4A2CA

Crystal structure of galactitol-1-phosphate dehydrogenase from escherichia coli
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
346
structure length
346
Chain Sequence
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHEFSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEYIVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCAVALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVPQTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWETASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Galactitol-1-Phosphate 5-Dehydrogenase from Escherichia Coli K12 Provides Insights Into its Anomalous Behavior on Imac Processes
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords GALACTITOL-1-PHOSPHATE 5-DEHYDROGENASE
total genus 112
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 1.1.1.251: Galactitol-1-phosphate 5-dehydrogenase.
pdb deposition date 2011-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4a2cA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4a2cA01
3N58A 3O26A 1OZAA 4URFA 3OJFA 4YJFB 4D7AA 1MP0A 2VYVA 4FFRA 1YS4A 1P33A 1MFZA 2PH5A 2BRUA 2GR9A 3GAFA 1X7HA 1YOVA 4IDFA 5IDQA 4CLRA 2JD2A 3NTOA 4HBGA 3AJRA 4NK4A 1E3LA 4KQWA 1BTOA 3U4IA 4OJNA 4PLPA 4W9NC 3G17A 3WGZA 5JNLA 3D3EA 3K31A 1MB4A 4KDFA 4BO4A 3ZNOA 3U62A 4RPKA 4QX6A 1EVYA 2CUKA 1P1JA 5CAEA 2FWMX 3L6OO 4DVJA 3M2PA 1WZEA 5CDSA 2AA3A 2VYVD 1P1HA 4UEOA 5JE8A 3DMTC 1V6AA 1YE3A 3KYDB 1NPDA 3UICA 4B79A 3BYZA 1VC2A 2NADA 3KSZO 3ONFA 5JMPA 4B4VA 2Q50A 3VPGA 3PHHA 1GDHA 4CL3A 1GPDG 3NAQA 5JAIA 3DHEA 5F5LA 3I1JA 2Q1SA 4IUYA 3WXBA 5IDXA 1P31A 2E48A 1MLDA 3VVCA 1DFHA 4ID9A 4PN3A 1JKFA 4M8SA 3QA9A 3RC9A 2CFCA 4AL4A 3L77A 4L4RA 5COQA 2V7PA 1M2WA 3GVCA 5IZ4A 3HE3A 4BMSA 1L7DA 3KYCA 2A35A 3OA0A 4B8WA 5JCJD 1ENYA 1PJQA 2Q1UA 4ESOA 1XU9A 2V6BA 3OIFA 4M87A 3JQCA 1U3WA 3TPCA 5KNLA 5AXBA 1W4ZA 4D43A 4JP2A 5JXWA 2ZJ0A 4WEQA 4D3DA 3KLMX 1BVRA 5BSGA 2OBNA 1W8DA 1DIAA 1LRJA 1R4NB 3FD8A 3INRA 1WMAA 5U4QA 4E2WA 1W6UA 2PA3A 3DZKA 2Q45A 3ULKA 4DC1A 4I08A 4W99A 2X23A 1XIVA 5DNAA 3BMOA 4B4UA 5IXSA 3GGPA 4ZA2A 5HS4A 5L7TA 3H2ZA 2NU9A 2NTJA 4I9NA 1K6JA 1WPQA 5K6AA 4RL6A 1PZEA 3GVIA 4HUJA 1BW9B 4RVGA 3E18A 4AJ1A 1K6XA 3I6QA 4OIMA 1ZZEA 4YB8A 4YQYA 1YDEA 2O4UX 4YCAA 3DAFA 3GNTA 3OQ6A 5TF4A 5HWSA 1ULSA 2SCUA 2FRDA 3LVFO 2ILTA 3OSUA 4M54A 3U4HA 1NQOA 2DLDA 3U0BA 3ZH2A 3EY4A 4JNKA 5A9RA 3AI2A 4EZBA 4RF4A 1HL3A 1C1DB 3W6UA 5CEFA 1WAMA 1OAAA 2F00A 4NBUA 4HKTA 3VH1A 1VRWA 1DBVO 3D3WB 4GWGA 3CXRA 1J5PA 4FJ2A 1ONPA 1B16A 1G0NA 5F5NA 3NTRA 3G0OA 1V3UA 4YAGA 4UVHA 1ENZA 3NGXA 4ILKA 4UVIA 1TT5A 2J3IA 3JSAA 2OBYA 4HFJA 5A1TA 5B4TA 1UP4A 2UDPA 4IIUA 1ADFA 3GOHA 1ZUD1 5T64A 3WJ7A 1LDMA 2GDZA 4WLUA 4R51A 3HWRA 3GDOA 3EK2A 2AE1A 3OA2A 2VTEA 3IUSA 1E7YA 3TF5A 4L73A 1PZHA 1J6UA 4MP3A 4OXNA 2PK3A 3T7EA 2J5RA 5G4KA 3HSKA 2GSDA 3JD1A 5B37A 5U9CA 3BHMA 4DQXA 1H6AA 1E1KA 5DP2A 3A28A 1Z73A 2X9GA 3VDQA 3HFSA 2G76A 3BMCA 3GUCA 4WLNA 1MG0A 1DLJA 1HWYA 1NVGA 2OHXA 3LLVA 3RWBA 4YAKA 1P3DA 4CM7A 1EVIA 1H2BA 1GL3A 3UCEA 1D3AA 3UCXA 5ENVA 4KDEA 2DQ4A 2JFGA 2OFPA 1ONOA 2OZPA 1Y9AA 4D42A 4KUEA 4FFOA 1B14A 4PLYA 3MOIA 5AQ1A 3WMWA 3DL2A 3QVXA 2P9EA 3GGGA 1RYDA 4LCJA 4XYBA 4D3FA 4HX5A 4BNHA 1C0IA 1UXJA 4O63O 1VKNA 6LDHA 1NTOA 4FB5A 3RBXA 2CSUA 3K73O 4NJOA 4CMKA 2EP5A 3GN1A 2UAGA 3PXXA 1X0XA 1XEAA 3QVWA 4PZEA 4JXKA 4B7CA 4BO3A 3CZMA 1KVTA 2NQTA 5TT0A 4KUGA 5L4SA 3UCFA 1EDZA 4CM6A 1T4DA 1ZO8A 2LDBA 3CSDA 4UVGA 4JK3A 2VUSA 4NBVA 4BNVA 3KYCB 5HBRA 4ZN6A 1QMGA 3FR7A 4OQYA 2AEFA 2P2SA 4N5MA 4NDNE 2EF1A 1DHTA 5K1SA 1S6YA 2HQ1A 1CWUA 3F1LA 3ZU2A 3CKYA 2AG5A 2P9CA 4FC7A 3RASA 4JJIA 1MG5A 3HDJA 2EG9A 3NTQA 3G1UA 3JQ9C 3MJEA 4TMFA 1LA2A 1Z82A 2Y99A 4DTIA 1YJ8A 3PJEA 3RBVA 1B15A 1MXFA 4MVJI 2VHVA 2FP4A 3ANLA 3PIIA 3HJAA 1E7QA 2NM0A 4IXWA 4RGBA 1PJ3A 4BNMA 3CZRA 4J1TA 1HKUA 4JJGA 3RUIA 4QECA 3RVDA 1RM0A 5H83A 4U6QA 1CQIA 4BVAA 3KO8A 3H4VA 4RJTA 3O38A 1P1RA 2QYTA 4ZICA 1GV1A 3WBBA 1SMKA 3EVTA 1PJCA 3WWZA 4JX8A 4YDRA 3T4XA 4CLRB 5B4UA 2X1HA 1ZK0A 4M1QA 4RLSA 4E12A 5B12A 1ISGA 4ZRMA 3NX4A 3ZZNA 1Z6ZA 4FW8A 2O2SA 4LVUA 3D4PA 5U1PA 1R16A 4RVSA 1O9BA 4KTVE 2GYYA 4BUCA 2X0NA 3IL2A 2H1SA 4ZU3A 3WR5A 1E1LA 3DBRA 3NDIA 2BF7A 3QWIA 2YUTA 3S2FA 4AJLA 1QV7A 2YQ5A 3LQFA 2Y05A 2VTDA 5L9AA 4CMEC 2HK8A 3W4IA 4ZJUA 1ISHA 4BKQA 4YAIA 1IHYA 3JD3A 1HE5A 1KBZA 1B26A 4LRTB 5TQVA 4QFDA 1C0LA 1QLHA 2Q4EA 1DXYA 1PZGA 4XDZA 4DC0A 3DZGA 4NI5A 1T1SA 4GL4A 3JD0A 5IFLA 4DYDA 1I10A 4AFNA 3ITDA 1BRMA 3B1JA 5K0ZA 3AI3A 3NDJA 4NIMA 1I3KA 5HTOA 4ITUA 1U4OA 1DRUA 4J7CA 4TKMA 4XQEA 2XAAA 5A04A 3GVHA 4ND4A 4NFSA 4XB2A 4YJHA 4E3ZA 3HDHA 1RPNA 3JV7A 3ST7A 4YT5A 3MJTA 1Y5MA 5C37A 1I36A 1PIWA 3JQDA 4PVCA 2JCYA 4OYRA 3RUDA 2VT2A 2PY6A 2HUNA 1QSGA 1Z74A 2FZEA 3FF4A 3IDSA 3VPXA 1H6BA 3D5TA 3GUYA 1K0UA 4Y98A 4B4WA 4CM4B 1B8PA 2H5LA 1BVUA 4E0BA 2FY8A 4JBIA 3OMLA 4XEHA 4NPCA 2RBEA 4WNCA 1D7OA 1EBUA 1Z7BA 1F8FA 4BOYA 3BMOB 3GNQA 4CM5A 3MJ4A 1W73A 3WICA 2GN9A 3JYOA 4GKBA 4AJKA 5CFZA 2OP1A 3HDYA 3ZW8A 5EN4A 5ADHA 2VRCD 1A5ZA 1HT0A 2OO5A 2X86A 3AY7A 4JQCA 3GVXA 3ONEA 4PZCA 4BS9A 1N7GA 1HE3A 3Q9NA 5A9TA 3E8XA 4LW8A 1HZJA 1P1FA 1SEPA 3WDSA 2DBRA 3A06A 4FR5A 3H7AA 4GPD1 5JS6A 2IXBA 2X8LA 1DO8A 1IHXA 2HKIA 2ZYGA 4RVUA 1LXCA 3DBVO 2DPGA 4BV8A 3DFUA 5C5IA 5CDYA 3DHNA 1DIBA 1J49A 2X9VA 3GNSA 1OFGA 4FFNA 3BMQA 1CERA 1I24A 3S2IA 1BHSA 2IDZA 1E77A 4WLEA 4CQLA 1D1SA 4TWRA 2BFMA 1ML3A 1R12A 3QVOA 2WEKA 3BHJA 1ORRA 1I01A 2TMDA 2PV7A 3RC2A 5I7EA 4WOKA 1PR9A 1YBAA 1ZH8A 4S3MA 1U5AA 3BMQB 4LRSB 2YQ4A 4ALJA 4ZQHA 3PRJA 1VJTA 1LQTA 2ZCVA 3I52A 4UVDA 3RJ9A 4G65A 4HWKA 3G1TA 1BXGA 4ONEA 3GC6A 1TB4A 3JQGB 1Q2XA 3QLJA 3NYWA 4YQZA 1DFGA 2AQKA 4K1LA 5ILOA 1N9GB 3H9EO 4J0FA 1JN0A 4BNGA 4E32A 3FI9A 2VZ9A 3GRPA 1LJ8A 4OSOA 3FSRA 3ORFA 1DIRA 3GPIA 1DDOA 1PJ4A 4CLOA 1WDLA 3JQAA 4OXKA 5F21A 4CM3A 3FR8A 1TA4A 5AXAA 4AJPA 4DL9A 1MV8A 1XU7A 1UXGA 3OHSX 4DMLA 3FN4A 3MTGA 1JDJA 4YA6A 1GTMA 2HSDA 4FBGA 1I3LA 1KS9A 4NJMA 1EUDA 4P4GA 3ON5A 5FWNA 4YAJA 4HNHA 2RIRA 3KV3O 3ZV3A 3F47A 3DO5A 5HA5A 5JDCC 3AM3A 1C0PA 3LSYA 2O7SA 2EKLA 4RF3A 3VPHA 1I8TA 2HMTA 5CP8A 4I5DA 1CETA 3D0OA 4QUKA 2ZB7A 5AXDA 3O03A 3D5QA 1FK8A 1V35A 1N1GA 1ZK1A 4OKIA 2Q3EA 1P0CA 2D8AA 2DU8A 5CHEA 2G1UA 3GRKA 3V5NA 4Y6RA 4CODB 2QQ5A 3AU9A 4EEXA 4OHUA 1DC3A 5KJ1A 2W98A 3UGKA 3AU8A 1AUPA 4A2CA 5B4VA 1P44A 3WTCA 2ZTLA 1SO8A 5L95A 3VZPA 3BXXA 5TC4A 4AJIA 1GUZA 2ZTUA 1NM5A 1XG5A 1YL5A 1GADO 2FOIA 1NXQA 1DOHA 4JN6B 4BKPA 4XRRA 4BO8A 4RF5A 2J5KA 3SXPA 4FN4A 5A02A 2JFHA 3KUXA 3AUTA 1VE9A 3ZWPA 4R3WA 4MP6A 3PZRA 4Z6KA 5KOIA 4UUOA 4DPLA 5KVCA 5F1PA 3P2YA 3CMCO 1DAOA 1ULUA 3PDUA 4DPMA 1ISJA 4IIVA 3OECA 3U4DA 4I5FA 5DOVA 1YB1A 2ZB3A 3FWZA 2IEBA 2I6TA 3ADOA 3DMTA 1I0ZA 3Q0EA 9LDBA 3L4SO 4B8ZA 3GZ4A 1D1TA 1WMBA 3KXDA 4UUPA 2YZ7A 5EMHA 1SAYA 4FD3A 2HJSA 4XX0A 1OOEA 3BAZA 3PLNA 3GDFA 3I23A 3IKVA 3GDGA 1A7KA 1RYEA 4GX0A 3PHJA 4BNNA 3RFTA 3CIFA 4EUHA 4R9SA 3DZBA 3GGOA 1AGNA 3VH2A 4A7PA 1H5QA 4R41A 3R3SA 2Y1DA 2W2KB 2Y1OA 4EBFA 4XKJA 1HSZA 5A9SA 1AHIA 1X15A 2WE8A 4IINA 4PCVA 1QORA 4WK6A 5ER9A 2BLLA 4RVFA 5KVQA 4CV2A 1YQDA 2P4QA 3K8ZA 5DN9A 3P2OA 2X22A 1T4BA 3CUKA 4FSHA 2DBQA 3GLQA 4HFNA 2EJWA 1UDAA 3VC7A 2Y1GA 4HV4A 4CM8A 3O9ZA 2FR1A 2DT5A 3R6DA 4E2YA 1DPGA 3UVEA 1PQPA 2PR2A 2BELA 2DFVA 2ZATA 2G0TA 1TEHA 1L7EA 3OM9A 4AJ4A 5AYVA 2EIHA 4CMBA 1I2ZA 4CM1A 3F4BA 5L4LA 1NR1A 2ZCUA 1QYXA 1UZLA 1Y6JA 4QXMA 4B3JA 3GG2A 4X54A 3X2EA 1FF9A 2DUWA 2VQ3A 3E03A 4IDDA 5CPBA 2AW5A 5J23A 3Q2IA 1PL8A 2E4AA 2ZB8A 5KKCA 4YJFA 3FPCA 3N7UA 8ADHA 5BNFA 5FEUA 1NFFA 2IODA 2ZTVA 4LN1A 5ILGA 5LCXA 2J3HA 4IQGA 4IDGA 4NK5A 4RF2A 3LT4A 4A5OA 2P5UA 3OQ1A 4MIEA 4RLHA 3KEOA 1GYQA 1ENOA 1N5DA 1OC4A 3KB6A 4UVEA 1N92A 4F46A 1O95A 5CEJA 3ETDA 5KCZA 4I8XA 4D41A 3GEMA 3LK7A 2NU7A 2BFPA 2I67A 2RH4A 1O0SA 4CMIB 4W4TA 3TDKA 1Y5RA 2CDBA 2RCYA 1DB3A 1B2LA 3LZ6A 1NFQA 2FR8A 4TRJA 3VTZA 3B1FA 3NT2A 3T4EA 3ZNNA 1E3EA 3O8QA 5KVSA 1D8AA 3RD5A 1V3TA 3HZZA 3WGGA 1XCBA 4J6FA 1PS9A 3ZHYA 4XJSA 4C7JA 3F3SA 3H2SA 4R1SA 3BMNA 1U3VA 4QO7A 5L7YA 3AOEA 1CEQA 2JHGA 3LT0A 1WW8A 4D45A 1Y81A 3DB2A 3IOYA 4OOFA 3L6DA 3DBHB 4YT2A 3DQPA 3D7LA 2Q2VA 3HQ4O 3PVZA 3PQEA 5LC1A 3EYWA 4Z9YA 2PH3A 5JMWA 1VSVA 2E6UX 2Q49A 4C7KA 2GO1A 1HDRA 4BGVA 4OO3A 2DBVO 1JU9A 1GYRA 3BZUA 1YBMA 3WX0A 2UV8A 4CLEA 1R0SA 3KRTA 3MEQA 4G5HA 4J1SA 3MZ0A 3TZKA 2G82A 4Q39A 1FDSA 1BDMA 1M66A 1MC5A 3UN1A 3UW3A 4XA8A 3WQRA 3KETA 4BIIA 4XYLA 2A92A 3SLGA 1T2EA 4IMRA 2BI8A 3I5MA 3PP8A 4DMMA 3JQBA 4UUMA 3FNHA 2J8ZA 1R15A 2OGUA 4MJLA 4CLXA 1PZFA 2Q2QA 1G1AA 2GLXA 1KVQA 4MKZA 4ZQFA 1EK6A 1UJMA 2FPIA 1HLPA 2I66A 3FWNA 3H9JA 3DZFA 4II2A 3SVTA 1Y8QA 2BGLA 1O94A 2ZIZA 5IXYA 2A94A 3NKLA 4BGUA 4DXHA 1GZ3A 2Z1MA 4AG3A 3DDNA 4Q3BA 3TSCA 3RBZA 4M49A 1GUYA 2Z95A 3PEFA 1WWKA 1C0KA 1Q7BA 3NRCA 1Y8QB 4R01A 1JAXA 2C29D 2FMUA 3PGXA 4CMGA 4J1QA 3G79A 2B83A 4J4HA 1B3RA 2UUPA 1T24A 2Y1CA 1HETA 5ENDA 2GN6A 2FSVA 2B4RO 1C14A 1PWZA 4L9RA 3MCVA 1O5IA 3SEFA 2XXBA 4FPXA 4YYZA 4JBGA 3OEWA 4WOJA 2B35A 5JAZA 4PG6A 1LTHR 1E6WA 1C1DA 3JQFA 1GCOA 4P4LA 3ETGA 3TZHA 5A03A 4OKNA 4UEJA 2AEMA 3RQSA 4DLBA 3IQDB 4ALMA 4J43A 2X5OA 1IZ9A 4FFPA 3Q9UA 4QT0A 3RJ5A 4FGSA 3D4OA 2O3SA 1A72A 1I3MA 2CDCA 2IZZA 2NSDA 3AY6A 1JVSA 2RH8A 3ZNQA 1T2CA 1AE1A 1GZ4A 4J90A 4IDBA 1PJTA 1H93A 3WGTA 4DBVO 2HK9A 3EHEA 2VNAA 4BNTA 2O3UA 5JYDA 4J9VA 3DC2A 4BKOA 1DEHA 2PWZA 3QQPA 4JIGA 1VLLA 2B36A 4CMCA 3ZN2A 4PLFA 1PGOA 3GA0A 1HF3A 3C7CB 5TGDA 3C1OA 4K9DA 3I6IA 4CQMB 4EJMA 1C1XB 4CMJA 3EC7A 3ZWCA 4PRKA 3WSWA 2JD0A 2UUOA 2I99A 3GMSA 2VZ8A 3DBHA 1N2SA 3OH8A 1ZFNA 2DM6A 2Y93A 4J49A 4MO2A 3NJ4A 4AICA 3STHA 4DPKA 4RCVA 1ZIDA 4J9UE 3VTFA 4II3A 3GHYA 4R5HA 4PLVA 3DHYA 3OIGA 1PL6A 3W8FA 4GX1A 3C85A 3WLEA 4L4SA 3H3JA 3H9UA 1X0VA 1BXZA 2ZQZA 2BGKA 1VJ1A 3GZNB 3RSHA 2PFGA 3L6EA 4DWVA 3ZDFA 3F9IA 3AW9A 1PJSA 3GN2A 3LT1A 3HN7A 1V0JA 4P4NA 2I65A 4JJFA 1YONA 3VVBA 2OP0A 1RKXA 3L0DA 1B0AA 3F5QA 3JQ9A 4FOOA 4YRAA 3DAPA 1P9LA 2Y67A 1ZJYA 1X7GA 2CZCA 3ROKA 4ZVVA 1E0DA 3WNVA 2X6TA 1O6ZA 4DUPA 9LDTA 1NVMB 1CIVA 2VUTA 2PKRA 2WWRA 1LC3A 1U2DA 5T8KC 5CDGA 1NBOA 4WGGA 1GQQA 3EGOA 4HFMA 3EZLA 3K6JA 1GV0A 4U6SA 5ICMA 2P91A 5KIAA 1X14A 2O50A 4OXYA 5JC1A 2VWHA 3HN2A 3ZU4A 2X9NA 1LQUA 1LEHA 2D3TA 5JBIA 2VT3A 1M76A 4IQ8A 1PEDA 1LSJA 3JQ7A 1PX0A 4N7RA 4TKLA 5C3MA 1X7DA 4IM7A 1DRVA 4MKXA 4BNYA 3K2EA 4YR9A 1IPFA 1EZ4A 3S8MA 1H0KA 1Q0LA 1I5RA 2GZ3A 2VHXA 2ZK7A 4O59O 1XGKA 5G0SA 1YB5A 3QW2A 1IE3A 2IYOA 3I9MA 1C3VA 1ZSYA 4DIFA 2D5AA 5BSFA 3MJCA 4RPJA 2A9FA 1UH5A 4Z9FA 2WD7B 1Z7EA 2UYYA 4NBTA 2V6MA 5CDUA 4OGWA 3HNPA 3K5PA 3QV1A 1NPYA 1FXSA 4FJ1A 2CDAA 4BNZA 1LRLA 4HXYA 4BMVA 5T57A 3ZNPA 1QYWA 2B4QA 2BD0A 2GPTA 2FPPA 3HB5X 4JROA 1H6CA 1UUFA 3HUDA 2PGLA 2D2IA 3OETA 4GX2A 2PKQO 3RKRA 4YVFA 4DBZA 1UDBA 3QJ5A 4A03A 3D64A 4E2ZA 1DJNA 2ET6A 3GEDA 1EEHA 5I7FA 3ENKA 4LVCA 4EJ0A 1QYDA 3AY3A 5GZ3A 3M2TA 3COSA 3JQAD 1R4NA 1YVEI 3WLFA 3L9WA 4FJ0A 3NV9A 1DSSG 2D1YA 4IQ0A 4Y8VA 3K96A 4TROA 1G6KA 2VOJA 1H9AA 4RQTA 2QZZA 5JCXA 3V2GA 5K6AC 4CM9D 1HSOA 1U5CA 2QRLA 2DTDA 4YBZA 1NQ5A 1PJ2A 4YJDA 3QHAA 4YRBA 2Y1EA 1S7CA 3CMMA 2EGGA 1ISFA 3LDHA 5CPFA 4GI2A 3PJGA 1KC1A 4H7PA 4TSKA 4TVBA 4I5GA 3WBFA 2PD4A 1HRDA 4L0QA 1LUAA 3H3FA 4IJKA 3U9LA 4JBHA 1GEGA 4R68A 1QKIA 3UAGA 2D0IA 2ZB4A 3ANMA 5IF3A 2FHSA 2YYYA 4WE3A 2DUUA 4DYVA 4BNKA 4LGVA 3GPDG 1ZBQA 3PQFA 4RDIA 3IAHA 1SB8A 1CF2O 2YHUA 1TVEA 3ZV4A 1LDEA 1XSEA 5TT1A 4CUJA 1ISMA 3I9LA 3GK3A 4CMHA 5MGBA 4Z9XA 3HDQA 4MKRA 4R1TA 1F0YA 2R6JA 4ALNA 2HMSA 3U4CA 3A1NA 4JCOA 3AM4A 4MPDA 3SBOA 1JWAB 4Q3CA 3F6YA 2BFOA 5AVOA 3RC1A 3ZW9A 2AE2A 3QY9A 1WDMA 1JKJA 4NBWA 4TVOA 4L4XA 1UR5A 4EUFA 4EYEA 1UP6A 3WB9A 3OEYA 1CDOA 1NWCA 1BWSA 1VSUA 1MA0A 2GRAA 3FNGA 3PJDA 3NJ8A 4EUEA 1NAHA 1J4AA 4XD2A 1FDWA 2CD9A 2WJPA 3DOOA 3SJ7A 4D3SA 5TSDA 3DBRB 5H82A 4NBRA 5JO9A 2EERA 2NVUB 3UFXA 4MVJE 4IS3A 5THKA 1HE4A 4GMGA 1VKOA 1A7AA 1DIGA 5FI3A 2NV6A 2YDYA 3TZ6A 1OBFO 4LCEA 4XR9A 5G0TA 3LU1A 2DBZA 2JAPA 1RWBA 3MJVA 4PG7A 3W8EA 3SX2A 5CEEA 4CM4A 1ZVMA 1U2GA 3KBOA 2H9IA 4JLWA 1PGNA 1HTBA 2VHYA 1X1TA 1GZ6A 2VRBA 4I1IA 4AJEA 4L76A 1IOLA 4PLZA 4EJ6A 4DLLA 2HK7A 4XIYA 4LISA 2P9GA 4F6CA 3Q3CA 4UUNA 2W90A 4WCDA 4XDYA 4EDFA 2Y1FA 1WLYA 3LLSA 3ETEA 1U4SA 1QXSA 1SCUA 2AEJA 3IUPA 3ZI0A 1ZXBA 1R66A 1ZW1A 1U9JA 1LDYA 5IZCA 2NVUA 3G3EA 3H5NA 4L8VA 4OL9A 1U8XX 4LMPA 1R4MB 4Y67A 3JYPA 1E7SA 1HLDA 2B0JA 2YDXA 4OH1A 1R37A 3EMKA 4I9UA 1Y8RA 1C1XA 1CJCA 4R16A 2WYVA 3PTZA 2W4QA 1AXEA 4BHTA 1EVJA 5JDCA 1MXHA 5TRTA 3AWDA 4J1NA 2BHLA 4J0EA 4CL8A 1XA0A 2PD6A 4NQZA 5A5EA 1LBEA 2QRKA 1M75A 1K6IA 2JFFA 4GVXA 1GEEA 2AQIA 2YY7A 3ZV6A 2PD3A 1WVGA 2OORA 1XQ6A 4D79A 1ID1A 4AJNA 3PYLA 4CQLB 3W4JA 4ZQBA 1E6EA 1WXDA 2WTBA 5JCJA 4E2XA 2EHDA 4WNIA 3U49A 2HLPA 3WTBA 1VM6A 3ZHZA 4FCCA 3WGYA 1A9ZA 1DHRA 4BNUA 4DIOA 3M1LA 3PWSA 3V1YA 3U09A 5TX7A 2HO5A 2EW8A 3UF0A 3PLRA 4IDAA 2C2XA 5JY6A 3JQ6A 4NH4A 2OOSA 1PSDA 4J3FA 3VZRA 1LDNA 2YHIA 3GR6A 3S55A 4BQRA 4JGBA 2VN8A 3PFWO 1EFLA 5F3RA 2HCTA 4GH5A 2IZ1A 2E37A 3DBLB 5G0VA 1ADGA 1NFRA 2I3AA 4MOWA 3X2FA 1EBFA 3GAZA 1UXIA 3TN7A 2YV1A 5I7VA 5FFFA 1HXHA 4KP7A 2C82A 5A05A 3TFOA 1ZMOA 2C5AA 4UREA 4R1UA 1ZK3A 1ZSNA 2AG8A 4M55A 3JYQA 5EIOA 5TJHA 1P1IA 2D59A 3PHIA 3C1TA 3SC4A 3DEYX 4RPLA 5T5QA 3SC6A 2O23A 2WSBA 3TJRA 1GFSA 4WASA 3BTOA 3DMYA 3L4BA 5HS6A 5G4LA 4R5MA 2JKVA 2XXJA 3W4KA 2C54A 3KM0A 3VZSA 3CPSA 3QE3A 4B3HA 4B7UA 2CVZA 5ITVA 2VRCA 3PQDA 2OL4A 1DJQA 4P38A 3ABIA 5DOZA 3NUGA 4XQCA 2X4GA 2QX7A 4IDEA 3IC5A 3RUCA 5CG1A 4E5YA 2Z5LA 2O4CA 4WCFC 4GSKA 5A06A 1NQTA 1E5LA 2XOXA 3AOGA 3GG9A 4AJHA 4FC6A 3D1LA 4NFHA 1E3JA 4OMUA 5L40A 4CLOB 5DCWA 4WLOA 3JYNA 3BTSA 1F14A 4GQAA 4OAQA 4LK3A 3P5SA 4YT4A 4WECA 2NQ8A 3OJ0A 4ZRNA 2W8ZA 4GGPA 4A10A 1ZK4A 3GEGA 1LLCA 1EMDA 2PGDA 2FR0A 3LC2O 4BO5A 3DAGA 1PGJA 1K3TA 4U8GA 5T6BA 3HB4X 4JP3A 5TS3A 4CQMD 3GY0A 1XLTA 2XF8A 1F12A 4HFRA 5EJ2A 2BMAA 3DWFA 3PYXA 1Q0HA 3QWAA 1KETA 3WFJA 1G0OA 1XR3A 2C59A 5MDHA 2HU2A 3EZYA 3QRWA 3ZWVA 2O3QA 4DQUA 1AN9A 1QG6A 3RCBA 1I30A 5G4KB 4XIJA 1LSOA 3H8VA 3RKUA 3H65A 5HRUA 2PLAA 3LYLA 5L51A 3PYMA 2DTEA 2V6GA 4RZIA 2B37A 4MVJH 2AMFA 3JD2A 1E3WB 1TI7A 4EGFA 1NHWA 1LNQA 4O5OA 2AXQA 4BNJA 3WWYA 2DAPA 3C8MA 5B1YA 4IJUA 4OM8A 1GYPA 2Y68A 1I32A 3B1KA 3DONA 3KEQA 2WMDA 4FOSA 4TRRA 4K6CA 3QIVA 4RZHA 3ZWAA 3KHUA 2C0CA 2W2KA 3ROPA 4W7HA 1BW9A 4J16A 4RVDA 3AI1A 7MDHA 4NZ9A 3ZWXA 1YXMA 1IULA 2DPHA 3JYLA 4MIYA 2G5CA 4IPTA 4XJTA 3NEPX 1HZZA 4ZQEA 3MJSA 4N5LA 3SJUA 1HYGA 1KYQA 3CE6A 5EESA 3PIDA 4XQ9A 1CRWG 5EQDA 4YAEA 4R69A 5JC8A 3I3OA 2ZTMA 3TL2A 3ZCXA 4ROSA 5L4NA 2AHRA 4NG5A 4XCVA 3FNFA 2H6EA 5IDWA 5BQFA 3ASUA 5I8WA 2VWQA 5A3VA 3TFQA 4BO6A 1MFPA 4IS2A 4CR8A 4PVDA 4W82A 3OFSA 2YW9A 1HYEA 1LRKA 3VDRA 4YRDA 3RIHA 2DKNA 4J4TA 1T1RA 3A9WA 3BTVA 1YWGO 4BMNA 4Q3NA 3JQBC 3QWFA 4IY1A 1JLLA 4MVJG 4Q3DA 5IJZA 4O0LA 4AJJA 3KZVA 3AM5A 1UXKA 1ZEJA 1PQUA 3HG7A 2VZ0A 3JQEA 3F5SA 4XGKA 5C7LO 2C7VA 2HJRA 5CDTA 1X1EA 1YQGA 3AUSA 1A4IA 5DBFA 4CUKA 5G0WA 5EPOA 1DIHA 2B69A 2PZJA 1KVUA 2VWPA 3F46A 1R4MA 2CF6A 1JA9A 5BR7A 1IY8A 3GMDA 3WYBA 1FDUA 2GCGA 1R0LA 5F1OA 3W1VA 2GN4A 4U7WA 1T2FA 4AJ2A 1CYDA 2GUGA 1UDCA 3VAZA 1BDBA 1IPEA 1YB4A 2NLOA 4UAGA 2WYWA 4M86A 2O7QA 4E5KA 4Z0PA 4E4YA 3ZV5A 5KTKA 5F1KA 5ER6A 1FJHA 1HDZA 4BL5A 4E5NA 3FNEA 2HDHA 4MVJP 3INTA 3GFGA 3LC1O 4DA9A 1KOLA 4HY3A 5C7IO 1KIFA 2NACA 4FDAA 2VYND 1AHHA 3ROMA 4CLDA 3DZJA 3VHRA 1NVTA 1PTJA 2Y66A 3Q2KA 4A0SA 1NWHA 3RUEA 4PRLA 2HRZA 4WLFA 1GQYA 4E30A 4F6LA 5KJ6A 3CEAA 3PWZA 3ZHBA 1MUUA 3NGLA 4E5MA 3ANNA 1O8CA 2NUAA 3IS3A 4TRMA 4FFMA 4IGEA 1KEWA 2YFHA 3TZCA 1NHGA 4INAA 2IRWA 2VYNA 4W9NA 2YHIB 1HDGO 4CJXA 3VOSA 3GVPA 1Q7GA 1LC0A 4FS3A 1Y7TA 3NT4A 4K28A 1V3VA 1UXHA 2NNLD 2AQ8A 4BB6A 5KWEA 1QYCA 1GPJA 4XZ3A 1PGQA 1E5QA 3TNLA 4B7XA 5KJCA 3FBTA 2W2LA 4PLHA 1I2CA 4WUVA 2FSSA 4A27A 5AXCA 5TJ9A 2B5WA 3UXYA 1DC4A 3RUAA 3ZWNA 2EW2A 2IYPA 3QVSA 4DGSA 3I9JA 3K30A 3UUWA 4XB1A 1PJBA 2C5EA 5CG2A 3VKUA 5JSFA 2GZ1A 3QVTA 1AXGA 1ZMTA 2A4KA 4BKUA 3KVOA 3L9XA 4P8RA 2BH9A 2CY0A 5C7OO 3BMCB 3M1AA 5ICSA 1T25A 3Q6IA 4NMHA 4PZDA 2HRBA 2P4HX 4IZHA 3DXFA 3INGA 3JQFC 1BSVA 1NP3A 4N18A 2JJYA 3B6ZA 1EFKA 4L74A 1LLUA 3OJEA 4GBJA 3QSGA 5DP1A 4PFJA 3PZBA 4PG8A 4CPDA 3AUAA 4GSLA 3PJFA 3G49A 4ALLA 1XYGA 4R4JA 4FGWA 2EEZA 5EINA 1JVBA 3D4NA 4N54A 1KVSA 4ND2A 3I83A 4YEDA 3ONDA 4XR4A 5GMOA 5I7SA 3H5RA 1FMCA 2WE7A 4EI2A 3I4CA 3H9GA 1WDKA 3DOJA 2Y0EA 2EXXA 5FYDA 7ADHA 2WDZA 1E1NA 2P68A 2PZKA 2EKQA 3ENNA 3WMXA 5KJEA 5BSHA 2J5QA 4MP8A 3HFGA 2RAFA 5BNIA 4R3NA 3V2UA 4J2OA 3P7MA 1ZXLA 1Y1PA 3BHIA 2NWQA 1P0FA 3KSDO 5DF1A 2D5CA 1V9LA 4ND3A 1YQXA 2B5VA 2O3TA 3EVNA 4J91A 4DLAA 1H2HA 3PHGA 4IXTA 2P5YA 4UULA 3JD4A 5G2OA 3E6AA 4BO1A 2H63A 3WNQA 3I9KA 2QZ9A 1DLIA 1L1FA 1D4FA 1UZNA 1XWFA 4NU5A 2UVDA 1B3BA 3VZQA 1Y8RB 1JTVA 4J7UA 2EJVA 3I9NA 2VCYA 1F8GA 1V8BA 4CV1A 3V2HA 4S1VA 1CQJA 1E1MA 1YDWA 1I3NA 1KEPA 1YKFA 3DZIA 3E82A 5I9NA 1OMOA 1YH3A 5DCYA 4FQ8A 1T2AA 3IP3A 4WCFA 4H3VA 1QLJA 4Y6PA 4BGEA 1OI7A 2Q4BA 1XHLA 4F3YA 1MX3A 4KQXA 4WPGA 3FHLA 2EGHA 3Q1LA 5A5FA 3MWDB 1DAPA 4KUHA 1HDXA 3C1AA 3OF2A 1NQAO 4KWIA 2NVBA 3WGOA 2Y0CA 2IEDA 3WGQA 5I8ZA 3AFNA 5EQFA 4QSMA 1ADCA 2Z1NA 4MIOA 2ZJ1A 3DOCA 1NPTO 3K2BA 1GD1O 4XYEA 3JCZA 3WJAA 2OUIA 1P45A 3H9QA 5IG2A 2JAHA 4WKGA 2I76A 1LI4A 4QFCA 1R6DA 1EDOA 4NJMB 4YACA 5JDIA 4XQGA 3I9OA 5G0UA 5T67A 5JFOA 4Q9NA 1SNYA 2WM3A 2X0RA 1P77A 4I9HA 4G81A 3RUHA 3RU9A 5HM8A 3IKTA 1J0XO 4R54A 3WIEA 5DBIA 4O1MA 2C20A 1RM3A 1YGYA 2VUUA 1TLTA 4B4OA 1U1IA 5TIIA 3ROQA 4HP8A 3ADPA 5L45A 1GCUA 3C7AA 3WGIA 3ZWBA 1PL7A 3JQ8A 2GNAA 3IP1A 3H5AA 4YWJA 4H16A 1KY4A 1JKIA 3KLPX 3OICA 1Q0QA 2YJZA 4BO0A 1R0KA 1SOVA 4D0SA 2JCVA 2VOEA 4ZQGA 3N74A 3JQAB 4OQZA 5COAA 4CM9A 1ADBA 3ZWOA 4EEZA 1VL6A 1NYTA 1RM5A 1E7MA 1SBYA 1T26A 1EUCA 2DVMA 3O4RA 4RV9A 1H6DA 4YJHB 4Y6SA 2ZKLA 4D44A 3WGHA 3PWKA 3WFIA 4G2NA 3B70A 4PG4A 5JAMA 5JW6A 3U5TA 2DC1A 1U7HA 1KEUA 3GT0A 4E6PA 1WP4A 4W7IA 3ZU3A 5GZ6A 2QIOA 2F1KA 2W2LD 3PPIA 2NTVA 2CNBA 4D0RA 4BQPA 3EDMA 5IZCC 1NX6A 5FI5A 2E49A 3ZHXA 1SPXA 2J3JA 4OOEA 1ONNA 3IJPA 4J4BA 4E21A 2R00A 1P74A 4CR7A 5BNTA 1I2BA 2BKAA 2B4TO 3B20A 4TQGA 4QQRA 3V1TC 3ZWMA 5IN4A 1JW9B 1PQWA 4NFYA 2G17A 3V1UA 8LDHA 1BGVA 3MWEB 3E5MA 2QHXA 4E13A 3WIDA 4EITA 4MVJM 1RJWA 2O3JA 4Z3DA 1QR6A 2DFDA 1XDWA 3TOXA 4RPHA 1BG6A 2JL1A 3TZQA 3ZWWA 1EUZA 1VPDA 2O3RA 4OSPA 3RUFA 1B8VA 3TOZA 4BB5A 1ZKMA 5GZ1A 1K2WA 2IZ0A 3DZHA 3JTMA 5GY7A 3W6ZA 2D4AA 1FDVA 4PLGA 3GZNA 3S2GA 3DTYA 1MC4A 1NAIA 1QP8A 2EP7A 4U5QA 3E1KA 1RM4A 3WG9A 2NU8A 4O6VA 5DBGA 1Y9EA 4K26A 1XQ1A 4XGNA 4BNXA 1F06A 4Q3AA 4YJGB 3WOHA 4MVJA 2ZYAA 2I9PA 3QWBA 2HMUA 4GVLA 4M89A 2I5PO 4IJWA 3KSUA 2J6IA 4WLVA 4RVHA 3WYEA 3MOGA 1HYHA 5ITWA 2EKPA 4GWKA 4MDHA 2POQX 4XGIA 2GF2A 2Y0DA 4BNWA 2HMVA 1FDTA 4AJOA 4C4OA 4W6ZA 1YJQA 1X13A 4IMPA 1PJLA 5A9SB 3C3XA 2Q1TA 3AFMA 3BIOA 3HADA 4XYMA 3ZGYA 5L3ZA 5KKAA 1BXGB 5JDIC 4CR6A 4MVJF 4MVJD 1QYVA 1GU7A 2QRJA 3CH6A 1A4UA 1BXKA 5ES3A 1PR3A 2FN7A 4TZTA 1WZIA 1KEVA 4Z0TA 3DTTA 1IUKA 4ND5A 3VPSA 3VH3A 5I9MA 2PZMA 4H15A 4TZKA 5THQA 3UHAA 1YBVA 1M67A 1ZCJA 1JWBB 1VL8A 2VHZA 5FF9A 5T8KA 4BKRA 4E31A 2CMDA 2OMEA 5TLSA 3DR3A 4AVYA 5JY1A 2RHRA 3S2EA 2X7HA 1YRLA 2YV2A 1HDOA 5KJFA 1KC3A 4IDCA 4KOAA 4CV3A 3O8QB 1SZJG 3T7CA 4MINA 3I4FA 4QTZA 5DULA 3PFFA 2DTXA 2TMGA 1IB6A 1KVRA 1U28A 1HDYA 1YL6A 4P22A 4U0KA 2V6FA 3EUWA 4RO0A 2EWMA 2YFQA 2QW8A 2FPGA 4DIBA 3BMNB 2BI7A 1K5HA 2PTGA 1KERA 1GY8A 2C2YA 3IJRA 1TXGA 3TRIA 3KYBA 4N5NA 2GASA 1W0CA 2BFAA 1XKQA 3AUUA 4XWYA 5I9LA 2WYUA 4XRGA 4YXFA 2V65A 4IJVA 3GFBA 1EQUA 5LDGA 1YL7A 1LSUA 2R2GA 1TT7A 4PLCA 5EL0A 4Y9DA 5IDYA 4U0JA 1PU2A 4LSMA 2X5JO 1E3IA 3ICPA 4GKVA 4BGIA 1ZJZA 1LLQA 4J2HA 5DT9A 5TNXA 3RU7A 4ALKA 2J3KA 1ZK2A 2O48X 4R9RA 4BV9A 5LDHA 4XYGA 3WS7A 2JD1A 2EV9A 1Q1NA 3LF1A 5DCUA 3NT5A 1ENPA 1DRWA 3K92A 5A3JA 3FBGA 3TL3A 4BO2A 3W8DA 2Q2WA 2ZYDA 1WNTA 1LDGA 3FRJA 5DZSA 5BT9A 4PIVA 2PGJA 4J7XA 4KWHA 3RROA 3FTNA 2FZWA 3AK4A 3PK0A 4GLLA 4KMSA 2VHWA 5AOVA 2GD1O 1I33A 3P19A 4E33A 1GQ2A 1M6HA 3RFXA 4YPOA 3LT2A 4CMEA 2GGSA 5H81A 3QP9A 1HE2A 1EVZA 4D46A 1E7WA 2LDXA 3OJLA 4GAEA 4I5EA 3ZU5A 1U3TA 5JLAA 3F1KA 3A14A 3OQBA 4PLWA 2OXIA 2RHCA 4NU6A 1LSSA 3ICCA 3QWHA 4A73A 3PGJA 3R3JA 1VJ0A 1PWXA 1K89A 3VPFA 3ZWYA 3C24A 4ALIA 3FCOA 4CM8B 1T2DA 1IZ0A 3UOGA 4CUZA 3VKVA 3WSVA 1UAYA 1IYZA 1E3WA 4LMRA 3ITKA 4Q3EA 1NASA 4DRYA 3LC7O 3GH3A 1P1KA 4ZD6A 5IN5A 3K9QO 1UZMA 4HADA 3Q11A 4ZGWA 1B7GO 1E6UA 1DFIA 2X0IA 1O89A 3TQHA 2BGMA 3A4VA 3LF2A 4Z3KA 1SEVA 4L75A 4GLOA 3IMFA 1IL0A 1LLDA 4PGFA 3RI3A 3UH1A 3H6KA 4GMFA 2JCXA 2NU6A 1M6WA 4FIZA 5IAAA 4BO9A 1UAGA 3SLKA 1N1EA 3V8BA 1NNUA 2NVWA 5A4DA 3F4LA 3HHPA 5L53A 1OC2A 2PZLA 1EQ2A 1QV6A 4BO7A 1YOVB 2NTNA 3E9MA 1EE9A 3JQ7B 3KYDA 3OP4A 3D3WA 3CTMA 5COBA 1HDCA 3PHLA 5JO0A 1H94A 2IXAA 4CMIA 3E5RA 4F45A 4QO8A 1DC6A 3OBBA 3KOUA 2Q46A 3JQGA 4HNGA 4K6FA 4EW6A 1U3UA 1PS8A 1Z75A 1U8FO 1A71A 4ZHSA 5BSEA 2GZ2A 3L07A 5JAQA 3IIEA 2I3GA 4CMAA 3UKOA 3JQ8B 1Q7CA 3KTDA 4WCFB 4A26A 4CV0A 3OJOA 3EW7A 1MGOA 1B8UA 4IZIA 4NR0A 4KZPA 4RPGA 3OIDA 2C7GA 1UP7A 3GQVA 2CVOA 3DFZA 4DQVA 4R1NA 3PDJA 3VH4A 3RAJA 1N7HA 3NDRA 3AOEC 1E92A 1ZNQO 4YT8A 6ADHA 1JQBA 1U7TA 1ZEMA 4PLTA 3GF4A 4IGFA 2IE0A 4WJZA 2WD8A 3S1LA 4DREA 4NNJA 1ISIA 1GUFA 2AQHA 2O2YA 4GGOA 4NHEA 3RFVA 3M6IA 3TWOA 3EAGA 1ZSVA 2JHFA 1JAYA 1ARZA 4ND1A 3WYCA 4B3IA 3CINA 3GHHA 4E5PA 1N8KA 1XELA 4CLHA 4YTEA 2GERA 2X5KO 5K9ZA 1BMDA 1PGPA 1SB9A 4IBOA 3E48A 3C7DB 1Z45A 2PKQP 3FPLA 3DBLA 2Q1WA 5EERA 4BNFA 3R1IA 2HAEA 2HMWA 3E9QA 5DDIP 2VWGA 3WQSB 3BTUA 4QEDA 4BNIA 1NR7A 3ASVA 5JPIA 1N9GA 4GX5A 1EE2A 1E3SA 4RQUA 4BNLA 1HEUA 1SC6A 4KTTE 1PS0A 1QRRA 2QG4A 4LSWA 1GAEO 2C07A 1VI2A 3MTJA 2CF5A 1A27A 1LDBA 1YO6A 4TRNA 2CVQA 2XPCA 3WQQA 1EK5A 2X58A 1TT5B 2R00C 3PI7A 4PG5A 5JYEA 4CQMA 2YV3A 1KY5A 5KVVA 2X0JA 1LU9A 1SOWA 4WEOA 3RC7A 2PNFA 4Z0HO 2QYSA 1LX6A 2VNSA 4RDHA 4RORA 3FTPA 2WD7A 1F17A 1E7RA 3U3XA 5L7WA 4FFLA 3E9NA 2Q99A 3R0IA 1A9YA 1DC5A 4YJGA 1H9BA 2GN8A 1GR0A 3BA1A 3L4BC 4UEKA 2E82A 2ZQYA 1VL0A
chains in the Genus database with same CATH superfamily
3N58A 4BP1A 5C8DA 2VDRB 1X1SA 2VYVA 1NZJA 3WLOA 1YS4A 4F4JA 3DVQX 3MJHA 2PH5A 3QNUA 3QG1A 4PSDA 2WSLA 2BRUA 5FFMA 4R84A 3AXSA 1T34A 1E5TA 4HSGA 4XIIA 4CLRA 4NK4A 1GOTA 3MQ2A 3MT0A 1D7AA 1N0VC 1UBFA 3P0EA 4KQWA 4MWBA 4DXAA 4ZI7F 4OJNA 3WGZA 3G17A 1EZ1A 1T3HA 1GU0A 4YS6A 2VAWA 1VE7A 3DT8A 4CW7A 1HA3A 1A4RA 4RPKA 1W35A 3WGUA 2RI0A 1EVYA 1OZ0A 1A77A 1P1JA 1SVWA 1GJRA 2QYHA 1H2AS 3MQ4A 3NOVA 1DX4A 2I6UA 1TKCA 1WXEA 1DJMA 1QTIA 1OWNA 1EGMB 3WL7A 1UEIA 2AA3A 4KFRA 4HZIA 4MS1A 4LJLA 3S40A 3ZE1B 1FFHA 4J2TA 1X38A 2VHEA 3ZX5A 1V6AA 3A4NA 3Q3EA 1NPDA 4K05A 4B79A 2JJ1A 4YUXA 3Q6MA 5JJBA 2NADA 4FDMA 2IUEA 5JMPA 4A8JC 2Q50A 1CY4A 1GNSA 2R65A 1THGA 2V4ZA 3H83A 3I3SR 3PHHA 4CL3A 5K0EA 2JK0A 4JLKA 2ZUTA 3SBDA 1RBZA 3NAQA 3DL4A 4DCPA 3I1JA 1WP9A 3QLVA 5IVHA 3GT4A 2JBAB 2PV0A 4OGLA 1JKFA 3PNBA 4Z9AA 2QRHA 2JVKA 3KQHA 3QPBA 3WKDA 4C05A 4C0SA 4IDOA 2AHOA 1OKKD 3H1TA 3HXKA 3IA2A 4LOHA 3L77A 4L4RA 1NLUA 1M2WA 3GVCA 3VPCA 2HN9A 4EH1A 4OMDA 3VO9A 3PGLA 5IZ4A 4BMSA 2XI4A 3CUYA 4Q9IA 5JCJD 1GPH1 4D4LA 3L4EA 2Q4OA 5HDBB 1XU9A 2V6BA 3OIFA 3VR3A 3ILXA 4AROA 4G8BA 1N1DA 2JIMA 4KYTA 5IMBA 3MHTA 4WEQA 5CLHA 1J33A 2ZBDA 1MAAA 2OBNA 1DIAA 3ZYZA 1R4NB 1L3IA 1HRKA 1Y3BE 1UKAA 1G38A 4NU0A 2PA3A 5DW0A 3PDIB 5I6DA 4L5IA 1VJGA 2RK6A 1US8B 3QV2A 1DMRA 4HRAA 3PX3A 2EC5A 3WKAA 2JH9A 5AHRA 2NPIA 3PXGA 1R8JA 4EHAA 4JLVA 3H18A 2X23A 5CCEA 1USWA 5IPFA 3GEHA 2YRWA 1I4OA 2WV7A 3C4VA 4F3CA 1WD5A 4P36A 5DYGA 2OMKA 4ZV4A 3OIYA 2CDNA 5D1HA 1R8YA 1TCBA 4PX2A 3D2BA 4TWBA 2YVKA 1TVKA 2NU9A 1SKYB 2NTJA 1YA8A 2Z8XA 3H2ZA 4I9NA 5FXMA 1JHUA 2BZ0A 3NBUA 3OPYI 1W2WB 5IUKC 3V8PA 1SVMA 2VSFA 4HUJA 5IJ9B 3QBVA 4RVGA 1DV1A 3LBAA 1SQFA 1X8LA 3ENZA 3II6X 4AJ1A 1Y8CA 3NCTA 1K6XA 3I6QA 5FUYA 4YQYA 1ZZEA 4YB8A 1IUOA 2O4UX 3DAFA 3GNTA 3OIVA 3OQ6A 5E38A 1R18A 1RXWA 2QGFA 3NM6B 4UU1A 1NQOA 4MO9A 1NN1A 2YIVX 5FI0B 3ZR4B 2FHPA 3UIEA 4ZVTA 1B73A 4ZGGA 5A9RA 1GU1A 4A1FA 4F21A 1HL3A 3RAPR 3WYGA 1L7PA 5CEFA 1UFRA 1WAMA 2AN9A 2F00A 4UAUA 1WR8A 1ZLYA 3OO1A 4YONB 2JZNA 2ODBA 1XDUA 1P7WA 3LWZA 4JT4A 1TJNA 4UQPA 3VH1A 1E9VA 2FW0A 4GWGA 1XB2A 3CXRA 1J5PA 4ZAFA 2IH4A 5SYMA 2G25A 3G9QA 2JJ8A 4RJ2A 1S3GA 1A8HA 2AIRA 1W1IA 3N8KA 4UTZA 2NZWA 1GA6A 4RK4A 2WUGA 1V3UA 1X80B 5AIAA 4YAGA 1VECA 4ILKA 1TT5A 2J3IA 4PGAA 4HFJA 1BMTA 1UP4A 1WSWA 1Z6XA 2UDPA 2XNJA 4B6JA 2BPOA 3OHMA 1ADFA 2PWYA 1ZUD1 2HF8A 3KR9A 4NOMA 3NH6A 1W581 5T64A 5LQNA 3ILVA 3QUCA 2IPAB 3V7NA 2IEYA 4H0NA 2GDZA 2TMKA 1C4KA 2HV9A 2YV5A 3UWOA 1ATIA 3HWRA 5CD9A 5BSTA 3IUSA 3FDXA 1KI8A 1RADA 2X40A 1F7VA 3AMVA 3VNRA 3COJA 4ZZ2A 3OZTA 1CPYA 1IAQA 1JS1X 1OSNA 2HB6A 2PK3A 3G2JA 3HVIA 4OUDB 3UK7A 2GS9A 5G4KA 5CFRA 4OFXA 5EXXA 4HDKB 1P62B 3H5WA 2OXFA 3ECCA 3IE0A 2IYFA 4PQEA 5B37A 1RWQA 4KGXA 1G8GA 2EBFX 3GQBB 4DM3A 4DQXA 2PLFA 4JKOA 1VA5A 3G82C 4V24A 1Y7HA 3K8QA 3P71T 2DR2A 1EKXA 1JSXA 3IT3A 5EJGA 2ONKA 5KHLB 3UKDA 2JLUA 1U9YA 3BMCA 1EFRA 3A3NA 2I3DA 1MG0A 1DLJA 1HWYA 2A1UB 2OHXA 2DQSA 4FU0A 4GC5A 4L27A 3RWBA 4YAKA 4HXEB 1GP2A 1KEEB 2QM8A 1H2BA 2ISSD 5H9WA 4MK4A 3W3AD 1OAKA 4KDEA 1F4VA 2OFPA 3KQQA 2P3QA 2Y6UA 2R87A 1F2TB 4X6YA 2ZR8A 4W6QA 2R0QC 4BX2A 1DTSA 5DLEA 5FUVA 3RHFA 1OIXA 2OFOA 4L51A 2P9EA 1ODSA 1Q91A 1BE6A 4JVOA 4LCJA 1UBTS 5FWXA 4D3FA 4BNHA 2EL9A 1R0YA 2I78A 3LL7A 4PC1A 1VKNA 3T0GA 1K5PA 2OYCA 4ZCQA 2CSUA 5ALNA 5JFGA 2XD4A 4WBNA 5HYVA 2ID7A 1KQGA 1L8QA 3JS5A 2AWOA 1TNDA 1G7TA 2XA2A 3HABA 3W3AA 3BJRA 3ZI7A 4CF7A 3PEWA 4O4HF 3AVVA 3MWKA 1OX4A 3LKBA 5JRDS 1T6BY 4AMGA 5JMOA 4YI5A 3TG8A 1AS2A 2P2DA 2GM9A 3R5KA 5D5PA 1RCTE 2X13A 1K0FA 4MEAA 3T9EA 4OX9Y 3CSDA 3UMVA 4UVGA 2AKAB 4JK3A 5FOWA 3T3MB 2FXVA 2PRJA 2VUSA 2C94A 5HBRA 4X3CA 3S2YA 4Q1CA 4RHTA 2AEFA 4E03A 4HGOA 4MI3A 1TGYA 1ZI6A 1II9A 2AGVA 3QI7A 5IVDA 4DR2B 1VMDA 3E35A 3I1YA 1U90A 3T7IA 3UBMA 2P9CA 3IFSA 2WMYA 1FYDA 1MG5A 3O3NB 1XWIA 1YS9A 3W90A 3DEZA 1P5FA 2XLBA 3GLRA 3MJEA 3DFMA 4PIMA 1B74A 1Z82A 1B23P 3PJEA 3RBVA 2O06A 5FULA 3SIRA 1O5TA 1T9GR 3IV9A 4YDHB 4JLMA 1SD2A 4UNIA 5GPBA 3WNCA 5HJ2A 4BPBA 3A6LA 3M3DA 4BNMA 4QQFA 3MWGA 1V6CA 3RUIA 5HXAA 5CDHA 3JATB 5H83A 5KPDA 3AFGA 3KO8A 4C4TA 2QG9A 3IUBA 1RZVA 3MWLA 1NG1A 4MLPA 5FOVA 3VUFA 3I8OA 3OPVA 4I9FA 1T8SA 3PDWA 2QYTA 1AK1A 3D8HA 3VR5D 1GV1A 4ZICA 1U1FA 2L19A 2VSQA 4JA2A 2QT0A 1SMKA 3D1JA 3EXG2 1S9HA 3GNLA 2HPAA 3H5TA 4W5TA 2II6A 2AK2A 1MX1A 4WBSA 1FSZA 2E4ZA 2P6NA 3B6JA 3QKTA 3ZHSA 4CLRB 5B4UA 1BROA 4KE7A 4ISCA 3BGVA 4MGYR 5DEOA 1G8SA 3SSNA 3UQZA 3ZJ4A 4DLRA 3H2IA 3ADDA 1X74A 4TLLB 4XVUA 1T6XA 5CA0F 3GLGB 1GTG1 2YX1A 5IJAA 5IF9A 2YINC 3SHOA 2ZIXA 4P98A 1UC4B 4RVSA 2GJAA 5JH7B 2FFBA 3G68A 4BUCA 2WVGA 4LSZA 3UMJA 5IJWA 3V8VA 4ZU3A 4AURA 5J43A 3IL2A 1QV9A 2HU8A 2C9BA 3NDIA 4OLFA 2BF7A 3RS8A 1RHQA 1TF2A 2YUTA 4FMDF 1QV7A 2YQ5A 3CLKA 3ROEA 5DSZA 2Y05A 1E1QD 2PUFA 3ROTA 5L9AA 1TYAE 3AFIA 5JR3A 3M4ZA 4CMEC 4ENSA 1M8JA 2HK8A 3VBCA 1H3NA 1IHYA 2ANCA 4QZVA 5CVCA 2AN5A 3KPVA 4LRTB 5TQVA 2A9VA 1C0LA 3PUHA 1PZGA 3L05A 2JBAA 4U6NA 1KAMA 2WJ4A 3ZXXA 2I6XA 5IFLA 4AZ0B 3KC2A 4DYDA 4KN9S 1KS2A 4AFNA 1W25A 4L9AA 2AZTA 4V0KA 1GZ7A 3VU3A 1YR8A 5HTOA 2RHOA 4TKMA 1G6OA 2XJ9A 3ORSA 3REOA 2QMYA 4RX1A 4CL2A 5JLJA 4E3ZA 4EY5A 1EUYA 4CCAA 1T9CA 3M6FA 2AW3A 1KI7A 1RPNA 1YB7A 2Q6VA 3JV7A 1EE1A 4BVEA 4YT5A 3W8NA 3THXA 1Q15A 5JSKA 3D02A 3W5JA 1QGZA 5C37A 2YWJA 1OGJA 2ZGVA 1Z12A 1PIWA 3OTQA 1U0OC 1E2KA 1YBFA 2G1JA 3H0KA 3K9NA 4WI1A 1TCUA 5B55A 4O4IB 2W6MA 1QSGA 5BPHA 3PRYA 3IBSA 3Q8XB 2QD3A 3VPXA 3RFUA 1H6BA 3B1YA 3E7PA 3ESAA 1K0UA 1C7ZA 4X97A 1PFYA 1XTZA 4Y98A 3AGQA 1P3Y1 3A1CA 3AR9A 2FMIA 1U2RA 1CLEA 3UQYS 2ORWA 1XBTA 2AOVA 4P7GA 4B47A 3OMLA 4EARA 1L9XA 5K3DA 4CQNA 2DSNA 2CUTA 1C30A 3BMOB 1XC7A 1GGVA 1RRPA 5JJCA 1WF6A 1MZPA 1U9IC 3M6MD 3WICA 2ORIA 3EZ2A 4FHZA 4DSAA 1XRNA 4EP1A 2X14A 4AY4A 5MHTA 3T4UA 4TGLA 4ZEMA 5JZMA 3IJEB 5DI3A 3WLSA 4X7PA 2A86A 4TMXA 2VRCD 5EIEA 5J58A 2BEWA 1LNSA 2P2GA 3AY7A 4HGPA 4JQCA 4F2DA 4G4SO 3H1EA 4RKRA 5ALJA 4PZCA 2O5EA 2QAIA 4BS9A 1HE3A 2XGMA 4L7QA 1DPFA 1UMBA 4LW8A 1P1FA 1H2EA 1PNRA 3KSRA 1GQRA 5AK3A 1VBMA 4FR5A 5C4MA 3OZUA 4X0EA 1M7GA 4GPD1 2WWWA 5LM3A 4Z2YA 3LRTA 1IHXA 2CW5A 2A59A 2W6CX 4MV3A 1XZGA 3E58A 4TXMA 4BFTA 4P80A 1ORDA 5IP5A 5C5IA 1DXHA 2AL7A 5CDYA 1AKQA 3B38A 5F12A 5KQPA 1G8PA 1YA6A 2V5UA 3ZKWB 4AYTA 2WHYA 2J41A 3O0DA 1OFGA 3Q7TA 2XVXA 1CERA 4KNWA 4OHCA 3K8YA 4IEFB 5SZKB 3IESA 3S1AB 1Q44A 1K8ZB 3HB7A 3GAMA 4J3NA 1NLMA 3F74A 5F3DA 1ORVA 1R12A 4ZZ1A 5TPZD 2J4FA 1NVUQ 2F8LA 3Q3IA 1V3QE 5IASA 1Z5GA 5MN6A 2BGNA 1BHJA 1Q50A 4NCBA 4RANA 3AESA 2PV7A 2QR2A 3MG9A 3DF7A 1IBMB 4S3MA 3IHKA 1U5AA 4EKIA 2O8CA 2C2OA 3EOZA 3IURA 4LDPA 4Q5IA 3PRJA 1A7UA 1VJTA 2G8NA 1LQTA 1U31A 2GEUA 2ZCVA 4UVDA 4DZRA 4G65A 2J32A 3B36A 3G1TA 4Y2VA 3DLPX 3JRWA 4FBMA 1T0HB 1TB4A 1ECJA 2I4NA 2QLLA 2EDCA 1D8TA 3LT5A 3QLJA 2E4UA 5GADl 4BFYA 2PGNA 1MCZA 4UM8B 2AQKA 4K1LA 4PZPA 5E8JA 3H9EO 3RF6A 3V1LA 3MUNA 3FI9A 1LD3A 4HDOB 4BC1A 1LJ8A 3GQBA 2BH2A 1OY1A 1P4HA 2B4AA 3CLSC 3ASZA 3MGCA 3MS4A 4JYCA 2R1VB 2PGIA 3BIXA 3DEKA 1CRLA 4KAJA 3VGJA 4CLOA 1TQ8A 1H2YA 1KP3A 2LKDA 1TA4A 1X1RA 2ZYIA 3WB0A 3LTEA 5E1BA 1P7CA 1EFVA 5AXAA 3R3XA 6NULA 1F2TA 3ZVKA 4V02A 1Z3CA 4L2IA 1SKMA 3FN4A 2PUDA 4FBGA 1BCRA 3NMUF 2H07A 1NP6A 5AP9A 1W88B 1U7XA 4YAJA 1JJ7A 4YLYA 1LB1B 3KQWA 3QW4B 4XIFA 4QT4A 3A1TA 1YK0A 2O0MA 3DDOA 5BR8B 3QKRA 3WXMA 4W9MC 2QTTA 7MHTA 3FSJX 2FOLA 1QQTA 5CP8A 2RHMA 3KTOA 3BSYA 3CS3A 4YCCA 5G40A 3D0OA 4QUKA 5AXDA 1H42A 3VNSA 4U1RA 2WU3A 2E55A 3D5QA 5EJ6A 1S4MA 3B53X 1T4GA 4A8HA 4EGSA 3LCVB 2Q3EA 3HXTA 2D8AA 5CHEA 4AKGA 3PKJA 5CVDA 1TFUA 3W5CA 1AT1A 3SYTA 3V5NA 2YJ6A 2ZT8A 5F7JA 4FDTA 4HQKA 2DFNA 2WHPB 3ZDQA 1YFJA 1UXOA 3KTAB 2NXJA 5KJ1A 1T15A 4RJIA 1MVLA 4KSCA 2QRGA 3BERA 1KO8A 3HA5A 4GZMA 3HGTA 3OLYA 3AU8A 3DT6A 3OQJA 3LCMA 4JB0A 5B4VA 3LV8A 2JFNA 4B6EA 4IIXA 1DC7A 3ABZA 3CNLA 4JR1A 5DYNA 3VZPA 5K8CA 2C8LA 1VJ5A 3T35A 3ESXA 1YUNA 1XG5A 4AJIA 1S2GA 4YXWD 1ZHFA 1SH7A 3NCHA 3Q5GA 3RYHA 2AC4A 3IMCA 4BV2A 3U7GA 3NHSA 2NSHA 1QHSA 2J7PA 3LYHA 4I1SA 1MJ5A 4UXIA 1SXJD 3ZWPA 2JARA 4PF1A 4MP6A 1LVGA 3LKDA 4R3WA 3A3OA 3PZRA 4Y1FA 4B2IA 1E1QA 5IT5A 1DOAA 2OXRA 2OZKA 1KH1A 1EJ0A 2QMUA 1M34A 3P2YA 5HIMA 4LVNA 4YUVA 3H5OA 4Z4GA 3M3PA 4OHFA 1C41A 3OECA 1ZCFA 4G1FA 1AQIA 1Y89A 2JH8A 4LSGA 5AK5A 4ZVKA 1YB1A 2ZB3A 2J3QA 3FWZA 3LHKA 4WMLA 4C0KA 4MQFB 2IEBA 2I6TA 1TA0A 4ZOLA 1M7HA 3Q0EA 3GJTA 2J9XB 9LDBA 2VJYA 4P4SB 1T6ZA 3GZ4A 3THSA 1LTKA 1Z15A 2BBWA 3BA6A 3WAJA 2FF5A 1JHVA 3RSQA 4BU1A 1SAYA 2V6JA 3HCEA 4NYMQ 2DP4E 3RAGA 5LKRA 3SC3A 5HX7A 4H77A 1EVLA 3CW8X 2B9EA 1J1ZA 1KAQA 3E2PA 3GDGA 2AXNA 4BNNA 4LOAA 3A1WA 3RFTA 3UWPA 1I5OA 4EUHA 1RCFA 3MUFA 4ARZA 5A1TA 1COWD 4UZFA 3X0DA 3FETA 5A4JA 2C9CA 2GBLA 1AK2A 4S1OA 1N9ZA 4QASA 2XHEA 4ZOLF 1RACA 4R41A 4EB8A 4AD8A 1FP1D 2MSDB 5HOEA 3CO0S 2W2KB 4QGFA 1N6KA 4RXUA 1DGQA 4EBFA 4XKJA 3TTVA 1R27A 3UV6A 1QAQA 2DF8A 2JGAA 1Q14A 2XSZA 2GHIA 4QUDA 2L2QA 4R2IA 4Y9SA 3SMVA 1MQAA 4ZAVA 1Q1ZA 3EFEA 2IYUA 4TKUA 2Q41A 1Q20A 4RVFA 5DTEA 3A04A 5KVQA 2P4QA 5I9IA 5DN9A 1QG4A 1SN7A 2Q6LA 3AP1A 1QIKA 4FSHA 2DBQA 3UJAA 1E32A 2G9QA 2IYWA 2B7LA 3FXAA 4HFNA 4MLZA 1NJ5A 2HFJA 4PYMA 1UDAA 4OJKA 3VC7A 4BJ3A 5CFPA 1EYZA 4BZWA 1U8AA 3O9ZA 4ZO6A 3R6DA 4E2YA 5F7XA 1DPGA 3UVEA 2XECA 3I1IA 3ZVLA 2BELA 2DFVA 3O8BA 4XXHA 2QTVB 1A98A 1ZWKA 2FWRA 3WL4A 3ITEA 2YYSA 3S4YA 1E79A 1I2ZA 5KSPA 3F4BA 4F2PA 1YFLA 2XSZD 5K0TA 1Y6JA 4B3JA 1L7XA 5CJ2A 4OXQA 1CRQA 1FF9A 2DUWA 2GLUA 3DDUA 3E03A 1J24A 4IDDA 4MVXA 3M4JA 4F4IA 2E4AA 2ZQ5A 1U8UA 5L51A 1KDRA 1V9CA 2O05A 3A26A 4X7RA 5FEUA 2IODA 1XAGA 1PFVA 4RF2A 2FLWA 4CKCB 1VIAA 3OM1A 3BZBA 1TD9A 2P5UA 5DK6A 1UT6A 4F5DA 1JA1A 1NXOA 1GYQA 1ENOA 4Y0VA 2XE7A 3AL2A 1HBJA 4XTCS 4EFMA 3R5FA 3W0LB 5K4GA 4UVEA 4F46A 1O95A 4BFWA 1A8PA 3ETDA 1PTJC 3BDAA 2V4UA 4YDQA 3BGSA 5EWMA 1OASA 1QWSA 1N1MA 2BFPA 2Y0BA 3DO8A 3E8SA 5ECGC 3PTAA 4A91A 3EX7C 4MWGA 4IF6A 1Y5RA 1IM2A 2CDBA 3UHFA 1NFQA 4TRJA 2BV3A 3BILA 3T4EA 1NBEA 4GECA 1N77A 3QX3A 4GDFA 2RHLA 5HMLA 4MI6A 1QPGA 3CLVA 1D8AA 3EGWA 3R20A 4YAUA 1VP3A 2QN6A 2HU5A 1QZUA 4GMKA 4J6FA 5EXDA 4C7JA 3NHWA 5J1SB 1ST2A 2FSPA 4R1SA 1HFEL 2ZS8A 2J6CA 4ZVOA 1NW6A 1VYHA 1J0DA 3B9BA 1K6MA 1E62A 4G5SA 1WW8A 1OQAA 4D45A 4RWEA 3UC5A 2I1QA 2ENUA 4LCBA 4P93A 2JAWA 1E20A 4L5YA 3OUZA 3DQPA 3PVZA 1MDBA 1PT5A 3CE9A 4X1IA 1MO2A 1NVVR 3SAJA 3SXJA 1GGNA 3DUWA 3H2YA 3EYWA 3HDTA 6AT1A 2PH3A 3DVSX 5JAPA 3RT7A 4JEUA 2Q49A 3FDJA 1WZCA 1ZJ5A 3LY9A 1TKBA 1YIOA 1HDRA 4ID3A 4IFBA 1UPFA 5BWMA 5ALFA 1ZXXA 2W2OA 4OO3A 1XMSA 1J9GA 2DBVO 2VJAA 1ABEA 3B6KA 3BZUA 3EW9A 2XUDA 2XXAA 3STXA 5EWJA 1T2UA 5EE5B 4B33A 5DH9A 4C43A 1LS6A 2GAIA 2G82A 3W5UA 1KTVA 5TR9A 2WT8A 3U4QB 3CNHA 4F7WA 3U6BA 1P4GA 4MV5A 1IZ7A 3T0FA 1YS1X 1UFKA 3WYFA 4S2UA 2CVFA 3KU1A 2FFHA 2PM8A 2YIJA 2XQKA 2PJDA 3BJMA 3DZCA 5AM2A 4EKGA 4CEJA 3UW3A 4IG9A 4TV9B 2CLCX 3CVJA 3WQRA 4KNYA 1EXDA 1KIMA 3FPHA 5JASA 1FRQA 1F3OA 3FDIA 4IMRA 2BI8A 1MEOA 4TMTA 5YASA 5KYWA 4RIFA 3FSEA 5CFQA 1R15A 5D5HA 3C6YA 4D6XA 3T3EA 1OFUA 5C1IA 3DCYA 1THZA 2PRYA 5JQGB 4ZU1X 1TZBA 4AF8A 2C2BA 5GV7A 4KYVA 1BN7A 4ZQFA 4PO1A 4HTFB 2OCBA 4V0LA 2QTFA 3JPYA 4HB4A 1ZVQA 4GSYA 2I66A 4IAOA 1W4RA 2F17A 3FWNA 2PKCA 1CRZA 1OYYA 3LY5A 3OCWA 1T5HX 3TR0A 2DJ5A 2ZYSA 1Y8QA 2DR0A 5DI9A 2BGLA 2CLMB 1SZCA 1PNOA 2ZIZA 3NKLA 2PZAA 4HDSA 1GKYA 2PX8A 2YW2A 3LCCA 3P2KA 4DXHA 3ESQA 4V1CA 1RD4A 2JIZA 3FCEA 1HTWA 2QUBA 3CH7A 4M49A 1JYFA 2DFLA 2Z95A 3TSCA 3NIDB 1C0KA 1E4VA 1SXJA 2ZI4A 4MCIA 5IAJA 1RLOA 1I7SB 2JA2A 2WOOA 1EWKA 1X7XB 4R01A 4YRKA 4N5DA 3PGXA 3WK5A 2WHRA 4CMGA 4WVLA 5KB3A 2C2WA 3A6DA 4AUNA 2JEZA 1FE8A 4DLUA 1GTRA 1B3RA 3KYIB 4IGKA 5JJKA 2W0SA 3GFSA 4IHAA 1HYBA 3WWDA 2GX6A 5KS2A 3RAFC 4WA8A 1QIMA 4MDFA 1XZLA 3I12A 2F7SA 2ONCA 2NVOA 2B35A 3IUMA 5ALGA 4CVNA 2VF7A 3X2SA 4C4ZA 3LO8A 5LBTA 5JAZA 2X2PA 3BIJA 1KYIA 8AT1A 5E2AA 1OHHA 4TWIA 3K71B 3TZHA 5A03A 2J9FA 3ETGA 3M3HA 4BMZA 4UEJA 3IQDB 1KFCB 1OUMA 2VKQA 3D8BA 1U5BB 2I2AA 4UCFA 1H2ZA 3P0RA 3VJKA 4URZR 2PAAA 4FGSA 2NU6B 3D4OA 4WOCA 1K8QA 4HXGA 2GSWA 2VXOA 2CDCA 3D3QA 2FKNA 4QQKA 1W5FA 4K86A 1AE1A 1GZ4A 4PYIA 4YP6A 3EBOA 1GRCA 2O54A 1JG7A 2OAQ1 4KXMA 4RK1A 2A9RA 1RPAA 3FVVA 3EHEA 3ML1A 2E5WA 2O3UA 5JYDA 4J9VA 4Y2XA 3TIVA 2O20A 4BBAA 4N49A 1Y9ZA 1JYEA 4EGQA 2QPLA 1OJ7A 2B36A 4CMCA 3ZXYA 4Q66C 1PGOA 2F9LA 1L4FA 3C7CB 2EX0A 2C3UA 5H8WA 4IOJA 1U0BB 4NZMA 5DIFA 4EJMA 1E5XA 3IQHX 1W7AA 4U2GA 3ZWCA 3DUFB 1SM4A 1Z4MA 1ESEA 2JD0A 5EHGA 5KSWB 3ROXA 3DBHA 1N2SA 1J8YF 5K0GA 4AICA 9GPBA 1JHQA 3NJ4A 2BDEA 1KO5A 3NHZA 3STHA 1UK8A 1Y8AA 2WU4A 3L84A 3F8WA 2FW6A 3C41J 3VTFA 3GHYA 5ALXA 2XOKA 2WAXA 3WKBA 5LP6F 4L4YA 1NC1A 4UOQA 1JIQA 1SCUB 2ORYA 1RHRA 3W8FA 2FSVC 4WZAB 3C85A 2M9MA 3WLEA 4NXNB 3NRBA 1TK3A 2QP3A 2A5DA 1C7RA 3VQTA 3LPDA 4FSXA 4IRUB 1BXZA 1H5NA 1NW9B 2JA1A 1K4YA 3O0TA 2CNDA 4MX8A 2XDQB 4G5YA 4NE7A 4DWVA 4WJLA 4QEZA 2PUHA 4I50A 4IF4A 1ODCA 1TCCA 4ZHQB 1T5BA 5FA5A 5BSWA 3IRVA 1SHUX 3PUVA 3C8ZA 4DHEA 1B42A 1BS9A 2PSJA 4FFBB 4WKNA 1FYFA 2HHJA 1A96A 5IHPA 3G2OA 5CT8A 2X9LA 3AUFA 5BSVA 1EX9A 1U0RA 2P77A 4MW1A 4CEHA 2EU8A 2CZCA 1MF7A 3WHLA 3WNVA 4DUPA 1O6ZA 1SIWA 5CIQA 3DDZX 1BQ3A 2ODAA 2WWRA 3LLUA 1R0WA 5T8KC 5CDGA 4WGGA 2WWFA 3AEKB 3LXRA 2VJKA 5B1DA 4MB2A 2IU0A 1BE1A 1NDUA 4OF4A 3ZY4A 2OV8A 3DMPA 4M4SA 3GH1A 2N47A 2QK4A 2WWTA 3DAOA 3GZJA 3K4HA 2XZLA 3JVDA 2QW1A 3P2IA 3T1OA 1G8YA 4OXYA 1F0KA 1VHWA 3C3PA 2BCEA 3IULA 2VWHA 5CUQA 2NTEA 3CEPB 3KWMA 2X9NA 1T3TA 1YZQA 2QN9A 3AEKA 5HK8A 1CK4A 1KY3A 5JBIA 3CJRA 1SU7A 1M76A 1NVWQ 4B32A 1PEDA 3MTEA 4FZJA 4KL8S 4N7RA 4P31A 2WA2A 3RRNA 5C3MA 5JT1A 1X7DA 5LR6A 1JZQA 3E22B 1Z6QA 2ZJOA 3K2EA 1QGDA 3CVYA 4YR9A 2FUG1 4CL0A 1Q0LA 2VHXA 3LDGA 4H31A 3FMGA 1XGKA 1KU0A 3KXIA 2RGNA 3C70A 1IE3A 5G0SA 3UK2A 3VPAA 3NDPA 4L6CA 5JRJA 2IP4A 2IYOA 1DTWB 2HI0A 2Q0QA 2JLBA 1C3VA 1ZSYA 2B6NA 3BB4A 4S05A 4YRGA 2ZBPA 4RPJA 2WD7B 1QZZA 1U1DA 2UYYA 3LYAA 3PNYA 4LJ9A 4P3PA 1PFQA 4W63A 4RETA 2V6MA 3GGJA 4EBBA 3QV1A 1NPYA 4G67A 5EKUA 4E7OA 5FLEX 4FJ1A 4XM1A 4G9EA 4HWSA 2RKBA 3K1JA 3LLMA 4IIGA 1NSYA 1OFUX 2YXPX 3UJ8A 4BNZA 4NG4A 1P2UA 4MQUA 4J3JA 1FJXA 4KMMA 2HSJA 3C3BA 2GPTA 2FPPA 4D8UA 3BKXA 3DNPA 4HX2A 4BDTA 4TMVA 2YIDA 2QQ0A 3PUJA 4HZUA 2XDWA 4QYSA 4YVFA 3TL6A 3UXEA 4JJEA 2GDJA 4O08A 3QJ5A 4A03A 1L4UA 1UBRS 2FPOA 5HIKA 3Q87B 1DJNA 2I4IA 2ET6A 1SWVA 3F8TA 3E23A 1B0PA 4RD0A 5BOVA 1XQYA 1TM2A 4FT4A 4LZLA 1P7YA 1GKKA 1HKHA 3M2TA 1KK3A 4Q6BA 4ZI7A 2FRDC 4NP6A 4P32A 3ZEAA 3C15C 3MTAA 4PW0A 3NB0A 1YVEI 4J7AA 3SBXA 3L9WA 1YVRA 3KEMA 3NV9A 2CLLB 5FQNA 4PSAA 4ERXA 4IQ0A 4NS4A 1O94D 4TSFD 3ZJ5A 2JGMA 2VOJA 1H9AA 2ZDHA 3DEIA 1EB8A 4CFSA 4XOIA 1NJSA 1XVTA 4M7PA 4CDNA 4CM9D 1VGVA 5J59A 1XKLA 1U5CA 5F73A 1XMVA 2V1XA 2E4XA 3DVRX 3FYUA 1W59A 1NQ5A 1NF9A 2I2FA 1OTXA 2XMSA 2YHAA 3CM0A 3W2TA 3QHAA 3C4QA 1Y6QA 1OCEA 1SCQA 3OTIA 5LP6C 1O6CA 3CMMA 3N0VA 4KIJA 1DKUA 2F1JA 1A2BA 2J08A 1ISFA 1Z22A 3K6KA 3LDHA 4JYPA 4IR7A 4RW0A 2OC9A 4RZ3A 2OV2A 3FROA 1KC1A 1C9MA 4TVBA 3CH4B 1IHOA 4I5GA 3WGMA 2IDJA 1WA5A 2PD4A 1HRDA 4L0QA 5JANA 2IOFK 1CUCA 1GUAA 4H18A 4IJKA 2GXQA 1HYQA 1B0UA 4UOEA 3NJRA 3F6EX 2ZB4A 3ANMA 2XBLA 3L49A 2IS2A 3UXHA 5H68A 2FHSA 1TF5A 3R6TA 3V46A 5KWVA 2DUUA 1WQ4A 4BNKA 1W5TA 4OB8A 4LGMA 1MA3A 1ZBQA 1ZJWA 4RDIA 4ZODA 2W6JA 5B6PA 1UOOA 1FNMA 3S29A 1TVEA 2YHUA 4BATA 4AC9A 3DEAA 1LDEA 2ZRAA 2HZ7A 3TLMA 4JBYA 4JUCA 4WCVA 1ISMA 4RLFA 3GW8A 1SBCA 4BN0A 4CMHA 4W5WA 3E84A 3GRZA 3RVBA 4MKRA 5FLKA 3GP3A 4MS3B 4HB2A 2QTAA 1GXSB 2OM2A 4DJFC 3H4TA 4YRRA 4MPDA 3I05A 3SBOA 3F6YA 2BFOA 3CRQA 3RC1A 5IK2A 5DE3A 3RSZA 4ES6A 3WZMA 4EA8A 3IERA 4H35A 4CZ2A 4GG1A 3R9IA 1A97A 1UR5A 2A30A 4HWRA 3KJGA 2PG3A 2PMWB 5HKAA 4GR5A 4JI7B 3TRDA 1MA0A 3LXXA 4Z3OA 3PJDA 3NJ8A 1J4AA 1KZGB 2CLKB 2RCNA 2C97A 2WJPA 1RMTA 5F4BA 1SUWA 4Y2YA 1Y80A 5KWSA 5BSKA 1RXUA 4AXBA 4N41A 5H82A 4K0KB 5JO9A 2VDMB 3QPUA 1QBKC 3G2MA 3JWHA 4N6OA 3KT6A 2NVUB 1QO0D 4OLBA 4MVJE 5K6RA 2CLSA 2I87A 3ZK8A 2ZZMA 1VKOA 1A7AA 5JBNA 5C2JB 2PPVA 1IDN1 5EEGA 1JMKC 4BLRA 1OBFO 2MYUA 1P72A 4J0DA 2ZSEA 1RWBA 4PG7A 3A6HA 1GLNA 2QRMA 3N2EA 5FUBA 3W8EA 4UE3S 5JXGA 3K5HA 3KBOA 1V16B 1RLUA 1E4EB 1XOIA 2IEAA 1RJ9A 3O2JA 4JLWA 3TLCA 1X1TA 1J97A 1MOSA 2J7KA 4AJEA 2RONA 4AKEA 2XT6A 3BD8A 4EJ6A 4ZQIA 1QO0A 2X76A 3I5UA 4F6CA 5IKOA 3T0IA 3LKZA 5JZ9A 2DWQA 4MYRA 1L1QA 3D2LA 4BAUA 2UXDB 1NC3A 1Y34E 4EDFA 3KJXA 5AJZA 4EVQA 1FP4B 5CYGA 3ETEA 1U9IA 1LBHA 1U4SA 3BOSA 4GC9A 2AEJA 4JGIA 4UU7A 4X84A 2GM3A 3ROZA 3JWIA 5ERYA 2HYIC 1FY2A 3EWIA 5CM8B 1LDYA 3OCYA 2XRZA 2Z4RA 4X8OA 3EB9A 1CIJA 2J1LA 1SQ5A 1UEXC 1FFSA 1N78A 5C46F 3RM3A 1R37A 1PV2A 1L7AA 4DRXA 5L3QA 4AP5A 5LQRA 1JPNA 1NBMD 1C1XA 1BDJA 5CK5A 3ZHOA 3IQWA 5JH7F 4HRYA 4LC0A 5LA6B 4NCKA 4DT1B 2OR3A 4BE9A 2RHTA 3BD6A 2YOFA 4IHQA 1R9GA 1AKMA 1M1UA 4QYTA 2EARA 3X1KA 1QCZA 2G6TA 4J0EA 4CL8A 4NQZA 1LBEA 4KRFA 4AKIA 4NOLA 3FYDA 1K8YB 2JFFA 4GVXA 5EWMB 5BUCA 3VA7A 3RSOA 3SE0A 4D79A 3OIWA 3PYLA 4CQLB 1Z4JA 4RUKA 1JZSA 2IQ5A 3K05A 3GCWA 4JIMA 4TVSA 1T10A 4E2XA 5C8VA 4OIFA 3G5AA 4WNIA 1ESCA 3WTBA 2UYHA 2P7HA 1DHRA 1J20A 3T3HA 3DO6A 1L2TA 3PWSA 3UJNA 1JHAA 4PO3X 2H3HA 1DO2A 1JQDA 3UO8B 1MIOB 4OQFA 3KZCA 1UWCA 4IDAA 5TF0A 5LQCA 3KQVA 4MW9A 4NV3A 3VZCA 1Y4SA 4J3FA 5GQSA 5BQ5A 1FLDA 4MPPA 1DMSA 3L1KA 2IELA 2QM0A 2VN8A 3MYYA 4JGBA 3HYCA 4BQRA 5JUWA 4GGMX 4ZEXA 3GA5A 1AGPA 1JSLA 1M1YB 1WL8A 1TTPB 1R1DA 3GMIA 3DT9A 1MQSA 1YT5A 3LZDA 4JLAA 1QCCA 3TTTA 1NFRA 2WYHA 1G3MA 1G291 3JPWA 4DNFA 1R5OA 2BDTA 3AXTA 2IP2A 1EBFA 2BFCB 3WGLA 1UXIA 1Y4ZA 3KXLA 3QQ5A 3EASA 2YV1A 3MJRA 4O3FA 3PQ3A 5IJ0B 4H7EA 3DV0B 1K7SN 2C82A 3TFOA 3G8CA 4FWTA 1ZMOA 2C5AA 5TJHA 1ZSNA 5EIOA 5A3QA 4CIWA 2HL6A 1YUBA 2D59A 3QNWA 2C2ZA 5HE8A 2GH1A 1KO1A 3PHIA 3K09C 3ZUPA 1KOJA 1YGPA 3DMHA 3MSCA 4XARA 5E7IA 2OQVA 3QUSA 3SC6A 4G8JA 3BTOA 5AR1A 4ND7A 1Z62A 5EJ9A 1GPKA 3QHPA 1TZJA 5FO1A 1JQJC 3CT6A 3KM0A 2NXNA 1JEEA 2P3LA 3A7EA 3ACBA 2RBKA 3M6AA 4IVRA 1C9EA 5BN5B 2EKBA 2OVFA 4EK9A 2D3WA 3PQDA 3FCXA 3ICWA 3P9PA 1DJQA 4B5KA 4RNDB 2QX7A 2WTNA 4Z1OA 4IDEA 4M0DA 3ZDEA 1TEXA 3KLBA 4E5YA 4R05A 5FTJA 2QJTA 5H3HA 2G4LA 3DR5A 2ZRKA 2YOGA 4RJJA 1MIHA 2OO5C 4E14A 1E5LA 3N5CA 4M2LA 5ESDA 1L5KA 4Z8YA 1RQGA 3CVWA 4DY4A 1KPHA 4HNUA 4NFHA 4LQDA 1E3JA 4WW0A 3QF4A 3BL8A 3I1FA 3ZI4A 4M1YA 4S35A 2CHGA 3E3OA 3R7NA 2C5FA 3A9TA 3N75A 2P1RA 1F14A 1RQNA 4AYWA 5DNCA 1QP0A 4OAQA 5L3VA 4MA0A 3OPYB 1NATA 5ULLA 3OJ0A 1J0BA 3KZXA 2QX9A 1ZK4A 3GEGA 4L0CA 1TRKA 4M9XA 5AKZA 2PGDA 2P2LA 3LC2O 1EHCA 2QV7A 2JVJA 4PS1A 5CU7A 2JGFA 2HSWA 5LYJF 3CIOA 4U8GA 2OFXA 3R7SA 3GBSA 1NXPA 1XAHA 5TS3A 4CQMD 4CU5A 4QGAA 4Q9HA 4I5IA 1XLTA 2XF8A 4R8RA 1PG0A 4HFRA 1KP9A 2H2AA 3DWFA 2CWDA 2DY1A 5DRYA 2MJLA 1F5SA 5TQ2B 3PYXA 1CDEA 1G0OA 1ZGGA 2WJ3A 3PC3A 3LMKA 5HZKA 2MOKA 3L0OA 4M22A 3EZYA 3ZWVA 4EECA 3DMRA 1ZITA 2FTKE 4O4HB 3RCBA 3CZ4A 1JG2A 1UKVY 1LSOA 1IWBB 3H8VA 1JIUA 3H65A 3QU7A 1MT3A 4G09A 4RMJA 4PRZA 3KFLA 3PYMA 2AD1A 1V4BA 4JKYA 3L41A 3N9IA 1COWA 5DHFA 4AUEA 1X7YA 2AMFA 4FI3C 4BY9E 1A4XA 4Z54A 3ZOZA 4AY5A 4YJ3F 4CKXA 1ECPA 1XZKA 1N6PA 3C3CA 1NNLA 3JAWA 2AXQA 4O5OA 3SF0A 4BNJA 3WWYA 5ADVA 1NOIA 1W4BA 5FBVB 2Z4TA 2PWAA 3ZPXA 4FLMA 3O9MA 4KXVA 4IJUA 4N0MA 4MUNA 4OM8A 1GYPA 1I32A 3DONA 4LMAA 4A23A 5BWBA 1QO9A 4JQOA 1U3DA 1AGYA 4GPZA 1PP4A 2NAFA 1M10A 1BGWA 1DXQA 5F2EA 4AN4A 3MD9A 4C08A 4M3NA 4W7HA 3ROPA 4NMMA 5K6TA 4YASA 5DTRA 7MDHA 4A0RA 3ZWXA 4RTNA 4MRMB 2DPHA 2FPWA 3ZE2B 2G5CA 1TEVA