1H2BA

Crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
343
structure length
343
Chain Sequence
KAARLHEYNKPLRIEDVDYPRLEGRFDVIVRIAGAGVCHTDLHLVQGMWHELLQPKLPYTLGHENVGYIEEVAEGVEGLEKGDPVILHPAVTDGTCLACRAGEDMHCENLEFPGLNIDGGFAEFMRTSHRSVIKLPKDISREKLVEMAPLADAGITAYRAVKKAARTLYPGAYVAIVGVGGLGHIAVQLLKVMTPATVIALDVKEEKLKLAERLGADHVVDARRDPVKQVMELTRGRGVNVAMDFVGSQATVDYTPYLLGRMGRLIIVGYGGELRFPTIRVISSEVSFEGSLVGNYVELHELVTLALQGKVRVEVDIHKLDEINDVLERLEKGEVLGRAVLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALCOHOL DEHYDROGENASE
publication title The structure of an alcohol dehydrogenase from the hyperthermophilic archaeon Aeropyrum pernix.
pubmed rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
total genus 112
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2002-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h2bA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1h2bA01
1ZIDA 2PZMA 1C0KA 2RBEA 4DQVA 2YW9A 1U8FO 4AICA 1OC2A 4R1NA 1EUZA 4NG5A 1KVSA 4KZPA 5KVCA 4CLOA 4WLVA 1LU9A 3ZHBA 2G5CA 3D5TA 4RDIA 4RVGA 4LCJA 1QMGA 1VPDA 1JLLA 2OGUA 2QQ5A 3BTSA 4MO2A 4BL5A 1F8GA 3NAQA 2JJYA 4ND3A 2WM3A 5JCJD 3L0DA 4BNMA 4HNHA 4CMEC 4R1UA 4EZBA 1DHRA 3ZU4A 4FCCA 5I7FA 1CQIA 1SMKA 4RLHA 1PJBA 2FR8A 5L51A 3ZN2A 1M75A 4LW8A 1UDCA 1EK6A 1WNTA 4EW6A 4YTEA 4BO3A 2C2YA 1P1RA 3AFMA 1IYZA 3INGA 4BNNA 4FR5A 3HFSA 2X4GA 5ENDA 5L40A 2FHSA 2ZTUA 3HN2A 1ZMTA 5I8WA 3TRIA 2VOEA 3ETGA 4ND2A 4LSMA 4MKRA 2AEMA 2NWQA 2FR0A 1IL0A 1BW9B 3GLQA 4RF4A 1JQBA 2I3AA 3OQ6A 4MKZA 2W2LD 2GN8A 1UXGA 4CV0A 4E30A 1LTHR 3HJAA 1LLUA 1GTMA 3E48A 1XCBA 3WGYA 1I30A 2PLAA 3WFJA 3E18A 1C0IA 3CSDA 2B4QA 3ETEA 4OM8A 1J6UA 3UAGA 1E7WA 1PWXA 2VCYA 5CDSA 4WCFB 5FI5A 1PJSA 5IDYA 1ZUD1 4BIIA 4OOFA 5I9MA 1NTOA 5JFOA 2EW2A 4IY1A 4J0EA 1ZK3A 3PJFA 1LQTA 5IXSA 3AK4A 3GVXA 4UVEA 4KQWA 3PQFA 1RJWA 3V1UA 1E5LA 1Z75A 1OMOA 4I8XA 1R12A 2PH3A 3UVEA 1YOVB 1A72A 3RKRA 4D0RA 2B0JA 3P2OA 1PGNA 1ZK1A 4ZVVA 2PGDA 2BGLA 1CQJA 1QR6A 2W2KA 3WWZA 1NM5A 3RQSA 3WNVA 4C4OA 4DLAA 1YB5A 2CY0A 3GG2A 4M54A 4E2YA 2EXXA 2Q1UA 3M1AA 4B3JA 1ZXBA 3UGKA 4EEXA 5IG2A 5A9SB 1GUYA 2YDXA 4BO8A 4YJHA 4R68A 4OXYA 1Z45A 5G0UA 4MJLA 4CUJA 5G0VA 1LQUA 2H63A 1JWAB 4BNKA 3BMOB 2AQIA 2O7QA 5IXYA 4RGBA 2ZTVA 5CDUA 1BDBA 4IGFA 3E9QA 3T4XA 4PZDA 2ZB8A 5CPFA 1HDRA 1GZ4A 4MVJI 2B4TO 2Y0DA 2IEBA 4YQZA 1O5IA 2H1SA 3U0BA 3JSAA 2GNAA 2NVWA 4PLYA 2O3TA 2X0JA 5G2OA 4CQMA 4O1MA 4R5MA 2C07A 2PZKA 3PFWO 4WNIA 3GK3A 1EFLA 1NXQA 5JDCA 1E1LA 4XDZA 1JKFA 2P68A 3U4CA 1ZXLA 3WGZA 4PVCA 4F46A 2CD9A 3DZBA 3A9WA 4Q9NA 4RF2A 5JMPA 5JC8A 4FIZA 5GZ6A 3GEGA 1NVGA 3GZ4A 3H7AA 5CHEA 4YWJA 4ZHSA 5KJ6A 4UUPA 2Q50A 1GEGA 3L9XA 3NRCA 3BIOA 3WS7A 4IBOA 3I3OA 4FJ1A 2BELA 2JL1A 3S2GA 1LC0A 1AUPA 5T6BA 2Y1DA 3UXYA 2Y0CA 4PLHA 4ZICA 4CMBA 1DOHA 3PTZA 1MB4A 4Y6RA 4GSLA 3FPCA 3ZV4A 2P9EA 3K2EA 5AXCA 5JE8A 4XRGA 5IJZA 3KYCA 2PY6A 2A94A 3S1LA 4HNGA 4XIJA 3O26A 4I5EA 4P4LA 1YGYA 1L7DA 2J3HA 1OI7A 2GGSA 3TL3A 3NEPX 1ISJA 4CR7A 5JCJA 3RAJA 1ZNQO 1XQ6A 2OZPA 5EINA 3FPLA 3GNQA 2GN9A 5JDCC 3D4PA 2X6TA 1JW9B 1QORA 5COQA 3ANNA 3AM3A 5H82A 1HRDA 3EHEA 4ONEA 1P0CA 5J23A 1W4ZA 4WLUA 4D3SA 5C37A 5L7TA 3A28A 2R6JA 3GVPA 1Q0QA 3MEQA 2DFVA 3DBRB 1T2FA 2PWZA 1ZMOA 3JQ8A 2XF8A 4NQZA 3U62A 4BGVA 4JK3A 5B37A 4D45A 1JDJA 5A3JA 4TVOA 3ZU5A 4GGOA 1KEPA 4OQYA 4J0FA 5BSGA 3LC1O 4FC6A 4YJFA 4ZQGA 1SO8A 3IDSA 2W2LA 1Y8RB 3BTUA 2O4UX 2BF7A 2ZQZA 4GGPA 1VSVA 1NAHA 4PLWA 3QVOA 1UP4A 4DBVO 1G6KA 2X0NA 3PZRA 2EKLA 2RHRA 3EGOA 3HQ4O 5G4KB 4D3FA 1CEQA 1SZJG 4PLVA 4BNTA 2B4RO 2Y1OA 3GVHA 4ZJUA 3E9MA 5F21A 1LJ8A 3VTFA 4IXTA 2NSDA 3PYXA 2OHXA 2DTXA 4EUFA 1JKIA 4EDFA 4YRDA 1LXCA 1V6AA 4XEHA 4CODB 5T5QA 5L95A 4Y98A 4JX8A 3LF2A 3KSZO 1C1DB 3TWOA 4ZU3A 4DQUA 3TF5A 1K2WA 1QRRA 4PRKA 3TZQA 1U7TA 5G4LA 3BTVA 1HL3A 4JBIA 4II3A 3VHRA 3JV7A 3EZYA 3WGTA 3UH1A 1YQDA 3OEYA 1KVQA 2F00A 4D0SA 1NWHA 4NZ9A 3ZWVA 2DPHA 4DWVA 1ML3A 3WJ7A 1QYDA 5ILGA 1ZW1A 5DP1A 3CH6A 4Q3DA 1VJ0A 2DAPA 4ROSA 3IUPA 4DQXA 3O03A 3PZBA 1E92A 1KC1A 1L1FA 1IY8A 1Z6ZA 3DAFA 4K6CA 1T4DA 2W4QA 3WJAA 1NWCA 2GZ2A 3DOOA 4BS9A 3U4IA 2X9GA 1ENOA 3OEWA 3KYBA 3PIDA 3LZ6A 2GSDA 4NFHA 2BFMA 4FN4A 3RBZA 4DVJA 3I9LA 8LDHA 1X7HA 3SBOA 3KHUA 3B6ZA 3DAPA 3GN1A 3L4BA 3RUIA 4TKLA 1ULSA 4DC0A 1AXGA 4KUHA 1PX0A 1LDEA 4JJIA 4ZQHA 3G0OA 1XU9A 3KXDA 1R0LA 3DEYX 4Y6PA 1DC5A 1GFSA 1SPXA 5EQFA 1HZZA 1XEAA 4IDEA 1ISHA 3BMCA 3VPXA 3AY7A 4JNKA 1EVIA 4D46A 4E5MA 5JY6A 5JNLA 4GWGA 3ZDFA 5L4SA 1ISMA 4LVCA 3RUAA 4WE3A 3HNPA 4CJXA 2RH8A 1HYGA 3QWFA 2PD4A 4MP3A 1F14A 1TT5A 4ND5A 2I66A 4A5OA 4ALKA 3D5QA 3NT5A 4NBTA 4HY3A 2O50A 3A06A 1HYHA 4X54A 3O9ZA 3D1LA 4JBHA 2HDHA 3EK2A 4BNYA 5L4NA 2PK3A 2YV1A 3JYQA 4QX6A 1K0UA 1E3WB 1DC6A 1S6YA 3D3WA 2SCUA 1QKIA 1WWKA 5EQDA 3VZQA 5ENVA 4JQCA 3KBOA 3T7CA 5HS6A 1PJCA 3GRKA 3ZWXA 3CMCO 4MVJP 4A73A 2DQ4A 3MOIA 2VUTA 2HK7A 5MDHA 1XKQA 1UUFA 3I9KA 3ONEA 5K0ZA 3DOJA 4CLXA 4LMRA 2NTJA 3FNFA 5FFFA 3I9MA 5JMWA 4S3MA 1DSSG 4IDDA 2GN6A 3CE6A 4KWHA 4JROA 3V5NA 3NV9A 1E6EA 6ADHA 3OF2A 3DZIA 1CJCA 1EVZA 3RJ5A 1UZLA 3ABIA 4K1LA 3Q1LA 5KVVA 1F12A 4ALLA 1D7OA 2VRCD 3QWAA 4E4YA 4KUEA 4WLOA 3SJ7A 4BKOA 3WB9A 1U3UA 2Q46A 2W90A 2X0RA 2XAAA 3N74A 4AJEA 3LDHA 1ENZA 1U5CA 3R1IA 3VPSA 3ZWNA 1EEHA 4CMIB 4CMAA 1U3WA 2YUTA 1FXSA 1GPDG 1ADCA 2X9VA 3AI2A 3RWBA 1H6CA 4AVYA 3INTA 2VHYA 3GVCA 4UEOA 1Q7BA 3HWRA 1DIGA 2RH4A 4HFJA 1NQ5A 1QV6A 4OOEA 4NU6A 1V0JA 5T67A 2J5RA 2O3JA 1GCUA 5A03A 1JTVA 4UULA 2NU8A 2WEKA 1HDZA 3T4EA 2NU9A 4IIVA 4O5OA 2Y05A 2CF6A 2XPCA 1E7QA 1E1KA 3EY4A 3E82A 3GT0A 3PWZA 5KKCA 3JQ7A 3GOHA 2V6BA 1QYXA 4DLBA 2O7SA 1WDMA 2Y66A 2NVUA 4L9RA 4XWYA 1NYTA 2VNSA 3DTTA 1HTBA 2WD7A 1LBEA 4CLRB 4IDCA 2PV7A 2HSDA 4NFSA 5HM8A 4XB1A 5JC1A 2TMDA 4DIFA 3C3XA 5GZ3A 3CMMA 1PJQA 3B1FA 3DZJA 4CMJA 1EQUA 1BWSA 2WD8A 2AG5A 2JD1A 2RHCA 2V65A 1MXFA 3LQFA 1NQAO 2ZB7A 4ZRNA 3KVOA 4DIOA 5GMOA 3DBLA 1MFPA 4R69A 4D3DA 1DLIA 4BO7A 4JN6B 4TRRA 1I2BA 2B5WA 3FWZA 1PR3A 5TLSA 2FY8A 3LSYA 3F47A 3QA9A 4D44A 5LDHA 2PR2A 3JTMA 3AI3A 2X0IA 1ZK0A 3H9GA 1DC3A 3OM9A 4JGBA 5TT1A 3W4IA 2AEFA 4Z0HO 1GYPA 4AG3A 3KZVA 4FJ0A 2QYSA 1GD1O 3BA1A 4MIOA 1KEUA 2VQ3A 3TJRA 1ZO8A 3ASUA 1MUUA 3FD8A 1UZNA 3EVNA 2EW8A 2QZZA 1SAYA 1Y7TA 3C24A 3OHSX 2I76A 4NK4A 9LDBA 1CWUA 1UXIA 1B8UA 1I3LA 4ALNA 4M55A 1VL6A 4FC7A 1C0LA 1Y8QB 2QG4A 4JLWA 4TQGA 1U3VA 5BQFA 3NTOA 2PGJA 4NBUA 5JXWA 4Q39A 3VZSA 2WDZA 4NBWA 2D8AA 4BNLA 5JAZA 4XB2A 1YL6A 2EG9A 4Z9XA 2J5KA 2O3SA 3KO8A 3OQBA 3DFZA 4MPDA 4DIBA 5CAEA 1N7HA 2GF2A 4ZGWA 3DHEA 4HBGA 5JLAA 1EZ4A 5EMHA 1GADO 3Q2KA 1NAIA 1QSGA 1PS9A 3Q3CA 3WQRA 3RC7A 1EQ2A 5ITWA 4C7KA 1VKNA 3DBHA 5G0TA 5TX7A 1ONOA 3HSKA 4L74A 5FWNA 2A4KA 2FR1A 3N7UA 4AJ1A 4J2OA 2WYUA 4HFRA 4E21A 1A4IA 5F1PA 1GAEO 1R0KA 2WTBA 2NQTA 3UFXA 1NPYA 1ARZA 1JWBB 3IKVA 2AG8A 1HDXA 4J1TA 1NNUA 1GQQA 4N54A 2ZYGA 4YRBA 4RPLA 1WZEA 2ZK7A 3KEOA 3R6DA 4PG7A 1W8DA 3LC2O 2OUIA 4W82A 3GEDA 4CM4A 2CVZA 1XELA 3V8BA 4DA9A 1C3VA 1FDVA 2P9CA 2GRAA 2FPGA 3E8XA 3H2SA 4DPKA 3H2ZA 1VJ1A 5L9AA 1HXHA 2HRZA 3UHAA 5HTOA 3RD5A 1SNYA 1M76A 1RM4A 2DTDA 2VRCA 4O59O 1A9YA 3OQ1A 1EFKA 1T4BA 1J4AA 3HG7A 5BSFA 2GDZA 4P8RA 4RLSA 3W8EA 1UDBA 2HUNA 1NPDA 2ZB3A 3WTCA 4RPGA 1Z7EA 4E5KA 1EE2A 2YDYA 3ZZNA 2DU8A 1HE4A 2ZIZA 3O38A 3NDJA 2X86A 2PKQP 2O2YA 4PVDA 4XQ9A 4RJTA 4J49A 4GLLA 4U7WA 1LC3A 1H6DA 3PFFA 5IZ4A 2NU7A 3NJ8A 5I7EA 2X8LA 3BHIA 5T64A 2ZTLA 4J7UA 3E6AA 2BFPA 2BLLA 3IUSA 1UP7A 3P7MA 4OO3A 3IMFA 5KIAA 2QRLA 3JQEA 2NACA 3GMSA 1BXGB 3GGOA 4HXYA 1CETA 4FJ2A 3PYMA 2C0CA 5CDGA 4LK3A 4TMFA 3RBXA 2Z95A 1R0SA 1BW9A 2RIRA 4G5HA 4MINA 5U4QA 4E5NA 2CMDA 3F5SA 2X5JO 3Q9UA 4K28A 4WASA 4EJMA 3H8VA 1QP8A 4PLGA 4RF5A 4G81A 5DT9A 4ZN6A 3K6JA 4E5PA 3MJEA 2WMDA 2DUUA 3PLRA 3S2FA 2Y1GA 4AJHA 2PD6A 4IZHA 1Z82A 3C85A 2GN4A 4I5FA 4WCFA 1U9JA 5DZSA 1TXGA 3WGIA 4RDHA 4OAQA 3H5NA 1EDOA 1C14A 2CZCA 1IZ0A 5A3VA 2V7PA 2Z1MA 1WXDA 3P19A 4DYDA 2C7GA 1XDWA 2EJVA 3QE3A 4OMUA 5C7LO 1YXMA 3G1TA 3C7CB 1HDYA 2Q99A 3FWNA 1WDKA 3ZI0A 5JW6A 4GX2A 3LT1A 2WYVA 1W0CA 1LDBA 3GUCA 3QVSA 2PA3A 4GSKA 5L45A 2Y68A 3JQ9A 4IXWA 5ICMA 4NU5A 1HE3A 4IS2A 3LT2A 1LNQA 4RORA 4WEQA 2HMUA 5AVOA 3QWBA 3M1LA 1DC4A 4XGKA 4BNWA 4KQXA 1DRVA 4BO9A 2Y1CA 1ENYA 2AW5A 4GI2A 4F6CA 5A9SA 2D0IA 4FFRA 5L7WA 3GH3A 1NR1A 3ONDA 2Y93A 4NDNE 1Q7CA 3BMOA 3WQQA 3OH8A 1R15A 1P1HA 3RC1A 4WCDA 1R6DA 3GQVA 1QYCA 3VTZA 3JD1A 3TFQA 4CM8B 4UUMA 1KOLA 1EK5A 3WWYA 1YONA 1GYRA 1RKXA 4XDYA 1OOEA 4A2CA 5BR7A 3QHAA 1PJ3A 1YBVA 5DCUA 3MOGA 4Z9FA 4UREA 4ZQEA 4DXHA 1O8CA 1C1XB 1U4SA 1Y5MA 5L7YA 5MGBA 1UH5A 3DHNA 4E5YA 3R3SA 4R3WA 1D3AA 4TSKA 1YQGA 2DPGA 5COAA 3LVFO 3SLGA 1VE9A 1U4OA 3GY0A 5KJEA 1N1EA 1IPFA 1NFQA 1P0FA 1XGKA 1P45A 3WIEA 2VZ8A 4KP7A 2JCVA 1NFRA 2HKIA 3TL2A 3LC7O 1MXHA 4ILKA 1BVRA 3ENKA 4QQRA 1NPTO 1T24A 2D4AA 5KWEA 2C54A 5DBIA 1JVBA 1TT7A 1YWGO 3LYLA 1YJ8A 1YB4A 4JIGA 2Q2VA 1H2HA 4BO2A 5ICSA 1YS4A 1GYQA 3GGGA 4GLOA 3TZ6A 3K9QO 1A27A 1P9LA 2ZJ0A 5JY1A 1CERA 3BMNA 4YQYA 5TS3A 1T2AA 2VWPA 3O8QB 1FK8A 1QLJA 1FMCA 3ONFA 3PHGA 3W1VA 1ZH8A 7MDHA 4YPOA 4NPCA 4BO5A 4QSMA 1HDCA 3OJOA 4P22A 2IZZA 4B8WA 1NHWA 1O94A 3FRJA 4ESOA 1BMDA 5IDWA 4RVDA 3PEFA 2PKRA 4YJDA 1Q2XA 3V2GA 5CP8A 1MC5A 4J6FA 2IRWA 1D4FA 4RV9A 5GZ1A 2ZATA 4TKMA 1ZKMA 4MDHA 3EAGA 3QVTA 4LRSB 3DBRA 3PXXA 5EIOA 5DNAA 3WICA 4M49A 3W4KA 1R4MB 3BYZA 3RKUA 3AUTA 3C1AA 5TIIA 3JQGA 4OXKA 4NBVA 4Q3NA 5L3ZA 3F4BA 4CM6A 4D79A 4M86A 1ZZEA 1PJ4A 4MVJG 1F8FA 3WYBA 2IYPA 3A4VA 3DBVO 3RUEA 3QW2A 4RPJA 4R1TA 1EMDA 1PQPA 5ER9A 4FD3A 4Z0PA 5G4KA 5HS4A 4U6SA 1SB9A 2JCXA 3FBGA 3W6UA 1UR5A 2VYND 3VPHA 3X2EA 1YO6A 3D0OA 4GL4A 3PK0A 5EL0A 5B1YA 1E7YA 4CMHA 2J6IA 3CTMA 3RU7A 3ROKA 2QHXA 5KTKA 1LI4A 2YFQA 2ZKLA 3OIDA 5I9NA 4HKTA 1CIVA 2EKPA 4NK5A 4TZKA 1SEPA 1QG6A 1SC6A 3E5RA 3ZU2A 3B1JA 3DFUA 2A92A 3GNSA 1I5RA 4L76A 4L73A 4W7HA 1C1DA 4OIMA 2POQX 4CMCA 5BNIA 4YAIA 3K96A 3HE3A 4CPDA 2FMUA 4HFNA 1PGPA 2HAEA 3FTNA 2GYYA 3ROQA 4QFDA 4J1QA 2JD2A 1V3TA 3I4CA 4L75A 3GHHA 1DFGA 4J4BA 4NMHA 2Q4EA 2TMGA 3EUWA 3NUGA 4IJKA 3GHYA 4BB5A 4EEZA 2GERA 3M2PA 2B69A 4FFPA 2UYYA 4BNGA 4OHUA 4XR9A 4DPMA 2AE1A 5IZCA 2EJWA 5TGDA 1VC2A 1ZSVA 5AOVA 2OXIA 1VRWA 2NQ8A 3D3EA 1B8PA 2BI7A 3QY9A 1HSOA 3WG9A 4L4XA 2CNBA 1A4UA 1PGQA 1XU7A 3LT4A 2BGKA 3VC7A 3RASA 4BV9A 2BI8A 5TSDA 4B7UA 5JS6A 4YVFA 4WKGA 3AM5A 4FGWA 2NLOA 4FFOA 1U2GA 3PQDA 3VPGA 3G17A 1M66A 3COSA 3Q9NA 3OICA 1U1IA 2NUAA 4I1IA 4AJKA 4BQPA 2VRBA 3WBFA 2ILTA 2CDAA 3HN7A 1NFFA 9LDTA 1T2EA 1MLDA 1I01A 1ENPA 3G49A 1XLTA 2PNFA 1N2SA 4CQLA 5CEJA 4R51A 4IPTA 5IZCC 1X1EA 2F1KA 4CM3A 4CQMB 5CDYA 2I67A 2DKNA 4EYEA 1WDLA 1TA4A 1ONNA 3P5SA 3KOUA 2CUKA 1RM3A 1NBOA 4TWRA 4Q3EA 2AHRA 3JD3A 4KDFA 1BRMA 5JAQA 4MKXA 5DBFA 5I7SA 2Q4BA 3H9QA 3ZWYA 1E7RA 1SBYA 4IGEA 4XYLA 1PR9A 1I3KA 4E12A 3UOGA 4YEDA 3CKYA 5COBA 1E3WA 5DDIP 3FNGA 1SOWA 3ZH2A 2EGGA 1AN9A 4WECA 1DBVO 4B3HA 1HETA 3Q6IA 1IOLA 4GVXA 2EEZA 4JJFA 3UCEA 4RVSA 2AQKA 3MWDB 5CEFA 1BXZA 3K92A 3JQBA 4E31A 3HHPA 4R01A 4BNXA 3DB2A 4FFLA 2A9FA 4XJSA 2Z1NA 3WGQA 4DTIA 5THKA 3AM4A 2I6TA 1E3IA 5JAMA 3GEMA 1EVYA 5CFZA 3FTPA 3RC2A 3D7LA 5C7IO 1CRWG 2FZEA 4GX5A 3ZCXA 3GRPA 3VZPA 1ONPA 1UAGA 1WP4A 1DLJA 4RF3A 3UCFA 2C20A 3EC7A 3S8MA 3TDKA 4ALJA 1EDZA 3UICA 3H9JA 4FS3A 3RSHA 3BXXA 3JQ8B 3SJUA 4ND4A 4CMIA 2IODA 2ZTMA 3X2FA 4W9NA 5BSHA 1PZHA 3ASVA 3Q0EA 2DT5A 2PZJA 1RYEA 2VHXA 1LRJA 1FJHA 1VL8A 1LDMA 3JQAB 4CMKA 1LLDA 1U2DA 2VYNA 1EUCA 4ID9A 1B7GO 3HDHA 1HEUA 5AYVA 2UAGA 3JQBC 4B7CA 4BNHA 1SEVA 2LDXA 2O4CA 3CPSA 3IKTA 4NNJA 1LRLA 2Y1EA 1I3NA 3AU9A 5FYDA 5TJ9A 3L4BC 4AFNA 4KMSA 4J9VA 4RZHA 1I2ZA 1K6IA 3PWSA 2DBQA 1ORRA 4ALMA 3G1UA 1W6UA 4U6QA 4XJTA 2AEJA 3F1KA 3RFXA 4JP2A 2YV3A 1DB3A 2AE2A 3CIFA 2P4QA 3UUWA 4MIYA 3C7AA 5HA5A 2YQ5A 2XXJA 4N18A 3U09A 5T57A 1T2CA 3E1KA 2CF5A 2VWQA 1E0DA 3OECA 1ADFA 2VZ0A 4EJ0A 4LRTB 3AUSA 5GY7A 1GQ2A 3NTRA 3A1NA 4CV3A 4YT4A 3C1TA 3BHJA 4F3YA 1W73A 3M2TA 5EJ2A 1AGNA 2RAFA 1B3RA 3MJVA 3KYDB 1N9GB 4FFMA 2Q49A 4XZ3A 1X15A 2HJRA 4YAKA 5LC1A 1J49A 1HLPA 1P1IA 1S7CA 3HUDA 5JSFA 1E6WA 1ADBA 2BH9A 1JN0A 1V8BA 4RO0A 4MOWA 3AFNA 2VYVA 4B3IA 3EVTA 2LDBA 3H4VA 4URFA 3JQFA 3FNEA 4G2NA 4B4OA 5I9LA 5JO9A 2NADA 2UVDA 2D2IA 4ZQBA 2CFCA 2DBVO 3EW7A 4LSWA 4DRYA 5DP2A 2D3TA 5HBRA 4Z9YA 3PHIA 1PZEA 3GFGA 1JKJA 1BGVA 1I33A 3PPIA 4DLLA 3AWDA 1GEEA 3GNTA 4B4VA 3A14A 1GL3A 4XYGA 4PCVA 2GASA 4A26A 2UV8A 2HCTA 3TZKA 4GMGA 1BXKA 4NJMB 3WGOA 3F6YA 3GC6A 3WMXA 2B35A 4PLTA 5EN4A 2QX7A 3HZZA 2D59A 3DMTA 1LUAA 4AJJA 2JAHA 1GV1A 2EWMA 2VHWA 2YFHA 3O4RA 4XR4A 5H81A 1T1RA 1TT5B 1ZBQA 4RCVA 1IULA 5LDGA 3RUHA 3B20A 3OP4A 3JQFC 5A5EA 4BMSA 3D64A 8ADHA 1A7AA 2FOIA 3JD2A 4MP6A 1XA0A 4OGWA 4DUPA 4NR0A 5CDTA 3FF4A 1H0KA 4HFMA 1U8XX 1QYVA 4QUKA 4XQEA 1VJTA 3IAHA 5DCWA 1M6WA 2YV2A 4GBJA 1EVJA 1GQYA 4IJVA 1LSOA 2YHUA 3DR3A 2VTEA 4M87A 4H3VA 4ZRMA 2OP0A 4FOSA 1KEWA 5TNXA 4D7AA 1ZEMA 1P1FA 2UUOA 4N5NA 1Q1NA 2GZ1A 3U49A 3WGHA 5G0WA 4CLDA 4A27A 3CXRA 3CEAA 2YHIB 4S1VA 1O89A 1PSDA 4DYVA 4W4TA 1YDWA 1HZJA 1LA2A 1Q7GA 4CMGA 3IC5A 3DMTC 3MTGA 4P4NA 1V3VA 3W8DA 3ANLA 2C5EA 1OAAA 3GUYA 4JBGA 4BKQA 1K6JA 4RPHA 4OKIA 2EGHA 3SC4A 4BKRA 3RUFA 2FZWA 5IDXA 1IUKA 5BNTA 4AL4A 2GLXA 4XKJA 4KWIA 1YBMA 3GZNB 2W98A 5K6AA 4J3FA 2EIHA 3BZUA 3QWIA 1PL8A 1YKFA 2JFHA 3WTBA 2G17A 5TF4A 4OL9A 1ISFA 2OFPA 1VSUA 4YBZA 3RCBA 2VT2A 4YJGB 4PLZA 2V6MA 1RM5A 1TLTA 1LDGA 3MCVA 3Q2IA 1NQOA 2PKQO 1DXYA 2FSVA 2BRUA 3RUCA 4DC1A 3LLSA 5HWSA 3BMQB 4H15A 4UVHA 1O9BA 1MG0A 2I3GA 3GDGA 3K31A 4M1QA 3RFVA 2QW8A 3VH1A 5JAIA 4BOYA 5A02A 3SXPA 3WMWA 3PYLA 3HDJA 4RL6A 1UP6A 2VNAA 4E2XA 4XQCA 2DTEA 4IS3A 1E1MA 4BNJA 3ZWPA 3F9IA 3QLJA 1E7MA 1PJ2A 5BSEA 3BHMA 3ENNA 4EITA 3E9NA 2WD7B 2VWGA 5K6AC 2C5AA 3DHYA 2CVOA 5KVQA 1VI2A 6LDHA 1NVTA 2Q2QA 3WGGA 4LVUA 1EUDA 4U5QA 1I10A 1IZ9A 1E7SA 3K73O 3ROMA 4E3ZA 1UXKA 1Y5RA 4ZD6A 5TC4A 1NVMB 2ZB4A 1XYGA 3QQPA 4EUHA 3SLKA 4XA8A 3DWFA 3OA2A 5IN5A 4I08A 3DXFA 4MVJM 2OO5A 3IP3A 3DOCA 4IDAA 1IE3A 3GFBA 5IF3A 5CPBA 3GGPA 3ANMA 1IHYA 2FWMX 1BSVA 3IP1A 3MZ0A 2JAPA 2ZYDA 4WNCA 4JP3A 2I5PO 3UCXA 2E6UX 3L9WA 2B36A 3TFOA 4IINA 3LK7A 1XHLA 4YAEA 2IE0A 1VL0A 3PHLA 4M89A 4P4GA 4N5MA 3VKVA 4DMMA 4AJ2A 4MVJE 2HMWA 2WE8A 2DUWA 1Y1PA 1K5HA 3JQ6A 2YYYA 4J4HA 1U3TA 4GPD1 5IAAA 1R16A 1LDNA 2Y0EA 3U9LA 3GR6A 1F06A 2B83A 3PHHA 3VDQA 2NTNA 4UEJA 1X0VA 4PLPA 2IXBA 4DL9A 2O3QA 3TSCA 1NQTA 1H6BA 3NDIA 4CR6A 1Y9AA 2JHFA 3H9UA 1HWYA 4BHTA 3FNHA 2VHZA 4ZA2A 5ADHA 4R9SA 3F4LA 3WX0A 2CVQA 2EERA 5JDIA 3AW9A 2WJPA 4Q3AA 1HKUA 4CM8A 1H9AA 1LLCA 3AOEA 4LN1A 2Y1FA 1FDTA 1DIRA 2HMTA 3M6IA 3DO5A 4PN3A 3L6DA 4PG8A 2AA3A 3KV3O 4LMPA 1LEHA 4IDBA 1TVEA 2FP4A 4UEKA 2GUGA 2EKQA 1C1XA 1WMBA 1M2WA 3E03A 1RYDA 4XGIA 3RIHA 5HRUA 1UJMA 3QIVA 1LX6A 3AI1A 3WSVA 4TROA 3WLEA 3ZGYA 4QO8A 1FDUA 3WR5A 2I65A 2YQ4A 4IM7A 4MP8A 3VVBA 2AQ8A 3QWHA 3H3JA 4CMEA 3FR7A 1YOVA 2I99A 5B12A 4R54A 4CM4B 4WPGA 2DVMA 5IFLA 1XIVA 3NT4A 5JDIC 3VH3A 1V9LA 4YCAA 1A7KA 1ZVMA 3STHA 1MV8A 2C59A 3AOEC 4QECA 3ICPA 3NX4A 3W6ZA 3LU1A 3PDUA 4GVLA 1N8KA 4DREA 3E5MA 4E2WA 4INAA 4KTVE 1WW8A 1LSSA 1B14A 1GU7A 4AJPA 2WYWA 1YQXA 1ADGA 2X5OA 2GCGA 2DC1A 3H9EO 3OMLA 4E13A 5C5IA 4WCFC 1KS9A 3ON5A 1YVEI 1SOVA 3H6KA 4CUZA 3SX2A 2ZYAA 1G0OA 4I9NA 4B8ZA 1R4NB 2VHVA 3OJEA 1CDOA 1Y9EA 1GPJA 4Z0TA 4IDFA 1BDMA 4NBRA 4YT5A 1YDEA 2R2GA 5JBIA 3D4OA 4IDGA 3WSWA 1R4MA 4YT8A 3DZHA 4GAEA 3ZNOA 4TRJA 4PZEA 3PWKA 1P31A 2AXQA 1RPNA 3I6IA 3RFTA 5ITVA 5TT0A 1NR7A 1EBUA 1ZK2A 3ZW9A 4FB5A 4NHEA 3I6QA 1BHSA 3JQ9C 1YB1A 4YYZA 3S55A 2NVBA 2E82A 1PWZA 1HDGO 1C0PA 1YJQA 4QTZA 4TRMA 3ZHYA 4W99A 1ISIA 1O0SA 5DOZA 1X7GA 5T8KA 5BT9A 1UAYA 1HDOA 1ZJYA 1N1GA 1K3TA 3JQAD 1SCUA 3D4NA 5L53A 1QV7A 3NJ4A 4M8SA 3F3SA 3F5QA 4WLEA 1HYEA 4OH1A 3W8FA 1GZ6A 5K9ZA 1B15A 5A1TA 2QRKA 1VM6A 3OSUA 2PH5A 3VVCA 1L7EA 3FHLA 4FQ8A 4YT2A 3WLFA 1MA0A 4MVJH 4MVJD 4J43A 3ZWOA 2P5UA 3NKLA 3ITKA 4LISA 4XRRA 3WQSB 1PJLA 3PGXA 1GDHA 4UAGA 3RI3A 4MVJF 2D1YA 1KVRA 3ZWMA 2V6GA 1G1AA 2QYTA 1A5ZA 3K5PA 1RWBA 2ZJ1A 4RVFA 1PTJA 3R3JA 4G65A 4CLOB 4KUGA 3DTYA 3HDYA 1MG5A 5DBGA 2GPTA 3B70A 4WLNA 4NI5A 4QT0A 4GQAA 2GR9A 3HFGA 4MIEA 4Z3KA 1I32A 3H3FA 5EESA 4Z6KA 1YH3A 2PTGA 1ZEJA 3PJDA 5T8KC 4IQ0A 2J5QA 2PZLA 2EP5A 1H94A 1KEVA 1AHIA 3LLVA 4JXKA 4O6VA 4CR8A 3FSRA 1PZGA 1X14A 4OSPA 4R5HA 5L4LA 3INRA 1P1KA 4FDAA 4J4TA 3ZV3A 1NASA 3DZFA 4IQGA 3U4HA 1BVUA 1DJNA 1WVGA 1X1TA 1Y8RA 3G3EA 3GPDG 2HK9A 4PG6A 4ZQFA 3FI9A 4GX0A 1PIWA 4EI2A 3CZMA 4NIMA 3JD0A 3GN2A 4IJWA 3S2EA 3ZHXA 4BMNA 2G1UA 2I9PA 4XYEA 4OXNA 4XCVA 4BO6A 5H83A 3CZRA 4LCEA 5IDQA 3RUDA 3H5RA 1ZK4A 3PHJA 3L77A 4IJUA 4K6FA 2NV6A 4Y9DA 1B3BA 1J5PA 3OETA 1I36A 1YL7A 4BO0A 2BGMA 2CDCA 5KCZA 3TOXA 4R41A 3DAGA 1X13A 4IZIA 4U8GA 5KJCA 4EGFA 1OBFO 4FPXA 1KVUA 2UUPA 5K1SA 5A9RA 1J0XO 3LT0A 3LF1A 4R4JA 4YAGA 4BB6A 4XX0A 2H9IA 4Y67A 3FN4A 2NTVA 3QSGA 1DJQA 4NJOA 3B1KA 4RZIA 4IMPA 5ES3A 2VUUA 2X22A 4XQGA 1LLQA 1GR0A 4FGSA 4ALIA 3KETA 4I9HA 4CL3A 4OKNA 4PG4A 2O23A 2IEDA 1LRKA 2IZ1A 1R66A 1U28A 3TZCA 1GCOA 2XOXA 2W2KB 4QFCA 3BMNB 3DL2A 3R0IA 3FR8A 4GX1A 2A35A 2IXAA 3H5AA 4HUJA 4J90A 4UVGA 4EUEA 3EZLA 2D5AA 7ADHA 5AXAA 1MC4A 4PFJA 1DIBA 2HJSA 1YRLA 2PFGA 5EERA 3MJTA 3PIIA 2E4AA 4YJHB 5ER6A 1E1NA 3IQDB 3ADOA 3PJGA 3VAZA 1KETA 4KOAA 3EYWA 3PGJA 5U9CA 2AQHA 2VYVD 5A06A 2Q2WA 3JYNA 1ZJZA 4PZCA 1BTOA 1MFZA 3RBVA 3WNQA 4CLEA 1PS0A 4FBGA 4F45A 4BV8A 3JQGB 4L4RA 4D41A 5CEEA 3F1LA 1F17A 1OC4A 1P74A 1DEHA 2EP7A 1WZIA 2Q1SA 2X1HA 3KTDA 4R16A 4R9RA 2X9NA 3ZHZA 2BKAA 1DFIA 1TI7A 3JQAA 1UZMA 1I3MA 4UVDA 4TVBA 1KBZA 1N92A 4RQUA 3K8ZA 2OBNA 3FCOA 1XR3A 3TPCA 3UF0A 4PRLA 4UVIA 3UKOA 3W4JA 3GDOA 4AJOA 2EF1A 3PVZA 4Z3DA 1IPEA 3C8MA 1ZCJA 2NM0A 3DQPA 4MVJA 1FDWA 1UDAA 1Z7BA 3I9JA 3G79A 3OJFA 4U0KA 1M6HA 3MJSA 1MX3A 1Y81A 4AJ4A 1NX6A 1AXEA 2BMAA 4PGFA 4J1NA 3PJEA 2C2XA 5A5FA 1B26A 2Q1WA 2IYOA 3MTJA 2BFOA 4OQZA 4OYRA 3ZU3A 3U4DA 3GVIA 3L6EA 4R1SA 1EE9A 2Q3EA 4E0BA 3MJCA 3V2UA 4BVAA 3IL2A 1KY5A 1DAPA 3QRWA 1DDOA 3KYCB 1Q0LA 1UXHA 4DMLA 3KEQA 2C29D 4CM5A 3JQDA 1PL7A 2J3IA 2NNLD 4WUVA 3MWEB 2JCYA 1LSUA 3PP8A 5IN4A 1B8VA 3V1TC 2HRBA 4JCOA 3JD4A 4BMVA 5CG1A 3KYDA 1N9GA 3DC2A 3QJ5A 5A9TA 2QZ9A 3GG9A 2D5CA 3P2YA 4ITUA 2R00A 4N5LA 2FPIA 3DDNA 3ZWBA 4XGNA 3CINA 4HX5A 3U5TA 2QIOA 1M67A 4QO7A 4XIYA 1E6UA 2P5YA 2VOJA 4U0JA 4AJNA 1D8AA 1MGOA 3QP9A 3VH4A 2Q45A 3I9OA 1PGJA 2XXBA 3HADA 1GY8A 5TJHA 3TNLA 2X58A 4J16A 1XSEA 4YJFB 1QLHA 1PJTA 4BO1A 4TRNA 5TQVA 2O3RA 2WE7A 1P3DA 2ZQYA 3L4SO 2X7HA 3I9NA 2HMVA 3PRJA 1WPQA 5CG2A 1OZAA 2Y67A 3NGXA 2CSUA 3I23A 4NJMA 1NP3A 4BQRA 1JAXA 5JO0A 3ICCA 2E37A 4J91A 5JCXA 3I4FA 1I8TA 3GDFA 4CQLB 2X23A 4GMFA 2ZCVA 2R00C 4NH4A 3GMDA 4BO4A 3DZKA 4YR9A 1KYQA 4QEDA 3K30A 4JJGA 4D42A 4DBZA 1P33A 1H93A 4CM1A 4XYMA 1ISGA 3EMKA 4CLRA 4WJZA 3MJ4A 1WLYA 3FBTA 4PLCA 5F5NA 3L07A 3K2BA 1ZFNA 4II2A 3H65A 5JYEA 1HT0A 3BTOA 4IMRA 4W9NC 3KLPX 2H6EA 2WWRA 1E3LA 4WOJA 4L4SA 4ND1A 3QVWA 2P2SA 2BFAA 4J7CA 3ZNPA 4RQTA 1B2LA 3I52A 4CL8A 3TN7A 4CM9D 1XG5A 3NTQA 4BNUA 3WOHA 4BNZA 1TEHA 4BGUA 2GD1O 2Q1TA 3Q11A 5C3MA 4HP8A 5DCYA 3RJ9A 4CV1A 1ID1A 2J3JA 3BAZA 5AQ1A 4H16A 5DULA 3GAZA 3ZWCA 2GZ3A 5THQA 1B16A 3IJRA 4GH5A 4BUCA 2YHIA 1I2CA 4B4UA 4WK6A 2VUSA 1KVTA 1PQUA 5B4TA 3JYLA 1HSZA 4E2ZA 3VH2A 3ZV6A 2HK8A 4B4WA 1MP0A 4C7JA 1BG6A 4A7PA 2BD0A 2OOSA 5F5LA 4BNFA 2OORA 1PU2A 1DFHA 3EDMA 4PIVA 4GKVA 4CUKA 5KJ1A 4KTTE 3KB6A 4BNVA 1Y8QA 3GZNA 3SC6A 2DM6A 3TQHA 3ZNQA 4J7XA 5JYDA 2Z5LA 5DF1A 1YE3A 3KSUA 3KM0A 5U1PA 1E3SA 2B37A 3WBBA 3WYEA 1DHTA 4YJGA 1VKOA 2C7VA 3BMCB 1K6XA 2OBYA 3AUAA 1K89A 4OSOA 2JFFA 1O95A 1GV0A 2IZ0A 3ZWWA 2E49A 2JD0A 3JYOA 4R3NA 1P77A 3BMQA 3OJLA 2OL4A 3DONA 2O48X 4WLFA 2PD3A 2VTDA 5A04A 2J3KA 5TRTA 1Z74A 2OMEA 4WGGA 5ILOA 1YL5A 3OA0A 1E5QA 1IB6A 5FEUA 3CUKA 3OFSA 2Y99A 2VZ9A 3AU8A 4IQ8A 3C7DB 4N7RA 1E3EA 1DO8A 3OBBA 4HWKA 2O2SA 3KSDO 2YJZA 3D3WB 1FDSA 1DIAA 3NT2A 5C7OO 1T26A 5EPOA 5B4VA 2JHGA 1HF3A 4B79A 5A05A 4PLFA 5DN9A 4FSHA 5FF9A 1LSJA 1ULUA 1Z73A 1G0NA 1FF9A 3GAFA 2P91A 4IUYA 4XD2A 2HLPA 1AE1A 3N58A 4YDRA 2J8ZA 3ITDA 3KUXA 4Y8VA 1KIFA 1I0ZA 2X5KO 3DZGA 1DIHA 4GKBA 4O0LA 3OJ0A 3IOYA 3IS3A 4QXMA 1PQWA 2YY7A 3F46A 3C1OA 3VPFA 3JQCA 3ULKA 1DAOA 2YZ7A 1H5QA 4BGEA 4YXFA 1ZSYA 4I5DA 1KY4A 2WSBA 4E32A 2EV9A 3AY6A 1H6AA 5F3RA 3ZV5A 4BGIA 3SVTA 1DPGA 4P38A 2GO1A 4YB8A 3KRTA 4D43A 3AOGA 4PG5A 3NYWA 4DPLA 4AJIA 5KOIA 5KNLA 3PLNA 3NDRA 3WFIA 3ZW8A 4YACA 1E3JA 1NHGA 1O6ZA 3HB4X 2DBRA 3S2IA 4O63O 4A10A 2CDBA 3V1YA 3ORFA 1A9ZA 1PZFA 1BXGA 3RVDA 4I9UA 1KC3A 3UW3A 1D1TA 4XYBA 1PL6A 2E48A 2DFDA 4BKUA 1X0XA 2P4HX 2FN7A 1IHXA 3JQ7B 1T25A 1XWFA 3PQEA 1GUFA 3VOSA 4J1SA 2HO5A 5I8ZA 4GWKA 2NVUB 2FPPA 1ZSNA 3U3XA 2FSSA 2EHDA 4CM9A 5LCXA 4RVUA 3ZWAA 1VLLA 3I83A 2O3UA 1YBAA 4FOOA 4UUOA 4J9UE 3I5MA 3VDRA 4J2HA 5A4DA 4RPKA 1WMAA 1HE5A 2JKVA 4FW8A 3TOZA 3JYPA 3UN1A 3RU9A 3NGLA 2HQ1A 1U5AA 1N5DA 1B0AA 3DBLB 4Y6SA 1JU9A 1SB8A 5KKAA 2DLDA 3ROPA 4L8VA 4YAJA 1GUZA 4K9DA 4OJNA 2HU2A 1DRWA 1AHHA 1V35A 4E33A 1R37A 5B4UA 3RC9A 2OP1A 3V2HA 1PEDA 5G0SA 2C82A 3TZHA 1WAMA 1JAYA 1RM0A 1F0YA 2PGLA 1CYDA 3PI7A 3GF4A 4NFYA 4I5GA 5JPIA 4EJ6A 4Q3CA 2G82A 2H5LA 4W7IA 2P9GA 5BNFA 4LGVA 3ST7A 3SEFA 3HB5X 2RCYA 1N7GA 1QXSA 2ZCUA 3AY3A 1PGOA 4KDEA 5DOVA 4EBFA 3JCZA 4WEOA 4BKPA 4FFNA 1QYWA 4BNIA 1T2DA 3T7EA 4HADA 3WXBA 1T1SA 1EBFA 4E6PA 5I7VA 1R4NA 4TZTA 3WYCA 1LDYA 2VWHA 4YA6A 1A71A 4CM7A 4HV4A 3VKUA 1HE2A 5KJFA 5F1KA 1X7DA 2QRJA 3IIEA 2G0TA 4K26A 4L0QA 3DMYA 1KERA 5FI3A 2G76A 4Q3BA 1XQ1A 2VT3A 1P44A 2ET6A 1GZ3A 1P1JA 1D1SA 3ETDA 4F6LA 4B7XA 1HLDA 2AMFA 3PDJA 5F1OA 4A03A 4CLHA 2NU6A 4YRAA 3OIFA 2HMSA 3ADPA 4AJLA 1E77A 2UDPA 3VZRA 3HDQA 4W6ZA 2W8ZA 3OIGA 1OFGA 1V3UA 1U7HA 3GPIA 1CF2O 2VN8A 3DBHB 1DRUA 3KLMX 1JVSA 3AJRA 3GA0A 5KVSA 1JA9A 3IJPA 1H2BA 4H7PA 4CV2A 2BHLA 1TB4A 4WOKA 4CQMD 2DBZA 4UUNA 4A0SA 3WDSA 4IIUA 3RROA 2B5VA 4DGSA 2JFGA 3WIDA 1Q0HA 2FRDA 1UXJA 1PS8A 1I24A 1Y6JA 3QVXA 3I1JA 1H9BA 2IDZA 2V6FA 3AUUA 5AXBA 3L6OO 5AXDA 4RVHA 3QV1A 3O8QA 3ZNNA
chains in the Genus database with same CATH superfamily
3NNDA 4OJQA 4DLUA 4C3OB 2XOKA 3A6ZA 3SQOA 2XA9A 1FRZA 3F7NA 2J4DA 2W8BA 3O1LA 3PUIA 3RIYA 4DQVA 5EIAA 3HU1A 1OC2A 4AICA 1VJDA 2QXTA 1SVIA 3UA4A 2A9OA 3P4UA 2IS6A 4HDQB 1QPZA 5KVCA 3TD2A 1SIBE 3REQA 4OU4A 1M1YB 1BHO1 1E3DA 1TU4A 4IV0A 2WSIA 4ZYXA 3C48A 3K9FC 3OOEA 5LQNA 3ZHQA 1RQLA 1GTRA 4RVGA 1H5UA 3V7UA 3C7TA 1VPDA 4JHLA 3BTSA 3O1HB 4BL5A 4YHBA 3RVPA 5JZ9A 2JJYA 3LOPA 4AM8A 2WM3A 4F5EA 5JCJD 3L0DA 4DHWA 4PAWA 3B48A 4EZBA 3VV3A 2ZRLA 4UU8A 2WKRA 3KKMA 3PXEA 2FR8A 5L51A 2XGGA 2GARA 1M75A 4LW8A 4V03A 2NU7B 1UDCA 2P1DA 2X0DA 2FFAA 3V4OA 1WUKS 3FCSB 4G4SP 5JASA 1P1RA 1ZUIA 4E15A 2Q3LA 1H1TA 5EP3A 3INGA 4BNNA 1YJBA 4KN5A 4QUBA 3ZIDA 4AS3A 1TCCA 4FR5A 3TXXA 3HEBA 3QPAA 1MHPA 1ND5A 3GUHA 1CUSA 2ZTUA 1OYOA 5DNDA 3VHXB 2BH2A 1OLOA 3O8DA 3BD7A 1URPA 1W0KA 1WSDA 2I4TA 1HFEL 1M10A 2XUOA 3ETGA 3NC4A 4JR1A 5FAXA 3OIVA 3BKXA 2QN7A 4UCWA 5EFZA 1GHTA 5A4AA 1QIEA 3AVXA 2JBWA 3IV7A 3GLQA 4E70A 1DJMA 3H0CA 3KD2A 3OQ6A 2GB4A 1C9DB 2FE4A 1KFKB 2QTNA 4G89A 4WBXC 2OFFA 1GKLA 1SWVA 4WQMA 3FB4A 2GN8A 1W4AA 4U2EA 5P8WA 1KJIA 2XCIA 3HJAA 1SA0A 2YWJA 5EZSA 1N2OA 2RDMA 2PLAA 1YUMA 4JFRA 3E18A 4LXYA 1XAIA 3SDZA 3TR5A 3ETEA 3ZBQA 3ZVLA 1J6UA 3FTEA 3KOMA 3LKDA 1XJCA 1E7WA 1PWXA 3V42A 2OE2A 2GHRA 2P0EA 4E88A 2OG2A 3MMXA 2H31A 4RFLA 1QONA 2VT6A 4LHXA 5IDYA 4UCQA 4ENWA 5A3RA 1H3EA 3STUA 1ZUD1 2R25B 2WU3A 1NTOA 4I50A 2A78A 1NYQA 2H5EA 3NHWA 2Z9DA 4IY1A 2QUZA 5CBPA 2YINC 1LQTA 3CT4A 5K0BA 2CL5A 4JLBA 3HCDA 3HTXA 1RJWA 5DMHA 2QVXX 2UYGA 1IJFA 3W5UA 1Z75A 5CVJA 3UJCA 4I8XA 2FUCA 1EGAA 5DM0A 3SICE 3EDOA 3CCFA 2BIFA 3NXSA 1U8UA 1TE2A 3IILA 1H05A 1UKZA 4M8NE 5G02A 4TUYF 1CDEA 1CQJA 1GU0A 1YUBA 2BGLA 3DVQX 4WZAE 3WWZA 2WU0A 3WNVA 3JARA 4C4OA 2IPLA 1YB5A 1Z4MA 2RB5A 4XSHA 1IHPA 3IBFA 3JATA 3T52A 4JJAA 3V1MA 2H54A 1BS2A 4E2YA 4MRAA 3WAGA 1H4TA 3TO5A 4OHKA 2Q1UA 2XZPA 4EGQA 5I7UA 1ZXBA 1PDOA 3I4LA 4WNAA 4FOTA 4GP9A 1QHFA 3V7WA 5A9SB 3A9SA 4GC9A 2H29A 3B1WA 2RGAA 5FAKA 1OFUA 4C06A 5DNYB 5B3JA 1OX4A 4CUJA 4BEBA 4QDJA 1SCAA 3AM1A 1LQUA 1XK7A 3IVXA 1D2HA 3CUTA 4WN9B 1WPGA 4ER0A 4A8JB 2X1LA 3L2OB 2UXDB 2O7QA 5DXJA 3MILA 1NLYA 1PSZA 1ACMA 1Z6AA 3GQBA 4RGBA 3SC3A 3WDLA 3IE1A 3D8NA 3J81k 5EJMA 3QSYA 4WK0B 4PTZA 1LVUA 5KTTA 1JHDA 1R10A 2HYDA 2ZB8A 1GQFA 1HDRA 2B4TO 2C78A 2IXEA 3RRFA 3NBZC 2QRHA 1O5IA 2AF4C 3PF8A 4BFYA 1VA4A 4KQIA 4TVKA 4DAEA 3D8BA 1GFWA 3JSAA 2ZWOA 4PLYA 2GPBA 1JYEA 5CJJA 4MUBA 1RI5A 4R5MA 1CRPA 1N4AA 3N8IA 2D3WA 4XCXA 3GK3A 1SK8A 3ADBA 1EFLA 3L0PA 1NW4A 3RRXA 1VMKA 2DWCA 3MTIA 5JDCA 4I7EA 4URHA 3DZBA 4RF2A 4TKZA 3TB6A 1U9IA 2ZE6A 3X1ZA 1U65A 4C7VA 5JC8A 2YOHA 4PZ0A 2CLOB 1EM8A 3GZ4A 3H7AA 4GM1A 2PUAA 2VNJA 3PXUA 4YWJA 3TM4A 4ZHSA 4YJ2A 1JDBB 4J29A 2W70A 3Q6MA 1QVRA 4LZAA 4B40A 1BCRB 4B3CA 4TQAA 3K0HA 1BMTA 4KXLA 3T94A 3STXA 4BAGA 4FJ1A 2PMCA 2Q9CA 1N7JA 2BELA 2C5GA 4H3KB 2G70A 2A1UB 1AUPA 1TQDA 3SPXA 4X1IA 3CYFA 1ZZGA 3GFSA 4AROA 4F0JA 2G4VA 4Y6RA 4GSLA 3C5EA 1KK2A 3IKMB 4INJA 3CRW1 3P9RA 2G88A 4PY2A 1YRWA 2G4LA 5JE8A 4CKXA 4D9EA 4RTMA 2BF4A 3F98A 4N40A 2A94A 3S1LA 4BAZA 1O03A 3O4HA 4HNGA 4WKCA 4BBZA 1K88A 3KOYA 1NVDA 4P4LA 4FWTA 1L7DA 1RLOA 1YZHA 1KO4A 3N8DA 4MUGA 1PWEA 4BJHB 4CR7A 4NE9A 1ZNQO 3CT6A 4EG6A 2QL6A 4EHHA 1BWQA 3HXOA 1DZIA 2CFOA 4R40A 4JWKA 4D3ZA 3D4PA 2X6TA 1JW9B 4BJ3A 3ZU3A 4UTRA 2ENWA 2FSUA 3CLUC 1T35A 1MJHA 4HWTA 3AVTA 5H82A 2QA5A 1HRDA 1DEKA 1CUCA 2FEKA 3AZQA 4GP6A 4OJYA 4QXOA 1U1DA 3A28A 4WLUA 4LXHA 2PRSA 1CKEA 1Q0QA 1QQTA 2EP8A 4TS9A 3TIIA 3DBRB 3RTAA 2G1AA 3A3OA 5C5DA 3FGNA 2FW6A 2SHKA 3BDVA 5EHQA 2XF8A 2QTFA 2IXFA 3B2EA 3KTAB 3CEPB 3GLKA 3U62A 4BGVA 1QLWA 2R84A 3ESQA 1JDJA 4YRLA 5A3JA 3ZU5A 4GGOA 5K5EA 2PGAA 4MDYA 4OQYA 1XAJA 1XF1A 2Q0SA 5AK0A 1U28C 3O92A 4QOGA 1WXXA 4O4LB 1ULAA 3IDSA 4NAHA 1D0VA 1G5FA 2B7CA 5CT9A 1ZL2A 1Y8RB 2YHAA 521PA 4D92A 4YMUA 5JI3E 4QBKA 2EF0A 3OEHA 4C2UA 3H17A 4TZ0A 2X0FA 3QVOA 2ACEA 1YA6A 2JGFA 2PXAA 4FEEA 4OCZA 5BN3A 2EKLA 1ZONA 1JIKA 5H80A 2X40A 1YZLA 1ZC4A 3EGOA 3L5OA 2NO0A 3TDNA 3NM6B 1O54A 3LBIA 4D3FA 4PLVA 2I78A 1E4EB 3DDZX 3N8HA 2ENUA 4AULA 1W19A 2I8CA 4B6JA 3VTFA 1ZITA 2FYTA 1FS6A 2UVQA 3BXFA 2OHXA 1SBZA 4EUFA 4F7DA 3M6XA 4MUEA 3RV4A 2CKDA 3UHOA 3CX3A 1DV1A 4EDFA 3EH2A 1LXCA 1V6AA 1W85A 1PVVA 1Y80A 2C99A 5L95A 3A1CA 1GCIA 1Q22A 3TTWA 4Y98A 3EVDA 2NOAA 3LF2A 1SBCA 1CLEA 3CPEA 5EYPA 3KSZO 5KWVA 3FSGA 3CXUA 3AHEA 4ZU3A 4Y1RB 1K2WA 1QRRA 3A2MA 4PRKA 1U7TA 5DU2A 4BO8A 4Q9LA 4JBIA 2P79A 4KLZA 2EBFX 2VRWA 1JPNA 3IQIX 3BQ9A 3ADKA 3NRJA 1PT6A 1O1YA 4OAPA 1OXSC 4IH1A 3ZWVA 3AEUB 1O4WA 1Y6GA 1ML3A 4RSGA 2IIQA 1RQNA 5DP1A 1RCFA 1VBNA 3O8BA 4WT7A 3GT3A 1ZRHA 2DAPA 1MO2A 4LQ4A 4DQXA 4MUXA 1U5BA 3PZBA 1K7YA 1P0PA 4MUJA 1E92A 3DJFA 4ZAZA 4HMQA 1XZ8A 1L1FA 4DMHA 4U63A 2FG5A 2HA2A 5J4YA 4OMCA 5E4FA 1NWCA 1BQ3A 2GZ2A 2P69A 5H68A 2GVZC 4L22A 4ZT5A 3KHTA 2H85A 4GI7A 4C4PA 4BS9A 3QU7A 3VI3B 3U4IA 2EX4A 6Q21A 1EXVA 1Q0TA 3JY6A 2UUAB 1W29A 5FL3A 3LZ6A 2PUBA 1WU8A 3K6SB 3SK0A 2OYCA 2J0UA 4QOJA 1FNCA 2CLSA 4DVJA 3I9LA 5DN6D 8LDHA 1X7HA 3SBOA 1M2EA 4CQJA 4TKLA 1ULSA 4DC0A 1FBTA 2FGJA 5CT4A 1HKHA 3VNSA 1ADJA 1W4BA 1JLHA 1YR9A 2HNAA 1NQWA 3G0OA 3KXDA 4V0ME 3DR5A 1GNPA 3VMFA 2NYAA 1C81A 3G6WA 3UMJA 1WZNA 2QLTA 2WIFA 3W3AH 1DC5A 3FLMA 1SPXA 1IWBB 1W46A 1ZX1A 2EJTA 3ABRB 3BA6A 1GUDA 4FZVA 5EQFA 4DJTA 2VTBA 2O19A 3VMMA 2W42A 1XCGB 3NG1A 4IDEA 2QMEA 3RWMB 3NBXX 1QF6A 1CV2A 3VPXA 4D46A 4P54A 3Q3VA 3WLOA 3CE9A 3ZDEA 4BVGA 1TADA 4ZI3A 1H3NA 3TQRA 4AU1A 4LVCA 2CK3A 1U8TA 1Z18A 1YR2A 2WF6A 4GC5A 4MP3A 1WMSA 2LCFA 4C4XA 4UTXA 5TPWB 1F14A 1TT5A 1ZD5A 2I66A 2QTMA 3EUFA 1B0PA 4LXUA 1E4OA 4A5OA 3WHLA 3ZCSA 5JATA 1EDEA 2C9OA 4S1NA 1QNLA 4ZVNA 3OFKA 4QULA 3A06A 2VTKA 4LV8B 1HYHA 3KJQA 1E58A 2RB4A 3EK2A 2DQYA 3G59A 2PK3A 3JYQA 4KQ2A 2IPNA 1C30A 3MA0A 1FFEA 1E3WB 2ZQ5A 1DC6A 3D3WA 3VZQA 5I01A 5JJKA 1U7UA 2J5BA 2R68A 2VK4A 3FGPA 5ENVA 5TY0A 5IK2D 4JQCA 5LQJA 1FYFA 4OBWA 3A3YA 4MVJP 1KO7A 1LV7A 3KD3A 2DQ4A 1ZNWA 4BATA 2EJBA 1G8YA 2DBYA 4Q9KA 5D3MB 3VGJA 3NDBB 3NRBA 1C8VB 2Y1XA 3EG5A 4JLJA 3SS9X 3Q41A 3Q8LA 4IV8A 3C4JA 5JMWA 4S3MA 3HM9A 5JSKA 2I3DA 4LC0A 5IKOA 1ZDMA 5J4LA 4Y6GB 3WRWA 3DTVA 3FVVA 4PC1A 4B5KA 4H1VA 1HNWB 3SZLA 2ZB2A 4RHFA 2QBYA 3D6UA 4Q9DA 1TM1E 3P1JA 3AB3A 4O4HB 2AUNA 3C3PA 1JP7A 3QPWA 1JQLB 4PGMA 5EZ5A 3DZIA 1CJCA 4TSRA 2GN0A 1UZLA 1IOZA 4C0SA 2ZUDA 2GN2A 1EFHA 4L6CA 1Q92A 4E4YA 5KSOA 4KUEA 2H2HA 2JI4A 10MHA 1KPGA 2CYAA 1IRIA 1JMYA 4JP1A 4DJDC 3CLTC 3CX4A 1WUJS 4AJEA 3VJRA 4LG1A 3R1IA 3VPSA 2I6SA 1EEHA 2FPWA 5CK4A 1VOTA 5A71A 2VJCA 2YUTA 4K9KA 1BE8A 4U7TB 3EG9A 3QLVC 3HV0A 3QVUA 3C3DA 2OGWA 2YN0A 1ZI6A 1H6CA 1G7TA 4YCCA 1Z15A 1IUNA 2BCJQ 3GVCA 3OLYA 3A05A 4L7QA 5K3OA 2I2CA 1EJBA 2W2TA 1HNZB 2PLFA 1OY1A 1TO6A 2YMPA 5CXXA 4WVLA 3GDWA 2AWOA 1F20A 1SQGA 1V0JA 1XF9A 2J5RA 4Z5XA 2I4MA 2ZFUA 3DOUA 1QJCA 1JTVA 1X39A 4YMGA 5KTMA 5CFPA 1ZVVA 3T4EA 1OLSB 4D9NA 1B23P 1QZUA 2Y05A 1RXCA 1U2RA 2CF6A 1E7QA 5AW2A 5K8VA 5HKLA 5KKCA 3L0IB 1W1WA 4MWEA 1MA3A 1HV8A 2GHQA 3GNLA 4MH0R 1ZIYA 2NVUA 4KIFA 4LVOA 2OQIA 2R4UA 2VNSA 4BUJA 1QQAA 1KS2A 3RGWS 3IDAA 2G3YA 4BP8A 3QEMB 2IH4A 4IDCA 1U3DA 4XIIA 3N87A 1G6Q1 3ZCRA 2TMDA 4BMOB 1FVHA 4DIFA 5GZ3A 3CO5A 3U44A 1EQUA 1G5IA 3TB4A 1BWSA 1PHPA 1GNQA 1NU6A 1M2VB 1ZN8A 2RHCA 1XRRA 3HDTA 2NSJA 3NIGB 3W8RA 3VR5D 4BEVA 2IYTA 4BBJA 1L8XA 5IC4A 3DHWC 3IULA 3LQFA 5HILA 2RHOA 3C6YA 1DQNA 3NIBA 2QTRA 4DIOA 4HUTA 1DAMA 1DOAA 3NXKA 4BLTA 3FPSA 3MLBA 1J9EA 4YC7A 1POXA 5EEHA 1I2BA 2B5WA 3CF4A 5DI3A 1IQRA 1J2YA 2JIBA 2NYUA 2AKAB 2DSTA 3LSYA 3F47A 2C77A 3NV7A 5IVIA 3N9IA 4KO2S 4M1SA 4D44A 4B3SB 2X0IA 3ANSA 3H86A 1ZK0A 4QJ4A 1Y7PA 2OQ2A 1NBMA 1DMRA 4GI1A 3H9GA 3TVDA 3OM9A 4JGBA 3E9EA 4M1YA 2B1JA 5EUQB 4WIAA 5C1DA 4AG3A 4WXYB 4JGIA 5IAGA 4ZGBA 1MQ8B 1GD1O 1FU7A 2VQ3A 3GARA 3SCZA 1TTPB 1SHJA 3FD8A 1UZNA 3PL1A 3QGMA 1M7GA 1XDBA 3Q3GE 4OKSA 2O20A 2SECE 2R44A 5BW8A 1JEQB 1IQPA 1U2TA 2EW8A 4KITB 4QHYA 3ACBA 4JNCA 4ZYZA 3GJZA 1SAYA 3GFTA 1WG8A 3QE0A 4NK4A 5IYZA 5JLJA 1AV6A 1Q44A 4KR7A 1JKJB 4ALNA 4PYLA 2GZMA 4UC0A 3OE1A 1G9XA 1QH0A 3NM4A 1TM5E 1YS6A 2WT4A 1X1QA 4L6AA 2IYWA 2RAPA 3H5VA 4TQGA 3B6IA 4OQFA 4C3ZA 4IHJB 1LNZA 4UHEA 2IXTA 5K09A 2OV6A 3M1YA 5JXWA 4IFBA 3IPRA 4Q39A 3TEFA 3BGSA 5KX5B 3TOCA 2MT9A 4AZSA 2AWNA 1I0IA 4Z9XA 4XVRA 3ZXYA 4QNNA 2J5KA 5IBRA 2O0KA 3IR6A 4TZ6A 3A4MA 3OX4A 4KQJA 5ILQA 4AY5A 5HPYB 4B45A 5KO2A 1E6LA 1QPBA 1RXIA 4RA9A 3DFZA 1J90A 3SD7A 3TOVA 5AKHA 1LVHA 1U11A 4HN4B 5AKEA 4DIBA 1FMFA 3D6TB 4JQOA 5I3ZA 3OZVA 2OXRA 1RR6A 1EZ4A 3E7WA 5JLAA 4UU7A 2VP4A 4IOJA 5AVTA 3WQRA 3D6JA 1G8KA 5ITWA 4C7KA 3ACCA 3D8UA 1I14A 5TX7A 1QO0A 3OLQA 4HRYA 2AC2A 2QNRA 1SH7A 3LNTA 1TPYA 4N7BA 1SCQA 2QKYA 4AJ1A 2WYUA 1QPGA 4PQYA 1G59A 4ED9A 4Y6LA 1QP4A 2VF8A 2Y1WA 3DGEC 3UFXA 1JWBB 4UTOA 1KJZA 3ISTA 1JH9A 3BRCA 2ZCJA 2QR3A 3EIXA 4N54A 7ABPA 4IVQA 1Z68A 5KTOA 2VAWA 3KEOA 5ALUA 2IYEA 3LC2O 1OIXA 4QDOA 5EXSA 2D13A 2JHCA 4B3GA 2YWHA 4UQLA 4OVKA 5M2QA 5JEEA 4DA9A 1JL3A 1C3VA 1JIUA 4MV8A 1TDJA 2P6PA 3R3YA 4ZAXA 2FPGA 2KLHA 3MXOA 4HF7A 1ZIPA 3NH9A 4NOMA 2CB0A 2FSFA 4TWBA 4AAYA 1VJ1A 4YRKA 5L9AA 4B81A 1HXHA 3HI6A 5LVAA 1DCMA 1SNYA 5A5VA 3Q9SA 1Y5IA 3TKLA 3VZBA 4HAWA 2VRCA 7GPBA 3U26A 1A9YA 2PXXA 4WK4B 1QF9A 3HG7A 1VHTA 3E27A 4C4SA 5JJ5A 1IB0A 3FJ1A 5M5BA 4RZ2A 5J2TA 1UDBA 1TUBB 1AUXA 2HUNA 3HXTA 2XIQA 1A76A 4G07A 4LFBB 4E5KA 5KREA 1IJBA 3K05A 4PS1A 4QOEA 3DE5X 2VP5A 1OA0A 3A1DA 3IJ5A 3HCCA 2FFJA 4JELA 4Q4LA 1XC7A 4TSFA 3ZE6A 6GPBA 2X86A 3VNQA 4IMIB 5KYUB 4BGDA 2V7EA 5EHGA 3GEIA 4Z4CA 3JWPA 1O94D 4PVDA 4XQ9A 2WWVD 4U7WA 2F59A 3LNCA 1CUUA 2IUFA 2OYSA 1AXRA 1THGA 4IFTA 1SQ6A 1G38A 3DFFA 3CM0A 2QPAA 4GOKA 4UU0A 16PKA 1J1UA 1R7RA 2QNIA 3WL5A 1F8XA 2Y27A 2BFPA 1KTVA 1Z37A 3KOOA 3IUSA 2QJFA 1XTRA 2QTVB 2QRNA 1USVA 5AVKA 3HVKA 4G5OA 1WZUA 3IMFA 1DADA 4GYJA 1ZGCA 5CITA 4WZ6A 1BXGB 4OQEA 2XZTA 2VSXA 4D25A 4BX8A 3U6BA 1CETA 5C1IA 3DYBA 4TMFA 1SVLA 3VYVA 2NG1A 3RBXA 1UBFA 1BAPA 1NF2A 1P6QA 3M6VA 3QXJA 1BW9A 5IM5A 5U4QA 4BE9A 2YS7A 4D98A 3F5SA 4ZTZB 1MD9A 5CIWA 4JB0A 4WASA 5F73A 4KB5A 4RH3A 5U4XA 4ENPA 4GMXA 5EWJA 2B6HA 1S8AA 2WVAA 4G81A 2I1QA 3N5KA 4GE0A 1XDGA 3EXEB 1G41A 1Y1KE 2G67A 4JBWA 2G5TA 3MJEA 2QRVB 2D7JA 5LXTA 3PLRA 2HV9A 3IMGA 4O4LF 4AO7A 1D1QA 3ZPXA 4AJHA 2VPQA 5E2AA 2VYFA 2GN4A 2CJWB 2IY7A 4CEJA 3H2KA 1YBHA 1ZM7A 4Z99A 3U4AA 1I1NA 4J0GA 3VR6H 4JODA 5KSWB 3H5NA 4MQEA 1J8YF 3Q40A 3W9YA 2PSEA 1M7HA 2KMLA 2JGDA 1C14A 2CZCA 3CNNA 1THZA 4DARA 1W36B 1IZ0A 4ZOCA 2D0PB 4R8LA 3IO5A 4PSAA 4LQCA 3P19A 4DYDA 3UOWA 1QU3A 4OMUA 4DR7B 3HJHA 3QPVA 4PC2A 3TZLA 3ZOZA 1CZOA 5C51B 3D0QA 2IY8A 1WMFA 3KEFA 3NATA 4KU4A 2DKOA 1LDBA 3QEJA 4UM7A 3ZC3A 2GJSA 2XYGA 3O74A 4JMPA 3D1JA 5FO0A 2FPOA 2DJ5A 1K7EB 3AFGA 1DTWA 2WTNA 4JWTA 3VH1A 2VAXA 5L45A 2Y68A 1M54A 1INLA 4IS2A 1BU8A 1LNQA 2AFVA 3ZHRA 1GL6A 3U9TA 1G21E 3M1LA 4XGKA 1JPVA 3PFGA 2N0SA 4EJSA 1DRVA 1U6IA 1WW2A 4PYOA 2QTGA 3EVFA 2YJ5A 1X8JA 5BXYA 1G8GA 1XU4A 3QU9A 2D0IA 4M98A 2HY7A 1EQAA 3C8HA 1FMTA 3MUOA 2WICA 4NTZA 2Y2VA 1KZ7B 5AOBA 5EWLA 2Q07A 4G5XA 3ND7A 2PYZA 4EGSA 2JLBA 1RI2A 4YI3A 2PV0A 1P2FA 2O7RA 3WQQA 1J0CA 3CLHA 2GCIA 3PPVA 4G4JA 4C4RA 4YUWA 4US0R 3PXAA 1KARA 5LWHA 5EUMA 5KI6A 821PA 3L93A 4CM8B 1CNMA 4EB6B 1EK5A 1PDWA 2JKZA 2EOAA 1GYRA 3L7MA 4XDYA 5EMKA 2NVOA 1NLFA 3W06A 2WJGA 1Z35A 4Z9FA 1V39A 3R6TA 2R8RA 3AVOA 2AVNA 3UV6A 5SY9A 5ALSA 1L5KA 3SXJA 3NVAA 4ON9A 4ABTA 1Y5MA 5MGBA 2OKCA 3R3SA 1IY0A 2ERCA 2ZIXB 2DR3A 2HK6A 3MUNA 4IW3B 4L07A 4U6NA 2Q8QA 3QFHA 4DDMA 4AMBA 4YV2A 3SLGA 2BFNA 3SM9A 1D4ZA 2YZGA 4TS4A 4AJ4A 4W1RA 5K8CA 2CW5A 1N1EA 3ESDA 1QX3A 4QATA 1P45A 1IDOA 2B78A 4KQ9A 3U48A 4OHZA 1NFRA 1U8ZA 3LC7O 1GLNA 4LYHA 2GK4A 1BVRA 1FX0A 3UXMA 1IOVA 3ENKA 4FCTA 1FFBA 3LP8A 5H59A 2PUVA 3DXYA 1PDVA 5GADl 3RSOA 1TT7A 4U2GA 1XBTA 4LC9A 2QRZA 1ZRMA 1NW5A 2G07A 2GAOA 2DLNA 5DV9A 3S5UA 1GYQA 3PEYA 3TZ6A 1A27A 2ECKA 4KN8A 1P9LA 3ASZA 3KXLA 4W8HA 4B48A 5JY1A 2OR3A 1S4MA 1DCKA 4YQYA 2ON6A 1T2AA 2VWPA 3O8QB 2FZVA 1FK8A 3QFRA 1ULHA 4D9IA 3WSTA 2KM1A 4MKHA 4B7ZA 1NGSA 2AN5A 2PLWA 3LFTA 1YB2A 2HXYA 3ROXA 1YRAA 4YAWA 4QSMA 5JCOC 1HDCA 3D31A 1GGJA 2HIGA 3OJOA 3WV4A 5C18A 1A9SA 3GCDA 2WJ6A 3OHMA 4GS5A 4NENB 4B8WA 1IQUA 1O08A 3RSGA 4ESOA 2XUIA 2OUKA 5IDWA 4ITVA 3DEAA 1Z8NA 2FKAA 2FPRA 5K3FA 4F4JA 2CNWA 4Q47A 3IVGA 2SICE 2TECE 4RMIA 3GT4A 5CA1A 2KWIA 3BL5A 4HDKA 1V2HE 1MC5A 5SV2A 5K0EA 4WJLA 3PWTA 3NP7A 5GZ1A 2ZATA 1O0BA 5E7IA 1Q3TA 3I28A 1ECCA 1RQ2A 3BN3A 1UMCB 4WL0A 3QVTA 1UMDA 4NQRA 3KSMA 3PXXA 2NYRA 5IPFA 5EIOA 2MMGA 5DNAA 1ICIA 1Q2UA 2VJQA 4M49A 3SBEA 3W4KA 4FE7A 1N2CA 1JDNA 3RKUA 5TIIA 4X84A 2MSWA 1O5TA 2ZSKA 4MRRA 2QT9A 2D2EA 4EPTA 3P2EA 4M86A 4D79A 5BN5A 2XYHA 3FPFA 1ZZEA 3I0NA 1FC0A 1PJ4A 1ZKDA 3M5WA 4O4HF 1KRWA 3USCS 4FXPA 1XI2A 5JMOA 4RPJA 4CEHA 2I71A 1EMDA 3EOZA 1JPUA 1G5QA 1U4NA 1CSEE 2P2NA 3TQSA 3KB2A 2EBWA 2ZT5A 3LUFA 2IYNA 4ZO4A 4Z0PA 1I1OA 3UW1A 1NVUQ 4ZCMA 1O94C 4AKIA 1SB9A 1UBKS 1X87A 2A9PA 3AZOA 3FBGA 2GOYA 5SZKB 3U80A 4KQKA 5JRJA 4N3AA 1E7YA 3F2VA 4CMHA 3ET4A 2XWQA 2QW0X 3AEYA 3BCUA 3D1VA 3EARA 3TH5A 1P19A 3I04M 1UBHS 3CTMA 4OLFA 1G55A 2FOXA 2WAYA 4MS4B 4BNDB 5KTKA 3ZD6A 2W4IA 5DNVA 2UXCB 4UHKA 1MOSA 5ALGA 3SBXA 4AZTA 3RFCA 1YHYA 2EKPA 2JJ8A 4NK5A 3E5RA 4F2DA 4WZBA 4TKUB 5TS2A 3B1JA 4UZEA 1NOJA 3AEQA 1I5RA 1Z12A 3IUBA 2ZIUB 1C1DA 3DJYA 4L76A 4NOKA 4Z2AA 2PZFA 3AF6A 5NLLA 3OKAA 1Y7HA 5SY6A 2XKKA 1R3DA 3A4IA 2WP0A 3KCNA 2FMUA 3N7AA 4HFNA 5BSRA 1JHRA 1GNLA 2GTHA 4U8HA 3ROQA 3J7AC 2HZ7A 3LXUX 4QFDA 1EX6A 3GHHA 4NMHA 4LZPA 2TMGA 3HKDB 3G8YA 4IJKA 1MVOA 2AJBA 3KZOA 4BB5A 3T3OA 1TF2A 5F78A 2GFIA 3K9LA 2B69A 3MLEA 2UYYA 4WADA 5IVDA 3VOBA 2RK4A 1ITZA 4PXSA 4MX8A 4DPMA 1Z0AA 1VC2A 4IRMA 4UFPA 3C8UA 5IBPA 5CYOA 2JI6A 2A7QA 5E6UA 1G2OA 4KXUA 4LF9B 1VZ3A 3OQIA 2ZRCA 3PNLA 3VVLA 2YN2A 1HSOA 3R4CA 5E6SA 1CY7A 2H92A 1PGQA 5CB6A 2BJHA 4JAVC 3R0JA 2BGKA 1N6HA 4K0KB 3VC7A 1B1AA 1GR1A 3EW9A 3NC1C 3RU3A 4CDMA 2J0VA 2IHKA 5BY2A 4YVFA 1EP9A 1YB6A 2QU7A 2VSNA 2ZJ5A 3AM5A 1T1IA 3M6WA 1BS1A 2ZYUX 3HZHA 4FFOA 4MQFA 3PQDA 3VPGA 5A4MS 3D7MA 3U17A 5DNUA 3OICA 1Z56C 3EJ6A 8ATCA 3SKVA 4AJKA 4BQPA 1BDIA 4U2FA 4FEAA 1Y63A 2VRBA 4GPEA 3WBFA 4CDGA 5B55A 3A1TA 3HN7A 1MF7A 2F43B 4GG1A 4HLCA 2CEKA 2GF9A 3MS2A 1XTKA 3LCMA 1T2EA 4G0NA 5SICE 3WIOA 3VOAA 4JUFA 3ESZA 5ALDA 1OI3A 3U1TA 1ENPA 2G40A 2PIAA 4OX9B 3CEJA 1PFKA 4FUQA 3BF7A 3DWGA 4DLKA 2REOA 2I67A 4EYEA 4XI9A 4G0WA 4OB6A 5HF6A 2ISCA 2J4CA 4EB0A 1RAEA 3X44A 4UBIA 1YBFA 2XT0A 3KQHA 2HR1A 5JZOA 2ODPA 3I12A 1I6KA 1MOZA 3JD3A 3ER8A 4IHJF 1UKBA 1JKMA 2RARA 1E79D 1F2TA 1W35A 2ZUSA 1CUZA 3Q5EA 3KPYA 2W9XA 3TAUA 3F67A 4DLWA 4MKXA 5I7SA 5KX5F 3ZWYA 5E9AA 3DF9A 1HX7A 2A9VA 3L82B 1SBYA 1UPXA 1X2BA 3E5HA 4XYLA 5DM1A 1PR9A 1U2GC 3EASA 3AEKB 4MPPA 1T9HA 1TQ2A 5COBA 1SULA 2PAFA 2ZDGA 3M4YA 3FNGA 1Q21A 2PXCA 2W6IA 5DDIP 4ABYA 4EB8A 5IASA 1C5KA 2EGGA 3HB1A 4WECA 1VXRA 5P21A 1HETA 2CXTA 4B3HA 3QKSB 1IOLA 2HA4A 2ZVJA 3IELA 2EEZA 4I14A 4AMUA 2ECQA 4HWRA 3NYQA 3Q2OA 3C16C 2VVTA 2GCOA 1BXZA 3F6SA 3K92A 3E7FA 3QKUA 4OYYA 4E31A 2FX5A 5CD1A 3LX4A 2ID9A 2GNPA 2A57A 3HHPA 4DNXA 4BNXA 2R6AA 4XJSA 3UPDA 5J58A 1DBIA 3WGQA 3RYCB 3S29A 1RBZA 1B1CA 5HK9A 5DASA 1E3IA 1Z47A 4J03A 2OCPA 4E09A 1F5NA 5FL7D 2WJ4A 5C7IO 4GXQA 1F6WA 5GTDA 4C0HA 2ODWA 1ONPA 1JHPA 2ZWPA 4HAUA 4M36A 4WBNB 4RF3A 3S8MA 1LBHA 4ALJA 1EDZA 3T7AA 2W83A 4EI8A 1EWQA 2VJBA 4HQKA 3H9JA 4HWPA 3BXXA 3EE6A 3JQ8B 4OREX 1M8GA 3PNBA 2J9YB 3IHTA 4QYXA 5LYYA 4CMIA 5HKKA 3D4BA 2BEKA 2OC9A 3K0FA 3M9LA 3D0RA 4N3BA 2QM3A 4ZIRB 1YQEA 2TRSB 2IYQA 1FJHA 5J4KA 3NHPA 4C88A 1LLDA 1TAGA 2VYNA 2CXOA 3A10A 3R6GA 4JZYA 3NHAA 4OFWA 5L3RA 4BAUA 4ID9A 2PAAA 3TSZA 5HUJA 3CNLA 1NNI1 4QEKA 1TUEA 2UAGA 3R75A 3TUIC 3UJDA 4ENQA 5HOEA 1U0GA 4PCLA 4AIRA 4GPAA 2GH1A 1M1ZA 4J6EA 2O4CA 3K9CA 2FXIA 1AKTA 3HWWA 1E9VA 2OY0A 4B0PA 1E89A 4F3NA 4F4FA 4C5AA 4FYHA 3TTVA 2EFJA 5EHZA 3IKTA 4Q4HB 1FTQA 2AOTB 2WIGA 3K09A 5FYDA 4N1AA 5AW3A 1PLKA 3GO4A 1GSAA 2GETA 4KMSA 4X45A 3RVRA 1GA4A 4RZHA 1I2ZA 1N0WA 1L8OA 1ZN2A 4INZA 1X77A 4K0RA 2QN6A 5KVAA 1STOA 2DBQA 1DXOA 1D2CA 4EHNA 3BBPA 2AEJA 1JUDA 2IUEA 5GV7A 4JLAA 4OXIA 1DB3A 2QUHA 2X5XA 2F1IA 3IAXA 3UUWA 3LHKA 4ZANA 3B89A 4RBNA 1WF3A 2XUDA 3NI2A 3O8CA 5J5CA 4HLUA 4FGJA 3U09A 4X7PA 2D1RA 2CCJA 3BE5A 1RBYA 3KK0A 4EUNA 5DWDA 3GJ0A 3OECA 2F64A 4G01B 4E3WA 1KJYA 3NBUA 4IP0A 5GY7A 4MV1A 4MUYA 1LW6E 3FPKA 1BX3A 4D4IA 3PQ2A 4CU5A 2R87A 5FI0B 2Q0QA 2OB2A 1W73A 3LCRA 3PSAA 1AX9A 4IGAA 5BORA 3CZAA 5GJVC 2KPOA 4XZ3A 2IPMA 4TMKA 4KWCA 2FJ0A 1J49A 1JIQA 1Z0SA 4ZMSA 4D3XA 2COUA 1ADBA 3KC2A 4D4MA 3N2ZB 2LKDA 4RO0A 3F71A 3T38A 4KC0A 1NN5A 3HUFA 5K2MA 3SY8A 1BX0A 3GPCA 2C9CA 2VYVA 3D59A 4IF4A 4D3YA 4RXMA 4WA7A 2NTEA 4Z8XA 4URFA 1E0SA 5I9LA 3FNEA 3OTQA 4B4OA 5JO9A 1YZQA 1QGED 1U3FA 4UBMA 4LNUB 2QX6A 2V4UA 2D3TA 1VMAA 1D9XA 1YRYE 3CX7A 4PIPA 5HBRA 4Z9YA 2XXAB 1PZEA 3GFGA 4FKBA 2H57A 1BGVA 2KHZA 4KDRA 4QICA 4ZPXA 3U7QB 4DEYA 4WERA 3SKXA 4B4VA 2HQOA 4K05A 4IWXA 1OZHA 4EWLA 2GASA 1JFTA 1R6VA 3TRKA 2VQSA 4HX2A 1E9AA 4GMGA 1TD9A 3O9VA 3WGOA 4U7DA 4RSMA 4YQEA 4C0WA 2N75A 3ZVMA 2V98A 3WMXA 1M2OB 1R18A 2NTYC 4BZQA 1ZVJA 3D6FA 4PLTA 1H8EA 1J24A 2RHDA 5J4VA 3RJZA 1KAMA 4PXAA 5A0FA 1YULA 2FUKA 4NESA 2D59A 1PJRA 3DMTA 5EY5B 2HRRA 3HM2A 1BEEA 1P7YA 3FXAA 2VHWA 2YFHA 4N12A 3CN7A 3N28A 3HA2A 1ZHFA 2PRKA 4XR4A 5H81A 1ZBQA 3TKAA 1VG1A 4RCVA 2R4QA 1IULA 3FVQA 3RUHA 4ASUA 5KYTA 4RULA 3IV6A 1T9GS 3BXOA 4GE3A 4NZNA 4JJ8A 1A7AA 2FOIA 8ADHA 4NBLA 5BSVA 4NR0A 2OXEA 2H1VA 4BB9A 1IBRA 2JDIA 121PA 4OFBA 1E99A 4YCBA 5DCWA 3VR4A 2O8BA 4JH0A 1VJTA 1J25A 4GBJA 1GQYA 4MWSA 4Q6BA 3LO5A 3QG1A 1LSOA 3DR3A 2H7YA 2B21A 2VTEA 3C3JA 4M87A 5AVSA 4QDUA 1CR2A 1RI3A 2XB4A 4ZRMA 1L4YA 2QPOA 2EZTA 2PSSA 4G6ZA 1SXJC 4V0QA 5TNXA 1KO1A 4C01A 5CCXA 2CB9A 2IEIA 1ZEMA 5ERXA 3IQXA 5C2JB 3L7OA 2PWYA 1O58A 3WGHA 2GZ1A 4TMVA 1FUEA 2BEVB 3OLCX 4ETNA 2YHIB 2A7XA 4C29A 3VR2D 2X6RA 1PSDA 2BUAA 2P62A 1HZJA 1BS9A 1ZIXA 1Y6FA 3SYKA 1EFCA 2WHPB 2O8FA 4C7XA 1V3VA 3W8DA 2PBFA 4L9WA 3AVVA 4RPHA 3AI7A 1GAWA 4JQZA 2PH1A 4GI3A 2QPTA 5FV7A 4F86A 1YK0A 4POOA 1TJYA 5IDXA 5DSTA 1IIRA 1AIPA 3I42A 3KT6A 4JLUA 1C3OB 4LXIA 4AL4A 1MJGM 1YBMA 1Y3CE 2XH8A 4AYXA 1TF7A 3TX2A 1FFYA 5ELXA 1TYBE 2GLTA 2JFHA 1BYUA 2G17A 2P9BA 1KZ1A 2ZR0A 3AY0A 4BN0A 4CIXA 5JHHB 2H5JA 3O21A 3RTCA 1CQPA 4X97A 3CVXA 3KQKA 1N2JA 3KEGA 2FFRA 3LTNC 4AS1A 3TVYA 3FGOA 2VDWB 3VR3A 5HMMA 4KDCA 2RC6A 4E08A 1S89A 2PVCA 1LDGA 3TTSA 5HJ5A 2PKQO 1A5SB 4OK5A 1VSTA 2I8LA 3LHSA 4F3CA 4FHGA 2FJPA 3BMQB 3SIWA 1XZNA 2QE7D 2HJGA 3VNAA 4LHYA 4LI0A 1MG0A 3K31A 5JAIA 1PW7A 2Q62A 3D3NA 3OVMA 4JI3B 1R3UA 3A1VA 2P3SA 3PYLA 3HDJA 5AW7A 1VKJA 4RL6A 5AW5A 4IFEA 2R11A 2B8NA 3AEZA 5FPYA 1RXVA 3LH5A 2VNAA 3VSCA 4E2XA 1X7ZA 1Z4NA 4KXQA 1XPUA 4JIMA 4HH3C 3RS9A 1YV9A 1E1MA 1QCYA 1CZKA 1RABA 1UKAA 2E55A 2HSEA 1P5FA 2AFIE 4BRUA 4R0VA 3LP6A 1KR2A 3QLJA 1T5LA 2GEFA 2P77A 4QEZA 2ZWMA 3E9NA 1S9HA 2C5AA 4RKRA 3DHYA 2CVOA 2JLQA 3KZCA 4AO8A 5KVQA 2JI9A 1VI2A 1QG2A 4RVNA 4WTOA 5AKYA 5MGNA 4U5QA 1ZD9A 4LXTA 1T9AA 5DBHX 4MVWA 1I10A 1E7SA 3AGQA 2BPOA 3N8NA 4KPUB 1UXKA 1ZNXA 5D01A 5CB4A 1XTZA 5IEJA 4NH0A 4Z4GA 1U0BB 1JR3E 1XYGA 3D43A 3MB5A 3P45A 4Q3OA 4ZKEA 3TQOA 3BVPA 2R751 1CZRA 3DWFA 3WRYA 5IN5A 3ZY6A 1KP9A 3ITNA 4EYSA 5BVHA 4HDNB 3PC7A 2BRUC 3I0ZA 3FCYA 3GFBA 3BWDD 3GGJA 3I73A 5IF3A 5M29A 4NYIQ 5IM4A 1C29B 1JEDA 2JAPA 2YZMA 1GG9A 1I5OA 3MZ0A 2JFXA 3LUAA