2CDCA

Sulfolobus solfataricus glucose dehydrogenase 1 in complex with nadp and xylose
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
366
structure length
359
Chain Sequence
MKAIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGADREIVNGKLGKDFLVLGHEAIGVVEESYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHGEIKIRILWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis of substrate promiscuity in glucose dehydrogenase from the hyperthermophilic archaeon Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
molecule keywords GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE, DHG-1
total genus 123
structure length 359
sequence length 366
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.120: Galactose 1-dehydrogenase (NADP(+)).
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cdcA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2cdcA01
2Y99A 4XB2A 2JD2A 2OL4A 3WSVA 3ZHZA 4IJVA 4GX1A 4IXTA 1V3TA 3WYBA 4NIMA 2BHLA 2EV9A 1X7DA 3PZBA 3WXBA 4BO7A 4CR8A 1A7KA 2FR1A 2FWMX 2BI8A 2HO5A 4XGIA 5TT0A 1NWCA 2NVBA 3PGJA 4DA9A 4RO0A 1NAIA 5KNLA 1YQDA 3FBGA 2AQKA 4FCCA 3PDJA 4WE3A 1NFQA 3IJPA 3GVHA 2PNFA 2HMUA 3A1NA 1UZLA 3WNQA 3I52A 3U4IA 1B8PA 4WECA 3FNEA 1KOLA 5A9SA 3RC2A 1R4MB 2I6TA 2PFGA 1GCUA 2EHDA 3A4VA 2J3IA 1T2FA 4NR0A 3WQRA 1WMBA 3AUSA 5A04A 4I5DA 2V6FA 4M86A 4IDBA 5T5QA 4BGIA 1EUDA 3ZWOA 2QQ5A 1BG6A 2H5LA 2IZZA 2W98A 3WGTA 1LSUA 3AW9A 4YXFA 5A02A 2QZZA 1YBMA 4DWVA 5JC1A 2JCYA 2Y68A 3HB5X 1M66A 1ZUD1 4M54A 4MO2A 2E49A 3LK7A 4BNTA 1AXEA 5I9NA 4W7HA 1Y81A 2DTDA 4RJTA 2Y1DA 1CRWG 2WJPA 1I01A 1YB4A 2F1KA 3H5AA 2JL1A 4XCVA 1Q0HA 3JD2A 4MJLA 2NNLD 4L4XA 2P4QA 3ZHBA 4B79A 5TIIA 4EW6A 1BTOA 4E12A 5JY1A 2B35A 5COQA 1KY4A 1QLJA 4WOKA 4UEKA 4GQAA 3E5RA 4W99A 1BW9A 3L6OO 3I1JA 2YV3A 3ONEA 3B6ZA 5GMOA 2QW8A 4F3YA 4MKZA 4E3ZA 4E5NA 4HADA 3DZBA 3L4SO 4J7CA 4JJIA 4IDAA 4LSMA 1T25A 2IRWA 4GWKA 4PIVA 3VH4A 2GO1A 2P5YA 1P1IA 2CY0A 7ADHA 2SCUA 4D44A 3OFSA 3VOSA 5GZ1A 3CPSA 2BD0A 2GN6A 4RPLA 2Q1SA 4KOAA 1EBUA 4TRRA 1WDMA 1JVSA 2PD6A 4RPKA 1DFHA 5DZSA 1ADCA 1ZSYA 5L7TA 4RZIA 2OO5A 1B3RA 3ZWCA 4WNIA 3U09A 2OXIA 5I8ZA 4RDHA 4YAEA 3TOZA 1E1NA 4NU6A 4YJGA 1DIBA 1HZZA 1B15A 1BVUA 4N18A 4NBUA 1IE3A 1PL6A 3BHMA 3KBOA 2EXXA 4I9HA 1MG5A 3ETGA 1IL0A 6ADHA 4OQYA 4IJWA 1EFKA 2A9FA 4WLUA 3BZUA 1O9BA 4IMRA 1KC3A 3O38A 3O03A 4L76A 2QX7A 3HDQA 4RQUA 1ZK0A 3DZHA 3WLEA 1SB9A 2YY7A 3WQSB 1GUFA 2OBYA 2R00A 2VQ3A 1R4NA 2V65A 5EMHA 2FSSA 3PDUA 4IUYA 3GN2A 3IP3A 3M1LA 5COAA 4DPMA 4YRAA 4CMIA 4J90A 1WWKA 5IXSA 3S2EA 5FF9A 3OIFA 3ZHXA 3WJ7A 1MA0A 1F17A 4U0JA 2B4QA 4XQEA 3F5SA 2RBEA 3H9UA 4XD2A 4XWYA 1UP6A 2V6MA 1AE1A 1H9BA 1SOWA 3ICPA 4WLVA 3WGGA 2PLAA 4Y9DA 1LUAA 2P4HX 5CDSA 2VNSA 3L4BC 2DFDA 3DZKA 1PJSA 3C24A 1QYVA 5ITVA 3AFMA 3RWBA 3RIHA 3C7AA 1K2WA 3JYOA 4UREA 1UUFA 4BNYA 3P2OA 4M8SA 5L7YA 5MGBA 2D1YA 5HBRA 3U0BA 1A72A 3KSDO 1LSOA 2C5AA 3DFZA 3V2HA 4P38A 1C0LA 4FJ1A 3D4NA 1GYQA 1NPDA 2C2XA 3DAFA 3ASUA 4AJEA 2ZJ1A 3QVOA 3PJGA 4OSOA 4AJPA 1X1EA 4MVJG 3WLFA 1NAHA 2P9EA 4JP3A 2DC1A 4IDEA 1AXGA 1XELA 2UVDA 3NTOA 5T57A 5K0ZA 2O4CA 1Y9EA 1MFPA 5TT1A 5C7LO 2VZ8A 5ITWA 3GF4A 4QEDA 2DUWA 4W9NA 4XIYA 3FWZA 4HFMA 3GMSA 5CEFA 3V1UA 1DRWA 1H93A 3KYDB 3RROA 3WMWA 1X0XA 3HSKA 3WNVA 4CM9A 4BO9A 2PKRA 5TSDA 4CMBA 4F6CA 1FMCA 4WCFC 4CUZA 1YVEI 5JAZA 3LF2A 3ZWYA 4BGUA 2NVUA 4BKUA 3DBHB 5LDGA 4E5MA 1ZCJA 4FFPA 3WX0A 4E32A 5HA5A 5IF3A 4ZGWA 1O89A 3FCOA 3OECA 3DTTA 3D3WB 1OZAA 2Q1UA 4RVSA 4B3IA 3OMLA 4KWHA 4FD3A 1NXQA 3LC2O 3W6ZA 3H3FA 3EZLA 3GH3A 4Z3KA 4BNHA 3MJEA 2NTVA 4RVUA 1H94A 5HTOA 4PFJA 3KEQA 2FN7A 3ANMA 4EJ0A 3HN2A 4ZVVA 2B4TO 4KTTE 2IDZA 4P4NA 3ZWNA 4XYBA 3DMTC 4AJ1A 1QYWA 4UUOA 4J7XA 5AXDA 1YB5A 3C1OA 3W1VA 3ZU3A 4MVJE 2AG8A 2FP4A 2I5PO 4AJJA 1M76A 4MKRA 2AW5A 4A0SA 1WPQA 3I3OA 3GFBA 4D3FA 4DYVA 4WPGA 2V6GA 3EC7A 2PTGA 3JQ6A 4BGEA 3I9KA 4E5YA 3R0IA 1JN0A 2OP0A 5A05A 4MOWA 4RPHA 4PN3A 1OOEA 2O7SA 1MLDA 2PWZA 4EYEA 3QIVA 1DIHA 3QHAA 5F5NA 1D4FA 7MDHA 1MV8A 1OI7A 5BR7A 3WG9A 1Q0QA 4OQZA 1ZEMA 2Q49A 5C37A 3H5NA 3JQ7B 4M55A 3S2IA 1JKJA 5CDTA 2NSDA 2E48A 2JFFA 5H81A 1H6BA 5JCJA 4FOOA 1OBFO 3AY7A 1WAMA 2D8AA 4II3A 5T67A 2B4RO 3IUPA 5HM8A 4E30A 3VC7A 2EJWA 2FZWA 2XXJA 2IZ0A 2ZTUA 4NMHA 3OEWA 2VOEA 2X1HA 1V8BA 5KKAA 1HDCA 2ZB8A 3BA1A 4K6CA 4LN1A 2ZATA 1L7EA 4BNNA 4CPDA 3E9QA 4Q3DA 2AQHA 4RZHA 3CEAA 4NFSA 3SBOA 4YACA 5IDQA 3ENKA 5G4KA 1DO8A 2OOSA 4DYDA 2Y93A 2AQ8A 3ABIA 1XHLA 4HX5A 4W82A 3ZNOA 3ZWWA 3QSGA 2YFHA 1CYDA 3F5QA 1LDEA 2JAHA 1HDXA 5ENVA 3WWZA 3LVFO 4I5FA 1ENYA 1EFLA 2B83A 3PQDA 4HFJA 3K2BA 4L4SA 3TDKA 1ZH8A 1SBYA 4BV8A 3O26A 2YHUA 3O4RA 1HTBA 2NQTA 4NI5A 1D1SA 1T4DA 4QO7A 3STHA 1GV0A 1LRJA 1KIFA 3RQSA 3U49A 4OXYA 4RF2A 2W2KA 4ALIA 1I3NA 1IOLA 4JCOA 4ESOA 3IS3A 5BSFA 1N9GA 4GL4A 5DBIA 1N1GA 4BB6A 3I83A 3JQBA 5B4VA 2Q2WA 1XIVA 4CR6A 2DPHA 2PH3A 1PQWA 1LRKA 1PGNA 4MP3A 4J2OA 1HE2A 4NBRA 1ISHA 5COBA 2X6TA 2OHXA 4TVBA 1I2ZA 3VPFA 3S55A 3DAGA 1GZ4A 1Y7TA 3OJEA 5AOVA 1ENOA 3VVBA 1LTHR 3L07A 4R3WA 3MTJA 2GERA 1Z7BA 5KWEA 5B37A 3S2GA 1FDUA 5A9RA 2W2LD 3L9WA 4IDDA 2VYNA 5CFZA 2FMUA 3B1FA 1K3TA 3B70A 3C1TA 4LK3A 3OICA 1E3LA 2I76A 1C0KA 3AOEC 3EMKA 4LMPA 3GFGA 5ENDA 1G1AA 2D5AA 4WEOA 4EGFA 4RVHA 5I7VA 1Q1NA 4N54A 3V1TC 4Q3NA 4CLOA 2G82A 3WIEA 1WZIA 4EEZA 1K6JA 3FR7A 3ROKA 3HDJA 2HJSA 3KOUA 3ORFA 3H5RA 5IAAA 3NT4A 1ZVMA 1SMKA 5A1TA 1QR6A 1EDZA 3DBLB 4OXKA 3ZWXA 2NV6A 2X5JO 3GZNA 3R3JA 5ER9A 3ROMA 1HDYA 4ND1A 9LDTA 4NBTA 1H5QA 4XQ9A 4CM4B 2GN9A 2A35A 3ANNA 4KMSA 3PQFA 3NJ4A 1E7YA 5DP2A 5F5LA 4J4HA 3VH3A 2NM0A 2PKQO 2VHXA 3AI3A 5IZCA 1ZSNA 1R4MA 1ML3A 4E2ZA 4BNKA 5ADHA 2X5OA 3R1IA 4GLOA 1H2HA 1MXFA 4D45A 4JIGA 1M75A 1HYGA 1S7CA 4CMKA 5KJ6A 1HSZA 1M6HA 1UP7A 2CF6A 2GD1O 1C0PA 4IQ0A 5T8KA 5IDWA 1I30A 5HWSA 4BL5A 4TZTA 5EL0A 1IZ9A 2WSBA 4FBGA 2D5CA 5A9TA 1ZJZA 3TFOA 1M6WA 1WDLA 2X9GA 2ZCUA 4XR9A 1HE5A 1P1JA 4QO8A 1PZFA 1Z6ZA 2F00A 5CG1A 2P5UA 2JHFA 3W8FA 4UULA 3BMNB 4LMRA 4U6QA 3AY3A 4YR9A 1R15A 4OXNA 4M87A 2W2LA 4CMJA 3HN7A 4UVDA 5KCZA 1B2LA 2BI7A 2EGHA 3OQ6A 2LDXA 4IMPA 3CMMA 1CJCA 3V2GA 4BNGA 4GGOA 4D3SA 3PK0A 3UOGA 1KVTA 2Q1TA 4EJMA 4WUVA 2HMTA 3W8EA 2VHYA 5L4NA 1E92A 3MCVA 3UXYA 4CV2A 4ITUA 5EN4A 3GAFA 4B8ZA 2HK9A 2J3JA 5DNAA 2JJYA 4HNGA 4HFRA 3PJFA 1O0SA 5JNLA 3D4PA 3NX4A 2JCVA 2DQ4A 1BXGB 3ONFA 3PHLA 3RUFA 3WOHA 4TKMA 4XJTA 4YJGB 5AVOA 5KVCA 1DEHA 2YW9A 1E3IA 3JQ8A 4R68A 1F0YA 3UF0A 3JD3A 4DVJA 4BS9A 4R69A 3CH6A 4BOYA 4YRBA 3IC5A 1H2BA 4CMGA 5JXWA 4K28A 5L7WA 4IBOA 5CAEA 2Q45A 1PQPA 1LEHA 3JD1A 4IM7A 1Q7CA 2C5EA 2ZB4A 3ZV3A 1UJMA 2DAPA 3FNGA 3PP8A 4J3FA 4DLBA 1ADBA 2EP5A 4CM4A 1FJHA 1YQXA 5G4KB 2DM6A 4CUKA 3ZU4A 4E21A 3TZ6A 3BHJA 3TJRA 1CWUA 3QVWA 2CD9A 3D0OA 4BHTA 1LC0A 3G1UA 2G17A 2WD8A 1N2SA 2PY6A 4RVDA 4CM6A 1VLLA 3H6KA 4UVIA 3V5NA 3MTGA 4D79A 1EVZA 1I33A 3ZGYA 1QSGA 1PJ2A 2CNBA 4YCAA 5TGDA 4BO5A 1F06A 4EJ6A 1P9LA 5JLAA 1A4IA 5EESA 3JQGA 2IE0A 4CMAA 3KYDA 2PKQP 1Y5RA 5G4LA 2VUSA 4HKTA 1PQUA 1ULUA 2FPPA 4H15A 2R6JA 3ETDA 4D0SA 4Q3AA 3PHJA 2LDBA 4AJHA 1Q2XA 3Q6IA 1XU9A 3VPHA 5BSGA 5A3JA 1VJ1A 4NBWA 5JO9A 2TMGA 1U3TA 3ADOA 3B1JA 2ZK7A 2PGJA 1HRDA 3KEOA 4L8VA 4ND4A 4OYRA 4CMCA 4DPLA 3GDFA 3L9XA 1R37A 4RPGA 3O8QB 2EGGA 5THKA 3LLSA 3GLQA 4E0BA 5L9AA 4CLRB 1CQJA 2AQIA 1D8AA 5DOZA 1CIVA 4AJNA 1B8UA 4LRSB 4DGSA 2YV2A 1A9ZA 1P31A 2ILTA 3G3EA 3L6EA 4RLSA 4J1NA 1NVGA 4D46A 1KVRA 1ZNQO 2DTXA 1U28A 4MP6A 4Z3DA 1I2BA 3TZCA 3DBRB 3IKTA 4PRLA 1ADFA 3U3XA 5BQFA 4Q9NA 1PIWA 3DHNA 5ES3A 4FR5A 4AFNA 5CEJA 1Q0LA 5L53A 3KYCB 4BUCA 1VC2A 5G2OA 5ILOA 3K8ZA 1SPXA 5DF1A 1YE3A 4WGGA 2YFQA 1YXMA 4XB1A 1UAYA 1VL6A 5U1PA 1A9YA 1Z75A 5G0SA 3K96A 4UVHA 4CUJA 1F8FA 2GDZA 4CM8A 2Y67A 3I4CA 1V6AA 1ZKMA 3FRJA 3BMCB 2H1SA 4DXHA 3GOHA 3UUWA 4A03A 1GL3A 4LCJA 5ICSA 4ZHSA 1EE2A 1VSVA 1SAYA 3TPCA 1XCBA 1HE4A 3IKVA 4BNMA 3H4VA 4PZDA 3BYZA 5TS3A 3CKYA 1HKUA 3B20A 4DQVA 2Z1MA 4W4TA 4XA8A 3QWIA 1BDMA 2C7GA 1D1TA 2I99A 1YQGA 2ZYAA 4AJOA 1FDTA 1RJWA 4I8XA 1QYXA 3RU9A 6LDHA 3MJ4A 1DXYA 1YS4A 1H6AA 2EKLA 1TXGA 5EIOA 4TRNA 1TA4A 1PS0A 1IHXA 4ONEA 1XG5A 5FI5A 3DC2A 2C54A 3QWFA 3K73O 3PLRA 5DN9A 1MGOA 3AY6A 3KYBA 3UICA 5EINA 4CMEC 1E5LA 1KERA 1T2CA 3LT0A 5JCXA 1F12A 4DQUA 3MJCA 1XGKA 3JYPA 1EQ2A 4E5PA 3W6UA 1KBZA 5FYDA 3U4CA 4BGVA 4KUHA 4ZU3A 5A9SB 3TF5A 3MJTA 3EAGA 3VDQA 1AHIA 5JSFA 1Z73A 3K92A 2Q1WA 3TSCA 5K1SA 3QLJA 2VHZA 1T4BA 2BFMA 4OSPA 1DC6A 3QVTA 4BMVA 2Y1EA 2NWQA 1U7TA 4ZJUA 4UEJA 1QMGA 4EEXA 5GZ3A 3Q1LA 2X4GA 3OA0A 1CQIA 2WDZA 4RF4A 1WDKA 3OJLA 4GKBA 4JQCA 1LJ8A 2XXBA 2NQ8A 4ALLA 5JW6A 2GCGA 1YOVA 1VPDA 1H6CA 2IXBA 3CTMA 3GEDA 3RKRA 3JQGB 3T4EA 4OL9A 9LDBA 1C1XA 4TRMA 5B12A 4NDNE 1EK5A 5ER6A 2Y1FA 3PIDA 5EERA 3WGQA 3B1KA 2GZ3A 3ZV5A 3HFSA 4M89A 3PWZA 4ALNA 1ZEJA 1DSSG 4J49A 3UAGA 4N7RA 5TQVA 2G76A 5TNXA 4B7CA 4E6PA 3PJEA 2HK7A 4BMSA 3I6IA 4PLWA 4LRTB 1NQAO 5IG2A 4R5HA 1H6DA 2IYPA 5F1KA 4JN6B 3RFTA 4Z9XA 3E48A 1JWBB 1R16A 3VHRA 5IDYA 3I9JA 3IJRA 2O3TA 1SO8A 1ULSA 3GRKA 3RBZA 5G0UA 3TNLA 2FR0A 2VWQA 4J1QA 2IEDA 3OF2A 4PVDA 4E13A 4FIZA 3RUIA 4G81A 5J23A 4WCDA 5JAMA 5KTKA 5L4LA 1KEPA 1HXHA 3H7AA 1B14A 4RVGA 1LXCA 2DFVA 1BW9B 2BKAA 3SEFA 4TKLA 4RL6A 2VRBA 3GMDA 5DULA 3NRCA 5BSEA 2D59A 2HMSA 3JCZA 4O59O 4Z0PA 4GSKA 4X54A 1RWBA 4GI2A 2NU6A 1LSJA 3G49A 4Y6SA 4ZQBA 2FHSA 4OOEA 4URFA 1DHTA 5JY6A 1VRWA 1LSSA 3RCBA 4RGBA 3GRPA 2FRDA 2DBZA 4DLAA 2VTEA 4C4OA 1JKFA 1X7HA 2C20A 3N7UA 3VPXA 4J4BA 1YDEA 3FTPA 1VJ0A 4CMIB 1Y5MA 3NTQA 1JDJA 5DT9A 2C29D 3DBHA 3E18A 4CODB 3OHSX 4ILKA 1I5RA 5FI3A 4WNCA 2C59A 4PRKA 1ADGA 3DONA 1ZZEA 4WCFB 3AOGA 4ZD6A 2E37A 2VWHA 2DBRA 2WYUA 2C0CA 2C7VA 2OZPA 2X23A 1ONNA 2BGLA 3RC1A 1E3SA 2VHVA 4HNHA 3BIOA 1GEEA 2O3QA 1DFIA 2JHGA 3OA2A 4J4TA 4GVXA 2PZJA 4O63O 3C7CB 2B37A 2UAGA 4L75A 4QT0A 1Y1PA 4N5MA 3EGOA 2PR2A 1ARZA 4F6LA 3FSRA 1O94A 2DTEA 1T2DA 3NT2A 1RYEA 4MVJA 4AJLA 1EK6A 1PZEA 2JD0A 2DLDA 3WB9A 4H16A 2E4AA 4BO3A 1ZMOA 4AVYA 1KEVA 5K6AC 4LGVA 1I32A 3SC4A 4PG8A 3EW7A 1GAEO 3ZI0A 3NEPX 1E7RA 3FI9A 2BRUA 4CL3A 4NZ9A 1GYPA 3QY9A 1ISGA 4MVJM 3BTUA 2OMEA 4RCVA 5H82A 4R16A 1VKOA 2O48X 4GMFA 1R0KA 2EJVA 4BV9A 4N5NA 4M1QA 4QQRA 3QV1A 2AE2A 2QHXA 2HJRA 3ONDA 1P44A 3VPGA 3K6JA 3OJOA 2O7QA 3HWRA 4HP8A 3U4DA 4DBZA 4FGWA 4JLWA 5A3VA 2XPCA 3IUSA 4W9NC 3VTZA 4MVJP 2EKPA 3QWAA 1ONPA 4E5KA 1E7WA 1SEVA 2AEFA 1NYTA 3AK4A 1J49A 3RSHA 3P2YA 4J43A 3KHUA 4P4GA 4HY3A 5I9MA 3VAZA 3MEQA 2H63A 4MVJF 3ZH2A 2UUPA 1Z7EA 5DCWA 1EVYA 1R4NB 2WM3A 4PZCA 3A14A 1DIRA 4ZA2A 4YB8A 3VVCA 2EW8A 3OJFA 4PG6A 4A73A 4GAEA 4YRDA 4BO4A 4FQ8A 3RC7A 1NQTA 3RVDA 1ISFA 4O6VA 3DXFA 4RPJA 1Y8RB 4MPDA 4BB5A 1EVJA 2HDHA 5CDGA 4IZIA 4MDHA 3WTCA 4YT8A 3UGKA 3D5TA 4NFYA 2FOIA 4JBGA 4RDIA 1BVRA 1PJCA 3Q9UA 1X15A 3LT2A 1TVEA 3FTNA 3F4LA 1W6UA 5JS6A 1E1KA 2CZCA 2O3RA 4LVCA 3L6DA 2PH5A 1P74A 4UUNA 3RD5A 3ZWMA 4EUEA 1GQYA 1YJ8A 4CR7A 4DUPA 5DCUA 1QV6A 3CMCO 4IZHA 4R1SA 3TQHA 3GK3A 1CETA 1PGQA 1DAPA 2CF5A 2BH9A 1U2DA 1JAYA 2PZKA 3CE6A 3E9MA 3TWOA 4CQLA 3EVTA 1V3UA 2PZMA 4MP8A 3HFGA 2B36A 2NTJA 2OBNA 4MIOA 2O50A 5JDIC 4YA6A 3HE3A 1P1RA 4ZQFA 3G17A 1H9AA 1R0SA 1VL8A 3D1LA 1F14A 3GZ4A 1XU7A 4CM1A 3U62A 3CSDA 4ALMA 5KKCA 1ISIA 1ZFNA 4ID9A 4RF3A 3RUDA 4FSHA 1LDGA 1GQ2A 4HBGA 5KVQA 3GDGA 1LLDA 2D3TA 2BGMA 3WIDA 5JYDA 1LBEA 4BQRA 3GAZA 5JPIA 5JCJD 1EVIA 2BF7A 1VE9A 3E8XA 3GGPA 4FOSA 1VM6A 5DDIP 4D42A 2EF1A 2X0IA 3JQDA 3LC1O 3RASA 3WMXA 4DTIA 4TWRA 2XF8A 2RH8A 2P9CA 3JQ9C 3KETA 4WLFA 3GEGA 3LF1A 4FJ2A 3FF4A 5JBIA 4U6SA 3OSUA 3VPSA 4YQYA 1YJQA 3BTSA 4DREA 1NASA 3VZPA 1PJ3A 2HU2A 5BNIA 4EBFA 2RAFA 2VT2A 2I9PA 3GGOA 2EWMA 3D4OA 4YPOA 1DC4A 3K30A 1DIAA 4IPTA 4BKRA 5FFFA 4CLDA 1DDOA 1E5QA 3N58A 3DZIA 2IYOA 1DOHA 1YB1A 3PPIA 3RBXA 1ENZA 1Z82A 1RM4A 3H9GA 1NP3A 2NADA 3PQEA 2B5WA 1WVGA 5ICMA 1X0VA 4PLPA 4MIEA 5F3RA 3P19A 3MZ0A 2WYWA 4CM3A 1U5AA 1D7OA 5U4QA 3WYCA 1SZJG 5L3ZA 4U7WA 1UAGA 3NV9A 4BVAA 3LC7O 2X0JA 4GX2A 1ZMTA 1DIGA 1P33A 4I5GA 4M49A 4L73A 3VH1A 3PWSA 3WDSA 4DQXA 4K1LA 4EDFA 4DLLA 5JDCA 1GYRA 2AE1A 1PS8A 3RFXA 2O3JA 1YKFA 1GV1A 4TRJA 2AXQA 4J16A 4CM9D 1SEPA 2UUOA 3OQ1A 3ZZNA 1PL7A 2HRBA 4PG7A 5TF4A 2VUUA 3WICA 2I3GA 4CMEA 2FSVA 1JLLA 4I08A 4XYMA 4AG3A 3JQ8B 2ZKLA 3MWEB 3BMCA 3BTVA 1XQ6A 1NR7A 3IAHA 5EJ2A 3H2SA 2X0RA 3OJ0A 2YYYA 3DHEA 5CEEA 1J6UA 4NJMB 4WKGA 1G0NA 4TQGA 1I3MA 4B8WA 2TMDA 3ITDA 1IPFA 4YAJA 2VNAA 4BO6A 3KB6A 4OIMA 4OAQA 4PGFA 2VRCD 2VT3A 1NTOA 4XZ3A 2BFOA 4GGPA 3T7EA 2VWPA 1BXKA 2ZTVA 4HXYA 3MOGA 2I67A 4BNIA 1HYEA 3RBVA 1YL7A 4BKPA 1WNTA 1MP0A 1X7GA 2D0IA 5BT9A 5IFLA 2VYND 3GNTA 1E7MA 2EKQA 4XRRA 5DBGA 5H83A 4MVJI 2X58A 5THQA 2AEMA 4YQZA 4BMNA 4P8RA 4XYLA 5T6BA 3EZYA 3ON5A 4AJ2A 1RYDA 4J1SA 2FZEA 4L4RA 4NH4A 5L95A 3GGGA 3HZZA 1NHGA 1DFGA 1PSDA 3HNPA 3F1LA 4R1UA 3GVPA 1NFFA 3GG9A 3R6DA 3GDOA 3H9EO 4CLXA 2VZ9A 3FNHA 3P5SA 4IY1A 2WD7A 1A27A 2B5VA 3ZN2A 2YQ5A 3HB4X 4YJDA 5U9CA 1PX0A 2X9VA 3A28A 1S6YA 1HF3A 2HAEA 1RM3A 1ZSVA 1BGVA 4WASA 1T2EA 4Y67A 1N92A 2PGDA 3C7DB 4CLRA 4R9SA 2PV7A 1C1DB 1Z45A 4C7JA 4U8GA 2X86A 1DPGA 3RUAA 1K5HA 5JO0A 2X0NA 1UXJA 5IXYA 1MG0A 4AJ4A 3I23A 1PWZA 1C1XB 3L4BA 1XLTA 1YGYA 4ZICA 1IHYA 5TJ9A 4YT4A 2BLLA 2O23A 4DRYA 1UXGA 1JW9B 3EUWA 3OBBA 5AQ1A 3AI2A 1NR1A 2G5CA 1HEUA 1VKNA 1BSVA 2AA3A 2PD4A 1PL8A 3A06A 3UN1A 2IEBA 1P3DA 1ORRA 1B0AA 1ZK4A 1LRLA 3MOIA 4R1NA 3RUEA 1NM5A 4TZKA 3NGXA 5AXCA 3V2UA 3JQ9A 1E1MA 1IY8A 1J4AA 3AUAA 1ZW1A 3JQAD 3FPCA 5JYEA 1HDZA 3I6QA 3NYWA 2VTDA 3RU7A 2GZ2A 2Q3EA 3DOJA 4BNFA 1U8XX 1B3BA 2PK3A 3F3SA 3TZQA 4CM8B 4EUHA 3MJVA 4UAGA 1OMOA 4O5OA 4TSKA 3D5QA 3OETA 3S8MA 3SJUA 1HDRA 3JQFA 4NFHA 2GLXA 4ALJA 2J3KA 4XDYA 2RHRA 5B4TA 3F46A 4KDEA 1LU9A 5CP8A 5JC8A 3KM0A 4II2A 1P0CA 2GYYA 2Q46A 2ZB7A 4FJ0A 4WLOA 1R0LA 3PIIA 1KYQA 1SC6A 2Q99A 4JBIA 1UH5A 1YWGO 1I10A 3TL2A 2HQ1A 5C7OO 2H9IA 3ZU2A 3KZVA 4NJOA 2DBVO 4Y6PA 1KEUA 3QWHA 1FDWA 4L74A 2ET6A 4J91A 1HWYA 2I3AA 5I8WA 3EVNA 2ZIZA 1EBFA 3V1YA 3VKUA 4MVJH 4XR4A 2ZJ0A 3PYXA 1VI2A 3GR6A 3PRJA 4E4YA 1GTMA 1UDAA 2WEKA 1V3VA 4CV0A 3ROPA 4PLVA 5BNTA 2Z5LA 3KTDA 3HJAA 2UYYA 3KYCA 3RFVA 1IYZA 3TRIA 2EG9A 3K2EA 3SX2A 1GY8A 4Z0HO 2YJZA 3ZWPA 1LQUA 1AGNA 2HLPA 3GPIA 1V0JA 4P22A 3Q9NA 2A4KA 4PLFA 3FR8A 2CVZA 4K9DA 4FN4A 5LDHA 3DOCA 4IDGA 1I8TA 3ZNQA 2A92A 5IDXA 4YBZA 2CMDA 1IULA 4YVFA 2Y05A 3COSA 4L0QA 3ZW8A 4A2CA 1W4ZA 1KVSA 3KSZO 1W0CA 1XR3A 2O3SA 2PD3A 5CDUA 3DL2A 3C8MA 1ZO8A 4Z6KA 3CZMA 1G0OA 3PYLA 2VUTA 4UVEA 3IL2A 1A71A 2YDXA 4YAGA 4YJFB 3GZNB 3WFJA 1UP4A 4TMFA 1PJTA 3VTFA 3ZHYA 4O0LA 2YDYA 1QG6A 4WK6A 1B16A 1A5ZA 3LSYA 3T7CA 4KQXA 1BXGA 1WZEA 8ADHA 3JV7A 3E1KA 4Q3BA 4XGKA 2J5RA 1XA0A 5JMWA 2QRLA 1PGOA 2YV1A 3ZWAA 1L7DA 2WE8A 1V35A 1XEAA 2VYVA 2WMDA 3KSUA 2V6BA 4F45A 1GUYA 4BNXA 2GGSA 4YTEA 3Q2KA 3AUTA 3JQEA 1PJBA 1C3VA 3FD8A 3NDIA 3BXXA 2J8ZA 3DZFA 3GNSA 3UHAA 1YL5A 5T64A 5C5IA 2Y66A 3D7LA 2Q4EA 2HK8A 4EITA 4FFNA 3JD0A 3ENNA 4KUEA 5LC1A 1PU2A 1P1FA 1LNQA 1P1KA 3I4FA 3PZRA 1GZ6A 1PGPA 2CVOA 2HRZA 5KIAA 2BGKA 4BNJA 1WLYA 3BMNA 3DWFA 1NQ5A 3L77A 4IIUA 4GWGA 2QG4A 3ROQA 4JXKA 3D3WA 4KZPA 5AXBA 1U4SA 3DZGA 4WLNA 4IDCA 4XEHA 2DBQA 1YDWA 4W6ZA 1PGJA 2J5QA 5CHEA 1NVTA 3FHLA 2DUUA 4KDFA 5CPFA 4IQGA 3H9QA 3UFXA 5JAQA 2DT5A 1XWFA 3DBVO 1EEHA 4K26A 4R51A 1PEDA 2XAAA 1UZNA 4U0KA 3QRWA 4HWKA 3SLKA 2HMWA 1QRRA 1I3KA 2NU9A 2JCXA 2DVMA 4XQGA 1E7SA 5T8KC 1CERA 2GPTA 2UV8A 4QUKA 4I9UA 4GMGA 3OQBA 1E6WA 1QORA 1T1RA 3WS7A 3DQPA 1WP4A 1U4OA 2PZLA 2Z95A 3H65A 3PHIA 3HG7A 2H6EA 3BMOB 5L40A 1NQOA 4FGSA 1E6EA 1Y9AA 3DMYA 3ZV6A 1N5DA 1N7GA 2YQ4A 2C2YA 1GDHA 4WLEA 4GPD1 4Q39A 4WEQA 1ISJA 4BNLA 4BIIA 1WMAA 4UUMA 1DRUA 4OM8A 3JQ7A 5K9ZA 1W73A 3KUXA 4FPXA 4AL4A 3ZWVA 2VWGA 3LQFA 4R5MA 4JGBA 3PJDA 1U3UA 2NLOA 3AM5A 4NBVA 2BFPA 3SXPA 1SB8A 1EUZA 1YO6A 3WGHA 4D7AA 3C3XA 1EE9A 4XGNA 2VCYA 1I36A 3T4XA 3GVCA 1MC4A 3OEYA 3H9JA 4NK5A 5IZ4A 4GX5A 2AG5A 3AU9A 4CLEA 3E03A 1JA9A 3VKVA 2VZ0A 4FFOA 3N74A 3U4HA 3KLPX 1AUPA 1UXIA 3QE3A 3ZU5A 4MVJD 5CDYA 3E82A 2W8ZA 5IZCC 5B4UA 3WTBA 1KETA 1HETA 2POQX 1VJTA 1N7HA 3OIDA 3W8DA 2Q2VA 1PJQA 4BNZA 3PXXA 3LT1A 2WE7A 3F6YA 2Q4BA 3KO8A 3PI7A 2Y0DA 1M67A 3Q11A 3ADPA 3DTYA 1TT7A 3C1AA 1HYHA 3SJ7A 3GY0A 3L0DA 3NJ8A 1ENPA 4PLCA 4CLOB 1T26A 4PLZA 5HRUA 3LZ6A 3M2TA 3PGXA 3WSWA 1KY5A 2GF2A 4YYZA 1U9JA 5A4DA 4JJFA 2O4UX 1TI7A 4H3VA 1NHWA 2CSUA 1Y8RA 4FC6A 3ICCA 4G2NA 5TC4A 1DC3A 2CVQA 3WJAA 4FB5A 1IUKA 4DC1A 3QQPA 3D64A 4YJHA 5DBFA 3Q2IA 4QX6A 2X5KO 1Q7GA 3IMFA 1HDOA 1DC5A 1RPNA 2RCYA 3PTZA 4XQCA 1LLUA 5G0WA 3BAZA 2X8LA 1N8KA 3DDNA 4JBHA 4OGWA 3ZCXA 3UKOA 2O3UA 2D4AA 3FWNA 3NAQA 1HDGO 3WGZA 2OGUA 3WR5A 4B4OA 3WGIA 5JE8A 2NU8A 4A10A 4PG4A 1ZK2A 2D2IA 2CFCA 1EQUA 3W4IA 4BKOA 3RI3A 1SOVA 1ZXBA 4BNUA 1EMDA 4LVUA 3UH1A 3GPDG 3V8BA 4HFNA 3ANLA 3E9NA 2B0JA 3CUKA 3EY4A 1O6ZA 1O95A 4CV3A 2VYVD 3HHPA 4RVFA 3DFUA 4ZQEA 3ULKA 3UW3A 5IN5A 4UEOA 1NNUA 2RHCA 4GVLA 1UZMA 1E3WA 4PCVA 3QJ5A 1QXSA 4FFLA 4HUJA 2W2KB 1P77A 3SVTA 1FF9A 5FWNA 1RM5A 4R54A 3A9WA 1R66A 2QYSA 4FW8A 4Y8VA 4B7UA 1N9GB 2GASA 3ZNPA 5EQDA 5BSHA 4FFRA 1HT0A 3BHIA 5B1YA 2X22A 3WBBA 3INRA 3GC6A 1WW8A 4JP2A 5ILGA 1KVQA 1DAOA 2HMVA 4YT2A 5TRTA 2NVWA 4EI2A 4F46A 1L1FA 5IN4A 2ZQYA 3JYQA 1BDBA 4QXMA 5EQFA 1KEWA 1U5CA 4HV4A 4YJFA 4J1TA 3FN4A 2WTBA 5BNFA 1PWXA 3AFNA 1Z74A 2P91A 5DCYA 1IZ0A 1QYCA 1NWHA 1CDOA 2EIHA 4Z0TA 3RUCA 2E6UX 3O8QA 3RJ9A 1E3WB 2Y0CA 2ZYGA 1SNYA 1XDWA 1MC5A 2GNAA 2OP1A 3E5MA 3GHYA 4OH1A 2J5KA 3PFFA 1FK8A 4OJNA 3RC9A 3K31A 4GBJA 1HL3A 1EZ4A 4GLLA 4DL9A 3PVZA 3CZRA 3DAPA 5KJFA 2GN4A 1GADO 3JYLA 4R9RA 2IXAA 1LDNA 1B26A 3KVOA 3GG2A 1JWAB 3S1LA 3QP9A 5L45A 3JQAB 2EP7A 4QECA 4ZRMA 2HCTA 1RM0A 2WD7B 3NTRA 1YH3A 2GN8A 2RH4A 3MWDB 2FPGA 1YRLA 3PWKA 4NK4A 3UCXA 4B4WA 4YAKA 1CF2O 2ZB3A 3HDYA 4GX0A 1OAAA 4BNWA 2GUGA 3DO5A 1TB4A 1ID1A 1A4UA 3OIGA 2O2YA 3W4JA 3DHYA 3QVXA 5I9LA 4YEDA 2P9GA 3FNFA 2W4QA 3E6AA 3WQQA 4BO0A 4OKIA 3QW2A 3H3JA 1BRMA 1B8VA 1R12A 3LU1A 3G0OA 3X2FA 1U1IA 4DIOA 3CINA 2Y1GA 3GQVA 4CQMB 4XKJA 1N1EA 3WGOA 1OC2A 1XKQA 4NG5A 1HLDA 2YZ7A 2J3HA 3PHGA 4B7XA 3HDHA 2RIRA 3JQAA 1QP8A 4QFDA 5DP1A 1NBOA 4B3JA 1HE3A 3U5TA 2EW2A 3EDMA 4KP7A 1ZK1A 2EEZA 2G1UA 1ZIDA 2QZ9A 4JNKA 1LLQA 3Q3CA 4PG5A 4E2WA 4INAA 4LSWA 4AJIA 1GQQA 3F47A 1PS9A 1Q7BA 3D3EA 2PA3A 3TFQA 1NPTO 1U2GA 4GKVA 1C0IA 3I5MA 4I1IA 4UUPA 4XYGA 5KVVA 3RKUA 1Y8QA 4J6FA 2JD1A 1KC1A 3M2PA 4U5QA 4XRGA 3GUYA 4E33A 1BWSA 5A06A 1TLTA 1E1LA 4R01A 2IODA 1DB3A 1ONOA 3AM3A 3PYMA 4DC0A 3NKLA 1JU9A 3AOEA 4W7IA 1E7QA 1JKIA 1GR0A 2AHRA 5KJ1A 1HSOA 1UXHA 2B69A 4O1MA 3I9MA 1K6IA 1IPEA 1XSEA 1MUUA 3EYWA 4IJUA 4TROA 3UCFA 3W4KA 3AWDA 4Y6RA 4J0EA 5HS4A 3KXDA 1IB6A 3M6IA 4KQWA 1I3LA 5DOVA 4IIVA 4BO2A 1O8CA 1E6UA 3DOOA 4KWIA 4YDRA 1W8DA 4D43A 4RF5A 1LDMA 1MB4A 3ST7A 1GFSA 1E77A 4MIYA 4CJXA 2X7HA 4E31A 1OC4A 1VSUA 4CMHA 2QIOA 4EZBA 4JK3A 3SC6A 3GA0A 4A5OA 3LT4A 2QRKA 4CQMD 3WGYA 3IQDB 2P68A 3RJ5A 2Q50A 4ND5A 2WYVA 3FPLA 3I9OA 4Y98A 1JQBA 1PZHA 4FC7A 1LDBA 4JROA 1ZJYA 5G0VA 1G6KA 3GEMA 1KVUA 4E2XA 3WWYA 3OH8A 1J0XO 1GCOA 4YWJA 3GHHA 4QFCA 3RUHA 3ZW9A 3G1TA 3PHHA 1GEGA 2AEJA 4J9VA 1T2AA 4KUGA 1I0ZA 2Z1NA 3F1KA 3DR3A 2JKVA 4JJGA 2QRJA 2JFHA 5G0TA 3GVXA 4G5HA 1UXKA 4A7PA 2FY8A 4BQPA 3I9LA 4P4LA 4RORA 1FXSA 1TT5B 1E3EA 3HADA 2R00C 4YJHB 5TX7A 3IP1A 3M1AA 1U8FO 1V9LA 4IINA 3TN7A 1YBVA 4WOJA 3UVEA 3KV3O 1H0KA 4PLHA 2HSDA 1U3VA 3H8VA 3KLMX 3SLGA 1UR5A 3QA9A 1Y6JA 4ND2A 4YAIA 4NNJA 4K6FA 2CDBA 1T24A 2OFPA 1YL6A 2EERA 1XYGA 3ASVA 4IJKA 4MINA 1LLCA 5GZ6A 5JDCC 2BFAA 1EDOA 5TLSA 1P1HA 4AICA 1PR3A 1A7AA 3I9NA 3TOXA 4ZRNA 3FBTA 3GNQA 1D3AA 3LYLA 4L9RA 1DJNA 1DLJA 4XX0A 3NUGA 5FEUA 3CXRA 3IIEA 4S3MA 4FDAA 4OHUA 4OO3A 5CPBA 2CUKA 3UCEA 1GPDG 3BTOA 4DBVO 3ZNNA 1GD1O 4CQMA 2DU8A 5F1OA 4PLGA 3QWBA 2GSDA 3X2EA 3MJSA 1PJLA 4PLTA 3K5PA 3JD4A 1U7HA 2C07A 3F9IA 3Q0EA 1NFRA 4NPCA 3F4BA 4J7UA 4DIFA 2CDAA 1DBVO 5L4SA 3AI1A 3NGLA 1LDYA 4G65A 1I24A 1F8GA 4BNVA 2G0TA 4CM5A 4RV9A 4IGFA 3LDHA 4WCFA 4Q3EA 2HKIA 4BKQA 5AYVA 5KJCA 3G79A 1NX6A 1LC3A 4S1VA 4IQ8A 3HUDA 4ZN6A 4FS3A 5LCXA 1LA2A 1UDBA 5C3MA 3K9QO 4R1TA 4I9NA 1UDCA 1PJ4A 2Y1CA 3WFIA 3JSAA 1YBAA 4NHEA 1FDSA 3PEFA 1DJQA 1ZXLA 1XQ1A 1PR9A 2OUIA 1X13A 3DEYX 4MKXA 1U3WA 3INGA 4OMUA 4LCEA 1RKXA 5KJEA 4D3DA 1MX3A 2HUNA 3VDRA 4GSLA 1GPJA 4ZQGA 1HLPA 1MFZA 4A26A 2VHWA 4LISA 2O2SA 4XJSA 1GUZA 5HS6A 1TT5A 1K6XA 2GR9A 4BO1A 1WXDA 1PZGA 2VN8A 3RAJA 3AM4A 2IZ1A 1DHRA 1MXHA 1YOVB 4YT5A 5KOIA 3AU8A 1K0UA 4QSMA 1GU7A 5CG2A 5EPOA 2ZTLA 4GH5A 4KTVE 4D0RA 1KS9A 4IXWA 4ALKA 1M2WA 2DKNA 3C85A 3INTA 3ZWBA 2UDPA 2BELA 2BMAA 5A5EA 5K6AA 1QKIA 2NUAA 1GZ3A 4TVOA 4J9UE 3OP4A 4E2YA 2OORA 2C82A 3JQCA 4R4JA 4C7KA 4IS2A 1HZJA 1DLIA 4B3HA 4NQZA 4ROSA 5JMPA 4RLHA 4CLHA 4I5EA 3GT0A 2VRCA 3GUCA 5L51A 4J2HA 1BMDA 2XOXA 4CL8A 2YHIB 2JAPA 3LLVA 1JAXA 1CEQA 3JQBC 4XDZA 3NT5A 2Y0EA 3ZV4A 2W90A 1AN9A 2AMFA 3IDSA 4J0FA 4PZEA 4UVGA 4AJKA 5A5FA 1T1SA 2GZ1A 5JFOA 1K89A 1PTJA 1SCUA 5I7EA 4PLYA 1ZBQA 2WWRA 3ITKA 4H7PA 4Z9YA 3DZJA 3S2FA 1E0DA 1NPYA 3EHEA 3VZQA 3DMTA 1JVBA 4D41A 1NVMB 3WYEA 4IDFA 4Q3CA 5GY7A 4BO8A 4DMLA 3JQFC 2V7PA 4B4VA 1C14A 1R6DA 1C1DA 2Y1OA 4XYEA 8LDHA 3BMQA 4Z9FA 3JYNA 3HQ4O 4IGEA 3BMOA 2I65A 3NDJA 2E82A 1P0FA 3U9LA 5TJHA 4CM7A 1FDVA 2ZTMA 3PLNA 4PVCA 4DMMA 2NU7A 2J6IA 3GN1A 2I66A 2CDCA 3PFWO 4OOFA 3TL3A 1JTVA 5MDHA 3TZHA 4JX8A 4RQTA 3VZRA 3CIFA 4ND3A 4DPKA 4NU5A 4R41A 4B4UA 4FFMA 3H2ZA 3TZKA 1BHSA 3WBFA 4EUFA 2YUTA 3AUUA 3BMQB 2FR8A 1EUCA 1P45A 3GVIA 1VL0A 4NJMA 2NACA 1QLHA 2GRAA 1I2CA 5A03A 3ZDFA 4CV1A 4XIJA 3DBLA 2P2SA 3JTMA 3VH2A 1ISMA 3P7MA 3R3SA 3DBRA 4WJZA 4R3NA 5IJZA 4CQLB 3AJRA 4ZQHA 5F21A 5AXAA 4LW8A 1QYDA 1DRVA 4N5LA 5F1PA 3DB2A 1YONA 1LQTA 2NVUB 1TEHA 1QV7A 2ZCVA 1O5IA 2Q2QA 2R2GA 1E3JA 2FPIA 1J5PA 2YHIA 3QVSA 4QTZA 2VOJA 4DIBA 1ZK3A 1BXZA 1LX6A 1X14A 3ETEA 5JDIA 3NDRA 5C7IO 2DPGA 3O9ZA 3OM9A 4A27A 4IS3A 5I7SA 2A94A 2QYTA 1Y8QB 1AHHA 4OKNA 3IOYA 5KVSA 3EK2A 1OFGA 5JAIA 2PGLA 3KRTA 1X1TA 2ZQZA 2ZYDA 3VZSA 1LI4A 1B7GO 2NTNA 2X9NA 2JFGA 5I7FA
chains in the Genus database with same CATH superfamily
2Y99A 4XB2A 2JD2A 1GKIA 4BMDA 3BWDD 1BO6A 1XYYA 2NUBA 2AR7A 4DCOA 4MRSA 2JLWA 2C8VA 1V3TA 5CNKA 1W0KA 3G0HA 1Z35A 1HFWA 1NBME 1RWOA 2EV9A 3AEQA 3WXBA 1ZA1A 2GILA 1JJBA 2CXUA 1QCDA 2QM3A 4ZCMA 2BI8A 2GCOA 1CUJA 3HXOA 3T1OA 4E51A 1O9HA 4XGIA 5TT0A 3PGJA 1Q6ZA 3IDAA 4BRZA 4ZPXA 1K4KA 1YQDA 3FBGA 3ZGLA 3BIJA 4LBZA 4EW1A 4FKMA 4IIGA 4BATA 4KYUA 1U9IC 3CKMA 1OAOC 2QUIA 3D8NA 3I52A 5GV8A 5I5GA 1B8PA 4GI1A 2ZIXA 3VDNB 5A9SA 3RC2A 4EW2A 3OQIB 2BTEA 3T7TA 1Y6QA 1QU2A 2HSWA 3KSRA 4Y2HA 2VCHA 3JS5A 3GLFE 4H9GA 2IKQA 2XY4A 4EFMA 3HVHA 3WNDA 3DVAA 4JU9A 5A04A 1H85A 4I5DA 4M86A 1O4VA 5TPZA 4BGIA 2O6LA 2R48A 1MBZA 1JHMA 2SKCA 1RRPA 1TIPA 1EFVA 4WDRA 1SUIA 5E7JA 2PKEA 3G2NA 3IE0A 2H5LA 2IZZA 3WGTA 4IW3B 4HSEA 3X1KA 1CUIA 1RSZA 3D1VA 3AJ9A 2HYIC 2IYWA 4JYAB 2H2HA 2QZZA 4TM8A 3D4LA 2ZRBA 3PNMA 4RGYA 4GM1A 5HF6A 4M54A 5AK3A 2IOFK 3K0SA 3H84A 3PUKA 4AY5A 1LVGA 4BNTA 3H8SA 3IOCA 4PC3A 1BIFA 1ICEA 2A1IA 4KN8A 1Q0ZA 5LJLA 1Y81A 2VTKA 1N6IA 1XZPA 2FW9A 3WLTA 4RJTA 1MC1A 3H5AA 3RYTC 3YASA 4AWXA 1Q0HA 1S2GA 4GXTA 3VC2A 1VP3A 3N53A 3ZHBA 2XMZA 3NTUA 1NMQA 1X70A 2ADOA 4TYNA 1Z6XA 1JU3A 2AK2A 2ZIUB 1JYEA 1KY4A 3EIWA 4I50F 1OX4B 3M4YA 3F2IA 1QLJA 4RACA 4Z8YA 3UA3A 1GPKA 3WZMA 3E5RA 4GNKA 1E6KA 2P0AA 1JXOA 1XCOA 3E2IA 4X92A 1BN6A 3DVSX 5GMOA 2QW8A 5AOAA 1N57A 2FRDC 3AT1A 3HP4A 4GXQA 4MKZA 4ZVLA 3WLRA 4BAGA 4E3ZA 1GN8A 1KTVA 1S9HA 3DZBA 3L4SO 4HPWA 4D96A 4IRXA 4JJIA 2FDXA 3NYIA 4RFSB 1KZ7B 4O8CA 5GVSA 4GWKA 3U3KA 3TIGA 3V7YA 5EUCA 3H11B 1P1IA 3ITNA 3K1JA 2I6GA 4ZOEA 4WBNA 4WXHA 4MUEA 1GA1A 4RWEA 1EBUA 3ZY6A 2WJJA 1P29A 2GBFA 3IIMA 4UBJA 1DFHA 2VHUA 1ADCA 1ZSYA 2R8XA 1IXYA 4NZOA 4RZIA 3ZWCA 2P6RA 2B30A 3S1AA 4C4RA 1OQAA 2GJ4A 1E2PA 5FIUA 4CEJA 2YIVX 5ARDA 3HA2A 3SCZA 4XCQA 1GPAA 4RDHA 3WY9A 5FH9A 2IE8A 2J59A 2FSVC 2VJKA 2FGKA 2H7XA 3PRHA 3V1KA 1NQUA 4OAOA 3D02A 1QZZA 4JC4A 1HZZA 1M34E 1BVUA 1FFGA 1Z0AA 2R96A 2LV8A 1O97C 3BHMA 3FKSD 3KBOA 4M7OA 4N18A 4NBUA 2EXXA 2VDVE 5J2TA 1R8YA 1ZLYA 2FEKA 3ETGA 1L3CA 3JATA 4Q7EA 2QMUA 1T8RA 5EKUA 4OQYA 4IJWA 3EMVA 1K5PA 3A0UA 1VPTA 2A9FA 4WLUA 4YP9A 5H1YA 3SOPA 4ARUA 4LKRA 5I7RA 3O03A 5UKDA 2QX7A 3LKDA 1ZK0A 1PJ8A 3I42A 4X24A 4HEHA 4NZYA 5YASA 3NM6B 5G1NA 2VQ3A 5C7YA 1E3MA 2R8ZA 5AIAA 3C6ZA 1JQAA 4IUYA 2C92A 3GN2A 3M1LA 1E58A 4YRRA 4J90A 3RIMA 4EAAA 4M4SA 2R60A 4EARA 1NY6A 5FF9A 4EPWA 3WJ7A 2C9DA 1AS2A 3E53A 4XW2A 2P0YA 3UJ8A 5FOUA 4XQEA 3F5SA 2PEZA 3H9UA 5F5XA 2FX2A 1RBMA 3GFFA 4XWYA 4DLVA 3E5HA 2QRVA 4GDFA 2QMZA 3DL7A 2P62A 2YWHA 1UC5B 2A84A 3I53A 2VYQA 4RHTA 1U9IA 3L4BC 3PD0A 4Y9DA 3W8NA 1F7UA 1PJSA 3C24A 4Z4QA 1QYVA 3THYB 1P0IA 3MWYW 1ADJA 1AS3A 2WILA 1DKQA 2Z57A 4HGQA 4P7JA 1U1CA 1TQDA 4EJSA 1RAFA 4F6RA 5H9VA 3JASB 2G77B 5C9ZA 4ZYLA 4NWIA 5LA6A 4C2TA 2BGJA 5U4XA 1FJGB 4FINA 3RF6A 4ZIRA 5JATA 1EP9A 1Y48E 2C9CA 1E3DA 2G80A 2YV4A 5I4KA 5LR6A 5HBRA 3DE5X 2H59A 1A72A 1JHPA 2PE5A 1K88A 2C5AA 2PL1A 3A6GA 1UANA 2JLCA 3EQZA 4JXJA 3G2JA 5KYUB 3LUKA 2F67A 2VVTA 4FJ1A 5M2QA 3D4NA 3T3EA 1NPDA 1ZWKA 2BM0A 2C2XA 3MC1A 5E4YA 4PGGA 1FFYA 4WZAE 4AJEA 2HWWA 5IBQA 5EEGA 3TLMA 1N1DA 4OSOA 3HWX1 1X1EA 3LAWA 1HT3A 3R3WA 4MVJG 3LW7A 2DC1A 2FPKA 4LBVA 2UVDA 1XELA 3PX3A 3U48A 5F4ZA 3DVRX 1RWQA 1YBFA 3B1VA 3RS5A 3GEHA 4OHKA 1C81A 1E60A 2W6MA 3IELA 4A8JC 4F4UA 3SZLA 4F2PA 1V7QA 4CG3A 3QEAZ 3EFOA 1TO2E 1OIXA 1WBJB 1Z6YA 2WG1A 3IPCA 4F3KA 5CXQA 1JG7A 1U2SA 2ZJOA 3FFWA 4Y1RB 3GJ5A 4XIYA 5B7NA 3KXPA 2Q3JA 4U1RA 5KVAA 2QPAA 2WUEA 1HNWB 3RROA 1V4BA 4QRIA 5K4HA 3WNVA 4EO4A 3KKQA 3KOZA 4Q16A 4PYOA 5DWDA 3KZ1E 3GJ0A 4K9LA 4LK2A 3H2GA 2GZHA 3HSSA 4C4PA 2NXWA 3MERA 2XUPA 3I9FA 4M8LA 5JAZA 1W35A 2BEKA 4ADSG 3S8YA 4ON9A 9MHTA 3DBHB 3IXQA 3UK6A 3LDGA 2FWRA 5LDGA 2OG2A 4DQ0A 1RRKA 2IQ5A 4TWZA 4UMDA 3SJAA 3G2MA 3STXA 1O89A 1UBFA 3ZXIA 4ZGWA 3ER8A 1AGRA 3DTTA 2DCUA 4O4LA 2JBAA 2Q1UA 2XDQB 2VEOA 4BVJA 2AHOA 3OMLA 4AZ3B 1NXQA 5DNYB 1Z4KA 2QN7A 4LZLA 3SNKA 3E9DA 4K6KA 3B1ZA 3M7IA 3WC4A 1G2PA 1U0EA 2JJQA 2V1UA 1J5XA 1YNSA 4RVUA 2GB4A 1EGVB 1C8LA 1H94A 2WOOA 1Y4AE 5HTOA 1QO9A 5HFNA 1JG4A 1T9KA 3HN2A 4ZVVA 3FNBA 2H1OA 3TOCA 4KTTE 3GLGE 1OGIA 2IDZA 3B8EA 4BFWA 3RQIA 2IF0A 2GZRA 3DGEC 3H1PA 4N40A 4V0NA 3OTGA 5AXDA 3QIAA 5LFAA 2FWBA 4R8VA 1G1MA 5TRTA 1F0PA 4MKRA 4UM7A 5K3FB 3ND6A 1P75A 1PK7A 5EP4A 3VX4A 2WVHA 4DYVA 1UM9B 3JQ6A 4E5YA 2IXFA 2PTGA 4OQ4A 3OJXA 1FXWA 2WVAA 3LLCA 5KAMA 2HPVA 1L7AA 2ATIA 4M21A 1S2LA 4MKGA 4Z99A 3K70B 1ZMRA 1DP4A 4LJ7A 4X84A 1VP9A 1DTWA 4EYEA 3SYNA 3VR5D 3CF0A 1CE8B 1E2UA 1QX4A 2GNOA 2R66A 2CLEB 2IIPA 2OCGA 3C8HA 3FUTA 4ISCA 1MV8A 1QNLA 5CT8A 2JPDA 2OYCA 5BR7A 2J4CA 4ZQCB 1SVIA 3LFUA 4FZ5A 4JLBA 3K4PA 2H1VA 1YJCA 4DZZA 1DKPA 1PFGA 3K09C 4JB8A 3MD0A 3ZR4B 3C39A 5I3CA 4M9RA 2I1LA 2G9NA 4KR6A 1M2HA 1P17A 1SBIA 1V8OA 1YB2A 3WGLA 4HPXB 1JKJA 2WHEA 5JTUA 4KV7A 4QG3A 1QH0A 2JFFA 4W5TA 1TUEA 1H6BA 1ST2A 5ECWA 5H81A 1VBMA 4FOOA 4X44A 1OBFO 1S2DA 4G1MB 3B8HA 3ECAA 5E6RA 3TGWA 3IDOA 3SU8A 2EQAA 3Q7QA 4Q9AA 4UASA 3IUPA 4M98A 5CFPA 3JRXA 2OKCA 1XPUA 1PNQA 2G9ZA 4KJZA 3CF6R 3EIOA 1L7PA 2X1HA 4GC5A 1JEAA 4F4FA 3BA1A 1T5OA 1EFUA 2PUVA 3PCRB 4DR7B 1N2BA 3AERB 3CEAA 4NFSA 3CF4G 4OUKX 1YHZA 1UBCA 1Y1QA 5K45A 3ENKA 3EIEA 3ANTA 3R3XA 4MRPA 2GHRA 3VR0A 2HT6A 4RAOA 3OCCA 4ZU1X 2AH5A 3OVMA 4Y1FA 5KBYA 2ZETA 4ZEMA 3F5QA 2JAHA 3U31A 4LTMA 3WWZA 4I5FA 5FOXA 1MZPA 2B83A 1PDOA 3IP5A 4HFJA 3K2BA 4I2VA 3ROZA 4EI7A 1ZH8A 3BSSA 3E8SA 1B93A 3NZEA 3ZBPA 1M0EA 3O26A 4MYDA 5G1OA 4NI5A 1ACJA 1HTBA 5EFZA 3IVMA 1D1SA 2WA2A 2HZBA 1T4DA 5GPBA 2QUJA 2FP4B 3CN7A 2JLSA 1ZIOA 3K3PA 3STHA 3UT5A 4CG0A 2F59A 1I3NA 1LBQA 1IOLA 4B80A 1FRQA 2E1RA 3D31A 1RTKA 4F2WA 1D2MA 4DCPA 4GL4A 3S1SA 3V4ZA 5DBIA 5GGXA 5I6DA 4PCAA 2IXGA 3O4IA 3U3RA 3ISTA 3EISA 4C0SA 3OT1A 4AKEA 2PLRA 1Z28A 4NBRA 1ISHA 5COBA 2X6TA 2Z9BA 2OHXA 5JNUA 4LGMA 4TVBA 4DV7B 3S55A 3A1EA 3QPBA 3DAGA 1J25A 2AZDA 2OM2A 3OJEA 1ENOA 2Q6OA 4NG4A 5AOVA 5KJCA 2QBYA 2FQYA 1U1GA 2PXHA 3L07A 5E1DA 3MTJA 2PYZA 4EG5A 1Z7BA 5FXMA 4Q1FA 4WIAA 1DCFA 5ERYA 4RXUA 1OHHD 1JR3E 1G8HA 1O97D 1FW6A 4JOSA 1XD8A 2FUG1 2QUBA 5A9RA 3AQIA 3L9WA 4IDDA 3KKKA 5EZYB 5TR9A 3WO1A 1T8YA 4QBKA 2OXTA 1FBNA 3C1TA 3D3KA 4M6WA 5KQSA 3AP1A 4XOUA 1E3LA 1XZEA 1C0KA 1EFCA 1LWOA 2PLWA 4HB3A 4TMYA 4C08A 2WHPB 2XYVA 1AKMA 1H0HA 4WEOA 4EGFA 1Q1NA 2NXCA 4DCUA 4KJXA 3DMGA 3PXGA 1KK0A 1JU4A 5CA0F 1II8B 1MTZA 1Y80A 4UAJA 3HXPA 2OV4A 3HKDB 4X6XA 3RAFC 2O7VA 1EE1A 1K6JA 3FR7A 4BVFA 3AJEA 5I9TA 2XLBA 1ATZA 4XD7A 2CC2A 3IDZA 3QVLA 5A1TA 3EDQA 1MB0A 2QXYA 4KODA 4PS0A 1OU0A 2ZVDA 2NV6A 2ZSBA 4DUGD 4I4TA 4YP6A 4ND1A 3TCXB 3A2LA 4BIMA 4L6CA 4P4TA 4TTRA 4Z54A 4XQ9A 4CM4B 1OBHA 5CYOA 4W9MC 4LGCA 3AYXB 5AW5A 4A1OA 2HCJB 3QELA 5DP2A 1RYFA 3N59A 2PKQO 2VHXA 5K8JB 3CX8A 1GQFA 1ZSNA 1GTL1 5F3DA 1ML3A 2VBIA 1OYWA 2OCBA 2W6NA 3BGWA 3FNRA 4BNKA 2PMDA 4Q7KA 2H0QA 2ZAMA 4I4CA 5AW3A 5ADHA 1RI1A 1QVRA 2XDWA 4ZYUA 3RYHB 1QGDA 3WRXC 2WTAA 2WA1A 4LYYA 3TJMA 4CMKA 1CBUA 1AHNA 2I62A 2CF6A 1M6HA 2GD1O 2Q2OA 5JSYA 1WXEA 2I2BA 3NBKA 3X1XA 1U0SY 4DM4A 1FW8A 3CKKA 4DRXA 5EL0A 1V1MB 3G1WA 1QS0A 1T9GS 2D5CA 4R83A 1WXIA 1G17A 1O4WA 2BV3A 1I0IA 4Q05A 3WRYA 3IP9A 1W19A 3MJDA 4XR9A 1Z9BA 4QO8A 1PZFA 1Z6ZA 3PEVA 1YR3A 1OXTA 1Z2NX 4L50A 3LA6A 3W8FA 1RJDA 4K6OA 3UKDA 1EUQA 5BVHB 3U1TA 4LMRA 2H2DA 1SIUA 3V8QA 3B5EA 1SUPA 2YINC 1QZ3A 4N3AA 3BA6A 1H66A 4RJIA 1UPTA 4UVDA 3V2IA 3THXB 2BI7A 3OQ6A 3IAS6 2LDXA 5CA0A 1B8OA 3Q87B 4BNGA 4CWAA 2MWMA 2XNCA 3UOGA 4QYSA 4OBXA 4EJMA 3A9UA 3EXFB 3BH6A 2VHYA 3DE2X 5EIAA 1XQ9A 5E0OA 2WF7A 3UXYA 1PJRA 1KL7A 1XTPA 1M2OA 1RC8A 3GAFA 3KT0A 1KAHA 1UJCA 4MW2A 2QD5A 5CDFA 4B8ZA 2JJYA 3QEKA 2GFQA 4EUSA 4HFRA 4X7BA 2IZOA 4YMWA 5LP6C 1VE1A 5AO9A 3SSMA 3MB5A 1ZY2A 1ZU4A 2H18A 3B13B 2XWSA 1BXGB 1J2EA 4TKMA 4YJGB 1CJSA 5AVOA 1DEHA 2YW9A 2XGSA 1GNRA 1AS0A 2XWBF 5IJWA 3JD3A 4DVJA 3H18A 2VK2A 4R69A 1R0ZA 1HFJA 2CYCA 2ZREA 1H2BA 5B3JA 1TADA 2X1MA 1REQA 3QNMA 2HA3A 4K28A 3U9SA 4OI1A 2HDWA 3TE6A 2Q45A 4XX0B 4NV0A 2PV0A 3A6JA 2ZB4A 3E23A 3ZKWA 1UJMA 3PP8A 1S2IA 3F5MA 1FZTA 4FBMA 1FJHA 4PPNA 2VAVA 1SXJB 2XWQA 2V96A 4TSFD 4CNQA 3ZU4A 2OORC 4CKWB 4S05A 1M8FA 2ZR8A 3BHJA 1CWUA 4P93A 5CX4A 2CD9A 3DDWA 4LI0A 4UJ3A 5F78A 3IBCA 5EXDA 4BHTA 3V34A 3HYNA 3OAAD 1LC0A 2BVNA 2VPZA 3UA4A 1K08A 2PY6A 4CI9A 4CM6A 4A16A 3GARA 4UVIA 4D3YA 1DAHA 4D79A 2BBSA 1I33A 5BOSB 3RUPA 1DWUA 4G8JA 2CVHA 2M9MA 2CNBA 1T5BA 2FZCA 2QQ0A 3C1UA 3L41A 4H4CA 5JARA 3IHLA 2J1LA 3EMDA 2IE0A 3DLHA 1Y5RA 2VUSA 3JWEA 2CXPA 2X42A 2QAGC 2Z04A 4FOPA 5FBWB 5LYJF 1E9SA 3GLKA 4AJHA 5C5EA 3Q6IA 1ESZA 4JLDA 2REOA 3TKAA 2EFJA 4LJLA 4RETA 4DGQA 3RVJA 3CRMA 4D9NA 2WF8A 2XMDA 4BKMA 1WQ3A 2YX1A 5A3JA 1X8LA 5JO9A 1OXBB 1U3TA 1X6VA 3AONB 3WOVA 4CTKA 4EMBA 3LPAA 4OYRA 2XMGA 3FSJX 3EZGA 1RBQA 1TKAA 3GDFA 3BH7A 1GDDA 1IDN1 1IOZA 1J39A 1WHSA 2RGNA 4ZO8A 2D5IA 3O7MA 2EGGA 1C3JA 1XCGB 1VHQA 4E0BA 4N0EA 5L9AA 2XCRB 4JI4B 1YOBA 1UFKA 4CQJA 5DN6A 1J97A 5JD4A 2VNIA 1QUEA 1JJIA 2B1IA 2FG5A 1ZNXA 2MSEB 2PZAA 4GRIA 4MITA 5DB4A 1CKEA 3KB8A 1F4LA 1T15A 2FDRA 4TQAA 4J1NA 3ONWA 1M2KA 3LZCA 1NUPA 1KVRA 1ZNQO 3WQBA 1VBNA 2X0EA 1QIFA 5BXQC 4Z3DA 3MUFA 2QN8A 4FHFA 3TZCA 3GRZA 2WFLB 3AEUA 3I2YX 4Y9SA 5JALA 4HDMA 3MBIA 4KQGA 3O0DA 4MLPA 4QHTA 5H5JA 1USKA 4DV6B 1PIWA 1SD1A 5EHQA 5JS1A 1Q0LA 2HWYA 2J0SA 3S2UA 4S1WA 2OBMA 3JZMA 4ZOCA 4IFBA 5G2OA 3T7JA 5A6SB 3V80A 1KAMA 3VJKA 1Z5PA 2I7CA 4BZXA 1D07A 3GJXC 1D2RA 2R47A 1YE3A 2ADFA 1E32A 2OV1A 4TMKA 1PT6A 3NCHA 5LLTA 1YXMA 1UAYA 3OZDA 1UEIA 2FSUA 1AO3A 3CJQA 4EOGA 3TVDA 2WNIA 2BYTA 4UVHA 2ECFA 3QOWA 1H2YA 4YMTA 4P4UA 3EWSA 1V6AA 4B5LA 1OKKA 1MRNA 1YQWA 2QTWB 4IV5A 4HB2A 3GOHA 3SEAA 3HV2A 1EG2A 1CR0A 4MB2A 5TMPA 3F6EX 1VSVA 4WVFA 3TPCA 5IVKA 1MX5A 4HRYA 4L9AA 4NOLA 2GZAA 4ZXPA 1XCBA 4C0QC 1HE4A 1M2VB 4BNMA 2D2EA 5AI4A 2OD7A 5TS3A 4EYQA 3CKYA 1HKUA 1PHRA 1G8GA 1H5UA 3B20A 3MINB 3IQEA 3C6YA 5IMBA 5J2TB 3SYTA 1Z0FA 3G9TA 1WPGA 4V2IA 2DPYA 1J7JA 4IJMA 2AFRA 2FSGA 5KX5A 3VKHA 4LE2A 1V8DA 2PSFA 2LCFA 1FDTA 4I8XA 1SCUB 3HJGA 1YZYA 1SK9A 6LDHA 3THRA 1H6AA 2BEJA 3UB2A 3A9CA 2QDXA 1LZKA 5FLEX 1CHNA 1SWWA 1KO4A 1MABA 2ONCA 1XG5A 2D7CA 4ONEA 5FI5A 4OXQA 2NUPA 3C4JA 4URHA 3JWIA 2PGAA 3N6VA 5EINA 4ZV4A 2P2CA 3LG2A 2DYKA 3WV5A 3LT0A 2NU9B 5DI3B 3W5IA 1F12A 4EIWA 4Y18A 4DQUA 3MJCA 5JANA 1EPUA 3JYPA 3I4LA 5BW6B 3Q5EA 3W6UA 5FYDA 3U2QA 2QVLA 3JQRA 3K71B 3EAGA 1A95A 3SVLA 5DKFA 1SOAA 5LMUB 4K46A 3RTCA 2Q1WA 4CE6A 4OYYA 3VGPA 4EO7A 5HP4A 5HTKA 3QLJA 4YQFA 4RMIA 1T4BA 2BFMA 2V7TA 3B6KA 3ZCUA 4N49A 2FMXA 4HQOA 4BMVA 2A1TS 1DMRA 1QQ6A 2P1RA 2BEWA 1Q1QA 1JALA 3MBKA 4NU8X 3VR3D 1EXDA 1F2UA 2G4CA 4MRRA 4UEJA 3DS8A 4EEXA 5JYBA 3Q1LA 2X4GA 3OQHA 4GF5A 1P3JA 2WFAA 3KC2A 1JILA 3OA0A 4E46A 1WW3A 1CQIA 2G9QA 6YASA 3VSDA 4XWGA 3GGJA 4WADA 5I7UA 3TM4A 2NZJA 1LJ8A 1V7CA 2XXBA 3ZLUA 5JOQA 4ALLA 1EYZA 3HBLA 5JW6A 3VSEA 4G0OA 4N0QA 3M82A 4LZAA 3AUFA 1RWVA 4PV7A 2QI9C 5LQNA 1FTGA 1C1XA 3AZQA 3L8EA 2ZU0C 3LWDA 3NHSA 5B12A 1NXWA 1Q3KA 1XCPA 1W85A 5L3SB 2HA0A 5BUZA 1UMCB 4F9FA 2C7QA 3J80A 3HFSA 2RG1A 5DYYA 2AWNA 2P5SA 1W44A 3RFCA 5ALMA 1Q92A 5M7EA 1CZNA 1I7QB 2Z8YM 3TLBA 1OYVA 2JK0A 2VNJA 1JIUA 1NVUQ 2YJ5A 4NYIR 3UAGA 3SQXA 5LB4A 1AZWA 2XXAA 2JNWA 3TS1A 4F7DA 1V16B 2C5FA 3T54A 1NQAO 3DO6A 2EARA 3VR4D 4PNEA 5IG2A 4DYHA 3MLBA 3U4GA 5E38A 3RVRA 2VKQA 3CVWA 2JIZA 4R5HA 5FBKA 2CNLA 1L4FA 3PNVA 5LP6F 2DB3A 1S3SA 1H8HD 5F1KA 2P2YA 2GK7A 4JN6B 4Z9XA 3RFTA 4YV0A 2YOFA 3IJRA 3Q40A 2QR5A 2YUIA 2Z8YA 5KNDA 4MLCA 4A2QA 4RK6A 2QXUA 3TNLA 2FR0A 1NW9B 2O0MA 4JLKA 3NANA 4UDYX 4D8WA 5FR2A 4RMGA 5E4TA 3RUIA 4BPBA 5KTKA 4QUAA 1B14A 2MIIA 4JLSA 3BICA 3T5TA 4TKLA 3BE5A 2FF7A 5DULA 5BQ3A 1WIWA 2HMSA 1XEWY 5BN5B 4GSKA 3PSHA 5CCDA 2J31A 5ELXA 4UEQA 4ZQBA 3DAYA 4FCWA 4BWYA 2ZSHA 4G9EA 3U17A 2I7VA 4URFA 1W1UA 3FWHA 4WN9A 2QD4A 3I01A 2X15A 3OKFA 1JR6A 2FRDA 2DBZA 3AIKA 3VKGA 5D2CA 1J8QA 4NYMQ 2P4UA 1M6EX 3VPXA 1A50B 3ISVA 3ESYA 3UAVA 1Y5MA 4XASA 2R6CA 4HQLA 2JJ8A 4TMTA 2C57A 2B21A 4HEA1 3R7NA 4F96A 2RBKA 2VK4A 3WRWA 3Q3EA 5CMLA 4J94A 1CX9B 3KB2A 1QHYA 4M1EA 2VWHA 3ZCSA 5K09A 5CVCA 2WYUA 3PQ6A 1M1YE 4MGZR 2X23A 3CHYA 4LWPA 4RHXA 1VQ1A 2F48A 1GA6A 1GEEA 2CYBA 1HOXA 3BIOA 4YAFA 5J4HA 4Q15A 2JVIA 5HDQA 2C94A 4QUGA 1JHOA 1TZMA 2BFBB 4MS1B 1XEXA 4ENRA 5A4FS 1SWVA 1W96A 1LH0A 4HDKB 5EVJA 3OOJA 2GPJA 3C6MA 3CZPA 4C3OB 2PR2A 1DKLA 2DTEA 1T2DA 2Y9PB 1R0RE 1IN7A 1WUJS 2XQKA 3HY6A 3FB1A 3PPWA 2Z6QA 3IPXA 2JLAA 2DLDA 3MK31 2MSLA 3VZCA 1VMAA 2JANA 4IJQA 3A7DA 4ZHQF 1BD3A 1I32A 2ST1A 5C1BA 1T3LA 1XZFA 4FYVA 4OMCA 1E7RA 3INYA 4NZ9A 3TW4A 3BE4A 1VMEA 5EI5A 1CRZA 3DKVA 1OVMA 4BN0A 1ZKDA 1Q17A 1Z4IA 1L7VC 4L8GA 2OMEA 4RCVA 5ALEA 4R16A 5EHIA 5H82A 4OHZA 1GXSA 4KMRA 1M73E 3L5OA 2H1FA 4BV9A 2GPBA 5AW6A 3DOIA 3QSYA 3R23A 1H3NA 2ZRDA 4KLCA 1DNPA 2FJPA 3GFOA 2AKEA 2J5BA 4IHJB 3M3PA 5B3AA 1VECA 1WXFA 2FPWA 5ALDA 2NYAA 4K9QA 3ZHSA 3OJOA 4ENQA 5LZ8A 5I48A 3AR2A 4QEZA 3NFRA 5KOJA 4FGWA 5JS2A 5ALOA 4JLWA 2W00A 1G6OA 2XPCA 3ZGOA 1ULAA 3R76A 2H7YA 1U7WA 4HAIA 5CW2A 3EEBA 4XTRA 1E96A 3VJLA 1VE6A 3CRW1 4F3TA 1E7WA 1XQXA 2CE2X 4DCMA 2PUDA 2ZZMA 1NYTA 3I28A 1U02A 1N2JA 1J49A 1MO3A 4RGVA 3WKBA 5HZMA 4M7RA 2JFXA 3KOXA 2PMEA 3DT8A 1Y82A 2XR1A 3FVRA 1X7YA 2DKFA 2XYPA 4MVJF 2I4IA 3LUCA 1KE2A 3T3GA 1HC7A 4JYMA 2OTCA 4LFCB 4ZA2A 2GBCA 3A14A 3K8QA 3QKWA 4RY8A 2IY9A 4R8LA 5H80A 5IW8A 2EW8A 2XB8A 3OJFA 3N8KA 2BWJA 3SE0A 4Z4EA 1TO1E 4TLDA 4ZOLF 4C4SA 2QD2A 3HBAA 3TLJA 5AKGA 2VLIA 3DEKA 3AQ4A 2OFXA 3OT1B 5A62A 5DXAA 3FPKA 4CHGA 2E6KA 4US2R 3Q88A 4MPDA 2PMCA 4YRZA 4D02A 3ZVRA 1TZJA 1UDRA 4B6OA 1FFHA 2QJFA 3HCAA 3D5TA 4BC0A 2DOKA 4U3JB 1CD5A 2WQ6A 1BVRA 1D2HA 5C35A 1PJCA 4KBYA 1WMEA 5IM5A 1M7GA 3BMXA 3FTNA 1YE8A 2Q3CA 1W6UA 1DT5A 4DLXA 1JIQA 1ZDMA 3HR8A 4KO2S 3L6DA 4NZNA 3EX7C 3G2IA 5JAUA 2QRPA 1QV6A 3VGJA 4O1IA 4ZT3A 3TQHA 5AW4A 5FBLB 3GK3A 3IQHX 1CETA 1Y3IA 5D5PA 4FFWA 3WLLA 2CF5A 1Q15A 3ZE9A 2BH9A 3CZ9A 3IQFA 1U2DA 3L79A 3MAGA 3U7QB 1FPQA 1VTKA 5HKKA 1JAYA 2ZUSA 1SKQA 3C0KA 3MT0A 4KN5A 4N3NA 2CHUA 2HEGA 2RIPA 3LVRE 4K9MA 4D9HA 2JGRA 4NF2A 5KHAA 1PFQA 1X80A 3HFGA 2B36A 1RZRD 3OUTA 3CH4B 2WFLA 5B55A 1DQSA 4I4LA 4A6EA 4UAVA 5JDIC 5D51S 4ZQFA 3V7NA 1SCQA 4INJA 5DEOA 3GZ4A 2P75A 5LUAA 5KNCD 4PQEA 1ZFNA 4GQBA 4B9EA 2TYSB 4PRZA 3RUDA 3Q4GA 4YMIA 4F85A 1E4EB 4RL4A 2Q41A 4HBGA 4KX3A 2XB4A 5D3MA 5DGDA 3M6XA 5J59A 2B2NA 4MI6A 4E07A 1RE0A 3PV0A 1LBEA 1Z6TA 5JCJD 2BF7A 1ZD9A 1AUXA 3IODA 3SC2A 3A05A 3E8XA 3I61A 1Z5OA 3EUAA 4IXNA 2SICE 3Q9SA 1JR3D 2UYOA 3RASA 3V4RA 3OQOA 2WV9A 2XF8A 2WJHA 2QAIA 5KOYA 1Y5IA 1H0RA 3KETA 5KZMB 2AF3C 4FJ2A 5DRYA 4K81B 3C3DA 4R8MA 2ZIVB 3VPSA 1OXUA 3ANSA 4V0SA 1U6IA 2NGRA 3HJHA 3LBFA 3NVMB 5IK2A 2IEIA 4KQHA 1JECA 2BBTA 3D8RA 4TLCA 5BNIA 1ZVQA 3HZHA 2RAFA 4L6IA 1KQNA 4EBFA 5HMLA 1T8PA 2EWMA 1SC4A 3JW8A 3GROA 3V46A 3P9NA 1DC4A 3FFTA 4C06A 1DIAA 4EY5A 2E3JA 1KFCB 4RTNA 3KUCA 4BKRA 3GBVA 4HQRA 5SZJA 1CG6A 3PC3A 1E5QA 5C2JB 2NQ2C 3GEIA 1TZKA 2IYOA 1VLJA 2QL9A 1ENZA 2QXTA 3KUKA 1PD1A 4NFLA 4XPZA 1Y42X 3H9GA 1NP3A 3GPCA 4PHTA 2L18A 5ICMA 2JLUA 2VJOA 1X0VA 4WFJA 2B1GA 2Y2VA 3KQQA 1DX9A 2F7SA 3FPHA 1IEQA 2JH8A 3DOUA 4A0HA 5LP6B 3H2IA 4V3CA 2F62A 5C81A 4U7WA 1UAGA 1VCIA 3LC7O 2RSLA 1JFVA 3AHIA 1ZMTA 4QGAA 2BFNA 1K68A 2PX2A 2B1RA 3A9TA 3AW8A 3N6RA 3QU9A 5AM0A 2HWKA 4ZVNA 3WDSA 2AC2A 3ZE7A 5ITZB 1CUYA 3WGKA 3ZGNA 4WK4B 1QTIA 4EDFA 4QM6A 2FSIA 4OXIA 1PS8A 1XX6A 4XQ0A 3RFXA 2O3JA 4G56A 1DBQA 1UBSB 2XW6A 2ZT8A 1A7JA 2UUOA 4HDRB 3R8CA 1L5ZA 1U0JA 2HRBA 3II6X 3JAWB 4CTOA 1KFBB 2VAXA 3SHWA 1EVQA 1KU0A 3ABOB 4X1IB 3KZKA 4Q4JA 2QT1A 2DEUA 1I4TD 1B73A 1NLFA 3K5WA 3KWFA 4NAHA 1W36C 4A8HA 4O4HA 4XYMA 1CLEA 2XMBA 2ACEA 2JAWA 5EJGA 4B09A 5JYCA 4MQ4A 1KMNA 3QXSA 3SI7A 4XXHA 5HOQA 4JI7B 1NR7A 2ZQ5A 2CWWA 2I6QA 1KP3A 1HI9A 3D7SA 5KTYA 1XEWX 3F4KA 3UEOA 3DHEA 3VR2D 1WU7A 1YRHA 2F3RA 4FGJA 3PQ4A 3PFBA 2R65A 4NJMB 5I7OA 3O2QB 4KLNA 3R9IA 3H1FA 2TMDA 3Q8WA 3RYFA 1E1DA 1HYBA 1ODKA 1ZH6A 3IX7A 1BHQ1 1QMPA 3OZXA 4R8RA 4TV8B 5FAXA 4B71A 5DM60 4OIMA 1FNBA 2RJOA 3W2FA 3MLEA 1AG9A 5IEBA 4IHJA 4V0MA 5AESA 1NTOA 2YW2A 1A9SA 2AOXA 2Y1KA 2VWPA 5JWHA 3T7EA 4HDNA 1GG8A 2ZTVA 4QYMA 3DR5A 1MF7A 1HYEA 5GJCA 4PPGA 4LRQA 3CH5A 4HZUB 4DB2A 2XNDA 1E69A 4EPXA 5AT1A 4F8EA 2PZBA 2QTLA 3HCBA 3QNUA 1L5RA 1XAIA 2VYND 1EDEA 3E3NA 3GNTA 1E7MA 1S4MA 3DDZX 2JW5A 5AD1A 4XRRA 3WWCA 1SXQA 1B1AA 1JT2A 5H83A 5FWAA 2X58A 3RVOA 1FFDA 4YQZA 2PRSA 3DEZA 5AHRA 1V11B 3EZYA 1IIRA 1F2TB 5LMNB 1ICIA 1RYDA 2H7VA 3BRWD 4J1SA 4NQRA 4UCFA 5L95A 4DV5B 4IUDS 1PSDA 4OPMA 4ZVOA 2O8FB 4OFZA 4YV2A 1NFFA 3EBOA 3V4FA 3JWGA 4EG6A 5T7BA 4UBKA 3FA2A 2VZ9A 2YH2A 2VJCA 3P5SA 3HBJA 4IY1A 2W6CX 3UJ6A 1GG9A 1OLSB 2JA2A 1KA9H 3AJ8A 4S04A 4JLAA 2IDKA 2B5VA 2FW0A 1QVZA 3OZ7A 3DLTA 2V7QD 3MHTA 1PX0A 4WASA 2G72A 1HF3A 1L7NA 1MO4A 1RM3A 4Y67A 4BMCA 2JAUA 2IW3A 5LXTA 3OF5A 1MJGA 1JR4A 2GAAA 1VJGA 2G9UA 1X9HA 3GLHA 5T3YA 1FJXA 4CLRA 5EQJB 2OV6A 4FVTA 5EMLA 2PV7A 1U9CA 3Q15C 2OXCA 3H9CA 3UJAA 5AW2A 2IPNA 2X86A 1DPGA 3HCFA 3N70A 5D7BA 1K5HA 2RAUA 1CFZA 2ODWA 5DASA 1L5HA 3VO9A 1MQAA 5I5EA 1NDHA 3D8HA 3P97A 2YYZA 4ZP1A 3KQYA 3KP1A 3OJWA 3SSOA 4H6PA 4N8DA 1GTZA 3IO5A 1XLTA 1UFQA 1YGYA 4M83A 1IHYA 4ZICA 5TJ9A 3T7DA 4YT4A 3K7EA 3D2CA 1KGSA 2CBGA 3OBBA 5AQ1A 1DAGA 3ICEA 5CB4B 5IH7A 2PD4A 1PL8A 1TIKA 4IV0A 5FJJA 4QOGA 2IEBA 1LPMA 3WLSA 1MN6A 2ZI4A 1TF2A 3K9CA 4OREX 2IV3A 4CF4A 4ZJPA 2IITA 1P3DA 1ZK4A 1B0AA 2ZBEA 3MMSA 4MROA 1DPFA 3PL1A 3GJ8A 3Q1KA 3NGXA 3GLIA 3NH9A 2DF8A 3DLIA 4LZJA 1VKZA 1RC1A 2VJLA 4ZT5A 5JYEA 5JNRA 2JDID 1KO7A 2Q3EA 3HPRA 4WI1A 2W5UA 4D6YA 4RMNA 2H1CA 2IBMA 3TZQA 2BFBA 2PK3A 1PNRA 1EVLA 5HKOA 4DA4A 2V4ZA 5LKAA 4XI9A 3MN1A 1OMOA 2OCYC 3DE6X 2AN3A 5DM2A 5IKXA 4RULA 4IRMA 1M34A 4RDXA 4GUDA 1KY3A 2VT7A 1HDRA 4LDRA 1QG0A 3VISA 1CHDA 2PL3A 2QZ4A 1JHRA 2AC7A 1JQ5A 3GQBB 5L3RA 4KDEA 2H8KA 4KR9A 3WJ1A 1G5IA 1IATA 1BJKA 1NW5A 2FUG6 4QU0A 1GHTA 2H5EA 1ETHA 2Q46A 3BXOA 4D57A 4WLOA 2DWQA 2J85A 3AG5A 1R0LA 3PHBE 4V1CB 5KX5B 1CIPA 1TC1A 3S28A 1ZM3A 2Q99A 3HO8A 3COWA 2R6AA 3M1IA 1I10A 4JBIA 5ECYA 4P7FA 3U1BA 4OX9Y 4V0KA 2LR0A 2DBVO 4NJOA 2CFSA 1KEUA 2IYYA 3T9CA 1OASA 2ZJ7A 2B2CA 1IBKB 1VE3A 1VL1A 5K01A 1NUQA 1T4CB 5B6IA 1VB3A 5I8WA 1BQ3A 3O8OA 3VKUA 2YIJA 5DGXA 2DUJA 2BH2A 1CUEA 2O1EA 4MUHA 4ZMSA 1P18A 5B6JA 3S99A 2ZWPA 3WLKX 1F3LA 4KGXA 1JDNA 4D8VA 3PRJA 4JLNA 4REOA 5AR1A 5AOBA 2HM7A 4KDRA 5KYGA 2ZXUA 4UM9D 5BN3A 3TTUA 4NL4H 4BCDA 7REQA 4MQBA 4I81A 4QDUA 1FVXA 5DYNA 5BNTA 3HJAA 3H97A 3I1IA 3FPAA 3I8XA 4FDUA 1KFKB 3ME5A 4E5VA 3UMMA 5CT4A 5AVKA 2XDAA 4GZMA 4JVMA 2W6QA 4JUCA 4Z0HO 1LQUA 1SBHA 3GPIA 4P22A 2MMGA 5LYYA 3LM8A 4ID3A 4YFYA 1E0KA 1CF9A 2IHUA 3HZRA 3IE2A 4FYPA 4FN4A 4KMOA 3DOCA 3EA0A 1I8TA 2NU6B 4JL6A 1YI8A 2JH3A 4NABA 2NG1A 1Q0RA 2JFBA 1Q19A 1K7FB 2VXYA 4RS4A 3COSA 4UUQA 1BGWA 2EFGA 2XMCA 1KVSA 3FDJA 1VRVA 2BR3A 4JITA 4LC9A 2I8CA 5DHUA 2PD3A 3IH5A 1W4RA 3DQZA 4Z6KA 1JHAA 2WSYB 1NVWQ 4OHCA 3PYLA 2FEXA 4M1WA 4BTEA 4BX0A 2ZRFA 4EQZA 5LWQA 3K9FC 2JLRA 1U8CB 1XDBA 3GNLA 3NATA 4UUAA 2QSZA 3GZNB 1C4XA 2I33A 2PYIA 4YJFB 4AG6A 3U13A 4BZZA 5L3SA 4KE9A 4F9GA 4LE1A 3A11A 3L4JA 4JVOA 2H54A 1NKSA 3JRNA 4O0LA 2YDYA 2Z5FA 1B16A 1Z0DA 2OCPA 5AVZA 3BH0A 3FVVA 3K9HA 4HNUA 2YWRA 3LCJA 5FBQB 1G38A 4YGYA 1Z4NA 1VLVA 2BKXA 1UK7A 3JV7A 2C9MA 3LYAA 3ZHTA 2EJUA 4Q3BA 4Q48A 2PT5A 1TK9A 1ZJ6A 3AM1A 5GOZA 1XA0A 4EHLA 1ZH0A 1PGOA 3ZWAA 1FPMA 2ZRQA 3QPAA 3L1JA 5K0JA 1CJMA 2VYVA 4IMJB 1F51