2CDCA

Sulfolobus solfataricus glucose dehydrogenase 1 in complex with nadp and xylose
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
366
structure length
359
Chain Sequence
MKAIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGADREIVNGKLGKDFLVLGHEAIGVVEESYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHGEIKIRILWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE, DHG-1
publication title The structural basis of substrate promiscuity in glucose dehydrogenase from the hyperthermophilic archaeon Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 123
structure length 359
sequence length 366
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.120: Galactose 1-dehydrogenase (NADP(+)).
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cdcA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2cdcA01
3JSAA 4KDFA 3HWRA 4L9RA 4KWHA 3RBVA 3H7AA 2EWMA 4E3ZA 4EGFA 3KSUA 3UCEA 5G4LA 2PD4A 4MIEA 4L4SA 4Z0PA 3CZMA 4YR9A 4RVUA 4XYEA 3JV7A 3SLKA 1ISFA 4RZIA 2O3QA 3M1AA 1UXIA 3PGJA 2WDZA 3SBOA 2CSUA 3IC5A 3WSVA 3E1KA 2ZB3A 1MFZA 1N7HA 4TZKA 5EIOA 3I6IA 2PH3A 3B70A 4RVSA 3DB2A 2UV8A 4FN4A 1E7WA 4BNFA 1VC2A 2PD6A 4D0SA 1C1XB 1N1EA 5IXSA 1C1DB 2PGDA 3ETEA 4LK3A 1HTBA 3OP4A 4OYRA 3ORFA 1QMGA 2P9EA 2VTEA 3ZNPA 3ROPA 2J3JA 2PH5A 2VQ3A 5EMHA 4E33A 4CLRA 3F47A 3KEOA 4CMIB 1UZLA 1XA0A 3DBRA 4GQAA 5JAQA 2A92A 1HL3A 1E3WB 4L4XA 1KBZA 4HFRA 3WJAA 1PJQA 2NU6A 2FR0A 5DCWA 3AUTA 2EP7A 5LC1A 1OOEA 1O8CA 2PNFA 3COSA 3AI1A 3BMNA 5C7OO 2PZKA 2OO5A 4EI2A 2AEFA 4DGSA 3L07A 8ADHA 1QYVA 2QIOA 4P4NA 4PLFA 3ZN2A 3MWEB 1P45A 3VPXA 4K6FA 1Z6ZA 2DC1A 3GDGA 4JBIA 4E2ZA 2OOSA 1GUZA 3GRPA 4XIYA 1TEHA 3I3OA 1C0LA 3H9QA 4WPGA 4XIJA 4OH1A 4RF4A 1H94A 5KJ1A 3N7UA 3ZHYA 1ML3A 3ZU3A 3FSRA 3L6OO 4GVLA 1NQOA 1ENZA 3G17A 3TDKA 1FDWA 1LJ8A 3JQ8B 5L4SA 1U5AA 3DBHA 3A9WA 2YUTA 4GWKA 4H7PA 1ZFNA 3PRJA 4KWIA 5G4KB 5A9SB 5IN4A 2I76A 2DPGA 4P4GA 3D64A 3GHHA 3EUWA 3G3EA 3TSCA 3D0OA 1E7MA 3F1KA 3PHIA 3TL3A 1U3TA 3R1IA 1MA0A 3RUAA 1J4AA 3P2OA 4HUJA 4FGSA 3IP3A 2B36A 4R3WA 4CMCA 4YAKA 2BKAA 4RQTA 4E31A 4MJLA 1N2SA 2Y1EA 4TKMA 5KVSA 1JQBA 2WYVA 4CMAA 2XOXA 5I9MA 4NHEA 4PLVA 4I8XA 1T1RA 2WMDA 3INTA 2B37A 4K28A 4W9NC 4EW6A 2C2YA 1KVSA 4BNKA 2FR1A 4I5FA 4L0QA 2EJVA 5DDIP 4GAEA 3PGXA 4GKVA 5IXYA 1JU9A 4NJOA 3QVOA 4D3FA 4UUPA 1HYGA 5IJZA 2VHXA 1EVYA 1XQ6A 3OFSA 2OGUA 4CODB 4DLBA 1UP7A 4YACA 2PZLA 3U0BA 2W90A 3NT5A 2X5JO 1U1IA 2G5CA 4URFA 2YDXA 3JCZA 4CM5A 2IE0A 5AVOA 3JQFC 3RKRA 1BXZA 4M89A 3VZSA 2G17A 1A72A 2YDYA 1N7GA 2C29D 1E3EA 3H2ZA 3OQ1A 1OMOA 2H63A 1AXGA 3K2EA 1GAEO 2VYND 3PFWO 4XDZA 2NVBA 4ZQFA 3KETA 1PQPA 4E4YA 3VHRA 2HJSA 3TWOA 4OO3A 4BB5A 1E3IA 1V9LA 1Y6JA 2QZZA 1TXGA 4MKZA 1LXCA 1XQ1A 1DRVA 1KEVA 3UXYA 3ICPA 4CLEA 2VRBA 3WQQA 3KUXA 3RI3A 3S2IA 2EXXA 3G1TA 5G0WA 4DRYA 1H6AA 4ZD6A 3KRTA 2IYPA 2B69A 4ZRMA 3M1LA 3VPGA 5B1YA 4JXKA 1IOLA 3WDSA 4HKTA 3VKUA 4JK3A 5JO9A 2Y05A 2V65A 2YV3A 1ISIA 3DAGA 2BFOA 1XU7A 3OSUA 1XHLA 4WLFA 5C5IA 2X5KO 5JYEA 2CF5A 5DBIA 2C2XA 3G49A 1PSDA 1Z45A 4TROA 4U8GA 3RD5A 4E2YA 4D46A 3U4IA 5KJCA 3QVSA 3RASA 3H8VA 1ZMTA 3DZGA 5C37A 1XEAA 1YDWA 2OFPA 4J7CA 5JPIA 4ROSA 3B20A 4RF2A 2RBEA 3PPIA 2VHVA 3PIDA 2Q1TA 4B4OA 4BNXA 1C3VA 5ILOA 3QHAA 2PKRA 2NTVA 5BNIA 2ZKLA 4BO1A 3RKUA 4II2A 1ZKMA 2P91A 4MVJH 3I6QA 1NAHA 4B4UA 2P68A 3AM3A 1SEVA 5HRUA 1YB4A 3A28A 4OQZA 1WW8A 3PDUA 3O03A 1IB6A 1TT5B 4WCFC 4BKUA 3JD3A 1ZSYA 1UH5A 4IUYA 3MJSA 2Q4BA 4GX0A 5T6BA 5A3JA 3OJ0A 1AHHA 3WLEA 4E6PA 1S7CA 3HFSA 4DC0A 4R1UA 3B1FA 4L4RA 1IHYA 1U4SA 1E7SA 1T24A 3AW9A 3PQDA 1T4DA 5TT0A 1H93A 3WWZA 4L75A 3LLSA 3FBGA 1FDTA 4MVJG 4CMGA 4OJNA 3BIOA 4IGEA 3PZBA 4XB1A 4AJKA 1FF9A 5DZSA 1ENYA 5JY1A 1MXFA 3KBOA 1RYEA 4JQCA 4DLLA 4FR5A 4U6SA 1Z73A 5A1TA 2UUOA 4L8VA 4AJ4A 5CDTA 2X86A 3GDOA 3RCBA 3ASUA 1LBEA 1M76A 4LSMA 4Y67A 3GR6A 4Z0HO 2X9VA 3I23A 3DHNA 1CJCA 1QR6A 3EC7A 4HP8A 1D1TA 4YA6A 3U4HA 3ZWNA 3IJRA 3PFFA 4AJJA 1WWKA 4E5MA 4XR9A 1GV0A 2JD2A 4RPKA 4IDDA 4OM8A 2IZ1A 1ULSA 3UOGA 1HSOA 1O9BA 1KVUA 1PQUA 1SC6A 4N5NA 1NAIA 4R5MA 2Q3EA 5HS6A 9LDTA 2BGMA 1GDHA 3L6EA 4ND3A 4J91A 1EVZA 2DQ4A 2DKNA 2FPPA 4YWJA 1BSVA 1W6UA 3B1KA 4P8RA 2CY0A 2B5VA 4CQMA 1C0PA 1PS8A 4MIOA 4DREA 3PZRA 1PIWA 5TLSA 3KM0A 3CINA 3GAZA 5B4UA 2FWMX 3F5SA 4WUVA 3ANNA 1SPXA 1E5LA 3HNPA 1I2BA 2EV9A 2WE8A 3AUSA 1R15A 2J3KA 1HDOA 3GRKA 3GZNA 1R0KA 1U8FO 2D1YA 4QQRA 4BO8A 4FW8A 3V5NA 4E32A 5JE8A 3FNEA 4BNLA 3C1OA 1P1IA 2FN7A 3ZCXA 5JYDA 5AQ1A 4X54A 1ID1A 5JDCC 5JDIA 1IPFA 1MG5A 3U49A 3QWBA 3RUFA 3A1NA 4BNYA 4Y6PA 5T8KC 2VUTA 1DHRA 1H0KA 3JD0A 4D44A 3TQHA 1IE3A 1SB8A 1ZSVA 1WPQA 4J1NA 1U3VA 4W99A 2VWGA 4ITUA 2DFDA 3AOEA 1Z75A 4Z3KA 1LDBA 3U4DA 3N58A 3V8BA 4YRAA 3BA1A 3PWSA 2BD0A 3OICA 3ON5A 3U9LA 3UW3A 4BOYA 2QYSA 2VYVA 2XPCA 1ZJZA 2E82A 2AG8A 1P44A 2QW8A 1O95A 2PK3A 1AGNA 1YRLA 4F6LA 3IKTA 4DXHA 2H9IA 1UJMA 3UF0A 1ZSNA 2P5UA 2NU8A 3ONFA 3OETA 1UDBA 3NKLA 3ZWAA 3U3XA 4WNCA 3UHAA 4CQLA 5CG2A 3KLPX 1NHWA 3F3SA 2ZB8A 4PN3A 4CQMD 3TNLA 3PYMA 4ND1A 1MUUA 2JJYA 1J0XO 4WLUA 3P2YA 2GF2A 2HRZA 2Z5LA 3DZHA 4ZJUA 2YQ4A 3ETDA 2WSBA 3E48A 3LT2A 1EUDA 4BO2A 4CR7A 5A03A 5C3MA 3GNSA 5KOIA 4GVXA 5EINA 1YKFA 3F46A 1A9ZA 1X0XA 1ZEJA 4PLYA 3Q0EA 4CMJA 3UAGA 3OMLA 1Y5RA 1NNUA 3QVWA 4M87A 2OBNA 2VWPA 2O2SA 2PV7A 2BFMA 1BXKA 2BFAA 2UUPA 3WOHA 4CLRB 3DBRB 4DIOA 3QV1A 3GEMA 3GG2A 4D3SA 1P1KA 4GX5A 5ER9A 3FNGA 2CZCA 4PFJA 4YJDA 1E7YA 1YDEA 4E5PA 1L7DA 5JAMA 1EK6A 3E9NA 1B15A 2X0IA 1YQGA 2J5RA 1ZK1A 3BMNB 1N5DA 3S55A 4K9DA 1LUAA 4BGIA 1ADGA 5EN4A 4BV9A 2FR8A 1XG5A 2VYVD 4H3VA 4MVJF 1BDMA 5BNFA 2Q2VA 3GVCA 3K9QO 4F6CA 5JBIA 4BO9A 2GLXA 1HXHA 1ZIDA 1O6ZA 1GPDG 2Y1DA 4BQPA 2X7HA 2Y99A 3OJFA 1V0JA 1YWGO 4JNKA 1R66A 4FIZA 3GEGA 2DBVO 4IIUA 4PRKA 3S1LA 3DBHB 4E30A 2ZIZA 2WM3A 5IZCA 2G0TA 3ZV3A 4MP3A 1ISHA 5DP1A 3W1VA 3JD1A 4AJPA 3ZV4A 2V6MA 4FFNA 3S2EA 4XGNA 2LDBA 4LSWA 4IQ8A 3CSDA 3BMCA 4A10A 1JAYA 4OSOA 3WICA 1GY8A 3VH2A 2BF7A 3WFIA 2HU2A 2DLDA 3HE3A 2VHZA 3B1JA 1ZNQO 2DUWA 1HLDA 1N1GA 5CPFA 3VDRA 1VJ1A 4PVCA 1IUKA 3O9ZA 4L74A 3CIFA 1MGOA 4E5NA 1ENOA 1X15A 3PHJA 3OQ6A 4M8SA 1GR0A 2HK9A 4Z9XA 2WD7A 2CVZA 3UH1A 5EQFA 3KSZO 2BELA 4O1MA 4W6ZA 5I9NA 1YBAA 1HKUA 4IDEA 3H9GA 3WG9A 4XJTA 4J1TA 3EZLA 5KVCA 4JBGA 2Q49A 4OAQA 2NV6A 1R0LA 4R51A 3I9JA 5ICMA 2YJZA 4WE3A 4QX6A 2AA3A 4NZ9A 4BB6A 5U4QA 1CIVA 3JTMA 1VSUA 3V2HA 3LT4A 4LN1A 4RPLA 1C0KA 4Y8VA 1NX6A 3RWBA 2FOIA 3L77A 5AOVA 1QYWA 2HQ1A 4J3FA 1N9GB 3D5TA 3OHSX 1DC4A 4U0KA 1PZGA 3F4LA 1KVRA 4Y9DA 2YFQA 1ZK4A 3BTVA 4II3A 4PLTA 4I1IA 2AMFA 3FWZA 2Y1GA 3RC1A 4IM7A 5DF1A 1KEUA 3EHEA 2EG9A 1X1TA 1JTVA 1QKIA 3WGOA 8LDHA 1KY4A 2IEBA 1DDOA 1EE2A 4Q39A 2X5OA 5KKAA 2YZ7A 2JD1A 3OEYA 1H2HA 1NYTA 2ET6A 3SC4A 4DMMA 2GO1A 5CFZA 1LI4A 3MOGA 1T2EA 1KC3A 2ZJ0A 1UXHA 2AE2A 3A06A 3IAHA 3EAGA 1NFQA 2AE1A 2OUIA 2YW9A 1IULA 5EL0A 2Y66A 4EJ0A 2NTJA 4QXMA 1K2WA 3PK0A 2CVQA 4BNTA 4CMEC 5L45A 3Q9NA 2JD0A 3AY6A 3GY0A 3KHUA 4MVJI 4XX0A 4TRMA 5DULA 3VTFA 2Y68A 3RBXA 2H1SA 3TOZA 4GBJA 4XB2A 4BNWA 1ZW1A 4ONEA 4XGKA 6ADHA 3TF5A 1QP8A 3M2PA 1Z7BA 1U28A 1JWAB 1K0UA 2VZ0A 4KTTE 1EQUA 1YOVA 4LCEA 3VH1A 4NK4A 4OXYA 2C5EA 4YQYA 1YE3A 3AWDA 3PWZA 4QFDA 2DAPA 5HS4A 3E03A 1ONNA 1SBYA 3MTGA 3FI9A 3MOIA 4LGVA 2ILTA 3CMCO 1GYPA 3JQEA 3O8QA 3Q6IA 4XQCA 5JCXA 3H9UA 1A5ZA 3TRIA 2ZB4A 3D4OA 3KEQA 5KCZA 4NK5A 3NX4A 3RC7A 1Y9EA 2Z1MA 3PXXA 3TZCA 4IJUA 1QORA 2LDXA 4BL5A 2CUKA 1MC4A 3GVXA 3OBBA 4DQUA 1MXHA 2C5AA 3QVXA 4Q3CA 4E12A 1X1EA 1P1JA 4OSPA 3INGA 2O3SA 1T2FA 1DLIA 4J6FA 2P9GA 1MX3A 1UDCA 3EVNA 3IDSA 4OL9A 2IXBA 3UFXA 5TIIA 3H5RA 1NWHA 3ZWVA 1QYXA 1DIRA 1S6YA 4NFHA 2DM6A 2RHCA 5THKA 3ZNOA 2QQ5A 2I65A 2O3TA 4U7WA 1RM3A 3GFBA 2NVWA 4TQGA 1O0SA 1IHXA 4JP3A 2E4AA 3DO5A 1T2AA 2FRDA 4ZQHA 2J3IA 1HF3A 3QP9A 4B3HA 1UAGA 1WDKA 3H9JA 3FR8A 1YL6A 1CF2O 1LNQA 1X7GA 3AU8A 1YO6A 3LZ6A 4OOFA 4Z6KA 3W8DA 3PWKA 4XYMA 4MOWA 2DTDA 3L4SO 4AJ1A 1E1MA 4DUPA 1GQ2A 1MC5A 1ZO8A 2JHGA 3AJRA 3BTUA 1JLLA 2HAEA 3PHHA 4JX8A 3PEFA 4CQMB 3I4CA 3ZWBA 3SJ7A 3W8FA 5G0UA 4BNUA 4PLZA 4IQ0A 2BFPA 6LDHA 1QLHA 3LYLA 4DBZA 1PGNA 4AJNA 1ADBA 4J4BA 4R9SA 1I0ZA 3GZNB 3I83A 1RYDA 1GCUA 1ZJYA 2HKIA 1H5QA 1NXQA 4TVOA 2ZCUA 1O89A 2W98A 3JQ7A 4WOKA 5JO0A 4NBTA 4DBVO 3E5MA 1MLDA 1B8PA 4A5OA 4NU6A 3KYDB 3ZWOA 3GQVA 4XCVA 1EUZA 4R4JA 4NBWA 1DB3A 5KJEA 3H5AA 3WB9A 3WMXA 1JVBA 1W73A 2VRCA 2IDZA 1DFGA 1QYCA 2TMGA 4I9UA 3BTOA 1M2WA 1MB4A 3JQBA 4YT2A 1PS0A 3VAZA 3FNHA 1DJNA 1EE9A 1SOVA 2E6UX 1B0AA 4FOOA 2OORA 1CQIA 2GN4A 3PHGA 4B79A 5DBFA 4PLWA 4HX5A 2BHLA 1U7HA 1YQDA 3ETGA 4M54A 4ZGWA 3EYWA 4E13A 1LDGA 3KSDO 1FXSA 3FPLA 3QSGA 4OXKA 3I9LA 3VVBA 4YAGA 1KVQA 3L6DA 5F5LA 3W4KA 3GMDA 3Q1LA 1R16A 4UVGA 4NMHA 1M6WA 3OH8A 3AI2A 3ADPA 1EDOA 4Q3BA 3V2GA 3MEQA 4CQLB 4OXNA 5L9AA 3DOOA 2HLPA 1E6UA 1PGPA 1DEHA 3UICA 1U8XX 5JS6A 4CL3A 2IYOA 4Q3DA 1GQQA 3ENKA 2NTNA 3GUCA 4NJMA 5F1KA 4XRGA 5BSEA 2HMWA 5ENVA 5L40A 3NTRA 2I5PO 3MJTA 1YL7A 3GK3A 4EUEA 1PEDA 4BKOA 4RPHA 4DQVA 2FSVA 2GYYA 3P5SA 3ITKA 3HDJA 1LLUA 2OZPA 3TZ6A 4UUOA 1ZVMA 3RIHA 4KP7A 1DAOA 3FCOA 4NBVA 4D3DA 5L4LA 3EY4A 4OGWA 1A27A 1M67A 5F5NA 3F1LA 2VRCD 3RFTA 4BO7A 2GUGA 2XAAA 1OC4A 2A4KA 4ZRNA 1RWBA 2Y1FA 4I5EA 5U1PA 4ALMA 1XSEA 2I6TA 3GG9A 3ZWXA 3WTCA 3A14A 3PYXA 4MPDA 1NQTA 2Y0CA 5ITWA 4BGEA 3PVZA 3VH3A 1Q1NA 4AICA 2DFVA 4WEOA 1I10A 1BTOA 4YCAA 5I8ZA 3WLFA 1K5HA 1HLPA 1XIVA 1ZZEA 2OP0A 1HE5A 4JJIA 4OHUA 4MVJP 4DPMA 3BHJA 1EZ4A 1LC3A 1RM0A 1XR3A 3D3WA 2C07A 3WGTA 1KVTA 4D45A 4AVYA 5I7EA 5FWNA 4WLOA 1SEPA 4CLDA 1Y8QA 5TF4A 1JA9A 2O4CA 4R01A 2VUUA 2HDHA 4XYBA 5G0TA 3STHA 2CDAA 3E9MA 3V1UA 3ZU5A 5IDYA 3DFUA 2V6BA 4BKRA 3CZRA 1KERA 1K3TA 3BMCB 1YBVA 3ZWPA 1DOHA 3PI7A 4KUEA 4CM6A 3DOJA 4IDFA 2CMDA 1V3VA 5THQA 2ZQZA 2EGHA 4W7HA 4EBFA 2FY8A 4PG4A 3FD8A 3GPIA 3ZU2A 1CEQA 1PJ2A 2R6JA 2PWZA 5G2OA 2GASA 3D7LA 2HMVA 2O2YA 1T4BA 3DTYA 1HE3A 2WD7B 3GA0A 2B4QA 3ONDA 5TS3A 5JW6A 2W8ZA 4FQ8A 2HK7A 1K6IA 4J0EA 1YB1A 1GZ3A 3O4RA 1Y8RA 2E49A 4W9NA 5FF9A 1JKFA 4UVDA 1YQXA 1PGJA 3FWNA 2Q45A 4B3JA 3OJEA 3C3XA 1PJCA 3HZZA 4R3NA 1ISGA 3WBFA 3DHEA 1BWSA 1E77A 3GZ4A 2X9GA 3RROA 3RSHA 3DR3A 3QRWA 4GX1A 4IMRA 5A05A 2C20A 4RZHA 3WJ7A 4QTZA 2I9PA 3NT4A 2Q2WA 1GZ4A 3QLJA 4XZ3A 2UDPA 1L7EA 3JQFA 4ZQBA 4CMKA 5A06A 1OC2A 3IQDB 3WGQA 4GX2A 1EDZA 2P2SA 3WNVA 1N92A 4QUKA 2EHDA 2UVDA 1YH3A 4YAIA 5CEFA 2QRJA 3UN1A 3OM9A 3QQPA 1UZMA 3T4EA 4JN6B 2Z1NA 2VCYA 5KTKA 3I4FA 3L0DA 4S3MA 1EFKA 3AI3A 1BHSA 2HRBA 4TWRA 3E6AA 1R4NA 1F14A 1LX6A 2NVUA 3MJEA 1B3BA 5IAAA 4YJGA 3S2GA 4EUFA 4J4TA 2W2LA 5L51A 1EEHA 4KUGA 4ZHSA 4LMPA 4BO5A 1GUFA 3WFJA 2DU8A 2VN8A 3ZWYA 4CM9A 1KS9A 2IODA 1UXGA 3A4VA 5JAIA 5HA5A 1ZH8A 3I9KA 5U9CA 2E48A 1QXSA 1WMAA 9LDBA 2CFCA 4BIIA 1PJBA 2O7QA 4I5GA 1PQWA 2FP4A 5GY7A 1E1LA 3S2FA 4PVDA 4HNHA 4Q3NA 1ZXBA 4IJVA 4YEDA 5FI3A 3LT1A 4IZIA 3WS7A 2P4HX 5JDIC 1Q7BA 4CJXA 2DT5A 2PTGA 3U62A 3LQFA 5TSDA 1U4OA 3SXPA 1KY5A 4KUHA 4RQUA 5K1SA 4P38A 2AXQA 3O8QB 3TPCA 3GDFA 1HDZA 2DBZA 5A9RA 1H2BA 4F3YA 1PU2A 2JCXA 4N54A 4XR4A 4BO3A 1E6WA 1G0NA 3WYBA 3NT2A 2H5LA 3DAFA 2ZYAA 3BYZA 5F3RA 4O63O 1LQTA 5L3ZA 2HK8A 3SJUA 3WQSB 4A73A 2ZATA 4IPTA 4CUKA 2A9FA 4WCFA 3AM4A 4WECA 2I99A 3M2TA 4XEHA 2IXAA 3UCXA 2FZEA 2YY7A 2VZ9A 4YVFA 4QFCA 1LDNA 4CV1A 1WAMA 4NDNE 4BGVA 5DP2A 3WYCA 2X23A 2X1HA 1P77A 4K1LA 2FPIA 1DFIA 3RFVA 1HE2A 4OKIA 4R68A 4TZTA 2W2LD 1GV1A 3ST7A 2TMDA 2HMTA 1HDYA 2PR2A 4FGWA 1B14A 4CM9D 3K30A 3ZHBA 4HV4A 3NUGA 1BVRA 3CH6A 4TMFA 4YBZA 4YT4A 2YYYA 3OJLA 5A3VA 3VZQA 3GFGA 4O5OA 4WK6A 5CP8A 4G65A 3TOXA 1I33A 4CLXA 1EVIA 1H9BA 2X9NA 2D2IA 4TRNA 4B8ZA 4J9VA 4HBGA 4UVHA 1E3JA 3ANMA 5COQA 3I9NA 4BNIA 4PG5A 5GZ3A 2DBQA 1SMKA 4KQWA 4J4HA 5MDHA 3D5QA 4IGFA 4XYGA 5AXAA 1NVGA 3KO8A 5A4DA 1PJTA 5CPBA 3K31A 2QYTA 5TX7A 4HY3A 3WIEA 2NACA 1I3KA 3HADA 3JQ6A 2GDZA 1V35A 1V6AA 1ULUA 1BMDA 1TA4A 1ZMOA 2I3AA 5B4TA 1WVGA 1YONA 5DOZA 1GCOA 3L4BA 4DIBA 3MCVA 3JQ7B 1PZFA 3HB4X 3IP1A 2X6TA 1U3WA 3EW7A 4MP6A 4OQYA 1VJTA 3ADOA 1R6DA 2EERA 4J1QA 3U5TA 3GPDG 1FDUA 3RUIA 5COBA 3PJFA 1HT0A 1NQ5A 3TL2A 5ITVA 1NTOA 3AK4A 3G0OA 1LU9A 3LT0A 4FPXA 4N5MA 4EEZA 5JDCA 1D1SA 5EJ2A 3DTTA 4RO0A 5IZCC 5ES3A 3RUHA 3NTOA 1QV6A 4CUJA 3ZV6A 1T1SA 1EQ2A 2OL4A 4JIGA 5CDYA 3H4VA 2POQX 3OIGA 3QY9A 3GC6A 4I9NA 3DZBA 2RHRA 1H6DA 4XA8A 1I24A 3IKVA 1ZXLA 4FJ2A 3HDYA 2VHWA 2AW5A 3AOGA 4R1NA 4R1SA 4GMFA 4CM1A 5I8WA 1H9AA 1BW9A 1GZ6A 2F00A 3VVCA 1T2DA 5CEEA 5KIAA 4O59O 2JL1A 4HWKA 2VTDA 4GL4A 4NFYA 3PIIA 1A4UA 5IN5A 4IDAA 2AHRA 3C1AA 1SCUA 5JXWA 3PHLA 2BGLA 2HJRA 4IXTA 5BT9A 4J0FA 1SNYA 2GN8A 3KTDA 1NPYA 4CV3A 1F8GA 4E2XA 3D4PA 4A2CA 4RDIA 1OI7A 1C14A 3ZW8A 4NQZA 3WMWA 1GADO 3PTZA 1NM5A 1B26A 5IDWA 1EUCA 4RVFA 3RJ9A 2PFGA 3QWFA 3VPFA 2ZTLA 3DMTA 1XWFA 3DBLA 3DBVO 3E82A 1R0SA 1QYDA 1EFLA 1ONOA 3Q2IA 2X0NA 4CR8A 4EZBA 2EEZA 2PD3A 4Z0TA 5IG2A 4QT0A 1B16A 5T67A 2DTXA 4DPLA 3V1YA 1ZEMA 1Q0LA 2PZMA 4CLHA 2BGKA 3ZDFA 1C0IA 1HE4A 2J6IA 4IS2A 3MTJA 4C7KA 2JFGA 4YT5A 1NPDA 4PZDA 4BNMA 3IMFA 4MP8A 4YJFA 2NU7A 4IBOA 4RGBA 4JROA 5TRTA 3RUCA 1WMBA 4RV9A 4XRRA 4GH5A 1UR5A 4GSKA 1PS9A 3U4CA 2YQ5A 3D3WB 3CEAA 1Z82A 1QLJA 4R5HA 1VPDA 4Q3EA 4B4VA 2CDBA 1PL6A 3NDIA 5BSFA 4G81A 4U6QA 1A7AA 3GUYA 1SOWA 1Q0HA 4YPOA 1HDGO 3E18A 3KXDA 4MINA 2FPGA 2IZ0A 1Y8QB 1OAAA 4IDGA 3ABIA 3AUAA 1I2CA 1U9JA 3B6ZA 3OA2A 4AJHA 1DIAA 3F6YA 4WEQA 4XDYA 4YYZA 1JKJA 2YV1A 3ZWMA 1GYQA 1GU7A 4NG5A 4LCJA 2UAGA 5B4VA 4ZU3A 2C82A 4WLNA 1RM5A 3FNFA 1E0DA 2ZJ1A 3ICCA 5JMWA 1I2ZA 2VOJA 2PKQO 2O48X 1IZ9A 3HDQA 1G0OA 3NYWA 4PG7A 1LRJA 1PJSA 3W8EA 1QRRA 3T4XA 5LDGA 3SEFA 5F1PA 5TJHA 3GEDA 4GMGA 1NVTA 1Q7GA 2VNSA 1T2CA 1Z7EA 4UAGA 4OOEA 3X2FA 1PL8A 3ZNNA 4AJEA 1Y8RB 3HB5X 4BO0A 4D7AA 4BKQA 4UULA 4INAA 3GMSA 3KB6A 4E21A 1N8KA 2V6FA 2X58A 2Q1WA 1L1FA 2OMEA 5TQVA 4D41A 2WYUA 2Y0DA 1OBFO 3DWFA 3MJVA 2CDCA 4J1SA 4A7PA 4DMLA 3QWAA 1U2GA 3PJDA 1UDAA 4LISA 1DIBA 4BHTA 1E3SA 1XKQA 3ZWCA 4WCDA 1DHTA 2VWQA 3WNQA 4RLSA 2GD1O 4CM3A 3VC7A 4XKJA 5KKCA 4PLPA 5CEJA 4TVBA 3ZI0A 3I9OA 5TT1A 1VE9A 1YBMA 4GSLA 2AG5A 1LRKA 1DAPA 1I30A 1VSVA 3ZW9A 1R4MA 4UUNA 3TZHA 3VPHA 2IRWA 4YDRA 4OKNA 4FC7A 2X8LA 4GPD1 1Y1PA 4JP2A 1R4NB 2JFFA 2NVUB 1NWCA 1X7DA 3JQ9A 2BLLA 2PZJA 4IS3A 3DHYA 4LW8A 4RVHA 4YJGB 4F46A 3EGOA 4YT8A 4NNJA 4W82A 5DNAA 4Q3AA 3PQEA 1IL0A 3LU1A 4UREA 1AN9A 1NHGA 4JCOA 2OHXA 5CDGA 4XD2A 1YJ8A 3MWDB 4RCVA 4O6VA 1GEEA 3IUPA 3PJEA 1HYHA 3OIDA 3AFMA 1KETA 3OQBA 4RPJA 3EDMA 1P31A 2QX7A 3HDHA 2R00A 1I3MA 4PG8A 3NEPX 4ZN6A 3QWIA 1IY8A 2PGJA 3K96A 5GZ6A 1IPEA 2JKVA 3DZKA 5JFOA 3SX2A 1UUFA 2AQHA 1VM6A 1LTHR 1MP0A 3JQBC 4FJ1A 5K6AA 4LVCA 2B4TO 1OZAA 3OJOA 5F21A 2NUAA 3QE3A 4MDHA 1W0CA 4W7IA 1Q2XA 1W8DA 4WASA 4DPKA 4N18A 5MGBA 5C7IO 3RVDA 1CETA 3NRCA 3C24A 2GZ2A 2AQIA 4ZQEA 1VL8A 1DRUA 2AEJA 5TJ9A 2QZ9A 2GSDA 3MJCA 3RU9A 1LRLA 1X13A 1DIHA 1R37A 4G5HA 1CWUA 5H82A 2WJPA 2Y1CA 3GNTA 3CKYA 3IOYA 4YRDA 4Q9NA 2RCYA 4YQZA 1SO8A 3CE6A 2NNLD 3DZIA 3F4BA 3RAJA 1YXMA 2R2GA 2W2KA 4A26A 3GGPA 5CG1A 7MDHA 1WLYA 1TB4A 2X0JA 3WTBA 4IZHA 4IQGA 1LLQA 2HO5A 3VZRA 2GN9A 4DVJA 4L76A 1A9YA 3QW2A 2O3RA 4KTVE 3KYCA 5L4NA 3R0IA 3O38A 3ROKA 4I08A 4CMHA 2JHFA 2NM0A 4ND2A 2NWQA 3WX0A 1LC0A 2Q99A 4MKRA 4RF3A 3H9EO 1DLJA 3DC2A 1DIGA 1DPGA 1YB5A 1GUYA 1DBVO 4BMVA 2D59A 3I1JA 1X0VA 3C1TA 3NTQA 1NFFA 3WIDA 2GPTA 4MVJM 3G1UA 4B7XA 2O3JA 3IUSA 4ZQGA 2NU9A 1W4ZA 4NPCA 4UEOA 3RU7A 3GF4A 3JQGA 2W4QA 4RLHA 4NH4A 3KYBA 4E5YA 2WD8A 4PRLA 2I3GA 2EKQA 4J2OA 2EW8A 3G79A 4LRSB 3D3EA 5T5QA 3GVHA 1K89A 1HSZA 5DOVA 1HRDA 1I01A 4CLOA 3WGYA 2Q1SA 1GEGA 4DQXA 1O94A 1PJ4A 2P4QA 3OA0A 2RH4A 3QIVA 2GR9A 4IJWA 3DDNA 4ND4A 4TSKA 1KOLA 3PDJA 4G2NA 3N74A 1E1NA 1DJQA 5DCUA 5AXBA 3FN4A 5JCJA 1HDCA 2EIHA 1M66A 1P1HA 4RVDA 4BVAA 4DIFA 1E3LA 3CTMA 2I66A 5IDQA 2FSSA 3ZV5A 4B8WA 2J5QA 3W6UA 4BQRA 4IIVA 2XF8A 1YVEI 1VKOA 2ZTUA 2VYNA 3QA9A 4EUHA 1VKNA 3SC6A 1AHIA 1NVMB 4PIVA 3NGXA 2GZ1A 1CDOA 5GMOA 3P19A 1V3UA 1P74A 3P7MA 1BRMA 1HEUA 1XLTA 1Q0QA 3QVTA 2BRUA 4HFMA 1PZEA 4KMSA 3E9QA 3ZNQA 2GRAA 2JCVA 1UP6A 4HFJA 4IDBA 2DBRA 1BW9B 2Y93A 1DFHA 3K6JA 1BDBA 1WDLA 3K2BA 3QWHA 1BXGA 5LDHA 3AFNA 4BS9A 5IZ4A 1SB9A 4EYEA 2UYYA 4JLWA 1D8AA 5KVVA 4IMPA 4EJMA 3LC2O 1I36A 1WDMA 1FDVA 4ID9A 3FF4A 3ZGYA 4FCCA 3ROMA 5IFLA 1E6EA 2FHSA 3NAQA 1CYDA 2CD9A 2XXBA 1DXYA 2EGGA 2YFHA 3C7AA 1ZCJA 4JGBA 5KWEA 1LSOA 1E7QA 3NJ4A 4QEDA 4BUCA 2HCTA 2A94A 3WGHA 4FFMA 4AFNA 3RBZA 5HWSA 1X7HA 5H83A 1ADFA 1NASA 4J9UE 4CUZA 1ADCA 4LMRA 4XWYA 3TZKA 3X2EA 2VT2A 3LC7O 2VNAA 1Z74A 2PKQP 2QG4A 2AEMA 5TC4A 3DBLB 4WLVA 1T25A 2QRKA 4XQ9A 4R54A 1NR7A 1FDSA 5JCJD 2O4UX 3NDRA 1XU9A 4KOAA 2Y1OA 3DEYX 3FR7A 4GLLA 3GLQA 3HG7A 1G6KA 4WGGA 3GNQA 1EMDA 3Q2KA 3R6DA 3WGZA 1I32A 5ENDA 3BZUA 1GFSA 3SLGA 3DFZA 4PLCA 5KJFA 3AY3A 2NLOA 1XYGA 1P0FA 5ICSA 1N9GA 1D7OA 3C7CB 3JQDA 3UGKA 4DWVA 5BNTA 1ORRA 4CM4A 4CM8A 3FTNA 4YJFB 4FFOA 2V7PA 5T57A 2A35A 1PL7A 1NFRA 4J16A 3EZYA 1Y9AA 1P3DA 5FEUA 3FRJA 1X14A 4B7UA 1NQAO 2ZYGA 2BMAA 1EK5A 1PTJA 2Y67A 5DBGA 1WZEA 3PYLA 4YJHA 4CL8A 5C7LO 4WLEA 4AL4A 3CUKA 4H15A 4S1VA 3VZPA 3ZHXA 5JNLA 5HM8A 1U3UA 3C7DB 1RM4A 5B37A 4YRBA 1VRWA 4ALNA 1LQUA 3ASVA 4FJ0A 4EJ6A 1KC1A 5EQDA 4AJIA 5GZ1A 4PG6A 2PY6A 4J2HA 4BNJA 5JSFA 3LLVA 1ZK0A 4E5KA 4B4WA 5CHEA 2YHIA 4MVJA 1LDMA 2NQTA 4CV2A 1G1AA 4BNGA 1O5IA 3ENNA 4UVIA 3F9IA 2AQ8A 3FHLA 2D3TA 2I67A 2OP1A 1P9LA 4FS3A 3UVEA 3ZHZA 4A0SA 4A27A 3BMOA 1P1RA 3GGGA 3BMQA 2VZ8A 1BGVA 3NGLA 1LDYA 4K26A 1DC5A 3WGGA 3VDQA 4W4TA 2JFHA 2E37A 4C4OA 1VL6A 4ALKA 2Y0EA 4BMSA 4DC1A 4YAJA 4R9RA 3JYQA 2C7VA 3JQAA 1HDRA 4FFRA 4R69A 1PJ3A 2RH8A 1B8UA 3JYPA 5IF3A 4FDAA 4UVEA 1JAXA 3EMKA 3W4IA 4Z3DA 4ZICA 3LVFO 1I5RA 4I5DA 5ILGA 1B3RA 2WTBA 5FI5A 1YGYA 5I7SA 5COAA 4QO7A 1E7RA 3AY7A 3JQCA 3KV3O 2D0IA 2J3HA 1V8BA 4IDCA 4XQEA 4D0RA 3I5MA 1UP4A 3U09A 5TNXA 2O7SA 3K92A 1YOVB 1PX0A 1K6JA 3HQ4O 3AUUA 1MG0A 4EDFA 4HFNA 5L53A 1RKXA 1A71A 4WOJA 2O23A 2JAPA 4ZA2A 4BKPA 4TRJA 4JBHA 4CMBA 3ANLA 4FOSA 1YL5A 4PGFA 2VUSA 5TGDA 4YAEA 3ROQA 3AOEC 4ZVVA 2YHUA 1J49A 1P1FA 2BI8A 4MIYA 5DN9A 1R4MB 4Z9YA 1QSGA 3HJAA 4P22A 5KVQA 2WE7A 2Q50A 5L7WA 2C0CA 3IIEA 4MVJD 3WSWA 3D1LA 3MZ0A 2RAFA 5K0ZA 2Q4EA 2FMUA 3LSYA 1E1KA 5AXCA 3DQPA 3LC1O 1EBFA 5IDXA 3TZQA 5J23A 1QG6A 3TFQA 1BG6A 1MV8A 1H6CA 2QRLA 5BSGA 4ALIA 1U5CA 5LCXA 3H3FA 2HMUA 3HHPA 2YV2A 5T64A 3JQAD 2BI7A 3OEWA 4HADA 5FYDA 4J43A 1JVSA 3VOSA 1FMCA 1R12A 3L4BC 3DZFA 4DYDA 3GH3A 2EKPA 3O26A 3PJGA 1PWZA 1LDEA 1UZNA 4WKGA 3UKOA 1Y5MA 2ZB7A 3LK7A 5H81A 1JN0A 5A02A 4IXWA 1MFPA 1T26A 1TI7A 7ADHA 3KYDA 1IYZA 3GGOA 4RJTA 1C1XA 3QJ5A 3H6KA 1PZHA 3GVIA 4BMNA 5HTOA 2GERA 1C1DA 1WZIA 3V2UA 4BNVA 4DL9A 3DAPA 2WWRA 2D5AA 2NSDA 2O50A 4AJOA 3S8MA 2EP5A 4IY1A 2OXIA 4OIMA 3L9XA 4CMIA 3R3JA 5EESA 1GYRA 2PLAA 3H5NA 1A7KA 5JLAA 1ISJA 5I7VA 1KIFA 1E3WA 5L95A 1JW9B 5KNLA 3T7CA 3GVPA 1RJWA 4AJ2A 4Y98A 2GNAA 1NP3A 1XDWA 1NBOA 1LLDA 1TT7A 1GTMA 1VL0A 3F5QA 3KOUA 3NV9A 1HZJA 4ND5A 3E8XA 3W6ZA 5I7FA 2P9CA 3JYNA 1BVUA 4AG3A 4WNIA 4JJGA 4PZEA 4EITA 1DC3A 2WYWA 3BHIA 3D4NA 2W2KB 1CQJA 5A04A 1I3NA 5K9ZA 3ZZNA 5CAEA 3DMYA 2BH9A 4Y6RA 3KYCB 3BTSA 1GD1O 3TN7A 3RQSA 4MKXA 4CPDA 4RORA 1NPTO 2P5YA 3LF1A 1EBUA 5F1OA 3WYEA 4XQGA 4IJKA 5T8KA 5JAZA 2O3UA 4UUMA 2NADA 3JQ8A 1HETA 3DMTC 2C59A 5G4KA 1AXEA 2EKLA 5A9SA 4NI5A 1HZZA 2OBYA 4YXFA 2RIRA 2SCUA 1IZ0A 1PJLA 2PGLA 2B5WA 1ISMA 2EF1A 1LLCA 4O0LA 2H6EA 4QO8A 2Q46A 3HUDA 2D5CA 3SVTA 3JQGB 4H16A 1DO8A 3K8ZA 3Q11A 3RUEA 4FB5A 4QSMA 4ALJA 3CPSA 4UEKA 3I52A 3H2SA 4HXYA 4LVUA 4GGPA 1D4FA 3DONA 1DSSG 4F45A 4CLOB 4M55A 1UAYA 4BNNA 2C54A 4FBGA 3IS3A 4U0JA 2D4AA 1J6UA 2B35A 3ONEA 3EK2A 3FPCA 1HDXA 3JYLA 4FSHA 4NJMB 5DCYA 3RC9A 1M75A 3TFOA 3IL2A 2NQ8A 1P0CA 4B7CA 4FD3A 2XXJA 3PLRA 4NU5A 5JY6A 1PGQA 1ZK2A 1SZJG 4I9HA 4UEJA 2ZTMA 5JC1A 2B83A 5JC8A 1DRWA 4DLAA 3AM5A 4GKBA 4FC6A 3WGIA 4AJLA 4RPGA 3H3JA 4KZPA 3FTPA 1WNTA 1LSSA 3WWYA 4ESOA 3Q9UA 2HUNA 1E92A 1ONPA 3RFXA 4TRRA 3W4JA 5JMPA 4C7JA 1HWYA 1KEPA 2DUUA 2ZK7A 4XGIA 3JYOA 4ALLA 1KEWA 5AYVA 3NJ8A 1ENPA 3AU9A 2F1KA 4Y6SA 4MO2A 3BAZA 3BHMA 1GQYA 3HSKA 4CM7A 1OFGA 3OIFA 1I8TA 1Y81A 2DPHA 3E5RA 1YJQA 4K6CA 4A03A 1BXGB 2ZQYA 2X0RA 2CVOA 4WJZA 3I9MA 1JKIA 4Z9FA 5A9TA 4BNZA 4J90A 4D42A 4XYLA 1PR9A 4RVGA 1B2LA 1NR1A 5G0SA 3HFGA 3JD4A 2Z95A 3Q3CA 2X22A 3K73O 2X4GA 4BO6A 1PWXA 2QHXA 4FFPA 1U7TA 4B3IA 1FJHA 5A5EA 1UXJA 5BSHA 1K6XA 3IJPA 4J49A 3WQRA 3M6IA 2J5KA 4CV0A 4NBRA 1AUPA 3LF2A 2DVMA 2VT3A 2ZCVA 5ADHA 1JWBB 1UXKA 3VKVA 2JCYA 4QECA 1LSUA 5L7YA 4NR0A 2Q2QA 3OF2A 5EPOA 1U2DA 4PZCA 3VTZA 2D8AA 1LSJA 5L7TA 5A5FA 4DYVA 3INRA 1E5QA 1M6HA 2ZYDA 4PCVA 4J7XA 3T7EA 2GCGA 4KDEA 3ZU4A 5AXDA 1QV7A 4GGOA 2VOEA 2Q1UA 4OMUA 4R1TA 3EVTA 3RUDA 1SAYA 4XJSA 3RC2A 4TKLA 3HN7A 4HNGA 3GN2A 3UCFA 1RPNA 4BGUA 4YB8A 1TT5A 4CM4B 2VWHA 4CM8B 1CRWG 5BR7A 4U5QA 3UUWA 3JQ9C 4ILKA 4KQXA 1TVEA 1F12A 1VI2A 4IINA 4NBUA 5CDUA 4R41A 3ZH2A 1F06A 4D79A 3KZVA 3ITDA 5DT9A 3H65A 1V3TA 2G76A 1PGOA 4YJHB 1D3AA 5CDSA 1DC6A 2C7GA 3JD2A 1I3LA 4M1QA 3FBTA 4BNHA 3V1TC 4DA9A 3GAFA 3K5PA 4E0BA 3DZJA 4N7RA 4PLHA 3C85A 4L73A 2CF6A 1Y7TA 2R00C 2GGSA 3VPSA 4J7UA 3KVOA 1J5PA 2YHIB 4P4LA 3GOHA 3NDJA 3DXFA 3CXRA 1LA2A 1ARZA 1KYQA 5K6AC 2HMSA 1TLTA 3BMOB 4YTEA 3BMQB 2AQKA 1A4IA 4NIMA 1JDJA 1B7GO 4N5LA 4EEXA 3TJRA 2EJWA 3PP8A 4JJFA 4NFSA 3KLMX 4GI2A 4RDHA 4BV8A 1CERA 4DTIA 3DOCA 4RL6A 1ZBQA 1GL3A 3JQAB 4BO4A 4PLGA 3R3SA 4RF5A 3WBBA 4MVJE 3L9WA 2PA3A 4M86A 4LRTB 2J8ZA 2DTEA 2GZ3A 1PR3A 1VJ0A 1WXDA 1XCBA 3DL2A 3WR5A 5I9LA 5HBRA 5ER6A 2ZTVA 4CMEA 2B0JA 1Q7CA 1B8VA 4FFLA 3HN2A 3VH4A 4E2WA 3C8MA 5G0VA 2GN6A 2WEKA 3PQFA 1WP4A 1F0YA 1EVJA 3GT0A 2HSDA 4D43A 3MJ4A 1F8FA 1LEHA 2G1UA 3ULKA 2CNBA 2G82A 1F17A 1ZK3A 3GN1A 3PLNA 3WXBA 3ZWWA 2FZWA 5EERA 4GLOA 1YS4A 4R16A 1H6BA 2B4RO 1GPJA 1VLLA 1P33A 3OECA 2JAHA 1ZUD1 2IEDA 2VHYA 1XGKA 3BXXA 4M49A 1AE1A 4GWGA 5KJ6A 5BQFA 3CMMA 5B12A 3GHYA 3LDHA 4WCFB 3RJ5A 1HYEA 1XELA 2EW2A 2IZZA 1FK8A 5FFFA 4CR6A 2V6GA
chains in the Genus database with same CATH superfamily
3AF5A 1MAAA 3JSAA 4LOLA 3HWRA 3UG7A 3GUHA 3LDFA 4PNZA 3IQHX 3TR0A 3G23A 3U26A 3KSUA 3I6YA 2CHQA 1OU0A 2HJHA 1T1EA 3BXHA 1EFRA 1XQXA 2BM0A 3E58A 1VG9B 3N9IA 3LFTA 5EKDA 1Y7PA 2B78A 3T3PB 1Z08A 3VKWA 1R8XA 3AVOA 4MIEA 4Z0PA 2CW5A 3CZMA 1KJIA 4UTVA 4U7GA 4LE0A 1L6IA 4DCPA 4ZZ0A 5JSZB 1BN7A 2XWSA 1JG7A 2IKSA 3SYRA 1EWQA 1O94C 4IJ6A 1U2EA 3QA3E 3GO4A 1KKLA 4MWOA 3SKXA 4MUFA 2GYWA 3PQ6A 2WDZA 3IC5A 2AD1A 1MD9A 1UK6A 1Z33A 2FG7C 3OU6A 4H08A 4NBNA 4U3JA 1CUGA 2WP0A 3E1KA 4KV7A 4RL4A 3VSAA 4BMCA 2I80A 2QLMA 1W581 3LWNA 4RJIA 3PRKE 4PSKA 2MTBA 2ODAA 2FN8A 3A2LA 5EIOA 3IERA 2PH3A 1BHO1 3U7HB 4FN4A 4GMDA 5F9MA 4BNFA 4DFDA 2ZFUA 1YHZA 1Z83A 4O4IA 4D0SA 5FWDA 5LQMA 3AETB 2HBQA 2PGDA 3EBLA 3LL7A 4FYPA 4H27A 4LK3A 4QUIA 4TSRA 1L1QA 2YX1A 3WLKX 3UJ8A 2ZUFA 2MSLA 1LS6A 5FD8A 5LQAA 4E33A 4FQ5A 3I76A 1GKKA 2CHFA 5EMHA 4JBXA 3RYHA 1MCZA 1UZLA 2ERCA 2R8PA 4MR8A 4OYHA 4KAAA 1N25A 2RHTA 3WOVA 4E08A 1V4BA 1FXWA 2A92A 1HL3A 3ILVA 4Q3KA 4L4XA 1KBZA 4JKOA 1X94A 4HFRA 2FLKA 2N9UA 4FX2A 5DCWA 3CM0A 5EIBC 3WJAA 4YI5A 4JV5B 5LC1A 2IFTA 3ABSB 5JWOA 5JJLA 1OOEA 3QUAA 4IYJA 4LNAA 3TTYA 3TLYA 3C3EA 1CVIA 4NVRA 3AI1A 3V7WA 2PE5A 1EFHA 1UXOA 3A1FA 3QEJA 2RHDA 3IO3A 3FJYA 4D3YA 621PA 3G2OA 1KR2A 4OP2A 3EW9A 4EI2A 3QM1A 1QVWA 4P92A 4DGSA 5G1PA 5AIBA 2BGJA 1CJKC 2ORVA 1XJQA 3MN1A 1QYVA 4P4NA 5CD9A 1GTL1 1P45A 3VPXA 2H2GA 1AUVA 2WSSD 3F4KA 3GDGA 4O2LA 1I2DA 3O9VA 1TFUA 3LLUA 4RHUA 4K6MA 3GRPA 4QGHA 4AZWA 5K01A 2NX2A 4WPGA 3DUWA 4OH1A 4RF4A 3WZ2A 4TKVB 5CB0A 1MABA 4X95A 4EHHA 5D00A 1BHQ1 2X9QA 1R64A 3N7UA 1ZLXA 3U48A 1CD5A 2GPWA 3LP6A 3FKSD 4GVLA 2YZGA 1GKYA 4TX1A 2H1OA 2BKEA 3G17A 1ENZA 2G5PA 3R74A 3TDKA 4OSEA 4D45A 1BCSA 2JLUA 4GWKA 2PCJA 1VBMA 2PQ0A 1ZFNA 3G6WA 4H7PA 1MVNA 3HCCA 4IHJF 2F1OA 5E9JA 2UXBB 1BXRA 2DPGA 4J07A 4YMWA 2QGFA 5ICFA 1COZA 1SIOA 2J30A 3EAFA 5EQJB 3TDMA 3GHHA 4FBLA 5JZVA 4F96A 1ZKDA 2Z56A 4OQDA 5ARCA 3LCMA 1IJBA 3D0OA 1E7MA 2M1ZA 5DE3A 4I1SA 1ZA1A 1U3TA 4IVQA 2PSJA 1MA0A 5KX5F 3L8DA 1Z4IA 1TC2A 1L5YA 1TCCA 2OBLA 5E7IA 2J0UB 1SVNA 2GVZC 3DFIA 4R3WA 1OZHA 2AN9A 4ER5A 4YAKA 4QGGA 4RQTA 4E31A 5E7QA 3N3AC 2VKTA 2QQFA 2GB4A 2DCMA 3FOWA 5KVSA 2PFKA 3CWZA 4X00A 1R6AA 2EFGA 3AERB 1C4OA 4UJ5A 2HT6A 1EX6A 1K4KA 3CW2A 2WMDA 4WBXC 3ZDRA 5IT0A 2NIPA 4K28A 5FTLA 5HCIA 1FUYB 2Q0SA 4PX3A 4BNKA 3A27A 4ENQA 1R3UA 4JLDA 5DDIP 4Z2YA 4F9GA 1W96A 4V02A 5IU6A 5IXYA 1JU9A 3IGFA 4LEIA 3GPLA 3QVOA 2WVHA 4JZYA 3QLUC 2HCJB 3EFOB 5IARA 3ZHRA 4PSVA 5IJZA 5M34A 2EWVA 3PDCA 3EWAA 1AUQA 5LN1A 4OHVA 3U0BA 1HOTA 1Y4SA 2ZYTX 2W90A 3DC7A 3S5UA 3O8CA 3NT5A 4UUAA 1QJCA 3UWMA 1U1IA 3R3VA 1V6CA 2YDXA 1KZYC 5JLJA 3GFQA 5A0TA 3UWDA 1L8XA 3UXEA 4M89A 4TMXA 1JWLA 3BWYA 5DTIA 1C7FA 3PFHA 3SVZA 4L85A 3NFYA 1L5MA 1N7GA 1QE0A 2ATIA 3H2ZA 1FTNA 4G0XA 4I55B 3UHOA 1OMOA 3GEPA 1NF9A 5JBQA 1GU0A 2CZQA 2IDJA 4A8TA 2XVYA 2AN1A 3QUTA 1DKUA 2OILA 3IKLA 4B87A 3I61A 2QG6A 1Q7RA 3VOAA 1DIOB 1JQEA 2MT9A 3RIYA 4B45A 3NBFA 4YAFA 4FXPA 1PW7A 5FNZA 5HSGA 3TR6A 4JA0A 1CC1S 1T13A 4LGCA 1E2UA 3LZDA 4PPGA 5F4BA 2FEPA 5CNKA 4MICA 2EXXA 2IW3A 3G1TA 3T7RA 2RGEA 4TYNA 2B94A 1H6AA 5E1BA 2VLIA 3T6KA 3DOUA 4DMUB 3VPGA 3W04A 1ZN9A 3L0YA 4LE1A 4CEJB 2Q0QA 2HQOA 1CCWA 1FS4A 3KWMA 2QMYA 4HKTA 2OK8A 2MCFA 5AW8A 1LJLA 3R5KA 1KMMA 4LRXA 2Y05A 3TYXA 3O4HA 1FVOA 3L8GA 1QOQB 1C9NA 2I55A 3VR3D 3OKPA 4M0FA 5C5IA 3ZGZA 2MJLA 4YP0A 4FW9A 3V42A 3I09A 5JYEA 1L3CA 4ZOCA 3NOVA 1H2ZA 3HDVA 5DBIA 2Z2ZA 1EFCA 1FB5A 1GNSA 2FFRA 2W00A 4DSAA 4NARA 1PSDA 1Z45A 4TROA 4X6LA 5T4FA 2VXBA 3FGZA 2XUFA 1OASA 5K8IA 5E2AA 5C35A 1X1DA 3BBPA 1UM9B 1SCIA 1KZ6A 3LPCA 3GFTA 4G0QA 2IGTA 3H8VA 1AS3A 4I6GA 2OWEA 4RUKA 3W78A 2R3SA 3QF4A 4CI9A 4ER3A 4LOHA 5BYJA 4J7CA 1YA4A 3HWSA 1AU9A 1FLDA 4KQMA 2B7LA 4ROSA 2UKDA 2EKBA 2QI9F 1LZKA 3PPIA 2RHGB 3ZZ1A 3PIDA 2QL6A 2R7AA 1ZN2A 1C3VA 3BFKA 1PEKE 4B4OA 4DIDA 1FDRA 1DAFA 1Y1TA 2VFAA 1KXZA 3IYLW 3RKUA 2R1ZA 5JJ5A 1DGQA 1TW3A 2VLBA 4PXAA 4B4UA 3K0FA 4TUYA 3AM3A 4KK4A 5HYVA 4I2NA 5HRUA 1JF8A 4N0EA 3O03A 3DEZA 4WCFC 3JD3A 4IUYA 2JGEA 2ZU6A 3MJSA 2Q4BA 2ZSIA 3FKJA 3H2BA 3OJ0A 4GX0A 2C3MA 1AHHA 1GTG1 1SUFA 2OXFA 4QWWA 1B0PA 1MF7A 1V7PC 2WSMA 3W5VA 1YZVA 2Q3JA 3VHLB 2AD5A 2IIPA 4EYOA 5GIOE 3MGCA 1TUGA 1K4MA 5DBHX 3CX7A 5TT0A 3O3MB 3DFKA 3EC2A 4HDRB 3LKBA 5BR4A 2I7TA 1CQWA 4PM4A 1WXXA 3OZ7A 4PYIA 3V8VA 3FFXA 3C8ZA 5LKRA 1GPLA 5ELMA 1XCJA 4F06A 5FRDA 5IJAA 2VEOA 4UU1A 2FXVA 1Z73A 9ATCA 1ZESA 1ORWA 5K6RA 1VHLA 1ZX1A 5AUNB 2X86A 2C9OA 3NATA 3GDOA 2DPYA 4NCXA 3A25A 2YXEA 1OUMA 3MWDA 3BJRA 5DNEA 5AUQA 1XRNA 5C8YB 5SZJA 1NNLA 3GR6A 5C1DA 2X9VA 5KTTA 5KYYA 1V37A 2PS9A 1N34B 4MGHA 2F1HA 4G5FA 2QUJA 4HP8A 4K46A 3U4HA 3HUFA 4ZI7A 3C41J 3OKFA 5BSWA 1JG2A 2FGJA 4Q05A 3GLVA 3O1JC 2JD2A 3T9EA 4DV1B 4N48A 1KP2A 1NBMD 3ZUGA 4DUYB 5EY5B 3CLKA 3R7BA 2M1XA 2QQ0A 3ZCTA 1IHDA 4JFRA 1EBBA 5FA8A 1PQUA 4BMPB 1XAIA 2JFNA 4N5NA 3TQOA 1BMFD 4KQEA 9LDTA 3K1AA 5KZMB 3RS0A 1M8JA 3UW1A 1EVZA 2O2CA 3L0ZA 3V8RA 1JHUA 3IVXA 4EYQA 1JQ5A 1SKAA 2D2FA 1MC8A 1SBTA 1W6UA 1AQLA 2IHVA 3IQGX 3NHJA 1O96B 3RIXA 3IHKA 3KKNA 4G0PA 4Z8YA 5EYPB 2VDPB 1G42A 3QPVA 1PIWA 1OCEA 1SCJA 1XZGA 3KM0A 3NORA 5AM5A 5B4UA 3IMGA 2E1RA 2R8BA 2FWMX 3F5SA 5BQ3A 3HO1A 2VP2A 2PIAA 3ANNA 1SPXA 3THRA 4KLAA 2ZIEA 1N6KA 1I2BA 2WE8A 3KX2A 1R15A 1RYBA 1HDOA 3QOXA 4BO8A 1U8FO 3HUTA 3PTLA 4WVLA 3K94A 2JBWA 3D4IA 4EZIA 2HK6A 1NLMA 1K5PA 5B3LA 4YMVA 3PUWA 1ZHOA 1RI1A 1P1IA 5IUNC 2QRVA 4OCZA 3SBEA 3AB3A 3THOA 5HDQA 2XLBA 1JR3E 3WFZA 4UTNA 3TB6A 5KO2A 5K8LA 4Z1OA 2B2NA 2C2BA 3OPYI 2C8KA 1E2FA 4QTYA 5JDCC 4QOSA 1EI9A 4YXWA 2VDNB 3EX7C 1MG5A 4WK2B 1E4VA 1E9EA 3RUFA 5DGIA 3UENA 3UJ6A 5T8KC 4FKMA 2VUTA 1DHRA 4E46A 5K4HA 3OSZA 1G60A 1WPQA 1U3VA 2WMYA 3R75A 3WKBA 4OD0A 3JAWB 2VWGA 3HKCA 1Z3CA 3BAFA 1M2GA 2ODPA 4Z3KA 1LDBA 4BXOB 3U4DA 4R7GA 4AKEA 4YRAA 3K9LA 1ZRNA 3BA1A 5IVIA 3ANSA 1TMGE 2QN9A 5AW5A 3VO1A 4F2PA 1AJEA 2ID9A 3QTLA 5CGQB 2IHBA 3L8MA 1ZJZA 2YZMA 1K8RA 2QW8A 3I8OA 3GB9A 3G8DA 1C4KA 1AGNA 2PK3A 1U2TA 2WWHA 2VDLB 3GCZA 1YRLA 3H11B 1T5LA 5J5AA 4PFSA 4RVNA 1L4KA 1OI3A 1UJMA 4L9SA 1ZSNA 2P5UA 2NU8A 1WW3A 3OETA 2VHCA 3ONFA 4P82A 4KOEC 3CZ9A 1QAOA 3UHAA 2Q4RA 5CG2A 3ZDDA 3F74A 3QBVA 1FYEA 1NHWA 3F3SA 4X9XA 3L3BA 4RD4A 1UPBA 1WXWA 1EVQA 2G28A 4L9AA 4CQMD 2Q3FA 1WHTA 3GCGA 4ND1A 1MUUA 5ALFA 3EVEA 2Z5LA 4X20B 1IXSB 3A6LA 3DZHA 1CDZA 3SZGA 1JVNA 4FINA 3ETDA 1XTIA 4OYYA 1CZOA 5CA0A 1Y6GA 4BO2A 2JFBA 1RBQA 3WZMA 5BSTA 2ZR9A 5C4GB 3E81A 4JVLA 5EINA 4ZV4A 1CUYA 3F46A 1A9ZA 5CXXA 1YIOA 1ZEJA 3AZOA 3BCHA 3UAGA 1EGMB 3KAPA 3LUCA 1Y5RA 1C3JA 2BN4A 4B6QA 2B30A 2HA2A 3BH7A 3S68A 2VWPA 3IVGA 1R88A 4FUQA 2H7YA 4U00A 4ARUA 1FNDA 2PV7A 5KQPA 4YO8A 2BFAA 2FDRA 2UUPA 3L5OA 3T7DA 4CLRB 5KNCA 2QL9A 3QV1A 3WMRA 4GX5A 2OAEA 2X9LA 4YJDA 3QXHA 4F1WA 1QRUA 2X2FA 3E9NA 4GKJB 1B15A 2DQSA 3BJEA 1KYXA 2X0IA 1T0PA 2HQRA 3R5HA 2HX1A 4TL9A 2AMVA 1MNQA 1KJQA 1J1ZA 1LK7A 2NZ8A 4BFXA 1Y63A 1R3DA 5AM4A 1N5DA 3S55A 2JGFA 4NG4A 1BROA 4TS9A 4KPUA 1MB2A 1PYDA 3UA4A 5EN4A 3THWB 5ITZA 5LSAA 2FR8A 3TTSA 1XG5A 2VYVD 4HQNA 4P6VF 1UMCA 1KQPA 2BDUA 1GRVA 3A04A 3ZHSA 3T1YB 1GPNA 4RY8A 3SMVA 3K9QO 3NTVA 4B83A 1YR2A 5BUZA 5JBIA 3R4CA 4BO9A 1ZIDA 4DEXA 4ERXA 4UFPA 2N1BA 2HSEA 2VBGA 1O6ZA 3R44A 4BQPA 3IJ5A 2X7HA 2Y99A 3UC5A 1YWGO 2EKZA 3EA0A 3KCNA 5E3IA 3N2KB 2EG5A 4TM8A 5JD5A 1UJCA 2W7TA 1AKWA 3FM9A 3GEGA 2F55A 3H87A 3E9DA 1U2DC 3DKPA 2WWWA 4QG3A 3OPXA 1QE5A 1A95A 5LOVA 5IZCA 3CLHA 4MKFA 4C89A 1H2WA 2QRZA 5DIZA 1J1UA 4Z4EA 1V1MA 5I5GA 3ZV3A 1SM4A 1U2SA 3R6WA 3MTEA 3W1VA 2A1TR 4TV9A 3KZOA 2MSWA 3C3JA 4RGVA 2LDBA 3KZXA 3BMCA 4NF2A 1G59A 3VH2A 3R5JA 2DLDA 2VBIA 2VHZA 5IBQA 1R9GA 1XP8A 2DUWA 1J8VA 1N1GA 2MU1A 2XKAA 3VDRA 1QTIA 1ZG3A 1IUKA 3C8DA 1V2HE 1P5JA 4K6HA 3WRVA 2BFDB 1IIRA 1KK1A 1X15A 3FMPB 5BY2A 2EFHB 2JIDA 2PPVA 2PXAA 5JSKA 4DHEA 3W7VA 3KQVA 3W7AA 3X2SA 1PNRA 4KE9A 2H4FA 5IAOA 1ZMBA 3ABRB 4M8SA 1GR0A 1JHDA 2QRNA 1PT6A 2WD7A 2EX0A 2CVZA 3EDQA 4O2AB 1N2CB 1ZWKA 3KSZO 4FYYA 1Z0DA 4O1MA 2SICE 4EL0A 2WSYB 2XSZD 1V48A 4NYMR 1V2GA 4P4TA 4WZZA 2E0IA 4AIIA 3EZLA 1GG2A 1ZQ9A 2UZ4A 2BGWA 4GXTA 1W5FA 2BZGA 2CMHA 2Q49A 3NW9A 4OAQA 3CTPA 2VTVA 4R51A 1R0LA 4DLXA 2CYBA 3I9JA 5FPYA 5BVHA 5ICMA 2C8LA 4ZGGA 4B3BA 1AKNA 1IH8A 2AA3A 5ES4B 5SY6A 5U4QA 1RMYA 3HKDA 1KORA 2NO6A 2HPVA 1OWLA 4RPLA 2DECA 1C0KA 1WCIA 2GETA 3GP3A 3LA8A 3P9SA 3UJCA 5J2UF 4BPBA 3SQXA 5AOVA 3L77A 5AW9A 4JITA 3PE3A 2V7QA 1N9GB 2GN1A 2O8FB 1DC4A 4W5QA 1PZGA 3AT1A 3F4LA 5IJ9B 5LZ9A 3DDSA 4ZVQA 1E2MA 1LF0A 4Q21A 3LBNA 1BA3A 3KKZA 2BE7A 1UIRA 2F48A 5KU7A 3EHEA 4XSGA 5LU9A 2WWIA 2ADMA 4ZHQF 1JTVA 2I4TA 3IR6A 4CKCA 5FX2A 1AO3A 2XGSA 1UAAA 2JJ2D 1KDRA 2GESA 2IEBA 1DDOA 2JJ8A 3DPUA 1OBHA 3STYA 1Z0IA 2BF4A 1OFHA 1LGYA 2H29A 2LKCA 2X5OA 2ZR7A 3O9MA 2JD1A 3OEYA 1NYTA 2ET6A 4BQSA 1IBMB 1TM5E 2GO1A 5JMOA 4HZGA 3D2BA 1LI4A 3OE1A 5JEDA 2DY1A 4FDMA 3BFPA 4ZYLA 1UXHA 4MHOA 1WP9A 2V5AA 2AE1A 2OUIA 5F7OA 2YW9A 2XDYA 3PEUA 2Y66A 1INLA 6REQB 2NTJA 3PXUA 1K2WA 3K09C 5DLDA 3GJ3A 4U5XA 1P4AA 3GY0A 4XWGA 3SZ3A 2PMWB 3WYFA 4F84A 1PR0A 1PHPA 4HX2A 4TRMA 5DULA 4RDCA 1OQAA 4LDQA 4Q1BA 3TOZA 4ND8A 4GI1A 5DX0A 1DOZA 1VHDA 3QFHA 4ONEA 1RP1A 1FLAA 3BCRA 2VZ0A 3P9CA 3C4QA 1TU0A 4OBWA 2BFFB 3DW3X 4C7MA 4YRZA 4OXYA 4W5OA 5F5XA 4LV5B 3NEYA 1E2GA 1UBOS 4MQEB 3OI7A 5FV7A 5EIEA 4JKYA 3PC7A 3PXGA 5HS4A 2GBPA 3E03A 3GJ7A 1ONNA 2FN4A 5H5JA 1L5QA 3U4QB 2W2VA 4JDPA 1NC3A 3TQTA 1I4TD 3MTGA 2ZRAA 3MOIA 3QMVA 4FDTA 5B6PA 3LNTA 3ZK7A 3Q6IA 1G7RA 1CUUA 5JCXA 1U2RA 2PVPA 2R65A 3TRIA 2ZB4A 5AKXA 2AMJA 1YA8A 3U7IA 5JANA 3VRHA 5AW2A 4GFDA 3NX4A 2PYZA 4TMZA 3FOBA 2VZLA 2PNJA 5BXQC 1QORA 2LDXA 2RG7A 1AGRA 4LDZA 3B3QA 4MA4A 2PS1A 1MC4A 3OBBA 4DQUA 6YASA 4ZOEA 1RYZA 3R3HA 5EIXA 4LZWA 5GV7A 2P3LA 3JSXA 3GLUA 3WISA 4IDPA 3HCEA 1A2OA 1P2SA 2P9GA 2QJFA 4OL9A 4UM8B 5BOSA 2IXBA 3BS4A 4FWIB 4JJEA 3SQDA 2H57A 1QYXA 1DTSA 4C2UA 3AIOA 1EXMA 1V7CA 2QQ5A 1N0VC 1Z17A 3B78A 4QQ8A 4R1PA 4UHDA 4A6XA 3P4YA 4RH0A 1OW3B 4YH1A 3RRZA 3RS8A 1RBZA 2ZIFA 3CRQA 4YCSA 5CDHA 1GTZA 4R05A 2PUCA 2CNLA 3NASA 4JP3A 4AB1A 1E1QD 3SHQA 4LV6A 1RZRA 4PC3A 4TMWA 3JWHA 1HF3A 3E84A 4GOKA 3ZBQA 5IJWA 2N1MA 1LPSA 1VGRA 2C2GA 1JB1A 1FFEA 1RQ2A 2CWWA 2F2TA 1CUFA 3BB1A 3Q15C 5DWQA 1WQ4A 2ZUVA 5EIHA 1PN3A 3ZZUA 4EHNA 4YUWA 1QK5A 4GS5A 4O2BB 4PYNA 4FHGA 4Z6KA 3W8DA 2ATCA 3PWKA 4JJ7A 4U2BA 3LL4A 3LX5A 4EW1A 1VPWA 2DTDA 1FQJA 3EE6A 4JLOA 4DZRA 3L4SO 2GSWA 1YHNA 2X5XA 3AKZA 3UYLA 1I7PA 1XXHA 4AJ1A 3GD7A 4DUPA 1DTWA 3FOAA 2QJTA 4UHBA 4ANFA 1ZM3A 1TTTA 1IRXA 5EUMA 3AJRA 1NXPA 3ICEA 3FFWA 3BTUA 2FEXA 1WUJS 2HAEA 2JIBA 2QR3A 5EZYB 4HOYA 4I66A 4CQMB 5A2QA 3ZGNA 1KOGA 2YV5A 4Q01A 3N2GA 3FNRA 3VNQA 3SJ7A 3VYWA 1ZPDA 5DHPA 3GOQA 3W8FA 5KYXA 2X0KA 1QLHA 4PYOA 3CG0A 4LBVA 1DBRA 1V9SA 2GYVA 1I0ZA 2Y4OA 1NULA 3GZNB 3QU4A 4GOXA 1RYDA 2BSAA 5DRTA 5JZOA 1CR4A 3TIIA 3D54D 4RYLA 2QN7A 1QZ3A 5AHRA 4JOBA 1USKA 4BO0A 2BBOA 2QN1A 4L8WB 4P3KA 3QEKA 3ZY5A 4V2IA 3PB3A 2XBLA 4EG3A 1RRMA 3IA2A 3AINA 4NU6A 5A3SA 1IBKB 2R7NA 4XCVA 1XN4A 4M7RA 2ZUUA 4IO1A 4BJ6A 1GPMA 1IZYA 2XJ9A 4KCGA 1JVBA 2P3SA 3TRFA 1G16A 2VRCA 1Y3HA 3QVVA 4K81B 2IDZA 4KYTA 4PX9A 3Q85A 4I9UA 1O6FA 3T8YA 1M2WA 3JQBA 3GLRA 5IT9A 4MCAA 3CLTD 2FEWB 3HVIA 1YKSA 2P1RA 2FF5A 4BFSA 1EE9A 1PSWA 4WESA 5EPEA 3CH4B 4HGQA 4MQMA 2IZ6A 2OORA 3DE0X 4B2YA 1BH6A 1XAJA 3D3KA 4MUHA 2BKUA 2OQVA 1C9EA 5ETJA 4M54A 3K4QA 3T5TA 2DWCA 3SS9X 1LDGA 4YPVA 1FXSA 1P2FA 3PC8A 4PNHA 1ACMA 2HGSA 2OHFA 3I9LA 1VA4A 3VVBA 1KVQA 1Y1QA 2RC6A 3KYJB 1L7BA 1R16A 3HL4A 2Q6VA 3IFSA 3OH8A 4NMHA 2JAWA 1PR4A 4UVGA 4D02A 1F2TB 1VHJA 2VJQA 3ZXUB 1PWYE 3V2GA 2NXCA 4CQLB 2JFXA 2EDCA 2XQFA 3P8ZA 5B55A 4G97A 1E6UA 4G8CA 2FWAA 3R8CA 5EFZA 1ZCZA 1LB1B 1U8XX 2Z09A 2E7ZA 3T38A 1H2YA 4PICA 3HBJA 2AOXA 3CQ9A 3IT1A 3BL5A 4DEYA 1JAZA 2HT1A 1CK4A 3ENKA 4R2KA 5F1KA 4NJMA 1D0IA 1EUDB 1T5TA 3IXQA 3NTRA 2I5PO 2W6ID 3L7AA 3KQOA 5L40A 1V11B 4EGQA 2G1JA 5FHRA 1PEDA 3V34A 5EEGA 4X6UA 3LRPA 1E9VA 1GNRA 2C2ZA 1U0FA 2WJGA 4N0QA 3TOCA 3GDHA 3HDJA 4WH0A 3QBJA 1LLUA 4ER6A 3TZ6A 4XDGA 4BVBA 3RIHA 3PNVA 4KP7A 1FRFS 3CF2A 1OXUA 2LE0A 1JMYA 1WUIS 3IVMA 4IRUB 4OGWA 1A27A 5EC8A 3LVRE 5F5NA 3QEAZ 4FEAA 3LPNA 1Q0ZA 3D8UA 5FOWA 4UNRA 1FSZA 4V0OA 5JJIA 1OC4A 4Y9RA 5BOVA 4PZ9A 2JC3A 4QPPA 1JG6A 1RWBA 5D86A 1E1RA 4ZRNA 2O2IA 4DZZA 2I6TA 3A14A 1N78A 4XGQA 1ZRSA 5BN1A 2PUGA 1LPMA 4BGEA 1G20E 2PAAA 4AZ0B 4QATA 4CZ2A 5I01A 1Q1NA 2HFJA 2DFVA 2I0FA 5FULA 3KPYA 1OH7A 2HHHB 3FYUB 3WYAA 5I8ZA 2FW1A 4LECA 1CDEA 2PX8A 1MOPA 3ZQ6A 3R0XA 3ZS9A 5B58C 2V54A 1XJ5A 1ZONA 2ZTHA 4OHUA 4PCAA 2PSDA 3QE9Y 3RAGA 1LC3A 4CDGA 1XR3A 4I50F 3K0BA 4RHTA 1YQEA 1CS4C 1GNLA 2CXPA 1E2EA 2OY0A 3CT4A 1CRZA 2QOEA 3D6FA 3HVJA 3DMDA 3GGCA 4UC0A 5EFOA 4A82A 4DSZA 1FIUA 5JQGF 4WLOA 2M6LA 2Q1YA 4H9GA 3UMRA 4ARAA 2BJHA 2G0NA 1LBTA 3WK8A 4BFLA 1T1JA 1BMQA 2A1UA 4JA2A 1QO9A 1QE3A 2RAVA 3DVRX 5KAMA 2ZE5A 2V5UA 2Q7DA 3T06B 4U2DA 1ZGGA 5E0OA 5FADA 5E3JA 4MV1A 2H65A 1D7AA 1L9KA 2YVKA 1D4OA 1ZUWA 3MWYW 4YV0A 1UMBA 3ZU5A 1LPAB 1T3ZA 1ZIXA 2QA5A 1Z12A 2ZG6A 1ZIOA 1LWOA 3MWKA 3UJ3X 3A6FA 3K7EA 5MGNA 4KR3A 2HW8A 4MW5A 1KDOA 1KERA 1T0JB 4PAOA 2G4LA 5CMLA 1DOHA 3T5BA 3ZWPA 3H1FA 2FEKA 4DE5A 3PX3A 3X1MA 2QGZA 1FUKA 1A1SA 1JL3A 2CDRA 3LUGA 3SOZA 3HU2A 1I9GA 3DGEC 3MCZA 1ZWLA 4PG4A 1M83A 2WILA 2IKQA 2PWZA 4LXUA 1FBNA 2ZT8A 3T9FA 1Y42X 3T1QA 5HZHA 4NQRA 1U1CA 3S8YA 4BWFB 2G8LA 4IAOA 1CUJA 2H2FA 3DO6A 1YC5A 2JLYA 2O20A 1I51A 1DXHA 2WOOA 3GA0A 5JW6A 3ONDA 2QYOA 2VP9A 5CXSA 4TVSA 5ELLA 2WG1A 1K6IA 4LXYA 3ZIAD 3X1ZA 4G0OA 2D7CA 2C58A 3IILA 1YVRA 1YQXA 1DT3A 1PGJA 3FWNA 2Q45A 4JB3A 1E62A 4RKFA 4M46A 1HG1A 1KYYA 4HWTA 1N3IA 2WNSA 4MUYA 3C3XA 4B4KA 5G3ZA 1U8EA 4QHSA 3PVSA 4C0SA 5K7SA 4WDRA 1T3GA 4H3HB 1E2DA 2WC1A 3KIPA 3RROA 5EXDA 2ECKA 3F2VA 2BAGA 4RZHA 4ZP1A 4MIKA 3A3YA 2Q2WA 1GZ4A 2UDPA 4Y3UA 3OFNA 1ZLYA 5IYZF 2GXSA 4MYUA 3D7MA 2FX5A 3WGQA 3EF1A 4GX2A 4IDQA 2C8VA 2D7JA 4Y0AA 3VO8A 4FGJA 4LFCB 4OQXA 2BMFA 3PHCA 3GFSA 1N1MA 2E5WA 2X5NA 3RVBA 3D9QX 1FU7A 1WKBA 2WFAA 3S1AB 3UN1A 4F38A 3QQPA 1OLXA 5KYUA 1NKTA 4OI4A 3T3MB 4EY4A 3RVPA 5JXGA 4CNQA 4IXNA 2Z1NA 4UPVA 1U5BA 2VCYA 2BEVA 3I4FA 1AB5A 5KTKA 1KRXA 4LYHA 1JDTA 2ECPA 5ARDA 2AEEA 1KSHA 1PFUA 3P9XA 3F49S 1YZYA 2HRBA 1W4RA 1JA1A 4KAJA 5K3SA 1R4NA 2NVUA 2Q28A 2CBZA 4DA0A 2C97A 1SQ0A 4HNQA 4EUFA 3B1ZA 3U80A 3BH0A 1SOMA 1DCKA 3NIWA 5L51A 2C92A 2RGBA 4ZHSA 4BO5A 1M0SA 2CCJA 3N6XA 2DRIA 2RONA 3KQYA 3OEED 4CM9A 1TPZA 2O57A 4CU5A 3F6CA 3RS2A 4XX0B 1UXGA 4UDYX 2F3QA 2QVZX 1YRQA 4ZCQA 1ZH8A 4G8BA 4LYFA 1UQTA 1JMKC 1SBNE 2AMYA 4UOEA 2A5YB 4HNVA 4XIGS 1WBBA 2XYQA 5E8JA 3SX4A 1QXSA 4BMZA 1GSIA 2J4DA 2OXRA 5F3DA 5KX5B 2CFCA 3U44A 2M32A 5DHFA 3BZWA 3KPJA 3DXZA 2EQBA 1XRPA 3ONWA 2ACKA 4HNRA 3U7QB 3OZFA 4QEKA 3WGMA 2ODEA 4UPDA 2PL9A 2NXEA 3M8KA 5GWXA 1ITZA 3SHFA 4Q3NA 1ZXBA 5CTAA 4YEDA 5FI3A 5JDIC 3L7LA 2WYOA 1APBA 1AMUA 2DHEA 2F3TA 3P52A 4YCBA 1WF6A 3K9NA 1XHEA 4HATA 4N7MA 4NAVA 4GE0A 4YDSA 5TSDA 2XKKA 5C46F 2UZ1B 4RQUA 1CUDA 1ZP6A 5K1SA 1X3LA 3REOA 3QFTA 1OGJA 3TPCA 3HB7A 4MCJA 5FWYB 4HB4A 2WQ6A 1I6WA 2CXXA 1RNLA 4WINA 4N54A 4UD6A 5TS2A 2DMRA 3SNKA 1II0A 1UC5B 2YZKA 3R20A 2QSUA 2I71A 4PWZA 3TZLA 3L06A 5B30A 1QAQA 3IDOA 4RIGA 2QTAA 5CM2Z 3BYZA 3RRFA 1F60A 4BMXA 2K2WA 3ACDA 2JARA 5DIFA 3SJUA 2YS6A 5IEJA 5EKXA 5EE1A 4IPTA 5IASA 3AFIA 3SHWA 2QBYB 2YC4C 3AM4A 4RSRA 5DI9A 3DVAB 4ZC1A 1N2EA 1Z5PA 3M2TA 3QPBA 5CIWA 3E7XA 3ZHVA 2FZEA 3P9RA 1QQBA 1DJMA 1CHNA 3SE7A 1M2KA 2VZ9A 3O3NB 4LF7B 4CV1A 2Z8ZA 3G7UA 1WAMA 1DEKA 3MGKA 3RR2A 2FWJA 2ETVA 2I2WA 1XAHA 3AJEA 3TLCA 1L4GA 1B42A 4QGSA 2XTJA 2FMIA 4B3MB 3BIWA 3DTNA 1A2QA 4LJ6A 3RFVA 1VECA 2GTIA 4V24A 4R68A 2W2LD 3AHHA 3ND8A 4DRXB 1QS0B 4QOJA 2YJGA 5JALA 1MO4A 4LBYA 4CKBA 4HPJB 3WGNA 3Q6MA 1IJFA 4NWIA 4G8DA 4HV4A 1KAEA 3H4TA 3NUGA 4N8EA 5DLQC 2QR5A 1UJBA 2ZUBA 3B82A 1V41E 3AR6A 3KZKA 3BGOS 1F9AA 1E1YA 3OJLA 3VZQA 1L5GB 1EFVA 4DDKA 2X0FA 1FUUA 2OBFA 4KQ2A 2ZBGA 1SHKA 5DTMA 3AJ9A 1EVIA 1QCDA 4HSEA 1UMDA 4H0CA 3GLIB 3ZU6A 2P11A 2OCIA 2O7VA 1BS1A 1P7ZA 1VE5A 1NXVA 3TW8B 4W8HA 4TS3A 1KK2A 3AETA 4HBGA 5CM8B 1EVKA 5LXTA 4XARA 4GE3A 2VTKA 5GZ3A 1SMKA 2ZB2A 4IJQA 4J4HA 3GT3A 2VXYA 4PHCA 1F5NA 4IGFA 4XYGA 1P8AA 1NVGA 3DLTA 3H1TA 2EFYA 2LR0A 2YYZA 4UMVA 2O06A 1PJTA 4C03A 5AVZA 1X7ZB 2QYTA 4LY0A 2QSZA 4RH3A 4UBIA 5DKFA 5HQ3B 1I3KA 1H2XA 4QDJA 2EFJA 3UQZA 1DQZA 5CRIA 1N5OX 4LI0A 5BVGB 5B4TA 1WVGA 5DOZA 2JHCA 3L4BA 2Y6VA 3C6YA 3GFOA 4D25A 3JQ7B 2O1EA 3HB4X 3C43A 3DT9A 4QVIA 1U3WA 3T3IA 2HXSA 4MP6A 1S8FA 5DXFA 4NECA 2QN8A 3ADOA 1Z2EA 1W4BA 4DR7B 1G8GA 4J1QA 3V7UA 2CXOA 4A5SA 2II6A 1X38A 3RDPA 4TPKA 3RUIA 3Q8MA 3V2IA 1VQ1A 1GFWA 1US8B 3C3PA 4PRZA 4X3CA 1NQ5A 1Y7IA 2AFHB 2V0GA 5EWMA 3G0OA 3MFYA 4LJ4A 1M0EA 4TLAA 5EA2A 4ZC8A 1D1SA 1PCXA 3UTCA 4RO0A 3T3GA 4TKVA 3ZGLA 3DXXA 1DEXA 4K88A 1SUBA 3KJHA 1EHIA 3RUHA 1M8FA 1LI5A 1QV6A 3NTOA 1Y3DE 4CG1A 4Z7QB 2IYNA 4X84A 4YRNA 4FOLA 3T9CA 2H1VA 3IBFA 2XB8A 3LLMA 5DM2A 4EZEA 5BUSA 4EW2A 4OI2A 3EG9A 4D6YA 2O54A 2POQX 2XRFA 2Z83A 5B5SA 3QY9A 3GC6A 4I9NA 2CFIA 1H6DA 4LFAB 5K0SA 3IKVA 4GPEA 2WWVD 2ZI9A 3U3ZA 2DXIA 3CGGA 3HDYA 1PW5A 5AHXA 3AOGA 2AW5A 5UKDA 4A8JC 1XZAA 2WMOB 5KDLA 1BW9A 1YU6A 5KIAA 1YFZA 4DLZA 5CEEA 4BFCA 2QX9A 3W9BA 2CSXA 2JL1A 2A5JA 2VIIA 3BQMB 4LC9A 1A76A 1OY1A 2QE7A 4GL4A 4YK7A 4G5RA 3T4UA 4DDUA 4I4LA 5TVGA 3T7KA 4QU8A 2VP4A 1QHGA 2C03A 2RE8A 4G5OA 1K8YB 5JEEA 1HYBA 3FB4A 3O1IC 3ORRA 3R4VA 1UJ2A 2H7CA 2HC9A 4J0FA 2AUTA 4N9WA 5AT1A 2GN8A 3KTDA 2D8MA 2VYFA 3AF1A 3MAAC 3CSSA 5D51S 4UTOA 1I1HA 5CT4A 4RDIA 4WERA 1OI7A 1Y4DE 3ZW8A 4EHFA 2JEYA 4CT5A 4Z54A 4P86A 2O8DA 4FIDA 1GADO 2HYDA 2ZP1A 3PTZA 4H0FA 1JFSA 1B26A 4J1TC 5IDWA 1MZVA 3O8BA 1LVGA 2CJWB 2WTAA 3HI4A 5KEIA 3S2ZA 3EJWA 3P2KA 2FZKA 2ZTLA 3EEBA 3DMTA 3CUTA 1TGVA 5FFNA 3H1EA 1XWFA 3H0KA 3DBVO 3BJIC 1XZBA 3G5UA 3PXEA 1KMHA 2WUDA 3VXKA 4J03A 2X0NA 4EZBA 5F51A 5P21A 4J94A 1JRLA 4DQDA 4MULA 3LXRA 2IK8A 5LLTA 1WKCA 4P7KA 5T67A 1U2PA 1JHRA 4DPLA 1U11A 3K6RA 4OLBA 3K5WA 3H2HA 4NS1A 2PZMA 1IHOA 3PUVA 3WADA 1RTTA 3U1TA 5BNWA 1CULC 2ZRFA 2BGKA 3QGMA 5EJ5A 5LJLA 2G09A 1C0IA 2A9RA 2XEXA 3BL6A 5JG7A 5IJ0B 3PSAA 4IS2A 4F9EA 1J5XA 3M70A 4I6JA 4YT5A 4NXMB 2PBRA 3K16A 4ABYA 1Q1QA 4DQKA 5HNKA 1U94A 1DADA 1NY5A 5FI0B 4MS3B 4IBOA 4WT7A 4FKBA 4K3UA 4ILEA 4DV7B 3RT1A 3S81A 1JLSA 3GLFA 1PK8A 4MLDA 1SG0A 1PS9A 4JB8A 3CWCA 3CEAA 1GNQA 1UKBA 1QVRA 4R5HA 4Y2RA 1RRKA 2GNOA 1SOWA 2G36A 5LP6F 3KXDA 4KYIB 4FFBB 1GR1A 1AN0A 2VT7A 4M9UA 3SS7X 4DDTA 4M8IA 5JRDS 1Y8QB 1OAAA 1BEEA 1GAWA 3KAQA 1OILA 1P9OA 4JASB 1KI1A 4DA7A 5ABPA 1C1HA 1TX4B 1EFTA 4V0RA 4AG6A 3MCTA 4ZODA 1I2CA 4ZALA 5K2OA 1K0FA 4R6XA 3BF8A 4PZLA 2YIJA 4WEQA 4PR3A 1HNWB 1O57A 3GLSA 3ZWMA 1NVVQ 4TTIA 2BTOA 1T9KA 1GU7A 2L2QA 4IOLA 4NG5A 1GUBA 2FW9A 1II8A 3DUFA 2IGBA 3HCAA 4LWOA 4R7ZA 6AT1A 2NSLA 3EVFA 1WCXA 2PBLA 4CF7A 5JMWA 2HCFA 2G5GX 1P4SA 4O4JB 3TTUA 4E70A 4WXHA 3UV7A 2O48X 3IJEB 4UM7A 5HF6A 4AD8A 3ANTA 3NYWA 2HA3A 5HKAA 1V16B 4FXOA 1MTZA 1QRRA 2P67A 3T4XA 3TL6A 3P27A 2YR0A 5JOQA 3WGVA 3SEFA 3B3JA 1V95A 3NM5A 4UE6A 2WHPB 2PZFA 2VJOA 1Q7GA 4OL0A 1JEQA 1T2CA 1SZPA 2C9BA 1JYFA 2IEYA 3EXHC 1YS6A 2QKYA 4NZPA 3X43A 4OOEA 1QH1A 2HU7A 3X2FA 1CZHA 3H2KA 2HHJA 1OREA 1OWMA 3F7TA 3HB5X 2QY6A 1KO5A 1RP7A 4JZKA 5LZ8A 3RRNA 3CUYA 3K0CA 4BKQA 1ESCA 5DSTA 4K5QA 3GU3A 3OIUA 2PKWA 1EJ0A 2GAIA 2Q1WA 1L1FA 1Q17A 7MHTA 2YFKA 3B38A 2XI4A 3QX3A 5JAUA 3PUKA