER9A 5HOQA 1RWKA 4EL0A 3JQAB 3V6MA 2Z3ZA 4O4LA 5TPZA 1C1YA 3DUFA 1SCAA 3ZCUA 4U7JA 2ORED 1BQ4A 1G55A 3KR0A 3OTGA 4IUYA 3LX4A 4TPKA 3PV0A 2HKIA 4LOAA 4H7EA 4HO1X 2W2PA 1Q0ZA 2WYUA 2XYGA 3KPYA 4LRUA 5GONB 1U3TA 5AVVA 1ISMA 3NTQA 2PJZA 1JR4A 3PS9A 1KZHA 2YTZA 4URFA 1NXPA 3CZ5A 3HBFA 2VQFB 4MVJP 1Z75A 2XYQA 4F2WA 4RTPA 1NSTA 1KI9A 4Z8XA 3D6TB 3QITA 3F0TA 3P2YA 1U7PA 3ORRA 7YASA 5E6RB 3ROEA 4QTZA 4BMPB 4JV5B 1C5KA 1DJQA 3EVEA 2BUAA 2HK6A 1KVQA 1WTAA 1WKVA 1J70A 1ISFA 1XA0A 3NOXA 1M34A 2VJDA 1MA3A 1OIWA 2FZGA 2O3SA 4Y7DA 4YJGB 2WQZA 3KEGA 4LHWA 4O2AB 3H9QA 3V8NA 2OCXA 3N2KB 4IG9A 4PS1A 1IQPA 5LD2B 3ZU4A 3F98A 4CHTA 3U37A 4X85A 2C29D 2EFYA 3BTSA 4L5AA 4QFMA 3OTOB 1DELA 1QP8A 3U4DA 1RZ3A 1J5PA 4A0QA 2FGJA 3PPXA 4E1AA 3TUJC 3GCXA 4EGJA 4H17A 2A9KA 2QL7A 2ONCA 4HH0A 3KLPX 4A2CA 4FX2A 4E30A 1GUAA 5KOHA 4UU7A 4GMHA 2C4VA 1HNWB 4WZ6A 4YAIA 4AY6A 4M1OA 1E3TA 1Z15A 2QY6A 5JC1A 2HIMA 3R7WB 2NZXA 5LXTB 4NHOA 3ANYB 2RGNC 4CQJA 5ADHA 2PX8A 4S3MA 3LDGA 1WV1A 1BDHA 3I3OA 3VSEA 4J0DA 4Q3CA 4RSHA 4CMEA 1SZDA 1G8SA 1SBIA 2R66A 3A10A 4XCQA 5CFOA 1TA0A 1TK9A 3TLJA 1JR3E 3TTTA 3ER6A 1PR9A 4D43A 5JHGB 5LOVF 3EH2A 5AVWA 3TG8A 5KYWA 3AHHA 4NQZA 3STYA 2IK8A 5FFMA 3VKGA 1EBFA 4P80A 5F9MA 3CZPA 4WNCA 5DI3B 2P8SA 1MW9X 2A84A 1Z3CA 2WF7A 2QTLA 4UOQA 3MAAC 3ZHUA 2HPVA 2ZVPX 1Z4IA 3AM5A 5HNKA 5ALGA 1VSTA 3KT3A 4H0CA 3EPHA 2IYZA 3ZGYA 3U4QA 3I61A 4O2LA 2H54A 2DVMA 2IDJA 4PS0A 4BQFA 3DV9A 4IUDS 1MOPA 2FSSA 3TJZA 1JI0A 2KYRA 4WKCA 2JARA 4U7FA 1T13A 4ZZ2A 1WLSA 2V5AA 5J5AA 3RS5A 3ZZNA 3UKJA 4BFLA 1I3KA 1F8GA 3LUJA 4D9JA 1WSWA 3P8ZA 4C3VA 5DNCA 3F46A 1Z5NA 1T9CA 1EGHA 1H1DA 2AUTA 4YDHB 2XUDA 3WLFA 3K32A 4W5HA 2XZLA 3KJEA 4AS1A 3NVDA 4W7HA 3R5JA 2GN6A 2VBIA 1R4NB 2IHKA 1J9ZA 1KBOA 2Q6LA 4FZ3A 1DX9A 1Q7CA 1OBHA 3Q12A 5D86A 3R0JA 3W5UA 3ZKWA 2MSEB 4LF6B 1V5WA 3S28A 4AO8A 1TFRA 4J07A 4OXXA 2YOHA 5BUCA 3WK4A 4CUKA 1W5FA 2ZSAA 5K3BA 5BMVA 3PPWA 3GI1A 4M1SA 4QPNA 5ERYA 1VB3A 2C88A 2JIZA 1XJWA 4G8BA 5AW2A 4B82A 2QNRA 2XYVA 1RABA 1WZEA 2COKA 4ZI7F 1N36B 5JFOA 3KOOA 3KZ1E 4LYAA 1QVAA 4RD2A 1L7EA 3AKEA 1UWVA 2JGJA 2MINA 4QDKA 3A28A 4I46A 1I7NA 4P54A 2JAWA 4MWZA 5G0VA 4G4IA 1RPZA 2QENA 5FORA 4CLHA 3LXUX 1T6YA 2XF8A 3WGMA 3GJ3A 3N8KA 1KAGA 4MQEB 3ZQ6A 5EJ6A 2BR5A 2H2DA 5F5NA 1ORVA 4MWBA 4RPCA 2H4YA 3ZCQA 3GEPA 5DBFA 4GXRA 3MOSA 2VWGA 4F12A 2EKPA 5B1SA 3UATA 3HB9A 3RVNA 1QVWA 2GSDA 3A1FA 1QFZA 3HJHA 4FDVA 4EPTA 1OASA 1XMJA 2A7QA 2Y9PB 1GSIA 3FCYA 1CUSA 3UWKA 2TMKA 2FF7A 1XFDA 5LLSA 2YRWA 5BOVA 5LN1A 1HWYA 1A4XA 4PANA 2HXGA 3FKJA 4AJEA 4UTRA 4O5OA 1UK7A 1SKUA 2Q4RA 1MEOA 2FOXA 1U28C 4BLWA 3Q3IA 3D1JA 5F51A 3C3YA 2QE7A 1C9JA 1MO6A 1G21B 2NSYA 3ZGXA 2C4UA 1JFTA 1Q77A 2X0RA 3M70A 3I1YA 4DADA 4MROA 3VZRA 1OA1A 2NSJA 3KR2A 1USVA 4P34A 5IDXA 4X62B 4ESVA 1P1HA 2CLSA 3HU1A 4JT4A 4YREA 3GJ8A 4DA7A 1ENZA 2BKLA 2WOJA 3BJEA 4Q0MA 4WZAE 1Q2UA 3DHYA 3MWJA 1R8YA 1LJ8A 2ZIAA 1CJCA 2CD7A 5J40A 1NMZA 3DB2A 4AAYA 1Z2DA 1FZTA 4BJ6A 1Q14A 1K89A 2IDKA 2A0KA 3FH0A 5BUSA 2A9FA 1M67A 1PWZA 4L5CA 1XJ5A 1VHTA 1ZGAA 3O3MB 1LLDA 1EWVA 1WPQA 1GTVA 3UK1A 4XRGA 3AQ4A 1J7JA 4G41A 3RK0A 4N12A 4OFXA 4V0OA 3RD5A 3VR4A 4XDHA 4KOEC 3PJGA 4YWJA 1HDIA 3LY7A 1J42A 1ENPA 3GEEA 4RACA 2RD2A 2DPMA 1LPPA 3E2IA 4BLOA 1XEAA 5CAEA 1LS6A 3TM5A 3K70B 4D1YA 5GJBA 1O96B 3DYIA 4RKYA 4BRZA 4GKKB 3W3ZB 1RWVA 3V3TA 1RDFA 4Q4LA 1U04A 2JEZA 3G85A 4DEYA 1V2HE 1X3LA 1SFRA 1M1YB 4RQUA 3RSZA 4F4CA 1YJXA 3K6KA 4JLKA 1Y7TA 2QHXA 2G72A 1XZAA 4ILKA 5CH8A 3VO2A 1L7DA 2QNIA 4DAEA 3U5ZB 3TD6A 3SFZA 3QOWA 4MW1A 1ESCA 3PZRA 4RLHA 2ZG6A 4EB0A 2QTNA 1V5EA 3DVAB 4JFRA 3TZHA 9LDBA 1S1CA 4V1CA 4JLDA 1L5VA 4L9WA 5IEBA 2XJ4A 1KE1A 3Q7EA 1M6VB 2XZTA 5ALZA 1XZIA 4F3NA 5LMUB 1DG3A 4J90A 3V1UA 1Q5PA 4PGMA 1N2OA 1YAHA 3K0FA 4L8YA 4RSMA 4TT3D 5D3MB 4DA0A 4FOSA 1XP8A 4E4YA 4I19A 4N3BA 4JVOA 3V4LA 3VFDA 4J0EA 1SUIA 5EA2A 1QRTA 4CLRB 4M1WA 3R9KA 3F1LA 3ZWXA 4WN3A 2FEKA 1UDBA 3PFCA 1E2IA 2BZ1A 1KI8A 3BKWA 1AV7A 1H8HD 1UT5A 3H83A 3N8GA 1W5EA 1DT5A 1HOTA 1NU6A 5JSKA 1PD1A 3TTYA 3UJCA 3NM4A 1P5HA 2HDNB 3UQYS 5IN4A 3GUCA 3T06B 5FWNA 1E32A 3U40A 4KEAA 4DDVA 5EFZA 4C7MA 1J99A 4BWYA 1DB3A 1B6GA 2R1VA 4HWOA 4UTNA 2IQIA 2H52A 3LD9A 3ONEA 4DSUA 5L8VA 1KJQA 1SHKA 4E03A 5KYYA 5KUTA 2YWEA 5AICA 4RTMA 1ZJJA 3BRCA 1H9CA 4E2WA 5JC8A 1H2YA 2R8XA 3VNBA 2OXCA 5L3ZA 2JIDA 2WTMA 2ETXA 1PT9A 3LXXA 3LT1A 4JR0A 4WCDA 3UJPA 5I4IA 3NHWA 3C85A 3N5KA 1JHRA 4Q15A 4YCBA 5I9BA 2ZS9A 1C9NA 1WCXA 1S4MA 3SQOA 5AMXA 5B4UA 2AJBA 1H2WA 3AZQA 3L9WA 2R6R1 3N8HA 1YTLA 2UXDB 1M6EX 1M34E 1DC5A 1MR3F 1X7DA 3NHSA 3I2JA 4IH1A 5EVCA 1GNQA 5FBRB 2W6NA 5LR6A 4S2UA 5F78A 2W37A 4EARA 3R5XA 3Q2KA 1A7UA 4XYMA 1ESNA 2JCYA 3PNKA 4RIHA 1SPXA 3JQ6A 4YP1A 3QVLA 3VNUA 3IA7A 2ZUFA 3KV1A 5EWMB 1P31A 1UM8A 3GLIB 4IVRA 1P2TA 2V3CC 1MQ9A 2D1YA 3L92A 4DCNA 3DONA 4MKXA 2QU8A 3TSAA 3WNVA 3GFTA 2FFAA 4XQ0A 4M37A 5BN5A 2Q0SA 3AVTA 2EJTA 1EDEA 1TYBE 2QTHA 4RQBA 5DCYA 9GPBA 4CL3A 1PL8A 3CCBA 1UANA 1USIA 2AJCA 3I34X 1TZMA 4REMA 1OWLA 2H29A 5DBOA 5F1YA 1QR6A 2AHRA 5JVDA 2Y77A 4PYNA 1PS0A 2WINI 1XRMA 3FI0A 4WN9B 2NO7A 1PR4A 5T41A 5JWOA 5JBNA 2P9ZA 1IYZA 3H5NA 5B58C 1H0HA 1R9NA 1SKYE 3PQFA 3TR6A 3X0DA 3ZY3A 5DNDA 4BMDA 3P5BA 3SZ3A 5BSRA 4OAOA 2DZDA 5CJPA 3WLLA 2C92A 3SF8A 2OUKA 2R44A 4N82A 4NATA 1RI2A 1B8VA 3NRJA 3QE0A 3LBNA 5EC8A 1CQIA 2GH1A 2D5AA 9ATCA 3ADBA 2A9VA 3OFVA 1DAFA 1YZGA 3V8VA 3WLTA 2PY6A 4H6VA 2ZETA 1SUDA 2IPMA 2N0SA 3DF9A 1WIWA 2VPWA 3P9SA 4FYKA 2GQ0A 2G5PA 4Y6SA 3UTDA 4D46A 2QGZA 1ZCBA 3L46A 5D5PA 1Z83A 4F91B 1Y48E 1MVLA 1U5CA 2WHRA 2PMBA 1F20A 4LY9A 4PICA 1FYWA 3PEYA 2OBYA 5CDGA 2AKEA 3A9WA 4X6YA 1P5FA 4H77A 2HTEA 3EK2A 3W4JA 1FP7A 3KHKA 3DEHA 4CHGA 5T8KC 4CU5A 4BXOA 1DWUA 3GFQA 1CUXA 3LUHA 4ZQHA 1BAPA 5FPYA 3SIWA 1JEYB 2Q2OA 1TA4A 1LBIA 3LVQE 2NQ2C 3PQ6A 1EVQA 4B7AA 2ATEA 1ZJYA 5JNSA 1VP3A 2HSGA 3DZCA 1NXTA 3GELA 3CC8A 4HEA1 4LXYA 4MI6A 2IXAA 5F1OA 3WLJA 2PUEA 3M6WA 3P71T 2PH7A 3AR6A 5EMHA 1KMNA 2HYIC 1JHAA 3IXQA 1JQLB 2PX4A 2VF5X 3DFIA 3LZCA 4LQLA 1LRJA 4MWEA 4OMUA 3QNWA 4OVKA 1NBHA 3FUVA 3GAMA 4G67A 5ALKA 5LU8A 2ZU0C 2GDJA 4A2WA 5DTMA 1W30A 3CFYA 2NUAA 2QP9X 1EE2A 1FK8A 3E53A 2Q7OE 3TNLA 2WPNA 3NXKA 3PD0A 5EKSA 1C0LA 2VJCA 1R6UA 5IVPA 1VG1A 1XZJA 3GXOA 1MX1A 3IT1A 4J3FA 1J0EA 1JA1A 2XUAA 3KVNA 2QRGA 3BXXA 4JCCA 2OV1A 3MB5A 4IHJF 2Q8NA 4D3XA 2XDYA 5DZSA 1QYRA 4FW9A 3LA8A 3GFRA 2I99A 3PP8A 4RIFA 2PKXA 1NBEA 2R6DA 1U1EA 3QFCA 1XB2A 3QKWA 4X3OA 4XCVA 5FOSA 3RSSA 4JVMA 3NH6A 3STHA 2DFLA 3ZOZA 4CMAA 4U0KA 1TVMA 1P60A 2FUG6 3HKEA 3DEJA 1PZXA 4IZHA 4GE0A 5C1PA 1TMKA 2YV4A 4C4RA 3CX8A 3GUUA 4DMMA 5KYUB 4ESOA 5ALYA 1GTMA 2D74A 2P2DA 3F9RA 2V97A 2C2BA 1U28A 3IAEA 1SXHA 7ADHA 3ZTTA 4BNTA 3I92A 3NDIA 1P6UA 3LKVA 1JR3D 2B92A 3QUTA 4GO1A 5B57C 2O8DA 3MRSA 3VHRA 3NORA 1J8VA 4C4SA 5IHPA 2EP7A 4ZEMA 5A02A 5HIJA 1KP3A 1UPCA 1OV6A 1EK6A 1WZNA 2V7WA 5I5GA 3H9UA 1AMUA 4NBNA 2BTEA 1P0IA 1XPOA 1NE7A 3NP9A 5C8YA 4AECA 1SULA 4INOA 3SM9A 3PEEA 4Q7EA 2F55A 3ZWMA 4S04A 2J5XA 1ECGA 2QAJA 2YFYA 3OX2A 5E6UB 1MX9A 5ALOA 1F9AA 3D3NA 4I1YA 4B83A 4CT0A 1NVVQ 2PGNA 4MS4B 4UCQA 5TR9A 2JFWA 4YJ3A 2AI2A 4LJ9A 1NASA 3VU1A 1E1CA 1R8XA 1AGXA 5TS3A 4LSMA 4BDTA 1UBEA 3LPAA 4YJHA 2ZSJA 3B2NA 3LDAA 5KPJA 2DH6A 2V7XA 3I9KA 1K2WA 4JGIA 1QS0B 3TAXA 2NO4A 4CM3A 5BV2P 1ZVJA 3QJ5A 2VI5A 4B5LA 2QN3A 4IOLA 5JDCA 2Y4OA 3W06A 3WMXA 4NNPA 4BP3A 2OZKA 4PRZA 1IE3A 5U4QA 2DCMA 2B8EA 2I66A 3MCAA 5REQA 4BPBA 3OE4A 1EU1A 2P9YA 4IR7A 4PO3X 3GLUA 3PFFA 5IUNC 1CHDA 2HFJA 1VTKA 4IWXA 5A3QA 4N41A 4RTNA 1UUFA 4JJFA 4TZ0A 1XDWA 2HIHA 2PS0A 3D3WB 3ILHA 3QWAA 3TOZA 1E1YA 5BYBA 3TF5A 4L72A 1FFXA 3RRMA 3GGPA 2X58A 4WX2B 1DBWA 1RC1A 3IUJA 4QGGA 2PUWA 3G7UA 5D85A 3VXKA 4YP6A 2Q27A 4NMHA 4X1OA 3UMVA 2OY0A 3N0XA 2IUEA 1V1RB 2O3UA 3U39A 1CRLA 5FTNA 1I2AA 1QYXA 4HH3C 3RK4A 4C2TA 1JG4A 5BSFA 1EVJA 4DNQA 3FYUB 2XIQA 2JDIA 3SHVA 3OCUA 1U0NA 1E60A 1UBSB 1TQDA 2J1LA 4MA0A 4Z1OA 2OTCA 1U0OC 4AZSA 5CT4A 2KQUA 4KYUA 3VM6A 1F1BA 1VJGA 1LSUA 1B14A 1F2UB 1G42A 1OSNA 1R50A 3QV1A 3NTRA 4HSGA 4BFVA 4DT1A 5BSVA 4L51A 3HFSA 3HJUA 2W0MA 3LT2A 4H16A 1YR7A 1DEXA 3BSSA 5DWDA 3PQ5A 3QKTA 1TKRA 3S1AA 4D9KA 2DMRA 3T7CA 3LP5A 2BFDB 5D1NA 1J8QA 1B15A 3RO7A 3PGVA 5KKAA 2V6GA 5I7WA 1CXZA 2ZSHA 3CLSC 4KPUA 4ZZ0A 4I1UA 2IPNA 2PUHA 2NXEA 3D8TA 4MVJH 3HL4A 4JYZA 4KKVA 1N7GA 2AW3A 1MQAA 1L5QA 1CBUA 2AX3A 1NMXA 2W48A 5A3SA 4BN5A 4CTMA 3WNQA 3RSOA 3TAUA 1Y4ZA 2D1RA 3F73A 3RKRA 2H0RA 3P9QA 4GVXA 5DM1A 5EIOA 4ED9A 4GWLA 2XGJA 3QG1A 1T9GR 1I7LA 1RRPA 1L3IA 2WVGA 3P2MA 3R2JA 5AOAA 4F9TA 5HRCA 2HREA 3UV6A 4BFTA 4AZWA 5IF3A 4A15A 1M8FA 4ZJPA 3CZMA 1H5NA 2P79A 3DOUA 2Z5LA 5A5EA 3OJOA 3P20A 1OBOA 1OMOA 1B6SA 3ICCA 3M6VA 4D2IA 1CS4C 5JZBA 3L8ZA 4Y2SA 1EK1A 4QSHA 3ZDRA 1QG2A 2PL1A 3C4VA 4WNYA 4MWCA 1DC7A 1XRLA 1XZKA 1Z5OA 2FJUA 2X3YA 3GLKA 4AB1A 4XARA 1NZDA 3E5HA 3EF0A 2RGRA 1IOZA 1G8AA 2IY7A 2FAXA 3V5NA 5M5BA 4YACA 5E95A 4C06A 5IUKC 1YK1A 4FDMA 1C9EA 3IBTA 1KP9A 2XUOA 4FYVA 1G7RA 3ER8A 4BCDA 2BYTA 2W2KB 1Z0DA 2X22A 4DQLA 1YHNA 3DG9A 1E2NA 1M66A 5C7LO 3DL7A 1XCLA 2ENUA 3LQRA 1LKZA 2JH8A 2WA2A 4JGGA 1X7XA 5FBHA 2IHUA 4DCVA 2KB0A 3C3CA 2IYTA 4XFJA 4MS3A 3L7JA 4B85A 3PC6A 1NVEA 2YKGA 5AI9A 2JIOA 5G4KB 1I5RA 1JLRA 2GOYA 1X2EA 2I1LA 3M6LA 4GBMA 4BX8A 5FTLA 4YRSA 4W5TA 3ZVMA 1PYGA 4G0UA 1DE0A 3GPBA 4TMYA 4TL9A 3HVJA 3QBVA 4YUZA 3DAHA 4ZAYA 3ZCTA 1IXSB 4EJ6A 1TJ5A 3TE7A 7ABPA 2OLEA 2Z2YA 5KTPA 1JLKA 2XB8A 4KZPA 2NACA 2QZPA 1PVOA 3MTJA 2XNDD 4C3UA 3GGDA 1ESZA 3P2OA 2D7CA 1HPLA 1RQXA 2H7VA 3IOBA 3EIUA 1H2RS 3W4KA 3E27A 4QUIA 3G79A 5ALEA 2PGDA 3BKXA 4AQ7A 1MQ8B 1XDBA 3BJMA 4GM0A 3ZEIA 4NULA 5AW7A 1K5PA 1N2EA 1K7FB 1A5BB 2RHRA 3KWFA 5FR2A 5IZ4A 3VOBA 1JDBB 1D6NA 1SOMA 3OFSA 2IIVA 5I45A 4LHSA 4BFXA 1EB8A 1W0JD 1Z37A 4HUQA 1DBVO 5DYWA 2X0DA 2V65A 3HFJA 5AOCA 3PF9A 3A04A 1GZ5A 5TPZD 5CITA 2VDRB 2GRUA 3KELA 3C70A 1N92A 1E2QA 3R24A 3N2LA 3UK0A 1ODLA 2W00A 2GD6A 3M6FA 4S35A 5T8KA 5E1DA 4KQHA 3OCWA 3RUPA 3V8MA 4H4CA 1BEEA 1H2EA 1D4ZA 4NMLA 1E8DA 4IXDA 4RH3A 1K5GA 1VKZA 1C30A 1MIOB 2RGAA 4F8EA 5AIBA 2QL9A 1G38A 1F8UA 2GNAA 3CEAA 1GAXA 2DWQA 4M1ZA 1Q57A 1EX1A 3S27A 4DCSA 1IVYA 5ENZA 1UMCB 5A4AA 3IVAA 1LLQA 1G2IA 3OT5A 4B3DA 5KYNA 3WGOA 2PK3A 4QVIA 2PVSA 4RF5A 2DH5A 2Y6UA 1KI2A 3K4QA 3E2PA 3OZFA 3QLJA 2I8CA 2DT8A 2GO7A 2QPOA 3V1MA 1Y5LA 4Q7LA 2AJTA 5AVJA 1BNCA 3H4IA 2WUWE 2QLLA 2O7NA 3TAHA 3ZV3A 1SUAA 4HEQA 3MELA 4C4OA 1DBQA 4DYDA 2WE8A 3J7AC 1MABB 3MJCA 4CEIB 4EMTA 1ETHA 1WTCA 3DMPA 1U94A 2HA6A 4WZBB 4JLNA 2QRQA 4A73A 2AS0A 3F7OA 4LCEA 1XN4A 2XB9A 1GNTA 3SFVA 1ZD5A 4RY8A 2CNWA 1N6NA 3BZBA 2HM7A 3AEUB 2QTMA 1OV4A 3MJSA 4BZXA 1ADYA 1LXCA 2GF2A 5FOXA 1VL8A 3B6KA 3RF6A 3K0AA 2FZLA 3PVZA 5ITSA 2D0IA 5LFAA 2VNHA 3NO4A 4U7GA 5AR1A 4DRXA 5AW6A 2QQEA 2P9CA 5EFOA 4WXHA 4RHEA 2W4IA 5C7YA 3EX7C 2C2ZA 4ANFA 2CSXA 4X94A 3O8CA 3F6PA 2QG9A 4HXGA 2YJTD 5LP6C 3GZNA 5FAXA 4G25A 4MV6A 4AJOA 2Q3FA 3MWFA 1AS0A 3SJBA 1VSUA 4D74A 3UUFA 4BNKA 3H1PA 1FQKA 2X9NA 4G9BA 3WE7A 4HFNA 4DM3A 3ENQA 1EM8B 2O5CA 1CY8A 3VX3A 2REBA 2VDQB 3QVGA 4PVCA 1QIIA 5CPBA 3TLEA 5F9FA 1BFKA 3KM0A 3FCCA 4D4GA 4HUJA 4MLDA 1I0LA 5U1PA 1NDUA 3KV3O 3WTCA 1ZY2A 1MZVA 2I7VA 2I2CA 5H3LA 1TJYA 4BNDB 4DLWA 1OE0A 4Y9TA 3SLRA 4DM4A 1NULA 3G0GA 3DUWA 1EVKA 4DSAA 1O6GA 1ZWLA 4GPZA 1Z06A 2C2KA 1MFZA 3L8YA 1EIZA 5GONF 421PA 1JL3A 1H23A 5FLEX 2ZM5A 3GUZA 3N39C 5I8PA 1EUCB 2FCAA 2P1RA 1C8BA 3B6ZA 3IT2A 2GM3A 3JQPA 1QV7A 4B7ZA 2QRHA 4YK7A 3HNOA 3PC7A 1GADO 2XUFA 3IA2A 3CUVA 3OPVA 4OOFA 1NAIA 1WRBA 4QO8A 3SMVA 2QA5A 4F4DA 2BAGA 2X8AA 2Z4SA 3LZ6A 3R6WA 5JFTA 1KQGA 2OBXA 1M2GA 2XW6A 3LPDA 1G98A 1E2FA 1YUNA 1ONOA 2JG3A 4TTSA 5JR3A 1EE9A 1P1FA 5JY6A 5E7IA 1QTIA 1S5PA 1XXHB 3OTQA 4P5DA 3O92A 3AMVA 4HADA 3UANA 3V1YA 3R9XB 4QUHA 4F2HA 1P2DA 3DOCA 1GR1A 2HIGA 3OU2A 2J5KA 4G5QA 3L6OO 4CMHA 1DEHA 1S2LA 1Z28A 3I9V6 4O2AF 3KQUA 1I5OA 4E4RA 4UBMA 4UHCA 5ESWA 4B3GA 3DP9A 2AKAB 3KU1A 1XKTA 2QZJA 1KBQA 1X7ZB 3L0IB 5AJXA 5AXDA 4Z0TA 1DXOA 1JR2A 4A1FA 4EUKA 4ETNA 3T5PA 5BUQA 1AY0A 1YS1X 1J8MF 2A0WA 2VSXA 4N0MA 2X0KA 3WGTA 3BHIA 3FRHA 4J76A 3WYDA 1YCGA 4PHCA 1BWQA 2JIZD 3COSA 4RENA 3VVMA 2A1UA 4FYWA 4DA4A