1H2BA

Crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
343
structure length
343
Chain Sequence
b'KAARLHEYNKPLRIEDVDYPRLEGRFDVIVRIAGAGVCHTDLHLVQGMWHELLQPKLPYTLGHENVGYIEEVAEGVEGLEKGDPVILHPAVTDGTCLACRAGEDMHCENLEFPGLNIDGGFAEFMRTSHRSVIKLPKDISREKLVEMAPLADAGITAYRAVKKAARTLYPGAYVAIVGVGGLGHIAVQLLKVMTPATVIALDVKEEKLKLAERLGADHVVDARRDPVKQVMELTRGRGVNVAMDFVGSQATVDYTPYLLGRMGRLIIVGYGGELRFPTIRVISSEVSFEGSLVGNYVELHELVTLALQGKVRVEVDIHKLDEINDVLERLEKGEVLGRAVLIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALCOHOL DEHYDROGENASE
publication title The structure of an alcohol dehydrogenase from the hyperthermophilic archaeon Aeropyrum pernix.
pubmed rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
total genus 112
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2002-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h2bA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1h2bA01
3DZFA 3ZV4A 2FOIA 2I3GA 4N5MA 4EUEA 2W98A 3RQSA 3ZV5A 1ADFA 4BNMA 3GEDA 1YBAA 2ZB3A 4DLLA 3JQ7A 3DOCA 4E5PA 3T7EA 4BNLA 4RF2A 1NQ5A 1I2CA 4ZU3A 4B7XA 4H7PA 1U3VA 1MGOA 1I3KA 1P31A 2VHVA 1V6AA 2JHGA 4CMAA 3ENKA 2FPIA 3W6ZA 3ZN2A 4AFNA 1BRMA 1LDMA 4D0RA 4ZHSA 1JW9B 2C2XA 2XXBA 1NR1A 4PLPA 4YRAA 4OSOA 1LQTA 1XLTA 1YOVB 2HO5A 3OMLA 3CE6A 4INAA 3LT1A 4WEQA 3D64A 3ENNA 2HLPA 3NV9A 2O3SA 4F46A 5JMWA 5F1OA 3ROQA 3DAPA 4RDIA 1YL6A 2BF7A 4L4SA 3D4PA 1PEDA 4H15A 2EGHA 3RBXA 3TJRA 4B7UA 5CDSA 2VTDA 3Q9NA 3BTSA 2JD1A 3D1LA 4OXNA 3ZNOA 3OECA 4OXKA 1YDEA 3C1TA 3H6KA 1SEPA 2D2IA 2OP0A 1E1KA 3GNQA 1D3AA 4IDFA 4J7CA 1JAYA 3QE3A 2XF8A 3UICA 2HKIA 1E7SA 3KYDB 1PJLA 1YDWA 1E92A 1BXKA 1XGKA 3QW2A 4DXHA 6LDHA 4S3MA 3VZSA 2O7SA 1JKIA 3WTBA 3L6EA 3PXXA 4FBGA 3WLFA 4JJFA 4NI5A 4RPHA 5I7FA 5JAMA 5ILOA 1KY5A 3ST7A 5A9SA 4CR6A 4J1QA 1SPXA 3ZDFA 5CEEA 4LGVA 3PDJA 4RZIA 2JCYA 3KOUA 1GTMA 4TVOA 2E6UX 3DC2A 1WNTA 4JXKA 2GN6A 3GHHA 4S1VA 5I7VA 4R3WA 4ZQEA 2QYSA 4PVDA 4UVDA 4BVAA 4XDZA 1U5AA 4FN4A 2OOSA 2ZB4A 4D3FA 5GZ6A 3OA0A 1GQYA 3TQHA 3LT2A 4BOYA 2FR8A 1CJCA 3I5MA 2IZZA 1NPYA 3K30A 3B1JA 1HYEA 1CF2O 4IINA 5DOZA 2X5JO 1LDGA 3PPIA 2VHYA 4EYEA 1L7EA 4CM5A 5AXDA 3DOOA 2BFOA 4W7HA 1PL8A 4GL4A 1U7TA 3JQ8B 3QHAA 4XRGA 4TKMA 4XB1A 1XA0A 2AEMA 3HDQA 3NYWA 5CG2A 4A7PA 3IJRA 2NVBA 1LDNA 1PGOA 3HJAA 4I9UA 2P91A 4MKXA 5B4TA 2EXXA 4W82A 3JYOA 3VDRA 2HSDA 1WAMA 5F5LA 4RLHA 1KEVA 4JJGA 5I8ZA 4Z9FA 3BMNA 2O48X 1JAXA 4JBIA 4CM9D 4DIFA 2GR9A 1SC6A 1ZK0A 2Q1SA 3OBBA 1HEUA 1E3WB 4ZRMA 2E4AA 4KWHA 4A03A 1W0CA 4CLOB 4WPGA 1B7GO 4NNJA 3KV3O 3F1KA 1XQ6A 1W4ZA 3L6OO 4BKRA 3VDQA 3RU7A 1HWYA 3ULKA 4TRRA 1PGQA 3GF4A 1U9JA 4M8SA 4HFRA 4FOOA 3U5TA 5T6BA 1P1FA 3GVCA 3PYXA 3L4BA 5ITWA 4RO0A 3FHLA 3PWKA 3GZ4A 1K89A 4J1SA 5JLAA 1ULUA 3PGJA 3A06A 5AOVA 4HY3A 4LCEA 1E3SA 3GT0A 2I65A 1Y8QB 1DPGA 3EY4A 1PU2A 4WLUA 4IUYA 1GQQA 4WLFA 1C0PA 1CRWG 1G0NA 1A4UA 4HFMA 1H2BA 3PQDA 3AUAA 3JQCA 2YY7A 2Z95A 4E12A 5ITVA 4H3VA 3DBVO 3QWBA 1XU9A 2IEBA 2C5AA 3PEFA 4CMIB 3SVTA 3LF2A 3D4NA 1G6KA 2Y67A 4PG6A 1PGJA 1MXHA 1GFSA 1XYGA 2O4CA 5JY6A 5T5QA 5FF9A 5JO9A 5KNLA 4TMFA 1DJNA 1HDZA 3NKLA 3GAFA 4XWYA 3OQ1A 4L74A 3KLMX 2YW9A 3PP8A 3WNVA 3WOHA 4IS3A 2W4QA 3JQBA 3ZV6A 4B3HA 3WG9A 2Y1FA 5KJ1A 1KEPA 2X22A 1KBZA 2CD9A 3EYWA 4BNHA 3AI2A 1C0IA 2AE2A 3OHSX 3TL3A 3BTVA 5JYDA 5F21A 4AJ2A 2PZMA 1H9AA 3Q3CA 1UXGA 3ANMA 2NVUA 4GH5A 2HMWA 3WGYA 5JAZA 4UAGA 1MG5A 3E82A 5FFFA 4GGOA 5G0VA 4L0QA 4GSKA 1X13A 1T1RA 1YOVA 3H5NA 5JCJA 3M2PA 1EEHA 3O03A 3CMMA 1I24A 3K2EA 5AXAA 3VC7A 1Q7CA 1C0LA 1OFGA 2CF5A 4YRDA 5DBGA 2X7HA 4A26A 1D7OA 1E0DA 3ZNPA 3WJ7A 3IUPA 1T2DA 3STHA 3GK3A 1R12A 1M6HA 2FWMX 1PX0A 4UUNA 2G0TA 3RJ9A 1UP4A 1X14A 5JE8A 1XG5A 4AJIA 3QVTA 2GO1A 1YXMA 5G0WA 5L4SA 2CUKA 5ER6A 1QG6A 1QR6A 3ZWAA 3PIDA 5C7IO 1N5DA 1XCBA 1KEWA 1NFFA 3GUYA 2FP4A 2Y93A 3DTYA 2JD0A 3WGZA 1K0UA 4K6FA 3VPGA 4D79A 3KYDA 3ONEA 2PD3A 2Q3EA 4P8RA 4OOEA 4AJEA 2OXIA 3MEQA 4MVJF 1HT0A 1K2WA 1H2HA 3HWRA 3ZNNA 3A9WA 4F6LA 3VHRA 1K5HA 3LDHA 3DAFA 3GAZA 5B4VA 3B1KA 3OJ0A 5JC8A 3DONA 3GG9A 5DT9A 2Y0EA 4E30A 1I0ZA 3DAGA 3CXRA 2BRUA 1LLDA 3C24A 1DAPA 3QWHA 1E7RA 3TSCA 2OBYA 2Q2QA 3ZWCA 3S2IA 4O6VA 1Z7BA 4RF3A 3ETDA 3VH2A 3EAGA 4WLVA 1LLUA 1Q2XA 1ENYA 4CJXA 5TSDA 1WZIA 2ZJ1A 3G0OA 1U5CA 2CMDA 4KUGA 2YJZA 3G1UA 3I83A 2NU6A 4M49A 4CUZA 3L4BC 4B4VA 2QZ9A 3RVDA 1W6UA 3H9JA 3JQ8A 2QX7A 4G5HA 1FDUA 4PVCA 1IHYA 3TPCA 1H9BA 5B12A 1DIGA 2ZCVA 1DIAA 4IIVA 3FI9A 1C1XB 5KVQA 1ZJYA 3AOGA 2X0NA 4HX5A 3EZYA 5EESA 1P0CA 1WMBA 4EDFA 4J7UA 1DJQA 4PIVA 3GMDA 3OICA 3EHEA 1ISIA 2X4GA 1UUFA 5HWSA 3IS3A 1E3WA 3H65A 2Y1OA 1DIRA 1MB4A 4QX6A 1B8VA 3FSRA 4CLOA 1D1TA 3UXYA 1M6WA 2GN8A 2ZK7A 4QSMA 2I6TA 1S6YA 1GUZA 4FOSA 1MP0A 1DRUA 2YUTA 3I9OA 1I01A 4GX1A 4EW6A 3KUXA 1X7DA 2P5UA 1PZFA 4MVJP 2B69A 4MIOA 3K9QO 4PLVA 1UP7A 3DBHB 2Z1NA 2PTGA 4R1SA 1WPQA 4IZIA 1F8FA 5LC1A 4HFNA 1Y8QA 1DRWA 3RKUA 3KSZO 1DIHA 3NDIA 3X2EA 2WYWA 4LVCA 3F6YA 3WJAA 3HFGA 1B8UA 1U7HA 3ZH2A 1ENZA 3U62A 2HJSA 3L0DA 1KC1A 1DOHA 1B8PA 3RBZA 3OF2A 1ZK4A 4Q3NA 3KB6A 4CMIA 1QORA 4E2ZA 3KZVA 4FDAA 2ZQYA 4XRRA 3QA9A 3GRPA 4YJFB 2X5KO 1NPDA 2EIHA 2G82A 1UXJA 2G76A 4RV9A 4I5DA 2RH4A 4DIBA 3TFQA 4PRLA 4MVJG 5JYEA 1SB9A 3K92A 4NBUA 3ROKA 1KS9A 2CDBA 1U4OA 1LA2A 3PDUA 1HF3A 4Y98A 4DVJA 3FRJA 1ONNA 4QO7A 4MKRA 2VRCD 4BNNA 2B0JA 2O2SA 4E21A 2X86A 1ZKMA 4Q39A 2HMSA 3IOYA 3OP4A 1YQGA 3IQDB 3GNSA 4BNWA 3IJPA 3GMSA 3OM9A 5ILGA 2FZWA 4WLOA 5KVSA 3ZI0A 4BNIA 4E5KA 2I99A 2HK9A 3UH1A 4GVLA 1BGVA 3QWAA 2PH5A 5JAQA 3NAQA 3FBGA 4CM9A 4U6SA 4CMJA 4EBFA 3IC5A 4X54A 3W8EA 5TT1A 5L53A 4R51A 1O0SA 2J6IA 2QRKA 1NFQA 1YBMA 1YKFA 3GVHA 4N7RA 1GY8A 4IMRA 2DTDA 2TMDA 3DR3A 1HETA 1M75A 3GG2A 5G0SA 9LDTA 1DHTA 4YJGA 2D3TA 1A7AA 3KEQA 1HZZA 4EEXA 3FN4A 3S2FA 1GYPA 2DUUA 4Z9XA 3LF1A 1Q1NA 1C3VA 1FXSA 1VE9A 1PJQA 5KWEA 1YVEI 2OP1A 3O38A 1GUYA 2I76A 2QRLA 1AHIA 1HE3A 2D0IA 5CDUA 4D3SA 1ONPA 5B4UA 1Z6ZA 4YQYA 4GX0A 1B26A 4OQYA 3HN7A 4W4TA 3ON5A 2GD1O 2WYVA 3O9ZA 1JVSA 1GADO 4QFCA 2NQTA 3R0IA 5GMOA 4AJ4A 1Z7EA 3UAGA 1CQIA 5HTOA 5LDHA 3SC4A 2OO5A 4R01A 2TMGA 4I08A 5IJZA 1XIVA 2EV9A 3UGKA 2X9GA 4GPD1 2UV8A 4AJKA 4YR9A 3PFWO 3VH1A 2AE1A 3WWZA 2E48A 2F1KA 3OQBA 2B5VA 2VWQA 2W8ZA 1VJTA 2X6TA 3RUCA 5JC1A 1XQ1A 3DO5A 1P0FA 4BV8A 1J4AA 4PLZA 2VUUA 2EJWA 2H6EA 1PJBA 2DBQA 4LSMA 4WKGA 5KVVA 1H5QA 1LSJA 4BMNA 1GEGA 4FD3A 3UUWA 4YTEA 1OC4A 3GUCA 5B1YA 4P4GA 2EEZA 1GQ2A 1TI7A 1ZK2A 2DU8A 1HDXA 2J3IA 4BKQA 2YFHA 1C1XA 1U1IA 1HLDA 1XR3A 3CIFA 2BHLA 3K96A 4UEJA 3PFFA 1EE2A 5DOVA 1KOLA 1LLCA 2YQ4A 1U8FO 2H1SA 3SBOA 4Q3BA 3H5RA 4L75A 4W99A 4ITUA 7MDHA 3JD1A 4ILKA 2X23A 2FR1A 3KRTA 4OIMA 4CMGA 1YE3A 4IJVA 2P9GA 3DZHA 3AY3A 2J5KA 4KUEA 3VOSA 3C85A 3OA2A 2A94A 1FMCA 2NTNA 1NWCA 4HWKA 1GU7A 1BVRA 1NFRA 4IDEA 1NXQA 2UYYA 4PLHA 4FB5A 1N7HA 5JBIA 3GZNB 3MZ0A 1ONOA 3MJEA 4XQ9A 1JA9A 1KIFA 2IYPA 1B0AA 1GV1A 3JSAA 1HXHA 3FWNA 3BHIA 2A35A 3Q6IA 4XJSA 3WMWA 2J5QA 1DB3A 3DXFA 1IPEA 1P1RA 5TJ9A 4Q3AA 5ER9A 2QYTA 3ABIA 4CR7A 1N1GA 3GFGA 4XDYA 3IUSA 1F17A 3HHPA 3KSUA 1RM4A 2Y1DA 3WDSA 2P5YA 4I5FA 3VZRA 5G4KB 5L95A 4EEZA 3WS7A 1GAEO 2PH3A 2OHXA 2ZYDA 5L40A 4FPXA 3G79A 1X0VA 1X1TA 5DP1A 4MO2A 4HP8A 4BO8A 3O4RA 4YYZA 4NJOA 1AXEA 3FCOA 4IXWA 4XYGA 4BUCA 1LLQA 3L4SO 3O26A 3ICPA 4A2CA 4ZGWA 2IODA 1KERA 3Q2KA 4L73A 5IFLA 1LTHR 1J49A 4RJTA 2WYUA 4ALLA 3A4VA 1DC4A 4D45A 4YJFA 5TX7A 5BSFA 2EKQA 3AFMA 4IDDA 4CMBA 1BDMA 4AL4A 1FK8A 2Q2VA 2W2KB 3I1JA 4XGIA 5G2OA 3VPXA 4RLSA 1F06A 1ISHA 1E7YA 4XX0A 3ZU4A 3PJEA 1HRDA 2VTEA 4DQVA 1Q0HA 3OETA 2O3QA 4XGKA 5DBFA 4FIZA 3W8FA 3MWEB 1JDJA 4R54A 2VN8A 4CM3A 1NQOA 4DPMA 2C29D 1HE4A 1N2SA 4P4LA 1NASA 4I5EA 2Y05A 3QVXA 4CQLB 1IOLA 2NNLD 4YXFA 4IJWA 3WMXA 5TS3A 3GDFA 2FRDA 1UZMA 1QYVA 4XYBA 1D4FA 3P2OA 2W90A 1KYQA 3B6ZA 5TRTA 3SJ7A 3KXDA 4UVEA 4PZEA 2FSSA 2O3UA 2B83A 4U0JA 5AYVA 1OC2A 3RFTA 3AJRA 4ZA2A 4L4RA 1XDWA 1EUZA 2A4KA 4IDAA 3UKOA 3PTZA 1P1IA 1AUPA 1I2ZA 1VL0A 1KVUA 1H6DA 3M2TA 3KTDA 3VPSA 5H83A 2WD7B 1V9LA 1BG6A 3G1TA 4NR0A 4BMSA 5K1SA 1T2AA 2JD2A 2NVUB 1OZAA 5DULA 1MC4A 1WDMA 1IB6A 5C5IA 3EGOA 2VHZA 2QIOA 1Y7TA 4OMUA 3KVOA 3QQPA 4FJ1A 5DCYA 1Z82A 2F00A 2IYOA 3NGLA 4AJLA 3JYPA 4ND4A 2R00C 3E48A 1E6UA 4XR9A 1UP6A 5H81A 3QWFA 4BQRA 2VWGA 3HDJA 4MPDA 5ES3A 5B37A 5J23A 3DFUA 1HSZA 1IZ0A 4FFMA 3K2BA 5DCWA 1DXYA 1EDOA 1N7GA 2LDXA 4U8GA 4ND2A 3HDYA 3FPLA 3SX2A 3UHAA 1Y8RB 2E49A 5IDYA 3T4XA 4D42A 1MFPA 3OJOA 2HDHA 2AMFA 4BB5A 3H8VA 5COQA 2WE8A 3EMKA 5AXBA 3TZCA 1IL0A 3DHNA 4RPKA 4UVHA 1B3RA 4NG5A 4DWVA 1T2FA 2V6MA 4OQZA 4J9VA 1PWXA 3F5QA 3L77A 5C7OO 4Z0TA 1H6CA 1SB8A 1NWHA 3LU1A 4K1LA 3BA1A 4NHEA 1A9ZA 2D4AA 2GERA 3RUHA 4YAEA 5U9CA 4BKOA 1CQJA 2H5LA 4FJ2A 3JD4A 4NK5A 3WNQA 4OKIA 2GSDA 4DIOA 2BFPA 3FD8A 1E7MA 2CY0A 1VC2A 2QW8A 4WOJA 4ALIA 4BNFA 4PG8A 3PLNA 1FDSA 1EUCA 1P44A 2X1HA 4ZQHA 5DN9A 4J16A 4HUJA 2DTXA 2VRCA 1CWUA 1UXKA 1OI7A 4YJHB 1GZ6A 3ZWXA 5CP8A 3TOZA 3CMCO 3T7CA 1DFHA 4ALMA 1GYRA 2GZ2A 1MV8A 3N7UA 4IM7A 1PL7A 4UVGA 3T4EA 3H9UA 4OO3A 3WQRA 3INTA 1ADCA 3WSVA 3RKRA 1AXGA 1L7DA 2IZ0A 3JD0A 1NAIA 4AG3A 4PLWA 3F3SA 1R0LA 3EUWA 3DHYA 4KMSA 3RCBA 3CEAA 3GZNA 4WJZA 1CIVA 2HQ1A 3A14A 4M55A 3ZGYA 1ZK3A 4N54A 3AI3A 4E2YA 1X7HA 4FS3A 4QT0A 5HBRA 1BMDA 4RL6A 2PNFA 4MOWA 4TWRA 1QMGA 3E5MA 3AW9A 4CLHA 1ZEMA 1A7KA 2X0JA 3EZLA 4UULA 2BI8A 5IG2A 4CLRB 4NFYA 4XZ3A 5G4KA 1I33A 4CV2A 3NJ8A 1YQXA 4JJIA 3WSWA 1X0XA 4NBTA 2VUSA 4YT8A 2PK3A 3LLVA 4YAGA 2PA3A 4PN3A 1JWAB 1R4MB 4R9RA 2GZ3A 4WUVA 4CM4B 3UCXA 1XEAA 5TGDA 2B4RO 3R3JA 3ZZNA 1IUKA 4CV3A 1B3BA 1HTBA 2PGJA 2X9VA 3C7AA 4JNKA 3I4FA 4CLEA 1QLJA 4DC0A 5IXYA 3M1AA 3FPCA 1K6IA 1SMKA 4QXMA 2C7GA 1VJ1A 8LDHA 2A9FA 2W2KA 2ZYAA 5A4DA 2D8AA 1A71A 2J3HA 2VZ0A 3MJVA 3NRCA 1RKXA 3BIOA 3P19A 4BGUA 3U3XA 4IMPA 1NX6A 1E7QA 3S8MA 2NWQA 3JQAB 3PYMA 1UZLA 4B3JA 1LC3A 4R1NA 1F0YA 2G5CA 4QEDA 3LC2O 3EW7A 1ID1A 3CH6A 3UCEA 1R66A 4WCDA 4XGNA 4CQLA 4Z9YA 5EQFA 3KBOA 4CM7A 3E5RA 4YAKA 5JCXA 3GLQA 2NUAA 3S2EA 4MVJD 4J0FA 4ZQBA 4DTIA 1E3IA 1GV0A 1JWBB 3JQFA 5THKA 4CLXA 3NDRA 1XKQA 3GGOA 3IL2A 3VZQA 2CDCA 2ZTVA 3ZU5A 1QV7A 2Y1GA 1W73A 2I67A 2EW2A 4WOKA 2DBZA 2BI7A 2JCXA 1ZEJA 4FGSA 5A9TA 4W7IA 2C7VA 4AJNA 2JFHA 2NTVA 2GNAA 1ZFNA 2WD7A 1I8TA 1R6DA 2O23A 1EK6A 4MIEA 1NHGA 1V3VA 4TRJA 4I1IA 5EPOA 3NTRA 3I6QA 1LC0A 4IQGA 1DEHA 2GRAA 3GDOA 3MWDB 3NX4A 3ETGA 3W4JA 2BLLA 1DFIA 2RHRA 1NAHA 5L7WA 2O3RA 4ALKA 3TZQA 1HDRA 3PHGA 4RGBA 2VZ9A 4G65A 1X15A 3VH4A 4ND3A 5ENVA 2O7QA 5CEJA 1WXDA 3FBTA 3I9KA 4BO1A 4DYVA 3JYLA 3HUDA 2D1YA 3BTUA 4YJGB 1V3UA 1Y8RA 4QTZA 1NTOA 2PR2A 3WXBA 1NHWA 5L7YA 4CMCA 3GGPA 2NACA 5IN4A 1UZNA 4JROA 2QRJA 4A5OA 4BQPA 2YFQA 1Q0LA 2PFGA 3VKVA 1KY4A 2NQ8A 5BNIA 3AUTA 3WGQA 3K6JA 2Y0CA 3KLPX 4XIYA 4DYDA 4O5OA 3U4HA 2VT2A 5A9RA 2YYYA 1PQUA 1VJ0A 2AQKA 2C0CA 2AW5A 4XYEA 3AU9A 5AXCA 1YB5A 3ONFA 4YAJA 3VTFA 3FNHA 1UAYA 4J2HA 4B4WA 4UREA 4YQZA 4OH1A 4BV9A 2WWRA 3RUDA 5EQDA 1GL3A 1M76A 4PZCA 3OQ6A 3IKTA 2WMDA 1VPDA 2OL4A 4R3NA 4TKLA 5A3VA 3WBBA 3WQSB 3OIFA 5CPFA 4LN1A 3DZIA 3E18A 3RBVA 4TRMA 4YJHA 4KTVE 1YO6A 4G81A 2EJVA 4B7CA 4J1NA 1O5IA 3B20A 1V35A 5DP2A 3V5NA 3RASA 3JV7A 1PS9A 2RCYA 3V8BA 1IHXA 1Y5RA 5JNLA 2CZCA 5CFZA 2HCTA 3NJ4A 1ZZEA 1VSUA 2Q1TA 2UVDA 3B1FA 3FTNA 3MTGA 1YL5A 4Z3DA 4DMMA 2XOXA 1PGNA 2O50A 1LDYA 1N92A 1E3JA 4FFPA 3PZRA 4C4OA 5A02A 4KQWA 1E7WA 1I3LA 1I3NA 1QRRA 5BNFA 1R37A 3SLKA 4IXTA 4CL3A 1QXSA 4P4NA 4XQCA 2IDZA 4YJDA 4DQUA 2PD4A 5EINA 4TZKA 3VVBA 1D1SA 1Q7GA 4L76A 3HG7A 3UCFA 3I4CA 1YB4A 5L9AA 3LT0A 5L45A 1ZK1A 1OBFO 1TA4A 2Y0DA 3QLJA 3OJLA 3L9XA 4CM1A 3COSA 3QV1A 2VOJA 1CERA 4CLRA 3D5TA 3I3OA 3INRA 2FPGA 1KVSA 4J4HA 4J9UE 4P22A 3HZZA 3RC9A 1A9YA 1JVBA 4CMEA 1ZCJA 3GPDG 3QY9A 1PS8A 3L9WA 1DDOA 3MJSA 4DC1A 5HS4A 4IJUA 1X1EA 5G0TA 4B8ZA 5CDYA 1SZJG 3JQBC 1R4MA 1NR7A 1RYEA 4CM4A 2FPPA 3PGXA 2A92A 4L9RA 5T64A 2P9EA 3CZMA 4BNJA 1RYDA 4E5YA 5IDWA 1DBVO 3BZUA 3HDHA 4XIJA 4BNTA 2C82A 3G17A 2OORA 5L3ZA 5HRUA 3AK4A 1O9BA 3M6IA 3S1LA 1HLPA 4GX2A 2PV7A 3RU9A 4EUFA 1BXGB 1ZUD1 3ZWWA 5FI5A 3ROMA 2G1UA 4YBZA 2EWMA 2CSUA 5HA5A 4EGFA 5DCUA 5IZCA 4XQGA 4UUOA 1WW8A 1XWFA 2X5OA 1BW9B 3F1LA 1DRVA 1ULSA 3BHMA 4OSPA 4IS2A 2XAAA 3Q0EA 3RWBA 4BL5A 5FEUA 4N18A 5KCZA 1Q0QA 3JQAA 4M87A 1IY8A 3UOGA 3VH3A 2BH9A 2UAGA 5CHEA 1A27A 1EDZA 4GSLA 1VL8A 3DDNA 4RORA 4AJHA 3JTMA 1BXZA 1LJ8A 3DBRB 1U3UA 4PLGA 4RPJA 3WICA 3WFJA 4FC6A 4UEOA 3WYCA 3ZWPA 4A10A 2EERA 2NLOA 1F8GA 2ZATA 1EBFA 1RPNA 3C1OA 5F1KA 4D3DA 4IGFA 1GPDG 4XA8A 4GGPA 4D0SA 1U4SA 3U4DA 3AU8A 1U8XX 3CSDA 3VPHA 4EZBA 5JDIA 5KJFA 4BO7A 1E77A 3R1IA 3ZHYA 2EHDA 3TZ6A 3I9JA 1U2GA 4BNZA 4UUMA 3FNFA 1PIWA 1AN9A 5T67A 5DBIA 3JQ6A 5FYDA 4FR5A 4IDBA 4AJJA 1I5RA 5L7TA 3JYNA 1PJSA 2EKPA 4E5NA 4R68A 4BNYA 4IDCA 1M2WA 3DL2A 1O94A 5JO0A 3ETEA 2WJPA 1PR9A 2V6GA 3E9MA 4IY1A 2RH8A 1TVEA 4URFA 4WEOA 4XR4A 1PL6A 5MGBA 2BFAA 1E6WA 4FGWA 2HK7A 4JGBA 4BKPA 1HSOA 4PG5A 3RUFA 1IPFA 1NPTO 1B15A 1PQWA 3KSDO 4IZHA 5TC4A 1F12A 4R9SA 1JKJA 1P1HA 1E1NA 1Y81A 2GN9A 1CDOA 2P4HX 4CM8B 4DA9A 2P68A 2V7PA 3UW3A 1HDOA 3PHJA 2PLAA 1PZEA 2BFMA 3WYBA 4LK3A 3ZWMA 1KVQA 3AUSA 2NTJA 3BYZA 3AWDA 1ORRA 1QYXA 4C7JA 3K8ZA 5JSFA 2O2YA 1G1AA 3CZRA 3PWZA 1ARZA 2PGLA 5TQVA 2IEDA 3PVZA 3WB9A 3WGTA 3LZ6A 4A73A 4MDHA 1Y5MA 4DBVO 4UUPA 1SOWA 3GGGA 4DL9A 5I7SA 1J6UA 2GZ1A 3Q2IA 1VLLA 1O6ZA 1EVYA 1O8CA 1EFKA 4R5HA 3ZU3A 3BAZA 4OYRA 3TDKA 1P33A 3TZKA 3N58A 3PJFA 3W8DA 1ZMTA 3BMQB 2ZKLA 2IXBA 2EF1A 1DC6A 3X2FA 2X0IA 3Q1LA 5IAAA 4RVUA 5HM8A 3PQFA 3LVFO 4A0SA 1SAYA 1ZW1A 1HL3A 4MVJA 3RJ5A 3R3SA 3GOHA 4TROA 4RQTA 3WWYA 4DQXA 4TVBA 1A72A 5L4NA 3C8MA 4E13A 4JBHA 5IZCC 1GEEA 1H94A 5DF1A 4XYMA 1I30A 2DBRA 3I9NA 4FSHA 3NGXA 4RVDA 4BIIA 4NFSA 1GD1O 5COAA 4J43A 4U7WA 3AOEA 2FMUA 1P1JA 4GQAA 4XB2A 2UUOA 4YEDA 3CINA 1ENOA 1UR5A 3HE3A 3EK2A 4KUHA 4R41A 3K5PA 2BGLA 4RVGA 3W6UA 1I10A 2XPCA 4GMFA 4CMKA 3ZWYA 4YA6A 1PJ3A 2IE0A 4F45A 4CPDA 2JFGA 2UUPA 4DBZA 4HADA 4KP7A 4RVSA 5BSHA 5IZ4A 5I8WA 1ZSNA 1XSEA 4HV4A 2JCVA 2AG8A 4WNIA 1U3WA 3WGOA 4WK6A 2FHSA 3SEFA 3OIDA 3TWOA 3U49A 5JDIC 3E1KA 4J6FA 1E1MA 3AM4A 4OOFA 4FFNA 3V1UA 1AE1A 1JKFA 2VYVD 5KOIA 5DZSA 1YWGO 5TT0A 4GAEA 1ZXBA 2VRBA 5K9ZA 4KWIA 4E0BA 3ZU2A 4LSWA 4MVJE 5JY1A 4PRKA 4BB6A 1BXGA 4EUHA 2YDXA 4QFDA 5A5FA 1EUDA 3ADPA 4JQCA 1JU9A 1T2EA 2ZIZA 2G17A 3ZW8A 1SOVA 2JFFA 4NFHA 1BW9A 2DVMA 3MCVA 2QG4A 3I9LA 3QVWA 4IIUA 4N5NA 7ADHA 1R0KA 4NBRA 4ROSA 5COBA 1B14A 1DAOA 1LDBA 1LBEA 4AJ1A 1NQAO 2X8LA 5C37A 3ZNQA 2P9CA 3D3EA 4NPCA 4XD2A 2R6JA 1I36A 4B3IA 3AY7A 3LSYA 2GASA 4W6ZA 3GVIA 2PGDA 3GVPA 3WGGA 3OFSA 1KVTA 3PQEA 1LDEA 1E5LA 1K3TA 3DBRA 4ZICA 4YAIA 4LRTB 1OOEA 3P5SA 3RUEA 2OZPA 3D5QA 3HN2A 1IE3A 3DB2A 2Z5LA 2PZJA 2RHCA 2C5EA 4B4UA 3PYLA 5JW6A 3U09A 9LDBA 3E03A 2Y66A 2AQHA 1C1DB 2JJYA 3OH8A 5JPIA 4HNGA 4QO8A 2ET6A 1KETA 1PSDA 1QSGA 5LCXA 3ZHXA 3H9GA 3WBFA 4I5GA 4DRYA 1UDCA 5BR7A 3LT4A 5A03A 2GF2A 4GX5A 4RCVA 4TQGA 1QYCA 3Q11A 4CQMD 1GPJA 3UF0A 5KTKA 1ADBA 4EITA 2B5WA 4RZHA 3HADA 3PI7A 1PZGA 4GKBA 4LMRA 4R1UA 1GZ3A 3WFIA 2IZ1A 3LK7A 4GKVA 4U5QA 2Y99A 4BO3A 4HBGA 4WCFB 5G4LA 3U9LA 2I5PO 3F46A 4ND1A 4PZDA 3A1NA 4Z0PA 3V2HA 2ZCUA 3CTMA 3IIEA 2W2LD 1U3TA 4JX8A 1P3DA 2WE7A 4K28A 4E3ZA 2CVZA 4NBVA 3ZWBA 3RC2A 3H9QA 3OJEA 1MLDA 1J0XO 1PJCA 4ESOA 2E82A 3NT5A 4CM8A 2Q1WA 2OFPA 3OJFA 4IBOA 4MJLA 5TNXA 3ANLA 3QWIA 4YT2A 3VAZA 3V2GA 5BSGA 3AOEC 5HS6A 5A3JA 2Q4EA 1P9LA 1V0JA 5BSEA 4J4TA 3WGIA 3FF4A 2ZB7A 5BNTA 3P2YA 1SEVA 3D4OA 4NK4A 3DFZA 4PFJA 4ZN6A 3EDMA 1UAGA 3GR6A 2B36A 2HRBA 4Z6KA 4WECA 4Y6SA 1F14A 5MDHA 3A28A 4CV1A 1O95A 2V65A 1BSVA 3NTOA 3HB5X 2WDZA 4K6CA 1A5ZA 4IGEA 5GZ1A 3PZBA 5L4LA 2HJRA 2NU9A 2YV3A 2GUGA 3BMQA 1YH3A 4CLDA 2AEJA 1BWSA 4FC7A 4B8WA 4Z3KA 2OBNA 4WASA 3JQAD 3PK0A 1ZO8A 4BMVA 2DUWA 4IQ0A 4BO4A 3FNEA 2GLXA 3F5SA 2Q49A 4Q3CA 2ZB8A 5F3RA 3GN2A 5THQA 3NTQA 3JD2A 2VWPA 4NJMA 1DSSG 2RIRA 2VHWA 5TJHA 4G2NA 4YVFA 3WR5A 1X7GA 3MJCA 1EVIA 4CV0A 1E1LA 1JLLA 2PZKA 1IYZA 1V3TA 2O4UX 3GDGA 1LUAA 2YDYA 3JQDA 4Q3EA 2HRZA 2BD0A 1U2DA 3HFSA 4F6CA 1MA0A 2QHXA 1ZJZA 3KETA 4BNKA 3TF5A 4NQZA 1I3MA 2OUIA 4XJTA 4CQMB 4OJNA 1LNQA 1LEHA 1QKIA 4GWKA 5C7LO 3CPSA 3D3WB 3S2GA 3VZPA 1R0SA 4EJ6A 5ENDA 1KEUA 1VKOA 4AJOA 1YRLA 4QECA 3RI3A 4Q9NA 4AVYA 4ONEA 3TL2A 1LU9A 2HK8A 4HXYA 2LDBA 1PJTA 1T24A 2AEFA 3I23A 4D41A 1GYQA 1KC3A 3DMYA 2C07A 3ORFA 5EL0A 4YRBA 3DEYX 1P45A 1EFLA 2VZ8A 4XYLA 3GNTA 2I9PA 3K31A 1MFZA 4OAQA 1UDAA 3FTPA 5JAIA 1H0KA 2VOEA 3E9NA 5U1PA 5K0ZA 1Y6JA 2DKNA 3VTZA 2Q99A 3PHLA 4WLEA 1DC5A 1Z73A 2DAPA 1R15A 4B79A 1YQDA 2D5CA 4PG7A 2C59A 4FFRA 4EJMA 3NT4A 4RF5A 2VQ3A 1EZ4A 1MX3A 4OXYA 1PS0A 3KHUA 4JK3A 3FR7A 3ZW9A 4NIMA 2CVOA 3WGHA 4AICA 3MTJA 3ICCA 1R4NB 4KDFA 3I6IA 3NUGA 2C2YA 2Y1EA 3JQGB 3FNGA 2NVWA 1MXFA 1T1SA 1YJQA 1YL7A 4QQRA 5FWNA 5KIAA 3H4VA 3RC7A 1O89A 3LC7O 3RD5A 3V2UA 3H2SA 1V8BA 3RIHA 5LDGA 1NP3A 5CPBA 1K6JA 2BMAA 4R69A 4BS9A 2EP5A 4EJ0A 1HDCA 4GWGA 2ZJ0A 4MKZA 1C1DA 1NYTA 2GDZA 1SNYA 2FR0A 3UFXA 3WIEA 4FCCA 2X58A 3RUIA 3VPFA 4YPOA 3GVXA 3I52A 4Y6RA 4J7XA 4HNHA 1QV6A 3WIDA 2DFVA 1PTJA 1YS4A 3H3FA 4W9NA 2P4QA 3GRKA 1UXIA 3IP3A 4BHTA 4E4YA 2J8ZA 3U4IA 2ZTUA 4FJ0A 3WTCA 2AQIA 2H9IA 4GBJA 1EE9A 2CF6A 3DMTA 3LLSA 2PKQO 2O3TA 2NU8A 5CDTA 5CEFA 2RAFA 1CYDA 3SC6A 1TLTA 1GUFA 2AQ8A 4WCFA 4BO0A 3C7DB 1DLJA 4MVJM 2DPGA 3BMCB 4LVUA 5T57A 1VSVA 1VRWA 4E2WA 3KYBA 5I7EA 3JQ9A 5A04A 2DPHA 1FDTA 1RM5A 1LSOA 1WDLA 2Q50A 3DZBA 4CUJA 4MP6A 4KDEA 1GR0A 4WGGA 3U0BA 2VYVA 5KJCA 1PWZA 3SXPA 3RROA 4BO9A 1LRKA 5KJEA 2V6FA 3IDSA 3L6DA 3TN7A 4DPLA 4NZ9A 2Y1CA 4J2OA 2EKLA 3H7AA 3AY6A 5TIIA 1DC3A 3TZHA 4ZVVA 4MVJI 3ANNA 4WLNA 4UEKA 3V1YA 3INGA 1WLYA 4RDHA 1Q7BA 4PLTA 3WQQA 4N5LA 4R4JA 3PJGA 4KTTE 4RVHA 4BO6A 2IXAA 4E6PA 1FF9A 3F4LA 1IZ9A 1OMOA 2I66A 3U4CA 3QVOA 2QZZA 5A06A 3GN1A 4ZQGA 1I2BA 2YZ7A 3GH3A 1HE5A 4D44A 1ISJA 2PKRA 3IMFA 3CKYA 1ZMOA 3WX0A 4J4BA 1ENPA 3HB4X 3QVSA 2C20A 4TRNA 4YT5A 4ID9A 5T8KA 4XEHA 3JQEA 3VKUA 2VYND 4PG4A 1N8KA 1ISFA 1Z45A 3KM0A 2FN7A 3GPIA 4R16A 5EJ2A 1VL6A 3TRIA 4DREA 1EMDA 1C0KA 1M66A 1L1FA 5DDIP 5CAEA 3CUKA 1TEHA 3EC7A 3QRWA 5L51A 4I8XA 5DNAA 1GZ4A 1IULA 1EK5A 4E5MA 1DLIA 4FFOA 1Y9AA 2AXQA 4ND5A 5AQ1A 3BHJA 4OL9A 3DZJA 1ZSYA 2Q2WA 4HFJA 3H2ZA 4NU5A 3ZHBA 2PKQP 3PLRA 4LRSB 6ADHA 4RPGA 1YJ8A 5I9NA 1WP4A 2Q45A 1MG0A 4M86A 1E3LA 3G49A 4YCAA 2B4QA 1I32A 3DOJA 3BMOB 4CQMA 3C3XA 3HNPA 5IN5A 1E6EA 2PWZA 4O59O 5KKCA 3AM5A 1G0OA 3D3WA 2YQ5A 4GVXA 3ZHZA 2DC1A 4O0LA 5IDXA 4E32A 4RPLA 5EMHA 5U4QA 2H63A 3W4KA 3DQPA 4GLOA 4BNVA 2Q46A 1E5QA 3NDJA 3E6AA 3NEPX 4J1TA 1EBUA 4Z0HO 2P2SA 3ZWOA 2W2LA 1Z74A 4ZD6A 2Q1UA 3DZGA 4ALJA 3JYQA 4TSKA 3FR8A 4W9NC 3AI1A 4XQEA 4BGEA 1R16A 2E37A 4M1QA 1HDGO 3KYCB 4I9NA 1DFGA 1RM0A 1HE2A 4FW8A 3FWZA 3TNLA 3GY0A 1NVTA 1ML3A 3DTTA 2VNSA 3DMTC 1LSUA 3JQFC 3N74A 1WZEA 4P38A 2YHIB 3ITKA 3RUAA 4JIGA 3ZV3A 5GY7A 4FQ8A 1LRLA 4FFLA 4NDNE 2DT5A 4OGWA 4J0EA 3O8QB 1ZBQA 1D8AA 3PRJA 1BVUA 1R4NA 1TXGA 1A4IA 4WCFC 2EGGA 4JP3A 2BKAA 1B16A 2GCGA 4CM6A 4YDRA 4L4XA 3JQGA 1CEQA 3C1AA 4PLFA 1UXHA 3JD3A 3R6DA 3DWFA 1N9GB 1YB1A 3JQ9C 2YV2A 4MP8A 2OGUA 2AA3A 2DM6A 3GC6A 2D5AA 1ZNQO 2O3JA 5EN4A 3UN1A 3C7CB 1FDVA 1T4DA 2I3AA 2Z1MA 1JQBA 1Z75A 1WVGA 3QJ5A 5JFOA 3OEYA 1QYWA 1QP8A 3BTOA 4C7KA 4BKUA 4D7AA 3JCZA 4M54A 4U6QA 3SLGA 2B37A 5K6AA 3E9QA 2ILTA 4M89A 2UDPA 2ZTMA 3ONDA 5KVCA 1LI4A 4NBWA 1ZSVA 1DHRA 1BTOA 1EQ2A 1UJMA 2ZQZA 3GEMA 1LX6A 4D43A 3TOXA 2WM3A 5T8KC 4GLLA 3DBLB 1Y1PA 4NU6A 3BMCA 5IXSA 5IDQA 1NM5A 3ADOA 4NMHA 2WTBA 3AM3A 4O1MA 1PJ4A 1NVMB 1ADGA 3M1LA 1J5PA 2HMTA 1W8DA 2DLDA 2EP7A 2J5RA 4Y6PA 1ZXLA 4ZRNA 4MIYA 1TT5B 2QQ5A 2POQX 3MJTA 4BNUA 1FJHA 3W4IA 5BT9A 3ZCXA 2HU2A 5ICMA 1FDWA 3Q9UA 2CFCA 1YBVA 2ZTLA 2B4TO 3IP1A 1T2CA 3MOGA 1U28A 3RSHA 3L07A 1YONA 2GPTA 2XXJA 3ZWVA 4TZTA 4QUKA 4A27A 3PWSA 4DLBA 1JTVA 5KJ6A 2HUNA 2VUTA 5A5EA 3B70A 3PJDA 3MOIA 2PZLA 3PHIA 1C14A 1ISGA 1QYDA 2WD8A 4NH4A 5C3MA 1DO8A 1H6BA 2VCYA 4DLAA 2J3KA 4WNCA 3MJ4A 4II3A 4UVIA 4CR8A 4B4OA 1MUUA 2GGSA 1CETA 1Y9EA 1E3EA 3V1TC 2VT3A 4BNGA 3JQ7B 5AVOA 3RAJA 2CDAA 3HQ4O 2CNBA 4ALNA 3G3EA 4KZPA 4R1TA 3AFNA 4BGIA 1PR3A 2NV6A 4JBGA 2FSVA 3ASUA 3W1VA 3P7MA 5JDCA 5FI3A 3E8XA 4RQUA 2GYYA 4JCOA 4L8VA 1VKNA 2HAEA 1GCOA 1HYGA 1XU7A 1P77A 4DUPA 1OAAA 3ASVA 4CMEC 4BGVA 5GZ3A 4RF4A 3GHYA 3H3JA 3F4BA 5I9MA 4DMLA 3UVEA 1ZVMA 2OMEA 2PY6A 3D0OA 4Y9DA 4E31A 1AGNA 2NSDA 3QSGA 4LISA 4GMGA 3OSUA 3BMOA 2RBEA 2FZEA 1HZJA 4Q3DA 4CL8A 1NQTA 4IPTA 4LW8A 4EI2A 2VWHA 2FY8A 4IQ8A 4YB8A 4PLYA 3TFOA 4NJMB 3SJUA 1SBYA 3ROPA 3EVTA 2HMVA 4K26A 3AUUA 5A1TA 1SO8A 2JAPA 3K73O 3D7LA 1UDBA 5BQFA 3IAHA 1KVRA 4H16A 2B35A 4MVJH 4BNXA 4KQXA 2SCUA 5JMPA 3BXXA 1LRJA 5G0UA 5CDGA 5JXWA 4CODB 5A9SB 3GFBA 1T25A 3WYEA 2JL1A 3KYCA 3OIGA 5A05A 1NVGA 4ZJUA 5K6AC 2GN4A 1NBOA 4PGFA 4BO5A 5JS6A 4OKNA 4J49A 5ADHA 2NU7A 4U0KA 1PGPA 2ZYGA 3OEWA 3I9MA 3LQFA 2BELA 2YHIA 4GI2A 5CG1A 1WWKA 4IDGA 2NADA 4KOAA 8ADHA 3QIVA 5TLSA 4J90A 2WSBA 3O8QA 2R00A 5ICSA 1AHHA 3VVCA 4Y8VA 3NT2A 1PQPA 1LXCA 2IRWA 4XKJA 1PJ2A 4J3FA 5KKAA 4BO2A 3RFXA 1ISMA 2NM0A 1EVJA 1PZHA 5F5NA 4Y67A 4XCVA 3RC1A 4MP3A 4F3YA 1QLHA 1BHSA 2VHXA 1VM6A 4ZQFA 3H5AA 1N9GA 1XELA 1NNUA 3LYLA 1VI2A 3KEOA 3GQVA 2DTEA 5F1PA 4AJPA 1S7CA 1T4BA 2BGMA 1N1EA 4JP2A 1TT7A 4HKTA 3QP9A 2R2GA 1XHLA 5JCJD 2VYNA 1T26A 2JAHA 1BDBA 3RFVA 3PHHA 1HKUA 2DBVO 1H93A 1K6XA 1ZH8A 3BMNB 5IF3A 3DBHA 4I9HA 1EQUA 1HYHA 2HMUA 2JHFA 5H82A 4E2XA 4LMPA 3LC1O 1B2LA 3GEGA 1GCUA 1RWBA 3ZWNA 2D59A 1RJWA 4PLCA 3DHEA 4R5MA 1HDYA 4K9DA 4J91A 1WMAA 3PIIA 4YACA 2Y68A 1RM3A 4CMHA 4MINA 4PCVA 3DBLA 3HSKA 4CUKA 2DFDA 1SCUA 4RVFA 4LCJA 2C54A 4II2A 2EG9A 2J3JA 3GA0A 4DPKA 5JDCC 2WEKA 2CVQA 4E33A 1JN0A 4OM8A 3ITDA 1LQUA 1TT5A 1DIBA 2JKVA 4JN6B 2PD6A 2V6BA 1WDKA 1TB4A 1MC5A 3EVNA 5EIOA 2X9NA 2DQ4A 3S55A 4D46A 4YWJA 2Q4BA 2VNAA 5TF4A 5I9LA 1H6AA 1P1KA 1M67A 3IKVA 1LSSA 3F9IA 2EW8A 1P74A 4DGSA 3DZKA 2YHUA 3KO8A 5EERA 2BGKA 1ZIDA 3H9EO 1UH5A 1YGYA 4WE3A 4IJKA 1EVZA 3F47A 1GDHA 2AG5A 2AHRA 2YV1A 4O63O 3WLEA 4JLWA 4OHUA 4YT4A 2X0RA
chains in the Genus database with same CATH superfamily
2EFDB 3AF3A 1TF7A 2I3GA 4IVNA 1DMSA 4N5MA 2W98A 3G2KA 3SY8A 3ZV5A 3ICVA 5K3FA 4YUVA 2HRCA 4G86A 1F0NA 4MYCA 1PZMA 1QGUB 1YBAA 3VJKA 3SVLA 2H1IA 4M1MA 3T7EA 4RF2A 3FA2A 2V03A 5ALJA 5AW9A 4B7XA 2C2OA 4JQZA 4LXQA 1KRXA 4M7PA 5FOXA 4HDAA 1R2QA 2JHGA 4HNSA 1UBMS 2Q5IA 2VHEA 3G0CA 1P60A 1RHMA 3MQFA 2WV9A 3DPSA 4IVQA 4XGRA 1IM8A 2C2XA 5HDBB 4C6RA 1AUQA 1GAWA 1XMVA 3RS4A 2ZVDA 3ETCA 4PLPA 1UDXA 4OSOA 3V8RA 1XLTA 4KWEA 4HSGA 2JLUA 3N2NA 4GOXA 1MJHA 4N8SA 4INAA 2BE9A 2ZXFA 2BEVB 2HT6A 3L1HA 3LT1A 4RIHA 1CNEA 1WS6A 2FSUA 3SS8A 1Z5WA 4IHJB 1I2MA 2YN4A 4F46A 2P9QA 5HJ5A 5JMWA 3T7SA 1UIMA 3D81A 1YL6A 2MINA 5HQ3A 4GECA 1PEDA 1G7TA 2EGHA 3RBXA 4AIRA 2OGWA 1KI4A 1YRBA 3ZGOA 2AFHE 3B7PA 4QLAA 5GJCA 4BVEA 1PYGA 3Q9NA 4C21A 5KDOA 3D1LA 3KJHA 4KLNA 3PL5A 4WD3A 5CAEB 1FYXA 4O2AF 4B85A 4KMMA 4V1CA 1EPUA 1LX7A 2HKIA 1XWIA 4UUQA 2YINC 3LZDA 1UBOS 1VKHA 1Z8FA 4B09A 2H1FA 5DRTA 2AKEA 3HU3A 3ZC3A 4BVFA 4MHSA 3QW2A 4HMOA 4P5DA 3WLNA 4A8JA 5EIEA 2O7SA 4XB6B 1JKIA 4P86A 5DM70 1JPNA 4YMUA 3WTBA 3L6EA 4FBGA 1RRMA 4JJFA 4RPHA 1R0RE 4KI0A 5ILOA 1G59A 3T5MA 4C7OB 1KY5A 4G97A 4J1QA 3NWOA 4BLOA 1XF9A 2INGX 1SKQA 2VCHA 4PZZA 4NC9A 2HSWA 4XX1A 1GTMA 1OZ0A 1GRNA 1QQ6A 2E6UX 3TIXB 3TGPA 3GHHA 1SVSA 2HSJA 1TK9A 4R3WA 4YDSA 3VR5A 2H11A 3L8HA 1HM5A 3FOCA 2GK6A 2X8WA 1LBIA 4BVAA 1JDNA 1KF0A 3T1QA 1U5AA 1YZVA 5HFJA 2AJLI 2AV6A 2OOSA 1C30A 1LNZA 4H6WA 4WL0A 5GZ6A 3OA0A 2XUGA 1E1RD 1Y4ZA 3TQHA 4O2AB 1E3TA 3LUAA 4BOYA 2HB6A 5G3YA 1GU1A 4FI3C 3RVLA 3WKEA 2VATA 3GRUA 4LGMA 1GRQA 3NHZA 1HYEA 3NP9A 3I2HA 2FV8A 3ZIAD 3RIMA 3VMFA 1KOFA 2NMVA 1RHQA 2QLLA 5K3EA 5KWIA 1ZGGA 3EZ6A 2BFOA 4AN1A 1PL8A 4JASB 4BXOA 5JJLA 1NNLA 2XSZA 1JAHA 3BWXA 1XDZA 2V5VA 1OXMA 1F1BA 3QHAA 2CWDA 3H05A 1L5OA 2XYGA 3P9NA 4XB1A 1XA0A 4O4IF 5GONF 5CG2A 1IN1A 2RHDA 2IHZA 3L7IA 1B6GA 1PGOA 2GZHA 4ZT5A 5JBNA 3X1YA 4WK4B 3A6ZA 1OXTA 4A6XA 3PUVA 3MWYW 3VSEA 4MEBA 1OLUA 1JAXA 3EGXA 4I3HA 5JHGB 4KR0A 4DIFA 2Q1SA 1SC6A 3ZOKA 1ZRHA 1E3WB 1W6RA 2E4AA 4A03A 1FFGA 2OFOA 3WL7A 1SCNE 1X6VA 4N5IX 2IH4A 2BMJA 2J46A 2NZWA 4FHDA 2P75A 3KALA 5LQRA 1ICEA 2REXB 1Q7TA 3UWMA 1JGTA 3OY7A 5CCEA 3RU7A 2C4VA 3B3AA 2WI8A 4QYXA 3GF4A 1MABA 5PNTA 3QUBA 4YC7A 3B6EA 3PEUA 3TPZA 3I39X 2YJ6A 4H1TA 2ZQ5A 3STVA 1CVRA 4ARZB 1B4DA 4IHAA 3HGMA 2DSNA 1AK2A 1T5LA 2XMGA 5T6BA 4ZV9A 3TQRA 2NZ8A 3R7DA 5GONB 2MJLA 2UKDA 3L4BA 2Q4RA 4X92A 4L3OA 3N86A 4G0UA 4GXNA 2Y3IA 3FZGA 4D6YA 3OCCA 3SYMA 4WWHA 4XTCS 3PGJA 1E4EB 2F3RA 3A06A 4HH1A 4HY3A 2O20A 1HDIA 1SXGA 2YXNA 1AHPA 3W5IA 1F4VA 1U90A 1CUWA 1W85B 1XLTC 1EVEA 1R6TA 1PL0A 1Y8QB 1D9XA 2H7VA 3GJ5A 4RM3A 5LQCA 2BMEA 4Q9DA 3ABQB 3ICQB 1PU2A 3A4IA 1ATZA 1T0JB 4IUYA 2OE2A 4WLUA 5DNVA 4EI8A 1AURA 1RI1A 3M4ZA 3O83A 4QPPA 5AKZA 4HFMA 4S1TA 5CLHA 3SZLA 2QNBA 4K03A 3OZWA 2C99A 4B0OA 2QRVA 3JQCA 3TX2A 1JE1A 5G41A 5ITVA 4V0QA 2B98A 1YQUA 4PZ0A 1XU9A 5JFGA 3SVTA 3PEFA 4GBMA 4WA8A 1XP5A 1KNXA 4CMIB 2Q6TA 3T3GA 4FB4A 3PRKE 1DEXA 4IVRA 1QF9A 3GFTA 2NYAA 4G1FA 4F86A 3PDWA 1GFSA 3G7SA 5JJIA 4CVNA 4WZBA 3DHVA 1W4CA 4URYR 4FHFA 4MSUA 3UMRA 3CRQA 3NKLA 1QGUA 4L74A 2W6JD 4HDQB 5BYKA 3OMXA 3WOHA 4G0VA 2W4QA 3JQBA 1C4XA 3QUCA 4IICA 3LGXA 3QJGA 1JFFB 4EG1A 3ZDDA 2RHOA 3RVKA 3IO5A 4A8JC 1C9NA 4BNHA 1NG9A 1KBZA 3EYWA 3KFXA 1GAJA 3GCZA 5ALLA 2V97A 4B2LA 4EWLA 1TW3A 4D9BA 3PUKA 3PC8A 3GLIB 3SQNA 1GXSB 4C4ZA 2VC2B 2Y6VA 2ZUSA 3EBPA 2IGBA 4RH3A 4AJ2A 4ZOQI 1H9AA 3PGLA 3Q3CA 4N5DA 5AK3A 2PZBA 4HQLA 4AROA 4GH5A 3RJZA 2HMWA 3K09A 1CEYA 5JAZA 2BFDB 1KMIY 4FE3A 3WC4A 5FFFA 4GGOA 4EZEA 5KPJA 3CF4G 5E4TA 5CHYA 3K53A 4M0FA 5C8YF 4XCQA 1I24A 5AXAA 1C0LA 1OFGA 5DBGA 5SY9A 5H9VA 2BEVA 3OZSA 5D00A 1UCFA 3OCVA 2OHGA 4CCAA 2O8BA 1KOJA 4IHJA 4WT7A 3TVYA 1R12A 3NTXA 2DUJA 3H7IA 3A26A 4OXXA 5EE1A 3IXMA 5HIJA 3NO4A 4JLNA 1UP4A 2C7BA 3RJ9A 3WWOA 1X14A 1F2UB 5T57A 3UHOA 3KCNA 1Q22A 3FDZB 1G5FA 5DLDA 1E5DA 5JXHA 1YXMA 5NULA 5KWSA 3ZTTA 2CUKA 5L4SA 4DJJA 2BE7A 1QG6A 1QR6A 2VJOA 3O47A 4J03A 4M9UA 3ZWAA 2I9KA 1V7PC 2DQZA 3ZK8A 1P2SA 2IYSA 2WJYA 1G8FA 3F6CA 4K6FA 3TBHA 1TO1E 3ONEA 2Q3EA 1E2DA 4P8RA 3IXLA 3MEQA 3VR3A 4MVJF 4TS3A 3DLIA 4QXOA 3A9WA 3C3MA 5EP1A 2YOGA 4LRYA 3T8YA 2OKGA 3GJ8A 4F6LA 2KB0A 1O87A 1G7SA 3DAFA 3R6LA 1OT3A 5C8YB 4A5SA 5B4VA 2YX1A 3DO6A 3ENQA 4YREA 3M3DA 5JEDA 4MPJA 1FX1A 3ZHQA 4PNPA 3N7AA 2JLWA 2WTXA 4TTIA 4JBWA 3D0RA 3W79A 1TIBA 2F4NA 3ROGA 2NPIA 1AQ6A 2EC5A 2Y0PA 5DT9A 3TLGB 4K0RA 3DAGA 5I9TA 3VBEA 4E30A 1ZQ9A 4S12A 4F97A 3RVOA 3TSCA 2OBYA 2Q2QA 1M2VB 1U81A 4O6VA 4JOBA 4PXYA 4BMCA 3ZQJA 2QTVB 2O8DB 1HQYE 4P2BA 3VH2A 3JY6A 4EPVA 5HK8A 2FQ1A 2OQ2A 2O5EA 2Q7OE 1Q2XA 4O2AA 1US8B 3QLVA 1TMGE 4PAQA 5JSYA 1WZIA 2A0YA 1MD9A 2B21A 3D02A 3F73A 1U5CA 3G1WA 4PAOA 5KQLA 3F3YA 3L4BC 5DN6A 2XECA 3DKIA 5BWNA 1MIHA 1KSJA 4FILA 2BHSA 2WWYA 1ZOIA 1GG2A 1ZIXA 2RMKA 3TE7A 3RVDA 4PC2A 4FBLA 5KEIA 4G5HA 1CDEA 4UARA 3UMSA 4HNQA 5JSKA 4EVIA 4OK3A 3QLUA 1NBWB 2XQGA 2QTGA 4OIFA 1H9BA 1DIGA 4JLDA 1QVAA 2GHTA 3VHLB 1OBCA 4IIVA 4BMYA 1C1XB 5KVQA 2H08A 4HX5A 4JBNA 3DUWA 2Z3ZA 3ZLBA 4L6CA 2PBRA 4MWCA 5EESA 5FLEX 3N2LA 4LF5B 1N4DA 3FSGA 3V9AA 4E94A 1YR7A 3GMDA 1SXJD 3OICA 1ISIA 1MRZA 1NW3A 2X4GA 1KI8A 3IS3A 4AP9A 1E3WA 2EBFX 2RSLA 3GYGA 4GNKA 1A9QA 4L5CA 1TU0A 4R2XA 4MYRA 5HK9A 5CK5A 4AF8A 2ZK7A 2MYPA 4IRXA 4QOIA 1JLMA 1VIDA 4QBFA 1MP0A 4I0WB 1TPZA 2YVUA 3EFEA 4MPRA 2R1ZA 2JFUA 3SF8A 5I9IA 1XDSA 3I9OA 1I01A 4ARZA 5ALSA 2PO5A 1RC8A 2XVMA 1XZMA 5GONA 5CM2Z 2CB9A 1XZKA 3RGGA 3BCHA 4Q05A 2FNAA 2ZBPA 2Z1NA 3HYLA 3RE1A 1E4EA 3QEOA 3K09C 5L3RA 4HYEA 1BS9A 2WWVD 3ZGNA 4DY4A 1JIVA 1O03A 2AOTB 3K1TA 1W85A 1Y8QA 2PT7A 4RELA 2C1ZA 3IOMA 4G0YA 3RKUA 5CLGA 1FL9A 3EEBA 4ZHQF 4CCYA 4LY3A 3FCUB 5JFTA 1P4AA 1Z29A 2P4UA 4LVCA 4DV5B 1XLWA 3HFGA 2VXOA 5DHTA 4B9AA 5JS1A 2ZI9A 3L0DA 4OFZA 1IWOA 1DOHA 1XMSA 4UDOA 4WTOA 2MYNA 3UJAA 3B1XA 3OF2A 1HLFA 4CMIA 4E2ZA 3L43A 5DYYA 2AFRA 2W6PA 2ZQYA 4FDAA 4M1WA 4XRRA 1MEJA 1V1MB 1JDSA 4JGGA 2V9PA 4EVSA 1XTBA 4KPGA 2CXRA 1VGRA 2JASA 2X5KO 4AG6A 5JT1A 3HMQA 2W9XA 1MV5A 1OYOA 3FHJA 5K0NA 4C2AA 2ZBVA 1DINA 1UXJA 5EIHA 1UK8A 3L7YA 3ROTA 5DX1A 1JFSA 2GAIA 1E9DA 1E9RA 3OPYB 3ONNA 3O9VA 3UMVA 1VRVA 1QTIA 2V7UA 4PRLA 3MWJA 3UM9A 1QTQA 1SB9A 4I9FA 3ROKA 1UBTS 2CDBA 2GCEA 2P2ZA 1JFFA 4KXMA 5A3QA 1XZIA 3TTTA 4AUEA 2YICA 2WTUA 1HF3A 1NLZA 1SFRA 1ONNA 2VRCD 1IM5A 3TEMA 3F5DA 2B0JA 3MILA 3GLIA 4E21A 3MHTA 1ZKMA 3AEYA 1MVOA 2KS6A 4DIDA 3FSEA 1RAFA 3FHOA 3AEQB 3OP4A 4L6IA 3E7FA 4P6VF 2QN1A 3BFKA 4ZYTA 5IDVA 4CT5A 2Q8PA 1C7QA 2I55A 1J7KA 2QI9F 2XW6A 3BXHA 3OM9A 1L1RA 2BFDA 4F4CA 4G4IA 1OSNA 4FYMA 5D1NA 4AI6A 2ANBA 3F7NA 5JAHA 2Q6LA 2R65A 4NXNB 4M1OA 3H9BA 4WLOA 5GJBA 3CUUA 4M8KA 1XLUA 4OMFG 2QW0X 3ZI0A 1U0BB 8ATCA 4AMUA 1BAPA 1U1DA 2XWSA 3UH1A 2O6LA 2OV6A 1BGVA 1ZOPA 1VOTA 3QWAA 5AO9A 4EHJA 5JAQA 3QLVC 4BLTA 1TDJA 3HO8A 1G2OA 1U6IA 3VFDA 3L82B 4U6SA 5CIWA 1RCFA 3EH2A 3LIIA 3S2UA 3NIFB 4X54A 3SDZA 5AD1A 2Z8YM 5BW5A 3MT9A 1O0SA 2J6IA 3I3SR 1RWKA 4N7RA 1GY8A 1F2UA 2DTDA 3DT9A 3T9FA 2TMDA 4DF3A 1M75A 2BJVA 3D6UA 3FDZA 5KPDA 1QH1B 5ALXA 9LDTA 3F2IA 3B3JA 2QYOA 1IXSB 1O58A 3TLJA 3NRJA 3W9BA 1S3IA 2I3ZA 3FN4A 4RPCA 4EEXA 4IIDA 4I3FA 1A9TA 4KPEC 3NHLA 3QLUC 4BV3A 4NDAA 1RJ9B 1P73A 1PJQA 5FPPA 2J5BA 1YVEI 4DV1B 1M10A 2JGDB 3GX1A 2CLEB 2HM7A 3VR0A 2BYTA 1ZJ6A 2MSDB 2XYPA 3DMHA 3M6UA 5ECWA 3L6BA 4OCZA 5SYAA 1UFVA 3F0TA 3A3KA 2WAAA 1ONPA 3TRDA 1DX4A 3VC1A 1Z6ZA 4D3SA 5C8YA 4B2YA 4YQYA 1XTPA 3BS4A 3C6ZA 4GX0A 4KRYA 2WYVA 3NDPA 1MGPA 3O9ZA 1AKMA 4D9HA 1C0EA 2JJ2D 2H06A 4P7GA 2A3RA 1VHDA 5DNYB 3TLGA 1DEAA 1KI3A 2Q3DA 4QUHA 5GMOA 5A0FA 1LW6E 1Z7EA 1QQBA 3ZWKA 1F5SA 2Q4DA 1GR1A 4X84A 3UAGA 2VAMA 3PRHA 1XFDA 3PQ3A 2J3LA 4NPHA 5IEJA 1M2VA 1LBTA 4MGZR 5K99A 3EOBI 4B33A 1KTVA 4JJ8A 2TMGA 1XTVA 3C45A 4LRXA 2QTVA 3D8RA 3T9EA 2P9BA 4WH0A 2EV9A 4YONB 3UGKA 2O8DA 2X9GA 2UV8A 3E9YA 4BFLA 2H5EA 3D0QA 4CNQA 4M9CA 3KQWA 2IYRA 2W0SA 1UT8A 2E48A 2FW8A 3V97A 1UQUA 3TM5A 5HE8A 3OQBA 1GITA 2RGWA 1K98A 2Q0SA 4ADSG 1E4VA 4EA7A 1QX3A 3OM0A 1VJTA 4UPEA 1Q83A 1CF4A 4KB5A 3CBQA 1SBZA 2BMDA 1ZOLA 1TJNA 2V8OA 3HJRA 1OGIA 3PLAE 4BV8A 5SV2A 4UHFA 5IH7A 1WDWB 1P1BA 1YHYA 4WXMA 3LBHA 2H6EA 3LUJA 1PJBA 2DBQA 4LSMA 5KVVA 1QRTA 1LSJA 4JKYA 3E35A 4KVFA 4MRAA 4IDPA 4OQFA 4YTEA 4BFWA 4RACA 2GD0A 3GUCA 5CYOA 4TXJA 4P4GA 2XZLA 3GMIA 1TI7A 1ZK2A 3RKSA 4LECA 2DU8A 2C42A 4BKQA 1E20A 1C1XA 3CIFA 4FU0A 5GM2A 2BHLA 2QL6A 2QK4A 1JHZA 1OX4B 2FYTA 2VNKA 4IFTA 4IO0A 3PFFA 4UEJA 4IHQA 4Y30A 4ZVLA 4CYMA 4EHLA 4BVGA 4ZTZB 2YQ4A 3F3MA 1TQHA 1U8FO 3JVUA 3PGMA 3AR3A 2XD9A 3H5RA 3U3XA 4ITUA 7MDHA 3JD1A 1TKCA 2IK8A 3W7BA 1YHZA 1GDTA 4ILKA 4ABTA 2WJJA 1KZ6A 3AFGA 1E8MA 1DWPA 2OV1A 4YLGA 1VE3A 2IBTA 2OBMA 3PVCA 4EM6A 3VR6A 3WMRA 1FMCA 2PQMA 1NWCA 4NG4A 1GU7A 1U0HC 3BUSA 4YRPA 3NC1C 4IDEA 3LUGA 1L7BA 4GOJA 5HQTA 2DY1A 3R5HA 3N8DA 2LR0A 1U0SY 4XJSA 3Q3HA 1N6NA 2YIJA 5CD9A 2Q6VA 1YFZA 1T4GA 2QSJA 4R1MA 3ABIA 1YBFA 4HX9A 5DISB 3IUSA 4FEGA 4GWLA 5KWVA 2IXGA 1WBJB 3E58A 3WDSA 2GZAA 2AOTA 2BMFA 5G4KB 1XNQB 1W5FA 4RBNA 2VRNA 1GAEO 3DTVD 1OROA 2PH3A 1J8QA 3GEEA 2I8LA 4X7BA 3I01A 3F9RA 1XVTA 1X0VA 1RYMA 1ZGAA 3AB3A 1EINA 1X7YB 2DLNA 4E7OA 3C3JA 4DFDA 3O4RA 1RTKA 4YYZA 2XBUA 1X38A 3Q7IA 1AXEA 2CFSA 3QFCA 2PWAA 5DGTA 2HEIA 2YVAA 4COKA 1TJ5A 4ZGWA 2IODA 3SN6A 5HSGA 2YWBA 2COUA 1XAIA 1J49A 1V1MA 1YQTA 2HGZA 1RC1A 2OR3A 4MQ4A 4TLEA 3GLGB 2PXHA 4NJEB 1QHFA 2HU8A 4BX9A 3K8YA 4R98A 4D45A 5FL3A 1W9HA 3G2QA 4B35A 5BSFA 2EKQA 1G20B 3L41A 4IDDA 3SS9X 1BDMA 2O9JA 2W4MA 1V95A 1FK8A 1DX9A 2Q2VA 4LY6A 3I05A 5G2OA 4AL4A 4RZSA 1ISHA 1J56A 4GXTA 4XOUA 4H7JA 2MTBA 3GUVA 3OZAA 4N6OA 1UK6A 1HRDA 3HBJA 3U2QA 2Y8EA 4PV7A 3LY7A 3C6XA 3OJWA 5J2UF 4E4RA 4NEQA 3W8FA 1JDJA 4P3PA 2HLNA 2OCDA 5IASA 4JT9A 3H0KA 4Q66C 3NNDA 1Q15A 3I0ZA 1QYIA 2C29D 1HE4A 1CEXA 1N2SA 3WP0A 2FX2A 2P2YA 4I5EA 1GQSA 3ORSA 2VI5A 5AW5A 3IP5A 1X3SA 3AEQA 3CNNA 1NKSA 1N3YA 2Y05A 3LNCA 3V4LA 4N8DA 3WZ2A 1EAYA 3GJSA 2ZJ7A 2FRDA 5HZMA 3T0GA 4HLDA 4BX8A 3I61A 3T7TA 1Z4KA 3P2OA 4M0CA 5TRTA 3B6ZA 5AVYA 4F9FA 4RM2A 4Z7NB 3CISA 2FSSA 2O3UA 2SHKA 4U0JA 1UJ6A 1OC2A 4G5FA 3RFTA 3ZZUA 4RTSA 4WW0A 1L7PA 3VNUA 2NP6A 1I0IA 3HL4A 2OVFA 1C2YA 3PE6A 4L4RA 2BFEB 4I6GA 1O5OA 1Q6YA 4OHYA 5H7XA 4IDAA 1RWOA 3ZDQA 1P1IA 4YP6A 4I1OA 1ZVJA 2XJ4A 4EUSA 1KVUA 4X60A 2DH6A 4YDHB 2V7VA 2WILA 1H69A 3KTDA 5J2UB 3VBCA 4DR2B 2EX0A 2P8JA 5H83A 5K1SA 1QH1A 4DJEC 1NKTA 1SA0B 4DM3A 2I2DA 1T2AA 4JYCA 4YO8A 3RF7A 1OZAA 1BS2A 4G8JA 5C5IA 1Q16A 4MWEA 4OMUA 2NOAA 2YBEA 1RJ9A 4PGAA 3KVOA 1DCMA 4H4CA 1YI8A 2JGDA 2F00A 1HR0B 4HYQA 2AMVA 2R00C 4KQ6A 1E6UA 2W70A 1GHTA 2IYYA 5KDLA 4JEMA 5IWCA 4LDRA 2VSQA 1NI5A 4M83A 1E2EA 3VAAA 4M60A 2G08A 4GZ5A 3PTAA 4BVBA 1PUXA 5LA6F 4YCMA 3U44B 2W2MA 3E2IA 5TQJA 4KQEA 4Q1BA 5E9AA 5EP2A 3L40A 4C88A 2OXEA 5DCWA 3SM9A 3CNEA 2IUUA 4ND2A 3FPLA 4GMXA 4D4MA 3CLVA 1WUTA 5BY2A 1D5WA 3QTTA 3V6MA 1CUCA 1NLYA 1Y8RB 1M2KA 4RLFA 3OJOA 4AKSA 2PIAA 3JZAA 1VA4A 2HOQA 2FJ0A 5COQA 1VGVA 1J9GA 4AQDA 3TZCA 1IL0A 3DHNA 5CT8A 1NLMA 13PKA 1N2OA 4PY2A 4Y0AA 4YCSA 4UVHA 1XP8A 1SR8A 3NTUA 4QBHA 1OWNA 4E5VA 1Q77A 3TD6A 4OQZA 4AZ3A 4J9VA 3HXLA 3OEHD 2GEFA 1FSFA 2VH2A 3OPXA 4JENA 4RTLA 2MSLA 2HBYA 1KPIA 5KYXB 1BFKA 4PICA 1I4TD 1Y9ZA 1KZHA 2O8CA 4LCBA 1JX6A 1H6CA 1XPJA 1ES9A 2G8NA 1SB8A 2J31A 4G84A 4IW3B 4K1LA 5EXDA 2XZOA 1NJ2A 2GERA 3BE5A 5H0IA 3U5ZB 1QWOA 3M6XA 5B6IA 4D8WA 4JJEA 2BR5A 3WNQA 4FOTA 2W0MA 4OKIA 4BFXA 2BZGA 4DIOA 1E7MA 2CY0A 1VC2A 1MENA 2PIDA 4PG8A 3PLNA 3EA4A 1M6YA 2HYDA 1JSLA 5DN9A 3R24A 4NMMA 2RKWA 2BGNA 2CXNA 3D54D 3WQHA 3D3JA 5E6UB 1S02A 3PA6A 1UXKA 2LCQA 1Y82A 3DDOA 1OX4A 5EPEA 1IY9A 2BEUB 2R4QA 3IE1A 4H18A 4RFVA 1OWOA 1MJNA 5K4HA 4Q6BA 5T4BA 3TXYA 1AMNA 1DFHA 4MS3B 4ALMA 1H4TA 4MCHA 5IU6A 3WQRA 1PWHA 3T4EA 4D9FA 3ZY4A 4U7DA 3JAWB 4IDNA 1ECLA 4HGOA 3OSZA 3INTA 3ITEA 1NYLA 2PFSA 4P54A 1RXYA 2VYCA 2GRUA 4WXRA 4AG3A 4DCCA 2VLIA 5EC8A 1XALA 1K08A 1P17A 3HVHA 5CNMA 2JFXA 1OH8A 2K7FA 5JAUA 1DDIA 4N41A 3BWEA 3DHYA 2J0SA 1P62B 5AHKA 3BSFA 3N8HA 4TLBA 4WJZA 4ZK2A 2HQ1A 3A14A 1MOSA 2IPXA 4L16A 3ZGYA 4N54A 2V7TA 3GIDA 3LD9A 4JT4A 5E9QA 4FDMA 2RBGA 4DAOA 4BY9E 4PX2A 5ETJA 4BTEA 1VLHA 1XMOB 3E5MA 4B80A 1JALA 1ZEMA 1E89A 2AJDA 1QM5A 2BI8A 3UG6A 1Q1EA 4EDHA 1TA9A 3BE6A 5C8DA 4NFYA 4RZUA 5G4KA 3P9XA 2FRDC 4MKHA 1CIPA 1L1EA 1M5UA 2XNCA 3NJ8A 1K9SA 2C9MA 3HLKA 2H31A 1X7YA 4HDOB 3T4PA 4UASA 4NBTA 2EJBA 1YCDA 4HHEA 4OHOA 4MGHA 5CH8A 2W58A 3SQXA 2PA3A 4NBLA 5EVJA 5F7ZA 2G3YA 3LQKA 1JHAA 5AW7A 1R4MB 3T1TA 3Q8XB 1XEAA 4Z53A 2CYCA 2GOYA 3RRNA 4IJ5A 2P9TA 1IUKA 3ZZNA 4CV3A 4Z4EA 2C2WA 4Z1MA 2ZIWB 4BJ6A 5IPFA 2ZR8A 3KJEA 4DUZB 2NV0A 4I2VA 5C52B 1DQYA 4FYKA 1UC4B 1GNRA 3C98A 1T3SA 3LUKA 4NJEA 5B1HA 3GLGA 1JHXA 3K5IA 4HI0E 1OFVA 1G20A 5EI5A 4CFYA 3SEAA 1AKYA 3OE1A 5IX8A 4CGYA 2ZYAA 3JX9A 5F7JA 4TUYF 2J3HA 3I04A 2CKMA 5HKKA 3MJVA 5L3QB 3HCBA 5IRCD 4AQ7A 5JPIA 4JVOA 3JWIA 4IMPA 3TMAA 5K0SA 3KL4A 1LK7A 2E4XA 3ID6C 1SVNA 2PA0A 2B92A 2DPLA 2ZRPA 3BXPA 3JQAB 3QBEA 3PYMA 1OILA 2IS6A 2C3PA 1YV9A 4CIDA 1CHNA 3I37X 4R1NA 3EOZA 3LKZA 1VCIA 1S3FA 4R40A 1K6EA 4WX2B 3VM6A 5IT5A 1ZR4A 2X77A 2ZWAA 4QEDA 3WK9A 1P2TA 3SBDA 3ZH9B 1HLGA 1XROA 2C2BA 5B7PA 3CH6A 3E70C 4R2JA 4WCDA 5EZ5A 2M32A 3U44A 1JHPA 4DCSA 1A0OA 2ZJ2A 4HN2A 4CM7A 3E5RA 4WXHA 4R05A 5DSXA 2PDAA 3GLQA 3SX0A 2ZYWX 1DTWB 3S2EA 5C51B 1NW9B 1M8JA 1GV0A 5AK5A 4A8PA 4CLXA 1E9FA 1IN5A 1VZ2A 4MB2A 1CY1A 3CUSA 3NDRA 1XKQA 3KZCA 3IL2A 1O57A 1Z13A 2C8KA 4EQZA 3RREA 2OV3A 2ZTVA 4TUYB 1N7JA 3ZU5A 2OO3A 2BFEA 5E1BA 2I67A 1NZFA 3SZGA 2PX5A 4WOKA 3DFFA 5CXSA 1KSGA 2P7IA 2IWRA 4LTMA 4MITA 4RCZA 3U39A 3TSYA 1ZEJA 3V00A 2I4LA 4AJNA 1PEAA 2Q6IA 5J2UA 1KI2A 2BKUA 4GM0A 3MTDA 4IIJF 2O23A 1SA0A 4I6JA 1P5FA 4D9IA 3NXSA 5DYWA 5JOQA 4JXZA 1JMKC 2ERXA 4RK7A 4P7FA 1G5HA 4TMVA 4I36A 1E4OA 4DNFA 5JI3E 1ZQ1A 3GDOA 3NX4A 3VO2A 1JLRA 3P9YA 3D6HA 5KHLB 3I0NA 5LMUB 1DFIA 2OAP1 3P2EA 4TLCA 3WKCA 2HCRA 1SXIA 3GCWA 1F3OA 2EQAA 4ALKA 2FR8C 1D1QA 2GF0A 2BEWB 1GNLA 5ESXA 2C03A 4PNHA 3RIEA 4DNXA 1WSWA 4G65A 5CEJA 2C8LA 4C7BA 5DM60 2O7QA 1WXDA 2WMOB 3I9KA 4BO1A 4DYVA 3CLKA 4EBBA 1A9OA 2JFZA 3HUDA 4YJGB 1V3UA 1Y8RA 1M34B 2FWNA 3QFHA 3EGVA 2QY9A 1IBSA 1FP1D 2PBLA 4GOMD 4JT8A 1IEQA 1UZNA 3P0FA 1WUJS 3Q9LA 1J8YF 2QRJA 1N5LA 4IIJB 5C4IA 1KY4A 3HYCA 1CJSA 3HYSA 5BNIA 1AKTA 4U63A 1OLXB 2XCLA 3QX8A 4CG1A 4EG5A 2FPXA 3N8KA 4Q7JB 5LU9A 1PJZA 3M1YA 1LK5A 4XIYA 5IAOA 3R3ZA 4QULA 1YIOA 2CD7A 5KYXA 1VPWA 1TMOA 5IVKA 1NJ8A 3D1VA 3ZTYA 4CW7A 3UAZA 1U2PA 5KTMA 3DZCA 5I48A 1QHIA 1YB5A 3ONFA 4JODA 1WRBA 3O91A 4JOQA 3L7NA 2X4IA 1TL7C 3WB2A 2HQSA 1BHJA 2WWRA 4M0MA 4U2FA 5EQDA 5REQB 3KSBC 2FEWB 1Y8ZA 2F1IA 5LA6A 3OQ6A 2HWWA 3IKTA 4YJ3F 4R3NA 1RLMA 1ZUIA 4TKLA 1CBUA 4HNRA 2VF2A 3OIFA 4QYIB 3LY9A 4CFZA 3E18A 2ZDGA 5E6UA 4BLUA 4JITA 3EUAA 1QG0A 3K9BA 2BEUA 4J1NA 1O5IA 5DP2A 3TQFA 3EXAA 2JGMA 3ZGZA 4L28A 4BEVA 2VNIA 5JNLA 4MS3A 5FHRA 3K6SB 1Q92A 4HDKB 4NE7A 4G5QA 1JEYB 2HCTA 1NVVR 1SVLA 4FXPA 4LF9B 4F06A 3JAWA 4OBXA 5AESA 3B1FA 5ICGA 2J5XA 1O0CA 3MTGA 2JEOA 2XOXA 1PGNA 1XMIA 4F1KA 3KQYA 5C5EA 3PZRA 3A32A 3OEEA 1CUIA 4E5DA 3DOEA 1I3LA 3OY2A 1AZLA 4DV0B 1H0SA 4KBFA 1QRRA 4RKFA 1JJAA 5DLPA 1D4OA 3TRJA 3ZJ4A 4JVMA 1ZY2A 4BFZA 1G21B 2IUEA 5IC6A 4MIKA 4CL3A 5L6MB 4P4NA 3GA5A 3IP8A 3Q8WA 2IDZA 4A36A 3ZX4A 1WABA 4YJ3B 1Z6TA 3VVBA 1D1SA 1D5CA 3CF4A 5CB0A 1B2RA 2O05A 4L76A 4NWIA 4KPFC 1Y3AA 2XOKD 5L9AA 3LT0A 5L45A 1B43A 1IXYA 1KRWA 1P0QA 1OBFO 4MVYA 3H04A 2TSYB 2LIPA 2Y0DA 1OZFA 1BQ3A 3MYYA 2AZ4A 3P26A 3QLJA 4CM1A 2B1GA 4QODA 3ZK9A 4J9UE 2AR7A 3PD1A 4P22A 2CDRA 4YUZA 3I0MA 4ZT7A 5T4EA 1TZJA 4K8RB 1AQIA 1ZCJA 4RHTA 3W2TA 1PS8A 3QOWA 3EIQA 1I6LA 4AY2A 2J9RA 5K0CA 2QTCA 4LKRA 1G19A 4IJUA 5D3QA 4YRLA 4N65A 1R4MA 1NR7A 3IUMA 5EMNA 3TYXA 1A8IA 2A92A 4L9RA 2CNDA 5CVVA 1DBVO 5FV4A 1BGXT 2LVBA 1ZA2A 2C82A 5DTEA 5L3ZA 1WZCA 3NC0C 2A3NA 1TU4A 4LG1A 3TH5A 1R5BA 2PSEA 2MMGA 2ZSUA 1ZUD1 1G18A 3RHTA 2QMYA 5FI5A 3FCXA 3C43A 5C18A 2C8JA 3ROMA 4ZI5A 4G5SA 5AOBA 3TI9A 1FDOA 5BR4A 5L3QA 4HB2A 1NMEA 4UBKA 4EGFA 3LHKA 1D8TA 4UBJA 4XQGA 3B89A 4GICA 1N2XA 3PPWA 2X5OA 2X2OA 1XJ5A 1BW9B 2OTCA 1H8HD 1DRVA 1FXWF 3GL9A 1JTFA 4K6GA 2EP8A 3Q0EA 4LAFA 3T0IA 4N18A 1G7RA 1Q0QA 3JQAA 4UTOA 4ZYUA 2ZI5A 1FSSA 2Q2OA 3ADKA 1F2VA 3VH3A 2XUOA 3D4LA 2WNIA 1J2JA 2BH9A 2ZRNA 4FDTA 5CHEA 5T3UA 4J8PA 4JI6B 3O8NA 1UJ5A 2CFIA 3MVEA 1EH5A 4NBSA 4U02A 1Y3CE 4GSLA 5CVJA 2IKQA 1ZCBA 3DDNA 4QUDA 5FOVA 4RORA 5F77A 4PR3A 1BXZA 2ECOA 3K2QA 4FHCA 4AJ9A 1HT1E 4M8LA 4PS1A 1DTWA 2Y9PB 2QM8A 2HIMA 3AVQA 2X15A 3LT5A 3Q0IA 2IX3A 1Z8HA 2SICE 4Z9BA 3VR4A 2EFGA 4PS0A 4U9HS 3EIEA 2NLOA 3GJ6A 5KB3A 2JGLA 2QRPA 1P9WA 3GQBB 4LJRA 1GPDG 2Q9CA 3KHTA 3MJHA 4KX3A 1C41A 2EZUA 2XMSA 2L17A 2C84A 4TUYA 3VPHA 1AQYA 1Y98A 4RXUA 1XVAA 1S01A 2YIMA 3FGPA 3TZ6A 2VA8A 4D0GA 4KFTA 1S2OA 1PIWA 1CX9B 2OHIA 3T38A 3TFWA 4HN4B 5DBIA 3JQ6A 3JTEA 1AMUA 2AUMA 4FFSA 1CE8B 4IDBA 3SD7A 4AJJA 1VG1A 1VZ3A 3SSAA 5BVGB 5L7TA 4I46A 2QXYA 1L3IA 4OSEA 2GEBA 1CUSA 4V1CI 1KZ9A 3O0TA 1M2WA 2VDNB 2ESRA 4IDCA 5JO0A 1W1IA 3ETEA 3I72A 4IGKA 2C7RA 2V6GA 2BGRA 4F2DA 1Z15A 4P3XA 2BJHA 2FN9A 2RH8A 4N8EA 2B6HA 4DSOA 4AX8A 1X1QA 2ABWA 1I0LA 2QG9A 4MWGA 2C0QA 4QLBA 4I1UA 1AO3A 4QEZA 5K1ZA 1CS4C 3IP6A 2BEWA 5KTTA 1QZZA 1CUUA 2GEUA 1YIDA 2AFHB 2ZRQA 2BFAA 3GEPA 1UMDB 4FGWA 3SCZA 4JGBA 4EKYA 4QOEA 5T7BA 3V4VB 2JEYA 5A3RA 3TBKA 3WZLA 3UMCA 1R3UA 2AWNA 1NPTO 1B15A 1CZUA 1PQWA 2D2EA 3B3QA 3MTBA 1CRZA 2I3DA 1VE6A 1TVKB 4NS1A 5TC4A 1M34A 2V74B 4D9EA 5SYNA 2AZDA 3A9SA 5CT9A 5HW0A 3ZJTA 3A7DA 4CM8B 2P4HX 1E6CA 4IIJA 3OU2A 4DA9A 4UCWA 2V7PA 5C8VA 3DHWC 2JANA 2ZRBA 3NEAA 5AKLA 2ERYA 3NIWA 4NDZA 1HDOA 3UW3A 2PLAA 5I7OA 5FTNA 5BWCA 1OLXA 5K3AA 4LK3A 3IMGA 3HCNA 5AJXA 3ZWMA 2MYTA 1M8GA 3E81A 3BYZA 1RT9A 4A91A 2NO0A 2Q5FA 3GT3A 4UNQA 4H59A 1P6XA 3EMDA 1ARZA 3PWZA 1EKXA 2IYAA 5CCBA 3QBDA 3VYUB 3WGTA 2CE7A 4M1KA 3LKVA 3NAZA 3IR5A 1SUAA 5I7SA 4MUJA 5DHAA 5REQA 2XUIA 5AUPB 3EXIB 4LRWA 2GZ1A 3IESA 3Q2IA 5DHFA 1O6ZA 4HZIA 1Y4AE 4QGAA 1G2PA 1O8CA 2C4KA 1EFKA 2ECPA 4RFSB 3ZU3A 4ZV4A 2ZWIA 4QYIA 3HPQA 1M3SA 1P33A 5FL7A 5TPZA 4C43A 4H9GA 2PKWA 6AT1A 2PRYA 2NU9B 1HL7A 1EFVB 5F3DA 2JI4A 2EWVA 2FE1A 2ZKLA 2O2CA 1L9KA 2X0IA 4NEHB 2MR6A 3K6SA 1YCGA 4K6MA 4HDKA 1JEYA 5JARA 1I94B 2FOLA 3R3SA 2EFJA 1FE8A 3VNSA 1HNWB 3U80A 4B8YA 4TVBA 3F74A 5L4NA 1VP9A 2FZ5A 1HBJA 3ORQA 3TNYA 2CBZA 3CVOA 4XYMA 3PEVA 5J2TF 5KMGA 2FHPA 2M1XA 3NGXA 4L3VA 1G21A 1XCJA 4M9ZA 4NFSA 1D0IA 4HTFB 3OG9A 4WFKA 2GK4A 4J76A 2X42A 4YJ3A 3CINA 1ENOA 1RQ7A 2Q3JA 3E1GA 3HE3A 1XCGB 1YS7A 2AD1A 3IQWA 4R41A 3UJ3X 1ZL2A 1G16A 2TYSB 3A0RB 5HUHA 2YXEA 3LCMA 4RVGA 5BSVA 2QN9A 4GMFA 2QRZA 4CMKA 1TMYA 3GFRA 4N9QA 5LB2A 3BE4A 5DASA 3D6VA 2XUFA 1UPTA 3GGJA 4BQIA 4HV4A 1FP2A 2GVDC 3QENA 1TLFA 4DUGD 3STWA 4ZZIA 1V8ZA 1U3WA 3X1MA 4ZYYA 4KN9S 2FHSA 2ZJBA 3U49A 1WE2A 1OX6A 4J6FA 2P6RA 4OOFA 2AKYA 4BYMA 4Z4CA 1RXEA 3N6XA 2I1VB 3OZXA 1VHQA 3QU4A 4IXNA 5DZSA 5J2TB 1MRSA 2Z09A 4W5JA 1WLSA 1RI4A 1JE0A 2VRBA 1UJ2A 4MXDA 3W7AA 2WHXA 1Z6PA 3ZU2A 4OGFA 2FLVA 1JS1X 4YR7A 3IAEA 4EUHA 3JQRA 3ADPA 3EBOA 2YCBA 4JQCA 5JRJA 4WUTA 4R2KA 1ZN8A 5EIBC 1POWA 2GHQA 1S3SA 3VOBA 4BLRA 4ARAA 2BKLA 1BW9A 3MCVA 1K1EA 2QG4A 4Q02A 1T3ZA 5ULLA 5HIAA 4Y6QA 1VRCA 4K3VA 1QQTA 4R0MA 2DUNA 4ROSA 2ZI7A 1DAOA 1ZHOA 1LBEA 2J7PA 2F8LA 3FE2A 4B47A 5C37A 4JQYA 3NBUA 1E5VA 2P9CA 2YW2A 4UEWA 4X8MA 4OB6A 3ZPXA 1E4YA 3LSYA 2GCIA 1PKXA 3DEFA 2YJNA