2CDCA

Sulfolobus solfataricus glucose dehydrogenase 1 in complex with nadp and xylose
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
366
structure length
359
Chain Sequence
b'MKAIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGADREIVNGKLGKDFLVLGHEAIGVVEESYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHGEIKIRILWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE, DHG-1
publication title The structural basis of substrate promiscuity in glucose dehydrogenase from the hyperthermophilic archaeon Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
total genus 123
structure length 359
sequence length 366
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.120: Galactose 1-dehydrogenase (NADP(+)).
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cdcA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2cdcA01
1RM4A 5G0TA 4AJEA 2Q2QA 4GMFA 3W1VA 4U5QA 1JLLA 5A06A 4KUEA 4MP6A 3DBLB 4HP8A 3OQ1A 1B8VA 1LRJA 1DBVO 4W9NA 5C7OO 4WLFA 4PLVA 4AL4A 4IMRA 1YDWA 2VNAA 1EK5A 3E1KA 4YJFB 5DULA 1LSUA 5DDIP 4EUHA 1U5AA 1CQIA 5LDGA 2W98A 4RVDA 3ANLA 1I5RA 3HHPA 3SC4A 1P1HA 1ONNA 2V6MA 1GV0A 3PVZA 1QYWA 5COBA 4XRGA 1W0CA 4MJLA 4K1LA 3ZWAA 2X5JO 4BB6A 2ZCUA 4PRKA 2ZQYA 2FSSA 1NTOA 3DXFA 3KSUA 3NDJA 5C3MA 4NU5A 2Y68A 4BQRA 4JBGA 1DSSG 2B5WA 1YL6A 4Y9DA 2OZPA 5H81A 3WQQA 4BQPA 1R6DA 5IDWA 1H6CA 1PL8A 4Z9XA 4BV8A 1F8GA 5IN5A 1WWKA 1QLHA 5IJZA 3TN7A 1MUUA 5GY7A 3ZZNA 1FDTA 2CF5A 3A1NA 4N5LA 5TJHA 4PLZA 1P1RA 4OSOA 5A5EA 2X6TA 3PQEA 4RGBA 2EKQA 1ULUA 5JCXA 3DZIA 3ZWMA 1XYGA 1NASA 2AQ8A 2FN7A 3ONEA 4CUJA 4Z9FA 4ALMA 4L76A 3MWEB 2JFGA 2Q4EA 4GVLA 3AFMA 5JPIA 3S1LA 4DLBA 5A5FA 4EYEA 4GWGA 1EUDA 2EXXA 4LN1A 3TRIA 4MPDA 4UAGA 1M76A 4YCAA 3Q2KA 1MG5A 4HX5A 2POQX 4J2OA 2PR2A 1KYQA 2C2XA 3QLJA 2OORA 3V2UA 4QO7A 3QWIA 2GF2A 3OIDA 1J6UA 5BT9A 4QT0A 5G4KB 5KVCA 1HKUA 2X9GA 4MKZA 3RROA 1IL0A 2B0JA 4HNHA 5EL0A 5JDIA 2I9PA 5JAMA 2HK9A 3L07A 3NUGA 4E33A 1T2EA 4YPOA 1ZSYA 4Z9YA 5GZ6A 3HFSA 1EUCA 1PJ3A 5LCXA 4NR0A 4GMGA 1XU7A 4R4JA 4BO7A 3ITKA 6ADHA 4ZQHA 4B4WA 3GMDA 3LSYA 2AQIA 2UDPA 1GCOA 2GERA 2J3JA 3X2EA 3ORFA 2OXIA 1FF9A 4UUOA 1R0KA 4DTIA 3BMNA 1YQXA 5KJFA 2IRWA 4R9SA 4P8RA 1FJHA 1FDVA 3ZWWA 1U1IA 3VVBA 3S8MA 4MVJM 3CTMA 2OUIA 4I5GA 2AE1A 4PG4A 3PDUA 1PGNA 1Q0QA 4KMSA 4BKOA 4RF2A 4XZ3A 4AJPA 1ZXBA 2FY8A 3CINA 3RUEA 3FBGA 3NTRA 4IZIA 1AXGA 1WZIA 4Q9NA 4YJGA 1FXSA 4IDEA 1E1MA 3HUDA 1CEQA 2ZTMA 4U7WA 4YAEA 5IAAA 1F0YA 4Z3DA 1B8PA 4OYRA 5JMPA 3L9WA 5CEJA 4BKRA 4TVBA 3A4VA 4CQMB 3UUWA 5G0VA 4RQTA 1U3TA 3RVDA 1DHTA 1F12A 3QVTA 1E3WB 1HLDA 3RI3A 3WSVA 4CPDA 2YHUA 3K8ZA 4U8GA 2NU8A 5JS6A 3IL2A 1QV7A 2J5RA 2O2SA 1Y8RA 2DBZA 2RIRA 1GCUA 5BQFA 5I7SA 1GD1O 3F1KA 4TRRA 4PIVA 1R16A 4XGNA 3PDJA 2HU2A 1HDOA 4DC0A 3ROKA 4DUPA 1Y81A 3O38A 4Z0HO 1Y5MA 5J23A 1MG0A 2GSDA 2BFOA 3ON5A 2BFMA 2IXBA 2AQHA 2GZ2A 3OEWA 5JLAA 4E5MA 1I3MA 3WGHA 3EZYA 3JYOA 5JY1A 2RAFA 4UEKA 1ENYA 1P33A 3Q9UA 2D1YA 3ZNPA 3WGGA 3GN2A 3OECA 1BDBA 1K0UA 4AJJA 4FFPA 2NWQA 2E4AA 4BNIA 2PLAA 1BMDA 5DP2A 1LRKA 4D79A 3DBLA 5I7EA 5JO0A 3K30A 4QUKA 4JN6B 4BNLA 4I9HA 5G0UA 1U3WA 3WGOA 4XYMA 5AYVA 3ROMA 3NT4A 1KBZA 1LI4A 1XDWA 1PX0A 3GZ4A 4JNKA 4TRMA 1P74A 2G0TA 1SEPA 2Z5LA 5L40A 1DDOA 3OJOA 4YJFA 3A14A 2JL1A 1CETA 4JLWA 4E5KA 4E31A 4M49A 3UH1A 3T4EA 4N18A 4B3HA 1PJ2A 1BVUA 1S6YA 3I23A 2P2SA 4MVJH 6LDHA 5DCUA 4XKJA 2BELA 4IGEA 1UXKA 2D0IA 3GFGA 4BVAA 1S7CA 2QHXA 3PQFA 5G4LA 2HK8A 3F4LA 4UVGA 2PNFA 4YRBA 1HSZA 3VPXA 4BB5A 1ZH8A 4NU6A 3DOJA 3VTFA 2PGLA 5KTKA 4YQZA 2D5AA 1L7DA 1ZK0A 1VE9A 1P1FA 4J9VA 4LVCA 3MCVA 3RAJA 4QFDA 1XG5A 2AQKA 4PZEA 1HE4A 1PIWA 3BMQA 3CMCO 4ROSA 5C7IO 4J6FA 3LVFO 3OICA 4I8XA 3F1LA 4IBOA 4OM8A 2DTDA 4GPD1 1W8DA 1EVYA 4W9NC 1WVGA 2ZQZA 2AEJA 2WM3A 1NQAO 2FSVA 2O23A 1O95A 4CM5A 3Q0EA 4YAKA 1I3KA 4KP7A 3R0IA 1LJ8A 2PK3A 1W6UA 3PWSA 2UV8A 5AXBA 1GEEA 4Y8VA 1Z7BA 2JFFA 3KVOA 1SOVA 1KERA 1M2WA 4CMBA 2DUUA 3Q3CA 2Z1NA 2FZWA 4E6PA 1TB4A 4RDIA 2B37A 3I6QA 5B1YA 1ISMA 4CR6A 3S2FA 3WBBA 5K6AA 1DC3A 1ZZEA 1QLJA 2O4UX 3H7AA 3SJUA 4PZDA 5G4KA 2C7VA 3S55A 4C7JA 3KLPX 4WLNA 1F17A 4RVFA 4RV9A 2O7QA 5BSGA 2BRUA 2Y1DA 2DVMA 2SCUA 3AUTA 2D5CA 1QYVA 1WAMA 3JQ9C 4WE3A 2P9GA 3TPCA 3FSRA 2WD7B 4E21A 5AXCA 3DBRB 4R69A 2QRKA 1NX6A 4NMHA 2CVQA 4W7HA 4AJ2A 2J8ZA 3SEFA 4HNGA 2VRCA 3A28A 1LC0A 4J49A 2JCYA 5DT9A 1UP4A 5I7VA 3VVCA 2I3AA 2NADA 3MTGA 5EMHA 5ILOA 3UN1A 4YT2A 2VWGA 4J90A 3UOGA 1DC6A 2JKVA 5ITWA 5BSEA 1JU9A 1LQUA 3MJSA 1PSDA 5TS3A 2WTBA 4HV4A 2C5AA 5KNLA 1FDUA 3WTBA 1KVSA 1KEWA 2P68A 4MVJA 2QZZA 2DPGA 3GZNB 3NT5A 4ND3A 1JAYA 4GGOA 3HB4X 3ASUA 4HADA 4YYZA 3IP3A 4GL4A 4LGVA 3WICA 1WDMA 2X0IA 2B4TO 1NXQA 4AVYA 1LA2A 4BKUA 1T1RA 4BV9A 2DUWA 5JDIC 1T4BA 4BNZA 1RJWA 5CDYA 1HSOA 1YDEA 3SLGA 2W8ZA 3GC6A 3SLKA 3EZLA 3JSAA 4QXMA 1TLTA 2X23A 3AM4A 3GPIA 3WLEA 2OHXA 4IDFA 4AJHA 3QV1A 4JK3A 4K6CA 3ZU5A 4L73A 1PGPA 4EW6A 3WGZA 4C4OA 4CQMA 3PGJA 4PZCA 4HXYA 3ZDFA 1OOEA 4YAJA 5ILGA 2XOXA 2WSBA 1E3WA 3AY7A 4XJTA 2AG5A 3F46A 4BIIA 1E1LA 4GKBA 3HFGA 4NBTA 1C0KA 4R51A 4FFRA 1E7QA 1DHRA 5TGDA 1GTMA 1ENOA 3O03A 4BO8A 2WYVA 4FJ1A 4BO4A 4E30A 3IKTA 4DQUA 3WB9A 3BHIA 4CMGA 1NFFA 1YB1A 1TXGA 3U3XA 2HMUA 2HCTA 5KKCA 3C7AA 2EWMA 4D3SA 4QEDA 5JFOA 3V2GA 4RDHA 2DTXA 4E12A 3U5TA 5T8KC 3FPLA 1JDJA 3MOGA 4IXTA 1C0PA 1DC5A 4A03A 4S1VA 3INGA 5COAA 2DT5A 4ZJUA 2D3TA 3HJAA 5A9SB 3AFNA 2YQ5A 1DLJA 3GA0A 3ADPA 3WNQA 4MP8A 3D0OA 4YACA 4ZU3A 4CMIB 1NVTA 3GNTA 1PGQA 4NG5A 3P2OA 3GVHA 4IS2A 1A7KA 1DFIA 3A9WA 2X7HA 3BTSA 3JQ8B 5CHEA 1TA4A 1ZMTA 5L7WA 3GNSA 2IYOA 1WZEA 3C85A 5JAIA 1JA9A 4EEXA 1TT7A 3ULKA 3JCZA 4XEHA 4L4XA 2IEDA 3DC2A 4GBJA 3TWOA 4OHUA 3GN1A 1ORRA 4CM6A 1T24A 4H3VA 4IGFA 3HNPA 3ZHYA 2C20A 4GSKA 1LDYA 3NGLA 4O0LA 1ENPA 3C8MA 3F4BA 1DAOA 1M66A 4PG6A 4YQYA 2D59A 3HZZA 3JQFA 3QVXA 1ZBQA 4XX0A 4HUJA 3EMKA 4XYGA 3RUDA 2ZKLA 3DDNA 4XRRA 1YVEI 1GYRA 4NFSA 4ND5A 3E03A 3QW2A 1R4MB 1L7EA 2NU7A 3VOSA 2X0JA 4DMLA 3C1TA 1VKNA 1WLYA 3LC7O 4YRAA 1V6AA 4CL3A 3KLMX 3LT2A 5B4VA 1XEAA 1LLCA 2BI7A 1NR7A 1Q7CA 3AI1A 3DOCA 2BF7A 5KIAA 3RFVA 3D5QA 4CMKA 5IDYA 2DLDA 3JQDA 3LLSA 4YTEA 3JD0A 1E3JA 1DIRA 4IM7A 3FRJA 4BO0A 5B4TA 4BKQA 1ZSNA 3GH3A 1ZIDA 2BHLA 1GAEO 2O3RA 3T7CA 3ANNA 4FB5A 2BH9A 1XQ6A 1ULSA 4NBUA 3ZN2A 4BNGA 1KOLA 2WYWA 1HDRA 3OH8A 4CMJA 3M1AA 4TZKA 2WE8A 4YDRA 5FWNA 4FFLA 4Z0PA 1I32A 1PS8A 2AEFA 2AG8A 2F1KA 4B7XA 3SVTA 2B36A 4E2ZA 3H5RA 4RQUA 3I9MA 2WD7A 4LRSB 3LDHA 3DBRA 5EINA 1YL5A 1QYCA 3ZGYA 4MIEA 2Q2VA 1XGKA 3ADOA 1GUZA 3PWKA 4P4GA 1HF3A 2VRCD 1LNQA 2PV7A 4XJSA 5CPBA 3ZNOA 4CV2A 3H9EO 1P1IA 5TJ9A 4AG3A 4L75A 2HKIA 4FD3A 5HS4A 3ETEA 1ZK1A 2DBVO 2BFPA 1EVIA 1ZK2A 4Y6PA 3IUSA 2GYYA 1DIAA 3P2YA 1HE5A 3RU9A 1SAYA 1BXKA 4MDHA 4IIVA 1BRMA 2CZCA 3D1LA 1NAHA 1ML3A 3GZNA 5HTOA 4MVJD 1E3SA 3WGIA 1F06A 2BGLA 2P9EA 2X1HA 4B7UA 5K6AC 1C1DB 1M75A 4XYEA 1EFLA 3AUSA 1IYZA 2QRLA 3LU1A 4BS9A 3BHMA 2Z1MA 1IZ0A 3CZMA 1H6DA 4I1IA 3V5NA 1SNYA 5U9CA 3GPDG 4OKIA 5EIOA 4DYVA 3KUXA 3PP8A 4LW8A 1I2ZA 4OIMA 1PGOA 2X22A 3O4RA 4E2XA 3AM5A 1BHSA 3PJFA 1BW9B 1R15A 3NDRA 4MVJP 1EBUA 4CMCA 4ESOA 3U4IA 5AVOA 4CJXA 1U9JA 3F5SA 2WWRA 5HWSA 3LQFA 4CM7A 4FFNA 2Q4BA 1T2CA 4CQMD 3N74A 3DONA 3F3SA 4NPCA 1IE3A 1SB9A 1BG6A 3C7DB 3V2HA 3K5PA 2VZ8A 4YJHB 4ZGWA 3JQ6A 4G65A 3FI9A 5A3JA 5T67A 5IXYA 1E6EA 2DTEA 4D7AA 4YR9A 2IZZA 4Q3EA 3KYCA 3TOXA 2UYYA 1E1KA 2V7PA 1ADGA 4IJWA 3U4DA 5C5IA 4ZVVA 1Q7GA 2X5OA 3HADA 5FEUA 1GQYA 2CMDA 2PD6A 1X0VA 3KHUA 4DQXA 1P0FA 3NAQA 4I08A 1P3DA 4UUNA 3WJAA 1QR6A 1E1NA 5H82A 4IJVA 1ZUD1 4W82A 3RUIA 2NVWA 3E5RA 3ZNQA 3I4CA 5A04A 5IN4A 5L45A 2IXAA 3C3XA 4XGKA 2Y05A 3JD1A 4CL8A 3WFIA 2CDBA 3BAZA 3UICA 4IMPA 5A9SA 3I9NA 4J0FA 3RBZA 2QQ5A 4WLOA 3VC7A 2JAPA 1WDKA 3O8QA 4H16A 3IJRA 3L4BC 3PFWO 4KUHA 4FN4A 3VAZA 3VH1A 4B3IA 3PHLA 3I3OA 2DM6A 5FI3A 2Y1EA 4WCDA 5TQVA 4URFA 2PGJA 1K6JA 5G0SA 1XHLA 3OA0A 3LT0A 2JHFA 2B83A 4CMIA 5K1SA 3WS7A 4DPLA 3JQ8A 5CDUA 4E3ZA 1ISJA 9LDBA 4RPHA 1BSVA 4XQGA 2QX7A 2JCXA 1DC4A 1GYPA 5TX7A 1J0XO 1AUPA 1UZLA 2GO1A 2OMEA 4MINA 1NPTO 1GY8A 3S2EA 2I76A 1ZEMA 3I1JA 4PVDA 2YFQA 1UJMA 2ZB4A 4TKLA 2PH5A 3H2ZA 3OQ6A 1ZO8A 2PD3A 2Q46A 3PZRA 3DZBA 4MKXA 3RD5A 4L4RA 4U0JA 2EP5A 4FJ2A 4NHEA 2CDCA 3VH4A 3V1YA 2I5PO 3LF1A 5EQFA 4EUEA 2J3HA 2BKAA 2PZKA 4INAA 2OL4A 1KVQA 2JD0A 2XPCA 3U4HA 1HLPA 3JQ9A 1ZW1A 2RHCA 1A9YA 3AY6A 2IODA 1R4MA 5IZ4A 3RFTA 2ZB7A 3PHJA 3GGPA 2DAPA 2DKNA 3VH2A 5I9MA 5T57A 4FPXA 2J5QA 2VUUA 3Q1LA 4RVHA 1H2HA 3E82A 4FC6A 5JY6A 3EW7A 1D4FA 3KSZO 5EN4A 5EESA 3W4IA 3ZHXA 5B4UA 2NTJA 5KKAA 1QXSA 4NJMB 4D46A 2LDBA 2QW8A 3D3WB 5FF9A 4FOSA 3H5AA 2O3SA 3LT1A 4Y98A 1ZNQO 5FFFA 5JNLA 1WP4A 4JQCA 2O3QA 3W8FA 1LDGA 2CD9A 2H63A 3P7MA 5DOVA 5JSFA 1HZZA 1A7AA 3OJFA 3JQAB 3K92A 1K3TA 4GVXA 1IULA 2NQ8A 4II3A 1LC3A 1R12A 3JQFC 3FR7A 3DAPA 1UXIA 2I6TA 4GLOA 4NJOA 3NYWA 2DFVA 5B37A 3M2PA 3EDMA 1RM5A 4L74A 1SEVA 3ZU2A 3EAGA 4E32A 3QWAA 4PLHA 1D1SA 1ISIA 2V6BA 5F3RA 4DGSA 4NFHA 3FNGA 1G6KA 1T26A 5TT1A 1T2DA 3IC5A 4OXKA 4WK6A 1JWBB 3OM9A 3ZWYA 4A7PA 3MJEA 4GX0A 3UHAA 3K9QO 3KSDO 2O3TA 3OEYA 4LMRA 4N5NA 5HM8A 3EVNA 2Q1TA 1IOLA 2A4KA 3JQCA 1I3LA 4ZQBA 1ID1A 3S2IA 1HT0A 3CPSA 4XA8A 2VCYA 4DIBA 3IKVA 1XLTA 4GQAA 2GZ3A 2YV2A 4CMAA 4J91A 3LYLA 4D3FA 4JJFA 1C1DA 3LT4A 3WWYA 2FWMX 2QIOA 2VT2A 2GN8A 2PGDA 2HRZA 5T8KA 3FNHA 4F46A 3H5NA 1YBMA 1YJQA 4KTVE 2G1UA 5LC1A 5TT0A 3EUWA 1JAXA 1YKFA 1RYEA 3GEMA 2RH4A 3B1JA 1BW9A 1B26A 3FPCA 3VTZA 4BMVA 1LU9A 2Q99A 1SZJG 2DQ4A 1CJCA 1HE2A 3AW9A 3PIIA 3WXBA 4OQYA 3H9GA 4XYBA 5JDCA 3D4OA 1JN0A 4ZQGA 1E6WA 1LUAA 4ZICA 4UVIA 3H8VA 2NACA 4YJHA 3GK3A 1DLIA 2ZJ1A 1J4AA 4PLTA 3G79A 1H5QA 3FD8A 3I9JA 3GRKA 3GUYA 1X0XA 1BVRA 3IAHA 1SOWA 4TKMA 4AJIA 5ADHA 4BO5A 4R54A 4U6QA 2D4AA 1B0AA 1PU2A 4U6SA 3ZW9A 2C59A 1UAGA 2IDZA 4ALIA 3OIGA 3MWDB 3RC9A 4YAIA 2ZB8A 3K6JA 4Q3BA 3V1UA 4UVHA 1FDSA 5DCYA 3DZJA 3WQSB 2IEBA 4GX2A 3AUAA 3DZGA 4DLAA 1Z74A 2EW2A 2VRBA 4WEQA 2VWHA 3GEGA 3HDHA 3WR5A 4D0RA 5JMWA 3ENKA 3ZU3A 1YH3A 5EPOA 4LRTB 1Z6ZA 2C7GA 3FNFA 4RZIA 5F21A 4NBRA 1YBAA 4W7IA 3SX2A 3JD3A 4O1MA 5I8WA 5DOZA 1UR5A 3C24A 2I65A 2ZYDA 2GASA 4PG7A 2JD2A 1E7MA 5C7LO 3VKVA 3BZUA 5A9RA 3NGXA 1E0DA 1E6UA 2EF1A 1P44A 4DREA 5JCJA 1HDCA 1SO8A 3D5TA 3RC1A 5DBFA 4WOKA 5IG2A 3INRA 4ND1A 4IDDA 4GLLA 1BXZA 1YO6A 4NIMA 4ZA2A 3F9IA 1R0SA 2FOIA 2GPTA 4R1TA 4DPMA 3B1FA 1TT5B 1DRWA 1PQPA 2H9IA 1XKQA 1EQUA 4E0BA 2YDYA 1EE2A 2AMFA 1E77A 3KB6A 4WNIA 1MV8A 1DFGA 2H1SA 4A2CA 1KVRA 2C82A 2EJVA 3B70A 2A9FA 4Z6KA 4MOWA 4W99A 4D42A 4YRDA 2Z95A 4IS3A 3TF5A 3NTQA 3QVOA 5BSFA 5ITVA 3GVPA 5CPFA 2TMGA 2PKQO 1B3BA 3P5SA 3CKYA 1OMOA 4XQ9A 2X86A 4R1UA 2HMWA 4EJ6A 3LK7A 4OL9A 3BHJA 3N7UA 3DB2A 4OSPA 7ADHA 2WJPA 3WNVA 3DR3A 1X1TA 3NJ4A 1YONA 3QSGA 2E82A 2FPPA 4L4SA 1GZ6A 3IS3A 1H9BA 4DMMA 3WYEA 3AOEA 2HRBA 1H94A 1ZXLA 1ONOA 2NV6A 1DEHA 2YUTA 4JBHA 4NJMA 2JCVA 3ZWXA 4I5DA 4JP2A 3MOIA 3DBHB 3D3WA 3I52A 1G1AA 1PQUA 4Q3DA 1EDOA 5A05A 3L9XA 3IJPA 1Y9EA 3WOHA 2A92A 3JQAA 4JCOA 1BXGB 3KRTA 3R3SA 2YDXA 4IDGA 3ITDA 2C54A 3HG7A 3L0DA 3OQBA 4XQEA 1MX3A 4CM4B 1JKFA 3E9NA 3M6IA 1HETA 3RUAA 4FCCA 2O3UA 3GMSA 4WASA 2I3GA 3W8EA 2HSDA 2XAAA 5TF4A 1E3EA 1V8BA 3LLVA 3H65A 1DFHA 1RWBA 3L6DA 3JD2A 4YEDA 3QE3A 1PR3A 3I4FA 2PTGA 1Q0HA 4RL6A 1G0NA 2NSDA 4QSMA 4BNFA 1JQBA 4DIOA 5BNTA 1E7WA 3RKRA 3NTOA 4QFCA 5L3ZA 1P77A 4FS3A 4PLCA 4Z3KA 3PTZA 4GX5A 3ICPA 3PJDA 2RCYA 4DBVO 3VKUA 1DIGA 4Q3NA 3BIOA 4HKTA 3UXYA 4J3FA 2V6FA 2YQ4A 3DEYX 1R37A 2GUGA 2EJWA 2W2KB 4WNCA 3OJEA 1UH5A 4E5NA 5CG2A 3VH3A 4ND4A 4DBZA 1C3VA 5ENVA 4RO0A 1AXEA 2O7SA 4FOOA 4TVOA 2ZYAA 1DOHA 3H9QA 5BR7A 2C0CA 2P91A 4NH4A 1DXYA 4YB8A 1UZMA 2ZJ0A 3VZSA 1K89A 2DFDA 3PHHA 3ROPA 4A10A 3HB5X 1YBVA 4A0SA 3F5QA 3JTMA 3ZNNA 3PPIA 4IQ8A 1VLLA 3W6UA 1EVJA 1P1JA 1W4ZA 4J1TA 2Y67A 2GLXA 4BUCA 5A03A 1PZFA 4CLEA 2EHDA 3UVEA 3D64A 5CDTA 4IQGA 3L4BA 1M67A 1RM3A 2BLLA 1WDLA 3Q11A 5DBGA 1A9ZA 4CUKA 5HRUA 3N58A 3SC6A 4NBWA 4PLFA 1JVBA 2AE2A 3WIDA 4R3NA 4XD2A 4UEJA 3OJLA 4J0EA 2PFGA 1YS4A 4OJNA 1LLDA 1U4OA 2FR0A 5L53A 1V3VA 4BOYA 2ZK7A 4CQLB 5GMOA 3WYBA 1B2LA 1LX6A 1T4DA 4UUPA 4E2WA 4GH5A 4TRJA 4JP3A 4LSMA 3VPFA 4MVJF 2HJSA 1VC2A 1IHXA 3GAFA 1LSJA 1ONPA 3NT2A 5I8ZA 5G0WA 5IFLA 3NEPX 4J4BA 3QA9A 4I5EA 3OFSA 5EERA 5A3VA 4PLYA 4HWKA 3QIVA 1Z75A 1Q0LA 2EERA 2B5VA 1K6XA 2B4RO 3PZBA 1D3AA 1IHYA 1I33A 1Z7EA 2GD1O 2QRJA 4RORA 2C2YA 3FHLA 1LEHA 1N9GB 4KOAA 4LK3A 4RVGA 2VZ0A 3TL3A 3ZU4A 3G3EA 4UVDA 3EVTA 4WLEA 4BKPA 1GYQA 1ARZA 5JDCC 2EV9A 1CDOA 1QYXA 2NQTA 5ES3A 5A02A 5CG1A 2OGUA 3PYMA 2X9NA 5ER9A 3DHNA 1I24A 4CR8A 1GQQA 3EY4A 4NBVA 5JCJD 4TMFA 1H93A 4AJLA 1KC1A 2NU9A 2X5KO 4OH1A 2GGSA 4J16A 1NVMB 1O9BA 3A06A 4FSHA 3PYLA 3VZRA 4Z0TA 4U0KA 4LCJA 3VPSA 3ZWCA 4OO3A 4L9RA 4JGBA 3GLQA 4XYLA 5THKA 1XQ1A 3E6AA 3IP1A 3ZHBA 2CSUA 5EJ2A 5KOIA 4IUYA 3BA1A 2O2YA 1YJ8A 1KEPA 4YBZA 4CV1A 1J49A 2NTVA 2Q1WA 3VZPA 4F6LA 5CFZA 1YQDA 5L9AA 4BO9A 1D7OA 3WGYA 3WBFA 4EUFA 3DO5A 2IZ1A 1HRDA 3I9KA 1QP8A 1MLDA 2OFPA 3P19A 4IPTA 4RVSA 4BNVA 1LLQA 4WUVA 2E37A 4AJ1A 3KZVA 3B6ZA 1RKXA 4HFRA 1ZKMA 2PH3A 2EKPA 2J3KA 3DAFA 2YYYA 1PQWA 2CY0A 4L0QA 4PLWA 4RZHA 3T4XA 4F6CA 1F14A 2VOJA 4OOEA 3RU7A 4CR7A 1AHHA 4JIGA 4BNNA 2EGGA 4PLPA 4A5OA 2DC1A 5IDQA 2XXBA 5TLSA 2OP0A 3E8XA 1TEHA 1Z45A 1HDXA 4ZN6A 3DBHA 1PGJA 1H9AA 3RWBA 3RKUA 3ZWNA 4GGPA 7MDHA 2E49A 2E48A 1DO8A 4BNJA 1NAIA 1EQ2A 4DYDA 5KJ1A 1MB4A 2V6GA 4QQRA 3IOYA 1BXGA 5HBRA 3PI7A 3JQAD 4M55A 4XGIA 4CM4A 1XIVA 4R5HA 4J7XA 1SB8A 1JW9B 4LVUA 4MVJI 3RCBA 1N1EA 1XELA 3LC2O 1QORA 1I2BA 2F00A 3MJCA 4N7RA 2GRAA 1FDWA 3GVXA 2VWPA 2BGMA 2VHYA 1UP7A 1Z73A 2JAHA 2J3IA 2WDZA 4O5OA 4AICA 5KCZA 5COQA 3RASA 2VQ3A 2P4HX 3UF0A 4YVFA 3MEQA 3AOEC 4HFNA 3WJ7A 1HYGA 4HFJA 1J5PA 4LSWA 5HS6A 4BNWA 3WGTA 3ZV4A 1U5CA 2EP7A 4WCFB 1GR0A 5H83A 3UAGA 2W2KA 4UREA 1P9LA 2I99A 1I10A 2JHGA 3KBOA 3U49A 5CEFA 1F8FA 1PEDA 4AJOA 1CRWG 5AXAA 3KEOA 5F5NA 3ZWOA 1G0OA 2ZTVA 1LSOA 3G1TA 3RC2A 1UXJA 2I67A 2Y1OA 3GHYA 2VWQA 2UUOA 1PS0A 3GRPA 2OP1A 3NV9A 3V1TC 3K2EA 1OZAA 1R4NB 2Q45A 1AGNA 1EFKA 4BNUA 3BMNB 1B14A 1X7DA 1SPXA 1PZGA 5AOVA 1AHIA 2NU6A 3FNEA 4YXFA 4JBIA 2DBRA 1X15A 2NUAA 1GV1A 1WMBA 1NHWA 1Q1NA 2G17A 1FMCA 2VOEA 1I3NA 1Y7TA 2D8AA 1H2BA 4R1SA 2YJZA 4UULA 4CM3A 1HDGO 1MGOA 3CEAA 2RH8A 1N8KA 4MIYA 1GL3A 3PHIA 3DHEA 1D8AA 3OMLA 1XR3A 4J9UE 3E5MA 4RF3A 5JAQA 5KVQA 4O63O 4CQLA 4M87A 2CNBA 1E3LA 1HXHA 4ITUA 3I9LA 1QG6A 1YL7A 4BGVA 1IY8A 4PCVA 3FBTA 1OC4A 1ZVMA 1U8XX 1U7HA 1NM5A 3TZ6A 3ABIA 1Q2XA 3RQSA 1VI2A 1H6BA 4BO1A 3V8BA 4BGUA 3UKOA 2HLPA 2A94A 4A26A 3G1UA 2YFHA 1CF2O 5GZ3A 1LLUA 1GUFA 1CIVA 1W73A 2VHWA 5JC8A 3BMOB 3DTYA 5KJ6A 1YB4A 2GN6A 2NVBA 5BNIA 4EITA 1N9GA 3ZH2A 1V0JA 3PYXA 1KS9A 3I5MA 1E5LA 3FN4A 3KO8A 4FGSA 2FPGA 3BTVA 4NK5A 3C1AA 5L4NA 2DPHA 5L51A 1JWAB 4CMEA 1AE1A 1GPDG 1GUYA 4M1QA 3I9OA 3PGXA 4IINA 5ER6A 3O9ZA 3SJ7A 8ADHA 5TC4A 1WMAA 1O94A 3GQVA 3U62A 1I30A 1U3VA 1V3UA 4WGGA 1UDBA 3QQPA 5TSDA 1DJNA 4MP3A 4ZHSA 1UZNA 2HO5A 1DIHA 5L4SA 3ZCXA 1BGVA 2BFAA 4IDBA 4CLRB 1GEGA 3OBBA 1CERA 1KETA 3ST7A 4CM9A 3U09A 1P31A 4PLGA 1I8TA 5TNXA 1C0IA 4DL9A 4E4YA 3RUCA 9LDTA 1B16A 1XU9A 4B3JA 1R66A 4WPGA 4E2YA 3GFBA 4FW8A 4CLXA 4KQWA 1NBOA 4FGWA 1EK6A 2ZCVA 3OHSX 5ICSA 3OP4A 4GI2A 3FR8A 3GG2A 4XDZA 1P0CA 2GNAA 4UEOA 4ONEA 3BTUA 2I66A 1FK8A 2WD8A 1PS9A 4MVJG 5FI5A 3PFFA 1MXHA 3WLFA 1IUKA 1OI7A 3JD4A 3JYLA 1CWUA 3JQ7B 1BDMA 3KEQA 4FDAA 3JQGB 1PJSA 4IQ0A 4HBGA 3U9LA 4IXWA 1NFQA 4RVUA 5JE8A 3D7LA 1YE3A 3AWDA 3BMQB 4D44A 5A9TA 1X7HA 1GZ3A 1V3TA 3TOZA 2XXJA 1U2DA 2PZMA 4O59O 1A4IA 4KUGA 4KZPA 3K31A 4CLHA 4B7CA 4ALJA 2OOSA 4UUMA 2JJYA 1HDZA 1Z82A 3G49A 1NWCA 5DP1A 1JTVA 1HL3A 2QZ9A 1VJTA 3ICCA 3C7CB 4EZBA 4M8SA 1ZK3A 3DMTC 4OXYA 2YW9A 3DHYA 3STHA 1V9LA 4TRNA 2JFHA 5BNFA 1IPFA 5KJEA 4G2NA 4JJIA 4ILKA 4J7CA 1X14A 2Q1UA 4D3DA 3R6DA 5MDHA 4OGWA 4XB2A 3E9QA 2ZB3A 4GKVA 2W2LD 1LRLA 3JV7A 4NI5A 1DRUA 3DMYA 3EGOA 1IPEA 1HTBA 4E13A 1ZCJA 2X4GA 3BMCB 4DA9A 4YT5A 5AXDA 4OKNA 5FYDA 5EQDA 1SC6A 5I7FA 3OF2A 2C5EA 4QX6A 5HA5A 4DVJA 4E5YA 4WCFA 2B4QA 2YHIB 3WWZA 2Y1CA 1Q7BA 4KDFA 3HDJA 5I9NA 1BWSA 1PR9A 3CUKA 3IDSA 4EEZA 1XSEA 3OSUA 4XIYA 3TFQA 2ZIZA 3AK4A 3O26A 1HEUA 1OBFO 3RUFA 3QY9A 4EI2A 2VNSA 1R4NA 4N5MA 2W90A 3M1LA 3QHAA 4Q3AA 1E7RA 4H7PA 4K9DA 1PTJA 3COSA 3GDGA 4S3MA 1VL0A 3OETA 3AJRA 1E7YA 1HZJA 1N7HA 3QWBA 2P5UA 3WMXA 1O89A 1NFRA 3AU9A 3VZQA 2B35A 4D0SA 3G17A 3AUUA 1DPGA 5F1KA 1DIBA 3IUPA 3HQ4O 1CQJA 2RBEA 3DFZA 3PHGA 1D1TA 3KM0A 4QTZA 4J2HA 1X13A 4EBFA 3WTCA 1E7SA 1PJLA 2H5LA 2PY6A 2YZ7A 2WMDA 2X8LA 1K6IA 2GR9A 1ENZA 1YOVB 3E18A 4J4TA 1KVUA 4GAEA 5U4QA 1ZJYA 1EUZA 2EGHA 3KV3O 2EIHA 3TQHA 4IDCA 1M6WA 1HDYA 1EBFA 3NDIA 1WXDA 2X58A 1HYHA 4TQGA 3SXPA 1TI7A 3DWFA 1PJTA 4B8ZA 1NHGA 2FPIA 3JYPA 1I01A 4RF4A 4A27A 3ZHZA 3KOUA 2HAEA 3CZRA 2R6JA 2O3JA 2VYNA 1YRLA 3IIEA 3OJ0A 2VTDA 3ZV5A 3BMOA 3WSWA 1IB6A 3KYDB 4CV3A 3HWRA 2FRDA 4EJMA 1Y1PA 1PWZA 3WQRA 3JQBA 1PJBA 1RPNA 2NTNA 4BMNA 8LDHA 1LDMA 2R00C 3GAZA 3CIFA 2HK7A 4HY3A 4XR4A 1QYDA 1B7GO 4ZRNA 1NYTA 1I36A 2UAGA 3Q9NA 3BXXA 3HN2A 1NQOA 3DZHA 4B4VA 3LF2A 5F1PA 3AI2A 3C1OA 2AW5A 1P1KA 2Q50A 2JD1A 1X1EA 2VUSA 4OAQA 5LDHA 2Q3EA 2W4QA 2FHSA 4II2A 4A73A 4AFNA 3MJVA 1O6ZA 1NP3A 2PA3A 5ICMA 2QYTA 3K96A 1DB3A 3H9JA 4BNKA 4MKRA 2HMTA 1ZFNA 4Y67A 4YAGA 1O5IA 1YQGA 3RUHA 2CF6A 4MVJE 3D4NA 3EYWA 2CDAA 4O6VA 4RPKA 1XCBA 3F6YA 1MA0A 3W4KA 4NZ9A 2Y0EA 4CMHA 1Y6JA 4P38A 2ZTUA 5A4DA 2NNLD 4CM9D 1QSGA 1U8FO 4D41A 2WEKA 3ASVA 4Q3CA 4YT4A 2P5YA 5MGBA 4M54A 5JYDA 4QO8A 2GN9A 2G76A 1GPJA 1ADFA 3SBOA 4BNTA 1SCUA 5IZCA 5L7TA 2AXQA 4YJDA 4KWHA 4D43A 4FQ8A 4ZRMA 4FJ0A 1NPDA 3OA2A 2NVUB 1VPDA 1MC5A 5AQ1A 1PJCA 4G5HA 3UCEA 1PJQA 3GHHA 4BL5A 2AA3A 4CMEC 2CVOA 4OOFA 4DIFA 3JQ7A 2OBNA 1QKIA 1H6AA 3GUCA 1LBEA 2PWZA 3JQGA 1N1GA 4R3WA 1K5HA 5ENDA 3DOOA 3TDKA 1N92A 2HQ1A 1C0LA 4PVCA 4R01A 1PZEA 1C1XB 2G82A 2GCGA 5TRTA 2V65A 4NQZA 3ONDA 3B1KA 3NKLA 4R9RA 3HDYA 4PG8A 1GU7A 1HWYA 5L95A 3RC7A 2YV1A 4TROA 3GDFA 3WIEA 1Y5RA 4I5FA 4WKGA 1QRRA 2BD0A 4DPKA 2FP4A 3VDQA 2ET6A 3KYBA 2Q49A 3OIFA 3FWNA 3GGOA 5JAZA 2FR8A 3H3JA 1O0SA 4AJKA 3RIHA 4KQXA 3GVCA 2VT3A 2NLOA 4RF5A 5L7YA 3BMCA 1ZMOA 2Y1GA 3ZWVA 4LMPA 3ZWBA 1GZ4A 4BMSA 4EDFA 2P4QA 4XDYA 1E5QA 3RSHA 4C7KA 1O8CA 1A4UA 4EGFA 2YHIA 1PZHA 4X54A 3W8DA 2QG4A 3R1IA 3E48A 5JXWA 4NK4A 1XA0A 2DU8A 1UAYA 3Q2IA 3GOHA 3H3FA 1PWXA 1VKOA 2VZ9A 2OO5A 4IDAA 3EC7A 2EEZA 3DFUA 4NNJA 4CM8B 2YV3A 3QVWA 3DL2A 2J6IA 3QRWA 3UCXA 1EMDA 3T7EA 1KVTA 4BO2A 1UXHA 2PZJA 3VPGA 5BSHA 1NVGA 4IIUA 2VHXA 3RJ5A 1U4SA 3GNQA 3MZ0A 1N5DA 5T64A 5KVVA 1WPQA 4XWYA 4BGEA 2GDZA 3AOGA 1VSUA 2E6UX 2PZLA 3H9UA 3RBVA 5KWEA 3EK2A 3PJGA 3RJ9A 3G0OA 4ID9A 1V35A 2HDHA 4R5MA 4I9UA 2UVDA 4AJ4A 4BHTA 4DC1A 1Y8QB 3PWZA 4BO3A 1B15A 1GQ2A 4J4HA 4WCFC 5IF3A 3CMMA 4PRLA 4BNYA 2CVZA 3AY3A 1YOVA 1ZK4A 4BO6A 4WJZA 1N2SA 3TL2A 3L6EA 1LSSA 3WX0A 1KEVA 3FCOA 1JVSA 3VHRA 3HE3A 1U7TA 3ZWPA 1UUFA 1YWGO 5CEEA 2Y0CA 4RCVA 3UCFA 3WMWA 4XB1A 1IZ9A 1B3RA 4OQZA 1WW8A 1E3IA 3JYQA 3B20A 3ONFA 3M2TA 4RPLA 1E92A 1NWHA 2VUTA 3CSDA 4CV0A 3KETA 2VYND 3VPHA 1OAAA 3LZ6A 2LDXA 3KYDA 4JX8A 4FFMA 1NPYA 3S2GA 2VYVA 3FF4A 3KYCB 5L4LA 4WECA 1MP0A 3GT0A 4RJTA 2DBQA 1DRVA 3NRCA 4CLOB 3DAGA 4D45A 1NNUA 1UP6A 2GZ1A 1SBYA 5JBIA 2Y1FA 3CH6A 4AJNA 1GFSA 4FR5A 2G5CA 3AI3A 2BI8A 3RFXA 4ALKA 1MC4A 4KTTE 4B4UA 1U2GA 4LISA 2BGKA 5DNAA 1T1SA 3L6OO 5JC1A 3IMFA 1DAPA 3WG9A 2RHRA 5TIIA 5GZ1A 4PGFA 1I0ZA 4XIJA 1R0LA 1LXCA 4KDEA 1VJ1A 4RLSA 1LDBA 1A5ZA 3O8QB 4TWRA 3X2FA 1OFGA 4FC7A 4P22A 1EEHA 4EJ0A 4RLHA 3HN7A 1A27A 1TT5A 3KXDA 1K2WA 3GVIA 2O4CA 2PKQP 1ISGA 3PRJA 4FIZA 3VDRA 2CFCA 3AU8A 4F3YA 1VL8A 1ZSVA 4ZQEA 2FMUA 4B79A 3ANMA 3ETGA 1Y9AA 5C37A 3ETDA 1DJQA 1A71A 1T2AA 4J1NA 1T2FA 1X7GA 1VJ0A 2Y0DA 4MO2A 1EVZA 2XF8A 1ISHA 4J7UA 4ZD6A 3D3EA 3DTTA 4HFMA 4K6FA 1ZEJA 2NM0A 2O48X 3AM3A 3DMTA 3JQEA 5DF1A 2O50A 4PG5A 5U1PA 4NDNE 3JQBC 3H6KA 3WGQA 4CLRA 2UUPA 3ENNA 5DBIA 5G2OA 5CAEA 4PFJA 3BTOA 1GADO 2NVUA 4TSKA 3GGGA 2HJRA 3W4JA 3TJRA 4M89A 3TZQA 1KEUA 4GX1A 1UDAA 1WNTA 1BTOA 2VHZA 4ZQFA 3UFXA 4ALNA 5KVSA 3GR6A 5DN9A 3QP9A 2EKLA 1VSVA 3LC1O 1C14A 4H15A 1H0KA 1ADBA 4YT8A 4DQVA 1C1XA 3DQPA 1JKIA 1LDNA 1PL6A 1VRWA 3ZV3A 2C29D 4K28A 1SMKA 3ZV6A 4OXNA 2X0NA 1VL6A 5I9LA 1I2CA 1RM0A 3H4VA 3L77A 1AN9A 2IYPA 1KY4A 1YXMA 1KY5A 1T25A 4PN3A 4Y6SA 4N54A 3JYNA 3PK0A 2TMDA 4CLDA 3MTJA 2VTEA 3WFJA 4WLUA 3W6ZA 5IZCC 3E9MA 3QWFA 4XCVA 3UGKA 4BNMA 4GWKA 3IQDB 3TFOA 1ADCA 3MJTA 1RYDA 1JKJA 2W2LA 4FFOA 4J1SA 2HMSA 2CUKA 1EE9A 5IXSA 1TVEA 5F1OA 4LCEA 2OBYA 3I6IA 4M86A 1NQ5A 3WDSA 1ZJZA 2Q1SA 3TZCA 4BNXA 4B4OA 4I9NA 3HSKA 1NQTA 4L8VA 4WOJA 4K26A 4P4NA 1OC2A 1VM6A 2ILTA 4DRYA 2IE0A 3R3JA 1PJ4A 2Y93A 3I83A 3WYCA 4R68A 3NX4A 4GSLA 4BGIA 4UVEA 2ZYGA 4OMUA 4XR9A 2YY7A 5JO9A 3QJ5A 1EDZA 4J1QA 4CM8A 1CYDA 5K0ZA 3PEFA 1QMGA 1UDCA 2WYUA 4JJGA 3U4CA 1LQTA 3DBVO 3HDQA 5F5LA 2D2IA 4TZTA 4DWVA 4FBGA 1ISFA 3PLRA 4WEOA 5JW6A 3FTNA 2VN8A 3PXXA 4BNHA 5CDSA 2QYSA 1LTHR 1YGYA 4DXHA 3FTPA 4RPGA 3FWZA 2Q2WA 4IJUA 2X9VA 2ZTLA 3TNLA 2VHVA 4CUZA 3F47A 2A35A 3GG9A 4JXKA 2R2GA 2PD4A 2WE7A 4P4LA 2C07A 2R00A 4CM1A 1NR1A 2AHRA 3PQDA 1EZ4A 1B8UA 3ZW8A 1MFZA 3DZKA 5A1TA 3QVSA 5CDGA 1LDEA 1Y8QA 2J5KA 3RBXA 1M6HA 3QWHA 5B12A 3PLNA 4CODB 3NJ8A 4W4TA 4YJGB 3TSCA 4IZHA 5KJCA 1HYEA 3TZKA 3L4SO 5T6BA 3K2BA 2EW8A 1PL7A 4YWJA 4ALLA 3H2SA 5T5QA 1XWFA 3ROQA 2HMVA 4G81A 2FR1A 4RPJA 1KIFA 5JYEA 3GF4A 3U0BA 3UW3A 4E5PA 4XQCA 4B8WA 5K9ZA 4F45A 3MJ4A 1UXGA 1U3UA 2B69A 4W6ZA 5DCWA 1L1FA 4JROA 1U28A 4ND2A 2EG9A 3CXRA 2HUNA 4R16A 3INTA 2IZ0A 2H6EA 2GN4A 4Y6RA 1KC3A 1Y8RB 4IJKA 4KWIA 5THQA 4YA6A 3TZHA 3BYZA 2P9CA 3GDOA 1N7GA 1MFPA 3EHEA 5DZSA 2AEMA 2Y99A 3CE6A 4QECA 4DLLA 5CP8A 2VYVD 4R41A 2PKRA 4CLOA 1YB5A 2BMAA 4IY1A 4J43A 4R1NA 4NFYA 1A72A 3PJEA 1HE3A 4WLVA 3Q6IA 3PIDA 5IDXA 1QV6A 3GEDA 3D4PA 2FZEA 3DZFA 3KTDA 4Q39A 2X0RA 4MIOA 1GDHA 2ZATA 3ZI0A 1MXFA 3GY0A 3K73O 2Y66A 1P45A
chains in the Genus database with same CATH superfamily
1Q91A 4AJEA 2QV7A 2Q2QA 3D6HA 1DRKA 4RDCA 1PHRA 2ZANA 3IUEA 1VMIA 5LYJB 1JT9A 5J5VA 2C42A 2I2XB 2XMCA 4UM8B 3DBLB 3ZV4A 4HF7A 3WWEA 1P19A 5JYBA 3IR7A 1IBCA 3S3TA 2UU9B 2ZRGA 1NF9A 3EQ7A 3W9SA 4PANA 3IPAA 4WLFA 4XDGA 5EIAA 1QO0A 4UKDA 3KE9A 4IMRA 3CA8A 3TINA 3C43A 2CSXA 3NDBB 4AZ0B 1C81A 1PG2A 4PU0A 5CT6A 2PXCA 2BV3A 3QPDA 5BRNA 1MR3F 2W98A 2BR3A 3QFSA 5DYGA 1E6LA 5FUWA 3QX9A 3EXIA 4MMXB 2W00A 2F8TA 5EWLB 4UUAA 2GPWA 1QYWA 2VDLB 3LCMA 4TYWA 2QPOA 5BV8A 1OU0A 2WHEA 3H75A 4LXIA 2ZQYA 4DSNA 1EGVB 4MR7B 3OQJA 2CJPA 3VM6A 5K3AA 1DOAA 4MLZA 4BQRA 4BVFA 3IOEA 2V7VA 4JBGA 4Y9DA 1EWVA 3WQQA 3DDCA 2IYZA 2YL2A 1H6CA 1PL8A 2ODPA 2ZZKA 1F8GA 2AW3A 2AVNA 3UMRA 1WWKA 4KIFA 3JAWB 1QLHA 2DRIA 5GTDA 3HL4A 2H31A 1SBNE 4WZAA 5D87A 1UWCA 1FDTA 3LCJA 3T0FA 2CF5A 1WCV1 3CWZA 3A1NA 3DUFA 3EAQA 4ZO4A 1P1RA 3DDSA 3ZGOA 4B6PA 1MDBA 2C58A 4RGBA 2J0VA 2EKQA 1ULUA 1JFTA 4LOJA 3BRSA 4YLYA 2J5BA 2K6GA 4MPJA 3KLNA 5KYKA 1HORA 3A9UA 2FN7A 2IEAA 2PU7A 2YR0A 2GI4A 4JHLA 5JANA 1Z2CA 5LJIA 3ZEAA 2ATVA 2RARA 1JLKA 3A1CA 4XCXA 5KB3A 4DLBA 3ISVA 5A5FA 1JLRA 3S1LA 2XY4A 4MROA 4W5NA 3G8AA 3NGMA 3BEDA 1TAHA 4LZWA 3VOAA 4LN1A 4Y1FA 3RS3A 3WK9A 5EYPA 5LYYA 3R9IA 3SIXA 3TRIA 2YNMA 5JAPA 1Z6GA 2DUJA 2JNWA 4YCAA 1SVUA 3MMZA 3Q2KA 2XWSA 1S9DA 5ETJA 1CLEA 3UK1A 4AURA 2PVPA 4QOHA 2UZ3A 1KZGB 3YASA 2PR2A 2PT5A 3LKVA 2C2XA 2KQUA 5LU8A 1FFAA 2WSLA 2QSUA 1T0BA 3UT5A 3FB4A 3I42A 1F38A 1J6UA 1FTQA 3N9IA 4WNYA 2EFEB 1D0VA 1JR3A 1SK9A 4G5FA 2C5LA 4C3UA 5HSGA 4X0EA 4CEIA 3M3PA 2P9FA 3WRWA 3AEYA 1VBFA 4BQFA 5BN5A 1KK1A 4TSRA 1GPYA 4FFWA 4MB0A 1LF0A 5E9QA 5JAMA 1C7QA 1FXWA 4J29A 1EAYA 1ABFA 2VSOA 1T2EA 1YI1A 3QGMA 1ZSYA 1AU9A 4GT1A 4KPYA 1Z2AA 4JVOA 1FUKA 5GZ6A 4B5LA 5H68A 5F98A 3OQHA 1Z4QA 3IDQA 2QQEA 3HCBA 3ITKA 2IDKA 4ZQHA 6ADHA 1E4OA 3DEIA 4QYSA 2MSDB 4YH1A 2OGSA 2GZHA 3EZ7A 3F8TA 4EY6A 1GCOA 2GERA 2RB5A 2VJLA 4I4TF 3DTVD 4EFMA 2X76A 2I4TA 4YI3A 1KJQA 1L1RA 4UUOA 2J59A 1KH2A 4AUNA 1DAIA 5ARBA 3KFLA 2R8EA 3GEIA 4MQLA 1SBHA 2BBTA 5DBOA 5PGMA 3OPXA 5CM2Z 4Q1AA 5KJFA 3E4DA 3C3JA 1XD8A 2LWIA 4U02A 1PT9A 4F2PA 1TTPB 2W48A 4WBSA 5FBVB 5HUQA 3ZXUB 4GPBA 3ZWWA 3VDNB 5KNCA 2J0EA 1JR2A 1U1IA 4C4YA 1YS2X 2ZOSA 3L2OB 5HF9A 1AQNA 2OWDA 2DSNA 3K6KA 4QPNA 4NEGA 1WUKS 2PMWB 1ZGAA 1MQ9A 1MC8A 1Z37A 2HCJB 2QY9A 4RIEA 2GFQA 4WT7A 1TVKB 5TPZA 1GNPA 2PLNA 4IUBS 1UPTA 1O7JA 3HDGA 2FZ4A 1TKBA 1PGNA 2MDTA 4X00A 3R7AA 1Q0QA 3V9AA 1WZNA 1DKRA 1Z17A 2W4IA 2FY8A 4JBNA 4Z9BA 3R8XA 3RUEA 5IBCA 4RMJA 2E87A 3L06A 5J58A 2GK4A 4Q9NA 1XDGA 3M5DA 1FXSA 1E8NA 1SCKA 4QDTA 4F1KA 3DNFA 4IDEA 1NLUA 1RIFA 2KS6A 4F1WA 4PO8A 2ZTMA 4YAEA 4Z3DA 3RSFA 5JXJA 3AM1A 4XXHA 5TVKA 2Q5HA 4CETA 3VHXB 2IH5A 1Q92A 4MK4A 1O6CA 1H2XA 4MXDA 5G0VA 1QG0A 4DLNA 2J41A 1DHTA 2H51A 4G5OA 3FTQA 1YUMA 5LDHA 4LQ4A 1JR6A 2Y1LA 3QLUA 1HLDA 3GRZA 1ZGBA 4LJ9A 4XLLA 5D3KA 5DM0A 2CXXA 5K2MA 5FA8A 4QOSA 3DM9B 5DWVA 3ZKWB 2O2SA 5KYWB 5H4HA 1RZ3A 1OH6A 1ZRMA 2WJ4A 4EKYA 1R8YA 1DC8A 2VF8A 5I7SA 1GCUA 4ZRDA 4BEVA 3F1KA 3E2PA 3ESDA 1FA9A 1R16A 3U40A 1HDOA 4TTJA 2PLFA 4D1YA 1ZLYA 1VPEA 3C70A 3FDZA 3O38A 4O25A 4Z0HO 5HIIA 8AT1A 2IBTA 4M83A 2HMAA 3A6EA 4YAIA 2BFOA 1J22A 2GZ2A 1VI6A 2IIBA 4EB3A 3OTHA 3KFVA 3T9BA 1WMEA 1S2NA 5BNWA 4IVPA 3FUWA 1P33A 2FQYA 1MO3A 1KJIA 3GBSA 4V2IA 3OECA 1FUEA 2YQZA 4G9GA 2AJBA 4QUEA 3WGGA 1DIOB 1XALA 2LIPA 3AVOA 3LUPA 4M9SA 1OE0A 2PLAA 1H42A 4ZODA 2O7VA 3X3HA 2NZYA 3GLKA 2UYQA 1LS6A 2VATA 4UD6A 5CNIA 3W2FA 5I7EA 1I13A 3FHOA 3K30A 5JO0A 4QUKA 4I9HA 1XJ0A 5KZMB 3ROMA 3L05A 4MW0A 1F2UA 1Q12A 4IV5A 5IJ0B 1KBZA 5IK2A 1XDWA 1GGVA 4EM6A 3GZ4A 4JNKA 3WSTA 2W43A 4JJEA 5U4XA 1MRSA 2YWBA 6Q21A 1DC7A 2B94A 1CETA 3HCPA 2SHKA 4M49A 1GIAA 3Q15C 4IZOA 4UPDA 4EK9A 5KYYB 1NUAA 3I37X 3I23A 2PU5A 2CHQA 3OMXA 2PIDA 2VJQA 2VTKA 3TI7A 4EF4A 5J2UF 1J0BA 3EWSA 5EJGA 5TRTA 2JRLA 1XAIA 1R3UA 2QHXA 3I45A 3PQFA 4QQNA 2HK8A 2IV2X 5LQMA 4UVGA 1SVNA 2PNFA 2O2HA 4I9FA 4REQA 4YRBA 4V38A 4KGVA 3VPXA 3I9V6 1OXMA 3OX2A 2TMYA 3FUVA 4HH4A 9GPBA 4NU6A 4U00A 1LK5A 2BLNA 3QUCA 1FYWA 2HWYA 5F2EA 4F71A 4HT3B 3DE7X 5CNJA 16PKA 1O6GA 5LQNA 3GWGA 3WP1B 1P1FA 3NTXA 3CH7A 5FNVA 3CEHA 3Q88A 4DMHA 4X92A 5GGXA 2IU4A 2JFYA 3C8HA 3OT5A 3REQA 3U9TA 1VA5A 3HPRA 4P6VF 1YMUA 5LNK1 3W06A 3OICA 2NU7B 2IPNA 2XE6A 3QVGB 4HAXA 5IAGA 1X1AA 2ISQA 1W8DA 4JHXA 1WVGA 3UOAB 2GF0A 1C9JA 3Q10A 4XH9B 2E89A 4RTQA 2XTAA 5KTRA 4CM5A 2B8TA 4X41A 3Q0EA 4YAKA 1IN6A 1I3KA 4MRVA 3NANA 5KBYA 3ER8A 3M4YA 4BFSA 3NOOA 2NZVG 3U44A 4JOSA 4Q1FA 3PWSA 2UV8A 1GEEA 4AQ7A 2OILA 3L7JA 3PPVA 4WA7A 4EELA 2DPYA 2BZ0A 2O20A 4IIGA 4B2IA 1KERA 1W75A 3A1TA 4NV3A 3MAGA 2YNMD 2RK3A 4KNYA 1U4NA 2EL7A 4G4IA 1LF5A 2NYRA 3ET4A 3MBKA 2R1VB 2WSSA 4HRAA 2I9KA 3HR4A 4RDIA 2ONKA 3I6QA 5JRZA 2FWRA 4H60A 3ZDBA 3IIJA 1DC3A 1ZZEA 2E5WA 2QD3A 2QPAA 1N32B 4K9MA 2C7VA 3O3NB 1QTNA 3OZRA 1GAQA 4WLNA 1S89A 1XZNA 2YZ2A 4RIGA 1V5GA 4RV9A 2O7QA 3AJEA 2E1RA 2DVMA 1ZYUA 4M7OA 2D5CA 1KJNA 4X1YA 4A1OA 4LZAA 2P9GA 3FSRA 4NULA 5BSKA 3K1TA 4HAYA 5CA1B 2QL6A 1SUIA 2PRKA 3RC3A 4TVSA 1FQJA 1SHKA 3V4VB 4DQLA 3ZI4A 3VOTA 2RAPA 4HNGA 3K9GA 2DQZA 3AY0A 5F7ZA 2FMFA 2PUWA 3UAYA 2JCYA 2OCPA 1UP4A 2GCNA 4LX8A 4N1AA 1TIKA 1L5LA 4MV4A 5AVWA 5I7VA 1OWOA 3AVQA 2BFDA 2IYAA 3RVBA 4E88A 2YXPX 3BL6A 4LNUB 4Y9TA 5FQNA 3RTBA 3UN1A 3PC4A 3ZQ4A 3WMFA 5F73A 4J3JA 1UPBA 4MGIR 3V97A 4MUHA 1T9DA 3VSAA 2VWGA 3W5IA 3CNLA 3GUHA 4OXIA 1VCOA 5TARA 5DYIA 3GUVA 1Z4NA 3LUCA 2XOEA 1PSDA 3MJSA 3W8RA 2ZBUA 2DY1A 4CG2A 5C8YF 1AVTA 5JS8A 1E2GA 3W9BA 1E5XA 5KNCD 2P68A 2Z58A 4LTNA 2QZZA 1QRDA 3D3JA 3GZNB 4MVJA 2CLEB 4UU1A 1JAYA 4GGOA 4P58A 3CH4B 1SY7A 3ASUA 5D1HA 2H48A 1AF7A 1PYOA 4LGVA 2V6IA 1WDMA 2X0IA 5F35A 3BXGA 4BDTA 3IA7A 4YDHB 4DIUA 4DM3A 8OHMA 2IQIA 1SUWA 1TM2A 4AVYA 4BV9A 2WI8A 4E03A 3Q8MA 1XRNA 1P1CA 1YZQA 1WV1A 1U2TA 2G1AA 4BNZA 1KI4A 4RD2A 4URVR 1P9RA 1HSOA 3I2IA 5H5JA 5A7GA 3TQIA 3UOWA 3U17A 3UT6A 4P3PA 3W6NA 1DARA 3TW8A 1O5TA 1VHJA 3E9DA 1T1IA 3A6LA 1M5RA 3AEUA 3WKCA 1YA8A 3WLEA 4BATA 2ZUTA 4AJHA 4IDFA 4FM9A 4XWKA 4JK3A 4ZOLB 4K6CA 1N36B 1DG9A 1GSIA 4IWNA 4DCNA 3ZU5A 5J2TA 1PGPA 4EW6A 4CHGA 1N75A 2YJ6A 4Z51A 4CQMA 4PZCA 5JD3A 2ABWA 3STVA 1G20B 1OOEA 4LOLA 2HCFA 1OGJA 4C3VA 2ZJFA 4KFCA 1E3WA 1TMGE 3DEHA 3PX2A 1E1DA 3F46A 2ZTHA 5LSAA 5IBPA 1E1LA 2BFCB 4LKOA 2GM4A 2IEYA 1Q15A 3P9NA 4ZT7A 3D81A 1JEEA 1MPXA 4M7WA 2J7KA 4R51A 1Z15A 5CTJA 4UPEA 3D2CA 3F90A 3WB0A 3O03A 3FLMA 2VPPA 2WYVA 4BO4A 1USIA 5C2JB 1T4MA 2A5FA 1LWOA 1QZUA 2YY5A 4CMGA 5C4IA 1A97A 3B1ZA 4MTLA 1YB1A 1TXGA 2HMUA 4G67A 1SQ5A 2QUJA 1XFAA 1X70A 3GRAA 3AXSA 1RDFA 5ED0A 1TU0A 1Z47A 5JFOA 2IYNA 1NUTA 2WAOA 1JZTA 2PKCA 4QELA 4N5DA 1ZA2A 3NEJA 3U5TA 3KJZA 3M6VA 1KFBB 2H1RA 4M9UA 2EBUA 3I5UA 5EP2A 3SJCA 3VR4A 1PDOA 1MN6A 4EA7A 1P18A 1TUGA 1JHYA 2BDTA 5JATA 3SFVA 3TCNA 4CCAA 4ZJUA 3HJAA 5A9SB 5B1EA 3SHFA 5A62A 1GRCA 5ELMA 1Z56C 4D8UA 1DLJA 3ADPA 1GL7A 1WV0A 4B3XA 3IAM6 1Y1LA 5YASA 4ZMSA 1KFEB 3FG9A 4RZUA 4YACA 2EKZA 1H85A 1UZUA 3H8SA 3UKDA 2ZULA 3BTSA 5C18A 3DNPA 5IK2D 3B1VA 1VE3A 3QLUC 1TYCA 4LBYA 4ZWNA 1CS0A 2ZBDA 1C9NA 1U3DA 1C3EA 2DHQA 3RYHA 2CYCA 1ZOLA 1RWPA 2JGDB 3WGKA 3IIIA 3EF3A 5A7HA 2G67A 3Q87B 2JBAA 5GQSA 3ULKA 1VRVA 2O8NA 2OR3A 1A8SA 2XUIA 3PFIA 4UAJA 4OHUA 2R7NA 3GRYA 2WMYA 3GN1A 2OYRA 4EKDA 3W5UA 3EHDA 1TEZA 1GFZA 4ADSG 1G9SA 1TA0A 4FGUA 4HQ6A 1NMXA 3B6IA 4MS1A 3H3XA 5KYNA 2QN7A 5B1HA 2WDPA 4PYJA 2J07A 4PG6A 3LLCA 1QH9A 1KZ4A 4MQ6A 2FFJA 3HZZA 1VJ5A 1ZBQA 4XX0A 2OQIA 3ZS9A 2L19A 4HUJA 4XTCS 3W2EA 2FSFA 3IO5A 3PEVA 2A57A 4B80A 4ZI7B 4TV8F 2ZKLA 2AL7A 4XRRA 5FAKA 1KYZA 1NGSA 2P3QA 5HIKA 3IR6A 2PCJA 3WKBA 4DMCA 1H23A 4NSNA 1ULBA 3QW2A 1HTWA 2XJ9A 3L40A 4HWTA 2FFHA 4RZSA 4UHKA 4WA8A 4DLKA 3PIRA 1RKBA 1IWBB 2FMXA 4MWCA 5K8VA 3HUTA 3HHEA 3E9RA 1LKZA 4CL3A 1LJLA 1CZNA 3TEJA 1MRZA 5B4VA 1R18A 1LLCA 4QUBA 2BGWA 3DOCA 1Q7CA 3Q7SA 4JEUA 4F96A 2HA4A 2J4DA 4NCIA 4UTPA 1CG6A 1SXJA 2VJMA 3AJ9A 1EGHA 2WC1A 2VDUE 3TNFA 3ZVMA 3ZE6A 1DEXA 1U90A 2QPLA 1A9SA 3B6MA 4IM7A 1IAQA 1QX4A 1E6MA 2PMFA 3QXJA 2D13A 1A9XB 2HHAA 3CG4A 1ZSNA 1VL2A 3Q1KA 2ZJOA 4MTCA 4NABA 2GESA 1MNAA 4PHFA 3UXMA 3T7CA 3ANNA 1CNEA 2XRZA 2B78A 2UVPB 3FPJA 2JLCA 2XLBA 4Z4GA 3OH8A 2JANA 2PS3A 2WUFA 3M1AA 1MJHA 3IOBA 4HWOA 5FUMA 3P0HA 3FGOA 1EX7A 4HLDA 1S4QA 2F43A 3PNMA 4Y2TA 3W5JA 1MOPA 2GOYA 2Z0MA 1EWQA 4JB0A 1YTUA 5HJEA 3WOVA 4J07A 1AHPA 2VKTA 2IGTA 4M22A 3H5RA 3JSXA 4X62B 4RQUA 2OFWA 3RHFA 3LDHA 3DBRA 4A82A 5EI5A 2AK2A 4NBLA 3GJXC 4HDMA 5EINA 1UFQA 2FQWA 3MMPA 1VG9B 2WU1A 3HY4A 2IX3A 1XOIA 3F6CA 3A6PC 3KEFA 1L4HA 4GI7A 3PWKA 1AKRA 4CBVA 1HF3A 2JIBA 1P9OA 5HP4A 2VBGA 4IGKA 3W6OA 4F4HA 1HH4A 2XKBA 3ZNOA 2QJTA 4EJ2A 1N0HA 2XT6A 4CV2A 4ENTA 1P1IA 1PFYA 1UCFA 1Z34A 3M8KA 3NIBA 4IXDA 4MRRA 1SXGA 3D6FA 1I4OA 5B1DA 5TJ9A 3SQMA 3EPJA 2NTEA 2MSWA 4DG8A 4RVCA 2ZZNA 4V0KA 3EPRA 3HZRA 1FYDA 1EVIA 1RXSA 4Y6PA 5F51A 3RHTA 2QN1A 3LCRA 1DIAA 1HE5A 5LXTA 1FNNA 2H7VA 3BWYA 1FMFA 1QZXA 2JIRA 3U0VA 3DZDA 2ZYTX 1XE3A 3PQ3A 1WXFA 1WJGA 1B8NA 2P2NA 3K1AA 2NGRA 1RYBA 3MRSA 4MVJD 1KO7A 2JFNA 2P9EA 2MMGA 4KZKA 2X1HA 3KZCA 2GBLA 3VUEA 4AMVA 4F0JA 2EVWX 3A4NA 3BHMA 3KG2A 4U7HA 4RHXA 3SEZA 1ID8A 2OSVA 5IHXA 1MH9A 1WMDA 2VH2A 4RHCA 2IXDA 4DYVA 4MCAA 3KUXA 1J99A 2ZDGA 1YVDA 5ALLA 3SZMA 4LW8A 3TS1A 3QEOA 3AM5A 1BHSA 3FOCA 1BW9B 2KPOA 3IBTA 3ONVA 1R15A 2K87A 4KE9A 4HQKA 4MVJP 5EHGA 1HR0B 1GKYA 3DSRA 4MYSA 1NNEA 1IJBA 4JYBA 5AVOA 3KZXA 3R3VA 5HFJA 4F9TA 1B6TA 1FP6A 1U9JA 2B0CA 5LMCA 3KOYA 4LFCB 5HWSA 1P2UA 3IE2A 1VRCA 3LQFA 1QZZA 3H16A 5BMVF 3QBVA 4FFNA 2Q4BA 5F2KA 5A1JA 3PC8A 4I1VA 3VYSB 1GG5A 1UJ6A 3N74A 4CQMD 4FZRA 4RH0A 1G291 2JGMA 1W0KA 5JCPA 2ZWPA 4WWHA 1J97A 1KKLA 1M1ZA 4B3GA 2VDMB 1FFXA 5T67A 4HXEB 1LV7A 4O2AF 3DEZA 4YR9A 4MVCA 2IZZA 3KYCA 2UYYA 1E1KA 3MW8A 4WDRA 2AD5A 2NW6A 1EHYA 4GEKA 3EGCA 3V4SA 5IX8A 1ZOSA 1CR4A 3IQIX 4ZVVA 4WUTA 3DLCA 3THWA 5FEUA 4B0OA 1GQYA 1QRAA 2JS7A 2QM3A 5CYGA 5KNDA 1X0VA 4DQXA 3TG2A 1W8IA 4HTFA 1JRLA 3NAQA 1M2GA 2A67A 3Q4GA 4LJAA 4YRKA 1QR6A 4KQIA 3DKIA 2G0AA 2PKXA 4E94A 3JRNA 1FU7A 3U2QA 5A04A 4IJVA 3OJXA 2NVWA 3E5RA 3HMKA 1JR3E 5L45A 2IXAA 4XGKA 1ML4A 3VR4D 3GOQA 1XBTA 1RBMA 2Y05A 4CL8A 2CDBA 3FFXA 4HYEA 3SVZA 3LHFA 3AUJB 3I9NA 2QQ5A 3TQSA 3VC7A 2JAPA 3O1JC 4GECA 3NFRA 3DE0X 1X92A 2XW6A 2GZDA 3I3OA 5FI3A 5J2UB 4CKWB 4MV7A 1H0HA 4WCDA 3OCYA 3LP8A 4URFA 3B2NA 5TQVA 4JYMA 4NCXA 3VTAA 4DV4B 4FIDA 1QZTA 4FCWA 4CMIA 5F78A 4Y6OA 3OIUA 4WNAB 4F4FA 2OT3B 5HRCA 3KUUA 5CDUA 3DG9A 3TBKA 1CVIA 3IAS6 3FCYA 1XK7A 1DC4A 5LZ2A 4URYR 1YASA 2G08A 1SKYB 3CUVA 4YAFA 5TX7A 1J0XO 2O8EA 4RBNA 1Y1QA 1XLVA 4Z2AA 1DCKA 3OPQA 4OI4A 4M8IA 2BM0A 2ZB4A 2JBHA 3H2ZA 5IVDA 3RJZA 2HL6A 3FWKA 2RGGA 4PO1A 4NCBA 2VCHA 3SQWA 1KRXA 5B7NA 4XVUA 4L4RA 1VMEA 3O82A 2EP5A 1U8ZA 3R41A 4Q3OA 3A1VA 2WWYA 4KNWA 4A16A 3ID6C 2ORIA 1WL8A 3NBYC 4TKUB 4DQKA 2B3DA 4IH1A 2D0PB 3BXZA 2KWIA 5EQFA 3UWMA 1KA9H 4AZWA 5CA0B 2PRYA 2PZKA 4PX2A 4B2LA 1C41A 1QVZA 2PQ2A 2WNHA 4RX1A 4S1PA 4MR9B 5EJFA 3U4HA 1HLPA 3LJKA 5B1SA 1CEXA 3OT1A 4PPGA 2HHJA 2C7OA 3F5FA 2WF7A 5A3SA 3TPFA 2I34A 4DE5A 3FOBA 4CG0A 3HXLA 3RFTA 2ZB7A 5F9HA 3GGPA 2Z56A 1Z0UA 2DAPA 2DKNA 2J45A 3DGFC 3PBKA 5I9MA 3U4MA 3C6BA 4GDFA 4LHXA 3L8ZA 4BFZA 2REBA 1TQ4A 2QTRA 1D5CA 3HKEB 1E5TA 1NUPA 4OHWA 5AM1A 1IEWA 1FUUA 2Q27A 3E82A 4FC6A 1CDZA 4O02B 4RVHA 5THXA 1RQLA 1SXJD 3ML1A 2G9NA 3E27A 3ZHXA 1ILEA 2JC3A 3H5TA 1QXSA 3EVCA 3FCXA 4P92A 4Z7QB 3Q9SA 3VSCA 2E2WA 5C35A 5C1BA 2I2FA 5DN6A 2ZETA 2QW8A 3AB7A 3HCFA 2DLNA 2GN1A 3H5AA 1R6VA 3QNUA 3WMRA 2IWHA 2WYIA 1P62B 5JNLA 4WK0B 1LDGA 5JSFA 4QKQA 1A7AA 3A1WA 1QIHA 1DT5A 2LE0A 4LPSA 1VCHA 1K3TA 1FRFS 1IULA 2ID8A 3PUJA 1RWXA 4UBLA 4II3A 3DLBA 2XXAB 4M1ZA 1EZZA 1EFPA 2VRNA 1LB1B 2XYVA 2XIQA 3B7GA 3GGDA 4NJOA 5EIHA 4DTCA 3V9PA 2CXHA 1JH8A 1MB2A 2H7XA 5CX1B 4DJTA 3PEWA 5B37A 2XWBF 4IXMA 3F7MA 1OW3B 2JLWA 1XZIA 4X60A 2VNJA 4XUDA 4L4YA 4NCKA 3CM0A 4JXJA 1KQFA 2V6BA 3SDBA 1XJQA 3RK0A 1NLYA 2WWXA 4RKYA 4DCUA 1DCMA 5F3RA 5JEEA 2B7CA 3FNGA 1RPJA 2Q7DA 4C87A 4A7PA 1JS1X 1ZM7A 3MJEA 3GLFA 3DO6A 2CLKB 1SXJC 2QSZA 4AKGA 3OEYA 3K5WA 2P6RA 2VYQA 2QG6A 4L8YA 2Q9UA 4NOJA 4D6XA 2Q1TA 4W5TA 1XTJA 4EMSA 3BC1A 4MUAA 3SQXA 3SR3A 3CISA 2QLBA 5LB2A 1EESA 3E7XA 1IG3A 1OROA 2O0HA 3IURA 4ZQBA 3OZTA 4C03A 2GJ9A 3CPSA 4XA8A 1UBEA 3L84A 4QBHA 3I5YA 2GZ3A 1QTRA 1CVLA 3KQVA 4DKJA 3GAMA 2A14A 4N40A 4JJFA 3WB1A 5IEBA 1TYEB 5GV7A 3HL0A 2FWMX 3SQOA 3UQZA 3WWPA 2ZU6A 3WWYA 4F9GA 4JJ7A 4QTYA 1ODKA 1R10A 3U39A 3KQNA 2XQKA 3DO8A 3PXCX 4TYNA 1BWQA 5G02A 2NXEA 3FNHA 4QRIA 2F4NA 4JA0A 1YBMA 1YJQA 2FEOA 3GLHA 4HVAA 4YMWA 5IJXA 5BN5B 3VX4A 2VUHB 4H1WA 4Q66C 2OV2A 1W5TA 3THYB 2XUGA 3BX1A 3R6WA 2LKDA 4EG8A 2CHEA 3KBBA 2RH4A 4FEGA 4F7DA 4DV6B 1B26A 1QVWA 2AIRA 4BMVA 1LU9A 2Q99A 1SZJG 3LBNA 5ERXA 4IRUB 5HZMA 2JIQA 1W94A 3GFQA 3O4IA 4LWZA 3S1AB 2GEDA 1ESEA 3FMOB 4TTTS 2PN1A 4H08A 1RAHA 4X95A 5JDCA 4K9OA 3D4OA 1U81A 3NIWA 3EH1A 1J7JA 1OWLA 4L51A 1KI1A 2OHHA 2OLJA 4XSHA 3BPSA 1OXUA 4XUCA 3M6FA 4UVIA 2NACA 2TYSB 3GK3A 3HZOA 4WMLA 3SGLA 1XO1A 3THXA 1RC8A 3O4FA 1XCGB 5E0KB 3H1PA 4ZCLA 1B4DA 3ZHRA 2PO7A 2II6A 3EWIA 4C9BA 2F8LA 2GX6A 2DPXA 2BEUA 2H1WA 1WXWA 2J9RA 2N1BA 4HGQA 3T9EA 2RHMA 1PG5A 1XTBA 1F8XA 5KSZA 2QNRA 2ZSBA 3BWVA 3D5EA 1ZICA 1SOWA 2WSYB 2ZI6A 2XCLA 2GBLC 4Q4JA 1NP6A 3U4GA 5KNDD 3RYFA 4H17A 1NMYA 1CIJA 2B25A 2D4AA 1B0AA 2IOYA 1IOZA 2HRCA 2J67A 3DCNA 3MRTA 3KC2A 1PX2A 3ITEA 3RC9A 3MWDB 4ALIA 5JFGA 1NV8A 1U2RA 2QVGA 2P6OA 2QX8A 1GGHA 1E9CA 1STOA 2PZBA 1F3OA 3QFHA 5DCYA 1PTKA 5HIAA 2J3LA 3GROA 4CZ2A 1IQRA 1VDZA 3DZGA 3WVNA 4N7MA 2EW2A 1H4TA 4R2XA 2VWHA 4WHMA 1XCJA 5JMWA 1M2OA 3ENKA 1L7RA 1YH3A 1TUBB 1F2TB 2C7GA 3W5DA 3SYMA 4FTWA 2Q6OA 3BILA 3ET5A 5FT9A 4PZ0A 3AVXA 2I65A 2ZYDA 4MMYB 1G21E 2A1UA 5AUPB 1E7MA 2B30A 3BZUA 4N5HX 3NGXA 3NBKA 3E3MA 1N0UA 1QK5A 3WJ1A 2EF1A 3CX8A 1SO8A 3D5TA 2B99A 2QJRA 4HGYA 5AKJA 3INRA 2WJ3A 4ZAZA 3KQUA 1HEYA 1BU5A 2BP7A 1BXZA 3EVBA 3MTEA 2XUHA 4ZTBA 1J8FA 3WLLA 5CBPA 4NIMA 3R4VA 3VNUA 2XBLA 1CKEA 3ZVKA 2BIFA 5ALRA 1O94D 1V8FA 2XHZA 3LQYA 1NULA 5EWLA 1NYQA 2V7WA 3RODA 3B1FA 4DPMA 1KWKA 1KEKA 4H31A 2FWAA 1PQPA 4JL5A 1XKQA 2VPWA 4KNVA 4E0BA 5KSWB 1LW7A 4J76A 2YDYA 4JLKA 4MZDA 5DFAA 3KB6A 3EASA 4X3OA 2GHIA 3QOWA 5EMNA 4JVNA 4HAOA 3T1YB 1G7RA 4NMLA 5H3CA 5EIWA 5HX7A 4MQUA 5JTTA 2W7TA 3ECAA 3R5TA 4W5OA 4Q01A 5E4TA 3G5TA 1LPOA 2YOFA 4AROA 5ITVA 2ZUEA 2BEVB 1P2DA 1J09A 1J23A 2ETXA 1XZPA 2GEBA 4G4JA 4BVHA 3ZVRA 2OHJA 4B6JA 4PHCA 4TSFA 1T10A 5ECGC 1UMDB 5LQKA 3W5VA 3TVYA 5HRAA 3LK7A 4OL9A 5AD1A 1FBNA 2V7QA 4DWOA 3BHJA 2ZREA 3DB2A 3N7UA 2ERYA 4CHTA 3K35A 3QSGA 5FOTA 5IVHA 3KQLA 3KLOA 1GZ6A 3IS3A 3CJTA 3K9FC 1YAJA 5G1OA 3W9UA 1QHYA 2HRBA 3LQ1A 4RKFA 5EXSA 5BWLA 3QFRA 1M33A 3SYTA 3C5HA 3KCQA 3MM4A 2BFBB 2OBBA 4QUDA 3R20A 3ZWXA 1X6VA 1QHNA 1SHZA 1O94C 2V9ZA 3OLVA 3B5IA 3H11A 4B31A 3W77A 4O4LA 5DN6D 3PX3A 1NC1A 2HU7A 4CEJA 4XM2A 5G3YA 3C3MA 2C96A 3AYXB 4IIEA 2YZMA 1FOEB 4P7KA 5A05A 4AQYB 2J08A 3L9XA 3WL3A 3WIOA 1Y9EA 2B2XA 2SNIE 4WINA 4AT1A 3EPLA 2DCUA 4FCTA 3JQAA 4JCOA 2NSHA 4M8NE 4OFBA 1BXGB 1BJTA 3R3SA 5FHQA 4YJ3B 1W1IA 2YDXA 3SJAA 3WJ2A 1ZGCA 5EXPA 5FOWA 4YMLA 1NMZA 3L0DA 1MX1A 4XQEA 1I6KA 2JW5A 1JKFA 4RENA 3TMYA 2ZBGA 2FPLA 3LW8A 5TGTA 1QIEA 2FPKA 3GMSA 3HDTA 1NXWA 2I1VB 2ZYUX 3BF8A 3EFBA 4GMHA 1NRXA 4M3NA 1E3EA 2VUIB 3D4IA 1JJ7A 5K7SA 2OXCA 3NPAA 3N75A 4PR0A 4O3MA 1J9EA 1MENA 1WHSB 5DM60 3MXTA 2KX7A 2JH9A 3TRKA 4ASUA 2P4SA 1B0PA 1NQUA 3I4FA 4RL6A 4OHZA 5LVAA 4U3JB 1DBQA 3JZIA 2QJOA 3BXEA 3IEXA 3P0RA 4QBTA 4PNZA 4QFCA 2NZUG 2BMJA 3QKRB 1P77A 2F3RA 4MVYA 4FDUA 4Z3KA 4G0QA 4GX5A 1GNQA 3PJDA 3VO1A 3KQYA 1TW2A 3QENA 5F5XA 2GRUA 1MIOA 1QMPA 4Q3NA 2H06A 5DGHA 2EX4A 1W4BA 4I55A 2W6NA 1BHO1 1R37A 4OATA 1KU0A 4G4GA 4ND6A 3OJEA 4CCYA 1ZR4A 2HFJA 3LG2A 4GO1A 1VHTA 3A7DA 5CG2A 5JZVA 2P3LA 1Q1QA 1JMYA 2C1ZA 3QEKA 2YFKA 5JJLA 4FOOA 4PIMA 1CHDA 2ZBQA 1GSAA 2X2FA 4TYMA 1TVKA 2VJOA 5K20A 5BR7A 4YCBA 3T3GA 4NH4A 1UZMA 3SFZA 3V8PA 1KFJB 2DWUA 3PHHA 4MWBA 3GFFA 1CR1A 3OF5A 2O52A 2PZFA 4A0SA 4MGEA 1VE6A 3ZNNA 1NJ2A 3FKQA 3PPIA 1VLLA 3W6UA 2R1TB 4J1TA 5CFOA 1OH8A 2GLXA 3C5VA 4I2NA 3LLUA 2XECA 6PFKA 4WVLA 4AKHA 3PD7A 1SCDA 5LMNB 2PWPA 5LKAA 2BGJA 1FP7A 3UVEA 3D64A 1G8FA 2GA9A 4OFZA 1QH8A 1E6KA 3V8NA 1SQ6A 1YBFA 3Q11A 1IOWA 4QQFA 3WFZA 3HCOA 1A9ZA 5D3MA 5HRUA 4I3FA 5AK4A 3FCAA 3SC6A 1JAIA 1U94A 2JJ1A 2X5XA 3D6TB 1JVBA 2DYKA 2HZBA 3GT3A 3QUQA 5D3ZA 3ZJ5A 3IESA 1YVUA 4R3NA 2IU0A 1YBHA 4UEJA 3OJLA 3AKDA 3INNA 3NHAA 3QG1A 4J0EA 4Z5XA 5JJIA 3JATB 4PFQA 1LLDA 2RJ3A 4OREX 5EEGA 1NRWA 5JMTA 5L53A 1V3VA 2BTEA 3IDFA 1ZUNB 2R68A 2ZK7A 5GMOA 5C4GB 5BV2P 2PS0A 5CXSA 1DXHA 2F7SA 1NJ1A 2C4MA 4F60A 4ZK6A 1KAGA 3HYCA 4KLCA 4A15A 3VPFA 2ZVJA 2OCKA 1JYEA 3PDHA 4R2JA 3W5CA 2WYHA 4YV7A 4E1BA 1J1ZA 2Z9BA 4HSEA 2B5OA 3MS4A 5BYKA 4A2WA 3VYRB 4LG1A 1U1GA 1KMMA 1DX9A 5G0WA 2G1PA 5IFLA 1ZD2P 1RACA 1E4YA 1I9GA 3IVGA 3QA9A 1AZLA 3OFSA 5EERA 3CF4G 4KLNA 4TTSA 4F11A 4XQ0A 1W88B 2PIAA 3EZ2A 5LZ4A 1L7BA 1KZ1A 5PNTA 3D8RA 1JAZA 1JI3A 1D3AA 1IHYA 2C00A 2GD1O 3KT6A 4RORA 2Q7OE 4DCJA 3FHLA 1LEHA 4D9CA 4DDKA 1I7QB 4AF7A 1IHPA 4BC0A 5FUYA 3DDWA 3DP7A 1RPTA 4F04A 5JV5A 3KXLA 4BU1A 2GBCA 4WLEA 3KTAB 1G64A 4HDAA 5JDCC 1QHEA 2EV9A 3I5AA 3EAFA 1GTSA 2NQTA 3R7LA 1QHIA 4WIAA 4WN9A 2OGUA 3ACBA 3P45A 3WV4A 5ER9A 3JXEA 4LJ7A 4DGQA 1P6QA 2FUG6 2QTZA 4UFNA 3AYZB 4HDNA 4TMFA 1I1NA 4R8SA 1H93A 4RTKA 1VI5A 2IYLD 4OFWA 1W9HA 2X5KO 4Q47A 3UPDA 1U7XA 2H7CA 1NVMB 1JLLB 2PJZA 4I1RA 3PYLA 1C80A 1KY3A 4FQ7A 1EM6A 3DP9A 3LVBA 4HDSA 5KQRA 1UIMA 2J4FA 3HBJA 3V8VA 3FJ1A 2P0YA 4K03A 4L9RA 3NOQA 4OO3A 1TCAA 3FYTA 4CKCA 4EG0A 3D0QA 4RJ2A 4XYLA 2BI4A 4EA6A 3E6AA 1NRIA 1NW5A 4WK4B 4E46A 2OG1A 3BK2A 5EJ2A 1FS5A 1R0WA 4B5KA 2HQSA 1QS0A 4OL0A 4R84A 4H4CA 5KOIA 2FFBA 1TTQB 1J49A 3C14C 5GP1A 5CFZA 1CQIB 1P39A 4EPRA 5JHHB 4BO9A 2Q21A 4HB4A 3O83A 4IIHA 3T3EA 1NE2A 3WBFA 4ABTA 3EGVA 4KAAA 3JW8A 3UGQA 4DA6A 4UUBA 3E7WA 3MYYA 3ROGA 1Q11A 1NT4A 4NNOA 1XEXB 4TSFD 2WZDA 2FP3A 3L5OA 2AFIE 1CJVC 1YZNA 1GAJA 4WADA 1RKXA 5SZHB 2V7QD 1ZKMA 2H07A 4EB0A 5FLYA 2W6IA 3DAFA 3DKRA 2CY0A 4ER3A 5JI2E 5C1DA 3A2MA 3EISA 3IEKA 1GARA 3EIXA 3G5UA 4GGMX 4BWFB 3MPOA 1FJGB 4Z8YA 1AZWA 3KV1A 2F1JA 1ULTA 3KOWA 2IYTA 3RH0A 3NM5A 4JR2A 2D1QA 1OWPA 4K1XA 5IDQA 1S2OA 1I6MA 4F7WA 2NT3A 2XXBA 1QH1A 3U3DA 4O0MA 2I87A 2WIJA 4FEYA 1F60A 4N65A 2RGUA 4DEXA 4NL4H 2CDRA 5UKDA 3IBGA 1H9AA 2PEZA 5A2GA 1GSOA 3R75A 3RKUA 4D9MA 5KYTA 1L4YA 1SKQA 1DO8A 4EI8A 3QPBA 1EP1B 1EQ2A 3OZUA 3T41A 2V6GA 3TCKA 4A0FA 5JQWA 5KJ1A 3FPFA 3IOYA 3ZCUA 1ODJA 2HR1A 4IMIB 3DDZX 3JQAD 2ZE8A 2BMEA 3H2IA 1T43A 3CNBA 3DF9A 4CM4A 1EBBA 1TIBA 3CT4A 3U60B 1XIVA 4QVKA 4J7XA 4WERA 2ZP1A 1WG8A 1SB8A 2O2JA 4MVJI 4G9EA 1LFAA 1FBTA 3BB4A 2WWWA 3GIWA 3BWXA 2IWRA 5EHQA 5E4YA 3EIQA 4FMCB 1I2BA 3EDCA 3MJCA 1DAEA 2GRAA 1FDWA 1NOJA 3LBFA 3GVXA 4LV5B 3H86A 2BGMA 5DXFA 2VHYA 4ASUD 2O2GA 4JMLA 2ZB2A 1DJLA 1V1RA 1MHTA 4J6EA 2QRQA 4YCJA 1EK0A 5FKJA 1L5KA 1W4RA 5AKLA 5FO1A 3D3NA 2JIOA 3BXPA 5EUBA 3AP2A 3C1UA 4BLPA 4HFJA 1KAHA 5HS6A 3P27A 4YN3A 3EA4A 1U5CA 2ZJ8A 5IG2A 4M60A 4WCFB 3V3TA 4MDFA 1JQLB 3FZEA 2EBHX 4D92A 1AOXA 2C95A 2JHGA 1F8FA 1KZHA 1QP7A 1C7JA 4AMZA 1II8A 1RD4A 3GMTA 4WX2B 2PUCA 3KEOA 1RQGA 1G0OA 1M7GA 2QTNA 2W6MA 3G1TA 4N9QA 1YCDA 3OQVA 2XUJA 1YR6A 4LXUA 4PAMA 4AECA 5EJ4A 3HCCA 2ZPUA 1R64A 1Y3CE 2C9DA 3AJDA 3GRPA 3NV9A 4OGGA 2Y0BA 5DNDA 2JI4A 4YRFA