2CDCA

Sulfolobus solfataricus glucose dehydrogenase 1 in complex with nadp and xylose
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
366
structure length
359
Chain Sequence
MKAIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGADREIVNGKLGKDFLVLGHEAIGVVEESYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHGEIKIRILWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis of substrate promiscuity in glucose dehydrogenase from the hyperthermophilic archaeon Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
molecule keywords GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE, DHG-1
total genus 123
structure length 359
sequence length 366
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.120: Galactose 1-dehydrogenase (NADP(+)).
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cdcA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2cdcA01
3U0BA 1LQTA 3QJ5A 2C82A 2EIHA 3WNQA 1C1DB 1GL3A 1H5QA 1JQBA 1R37A 2GASA 4NZ9A 1DC5A 1LU9A 5JAMA 4YTEA 5MGBA 4BV9A 1IL0A 3F1LA 3PYXA 2CZCA 3UCEA 1R0SA 4GGOA 1ZCJA 5F21A 2OP1A 3KYCB 4MIOA 3U4HA 2UAGA 1C1XB 2CUKA 5CFZA 3PTZA 5JS6A 3PFWO 1N2SA 2DFVA 2NM0A 2Z1MA 3Q9NA 4ZQBA 5G4KB 4B4OA 5HRUA 2C54A 3NT5A 5LCXA 3WFIA 2P4QA 3DXFA 3GN2A 4NMHA 4CM4B 5BQFA 5B4VA 3Q2IA 1OOEA 1U4SA 4HX5A 4CLXA 5A02A 1ZH8A 1UAGA 1UXHA 4BMSA 4YAJA 3S8MA 1PZHA 1PJ2A 3WQQA 1XWFA 1E3SA 4XGIA 3WQSB 1YXMA 1ZNQO 1HYHA 1ZMOA 2VQ3A 1E1LA 2BFMA 2G5CA 4J9UE 3UAGA 1X15A 1KC1A 1HSZA 3NUGA 3QY9A 1K5HA 4R1TA 5IZCA 3KM0A 3FTPA 4CMCA 4J0FA 1JDJA 3ADPA 3GA0A 3JSAA 2GERA 2P4HX 3G79A 3H5NA 3RUHA 1BXZA 4IUYA 4E33A 2FR8A 3L9WA 4YJGA 3ICCA 1FJHA 1Z75A 1I32A 4OL9A 3RBXA 1CEQA 2AE1A 4ZQGA 2O3RA 2EXXA 2F1KA 1IUKA 5CAEA 2PZJA 5JE8A 5LDHA 3ZU3A 4AJOA 2X1HA 3EAGA 3FWZA 1LTHR 4ALNA 4EEXA 3GEDA 2X9NA 1F12A 1NASA 3UF0A 5GY7A 3E6AA 2QYSA 3ULKA 2Y1OA 4OXNA 2HK9A 2PGLA 3O4RA 4NQZA 4D3SA 1E7QA 3JYPA 2JFHA 3M2TA 4BNJA 5IAAA 1GQYA 4BMNA 3QVSA 2Z95A 1KVRA 3AOEC 1IHXA 5I8WA 3CUKA 2F00A 1BGVA 1ONPA 2P9GA 3KSUA 3MWEB 4BNVA 4E30A 5ITVA 3RUIA 4GWGA 1WAMA 4GLLA 1UXGA 1HZZA 1QV7A 3BXXA 4TSKA 2OZPA 2O3SA 4I5FA 1M2WA 5IG2A 5ER9A 1OAAA 4P4GA 1LC3A 5TJHA 1H2HA 1T1SA 3AU8A 1I24A 5IZCC 1VJ1A 3S55A 3ANNA 1UDCA 2AEMA 3AOGA 4LSWA 1PSDA 3WLFA 4GSLA 1H6CA 4MPDA 2E37A 1H6BA 1V9LA 3RBVA 4Z3KA 5LC1A 7ADHA 2C5EA 1W73A 4ND1A 1XG5A 3CH6A 4J6FA 3AFMA 4BKUA 5L45A 3BYZA 2I66A 3GGOA 3PEFA 4KZPA 1NWHA 3IL2A 4XR4A 3KHUA 1RM0A 1H6DA 3VH2A 1I3MA 2EGGA 3JD4A 3V8BA 2YYYA 1DPGA 4A26A 4GAEA 3BMCA 1X7GA 4RDHA 2V6GA 1X13A 4HXYA 3LT0A 1DLIA 5G0SA 5U9CA 3PHIA 1MB4A 1T2CA 3LQFA 2D5AA 5DF1A 2E48A 1V6AA 1J49A 1FDUA 2I6TA 1IY8A 4RJTA 2QX7A 3AI1A 3IKTA 4CUKA 5HA5A 1LBEA 3PP8A 2D5CA 4UUPA 3EZLA 3ENKA 4XX0A 2Q2QA 3FCOA 1OI7A 1SPXA 4I8XA 3ZNOA 3OP4A 1UXJA 2FN7A 4RPJA 1F14A 5CP8A 2J5QA 4QECA 2PWZA 2W8ZA 2W98A 4WPGA 3ZWVA 1QMGA 2VZ0A 5JMWA 4BO1A 1Q1NA 3DBLB 1HLDA 3NDRA 4TWRA 3W8EA 1U28A 1ULSA 4G5HA 4OQZA 5T8KC 2EJVA 5EQDA 4CMIA 3JQ9C 4IMPA 5KJ6A 5IF3A 4O1MA 3I9MA 1ZSVA 4YDRA 2DPGA 3GMDA 4GSKA 3DEYX 4PCVA 5KKAA 4CMIB 3D0OA 4EUHA 1PZFA 1D1TA 1UZLA 3AK4A 3EHEA 4ZU3A 2OMEA 3OJOA 5A3JA 1C0KA 1SEPA 3AFNA 3F5QA 4PG4A 2BFOA 5TGDA 4P4NA 2O3QA 2OP0A 2C0CA 4MVJE 4ZRNA 1XKQA 4XZ3A 3S2IA 2FWMX 4JXKA 4R4JA 1DIAA 1LLCA 4YJHB 1ADGA 4QFCA 3DOOA 4IIUA 5F5LA 4OH1A 3VPXA 5EN4A 1QLHA 3HSKA 3PGXA 2H5LA 4UUOA 4BKQA 4EITA 2NVWA 2RCYA 2VYNA 3G49A 4H15A 3RC2A 1A9ZA 2C07A 1DAPA 3H3FA 3L0DA 1WDKA 1R4NB 3FN4A 1BXKA 5EESA 1K6JA 4OHUA 2Q49A 4OKIA 4CM4A 3BA1A 3W4KA 4CV1A 3U4CA 4XYLA 2V6FA 1VSUA 5TQVA 4LK3A 1NNUA 5IN5A 2HRBA 1AHIA 2Q1UA 3C8MA 4BNZA 1QRRA 4U6QA 2X58A 3FNEA 2RH4A 1N7HA 2HO5A 3SC4A 5IDYA 4KDFA 4NBTA 3L6EA 1HE2A 1JW9B 1NR1A 1ZK2A 1O6ZA 3ZWNA 2AQKA 4BHTA 4F3YA 2NU6A 1YDEA 3Q0EA 4HFJA 5IXSA 3B6ZA 3A1NA 5EMHA 1OC2A 4PLHA 1C14A 1E3WA 1I33A 4P4LA 1ONOA 3E9QA 3ONFA 1B14A 3IKVA 4S3MA 3O38A 4R5MA 1GYPA 1QG6A 2PKQP 3PHJA 3NJ8A 2CNBA 2WYUA 1KS9A 4Y6SA 5L7YA 3U62A 3QV1A 1XELA 1ZJYA 3LK7A 4ZQFA 1XU9A 4IDGA 3NDIA 4AJJA 2ILTA 3LVFO 3U4IA 3UN1A 1H2BA 1DB3A 1Z45A 2JCVA 4CMAA 2B83A 4OJNA 2BGKA 5G2OA 1P0FA 1U3WA 1Y9AA 3E9NA 1TI7A 4CM9D 3V1YA 2ZQYA 2VYND 4CR6A 1I0ZA 3GEGA 1YB1A 1E1NA 4XGKA 3NV9A 4BO7A 2UYYA 1I3NA 5EL0A 5ENDA 3GUYA 3OBBA 3VZPA 3KXDA 1DDOA 4W6ZA 4Z9YA 3GG2A 2C2YA 3FWNA 1WLYA 4J3FA 3TWOA 1ZMTA 2Y99A 4KP7A 3WGYA 2O4CA 4R3WA 1W0CA 1I3LA 4BNGA 5JY6A 4Y9DA 4AJ2A 4DTIA 3TFOA 4R01A 2JL1A 1A5ZA 4PLVA 2OO5A 1XCBA 3UGKA 4ND2A 4EW6A 3RC1A 2JAHA 4JX8A 2WMDA 3RI3A 1HDRA 2OBYA 1UJMA 3RASA 1QR6A 2ZKLA 4FB5A 1Y8RA 2FPIA 2XOXA 1HT0A 1Z7EA 2OGUA 4ZQEA 2WTBA 2PZMA 1O94A 1GQ2A 4UVDA 4R69A 3VHRA 1Z82A 3HB5X 3S2EA 2YY7A 1IHYA 1XIVA 1K89A 4L8VA 4N54A 1ZBQA 3N74A 3JD0A 4FFRA 3C3XA 3RU7A 3VDRA 3OIDA 2Y93A 2WYWA 2YHUA 1K3TA 1TXGA 4OXYA 3PWKA 2EERA 1EZ4A 1Q7CA 2XF8A 1Q7BA 4UVIA 4WK6A 4MDHA 1B8VA 1DXYA 5G4KA 4OQYA 3R3JA 3H9GA 1S6YA 4NFSA 4FJ2A 4B4WA 5I7VA 4UEJA 5CEEA 4BB5A 2WM3A 2O3UA 4BNXA 4CLOA 3TZQA 4PG6A 2AQHA 2NTVA 2AA3A 5DOVA 5JDCA 3R1IA 3RCBA 3WLEA 4BKPA 1GV0A 1MFZA 4NI5A 4NJOA 4OXKA 1EEHA 1U5AA 1NVTA 4B3HA 1P74A 1PGJA 4QQRA 1C1DA 1NPYA 4HY3A 3Q3CA 1BVUA 3P19A 2VZ8A 1LRKA 3C1TA 3DMTA 1K6IA 4GL4A 5DCUA 1GD1O 1JKFA 1LI4A 4HUJA 5G0VA 4PZDA 4GKBA 3ZWAA 1GYRA 1PS8A 3ZNPA 1T2FA 1XLTA 2FR0A 4M8SA 3OJ0A 3PHLA 4W7HA 4JBGA 1GR0A 2PZLA 3DZGA 4YJFA 4Z9FA 5KNLA 2VOJA 1LX6A 4BQRA 5KVQA 1CQIA 1UUFA 4IQ0A 3S1LA 4MKZA 3TN7A 4Z9XA 4E12A 2D2IA 1LLDA 4RQTA 4JK3A 2CSUA 4D41A 3IOYA 1XGKA 1I8TA 4DC0A 3K73O 3D5TA 4YRBA 3EW7A 3GLQA 3FTNA 3M1AA 4FGSA 1DC6A 4MVJI 4R1SA 4E2XA 4J1NA 1RYEA 2NSDA 3KYDB 2D1YA 1GUZA 4DLLA 1TT7A 3ZHBA 3F1KA 4R3NA 2AG8A 1GPJA 2GRAA 4HP8A 3WGQA 1MXFA 1X7HA 5DZSA 3JQ9A 3LSYA 4FSHA 2P68A 2IXBA 3L77A 1VM6A 1U3UA 4RPKA 4UUNA 2C2XA 2QRJA 4OOFA 4DIFA 3GEMA 4NR0A 1OC4A 5KTKA 2Y66A 3PIDA 4B3JA 4Q3NA 3ICPA 5CG1A 2IE0A 1X7DA 2YHIB 4MVJF 1UP7A 3DL2A 4ONEA 5CHEA 2Y1CA 3DBHA 4MP3A 1YO6A 2A4KA 3PLRA 4RGBA 3JQ7A 4P22A 1TB4A 1GADO 3CKYA 4FD3A 1PL6A 3GNSA 8ADHA 5ILOA 4J7UA 1YB5A 4Q39A 3STHA 1VKOA 5DDIP 4IDEA 1R0KA 2E4AA 4WUVA 3W6UA 1M67A 1CJCA 4U8GA 2HK7A 4WOJA 1F8GA 4FS3A 3V2UA 2VCYA 2I9PA 2E82A 2ZB3A 4RPGA 4PZCA 5KJ1A 3H7AA 2SCUA 3KO8A 1K0UA 3GG9A 1ADFA 4NFYA 4WGGA 4FFMA 4RVFA 2B0JA 3C24A 4ESOA 5TT0A 3NT4A 4DC1A 4ZICA 3HB4X 4D0RA 4TROA 4DIOA 2FRDA 3AUUA 5CDTA 4M89A 3GVPA 3WGHA 4HWKA 1JTVA 1CQJA 4IDAA 4WJZA 2NVBA 3WJ7A 4D79A 2VT2A 1YJQA 3PJDA 1WWKA 4RVGA 4PN3A 3CXRA 4N18A 1Q2XA 1F8FA 4D43A 1JU9A 1Y8QA 4XD2A 5C3MA 3WTBA 2D0IA 3L9XA 2J3JA 3ZN2A 2PD3A 2NLOA 3BHIA 3BHMA 4GVLA 4GBJA 1DRWA 5JCJD 3B70A 1V8BA 3DBRB 3PQFA 5DULA 4YXFA 5IN4A 3ANMA 5KKCA 4DUPA 4YT5A 2JD0A 4E3ZA 1UDAA 1ZK0A 1RPNA 2FOIA 3H65A 4BUCA 2A92A 5EINA 1Q0HA 2DTDA 4N5LA 2CVZA 3DC2A 1HXHA 1C0IA 3JQEA 1DJNA 4CR7A 3ZU2A 5B1YA 1QXSA 5A5FA 3NTOA 3D3WB 2OFPA 1LRJA 4KQWA 4FJ0A 1Q0LA 3RKUA 2IYPA 2VWHA 5HS6A 1P77A 4UAGA 3ZV5A 4J91A 2AMFA 2VHZA 3BMNA 1CIVA 3GAFA 3KLPX 4CUZA 4LSMA 1WXDA 3BMQB 4FDAA 1YB4A 3GVHA 1NYTA 1KVTA 3MJCA 3DZJA 4BO9A 3OHSX 4ZA2A 2PGDA 3V2HA 3RIHA 3I9JA 1RM5A 2NV6A 4XB2A 2DU8A 4Z0PA 4FJ1A 1MG5A 4NNJA 2CMDA 5DBGA 1LUAA 4ZQHA 4LRTB 1TVEA 1A72A 4LISA 5C7OO 4FFPA 3DZBA 2X86A 3I9OA 2QG4A 3PRJA 3FNGA 4RLSA 4KMSA 3VPSA 3KRTA 4AFNA 3ZHYA 3WBBA 4CUJA 4E32A 1LQUA 3WR5A 5AXBA 1PGNA 4RO0A 2R00A 2Y05A 4W4TA 1A4IA 3Q6IA 1IYZA 1ADBA 3V2GA 5L7WA 3IDSA 5BNIA 3IC5A 2G1UA 1HETA 2POQX 2X5OA 4Y67A 3RAJA 4IQ8A 1ZVMA 5K6AA 4QO7A 5JCJA 4LCJA 3DFUA 5ILGA 4CMEC 4EBFA 1V3VA 2ZB8A 4X54A 1H9AA 3TL3A 1P1FA 3WSWA 3ZWBA 1YVEI 4W82A 1R12A 3K6JA 3WG9A 4BNTA 2YDYA 3ZH2A 1EUZA 1F0YA 1ZSNA 4W7IA 4RL6A 3WYCA 3JD3A 2ZJ0A 2QRLA 1D7OA 1HE5A 3COSA 4QUKA 3TQHA 4BB6A 1E7RA 1PS0A 4R1NA 1WPQA 4JQCA 4IDBA 1BTOA 1QP8A 4ALKA 3TRIA 3VH1A 3T7CA 1H94A 1Y81A 3RFXA 4CM8B 5A5EA 5L4LA 2ZJ1A 1T4BA 3SLGA 1NFRA 2BLLA 3FPLA 3HNPA 4IPTA 4NBWA 4ZRMA 2OUIA 1QYVA 4KTTE 3DMTC 4UVHA 3KOUA 3CZRA 3JQ7B 4GPD1 1F06A 4IY1A 4KWIA 5F5NA 6ADHA 1PR3A 5AYVA 3ITDA 5T67A 4CM6A 2CF5A 4MKRA 2Q1TA 3L4BA 3HUDA 1ZXBA 5F1PA 2VHYA 4PVCA 1TLTA 1PWZA 2PY6A 1P1RA 4XRGA 3A28A 3FNHA 5TF4A 1SNYA 2B36A 4PRKA 5JSFA 1D8AA 2VUTA 5EIOA 4ALMA 4LVUA 1R66A 3JD1A 4WLFA 4J2OA 3L4SO 1Q7GA 2VN8A 3T4XA 2VUSA 4K6CA 2AEJA 3KYDA 2H6EA 3OQBA 4OSOA 3H9JA 3T7EA 3CPSA 4GX5A 4DQXA 1VRWA 3MTGA 4PLYA 1HDCA 2B35A 3ZWYA 5JW6A 1Y7TA 5JLAA 4PG8A 4ALLA 2VNAA 2JKVA 3I9NA 1QYCA 4N5MA 5K0ZA 4Y6PA 2BI7A 2HMTA 3WSVA 3JQFA 2X22A 2I99A 4RORA 5DCWA 5JFOA 2IYOA 1MUUA 4P8RA 1T25A 2DVMA 3D5QA 3TZCA 4OKNA 4J2HA 4CLHA 3EGOA 2JD2A 3I6IA 2GN4A 1SMKA 2UDPA 5L95A 3DAFA 4WE3A 4EYEA 4YBZA 1YS4A 4F46A 4QT0A 3VZSA 3ANLA 3C85A 1Y9EA 2BGLA 4Z3DA 1BHSA 1VC2A 3BIOA 2VZ9A 2GCGA 1KY4A 1B2LA 4PLGA 2PGJA 1LJ8A 3K8ZA 3LT1A 2Q4BA 3ABIA 3ZWWA 1DHRA 1VSVA 1LDBA 4E5KA 4QTZA 1KOLA 1I36A 4I5GA 3VAZA 3ZNQA 4XDYA 1LDMA 1GAEO 3DQPA 3PVZA 3GZNA 3B1KA 2EWMA 3LT2A 3SXPA 2FY8A 2HMUA 2IEBA 4DPLA 2O7QA 3OJFA 5HWSA 2C59A 2EKLA 1HWYA 2P9EA 3IQDB 2PKQO 1OBFO 3JQ8A 1ML3A 4UVEA 2GZ3A 4EJ0A 5CDGA 4DL9A 4RVUA 3LC7O 5A9SA 2ZYDA 2HLPA 2X5KO 1GFSA 1LXCA 3MCVA 1MC5A 3UVEA 1X0VA 4ZGWA 1GZ6A 1QYXA 2WD7B 4DREA 4I1IA 5IDQA 3FSRA 1YBMA 5I9NA 3O26A 3INRA 3WJAA 5B4TA 4EGFA 1HYEA 3GVCA 3HHPA 2OORA 3HN2A 2NTJA 4H7PA 1D3AA 5FFFA 2B5VA 1J6UA 2EKQA 3PWSA 3OEYA 4RVSA 2BH9A 2FPGA 3MEQA 1B3RA 3LC1O 3NT2A 4IS2A 4HFMA 5EERA 1CYDA 4RPLA 3AUSA 5A05A 4AG3A 5G0UA 1RWBA 4MP6A 3K9QO 2CVOA 3GQVA 1NTOA 1AUPA 2FR1A 2P5YA 4B4UA 4DPMA 1PQWA 1DIHA 3TZHA 1JVSA 3EY4A 1AXGA 3BHJA 3F3SA 5FI5A 4BKRA 1DC3A 1ISFA 4E5YA 1CETA 3H9QA 5JYEA 2XAAA 4E5NA 3JQAD 4OO3A 4HFNA 3VZRA 3DMYA 2C29D 3ZHZA 3O8QB 4EJ6A 5H83A 1KY5A 3CTMA 1A7AA 4B8ZA 3JQGA 3GH3A 2DTEA 4PZEA 2AE2A 1UR5A 4H16A 1NQAO 4J4BA 3SVTA 5F1KA 1U2GA 5U4QA 2D4AA 4KTVE 3QWFA 1IB6A 3RKRA 4J1QA 2EKPA 2NADA 3B1FA 4IJVA 3D4OA 4WLNA 4EJMA 5C37A 3MJEA 2VT3A 1I2BA 3WGGA 4DYVA 5JDIC 4HNGA 4Q3EA 4UVGA 1O95A 2VTEA 3I9KA 1HYGA 4BKOA 1PJ4A 2VOEA 4M54A 2LDXA 5B4UA 5JXWA 3C1AA 2WJPA 5JC1A 4L4SA 5A03A 1NR7A 2D8AA 2Q45A 1VI2A 2ZCUA 3K96A 4GVXA 1DC4A 4K9DA 1HKUA 1GZ3A 3QWHA 2CDAA 3GDGA 2PD4A 4HADA 4YPOA 5TIIA 4PVDA 1A27A 4RZHA 4IIVA 3KSZO 2I76A 4JJGA 1Y1PA 1ZK3A 3GY0A 3SC6A 3TZKA 1AHHA 2WD7A 5CEFA 3E18A 8LDHA 1KVSA 4TKMA 3BTVA 3EC7A 4RCVA 1YOVA 5L3ZA 1ONNA 2JJYA 3W8FA 5K1SA 2FP4A 3WGZA 2QIOA 3A06A 5C5IA 1F17A 3C1OA 3DFZA 4B7CA 4YA6A 1U8FO 1Z6ZA 1P1IA 1B8PA 4C7JA 3JQDA 2O2SA 1R4NA 1IULA 3NTRA 4FFNA 3ETDA 1FXSA 3DZHA 4DLAA 5BSFA 1RM4A 2PNFA 3OIGA 5A9RA 1MX3A 3PFFA 2Q4EA 2DFDA 1PJSA 4YT2A 4YJHA 2BRUA 1SZJG 4MP8A 4Q3CA 1V35A 1DAOA 3AW9A 2UUOA 4OOEA 4PGFA 4IMRA 2NU9A 5C7LO 4WECA 4IDCA 3F4BA 3G17A 3WMWA 1LA2A 3I3OA 4Y6RA 4E13A 3VTFA 1L7EA 3OEWA 4FFLA 1EK6A 3AI3A 2AEFA 4PLCA 4R1UA 3DR3A 4RF3A 2YDXA 1C0PA 1EE9A 5HM8A 1AE1A 3AM4A 5G0TA 5BSHA 4YT8A 2NUAA 2P2SA 4FCCA 1MC4A 4LN1A 2GN8A 2UV8A 2IZZA 4WCDA 2ZCVA 4P38A 3LDHA 2Q50A 3VKUA 5JPIA 4RV9A 2WE7A 1MXHA 3DBLA 4BO5A 4TRMA 5AVOA 2AXQA 1CWUA 2VYVA 4A7PA 5AQ1A 2YJZA 4J90A 3W4IA 2X9GA 2P9CA 4IJKA 2X8LA 3M1LA 3ZV4A 3T4EA 1KVUA 1RYDA 3A4VA 3DB2A 4PLPA 3KEQA 3U49A 3F9IA 1UDBA 3GR6A 4RDIA 1MG0A 4ZJUA 1MGOA 3E5MA 1BSVA 3OFSA 4XCVA 5KOIA 4XJTA 4QFDA 1WZEA 1BMDA 2R2GA 3WYBA 3ASVA 4IM7A 3CSDA 3K5PA 3VVCA 4IQGA 1YRLA 3HE3A 1FDTA 4CQMA 4U0KA 1DFGA 2B37A 1WP4A 2VUUA 2G76A 3PYLA 1W6UA 3RUDA 4UEKA 1ZKMA 1FK8A 3DTTA 2GZ1A 1U9JA 1NP3A 1JLLA 4XQEA 3F4LA 5KVSA 2X6TA 1JWAB 2O3JA 1EVJA 4W99A 4BGVA 3WS7A 1EQ2A 3AY7A 1E7MA 3PHGA 3AI2A 1ZO8A 3EZYA 2O23A 4TVBA 1KEWA 3HWRA 5THQA 5MDHA 4CM5A 1UXKA 3TJRA 1NAHA 2YV2A 4ND4A 2ZQZA 2DBQA 3OM9A 4YAEA 3EVNA 4QEDA 4I5DA 2YUTA 4W9NA 3FBTA 4KUGA 3ZDFA 4EUEA 1LC0A 4BNHA 3V1TC 1MA0A 3OJEA 2EP7A 4INAA 5COBA 5FI3A 1E3JA 5GMOA 3NKLA 5DNAA 3E48A 5DT9A 3WX0A 1ZK4A 1G0OA 3HG7A 5COAA 5TSDA 3DO5A 3NRCA 2YQ4A 3G3EA 4RF4A 3HFGA 3KYCA 4E5PA 1U1IA 4YJDA 2VRBA 4YCAA 1EE2A 1WDLA 4CLRA 4U6SA 3TZ6A 1XDWA 4IXTA 2D59A 3FD8A 1YE3A 2JD1A 4FIZA 3U3XA 1JA9A 4XYBA 4K6FA 4GH5A 4E4YA 4WLVA 1N92A 4GMGA 1PJLA 1HDZA 4BGUA 5A1TA 1ISMA 3ZCXA 3QSGA 1XR3A 4NH4A 3RWBA 5L40A 3H9UA 4FC6A 3QVOA 2E49A 2GNAA 4CMBA 3LLVA 2HMWA 5TRTA 4JP2A 4R54A 3I4FA 3ASUA 3VKVA 2ZB4A 5A3VA 3D3WA 3GPIA 1YL7A 5H82A 1DOHA 1NFQA 2DPHA 3UH1A 3PK0A 3I52A 2GDZA 1FF9A 3E5RA 4DMMA 2VRCA 3H5RA 4XIYA 3SJ7A 3KVOA 2DBVO 3PHHA 2XXBA 1EUDA 1UP4A 4XWYA 5COQA 4GWKA 4RZIA 4CMJA 4YAGA 1MFPA 3ZHXA 1YDWA 3GGPA 4MKXA 1L7DA 3O8QA 3ZU4A 4BO2A 2V65A 3K92A 4FQ8A 3DBRA 4GX1A 4XYEA 3WIEA 1UH5A 2X0JA 1P1HA 3OQ6A 3GFBA 2G0TA 2GLXA 4CM9A 4YAKA 1NWCA 1PU2A 4BNFA 4LRSB 3JQAA 1LDNA 1U2DA 4J7XA 1PR9A 1I5RA 4B79A 4LCEA 2RAFA 3WQRA 1YQXA 3CE6A 2DT5A 2EW8A 3HDJA 5L4NA 4WCFC 2LDBA 1ISJA 4XJSA 4XGNA 4TRJA 3H6KA 5A9TA 1B15A 4EUFA 4CM1A 1V0JA 2FHSA 2H1SA 3E9MA 1NBOA 3RSHA 1PEDA 1E7WA 2JFGA 3PZBA 2DC1A 4WCFB 2WD8A 3RC7A 3X2FA 2B69A 3O03A 3H2ZA 1E92A 5T5QA 2WEKA 2QW8A 1Z74A 4CL8A 1GV1A 1PJTA 2PK3A 3NGXA 4HFRA 1NXQA 1PJ3A 1TEHA 3HDHA 4ND3A 5F3RA 2X0RA 4IS3A 3E82A 3AOEA 4NDNE 3WDSA 1XSEA 5BSGA 1DIRA 2NVUA 3TOZA 2JFFA 3I23A 2GN9A 4CMGA 5CEJA 5IZ4A 4Q3BA 3GNTA 4HKTA 5JY1A 1P1JA 2C5AA 4BNNA 3QE3A 2AG5A 2J5RA 2R6JA 4UUMA 3PDUA 3O9ZA 1B16A 2VWPA 1BXGA 3G1TA 4J16A 2W4QA 1YONA 4NU5A 2FZEA 1LNQA 4BNYA 2AQ8A 2WSBA 3DZFA 4LMPA 1HZJA 3DBHB 1RKXA 2YW9A 3DZIA 4DQUA 4M49A 3PJGA 4R9SA 4B3IA 2X4GA 3GZNB 1Z7BA 4TZKA 4WCFA 1PZGA 4BNWA 4CQMD 3VPHA 2Q1WA 5K9ZA 3ONDA 2JHGA 2IZ0A 1JAXA 3WMXA 3K30A 1NX6A 1E0DA 3RJ9A 1E1MA 1BDMA 2JAPA 2HQ1A 4YQYA 1VL8A 1PWXA 2HU2A 2PA3A 1B7GO 4I08A 1Y6JA 4JGBA 4WLOA 4DBZA 4DIBA 4JLWA 5L9AA 3RC9A 4URFA 1N1GA 3QVXA 4DYDA 4CMKA 3DZKA 1PJBA 4G65A 5HS4A 1WVGA 1SB8A 4Z0HO 3RVDA 4ALJA 2D3TA 3P2OA 2O2YA 4YAIA 2X0IA 3OICA 2NACA 2CD9A 1T2EA 3BMOA 3W6ZA 1N1EA 1V3UA 3FF4A 2WE8A 4CLOB 1T24A 2J5KA 2JCYA 2AHRA 4M55A 2PH5A 4DMLA 4OYRA 1DO8A 4ID9A 3HDQA 3GC6A 1Y5RA 5IDWA 5JDCC 1G1AA 2Y1GA 4FOOA 4XYGA 3MZ0A 1ZUD1 4BO8A 1ENPA 3FR8A 4O5OA 4E0BA 3GVIA 3FHLA 1NQTA 2Y0CA 1H9BA 2Y68A 4R41A 3E1KA 4A0SA 3UCFA 2IXAA 3GHHA 4NK5A 4II2A 3VH4A 5JNLA 5THKA 4WOKA 3WGTA 3JYQA 4PLFA 4CV3A 1HDXA 4BL5A 3GT0A 2GR9A 1R0LA 4YVFA 3JYOA 4F6LA 4OSPA 4CODB 4KQXA 1XQ1A 4BO4A 4DGSA 1VKNA 3PWZA 2Y1DA 1DIGA 1BXGB 2CF6A 4R16A 1V3TA 1T26A 2Q3EA 3JTMA 9LDTA 4OMUA 4CM8A 2J6IA 2PZKA 1T2DA 3LLSA 1IZ0A 2ZTLA 1BVRA 2HKIA 3ZI0A 3JQ6A 1PJCA 2B5WA 1ADCA 1U8XX 2E6UX 3MOGA 4AVYA 5C7IO 1OZAA 1I01A 2NVUB 5A04A 1SB9A 3GNQA 2X7HA 3ROPA 3L07A 1I3KA 1PGOA 1QKIA 4IXWA 4PLTA 4BNMA 4KWHA 4MO2A 3W1VA 3CZMA 3NGLA 5L7TA 4J4HA 5A4DA 1ZEJA 2NU8A 5I8ZA 2BD0A 1EBUA 3I6QA 3R3SA 4XQ9A 3GRPA 4JN6B 2GN6A 1OMOA 2YFHA 1YH3A 1JWBB 3C7AA 3MWDB 1HE3A 4DBVO 1GCOA 2NTNA 2HCTA 5FEUA 2ET6A 1NVMB 5TX7A 4J0EA 1KERA 1MP0A 2V6MA 1ISHA 1H6AA 2VTDA 3PIIA 3TDKA 3INTA 1EK5A 1HDYA 3JQAB 4KOAA 3LF1A 4LW8A 2FSSA 2QRKA 3H2SA 4I9UA 5BT9A 4JROA 4C7KA 1WW8A 1Y5MA 2DM6A 2PD6A 1P9LA 4JBIA 3MOIA 3DDNA 2QZ9A 3KUXA 3SLKA 1EUCA 3OQ1A 5I9LA 2DTXA 5GZ6A 1VE9A 4YACA 3H8VA 4L0QA 1VPDA 1DFIA 4TRRA 2Q2WA 3PGJA 4A10A 3OH8A 1U5CA 1QSGA 1P3DA 3ROKA 3H9EO 2VRCD 4AL4A 3MJVA 5JC8A 1I2CA 3QWBA 4L74A 4XEHA 5HTOA 2I65A 4DPKA 3NX4A 3BTSA 5BSEA 1EFLA 2EEZA 3VPFA 1RJWA 3N58A 3FRJA 4NFHA 5CPFA 1ENYA 2ZB7A 4RF5A 1VJ0A 4CLDA 2FZWA 4KUEA 1KIFA 1W4ZA 1HLPA 1LSUA 4TRNA 5GZ3A 1E3WB 4XA8A 2HSDA 4KUHA 1NQOA 4FR5A 1C3VA 3VOSA 5ICSA 4TZTA 1PZEA 3WBFA 2BFAA 3QWIA 2ZYAA 5T8KA 3B20A 1BG6A 4K1LA 3R0IA 1FDVA 5KWEA 4GKVA 5BNTA 3BZUA 3DOCA 3HQ4O 1ZK1A 4LGVA 1NAIA 3L6OO 1R4MA 4XR9A 4CLRB 4R5HA 3U4DA 4FOSA 2C20A 3VH3A 1VL0A 4MVJM 5B12A 2CY0A 1E5LA 3P2YA 2PKRA 4L4RA 3K2BA 4D46A 1A4UA 1ENZA 3AUAA 4IGFA 1X1TA 1DLJA 3OF2A 4XRRA 1P33A 4RVDA 2FPPA 4BVAA 1LSSA 2H9IA 4U7WA 2YFQA 3UW3A 3G1UA 3SX2A 4MIEA 3SEFA 5DP1A 4PG7A 1K2WA 3VC7A 1ZW1A 3K31A 4XDZA 1G0NA 5BNFA 5TC4A 4L9RA 5L51A 5KIAA 3FBGA 4R9RA 4XIJA 1NPTO 1QYDA 3GRKA 5GZ1A 3UHAA 3M6IA 5AOVA 1M6WA 1ARZA 4BOYA 4D3FA 4AJKA 3UKOA 1ZSYA 3HFSA 1DSSG 2O3TA 4UREA 4CJXA 1E3EA 2EHDA 4DWVA 3PI7A 3PYMA 2YV1A 4GMFA 2VNSA 3DHEA 2DUUA 1SBYA 3NDJA 3DHNA 1E77A 3WOHA 3IJRA 2W2LA 3DHYA 4F6CA 3ZV6A 7MDHA 1RM3A 5DN9A 3EUWA 1XYGA 2BELA 2Z1NA 4TMFA 5I7FA 3PQDA 1BWSA 2NQ8A 1KETA 3DAPA 3QLJA 2J3HA 1ENOA 4H3VA 4CQMB 3IUPA 3UCXA 3OECA 1E1KA 3DWFA 1YKFA 4IZIA 2ZATA 2QHXA 3UXYA 1NVGA 6LDHA 4WKGA 1GEEA 3PZRA 5ENVA 4JJFA 2OL4A 3NYWA 3U5TA 1EVZA 4K26A 4A27A 3AY6A 2NU7A 1UZNA 3GF4A 1ULUA 4BQPA 2GO1A 5I7SA 4CQLA 4BMVA 2PTGA 2Z5LA 3EVTA 4LMRA 5K6AC 3LF2A 2YQ5A 4DVJA 5KJCA 3P7MA 5F1OA 2X5JO 4I9NA 2EGHA 4CMEA 2W90A 1GYQA 2P91A 4QO8A 3JQGB 4D44A 1O0SA 3DBVO 4U0JA 3WGOA 3U09A 4O63O 2BMAA 3LU1A 4OM8A 4AJ1A 4DLBA 2O4UX 3PPIA 3VDQA 1CRWG 4BIIA 4RVHA 4J1SA 1KVQA 3AM5A 4GX0A 3I5MA 3AJRA 4KDEA 4QSMA 1M6HA 4L4XA 3Q9UA 1KEPA 1GZ4A 3PJFA 2NQTA 1BW9B 1B8UA 3OIFA 1R15A 4HV4A 1E5QA 3E8XA 3RUFA 4Q3DA 5L53A 3VPGA 3AY3A 4R68A 2GSDA 4TKLA 2BF7A 4FC7A 1OFGA 4L73A 1QV6A 4E6PA 2VWQA 5J23A 1O5IA 4OAQA 1PTJA 4HNHA 3WB9A 5L4SA 3FI9A 3ITKA 4PLZA 4BGEA 2FSVA 1X0XA 1D4FA 4JNKA 2G17A 4GLOA 4IDDA 4OIMA 1MLDA 3ZWXA 1HTBA 5EQFA 2QQ5A 5KVVA 2CDBA 2OHXA 5IDXA 4ALIA 1AGNA 1AN9A 4CPDA 3NJ4A 5T64A 5IXYA 5AXCA 1NHGA 4IJUA 2VWGA 1VL6A 1PIWA 2A35A 1GY8A 3F47A 2ZK7A 3IP3A 2DKNA 4NPCA 5KCZA 1YOVB 1GUYA 2C7GA 4AJPA 2BHLA 1IE3A 2NWQA 1J5PA 4BO6A 1Q0QA 3INGA 4I9HA 1QLJA 4MVJH 4YRAA 4ZHSA 2J3KA 3QA9A 3DOJA 3ZWCA 1ZXLA 4XQGA 1LLUA 3PQEA 3OETA 1YQGA 1CF2O 3ADOA 1N8KA 4E2ZA 3OMLA 5JO9A 3TOXA 1M66A 3WXBA 4A5OA 5JO0A 2EW2A 3GMSA 3RUAA 9LDBA 1Y8RB 3D3EA 2X9VA 4ILKA 4HBGA 4JCOA 2HMVA 3CIFA 1A7KA 2ZIZA 3QP9A 3H3JA 1NHWA 3IUSA 3JV7A 1L1FA 4S1VA 3UUWA 1WMBA 1E6UA 3GVXA 5DBIA 5JBIA 3RROA 5G4LA 2RHCA 2UUPA 1BW9A 3P5SA 3WYEA 3MJTA 2BI8A 1B0AA 5HBRA 1XEAA 1TT5A 2R00C 3RBZA 4O59O 5TJ9A 1QYWA 3IAHA 4MVJP 4J1TA 1C0LA 5I7EA 3TNLA 5JAZA 5TLSA 1UP6A 2G82A 2NNLD 1JKJA 1SCUA 3ZGYA 4O6VA 3GHYA 4FW8A 3OSUA 3SJUA 2CVQA 5AXDA 1R6DA 3KEOA 2QZZA 5CDUA 4IJWA 3C7CB 2GPTA 4AJHA 5BR7A 5FWNA 2VHWA 4WNCA 3RUEA 1C1XA 4RLHA 2O50A 2IODA 3RU9A 4CQLB 3D4PA 1WZIA 1YQDA 2CFCA 1DRVA 3N7UA 4D42A 1GDHA 1PQUA 1EBFA 4K28A 4IZHA 2W2LD 1UAYA 4TQGA 4BNIA 5ES3A 5DBFA 3QVTA 4F45A 4BNKA 3W8DA 4M87A 4PIVA 2X0NA 3MJ4A 3BAZA 2HDHA 4E2WA 1XA0A 2VHXA 3D4NA 3KSDO 4AJLA 2HJRA 4L75A 1K6XA 3M2PA 1I10A 5JAQA 2QYTA 4Y98A 3WWZA 4NU6A 3ONEA 2GGSA 1FDSA 2HJSA 4WEOA 3I1JA 4A03A 4PLWA 1PQPA 1EQUA 4WEQA 1E6WA 3KZVA 4ND5A 4ZVVA 2VHVA 2ZYGA 2Y1FA 2Y0EA 1P45A 3LZ6A 4JBHA 1E3IA 3K2EA 5KJEA 5A9SB 4N5NA 1NQ5A 4E5MA 1FMCA 1KEVA 3JQ8B 5A06A 3QRWA 4DQVA 3GGGA 1YWGO 2RHRA 1ZJZA 3C7DB 5JMPA 3ZZNA 2Q2VA 4J43A 1LDYA 1LDGA 5U1PA 1WNTA 4NIMA 2BFPA 4MJLA 3GUCA 2Q99A 4MOWA 1HL3A 2XPCA 4WLUA 4CM3A 4L76A 2P5UA 2OXIA 3WWYA 2GF2A 4NHEA 3D1LA 3DAGA 3R6DA 2RIRA 1PL7A 2IRWA 1YL5A 1NPDA 2EV9A 3EDMA 5H81A 3V1UA 3PLNA 4Z0TA 4WLEA 2X23A 3WGIA 2IDZA 2AW5A 4EDFA 5LDGA 3G0OA 1WMAA 4CR8A 5KJFA 5ER6A 1O8CA 3LT4A 2W2KB 4PRLA 4E21A 1XQ6A 4EI2A 5IFLA 1EVIA 3GK3A 5CDYA 4AJNA 3OJLA 3NEPX 1DEHA 2GD1O 3ENNA 3AU9A 1BRMA 2I3GA 4YB8A 1QORA 2DBRA 3RUCA 3KYBA 2WWRA 3ZNNA 1IOLA 3JQBC 2O7SA 2Y1EA 4GI2A 2VYVD 3ON5A 1ZFNA 3IS3A 4NBUA 1U7HA 4CV2A 4II3A 5AXAA 2A94A 5TNXA 3ZV3A 1XU7A 4FN4A 3QHAA 4QXMA 3ETGA 3JQFC 4BNUA 4WASA 3ZW8A 2C7VA 4QX6A 3KTDA 1N9GB 4YWJA 3KLMX 4MVJG 2B4RO 3A14A 4MINA 5ITWA 1X14A 3ETEA 5ADHA 1BDBA 5JDIA 3D64A 1LRLA 1LDEA 4M86A 4WNIA 1KEUA 1HDGO 4I5EA 1IZ9A 1O89A 4IGEA 4Q9NA 1GUFA 2DQ4A 1T4DA 4J4TA 1R16A 1GPDG 2WYVA 3A9WA 4AICA 1IPFA 1GCUA 3BMCB 1EVYA 2I5PO 1E3LA 1Z73A 1IPEA 1ZZEA 1JKIA 1UZMA 1Y8QB 4J7CA 2ZTVA 4XB1A 3KBOA 3ZWPA 2DAPA 4A73A 3FPCA 5ICMA 4FBGA 2O48X 4NBRA 1R4MB 1P1KA 3QVWA 4R51A 5IJZA 3TSCA 4D45A 2DBZA 3JYNA 1GTMA 1E7SA 1SAYA 1ZEMA 3GFGA 3GAZA 1O9BA 4DA9A 2YV3A 1DBVO 5G0WA 4D0SA 1P0CA 2DUWA 3HN7A 1ZIDA 3GOHA 1LSJA 3RQSA 3WNVA 4PG5A 4E31A 2I67A 1J0XO 3CEAA 4Y8VA 4BO0A 1EDZA 4PFJA 4B4VA 1ID1A 1YL6A 4BO3A 3ROQA 1SEVA 3GDOA 3RJ5A 3U9LA 3LC2O 1J4AA 4MIYA 1YBAA 4JJIA 2UVDA 3CMCO 3I9LA 3MJSA 2PV7A 1DFHA 3QW2A 1P31A 3ZW9A 1DJQA 4AJEA 4GGPA 1NM5A 4FFOA 3QIVA 4CLEA 3KB6A 4D7AA 3AUTA 3AM3A 1N7GA 2BKAA 3GDFA 4NJMB 1GQQA 1T1RA 1VLLA 2AQIA 4IDFA 3GZ4A 2OBNA 3PJEA 1YJ8A 3H4VA 3VVBA 4BV8A 3WTCA 3EK2A 1U7TA 1YGYA 2YHIA 4IINA 5FF9A 3BTOA 3ORFA 2GZ2A 1JAYA 2Y0DA 3QWAA 3HDYA 1E7YA 5DCYA 3BTUA 3L4BC 1M76A 4NJMA 3D7LA 3H5AA 1CDOA 2H63A 4J9VA 2Q46A 4AJ4A 4BNLA 3IIEA 2GYYA 2BGMA 1LEHA 4G2NA 3UOGA 3I83A 3V5NA 4YR9A 3BMQA 4YJGB 4NK4A 1I30A 1PJQA 4Q3AA 3PDJA 1W8DA 3RFVA 3BMNB 4TVOA 3E03A 1SO8A 2RBEA 3BMOB 4EEZA 2DLDA 4OGWA 4RPHA 5KVCA 5I9MA 1B26A 4YT4A 2EP5A 2PR2A 3ROMA 3JYLA 4ITUA 3IJPA 3KETA 4W9NC 4B7XA 1ISIA 4RQUA 3SBOA 2GUGA 4E2YA 4O0LA 1H0KA 3RFTA 2XXJA 1UXIA 1NFFA 4AJIA 5JAIA 1S7CA 1KC3A 2V7PA 4YJFB 3TPCA 3GN1A 4ZN6A 3LYLA 3IP1A 1U4OA 4UULA 1KBZA 4DRYA 4CM7A 4Z6KA 4ROSA 1SC6A 3MTJA 2JHFA 4CV0A 1JVBA 3IMFA 2EG9A 3GPDG 4MVJA 2HAEA 2HUNA 2PLAA 3OA2A 1EMDA 1U3VA 2IEDA 1MV8A 3PXXA 2HMSA 1SOWA 1DHTA 1GU7A 5JYDA 1X1EA 5JCXA 1AXEA 3HZZA 3CINA 3OA0A 5FYDA 5T57A 1B3BA 1JN0A 2CDCA 2PFGA 1N9GA 1P44A 1VJTA 5CDSA 2Q1SA 1DRUA 3Q11A 4N7RA 5DP2A 2B4TO 2IZ1A 2B4QA 3L6DA 3VTZA 1A9YA 1HE4A 1HF3A 2EJWA 3WFJA 5B37A 5TS3A 3F46A 4B8WA 4D3DA 1HSOA 3QQPA 3ZWMA 3AWDA 3EMKA 4FPXA 3JD2A 2OOSA 3F5SA 3KV3O 2V6BA 1LLQA 1D1SA 4BGIA 4YEDA 2HK8A 1CERA 4B7UA 1N5DA 4GQAA 4M1QA 2PH3A 2EF1A 3VZQA 2W2KA 3UFXA 3F6YA 5DOZA 3S2GA 1WDMA 4DXHA 4G81A 1I2ZA 2RH8A 3ST7A 3NAQA 3B1JA 4J49A 5CPBA 3W4JA 3DTYA 2FMUA 4FGWA 1SOVA 1E6EA 1KYQA 4UEOA 1A71A 3JCZA 4GX2A 5EJ2A 3FNFA 1FDWA 3NTQA 4YRDA 4EZBA 1XHLA 3Q1LA 2HRZA 2TMDA 2Y67A 2WDZA 1ORRA 3WICA 3Q2KA 1TA4A 4YQZA 2A9FA 5T6BA 3WIDA 1PGPA 4NBVA 2I3AA 4RF2A 1HEUA 2ZTMA 2J3IA 4LVCA 4ZD6A 4A2CA 1YBVA 3EYWA 3I4CA 3JQBA 2TMGA 4C4OA 4YYZA 3TFQA 4IBOA 3TL2A 4XQCA 1M75A 1T2AA 3ZWOA 1PGQA 3CMMA 3ZU5A 3HJAA 1HRDA 1ISGA 3RD5A 4JP3A 5TT1A 1GEGA 1TT5B 3X2EA 4JIGA 4U5QA 3FR7A 3S2FA 1EDOA 3HADA 3TF5A 1HDOA 5EPOA 1G6KA 4CL3A 1PS9A 3DONA 4MVJD 4CMHA 1PX0A 1PL8A 3JQCA 4BS9A 1DIBA 4XYMA 1LSOA 2J8ZA 1U3TA 5CG2A 1H93A 4XKJA 4NG5A 2JCXA 2YZ7A 3UICA 2ZTUA 1EFKA
chains in the Genus database with same CATH superfamily
4M9CA 5F3DA 5K2MA 1S89A 1L5OA 4N48A 3OUUA 5CFLA 2BMEA 2C82A 2EIHA 4MARA 5KDLA 1L7VC 1UM9B 1UWLA 4WNYA 4ZT3A 4ZI7A 3LTEA 2X2EA 4DG5A 1H5QA 2DSNA 2PPVA 3CZ5A 5FUBA 1BDIA 3HY6A 4NNOA 1DC5A 2WU0A 1YQQA 5JAMA 3MW8A 3RGWS 2WWWA 1Y4AE 1IL0A 1Z8FA 1JFFA 5T4FA 3GDHA 2DR3A 2RJOA 2JFQA 2NAFA 1FRQA 1XZNA 4GGOA 5KYWB 1JG4A 4MIOA 4RYLA 5FLEX 5LU8A 1VLZA 1JFTA 2CUKA 4RFSA 2IHVA 3DB1A 3PTZA 3AILA 3NG1A 5DBEX 2QS9A 5FLXA 1DWOA 2Z1MA 1XHEA 2HQRA 4NESA 5G4KB 5HRUA 1F7VA 3NAMA 2ECFA 1XZQA 5LCXA 3WFIA 4F4JA 3DXFA 3ADBA 1DTSA 1J8VA 4BWVA 3COJA 2YIVX 3KZOA 1EYZA 1NMSA 2LR0A 3Q2IA 3NHZA 3A0RB 5GWXA 4CLXA 5A02A 5ARDA 5HW0A 1XMJA 1OGYA 1T4CA 4EAQA 3I0MA 1IN7A 4ZOLA 4LJ7A 1YIOA 4MIKA 5DE3A 3RU3A 5K0TA 1SN7A 1ZNQO 1ZMOA 3FNRA 2VQ3A 1L5FA 4WZAB 3WE7A 1HSZA 1KC1A 3NUGA 4RJJA 4YMIA 4ZYXA 5LFAA 5AOAA 1K5HA 2G0AA 2JI7A 5KNCA 2FMXA 1TQ4A 4J0FA 1QQTA 3ADPA 3PUZA 5TF0A 4A9AA 3FTFA 3JSAA 2HJVA 4UTOA 1I4LD 2AKEA 2G06A 1VSQA 4FKMA 5H16A 2FR8A 5FTMA 4OVKA 1FJHA 4BX9A 5AK0A 4GMDA 4WKBA 4ZQGA 2AE1A 4RADA 2O3RA 2F1KA 2QROA 3V1NA 1QIEA 5CAEA 2PZJA 1MENA 3Q5DA 4ZCIA 1EFVB 1EFTA 1XLWA 5DHUA 1ICIA 3RC8A 3MC1A 1K6MA 2VP4A 3O7MA 1CLEA 4RKRA 5L3QA 3FWZA 1JXOA 4EEXA 3GEDA 2X9NA 3W3ZB 4AYWA 4Z7QB 1CZRA 3UF0A 1J0BA 2LPMA 1ACJA 3IALA 3RIXA 1OZFA 4W5JA 1HPLA 1KI6B 1YCDA 3ZW7A 3T3OA 1CCWA 4TV9B 4DR1B 4OXNA 2O2DA 4NQZA 2AJBA 2KI5A 1WPRA 1AK2A 3JYPA 4QUHA 4ZVOA 4OJQA 4BMNA 2ZWAA 3AOEC 2GMWA 3I12A 2OZLB 3FE2A 4ZGBA 2XTMA 3L0ZA 4AULA 4GOXA 5H80A 5AM0A 4EMBA 4JY7A 3LIIA 3W9UA 4L3OA 2R6CA 1WAMA 3LGAA 1UXGA 4GLLA 3EF1A 1F9AA 1U6IA 2KYRA 1QV7A 4Q12A 4KMMA 3ZHSA 4EG0A 4M0CA 2PZEA 5HZHA 4TSKA 4BFUA 4ARIA 1N7JA 3O7WA 4N6NA 1OAAA 2GD0A 2CLLB 5DGCA 2N47A 1WY7A 5DGXA 4MUGA 3UMCA 4DR7B 1I24A 1XTVA 2Q4OA 3DEKA 1R0YA 4OP1A 1VJ1A 2JFNA 2OZVA 2RG1A 1P60A 3ANNA 3OKFA 3REFA 3S55A 1X77A 3AOGA 1UBFA 4KB5A 4LSWA 1G6HA 1WHTB 4H2DA 4JHLA 4GSLA 1H6CA 3HBFA 4LYYA 5A6VA 4C4YA 5BW8A 3AQ4A 1R5JA 5K3EA 1BD4A 3JPYA 5J43A 1Q21A 5LC1A 4LXIA 7ADHA 2VCHA 4MW9A 5I5EA 5ALHA 1CR4A 3HJNA 3CH6A 4J6FA 5D84A 4BKUA 1Q83A 4D9IA 3KZKA 1WG8A 1MQ8B 4KZPA 6AT1A 3IL2A 1AD2A 1XLVA 5JQGF 1EX1A 1H6DA 2EG5A 2R4TA 1WF3A 2QAGA 1GKKA 1HURA 1I3MA 1JZTA 1J2JA 1NVAA 3DKPA 3JD4A 4G85A 1Z4LA 4KSYA 3V8BA 3R7SA 3VX4A 4I19A 4EB6B 3BMCA 4HX2A 3LKDA 4JJZA 1MC8A 3R7NA 3LT0A 2V4ZA 3PGKA 3E1SA 2IVFA 3O2QB 4HGNA 1PKEA 2UYGA 2B98A 2XYPA 4JB3A 4GXNA 1UZAA 5EP3A 3TB6A 5I47A 4L2IA 2NV2B 3PHIA 1T2CA 3AFGA 3TE6A 3OCCA 4K9OA 1V6AA 2BM0A 1FDUA 1XALA 1JSRA 1IY8A 4MTCA 2F8TA 4R8RA 2BL4A 2ZT5A 3B78A 3I09A 4X93A 4CUKA 2AMYA 4OTZA 4NOLA 2FPPB 4OBBA 5KPDA 1KKUA 3HWWA 4J8PA 3FCOA 3UQYS 1BMQA 5JD6A 3P9SA 4LTDA 3ZZTA 4IG4A 1BRTA 4HQLA 4I8XA 1SBNE 1BCSA 1EX7A 4HPWA 2YKGA 4KVAA 5CP8A 4B17A 4M2LA 3ZVNA 2VDNB 3O5AA 4QECA 4RSRA 2AN4A 5DXJA 4CKWB 4OLAA 1M6VB 1KI6A 4OH7A 3OURA 3OAAD 2REQB 1ULSA 2KWIA 3R3ZA 5T8KC 3WGLA 4X8MA 2BJHA 3RREA 1E3DA 1VDMA 4R8SA 3I9MA 5EPUA 4BMPB 2IXEA 3FOZA 3CPJB 4YDRA 1QZXA 1Z4PX 3A3YA 4K87A 1KIAA 4GSKA 4PCVA 1G8SA 3DEYX 5KKAA 1HR0B 4D8WA 1OLXA 1DO2A 2IU6A 1QCDA 1R2QA 3E84A 1QVWA 1ISSA 1IUPA 1GTL1 2J33A 5JH7B 4FWBA 1SEPA 3F5QA 5I7OA 4R40A 2PKXA 2BFOA 4P31A 3P94A 4I3GA 4W8OA 3E5HA 4QFBA 3G59A 3GEIA 2I54A 3H1FA 4UJ3A 4WVLA 1KQGA 3L3BA 2EKBA 4NS4A 4LSGA 1UJ2A 2O7RA 5DN6D 3FZGA 4B3XA 1MIHA 1VLHA 3HGTA 3R7LA 5K6TA 3T7AA 2AUNA 2OHOA 4YJHB 2A9KA 3OZDA 4UQLA 4QFCA 1IMOA 2FDRA 4XTRA 4Y2VA 1KP3A 1A95A 2Q5CA 3UANA 3HSKA 1RHKA 4H31A 2BOVA 1U3GA 2HBYA 1IUNA 2X3YA 3SC3A 2RCYA 1GGNA 1OKKD 1A9ZA 2OVFA 4HXFB 4DEXA 1J0CA 1T4CB 2C07A 2I8CA 2R11A 1RRVA 3CX4A 3FN4A 1ZD1A 3HKDA 3OZXA 4KR0A 1DCTA 1PE0A 4OV6B 5E95A 1NJ5A 2Q49A 1P9NA 3WLOA 2YQZA 3TJZA 1ZM3A 3LYHA 5A7GA 3CZQA 3PKZA 4MI9A 3U4CA 4XYLA 1QCCA 2QG9A 4YAFA 2XIQA 2Z3ZA 2KW5A 4TYMA 4ZI5A 3EXFA 5TQVA 1T9GR 4LK3A 5IN5A 1E3QA 4O2AF 4QC2A 2IIQA 3IR6A 4QGFA 3VC2A 4Q9KA 1A9RA 1BWRA 4U6QA 2X58A 1SHLA 3DHWC 2HO5A 3FGZA 2R4QA 3H18A 5DYYA 5IDYA 5B2FA 2FQYA 3T52A 2QM0A 4NBTA 3AKYA 3QLVA 4KPFC 3L6EA 4EARA 2HTEA 4C9BA 1XJWA 1JDTA 2PWPA 1G18A 3AHIA 3FCYA 1NR1A 3MS4A 1ZK2A 2WU8A 3NEJA 1XRNA 3ORYA 1UJCA 4UXIA 5H5JA 4YMGA 1T1JA 2BIFA 3VR0A 1IEQA 1TA0A 3IAFA 3Q0EA 4BWYA 1K5GA 4LYEA 4BZPA 1FJ2A 3A1NA 3UB4A 1OC2A 4FHGA 4CN8A 1E2IA 3DLAA 1TUBB 4P4LA 1P9WA 4QL3A 4H4EA 5DLPA 3IKVA 4S3MA 3O38A 1JH9A 3FM9A 5FFMA 3D6VA 3K0AA 4C04A 1H66A 2OXRA 3NJ8A 3NXSA 3SQNA 3K5WA 4HNTA 5DH9A 5LSAA 4C7MA 5AJVB 2JI4A 4F91B 1NQUA 3IUYA 1KP9A 1NVDA 1KS9A 2GBLC 3U62A 3QV1A 2GCOA 1ZJYA 3GRUA 1M5UA 3LK7A 4ZQFA 4XIIA 4CKZA 1PD1A 3HV0A 2V7WA 1BXRB 1CJTC 2WNIA 3NHFA 2CXXA 2ORED 4IV8A 4AJJA 2ILTA 4B80A 5AR1A 1GOTA 2IYFA 3UN1A 1Y82A 1NRJB 3MTBA 1JXAA 1Y3DE 1DX9A 4IRXA 2JCVA 2DJ5A 1MN6A 1GNRA 3AR9A 2BGKA 4CMAA 1ABBA 3T3PB 4JVSB 3TNJA 3E9NA 4B09A 1SKYE 3TEFA 3OF5A 3KSAC 2GKOA 2VYND 3D0QA 3SF0A 1YDGA 1RLOA 2Y1KA 1WMDA 1YB1A 3NV9A 3QYPA 2JASA 2OD2A 4UZEA 3F4KA 4U9UA 2ONKA 4KXLA 2WDPA 1KMIY 3CLRC 3W5CA 3GG2A 2C2YA 2VJYA 3KQMA 1MNAA 3O83A 1WLYA 3TIVA 4BFSA 1P62B 4JLPA 2XGMA 3TIIA 1HX7A 1RVV1 1SVMA 3LKZA 4LY9A 3SDZA 3C4QA 1OXBB 3O4GA 4OL0A 3B1XA 4DTIA 3F98A 4QXQA 5LQCA 2CJFA 2Q6VA 2WPDA 2C9OA 1A5ZA 1W4LA 1VKRA 4PLVA 3E3LA 1HG0A 4FILA 4B2YA 3UGKA 1GLNA 2WFZA 2W0MA 4EW6A 2AG6A 1MQSA 2JAHA 2Z56A 3R9WA 1UQTA 1T9GS 2WMDA 4HGOA 3RI3A 2QQEA 3WHLA 1UJMA 4DOMA 5IJ9A 2ZKLA 3ZIUA 5D2CA 1L8QA 1HRKA 4PHTA 4HDMB 1Y42X 2FZKA 2OUKA 1TDJA 1O94A 2H4HA 4UVDA 3OJCA 5CURA 1RSZA 3UEOA 3F6PA 1Z82A 3HB5X 1ZJJA 2QXTA 3RRNA 3P27A 2YY7A 1KJQA 5IZCC 3A1SA 1ZBQA 1EUYA 1AC5A 2I7XA 3JD0A 3C3XA 4FFRA 4TWBA 3ZLTA 1S1MA 5EP1A 4HI0E 3AV3A 2G4VA 4OXYA 3Q3HA 2EERA 2XF8A 4UVIA 2GRJA 1Z5GA 3AESA 4DJDC 5FBWB 1B8VA 1MW9X 1XVVA 2WQ7A 3R3JA 3R7AA 3TSYA 3OPMA 1MT3A 2FFHA 3EH1A 2UYQA 2ZIWB 3FUCA 2B4KA 4LFCB 5I7VA 5JRDS 2B3TA 3UV7A 5CEEA 1A04A 4MYHA 2O3UA 4I14A 4UHBA 1E6KA 3TTWA 4GKKB 5K0BA 4PG6A 3BF7A 4R81A 3CLUD 3JATA 2NYVA 3IEUA 1QIGA 1Q0TA 3CVUA 3IEMA 3RCBA 4XSHA 2QUIA 1P6QA 4LZAA 2X76A 2QQGA 5HJEA 4UBKA 1GV0A 1MFZA 1OBHA 2J9RA 1E32A 2Z43A 4OXKA 5CGZA 4N47A 3W2HA 3I1IA 2G40A 4L9AA 4B3HA 2W2QA 2XTAA 3BH0A 3GA7A 3OZAA 4F21A 4X3OA 4F9GA 1NPYA 3UWDA 3MMNA 2A1UB 4HY3A 1BVUA 3HRHA 1SC9A 5FUXA 3FOCA 3P19A 2VZ8A 1LNZA 3N2EA 4Q7MB 4AKTA 3QG5A 5K3BA 5TVGA 4RQAA 1V5FA 4G9EA 3B8EA 2O0LA 1K6IA 5DCUA 5CR9A 1AZWA 2I4LA 1O2DA 4X1KA 1JTFA 4B3DA 2WSIA 4B34A 1KP2A 4NF2A 3TSOA 1LI4A 2BBSA 3GWGA 3UXMA 4MAFA 5JR3A 3U60B 4MQFB 4KMRA 3JAWB 1YQEA 5KYKA 1PS8A 2R60A 3G5MA 4NY1A 5EJIA 3H2BA 4ARUA 1E8DA 5FOQA 3OQNA 4JBGA 5KNLA 2D5LA 1TAGA 3HBMA 3I9V6 1PWHA 2P65A 2H59A 4BQRA 4BP9A 4TTTS 3FNBA 2UU9B 4AZWA 1Z5NA 2ZE8A 3PD7A 4H17A 3T1YB 4HH3C 4E12A 4CEIA 1DKQA 2PCJA 1Y1LA 4ATNA 1Z26A 2CSUA 2OFOA 1PLJA 4BEWA 3UMBA 4C0LA 3FUVA 1MO2A 2BDTA 4ZQCB 5CCEA 2UVPA 3U80A 3EUAA 4DC0A 4H0FA 4F3TA 3DBIA 4YRBA 1OD6A 5J4HA 3EF0A 3PB3A 1NJ2A 1JV2B 4QDJA 4DV4B 2XY4A 3KYDB 5IJ0B 1BQEA 2HU5A 2PGAA 4HJXA 4MWZA 5AKJA 3ZC3A 2AG8A 3QVKA 4GHWA 2R6FA 1BE0A 4HNUA 1MXFA 1X7HA 1V2GA 2JFUA 3E35A 3LSYA 3SQDA 2VAXA 2WSSD 4EHLA 1R6XA 2CNLA 3G2LA 2IXBA 1GPUA 4GFDA 4RPKA 1KKLA 3ETHA 8OHMA 3PFHA 5D6OA 5LP6A 2P9ZA 4IHJF 5FO1A 5FQNA 4X94A 3W7BA 1HEYA 2IE0A 3LG2A 2YHIB 4GR4A 1WMEA 2FF7A 3LUAA 3DL2A 1J07A 1NBEA 1W1WA 4MICA 4J7AA 3SFZA 2OK7A 1QG4A 4ONEA 2Y1CA 4MP3A 5CHEA 2VBCA 1ZH6A 3FOWA 3WGJA 1L7RA 4HDQB 2VTVA 3WWCA 1T1GA 1T35A 5JATA 5EJEA 2RARA 1BKSB 5JZVA 4HRYA 4C20A 4UMEA 3CKYA 3WL5A 1MDBA 3HUEA 2KJQA 2IC5A 4PQRA 5ILOA 4J7UA 4LDZA 1V96A 4B6OA 3WISA 3GFSA 1VKOA 2XLCA 5DDIP 4TUYA 3W6UA 3C6BA 5KKNB 1NXSA 2YHBA 4DLWA 5IBCA 4WOJA 4MHTA 4HMOA 1X70A 5LZ5A 4A6PA 1RIIA 4ZJYA 2ZSAA 4RPGA 4LWQA 1N2CB 3L6BA 4F7DA 3EY9A 5KJ1A 3ETJA 3IEIA 3H7AA 5IU6A 2MSDB 2SCUA 3D0RA 4R8MA 2RSLA 1E9EA 4WGGA 1M2HA 2BSQA 2O7VA 1E8NA 2PZGA 3C24A 5FTKA 3KQPA 4ITVA 4R9UC 1FLAA 1EWQA 3NT4A 4F3RA 2BF4A 2QBYA 2AEEA 4U2BA 1AMUA 3HB4X 2Q62A 4D0RA 1JDZA 2R68A 3KNZA 5LNK1 2FRDA 5LOVF 1PDWA 5CFNA 3OFKA 5CD1A 1OB5A 3AUUA 2W11A 4MITA 3SFVA 3WGHA 1RRGA 4HWKA 4U7FA 3VDXA 3G0DA 1JTVA 3RADC 4MS3B 2NVBA 4O4HA 4Q21A 2VT2A 2P41A 1BE1A 3B52X 3PJDA 4ZYTA 3S7ZA 4REOA 4P80A 3S6JA 3L1HA 2O9JA 5ANRB 3TLYA 4RESA 1KJWA 4N18A 1Q2XA 2H2GA 1DWUA 4D43A 5JWRA 1UKAA 3R5JA 1AKUA 2A8YA 2JGLA 2PX0A 2VAVA 3L40A 3L9XA 2J3JA 4TTSA 1QG2A 1ZIPA 4ENTA 3ZOKA 4ZEOA 5JCJD 1XD9A 4A23A 5BQPA 3ZXXA 1N1DA 4RBNA 5DULA 5C34B 1YA6A 4YT5A 3BVPA 3M89A 4AKSA 3IIIA 6REQA 3UTCA 5IRCD 1UDAA 4L6CA 2G7MC 2FOIA 1AGYA 2DTDA 2POCA 1W5EA 4NBNA 3AVPA 5CBPB 3T9DA 3L2OB 5CVTA 2QTFA 1KI4A 3P2MA 4QOHA 5KNDH 2WIFA 3F73A 5B1YA 2DKOA 2BN4A 4JVNA 5A5FA 2TYSB 2ZSHA 4AZVA 3ITNA 1D2NA 2QXYA 1G8PA 4OHFA 4KRYA 5IVIA 4YJ2A 3M4XA 4PFKA 4FCTA 4EHHA 3JTEA 2X5NA 4TT3A 4F6RA 4EG3A 5KWVA 4PQYA 5FUYA 3E9YA 1CIVA 1L4GA 4EY8A 4RTRA 3KLPX 2Q6OA 4N01A 4YJ2B 4CUZA 2FUNB 4KXNA 2R66A 5BUCA 5IC4A 3I8OA 2E4VA 2XQFA 3GLRA 4H7EA 3QVUA 1U9YA 2WHQA 3HXMA 4RK0A 4PO3X 5DPMA 3OOEA 4H35A 3Q3EA 3EVCA 5AW2A 2BGUA 3D1JA 3IBGA 3CLSD 4PGGA 2WUEA 4BRZA 2PGDA 1EUCB 2WC1A 2ZJ7A 5J58A 1KXJA 2RH5A 5CM8B 4CCYA 4B3RB 2CLHB 3RO7A 1PFKA 2FPLA 2DU8A 3IP6A 3GJQA 1MG5A 3GH1A 2J3MA 4NNJA 5FT9A 1QPBA 2OLEA 5DBGA 4MPJA 1MAUA 4D5GA 1SUAA 5FDFA 1U4NA 3WKCA 4BPBA 4GZ5A 2VLIA 5C7OO 5LZ8A 2X86A 3MWLA 3CWZA 2H1WA 3PL1A 3QKWA 4MWOA 5DCLA 4P3YA 4E32A 2JIPA 1O6GA 3EG9A 1UKBA 1NT2A 3FCSB 1ECCA 1RHUA 2ATVA 4G2TA 3PC6A 2P4UA 1G9SA 1X1QA 3V2GA 1NXOA 3IDSA 3MGAA 3ESBA 4I55A 3K0EA 2W6JA 4UHCA 3SOPA 1HETA 2POQX 4GPBA 4LBYA 3RAJA 4I4LA 3W3AD 4DMFA 1ZVMA 3QMWA 5DI3A 2YOFA 3VR3A 2RHJA 4HL6A 1OWNA 1MRNA 2NZVG 4KXYA 5WRFA 1EGQA 1Y3BE 1C3LA 4C0SA 4IGAA 4EBFA 1P1FA 1RTTA 2OC4A 3ST7A 3WSWA 1Z29A 2I2XB 1YVEI 2K2WA 3LHSA 1V26A 4PPGA 1L7NA 2PXXA 4WFQA 1KE2A 2OB2A 1HFJA 2YDYA 4I1VA 4O4IA 3W9SA 5KSWB 3TTSA 1GTZA 1U2QA 1JEEA 1FFAA 2ID4A 2W6IA 1N2CA 4RL6A 2IYNA 2QRLA 2UVQA 3WNZA 2C84A 4G5SA 1D7OA 1HE5A 5JSYA 3U4GA 1NVUQ 6ABPA 2Z83A 1RFLA 2QOEA 2BEKA 5FEMA 3C87A 3I9FA 1E7RA 1NN3A 2JW5A 5J9FA 1U7OA 3LUBA 4JQCA 3WRYC 2R6AA 2NXNA 3S70A 2OEPA 1GNTA 3RFXA 3RS9A 2G72A 2QLTA 4MW2A 1W7AA 5L4LA 2ZJ1A 1T4BA 3MYRA 1G3QA 3T7JA 1G60A 3SLGA 4NLLA 1WHTA 2IV7A 1XE3A 3FLBA 3MTIA 4UVHA 1Q77A 3ENWA 5KQLA 2R2AA 4KWIA 4PTYA 4UKDA 3ZDAA 3M6UA 5REQA 3ITDA 4CM6A 3A1DA 2WA1A 5B30A 5FA6A 1PT6A 2Q1TA 1UT6A 4UBNA 2A6PA 4PXAA 3EPLA 3IEVA 2C78A 2XQKA 1PWZA 2PPLA 2V6JA 3IERA 2G1PA 2AJ8A 1FTWA 4XRGA 2V3VA 5TF4A 1ZAKA 4AWXA 2B36A 1Z5OA 1AKWA 5JSFA 1LI7A 2VUTA 3UJ7A 2IUYA 3I4LA 5FBZA 3K3PA 4G0XA 4LVUA 1GITA 1VSTA 2ZZMA 1USKA 3FJ1A 4RABA 4HD8A 2RI6A 2E1RA 2WIAA 3BEOA 4KITB 4J2OA 2HNAA 4TYPA 3TOCA 2JF0A 2VN8A 4OQ4A 3C5CA 2VUSA 4HB3A 4K6CA 4TTJA 4OSOA 2RC5A 2BMJA 3AB8A 3GWZA 1U99A 1GSHA 3MTGA 3OLZA 3P9PA 3R9XB 2YTZA 2X8JA 1DBRA 2JKVA 1XJ0A 1QYCA 4N5MA 1ORIA 2YN4A 4H3KB 5K0ZA 2HMTA 1M1NA 1NLZA 2X22A 2YY5A 3JQFA 3M7IA 2OK8A 4LS3A 4UE3S 1MUUA 5DCWA 4DGQA 3P45A 3CNLA 3D5QA 1SBTA 5AUQA 4EKYA 4OKNA 5KNCD 1KMQA 4J2HA 5JWHA 2CB0A 3G8YA 1X7YB 1XAHA 3I6IA 1PEYA 3JW8A 3QUBA 5L95A 2OAGA 3A05A 4QQNA 4PWYA 1YS4A 2EU8A 3HCCA 3ANLA 1QAMA 2V1UA 3C85A 3E1GA 1CNFA 2R62A 3L41A 3LY9A 2EJBA 4NAVA 4Z3DA 4BQFA 3P0FA 1E94E 3M6AA 1TZKA 3LW8A 3CLKA 1BHSA 1TZMA 1J0EA 1VC2A 3D0KA 3IEPA 5LYYA 4D97A 4DJ5X 1WUJS 2FWIA 2GCGA 3V4ZA 1B2LA 1K9SA 2I80A 4PLGA 3UAWA 4B46A 3LT1A 2O52A 2WHXA 2O0HA 4C2UA 4J29A 3ZWWA 1X74A 1DHRA 1VSVA 3DP9A 4GXTA 4UE2A 1LDBA 2QX4A 4G97A 2JGNA 4E5KA 1QF9A 1KOLA 4FT2A 2CE2X 1E89A 3HLKA 3DQPA 4KCGA 3PVZA 1FNMA 4UC0A 5ADWA 3GZNA 1XRQA 5IPFA 4RETA 4PZ9A 3IDZA 5KTPA 3DLIA 1K4KA 4ZVPA 1MHTA 2HMUA 4DPLA 4WXRA 2GK4A 2XMZA 1XA3A 1PZMA 4GDFA 1RXYA 5FBKA 4BFZA 3Q5EA 2EKLA 4TS1A 2DH5A 3CRNA 1FDRA 1OBFO 1M6NA 4G3XA 4LC1A 2BSXA 3ED5A 1ZQ9A 1XZGA 1BX1A 4DKXA 1HL7A 2YXBA 4GYYA 4DL9A 4GEGA 5CDGA 5EJ5A 1N0HA 2HLPA 3NV7A 4REQA 3QU9A 1MC5A 2XDAA 3AESB 4H1WA 1E59A 2PLFA 2VK2A 3HKBA 4ZGWA 2WAOA 4FOPA 2G3YA 4DREA 2FTKE 3E58A 3JWGA 1J1IA 1YBMA 3W78A 5I9NA 3KOWA 3LWNA 3O3CA 3B5EA 3FETA 5AI0A 5FOVA 5H7XA 1RJDA 3INRA 5B53A 3WJAA 1C29B 1C8VB 4WFKA 1YCHA 4PWZA 3SS8A 1I94B 1FMTA 1RXCA 1YQUA 4F60A 4PYKA 4JZKA 4UNPA 2ZUVA 3AEKB 4BLUA 1F2TB 2ZE7A 4OQXA 1QGAA 1DUVG 2I0FA 2I29A 1LPBB 3ADDA 4QOJA 3OEYA 3IVGA 3DCYA 1FU7A 1F1BA 4RVSA 3NKFA 5FJIA 5BVHB 1L7QA 1P5FA 2BFFB 1N3BA 1BFKA 2DWUA 3DKKA 4B7AA 1O97D 3R0ZA 1SQFA 3B1YA 3A9VA 3BKWA 1TQ8A 3GV0A 5C8DA 3JQPA 4HFMA 3V1KA 3WA7A 3QPBA 2RE8A 1CYDA 1CR6A 2WUDA 2Q3CA 5A05A 5LWHA 5E2BA 2RKWA 3R4CA 3BJMA 3UWSA 1U9IA 3PPVA 1OH8A 1E64A 1Q15A 2FR1A 2GZDA 4HAWA 4FHEA 1KNQA 4B4UA 1PQWA 2FFAA 5TMEA 1C8LA 1XU4A 1WABA 3G82C 1KJJA 4LJKA 4HZGA 1SIOA 1PN3A 1WP9A 2VXBA 3FZEA 2ZAGA 3KT8A 4QFMA 2D1QA 4YRRA 3H9QA 4E5NA 3JQAD 4OO3A 2J46A 2RG7A 3VZRA 1SKUA 4EQ6A 5GINE 2C29D 3FHTA 1OXVA 2ZEJA 2B9VA 4EJ6A 5H83A 4BIMA 3QOFA 3FYDA 3EIOA 4D8TA 3IIKA 3CRZA 5EIWA 1KZGB 2EDCA 4BLWA 5A4FS 4J4BA 2R84A 4QEKA 2CL0X 4PFQA 3TW0A 2VEOA 4Q16A 1AQ6A 3R7DA 4PYNA 2FQ1A 2EKPA 3KZMA 1E4EB 2GZSA 2HLNA 4QGGA 4EJMA 4JXZA 4MWTA 2VJLA 5C37A 3MJEA 4H6PA 3QUAA 4QBIA 3A9TA 5JDIC 1L7MA 1B1CA 2B7BA 4JKOA 5ITZB 3K8YA 4UVGA 2GILA 4YRJA 4U2FA 2VTEA 3I9KA 3AF6A 4DANA 2HB6A 1PJ4A 2A1TS 5JZ9A 4U02A 4M54A 5B4UA 5JC1A 4QAQA 3JY6A 1ZR4A 3KZCA 1VI2A 2EYQA 5IJWA 4KLAA 1HFEL 3QELA 3I1YA 1PR0A 1QDLB 1RQPA 4PIPA 4XXHA 1T3HA 1T8TA 3I30X 5TIIA 3WKBA 2Q28A 5A6SA 5KINB 2XUAA 1GPNA 1Y1PA 3TZKA 3ROEA 1TCAA 2VJQA 1GTRA 2ZVDA 2PXAA 2H3EA 3BE6A 3E18A 4CKWA 1KVSA 2JLRA 1H5UA 1QF7A 1SY7A 4L28A 1EKXA 3JQRA 1YOVA 1ZPDA 3C98A 1VI5A 4YFYA 1Q50A 5BQ5A 3RK0A 3OOWA 3DLPX 3EXFB 4M0PA 2QYOA 5D5PA 3W8FA 1R00A 2FP4A 5AVKA 1WW2A 2A5GA 4M1YA 5E6SA 2K6GA 3WGZA 4LF5B 4F2WA 4MUKA 1CUAA 2WJHA 3RRBA 2QQ0A 4C7JA 3JQDA 1JHRA 3NTRA 3ZIDA 3Q6MA 1SBQA 1EXNA 4GECA 2ZBGA 4RA9A 4RXMA 5I45A 4Y2HA 3OIGA 2BZ1A 1TK3A 2HPZA 1U2TA 2Q4EA 2DFDA 4Q7LA 5EMJA 2NTEA 1SZJG 3P2KA 2ASEA 1CUYA 1P8JA 2GI4A 1V35A 1ZD3A 1PR6A 3CIOA 3IQGX 3AW9A 2UUOA 2XVYA 2X7JA 4IMRA 3BDAA 4MCHA 4OOEA 4HRAA 5H3CA 4DDMA 4LOJA 4OA8A 3F4BA 1Z2EA 1L6IA 4QHSA 1P3Y1 3OD1A 1L7EA 3OEWA 3C3BA 1EK6A 5JH7F 1QGUA 2AEFA 3HVHA 3IVRA 3DE2X 4HHEA 5FXMA 2YDXA 2VP3A 1QTQA 1JBQA 1EE9A 1RLUA 2ZUBA 5E7MA 1UIMA 3HBLA 5KOHA 3AM4A 1OLXB 3U7HB 4EYQA 1BROA 2OFWA 2NUAA 2P2SA 3V46A 2C8LA 4YMTA 5LL6P 1P2VA 1Y3CE 2IZZA 3BSYA 5HEKA 1HE1C 3DMPA 3A7EA 3TR0A 4AF8A 3GO4A 1WB9A 3LDHA 1E9RA 3AJAA 5JPIA 2FCAA 3BK1A 1MXHA 5I51A 2HM7A 2FW6A 4TRMA 5JFGA 2AXQA 4O25A 1KI2A 3ZLJA 2JLVA 3G9XA 2QRHA 2V0CA 2RKBA 4F4UA 1GNLA 3RJZA 5AQ1A 3TIGA 3IO3A 3W4IA 4LJSA 2NG1A 4IJKA 2CWWA 2PFKA 3ER6A 4EHNA 3M1LA 1PEAA 4GF5A 3S0JA 1A9XA 2WZQA 3WLSA 2X1VA 1USIA 3B3QA 5EHQA 3QPVA 1CFJA 1OTYA 4KYUA 2L18A 2BUBA 3LMKA 2M6LA 1FUKA 3C8ZA 1CDZA 2FEWB 4RDIA 3NHLA 3BHNA 2ZITA 4NC9A 1BSVA 1OREA 3OFSA 4P33A 4XJTA 4JI2B 3PHBE 4D99A 2JVJA 3KBBA 4EW1A 1A5BB 3ASVA 4LHZA 3CSDA 5EWMB 2H1VA 4CG1A 3GL9A 2HL6A 1XQYA 1H2XA 3QENA 3UENA 5KU1A 2QX8A 3CVJA 4EUKA 4IFBA 4IQGA 3QNUA 1YRLA 3OLCX 4HAXA 1SUFA 2VA8A 3WLPA 1FDTA 2PGIA 3TW6A 2QVBA 2WICA 1U1EA 1WM1A 3KTFA 2F2TA 3T9AA 4DILA 1FNSA 3F90A 3L0PA 4L7VA 4PXYA 5KDOA 1W6UA 2V3WA 1L7XA 1SBCA 2EBUA 3DQQA 4H7KA 3SGLA 1W5BA 2QLMA 2HGSA 3L1UA 1FK8A 3NIDB 3DTTA 2GZ1A 3LXUX 1WRBA 1NP3A 2I2WA 1JLLA 3R6WA 1C9YA 4D8UA 4JS0A 3X1JA 5G02A 2HZ7A 2X6TA 4N0MA 4F4IA 2VPTA 4J0HA 1FDIA 1US8B 1VJCA 3MJHA 3O82A 3WS7A 4MHOA 3CURA 2WABA 4M37A 1WY5A 2IUTA 3FWYA 3S27A 5HRCA 4TVBA 3LPMA 3OQJA 4DSZA 3ZDBA 1ZGZA 4K9LA 4JOQA 1UXKA 3HVKA 2A57A 2ZQZA 3RLFA 5ARBA 1S02A 4I0WB 1NV9A 3ZX4A 1DPFA 3DYBA 3I05A 4W9NA 1XXHA 3OLYA 1LC0A 4ZCTA 4L7QA 4UTZA 1UFRA 3P71T 5A1JA 4XPZA 1Y3AA 3FKJA 2WHRA 2EP7A 2ZJAA 1ECGA 2I22A 2J87A 2RFLA 1PG5A 5JXJA 1OT3A 2J3LA 5FI3A 5HMMA 3R3VA 2H9YA 4N0EA 4KSBA 4N9QA 1UODA 1WCWA 2JJ2A 2WJIA 1E2DA 1KYZA 1E58A 5DNAA 3WX0A 3WZLA 4D5EA 2J32A 2NP6A 1JJVA 2IW3A 3PD1A 1FTGA 3EQ2A 1Z68A 3O91A 4FLEA 4E5PA 5HHTA 1ZWLA 3AIMA 1W2WB 3TD6A 4YCAA 1WDLA 4X7BA 2O05A 1UJ6A 1VQ1A 1Y37A 2BT4A 3C6ZA 1DQRA 3RSOA 3QTLA 1JE0A 4IXTA 2Z04A 5CK5A 4IFEA 4OHZA 1YTUA 3SXUA 5FWYB 3I5AA 1Y1KE 1M54A 2PXHA 1JA9A 1DQYA 2JLCA 4WA8A 2ILVA 2FXVA 4JYZA 3P0EA 1W96A 4GMGA 4BGUA 4ZV4A 3PR3A 3SPXA 5HYVA 5A1TA 1IWOA 5I6DA 5KNDA 3Q7PA 2HEGA 1ECJA 2DY1A 3OZ7A 2IQIA 2VH5R 1W29A 3LWZA 3DKVA 4FZ5A 4P36A 1Z0DA 3ELBA 3PFGA 3RRYA 4LY0A 2FZ4A 4HNAB 3H9UA 5ETJA 4BMZA 4EABA 4ZI2A 4LJ6A 1OH7A 3CUWA 2Y0PA 1XTIA 1F1JA 2E49A 4LBVA 5BV2P 1E9AA 3LLVA 2KBFA 2QVCA 1EINA 2YIJA 5TRTA 4AZ0B 1JHDA 4JP2A 4PO9A 3I4FA 3VKVA 4RM2A 1Y1TA 3IP5A 2GCIA 1NNI1 4FFDA 1DOHA 1NFQA 2DPHA 2G8LA 3GLSA 3HEBA 4U7HA 3A9SA 3M82A 5M2QA 4OP2A 1N3LA 4WZAA 2GZHA 4XIYA 3SJ7A 2VT6A 5E3JA 5F7XA 2IBSA 1QX4A 3RDPA 3WL3A 2XUKA 2P6UA 4CZ2A 3ZVKA 4KJZA 4DJTA 3HJFA 3ZHXA 1EK2A 2A5DA 1HZZC 1XDSA 5DWQA 3SLRA 4BVFA 4B3MB 4HYYA 1DAKA 1CUDA 5DI9A 2JGJA 3K92A 1YVRA 3LVRE 2W8BB 3DBRA 4FQ8A 4YP7A 2QNBA 4NE9A 5KQRA 2PGNA 5JDIA 4XQ0A 3UG7A 1JMKC 2FUG6 2GLXA 2OV8A 4LJ5A 1FU8A 4QNRA 4D96A 1PNVA 4LRSB 5TEWA 5EJ6A 4HLDA 1U2DA 3REQB 1DG9A 1I5RA 3FJYA 1JTEA 4RFSB 3ZBPA 2RAFA 2F1HA 4UFPA 2PVCA 3EFOB 1ZM4A 2H0QA 2DT5A 3GBPA 3E53A 4WCFC 1U6KA 3BH7A 1AV7A 4XJSA 4TRJA 4FYMA 1O77A 5A9TA 1TZBA 4BJ6A 4F5EA 2H1SA 4U9HS 4JC8A 4RCZA 2FUG1 2VF4X 5KYUB 3KEMA 2DC1A 3WAGA 2FZ5A 3IUBA 2LXNA 4BMYA 2IEAA 2B69A 4GW3A 3O03A 4JJKA 1ZONA 2VNJA 4KO1S 5E9AA 3X2FA 4BBPA 2O2GA 5EHXA 4E3WA 1Z5PA 1VP3A 2BMWA 3AIKA 2HRRA 3EAFA 5K6RA 2GPYA 4E5VA 1TZ2A 1PJTA 3Q3JB 4ZI7B 2PK3A 1XDZA 4RHTA 1JB9A 1MMFB 3X1KA 2EFDB 1NXQA 5F52A 4ND3A 4B4KA 3OTIA 4GE3A 1T15A 1TM2A 2OV4A 3AOEA 3HB0A 3N2IA 1Z07A 3PFCA 4NDNE 4XM0A 5CDFA 2WWHA 5G1NA 1VOTA 3UY4A 2ISQA 2NVUA 1VL2A 5HJ2A 3OCUA 3I23A 4Y0AA 3B2NA 3TOZA 2NPFA 3ECSA 1IEXA 3E9ZA 3SK0A 1H0SA 5CEJA 3QKRB 4Q3BA 1SXIA 5I4IA 1RKBA 3RIMA 1P0PA 3AHCA 1IOZA 2FYTA 4F86A 5A7FA 4KR2A 1KDPA 3WHPA 2RAVA 3V32A 1R27A 1P4SA 2QIPA 1EFHA 5IH3A 3FIUA 5JQWA 2W4QA 3E3OA 1LNQA 3JAKA 3IR5A 2UXBB 3PXEA 2AYYA 1Z18A 2YRFA 2B2XA 3DZFA 3LTNC 4EI7A 4C2BA 1RKXA 1SPBS 2C4WA 4KO3S 3BGOS 4M49A 5F3WB 2JIQA 2ZVJA 4ZOAA 3TSWA 1OYOA 4IAOA 3HCDA 5CITA 1G41A 1LS6A 1ZM7A 2J45A 1GKUB 2X4GA 1J2UA 2C2GA 1Z7BA 3IKLA 3NHBA 4FYYA 5C4IA 3INNA 1BN6A 3KPJA 3L7NA 1NN5A 3VPHA 4FINA 1MGPA 2IHJA 4X44A 4RHXA 1VJGA 4AP5A 4HQNA 3TLBA 2C4MA 3RNOA 1YCFA 4F1WA 5A5DA 1BDMA 2CK3A 3CSSA 2JAPA 2G1JA 1X7WB 4Z4HA 4C7VA 1VJ5A 2HU2A 2PA3A 2PKYX 4JGBA 2RJ3A 4DBZA 4MJ7A 3RRFA 5LJIA 3ZJUA 4JLWA 4ZAWA 1RBQA 2VRWA 3DV2A 2FX3A 5AW3A 5L9AA 3AF5A 4URFA 2HSJA 1N1GA 2O7NA 4M6WB 2VPQA 3DEAA 4MQBA 2XITA 1TLLA 2MMCA 3P2EA 3BIWA 3PQ7A 5A4AA 3S2UA 5CA0F 2UYCA 4O3MA 2VPIA 3DGFC 1X94A 2QD3A 1MJFA 3IDOA 5LR6A 2FEKA 3P4XA 5JXIA 5ALYA 2UXCB 3RVDA 1NUUA 2Z09A 1AIPA 1THZA 2NZXA 2IX3A 5CVUA 2X0IA 2WUFA 4AN0A 3AUKA 4N76A 1BFUA 4WOPA 2CLKB 1CQPA 3W6ZA 1N1EA 3AXTA 4Z1OA 5FUMA 1N5JA 2IHZA 1OFIA 3I73A 4CLOB 2NO5A 1T24A 3RAEC 4QG3A 1U9CA 1L1EA 4RV4A 4J16C 1V8PA 2G04A 5LB4A 4DMLA 2WP0A 3CC8A 3ZK8A 3D6NB 1DO8A 3HDQA 4ZZ2A 2YY6A 1MJNA 3TQRA 3KFLA 3KOZA 4LX0A 2QMOA 2ZZKA 3RUPA 1ORHA 4XYGA 2VK8A 1C4XA 2H4YA 4QUAA 3CVXA 4S24A 3SD7A 4R41A 6PFKA 2BBOA 5AM5A 5JNLA 1H65A 2I34A 1DCMA 1PSZA 1UBHS 3NM6B 5ICCA 3CRW1 3JYQA 2WKWA 1JG1A 1RQ7A 1HDXA 3FFWA 2IYYA 3GT0A 2GR9A 2H18A 5D5HA 5CFOA 5JZSA 1ZCZA 4OSPA 4MLCA 3DBOB 3K72B 4IFTA 3GDWA 1Z0FA 4Z86A 1DIOB 2B99A 3EXAA 4DRZA 1RFGE 4PTZA 1UBGA 5AFSA 5JJKA 2HSWA 3NHKA 1BXGB 5KMGA 2LCQA 1V3TA 1T26A 2Q3EA 2G6BA 3EG5A 3LBIA 1UBLS 3QFCA 3H1GA 1SUPA 3U3KA 2PZKA 3PE3A 5HF9