4A2CA

Crystal structure of galactitol-1-phosphate dehydrogenase from escherichia coli
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
346
structure length
346
Chain Sequence
b'MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHEFSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEYIVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCAVALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVPQTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWETASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTITOL-1-PHOSPHATE 5-DEHYDROGENASE
publication title The Crystal Structure of Galactitol-1-Phosphate 5-Dehydrogenase from Escherichia Coli K12 Provides Insights Into its Anomalous Behavior on Imac Processes
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 112
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 1.1.1.251: Galactitol-1-phosphate 5-dehydrogenase.
pdb deposition date 2011-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4a2cA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4a2cA01
3F4BA 3EGOA 1I32A 1PGJA 4E31A 3K73O 4INAA 1W0CA 4CQLB 1H9BA 1HSZA 3LT0A 1YO6A 3Q9UA 4FGWA 4JP3A 4FD3A 4DIOA 3QWIA 2R2GA 1W6UA 2X58A 2NU8A 5C7IO 3PHGA 1I2BA 4EZBA 5HRUA 4N18A 1GYPA 3DHEA 4IIVA 4IZIA 3K8ZA 3P2OA 3PQEA 2CVZA 4B4OA 4IY1A 5IAAA 4BKPA 3DBHA 2D0IA 1D7OA 1YBMA 2CDAA 1KC3A 3LLVA 1V6AA 3HG7A 2ZKLA 4CMGA 1IUKA 1LRJA 1IULA 1ZO8A 2GASA 5KVQA 3WJAA 1YS4A 4Z9FA 1UZLA 3ABIA 3ZNPA 1HDGO 2ZQZA 1HLDA 1V9LA 2YFQA 5TT1A 2AG8A 5EQDA 2BFMA 1M6HA 2GYYA 3KRTA 4CLXA 1Y1PA 3AM5A 3RUDA 1YDEA 3TF5A 4NU5A 1SNYA 4WECA 4J1SA 1WWKA 4MIEA 3HDYA 1B3BA 4DLLA 3PIIA 5GY7A 4GX1A 1UAYA 1ZSYA 1LLUA 1U3WA 2Y93A 4CMAA 1HSOA 5THQA 4DQUA 3I9LA 3AUUA 5I9MA 3F1LA 5CP8A 3M1AA 2WMDA 3WGGA 4HX5A 3MWEB 3VH2A 1QYDA 2VYVD 2WSBA 1MXHA 2EKPA 1O6ZA 1RM5A 2FY8A 3ZNNA 3DMTC 5A1TA 1I2CA 1FF9A 3DO5A 3GA0A 4E33A 4N5NA 3GGGA 5I7VA 4R16A 1N1GA 2Y1FA 1E7YA 2AEMA 3FBTA 1X7DA 4J6FA 2R6JA 1HDRA 1NP3A 4PZCA 1DJNA 4FJ0A 2NM0A 3VDRA 2O3TA 3H3JA 1T1RA 1YQXA 3Q3CA 4F45A 2OL4A 2PV7A 3GHYA 2X9GA 1IL0A 5C5IA 5DBIA 1ISGA 5TF4A 4DLBA 1UP4A 4IDCA 1DFIA 3QHAA 4J4TA 4PVDA 3UUWA 1WZEA 5JYEA 2JFGA 3UVEA 2TMGA 5G4LA 2IZ1A 3GT0A 2PD4A 3U4DA 1ZZEA 4F6CA 3ZU4A 4NNJA 4CUKA 4MO2A 1NQAO 4R68A 1NWHA 4BGEA 2OGUA 3RJ9A 2PY6A 3ZWMA 2NNLD 3L77A 2FWMX 1E3WB 3B20A 3PRJA 3AUSA 2BFOA 2BI8A 1EDOA 3RC2A 2HK8A 3S8MA 4PZEA 1GR0A 1SCUA 3PYMA 2BLLA 4RDIA 4Z0TA 3AI3A 3JQ9A 1Y5RA 3WGZA 1U4SA 3PTZA 4DQVA 4GX5A 1NBOA 1U28A 5KVVA 1YB4A 3ZCXA 4HWKA 2AEJA 4PGFA 3LLSA 4Y6SA 3EMKA 2ZCUA 1J4AA 2WEKA 3UN1A 2P9EA 2W8ZA 2AE1A 1KETA 1LI4A 1XR3A 3INTA 5L4LA 2DTXA 3BMCA 2CVQA 5U9CA 3PWKA 3JQFA 3WGTA 4J1TA 4QT0A 1ZUD1 5HS4A 1HYEA 5A9SA 3DR3A 3HHPA 3I52A 1XGKA 1YGYA 4WLFA 2I6TA 1EUZA 5A06A 1MLDA 3AI2A 3BMQA 3IUPA 1DAOA 3UHAA 3RIHA 4I1IA 1H6BA 3KB6A 3QRWA 3NKLA 4C4OA 1ZKMA 2DAPA 3H5RA 1BXZA 4BB6A 4M54A 2NACA 2BI7A 4FFOA 4GSKA 4DYVA 4BKRA 3ZWCA 4J43A 1O89A 1KEUA 2CFCA 4NQZA 3L6EA 3GY0A 4IS2A 3GDGA 3JD4A 1YQDA 2WYWA 4PLHA 4DIFA 3S2GA 1R4NB 3OJFA 4IINA 4J4BA 4XA8A 4E2WA 4A2CA 2X6TA 3W8DA 3JQAD 4QO7A 3D4PA 1ZW1A 5BSHA 5ILOA 5CG2A 3WSWA 1GYRA 1IB6A 4E2XA 3S2EA 4YJHA 3DZHA 2PGJA 3JYLA 4U6SA 1YJ8A 5IN4A 1PEDA 4CMHA 3VAZA 2Q1SA 1RM4A 2D2IA 1I3LA 1Q2XA 1TXGA 3WX0A 1PL8A 1Q7BA 4L4XA 2X5KO 4D7AA 1I0ZA 4BKOA 2XXBA 4BNJA 4B7XA 4R3NA 4WCFA 4CUZA 4N5LA 4B3JA 1V35A 5COAA 2ZATA 2O2SA 2J8ZA 4MP8A 3U4CA 2WD8A 2AMFA 1RPNA 4L8VA 5B37A 1XYGA 1JKIA 4CLOA 4G65A 3JQGA 3DZKA 1HLPA 3G1UA 5KJEA 4EITA 2W2KB 3PIDA 1VKOA 5K6AC 1PX0A 1VC2A 1Y7TA 4K6CA 4YWJA 2X5OA 2EKLA 2C54A 2GD1O 4BVAA 3TRIA 4MINA 1YKFA 2FZWA 3JD3A 4GVXA 4WEQA 4RDHA 1ONPA 5GZ1A 2C59A 3RKRA 2DBVO 1F12A 2X4GA 4XYLA 1JLLA 4OOEA 3BHMA 3O38A 1KBZA 1ADCA 2P68A 3QWHA 4HNGA 3I9MA 4CR8A 1JAXA 3G49A 5KOIA 4W82A 3N58A 3VTZA 3RQSA 3VPSA 4ALIA 2VNAA 5JE8A 2AQIA 3BIOA 1TEHA 3KTDA 4ID9A 4K6FA 1QLHA 4AJ1A 3LYLA 4XDZA 3BZUA 2P4QA 4B4VA 2VQ3A 4A5OA 1LQUA 4XCVA 2NVBA 4NFSA 1C0PA 3QY9A 5A9RA 4YAGA 2Y66A 4ALLA 1H6AA 4IDEA 1YE3A 3HADA 3NT4A 3GEGA 1EE9A 2C7GA 2NVWA 3E9MA 1JWBB 1HRDA 5BSFA 4A0SA 5ITWA 2O3SA 1ULUA 3PWZA 3QW2A 3FNHA 1EUCA 1PS0A 1E7WA 4GMFA 4JJGA 3W4KA 5EINA 1YL7A 5EMHA 1XWFA 3C1OA 4MDHA 5DZSA 3GFGA 4YA6A 2G1UA 4D46A 4OHUA 2JJYA 1V0JA 4QFDA 2GNAA 3VPXA 5CEEA 3D7LA 3ROKA 1RJWA 2EP5A 1T2DA 2D5CA 3ROQA 1E6EA 3ITKA 1DXYA 3KSUA 2ZB8A 4OM8A 4G81A 1V3TA 3K2EA 2QHXA 4UUMA 3RCBA 1ML3A 3NEPX 1PZGA 4FC7A 4AJKA 4CMKA 2IZ0A 3S2IA 2ZQYA 1WMAA 1H94A 4PLGA 4XEHA 5IZCA 3NTQA 4QUKA 4RLSA 4CM3A 1UDAA 1UZMA 3RBXA 4EJ0A 3ZHXA 2FR1A 4BO7A 1UH5A 4E6PA 2JL1A 1B15A 5JAQA 3VZRA 1U2DA 3I5MA 4EJMA 3OJEA 4DUPA 2FHSA 4NJMA 2BKAA 4UVGA 3VC7A 1C0IA 2JFFA 3JD2A 4KDEA 4TVOA 4XGNA 4FFMA 1SC6A 1PQUA 4G5HA 2YJZA 4B3HA 2EHDA 3UF0A 4CV0A 2CDCA 3AY7A 1QMGA 2D4AA 3DBRA 2ZTLA 3MWDB 4Z3KA 1YQGA 3HB5X 1ID1A 3G3EA 5CPBA 1B0AA 1BHSA 4U5QA 3ZWWA 5IZ4A 4A10A 1GPDG 1DBVO 3AOEA 2POQX 4LISA 1DC6A 1HTBA 2GZ2A 4UEOA 1MG5A 4NBTA 1BVRA 1HDYA 4QEDA 5KJ1A 1GZ6A 3D4NA 4PLWA 1ISIA 4CLRB 2AW5A 3OQBA 1WMBA 1KEVA 2X9NA 2B36A 3PZRA 3T4EA 3L0DA 4BMVA 4IBOA 5AXAA 4XQCA 5JDCA 2CY0A 4OYRA 1T4BA 2ET6A 3ZWAA 5F3RA 4D42A 2OBYA 3PXXA 4BUCA 5BSGA 3SVTA 4WCDA 5HTOA 1H93A 4CMIA 3RVDA 2VOEA 3AFMA 1JWAB 2VZ0A 2Q49A 2C2YA 2ZYAA 3SXPA 2ZTMA 1U8FO 4K26A 4WNCA 5B1YA 5JLAA 2WTBA 1E3LA 1G6KA 3ZWBA 4D79A 3O9ZA 3H9UA 5KWEA 4NBVA 3BTUA 3ENNA 1QR6A 3RU7A 1TT5A 3RWBA 5JCJD 2YDYA 3OHSX 3WJ7A 1WDKA 1NYTA 1PR3A 3B1JA 4XB1A 4YJGA 2X1HA 2I3GA 2JCVA 5EIOA 4DXHA 4WOJA 4CL8A 4D43A 4DGSA 5JYDA 4QO8A 1ONNA 1MX3A 4ZVVA 3RU9A 2HJSA 1HETA 2NU7A 4MVJP 3SX2A 3ADOA 3NUGA 2EW8A 2VZ8A 1H2HA 2EF1A 2G5CA 2C20A 2GERA 1P44A 3MJSA 1BXGA 4A73A 5BNIA 1H5QA 3LK7A 1NPTO 3H5NA 1EBUA 4PLPA 3MTGA 4AJ4A 2AE2A 3WYBA 4BIIA 4BL5A 3WGOA 3WIDA 4NZ9A 3C7CB 1DFHA 3ONEA 3WBBA 4FDAA 4NH4A 3C1AA 2NQ8A 1HE5A 4HFNA 1VL8A 4IM7A 3WTCA 3WGHA 3PYLA 2I65A 3ST7A 4O63O 3FN4A 4OQYA 3U09A 1L7EA 1VKNA 4YTEA 2YHUA 4NG5A 2X0IA 3X2EA 2I76A 3JTMA 4R51A 4JCOA 2P2SA 3DFUA 4QTZA 3GDOA 2B4TO 3KZVA 4TWRA 3WXBA 1PL6A 9LDTA 4XIYA 1NQ5A 2QRJA 3WMXA 3SLGA 3TL2A 4EBFA 2P5YA 3M2TA 1MC5A 4XX0A 4J49A 1N2SA 3ETDA 3GEMA 3L4BC 4R69A 3D0OA 5JXWA 1ZJYA 3DFZA 3DBHB 4ZQBA 3ICPA 3DAPA 4ZHSA 2GF2A 1XDWA 1X1EA 4CQMA 5DOZA 5B4TA 4FOSA 3C8MA 2GCGA 4IDFA 4MKXA 1M75A 4RF4A 4W7HA 4GVLA 4MIOA 1GCOA 5CDSA 1XG5A 2DPHA 2O2YA 1N1EA 2I5PO 4IQ0A 2WE8A 1YB1A 2PZJA 3HZZA 4E30A 4D0SA 1GD1O 3LT2A 1HKUA 3KHUA 1R6DA 2BMAA 1X0XA 3H9GA 3PHHA 1ULSA 4J90A 4UUOA 4DREA 3INRA 1JDJA 2EKQA 4NBUA 1YBAA 3WGYA 5JAIA 4AJIA 1C14A 1I2ZA 4M1QA 1MV8A 2ZTUA 1PJTA 3MJEA 2BRUA 1JVBA 1XIVA 5A3JA 4TMFA 3OICA 1WLYA 2HDHA 1J6UA 2J5KA 3JQ7A 4RVFA 1AXGA 2O4CA 2YQ4A 1I24A 4YT5A 2ZJ0A 3ZWNA 4KTTE 1E77A 2Q2QA 4DRYA 1R4MA 1F8GA 3N74A 1IPFA 1X1TA 1V8BA 1DPGA 3F5SA 3JYNA 1R66A 1VPDA 3E5MA 2B0JA 5JO9A 1P3DA 4D44A 3A1NA 1EQ2A 5KJFA 1U1IA 1ZK0A 3FF4A 3GVHA 3GVXA 3ZW8A 4OKNA 1FJHA 1N8KA 2B83A 1GAEO 1WPQA 4RPHA 4CV1A 1T26A 1OI7A 4BNHA 3A14A 1EE2A 2B35A 2EXXA 4DWVA 1EEHA 1JU9A 5ER9A 1LXCA 3RAJA 4GGPA 2OORA 3K2BA 4C7KA 4HBGA 5F1KA 2YHIA 5G0VA 2PZKA 3QA9A 3S55A 1T4DA 4BMSA 4LMRA 1YBVA 1XQ6A 3DOJA 3DTYA 1CIVA 1QYCA 4ZGWA 1XLTA 3RFXA 2O3JA 3TQHA 4EEXA 3GPIA 3OQ1A 6ADHA 4HFRA 4W7IA 3OJLA 2DTDA 4IDAA 4BNUA 2NVUA 2HMWA 5DF1A 5A5FA 3PHJA 4CLEA 2AQ8A 3BTOA 5TNXA 2E37A 3E03A 4OH1A 2VTDA 3V1TC 4ZN6A 5AXDA 2PTGA 3A4VA 3P2YA 4D3FA 1PZEA 3GR6A 3ZU5A 4AJEA 2EW2A 3I3OA 3KEQA 3H4VA 3JQCA 1PR9A 3GUYA 3KSZO 3QSGA 4J7XA 3VH3A 2EJWA 2IEDA 3VVCA 4ALJA 1JKFA 4YAIA 1EVZA 3G0OA 4BNTA 3NRCA 3IUSA 4OSOA 5T5QA 4WNIA 1WNTA 1P77A 3MCVA 2VN8A 1HDZA 1EFLA 4DYDA 3PK0A 2AQHA 3RSHA 4OJNA 4FJ1A 3CSDA 4AL4A 2VRCA 4BGIA 3V2UA 1P1FA 3TZCA 4MP3A 4NFYA 5T8KA 5JY1A 1Z7BA 5F1OA 2PKRA 4U0KA 1E1NA 2VNSA 4D41A 3DWFA 4Q3EA 2YFHA 1HE3A 3JYOA 5HWSA 4Q39A 3EVNA 3GHHA 4FS3A 2FMUA 4R9RA 3AUTA 2O3QA 3WSVA 3CKYA 2P4HX 1G0OA 3QVOA 3DHYA 3JQEA 1VL6A 2NTJA 5K1SA 2BD0A 1PJSA 3O4RA 3TDKA 2ZYGA 3F47A 2EERA 2J3HA 3A06A 3D3EA 5TS3A 2OUIA 4M87A 1QG6A 4U0JA 1X15A 3WNQA 2CF6A 4ZICA 1D1TA 4RCVA 4BNKA 2Z5LA 5I7EA 2PKQO 4TZTA 2GO1A 1V3UA 4FN4A 4JX8A 3ZN2A 3AM4A 2OBNA 4YJHB 4NDNE 3OQ6A 4QXMA 2HRBA 3VOSA 5JDIC 1LBEA 1U5AA 3PJGA 1UXIA 2Q50A 2WJPA 1IHXA 4TKLA 2PKQP 2VWQA 4Q3AA 1U9JA 2QRKA 3KO8A 1PU2A 2Q1TA 3PEFA 4OKIA 3MJ4A 5COBA 4BQRA 4FFRA 2WD7A 1BSVA 3QLJA 4U6QA 1O8CA 2E4AA 3DBVO 4CM4A 5ENVA 3GVPA 3QJ5A 1P74A 2X8LA 5I9LA 4HY3A 4YT2A 2OFPA 1ZEJA 2QRLA 3GPDG 2YW9A 3OEWA 3FNFA 1BTOA 3O26A 4CLOB 5U4QA 4UEKA 1JAYA 1ZSVA 2VHVA 1A7KA 5FFFA 3EW7A 2GGSA 5A9TA 4CM9A 1PJ3A 4WGGA 2B4QA 1R0SA 5ER6A 2NQTA 3QWFA 5ILGA 3VPGA 4KUGA 4OMUA 1GDHA 1IY8A 2Y05A 3LC1O 4XRRA 3E6AA 3ROMA 3WQRA 5IXSA 4JJIA 4CMEC 1GY8A 4CM6A 2F1KA 1LSSA 3OETA 1UR5A 5CFZA 3FNGA 5L4NA 4PRLA 4B3IA 1C0KA 3LQFA 4UVHA 3WGIA 3MOGA 5MDHA 1RM0A 4J0FA 4PRKA 3WGQA 1I30A 3K9QO 3R3SA 3FWNA 1LLDA 4PG6A 4YJFA 2PD6A 2ZB7A 3U4HA 3EZYA 2O3RA 2VUSA 1YOVB 3WLFA 5L95A 2P5UA 1ENOA 2VHYA 1MC4A 3CTMA 3F3SA 3WB9A 4LVUA 4FJ2A 1K2WA 2DBRA 2EGHA 3LSYA 4XQ9A 4NMHA 1A9ZA 4EW6A 4UUPA 2CVOA 5CAEA 4LGVA 4CPDA 2BHLA 3JCZA 1KERA 2RHRA 1AHHA 4E0BA 1EFKA 1BMDA 1Y8QA 4B7CA 2FPPA 3JQFC 4N54A 1HYGA 2AEFA 3EYWA 1B8PA 3GEDA 2W98A 1SEVA 3JD0A 2UUOA 1RWBA 2HMUA 1NAIA 1XEAA 2GN9A 4EEZA 4MVJA 3PYXA 3VZPA 2OOSA 2X0NA 4NBRA 3CUKA 4OL9A 5DCYA 5TSDA 3C24A 1A9YA 3RASA 3V2HA 2RCYA 1I8TA 3LDHA 4MVJI 2PR2A 4JJFA 4E12A 3VZSA 4WPGA 2DKNA 1YH3A 4CUJA 1U4OA 2JD2A 1M66A 4EUEA 2JAHA 1PTJA 3H7AA 5A04A 2VRBA 4RV9A 1PGNA 3LZ6A 5C7LO 3GF4A 4C7JA 3BA1A 1JW9B 4XGKA 3F5QA 4YACA 1H6DA 5KVSA 1HEUA 3GDFA 4HV4A 3DMTA 4BMNA 3DBRB 4EJ6A 1FDWA 3JQ6A 3PHIA 4RGBA 4LSMA 4RQUA 5IG2A 4PG4A 2WE7A 3PJDA 1JQBA 2HK7A 1ADFA 2A92A 2HJRA 3JQAB 4E5YA 5JBIA 1MG0A 1GUYA 3O8QA 3ZH2A 2X0RA 2FR8A 1WAMA 3A9WA 3ASVA 3NYWA 5KKCA 1L1FA 2VT3A 3JYPA 2B4RO 3H8VA 2BGKA 4MIYA 4W6ZA 3WWYA 4IQ8A 3PZBA 1DEHA 1U3TA 5B4VA 3H3FA 5TT0A 4CMIB 2XF8A 3W4JA 3BMNA 3TZHA 3NAQA 1TVEA 4B7UA 1OAAA 2O3UA 1U8XX 2JKVA 3LC7O 4PLZA 1PZFA 1ADGA 3OIGA 3ZU3A 4R01A 3SEFA 1N9GA 5KJ6A 3IJRA 5A02A 4YQYA 1S6YA 1TT5B 4KTVE 4FQ8A 1I33A 1T24A 1JN0A 3ROPA 4O0LA 1T2CA 4YJGB 3V8BA 4B79A 3I83A 2Y1DA 4ZD6A 3U4IA 5FI5A 3GUCA 5THKA 1U3VA 1VI2A 4IDDA 5B12A 4UULA 4RPJA 1Y9AA 1UP6A 3ZV3A 1A71A 3BXXA 4LSWA 4GPD1 3KYBA 5G4KA 5FI3A 1X0VA 2Y0CA 3DL2A 3NV9A 3K5PA 4QSMA 4JN6B 1IOLA 5T57A 3NDJA 3RUHA 1UAGA 4BO8A 4CL3A 3B6ZA 1PQWA 3RKUA 3VKUA 1PS8A 4EGFA 1CERA 2GR9A 3PPIA 5DBFA 4Z0HO 4LN1A 1U7TA 4O59O 3CMCO 5ES3A 3ZU2A 5A5EA 3IJPA 4YBZA 2J3KA 1E7RA 3RD5A 2GRAA 2DFVA 4BB5A 4CQLA 3KXDA 4I5DA 4HADA 4Y6PA 2DM6A 4IDBA 2VHWA 1PGPA 4YXFA 4RQTA 2AXQA 3Q2IA 5LDHA 4LRSB 4CJXA 4R9SA 3ZZNA 1FDUA 3TOZA 9LDBA 3WICA 1CETA 2IZZA 3RUFA 3CZRA 4CQMB 3CH6A 1DHTA 2G0TA 2HQ1A 3DXFA 3WQSB 3W8EA 4E21A 5AQ1A 2PGLA 1EMDA 1MFZA 1GPJA 1R15A 4RVGA 2BFAA 3OEYA 5HM8A 3R0IA 5J23A 4AJLA 5KCZA 3K96A 1GQYA 3MEQA 4D3DA 4YR9A 4GKBA 5GMOA 1H9AA 2QYTA 2LDBA 4P4GA 3EC7A 4WLOA 3GG2A 4YEDA 2OHXA 4OOFA 4TRNA 2AA3A 1Y6JA 1SO8A 1YWGO 3DMYA 3EAGA 2VYNA 2QYSA 2Q1UA 3O03A 2EEZA 4CQMD 2GPTA 1PWZA 3K30A 3Q11A 2B5VA 3JQ7B 4R3WA 4ZA2A 1ZNQO 3KEOA 3ZV4A 1JTVA 2H5LA 1UXKA 5LDGA 1E5QA 4AJOA 1FMCA 2QIOA 5KJCA 4PCVA 1H2BA 3QVXA 3WBFA 1PJLA 1R4MB 4F46A 4GH5A 4JIGA 1I36A 2O23A 1NHWA 3EZLA 4ND4A 5K6AA 1FDTA 3Q1LA 1AXEA 2Y0EA 4W9NC 3V1UA 2ZYDA 3B70A 1KIFA 2D3TA 4MVJM 5L7TA 2P91A 3GNQA 2VWHA 1CQJA 3MTJA 4JROA 2VCYA 3AWDA 3PGXA 2QZ9A 3AU9A 3QP9A 4GQAA 5A03A 2YZ7A 3K31A 3HE3A 1GZ4A 4BO9A 1B7GO 1IHYA 3F6YA 3I4CA 3WFJA 4CLDA 1A4IA 1D1SA 1LDMA 3N7UA 3TN7A 1CQIA 1LSJA 3C3XA 1VL0A 1K0UA 3I4FA 1Z74A 3PFFA 1DRVA 3DHNA 3FI9A 4I8XA 3DB2A 2FN7A 4Z3DA 3ZNQA 4ALNA 1EDZA 1DIAA 2V6GA 4NFHA 4BNNA 4J7UA 1J49A 2OO5A 1DFGA 1LSUA 5EJ2A 1NFRA 1NVTA 4CLHA 1P0CA 4KDFA 2NVUB 3Q0EA 3D1LA 4DIBA 2BGMA 2J3JA 4HP8A 2GUGA 1ZSNA 2BF7A 3DZFA 1P31A 3FD8A 3I1JA 3PFWO 4BNFA 4CMBA 1NQOA 3IIEA 3EK2A 3PGJA 3IS3A 5L45A 1NFFA 4B8ZA 2I67A 1ENYA 1O5IA 1OFGA 4BNGA 3D3WA 4BO5A 1DB3A 4Y9DA 1ORRA 4RLHA 2HK9A 1ONOA 4P38A 4YB8A 3GQVA 5G0SA 3ANLA 4GL4A 1GCUA 3KBOA 2XAAA 4OXYA 2HMVA 4DA9A 3PJFA 1TT7A 1WP4A 4AFNA 1IYZA 3C7AA 3H6KA 4IJWA 2GZ1A 1SEPA 2JHFA 5EESA 4HUJA 2LDXA 3ITDA 2HO5A 2W4QA 1OBFO 4I9UA 1RM3A 2PGDA 4BGVA 5JAMA 4TROA 1GZ3A 1ZK3A 1Z73A 4IDGA 1N7GA 3FR8A 4NK5A 4E2ZA 4NJOA 1BGVA 2CDBA 4RJTA 3U9LA 2J6IA 4L0QA 1I10A 4MVJH 4E3ZA 3BHIA 4J9VA 1M2WA 3TL3A 3HUDA 3OMLA 4IZHA 4HNHA 3LC2O 1LU9A 1EVIA 1WDLA 3FTNA 4IMPA 3I9KA 2ZIZA 2OMEA 3CXRA 4JBHA 5JNLA 2DBQA 3VPHA 2VRCD 3GGOA 1IE3A 1PL7A 3OBBA 5DT9A 2HKIA 1LC0A 4A7PA 4BNYA 1AN9A 5DCWA 1DC4A 4XYMA 3BAZA 3FBGA 3UKOA 2XOXA 1NFQA 3BTSA 4IJKA 4Y6RA 3RC1A 5JO0A 2VHXA 3WG9A 1GFSA 3CPSA 2YV3A 4WK6A 4EYEA 2D59A 3QWBA 2V6MA 2WD7B 5G0TA 3HJAA 2Y0DA 4XD2A 2ZCVA 3TFQA 4CM4B 1ISJA 3DOCA 1J5PA 3PQDA 3WR5A 1OC2A 1LNQA 4XQGA 2NLOA 3DZBA 3NJ8A 4OXKA 5CDUA 4II3A 2EWMA 1YJQA 2W2KA 2GZ3A 3P19A 3HQ4O 1O94A 4BHTA 5IF3A 1UJMA 3W6UA 1U5CA 4PLCA 4KP7A 2CMDA 5JC1A 3ADPA 5TLSA 1Y9EA 5IN5A 2Q4BA 4E4YA 1MFPA 4W99A 5KIAA 1SB9A 1Y8RA 4EI2A 3NTRA 1A7AA 3NDIA 2X86A 1NR7A 3UICA 3AU8A 5JC8A 2HUNA 3TPCA 1KVRA 2RBEA 1GADO 2E48A 2YV1A 2X9VA 4GX2A 1JKJA 4BV9A 3HFSA 3C1TA 3GZNA 4RVUA 1PQPA 1X7GA 1IZ9A 1O9BA 3WDSA 4L76A 4RF5A 2UVDA 4H7PA 3NT5A 4BO0A 4I5FA 5L3ZA 1P1HA 2C5EA 4D3SA 1R12A 5EERA 4PVCA 1FDSA 1LRKA 1B16A 2GSDA 3FHLA 4CM9D 1NHGA 1P1RA 4XDYA 1OZAA 1KOLA 1K6IA 4UREA 4XR9A 3JQBC 4DVJA 4E32A 2D5AA 3I9JA 2D8AA 3IKTA 1UP7A 4ITUA 4F3YA 3IQDB 2P9CA 2X7HA 4WOKA 3ANMA 1T2AA 2R00C 3PQFA 1SBYA 2QZZA 4IS3A 1IZ0A 4PLFA 2OXIA 2GDZA 5T64A 1P1KA 4NK4A 3GRPA 3W1VA 3GN2A 5AVOA 4JLWA 1PJ2A 3LF1A 3ORFA 1SOVA 4A26A 1GU7A 1Y8QB 3DOOA 1RYDA 4IUYA 3WOHA 3WFIA 1CYDA 1WVGA 3PLNA 1VJ0A 2FPGA 3L4BA 4J1NA 5FEUA 3ASUA 4NBWA 1T1SA 3DQPA 1NWCA 1SMKA 1EVYA 1CRWG 2NADA 7MDHA 2D1YA 1YL6A 4WE3A 1D3AA 3DBLA 3GG9A 1G0NA 3RBZA 3TZ6A 1H6CA 3ON5A 2WWRA 1ZEMA 2H63A 3JYQA 3EVTA 5IJZA 1WW8A 5C3MA 4O6VA 3AUAA 4J4HA 3WWZA 3RUEA 1QV7A 1DIHA 3UW3A 4I5EA 5MGBA 2F00A 1BG6A 4I08A 1C1DA 4QFCA 1GQ2A 4RZHA 4OO3A 2Q4EA 4MVJD 2H1SA 4RVSA 1WZIA 3ZHZA 3G79A 1U3UA 3ANNA 3PHLA 4GLLA 4CM5A 3TZQA 1C1XA 1VRWA 1UXHA 3BMCB 2W2LD 1QYXA 3GFBA 1E5LA 4L9RA 4CM8A 1MA0A 1T2FA 1VSVA 2DT5A 2RHCA 3GH3A 1Q1NA 3GOHA 1UDCA 4RO0A 5A4DA 1LEHA 1O95A 3K92A 2WM3A 5A9SB 3GMSA 2C5AA 2X5JO 4FC6A 2E49A 4CLRA 1P0FA 3BMQB 5F5NA 3SLKA 2JD0A 3OA0A 3AW9A 5A05A 1T2EA 3O8QB 1E6WA 3INGA 2NUAA 2AG5A 1ENZA 4FR5A 3QE3A 4R4JA 4RZIA 1GQQA 3ZW9A 2IXBA 4QX6A 4LW8A 3M2PA 5T67A 1FXSA 4MP6A 2ZB4A 4FFNA 3B1FA 3BMNB 4PG7A 1YVEI 3CZMA 2PK3A 1P1IA 3E82A 4XJTA 3UCXA 2XXJA 3HB4X 4E2YA 1EK5A 4ZQFA 1YB5A 4BQPA 3W6ZA 3IP1A 3ZV5A 4CM7A 1LJ8A 3LF2A 5JS6A 1N9GB 1KY4A 1ZMTA 3FTPA 3JQ8A 4RPLA 3GNTA 2XPCA 4YAJA 4CR6A 3RI3A 3NX4A 5I7SA 4ALMA 2OP0A 2Y1CA 4BNWA 3DDNA 1ZXLA 2PH5A 2UAGA 2FP4A 3UH1A 1NPYA 2FOIA 5BNFA 3TWOA 4R1NA 4XKJA 5DP1A 2YV2A 1F17A 1S7CA 2IE0A 3LU1A 4KQXA 5TQVA 2C07A 4ZRNA 5DP2A 2I9PA 3BYZA 4WCFB 4ZU3A 1I01A 3MJCA 1E3JA 3JSAA 3ONFA 4GSLA 4L4SA 5G4KB 4YQZA 3U3XA 3IL2A 4R5MA 4GWKA 3ZGYA 2X23A 2UUPA 3IMFA 3RC9A 5FWNA 2I99A 2A94A 1ZH8A 3C7DB 4Q3CA 3AY6A 3BMOA 1AUPA 2X22A 3DEYX 2VHZA 3JQGB 1K6JA 1HZZA 4AJNA 2C7VA 2V6FA 1PJQA 4ZQGA 5C37A 5ICSA 2JFHA 1BW9A 1L7DA 2IDZA 4DPKA 4DMLA 4EDFA 2C82A 1EUDA 4IJVA 1LQTA 1HE4A 3D5QA 1DJQA 3E1KA 3RUAA 1Q7CA 3UOGA 4OIMA 1W4ZA 2ZJ1A 4MJLA 1DHRA 3PVZA 4YAEA 5TGDA 3KLPX 4L4RA 5TJ9A 3F46A 1LSOA 2IODA 1ZMOA 5HA5A 1XU7A 3W8FA 1MB4A 4CM1A 1P1JA 4Q9NA 3IAHA 3F1KA 2GLXA 2UDPA 2NU6A 3EY4A 3QVWA 3WS7A 4DC1A 4DPLA 2Q2VA 3NTOA 4AICA 1B8UA 5U1PA 4E5PA 1LDYA 3CMMA 1P9LA 2C29D 1MP0A 3DZJA 2Q99A 3ZV6A 3H2SA 2OZPA 1QSGA 1NM5A 3JQ9C 3JD1A 3KV3O 4LMPA 4Q3DA 4J1QA 2VOJA 3PDJA 5KTKA 2VZ9A 1HXHA 5JDIA 3OJ0A 4XGIA 4O5OA 3FCOA 3OP4A 1QYWA 4BO6A 4Q3BA 1YXMA 1NAHA 1ARZA 3COSA 3VHRA 4H15A 3S1LA 1M67A 4HKTA 1E92A 2GN6A 2NSDA 2ZB3A 1B8VA 5ITVA 1C0LA 3AFNA 3CIFA 2EJVA 1HDOA 4OQZA 5LC1A 1SOWA 3QVSA 5GZ6A 1XKQA 4F6LA 2JCYA 3Q9NA 1HDXA 2HRZA 2E82A 1NASA 4E5NA 4RVHA 1ADBA 1H0KA 1ZJZA 3NT2A 4BO2A 2EP7A 2W2LA 3KUXA 3KYCA 1KY5A 1ZK4A 4DQXA 1E3IA 4M86A 4E5KA 4TZKA 2O4UX 4H3VA 5DOVA 1KVUA 3EDMA 3Q6IA 2VYND 5JSFA 4YDRA 3KYDA 3FNEA 4CMEA 3VKVA 4BS9A 1VM6A 3E9NA 3Q2KA 4JNKA 2O7SA 2EIHA 4YVFA 4Z0PA 5IDXA 3GRKA 4NJMB 5JW6A 2B37A 1OC4A 4BO1A 4KQWA 4XJSA 3FWZA 4ND2A 1R0LA 2Q1WA 4DC0A 3VPFA 1E3SA 3QQPA 5HBRA 5IDYA 1PJBA 3H2ZA 1GUFA 3D4OA 4P8RA 1B26A 3RJ5A 4TSKA 4LRTB 5AYVA 2CF5A 3EUWA 3L07A 4JK3A 4P4NA 3FSRA 4Z9YA 3X2FA 5L40A 3D5TA 1B14A 3ZWYA 1EVJA 1B3RA 3MZ0A 5CG1A 4KUEA 1HZJA 1MUUA 1NVGA 4ZJUA 5BSEA 5FYDA 3TJRA 2HCTA 4XWYA 5KNLA 3KOUA 4WCFC 5EN4A 4UVEA 1CDOA 3UXYA 4OXNA 3GVCA 1NTOA 4J0EA 2B5WA 3D3WB 4A27A 4R41A 4Y8VA 3RC7A 3E8XA 2ILTA 2X0JA 1EK6A 4BO3A 4FIZA 4IXTA 3IP3A 5ENDA 1GTMA 1MGOA 5BQFA 4DTIA 3OJOA 3OECA 4FGSA 3QIVA 4IXWA 1E1KA 2WYUA 4GX0A 1DRWA 1M6WA 1Z7EA 7ADHA 1RKXA 2BELA 1XELA 4LK3A 3FPLA 5CEFA 1PWXA 1BDMA 1KS9A 2G17A 2P9GA 3WLEA 4II2A 3P5SA 1NXQA 2G76A 2Z95A 1PJCA 3LVFO 3LT1A 3AOGA 1P45A 3GC6A 4PIVA 3ZNOA 1UDBA 2HSDA 1X13A 4AJJA 5CDTA 1BRMA 4S1VA 1LUAA 3IKVA 3ETEA 5JPIA 4PG8A 1KVSA 3DTTA 4XR4A 4J91A 1GEGA 4FFLA 4PLVA 4FW8A 4YPOA 5C7OO 1N5DA 1PJ4A 4JBGA 3EHEA 5H83A 3HN2A 5BNTA 5K0ZA 1C3VA 2TMDA 3M6IA 4P4LA 5B4UA 1RYEA 1BXGB 1HDCA 1VJ1A 1EQUA 4OGWA 4ROSA 2G82A 4Z9XA 3AM3A 5DNAA 3OM9A 5EPOA 1QORA 1K3TA 2I66A 1QKIA 1F0YA 4B4WA 3MOIA 5T6BA 4DPMA 2ZK7A 3KVOA 2WDZA 4URFA 3GK3A 1CJCA 5G0UA 1ZXBA 5DN9A 4YYZA 2QG4A 4B8WA 1F8FA 2Q45A 4J2HA 1X7HA 4L75A 2BGLA 2PA3A 4ZRMA 3GNSA 4PG5A 4MPDA 4A03A 4CV2A 3SC4A 2GN4A 5JAZA 3H9JA 2Y1EA 4W4TA 3R6DA 4GAEA 2FRDA 2JAPA 4KZPA 1DAPA 4YRAA 1DRUA 3IDSA 2QW8A 5H82A 1A5ZA 4BOYA 3ZWVA 4L74A 4E13A 1DLIA 1W8DA 2VYVA 3MJTA 3CE6A 1ISMA 1W73A 1DOHA 1ZIDA 2PLAA 5TRTA 5TJHA 3ZHYA 4J3FA 3U5TA 1DC3A 1LDGA 1SZJG 1GV1A 1Y8RB 5IZCC 4YT8A 1A72A 3CEAA 1E7MA 2HAEA 5IDWA 4Q3NA 1R0KA 5BT9A 1BXKA 2DPGA 2ZTVA 5G0WA 3HDQA 2NTNA 4WLVA 1VE9A 2IXAA 2Y99A 4S3MA 1FK8A 1Z45A 2PWZA 3GLQA 5DBGA 4OAQA 4BKUA 4BNIA 3PJEA 2O7QA 1PIWA 4JQCA 4ONEA 5L53A 4NR0A 3GZNB 4CODB 4XZ3A 1U7HA 2VWPA 2DU8A 2HU2A 2JD1A 5EL0A 2IEBA 1YOVA 5CHEA 4XIJA 1YL5A 3ZHBA 3QV1A 1ZVMA 3ETGA 2NTVA 1KEWA 1TLTA 2Y68A 3AOEC 4FB5A 3HDHA 3LT4A 5TIIA 1J0XO 4IIUA 3JQDA 4JXKA 4MVJF 2PFGA 4GMGA 3R1IA 1SB8A 3DONA 3V2GA 2CD9A 1XU9A 2BH9A 4GGOA 2AQKA 2H9IA 2JHGA 1PS9A 3I6QA 4TRJA 5JDCC 4OSPA 4P22A 1SAYA 1BDBA 3I23A 3U0BA 4HXYA 2VUUA 2Z1NA 2DUUA 3A28A 4J7CA 2C2XA 1N7HA 1NR1A 4DMMA 2YHIB 1B2LA 4R5HA 5DDIP 3TFOA 3KETA 2Q2WA 1E1LA 1F14A 3I9NA 4IJUA 4RPGA 3DBLB 1E3WA 4U7WA 1AGNA 6LDHA 2HLPA 1K6XA 1KEPA 2RH8A 3I9OA 3L4SO 1X14A 1XCBA 2A9FA 4XRGA 4KOAA 4BNVA 4UUNA 3H9EO 1BVUA 4M8SA 2I3AA 3NJ4A 4ALKA 2RAFA 1TB4A 2NV6A 4UAGA 4J16A 1VSUA 4TRRA 1D8AA 4I9NA 2VTEA 1Q0QA 4AVYA 2A4KA 3C85A 1N92A 5F5LA 1C1DB 4WJZA 3WQQA 2YUTA 3B1KA 4MKRA 5AOVA 4EUHA 3AK4A 4FPXA 5I7FA 3L9XA 4R1TA 1GL3A 3SJ7A 4H16A 1E1MA 1KYQA 2CUKA 5JFOA 5G2OA 3DAFA 4LCJA 1C1XB 3P7MA 1EZ4A 3E18A 1K89A 4CM8B 1QXSA 3RROA 1K5HA 1I3KA 3R3JA 5HS6A 1TA4A 3UCEA 4L73A 1LLCA 2DFDA 5DULA 2Q3EA 1OMOA 3JQAA 4W9NA 3WTBA 2DVMA 1ZCJA 2JCXA 2EG9A 4IPTA 2WYVA 3KM0A 3V5NA 2IYPA 2IRWA 1EBFA 1PGQA 1ISFA 3DZIA 1A4UA 1VLLA 3ZI0A 1NNUA 4KWHA 1KVTA 3U62A 1M76A 4PFJA 2J5RA 2HMSA 2CNBA 2HMTA 5I9NA 1A27A 4YRBA 3E48A 2DTEA 4FFPA 1NPDA 2O48X 2Q46A 1HF3A 3ONDA 2VUTA 4PN3A 2V6BA 4ND1A 1UZNA 5EQFA 1E7SA 2DUWA 3D64A 1R4NA 3L9WA 3IC5A 1UXJA 4PLYA 3ULKA 3AY3A 1ZK2A 4KMSA 4HFMA 3JQ8B 4R54A 2SCUA 1GYQA 1P33A 2GN8A 1I5RA 5ADHA 4AJ2A 1LDNA 3ZWPA 3KSDO 1LA2A 3U49A 4ND5A 1AHIA 1T25A 1UXGA 3TSCA 4DBVO 4Z6KA 3FRJA 3RBVA 3VTFA 5L7YA 4WASA 3WMWA 3UCFA 4BO4A 3WYCA 3ZDFA 3HNPA 1PZHA 1HWYA 2YQ5A 1FDVA 3GAFA 3PLRA 4MVJG 3T7CA 4ZQEA 5JMWA 2O50A 4N7RA 4ILKA 4YJDA 4AG3A 4WEOA 4RORA 4FOOA 3BMOB 5CDGA 1MXFA 1Y5MA 3QVTA 4FCCA 4WLUA 3E9QA 3VDQA 4MOWA 4RF2A 3RFVA 1BW9B 2OP1A 3DAGA 4IQGA 1XA0A 5JMPA 1QP8A 1ZFNA 5L51A 3GVIA 1DIBA 2PD3A 1XSEA 4TQGA 5AXBA 2PZLA 4PLTA 5H81A 1NVMB 3F4LA 1LRLA 2YDXA 5BR7A 2VT2A 4TRMA 3VZQA 4ND3A 4NIMA 3CINA 1DIRA 3NGLA 4I5GA 4ZQHA 1Q0LA 8ADHA 4MKZA 4O1MA 3AJRA 2PZMA 2W90A 4YJFB 3UFXA 4ESOA 3RUIA 1QLJA 4Y98A 1DC5A 3BHJA 1I3MA 4GBJA 2C0CA 1UUFA 1Z75A 2EGGA 5A3VA 4R1SA 4DL9A 2DLDA 4PZDA 3OA2A 3G17A 3I6IA 2EV9A 1O0SA 2B69A 1YRLA 4BV8A 1JA9A 1TI7A 1CEQA 4G2NA 5JY6A 5I8WA 5COQA 1AE1A 5CPFA 4J2OA 1CWUA 1DO8A 1GEEA 4AJHA 1HL3A 5IDQA 4QECA 4IGFA 5DCUA 3UGKA 1QRRA 1NX6A 4UVDA 1E0DA 1XHLA 1GUZA 3V1YA 2UYYA 4DLAA 2AHRA 1Z6ZA 1NQTA 4RL6A 5JCXA 1PSDA 2DBZA 2RH4A 2YYYA 3AI1A 3H65A 4JGBA 5CDYA 5IXYA 5IFLA 1R37A 4B4UA 3HN7A 3GZ4A 2V7PA 4WLNA 1E6UA 1SPXA 5AXCA 3WNVA 5CEJA 2V65A 3K6JA 5F21A 1Z82A 2NWQA 3ZWXA 1ZBQA 2FZEA 3H9QA 3GAZA 5L9AA 3KYCB 4M49A 5KKAA 4Y67A 5T8KC 1DSSG 1G1AA 4JBIA 1Q0HA 1HT0A 1WDMA 3VH4A 2NU9A 3HSKA 1HYHA 3KYDB 2DQ4A 3RUCA 3ZWOA 2H6EA 4K9DA 4QQRA 4TKMA 4X54A 3PP8A 4RVDA 2PNFA 4YRDA 2A35A 4NPCA 3SC6A 1WXDA 2FSSA 4NHEA 1VJTA 3SBOA 3SJUA 4IMRA 3TZKA 4LCEA 4BNZA 3KLMX 1LDBA 3JV7A 4M55A 3IOYA 3OH8A 4XYBA 3OIDA 4NU6A 4WKGA 4R1UA 4N5MA 3JQBA 3DZGA 3HDJA 5TX7A 4BGUA 4I9HA 2FR0A 2PH3A 3BTVA 3HFGA 1LC3A 1BWSA 4IGEA 4XB2A 5JCJA 1ZK1A 2R00A 3L6DA 2J3IA 3M1LA 4FBGA 4M89A 4CMCA 4YT4A 3T4XA 3PWSA 3ICCA 3T7EA 2J5QA 4XQEA 4BNMA 5I8ZA 1DLJA 1E3EA 2CZCA 4U8GA 3OFSA 1GV0A 4BKQA 4J9UE 4BNXA 4KWIA 3HWRA 4NI5A 3STHA 3OIFA 5TC4A 3E5RA 1JVSA 4JP2A 4MVJE 3GGPA 4K1LA 3FPCA 3NDRA 4YCAA 5L7WA 1KC1A 2CSUA 3F9IA 3RFTA 4KUHA 3WYEA 8LDHA 3QWAA 3FR7A 1ENPA 1OOEA 4HFJA 1QYVA 1CF2O 2Y1OA 2QX7A 2Y1GA 3OF2A 5GZ3A 5KVCA 4UEJA 1DDOA 3L6OO 4CR7A 3S2FA 5K9ZA 1Q7GA 4BNLA 4YAKA 4D45A 4CV3A 1QV6A 3DC2A 4UVIA 4TVBA 5LCXA 4D0RA 4LVCA 5F1PA 4GLOA 3G1TA 3UAGA 1Y81A 2BFPA 5FF9A 1XQ1A 4FSHA 2UV8A 5L4SA 2QQ5A 3VVBA 1LTHR 4GI2A 3ENKA 1F06A 1LDEA 1DIGA 1V3VA 3H5AA 3MJVA 1PGOA 2FSVA 1I3NA 4RF3A 4RPKA 1KVQA 4K28A 4XYEA 2Z1MA 3W4IA 1IPEA 3GN1A 4E5MA 2E6UX 3GMDA 4DBZA 2DC1A 1HE2A 4AJPA 4XYGA 3TNLA 3NGXA 4CMJA 4WUVA 2VWGA 4WLEA 2YY7A 2Y67A 3TOXA 1YDWA 1LLQA 3PI7A 1U2GA 1D4FA 1YONA 3VH1A 1E7QA 5ICMA 1R16A 2RIRA 4GWGA 1ISHA 3WIEA 3OSUA 4GKVA 4EUFA 2FPIA 3PDUA 2IYOA 1LX6A
chains in the Genus database with same CATH superfamily
3NM4A 2QK4A 3F4BA 4K2HA 2IPMA 4NOJA 1E1YA 1CG6A 4OBEA 2R84A 4PQRA 1R50A 3K73O 4INAA 1TC2A 2QLLA 1AUVA 4FGWA 4WL0A 4DIOA 3E15A 1X7ZA 3RGWS 5C7IO 1W6UA 2Z09A 1NN3A 3NCHA 3PHGA 3WADA 2ODWA 2QRGA 1QK4A 4EZBA 3RRFA 4EVSA 1GYPA 1K06A 5HRUA 4IZIA 3WAKA 4W5JA 5EOVA 4E7PA 2J59A 4JSTA 4BKPA 3DBHA 1EFDN 1YBMA 3EEOA 1KC3A 3LLVA 1OREA 4NYJR 5HIJA 6AT1A 4CMGA 1LRJA 5KVQA 2PX0A 3LECA 1BC5A 2VHQA 3U17A 5LJLA 3RRZA 1YS4A 3DJFA 3ES9A 3ABIA 1I6KA 2ZIXB 4JLBA 3T9CA 3KR1A 3P9KA 3WLOA 3R9KA 5TT1A 2AG8A 4ZAFA 1CUIA 1RQGA 3BRWD 1W4BA 2XVXA 3DAYA 1BWRA 1M6HA 1XT6A 3KRTA 3P9XA 4X6LA 2CK3A 4XGRA 3T5CA 4CLXA 1KJQA 3AM5A 5JRZA 4H2DA 5CGQB 1US8B 4ZO8A 3RRBA 3QENA 1FRZA 1XA3A 1XXLA 5I45A 1Y80A 4AX8A 3EVGA 3QXGA 4J1SA 1VGVA 1QGAA 1NKTA 1D1QA 4MIEA 3O8OA 5DU2A 1BCRA 5CLQA 4C1NA 1OFUA 3M4NA 3OBIA 2R6HA 3PIIA 4GX1A 3RTBA 1ZSYA 1U3WA 2Y93A 3BXGA 3D8HA 1AZLA 5CGZA 2DOKA 3QUCA 1QIMA 1ZI6A 1L6IA 3AUUA 3M1AA 4L7QA 3W1EA 4CHTA 2JLXA 3LC0A 2WSBA 1W94A 3LBHA 1X2BA 5KREA 1JAZA 1EZZA 1RM5A 2M6LA 3R41A 3DO5A 1U1FA 2JBAB 5F35A 1P4HA 3OLXA 4N5NA 4NX2A 2C0QA 4ZTBA 3VR5D 4E33A 3EPKA 2LNDA 4JFAA 2OK7A 4P5DA 2GM4A 4F2PA 4EKYA 1EFHA 4LXTA 1E7YA 1JLKA 3PC6A 2AEMA 4BBPA 2O59A 4F9TA 1HDRA 3PD1A 3WYGA 3E5HA 4G5QA 5EEHA 5BSVA 1O9GA 4LHXA 3F8SA 2AR0A 1ZMRA 3UOWA 3VDRA 1FX1A 4QU8A 1DKRA 5DX1A 4LA4A 4YASA 3H3JA 1GGMA 4I50A 4LTMA 3DL0A 2PMKA 3QA3E 5AVZA 2R11A 2EC5A 1DCKA 2FR8C 1U5BB 2WV9A 3I01M 2X9GA 2ZRJA 4F45A 2WF6A 2G77B 3UAYA 5C5IA 2ZRHA 1AO0A 2VDPB 1UP4A 4J0DA 3TGPA 1YJ5A 4PVDA 4JLNA 1OZGA 5G4LA 2QTBA 4YRPA 2JS7A 1Y34E 4M0MA 4TTVA 2X40A 3U4DA 1NBEA 4F6CA 2Y2UA 4QOJA 5ESRA 3ECAA 3DVQX 3K94A 4NNJA 1MO3A 4MO2A 1V11B 1A0OA 4AY4A 1QCCA 1NWHA 1CS4C 4O4LB 1K6EA 2DKOA 2C9OA 5AVJA 1V41E 3ZWMA 3JPWA 2NNLD 3K15A 1W1IA 2EL9A 3AHCA 1LV7A 2VRNA 2BFOA 2IYEA 2BI8A 1QHIA 3AINA 3D4LA 3OJWA 2BLLA 4XWGA 4Z0TA 1Y4DE 4WKCA 3AI3A 3JQ9A 4EVIA 2OCXA 1MH1A 1QS0A 4W8GA 4QM6A 2Q0SA 3PTZA 2C2KA 2F8SA 1Z0SA 1U28A 1ZWKA 2FEOA 3Q3JB 3SYNA 5KVVA 3T7DA 2B2NA 2XZPA 3GFOA 1FXWA 2ATEA 1E4EB 1E6KA 2QP9X 3EH2A 3KQSA 1J4AA 4US0R 3UN1A 5IK2D 4LFBB 2W8ZA 2AE1A 3MIIA 5CMLA 1T6NA 1LI4A 5GQSA 2ZITA 3FHCB 2AJDA 1FDOA 1R6UA 4QHSA 5K4GA 3SIWA 1IU9A 1T3LA 4ND6A 1TJPB 3PWKA 4J1TA 4W9MC 3PB3A 1NQXA 1WB5A 2IXEA 5KYUB 2QTLA 3G5LA 4BWVA 3DR3A 3ZVMA 2FEXA 4CKCB 2I6TA 1EUZA 1JE1A 3ZTTA 5LQKA 2J41A 3IUPA 1A04A 1DAOA 1G41A 2OPBA 4NZMA 3TRFA 4K81B 1FFHA 5LOVA 3IPYA 4QEZA 5K3BA 3RS5A 3KB6A 4C4OA 3GLFB 3DEAA 1AGYA 5EXDA 4PV7A 1NURA 5TMDA 3RSGA 1Z6GA 1XXHB 1DQZA 3R6LA 5CBKA 2L0XA 1Q7EA 5JMTA 2PX5A 3AEXA 3NHZA 2NO5A 4UTPA 4M54A 4L5AA 3SN6A 1EESA 4FFOA 4V24A 1TF7A 4GSKA 3IOMA 3ABQB 4BZQA 1VDZA 3FPFA 2OCGA 2M1XA 2P2YA 1BMQA 3MYRA 4UZEA 4XWTA 4JI5B 3JW8A 1WUKS 2P6UA 5HMLA 4IILA 4Z8YA 3M82A 2M6KA 3GY0A 2A1TR 4B1FA 5CNJA 1O6FA 3ADKA 4KXWA 2FP3A 3R9WA 3KJIA 3LDGA 2O5EA 4JJ8A 3UTDA 3BQNB 1R4NB 3S2GA 4IUCS 1Z2OX 1R5OA 3KEGA 4KRYA 3R4CA 4PCUA 2PGNA 4ZV9A 2JJ8A 5ILOA 3M1IA 1P6UA 5LUBA 3WSWA 3TIGA 4E2XA 4MKGA 3K70C 2IW3A 4G0VA 3BD7A 4F9GA 1KZ6A 2UVQA 3O8CA 4FN5A 4RY0A 4P36A 3JYLA 4D9FA 2CDRA 1QIFA 1XZHA 1YJ8A 3T1OA 1PEDA 5BN3B 3VAZA 2ENUA 3GX1A 4DCJA 2D2IA 1EVQA 2G5PA 3PNQA 1N57A 1NMXA 1TXGA 1YHZA 2FZ5A 1Z2NX 1PL8A 1Q7BA 4L4XA 1QU2A 2X5KO 1EDDA 1W88A 3NANA 5H02A 2ZT8A 4B7XA 3PQ4A 4QJ3A 3D7KA 4IQ4A 5LJIA 1RBMA 1F4PA 3MS4A 2O2SA 4FLMA 4MP8A 2ZZMA 4X1KA 2YQZA 4FXOA 3U4CA 1TW2A 1WQ3A 2QL9A 1CBUA 5I3CA 3GFQA 4E5VA 3UMSA 5AVYA 1MGPA 3QU2A 1RPNA 2CBXA 2MMCA 4PSCA 2P27A 4QL3A 1J33A 2VG8A 3X1ZA 3ZY2A 5F51A 3HBNA 4NBSA 1I3OA 3G1UA 3A3PA 5C9ZA 2VSXA 2OZLA 3IDZA 5KYNA 4Y1RB 1VC2A 1JG4A 1VPLA 1Y7TA 3P8ZA 1XXHE 2DSNA 4KE7A 4L1KA 2C54A 4TKVA 2B6HA 2RGNC 5C1BA 3PQ6A 4JXXA 4LJRA 4DM7A 4D8YA 3BQMB 2FZWA 1IQUA 2CYCA 3U6KA 4WEQA 2OCKA 1L7RA 2FAXA 4J0GA 3SMQA 4A16A 4WKNA 1ONPA 1PI3A 3HI4A 4O2AF 3SKVA 3C3EA 2SKEA 3D6AA 1CE8A 2COKA 3QUSA 1R4AA 3KLOA 1JGTA 3RKRA 2B92A 4X64B 4M0DA 3LG2A 1GNQA 1X9IA 3Q8LA 4Q1EA 2X4GA 4XYLA 3RFUA 2XE4A 4RK4A 1KBZA 1UBFA 1RJGA 2P68A 4HNGA 1E18A 1XJCA 5D6NA 1E6CA 1JU4A 4HJRA 5LZ4A 2VK1A 4Q03A 3N58A 2Q0HA 4ALIA 2VNAA 2WWWA 2XDAA 1XTQA 3PA6A 3NWEA 4ZEWA 4ID9A 5DM70 1JIKA 5EWJA 5HJEA 2WU1A 1N0IA 4AJ1A 4XDZA 4L08A 3FWHA 5LN1A 1GXSB 1FLNA 2C8JA 1F2UB 2OAP1 1KRWA 3C6YA 4X3CA 2QUHA 1OTXA 2Y66A 4ALLA 4JLMA 1AKVA 4EF5A 1YE3A 2JHPA 2FCRA 3V7WA 1TPYA 4FHFA 2CEAA 3P96A 1EE9A 1RXSA 2C7GA 2OFXA 2WP8J 1WKBA 1BQ4A 1SJ9A 3E9MA 3UJCA 2O3SA 2C8KA 1J7KA 5DMXA 4F8YA 2OG2A 1RI2A 3W4KA 4XXHA 2VK4A 5FFNA 5ARCA 4MQ4A 4LQ4A 1T3TA 3SXUB 4BB0A 2WSLA 1G2PA 5DZSA 5BN4A 4BMCA 4Y6GB 3BICA 1TAQA 1W4CA 3VA7A 3IBCA 4JUAA 3MC1A 4FYJA 4WZ6A 4RD3A 3VPXA 2GNAA 2BPOA 5CEEA 1T13A 3ROKA 3QFTA 5GJCA 1VXRA 3HY6A 3ZBQA 3VJLA 1E6EA 3PD0A 2NO4A 4AZVA 2BJVA 1XRNA 4ZFNA 3EDCA 1V3TA 1DDGA 2VQDA 3TW8B 1OB5A 3RCBA 4L8GA 1ML3A 1W25A 4FC7A 1BDHA 5EE0A 2CYAA 4UKDA 5IBPA 2GPAA 2IZ0A 4HEHA 4MWOA 5KAPA 2VBCA 3H2YA 4AMBA 2HCFA 2ZQYA 1WMAA 3BJIC 1H94A 2HJHA 1AGRA 3F6BX 4JVNA 5SICE 4XEHA 2HA2A 4W1PA 3NTQA 1Z07A 3MB5A 3OD1A 3SYRA 4MUYA 1UJBA 4R2IA 1GLGA 4CM3A 1UZMA 4DDKA 2AG0A 3B6EA 4YMSA 2GCOB 3G7SA 1UH5A 2JL1A 1JXAA 4KO4S 1PFQA 1U65A 1U2DA 1ZL2A 2R7KA 3HB9A 4N3BA 4LXHA 1RYZA 1YU9A 2A5DA 3OJEA 4O08A 2MT9A 4UVGA 1C0IA 3BG5A 5JJKA 2R8BA 1E3MA 1GRNA 4KQMA 1VKJA 4G5HA 3A10A 3LQRA 5KWIA 3AV3A 5DLEA 4A8PA 5JXJA 3RSCA 3QYAA 2XEDA 2CDCA 5AW8A 1QVWA 4L6AA 2ZTLA 3MWDB 4DDVA 1YQGA 1XLUA 4P35A 4ES6A 4DKXA 1OBCA 2R79A 1B0AA 1ORTA 1GPDG 3FCEA 4MPRA 1WSAA 2POQX 1M1YA 2GTPA 3FCUB 1A96A 1DC6A 4LISA 3OEEA 1HTBA 1NVAA 3KT8A 4UEOA 3WL6A 3C8UA 3WLNA 1BVRA 2CNLA 4QEDA 5KNBA 4TYQA 4AECA 3QJYA 3DE5X 4EUSA 2B8EA 5K3FA 4UMDA 3IIMA 1MJNA 1PV1A 1G7RA 1U2QA 3DSRA 4EKDA 3NHSA 4ZGGA 3T4EA 2E87A 3KALA 3L0DA 3WKAA 1SQ0A 1YC5A 4X20A 3X3HA 4AK9A 4EEKA 1SBTA 2RKWA 4IBOA 1NXPA 1JA0A 3Q7PA 4IIEA 2GCEA 4FEAA 2CJXA 4XQCA 5AXAA 3TRHA 2DQYA 1BRTA 1NI3A 3G7NA 3T41A 3ZWAA 2CCJA 2WFLB 4MR7A 3L0SA 3ZH9B 2QRMA 4WCDA 4A2PA 1NUPA 4AG5A 1CDEA 3FUWA 4RTMA 1VHTA 5GAJA 2VZ0A 3DZDA 1C29B 1O94C 2HX1A 2ZYAA 1DXHA 4Q1DA 3A9TA 3HU1A 1VKHA 1U8FO 1OV6A 3Q3VA 5JLAA 3SGLA 4LOKA 1FSZA 1E3LA 3M4XA 1VPTA 5AKZA 4DSZA 3O9ZA 1HI9A 2R751 4NBVA 1QR6A 4WWHA 3NAZA 2OV3A 3I2YX 3WJ7A 3U60B 4RCYA 5ALIA 4Q15A 3EPLA 1EX7A 1WDKA 1Z6PA 4HLUC 4OA8A 4XFKA 5T4BA 3STTA 1EWRA 2CXNA 2JCVA 4FQ5A 4D43A 3Q98A 3A1CA 4TM8A 1ONNA 4KRXA 3W05A 3EXEB 4CKEA 2JIQA 1CJVC 3DBOB 2I8LA 4ZVVA 4CIWA 1EE1A 1HETA 1P4JA 4MVJP 3CCCA 4XFDA 2HT1A 2ZZNA 3HB0A 3DH0A 3KTAA 4UMVA 1USUA 1YGPA 3OFKA 4D81A 1XTRA 2XE8A 2G5CA 4RD0A 2PLWA 4TS3A 2FPUA 1IFXA 1X1BA 3OI7A 1X7YB 5BNIA 1ELOA 3ZCPA 1YQTA 4YJ3B 3PNYA 1NPTO 1EBUA 3KAJA 4EPTA 1QQAA 3GRAA 4OJMX 4A6PA 3HDGA 3B8EA 4NYJQ 5LLSA 1YMUA 4OX9B 2Y71A 4LDRA 1XAGA 3C7CB 1WBBA 2B5OA 1YOBA 4LDQA 4NH4A 4DUYB 4FCVA 2AJ8A 1RVV1 4CCWA 4OHMA 4BX8A 2QNRA 3AYXB 1ZD5A 4B3GA 3WTCA 1BAPA 5DN6A 1XZQA 4RMJA 3Q88A 5DLYA 3ST7A 2P77A 3UHOA 3FUXA 1L7EA 2FEPA 3K20A 4NG5A 4L72A 4GMXA 1RZ3A 3ZCQA 4MUAA 2V7EA 3DFUA 3PG5A 1QQTA 5IJAA 2B4TO 3AR9A 2K6GA 3KXPA 4H3KB 3LY7A 4TWRA 3W90A 1X7WA 4K9PA 3J81A 9LDTA 2IU0A 4WD3A 4HDNB 3VI4B 4IOKA 1I2AA 1NQ5A 5J4LA 2HA7A 5AVQA 3TL2A 2P5YA 5AJZA 1TYDE 5LU9A 1C3OB 3HI6A 4J49A 1RPZA 2KBFA 3DFZA 4GLBA 5I9TA 1NJGA 3DAPA 2P2LA 3FMVA 2ZWIA 4CQMA 5BV0A 1FPQA 1JTFA 4DQ0A 2VYCA 1QTQA 3FYUA 1XEWX 1M75A 2HXYA 2XGMA 2NT4A 2Y3IA 1TK3A 2IW1A 4PS0A 4W7HA 5FJIA 3LZDA 2R6DA 3R7SA 2DPHA 2O2YA 2BP7A 3OM8A 3U9SA 4PHTA 4H1WA 3U7QA 2PZJA 3HZZA 4BFVA 4HGZA 3LT2A 5D7BA 2PGOA 2UYQA 1R6AA 4OUKX 1R6DA 5FWYA 3L6BA 1X0XA 3QXSA 3ZHQA 4J90A 1HLFA 1P7CA 3ZE2B 1N6PA 3ACCA 5DBHX 3LWNA 2XVMA 3FROA 1BS9A 1UZAA 3AHHA 3Q4GA 1COWA 1CJUC 1M54A 2VTBA 1XRQA 4A8JC 4LOLA 1QYIA 4F3RA 2H1HA 4BKMA 2JK0A 2QMQA 5C1DA 1USIA 1O97D 2GD6A 4GM0A 2FN8A 1MV8A 2BKEA 3ZXXA 4IRMA 3LP5A 2BRUA 1XIVA 2RHJA 3LPDA 3HGMA 3UJ6A 5JHHB 1H2FA 3OICA 4HDSB 3HBMA 1ACMA 1NLMA 4WIAA 1G5IA 2J5KA 4RVFA 1DAHA 3ILVA 2H54A 2WM8A 4TTIA 5DHRA 2DMRA 1OV4A 3ZWNA 2WWTA 2B82A 2Y27A 1E77A 1NT4A 3A70A 3EPPA 3VU1A 1UJNA 4BU1A 1V45E 2Q2QA 3DP9A 3G82C 1C9JA 1N2CA 1IPFA 1N8SA 3QBJA 3F5SA 1QGUB 3R3YA 1VPDA 3DBIA 3TXYA 2CK3D 3WL3A 5GOTA 3C6ZA 4RTSA 1EQ2A 4WGFA 3TCNA 4RJIA 5KJFA 1IXSB 1U1IA 1ZK0A 3FF4A 3N2NA 1SHZA 3DNMA 3QK7A 5TDHA 3RB8A 1FJHA 1M8KA 1JG2A 2AZDA 1N8KA 2GWRA 3KJZA 5IAJA 2RGRA 1WCYA 4URUR 2OXCA 1OI7A 2CNDA 3A14A 4L8FA 4EPXA 4O4HA 2B35A 1H4SA 1R0CA 3SVTA 3MCZA 5CDFE 1IN6A 5HJ7A 3WB0A 5ER9A 4YMUA 1E99A 4LJ6A 1G19A 1ZAYA 4FZRA 4YS6A 4UARA 2QRNA 2XCSB 2OORA 4JS0A 3K2BA 4IEFB 2BFCA 2V6JA 1OT3A 3H1AA 3M3HA 2YHIA 5KSOA 5G0VA 3RVJA 1TKBA 4KFTA 4YGXB 3CZ4A 1FQJA 3VDMA 1GN8A 2ZI3A 1VMDA 1BGXT 4LZAA 3DOJA 2NO1A 3DTYA 3FB1A 3FGNA 3ZI4A 4BVKA 2BZ0A 2MYNA 3GB9A 3SZGA 1G9TA 2BCEA 2DWCA 3NPAA 1XLTA 4ZGWA 4PTLA 5KWJA 4I36A 1K4YA 3OQ1A 4OLFA 3V7UA 3OJLA 1L3IA 4EHHA 4ETWA 4MWBA 1K8RA 4AO7A 4YCNA 1JILA 2QAGA 4H59A 4A8TA 2HMWA 3P2IA 5CK5A 1OJLA 3CNHA 3PHJA 1N6IA 3GCGA 4F4DA 4PGAA 1MW9X 4BBZA 4DHEA 5F33A 4A2QA 4V0RA 2CJWA 1I1NA 3V46A 3MJRA 3NRBA 4HAVA 3AXSA 3RK1A 4P08A 2GZSA 1B74A 4CF6A 4UDYX 2Z04A 2ZSFA 1X9HA 3N5KA 1J2YA 3T5PA 1NU6A 1F9AA 1H22A 4GKJB 2NZWA 5BWCA 2MYUA 5HQ3A 3EH1A 3JQCA 3QSGA 4J7XA 3VH3A 1U0HC 1XC7A 2EJWA 2I4IA 3O21A 2FZCA 2XQFA 2IEDA 3S44A 4DMGA 4ALJA 4M9CA 1DE0A 1BIFA 1GGKA 2ID4A 2PEZA 2X13A 4MKHA 3ZE7A 4TKZA 4LVOA 5CM9C 5FB3A 3NRCA 3IUSA 4LFCB 3TEJA 5DM1A 5HZHA 3PRYA 3GYGA 1KNXA 3DKVA 4QYMA 4DLTA 2ZRLA 1AVTA 3LUDA 3O8NA 4MHSA 3AV0B 3PQ2A 1W29A 1Z38A 1CTQA 1JDPA 2R6GA 2WT8A 2B8JA 2GM9A 2TECE 3CISA 3CLTD 1P1FA 3CUUA 3PGA1 4NFYA 4REOA 3R3WA 3TZCA 4MQBA 1EVKA 1GHTA 5TVKA 3T3EA 3SDSA 2OV1A 3URKA 3IOCA 1E1NA 1Z6XA 2VNSA 3MMNA 4E6EA 3PHBE 3DWFA 4XCQA 4Q3EA 4W9RA 4C3VA 2YFHA 3F6PA 4HN9A 2CLCX 1TMKA 2O2ZA 3EVNA 3BDIA 3GHHA 3WDKA 5F78A 2CFOA 3V9AA 4V0KA 3A0RB 1CFZA 4GECA 3UHPA 5CXQA 3I9FA 3HR7A 1MR3F 3KD2A 1W5EA 2Y9PB 2VR1A 3O4RA 1VRVA 2HPVA 4L3WA 4MGKR 2DR3A 4NZNA 2WRZA 4L2IB 5F1YA 3TDKA 3H2KA 1RCUA 2EERA 2PH7A 1N7JA 3D3EA 3TTXA 1WZUA 1UOPA 1CRQA 2HH9A 3GFTA 3HCFA 4ZICA 3GEBA 3SC3A 2IOYA 2UXCB 1EM8B 1ZXXA 2PPLA 4MWZA 4Q1FA 3L7JA 5FNVF 4MPJA 4BNKA 1SBHA 2PKQO 4B76A 1UIRA 1NM5C 3E2MA 5KOJA 4YJHB 2ZJOA 1OYYA 3KJQA 3VOSA 1FTWA 2REBA 1LBEA 2XT6A 3DKKA 4PSAA 5J2UF 4G36A 3OC6A 3OCCA 2WJPA 2XBMA 4JITA 3WNZA 1U9JA 2QY6A 4OKIA 4NEQA 1OWPA 3NKFA 1Z56C 4PO8A 3L46A 3DD5A 4EO4A 1U2PA 3GVPA 3QJ5A 3UWKA 4CEJB 4OQ4A 6REQA 1P8AA 3IB6A 4OREX 2C4MA 3RTCA 1IN7A 4HY3A 5I9LA 2OKGA 4IYJA 4F5YA 1M10A 4HYTA 4RTLA 3L04A 1RWNA 1WS6A 1ZU4A 2IZ7A 3G9ZA 3WYAA 5BVHA 1K5DA 3HC7A 3OEWA 3H5IA 3FNFA 4ZCQA 2GKOA 4YX9A 3TL6A 1R0RE 4HAYA 3ZCUA 3LL7A 1G7SA 4TXLA 1NXSA 3HUFA 5KDDA 3EW7A 1RSZA 4CM9A 1UK8A 4DMFA 5JBQA 3MK31 1R0SA 2C5SA 3I5UA 3GQBB 1WMSA 3OOEA 5ER6A 3T1YB 2NQTA 1FMFA 3B7GA 3VPGA 1J8DA 4OMUA 1GDHA 2JASA 1IY8A 3C70A 3C45A 3UQZA 3HU5A 3WQRA 4CT4B 2NNWB 4JUDX 5DHUA 3PL5A 4DCSA 4OAPA 2ZUFA 1Q22A 4U4AA 3IAM1 2DE0X 1ZINA 4Y18A 1JLLB 4ZZIA 1X1DA 5FBQB 5AUNB 4GP6A 1RXWA 2CLDX 2QYHA 4PAWA 4YNBA 1UR5A 3FNGA 1NLUA 2JAQA 2PRSA 2VJMA 1Z5ZA 3L1KA 4OM7A 5L4NA 3WGIA 2PYIA 3PBKA 5CFLA 3AEYA 5MDHA 3WGQA 3R3SA 4GSYA 1YAHA 1NKSA 1LLDA 4JJKA 4PG6A 5JRDS 5JZVA 4DS3A 4NKRA 1YRWA 3QI2A 5C52B 4UBNA 2O3RA 3AB7A 5F52A 2VUSA 3OY2A 1YOVB 3L6CA 3O82A 2GF9A 3DUFB 2KE5A 3OKPA 4UD6A 2PZ8A 5L95A 4R8VA 4EGAA 4UZSA 2O7RA 1ENOA 3KYIB 3A6PC 4MQLA 1MC4A 4XWAA 1QTRA 1H66A 1BROA 4HYQA 1UWCA 4X1OA 3WB9A 5B58C 3F67A 2FUG6 4EW1A 4X1IA 1E94E 2EGHA 1SXJB 2GLUA 1A9ZA 2WTNA 2CT8A 2HDWA 2HIMA 4UUPA 1EUCB 2IYFA 3MJHA 4F2HA 3R20A 5HHTA 3R5SA 2PLRA 3D54D 3K0FB 2ZRPA 4YC7A 2PE5A 2I71A 1SUAA 1QCYA 3PUIA 2VDWA 2A30A 5AUQA 2BHLA 3OPVA 1WA5A 2AS0A 2YXBA 5JEEA 1KERA 3L49A 4GMDA 1AHHA 2HRRA 4QRDA 1Q3KA 1TYBE 2KB0A 5C1IA 2FPPA 4C0KA 3WAJA 4KRFA 2QTFA 1SBZA 1HYGA 2C77A 4DABA 2RGWA 2VBFA 2IYYA 1QDLB 2W98A 5HDQA 3VR0A 1FJGB 2QP4A 1QJCA 1SEVA 2QAIA 3QEMA 3R0XA 4HPJB 1T1GA 3JD0A 1B6TA 3I32A 3KXIA 4OBWA 1AQLA 4XD7A 4YIKA 1KAHA 2HPHA 4RTJA 3MF4A 3D2BA 2LV8A 2OOSA 3ZLTA 5MFPA 1KZ1A 3M6XA 1P3JA 4R7GA 3C24A 3VOTA 1LPMA 1BU8A 3TGWA 3WKCA 1FU7A 4YMVA 4KPUB 3LUAA 5JZOA 3VKGA 2RCYA 1C9DB 3U7EB 1I8TA 3L43A 3BKXA 5I48A 3O4JA 2X7XA 3OZUA 4G4JA 3QGMA 3IURA 1N7IA 3OOWA 1YH3A 4KJXA 3P2KA 1ZONA 4CUJA 4IVQA 1JBEA 2J46A 1OX4A 4L5IA 3K9BA 1L3CA 1F60A 3UJBA 2QN6A 4RV9A 4A6DA 5LMNB 1O6BA 1TX4B 4OTZA 5FLEX 4MUKA 1CP2A 2EP8A 4TLMB 1WD7A 3GF4A 4C7JA 2I6FA 2MSDB 5SY6A 1ZNYA 2EZ8A 2GZRA 4NXNB 2AI1A 2GO7A 5F7ZA 3KQWA 5BT8A 5HNKA 2F9MA 1KQFA 1CJBA 1H6DA 3BJEA 5BQ5A 4YMHA 3O95A 4RY9A 3DMTA 2PRIA 3LUPA 1MN6A 3UWMA 2H4HA 3I72A 1PT6A 1P4AA 5LD2C 5FIUA 4LSMA 1HH4A 3G0HA 1E96A 4OHZA 4TN5A 3OQMA 2WE7A 4NMMA 2JFXA 2P6OA 2ERXA 2A5YB 2JA1A 4KQFA 1VIVA 3AR6A 1OX6A 5JZMA 3AKZA 2ZVQX 5UKDA 1B0UA 4CT5A 2J9YB 1CIPA 3ILYA 5JBIA 5AIAA 3C39A 4KR0A 3ZH2A 1QZXA 2C8VA 3C0KA 1EJ0A 4JJ6A 1WAMA 3HYSA 5E0KB 5HRCA 2JLYA 1L1FA 4GDMA 1Z2AA 1H2WA 3JYPA 1MABB 2PRZA 1CRPA 4ARZB 2BGKA 1N2ZA 3AETB 4MIYA 3RVLA 2D74A 1GTZA 1C50A 4IF4A 3WWYA 4AZ3A 1U3TA 1YA6A 4CM5A 3ECSA 2VDKB 3BMNA 2HEGA 3ELBA 1TVEA 4M2LA 4B7UA 4C6SA 1NYQA 2CNWA 1K63A 2O3UA 1U8XX 3BRCA 3E70C 1PG5A 3LC7O 5KHAA 1PZFA 5EIHA 3ZX4A 5FPYA 4YJ3F 1C1YA 3NIDB 3OEED 2P3SA 4R01A 3ZU3A 1RJ9B 1N9GA 3AR5A 2Y1XA 4YQYA 1S6YA 5KNBD 2P9HA 4JDUA 4O4JA 2QTWB 2C5FA 1IZ8A 1VHWA 3ECCA 4O4IB 3WYFA 4BDSA 5FOQA 3LUCA 4L5CA 1JN0A 3ROPA 1P7VA 1QH0A 4KQEA 2XUJA 3IXLA 1C4OA 2P6NA 3SJZA 5THKA 4E1VA 4QBGB 3SM9A 2W6IA 4IFIA 4MI3A 2Q1XA 4PAOA 5B58T 1V5EA 2JB9A 3L7BA 3T3DA 2RI6A 4KN6A 1XN1A 2H00A 1A71A 3BXXA 5AW2A 4J6EA 1RLJA 5FI3A 2Y0CA 1KDYA 1S0UA 2ZUWA 3DL2A 4QSMA 1Z6QA 2HQBA 3RADC 3M6MD 4HNUA 4QDTA 4BDTA 3NDJA 3RUHA 4S2UA 4C4AA 4PYJA 4UDXX 3B6ZA 3H87A 3DE7X 3EPHA 3VKUA 4B3RB 4X7PA 1PS8A 4FE3A 1OBHA 6CHYA 2QOEA 4JZKA 5KSWB 1C7FA 4Z0HO 5J3JA 1NV8A 4O59O 5TY0A 3CMCO 4GZ6A 4EHNA 3H1BA 5HIMA 4DA8A 2GJSA 4KN8A 3TUIC 4Y6LA 4DW8A 1VMKA 2D2FA 5K3CA 3DUWA 1Z8DA 3RD5A 1RWPA 2GRAA 5C5EA 4QNMA 1X70A 2ZI7A 1J0CA 3FPJA 4MYCA 1KZ7B 4Y6PA 2GFQA 4IDBA 4ZYXA 3CCBA 1PGPA 3UJPA 5AESA 5J43A 4L07A 1GCAA 2JI8A 5ALUA 1YF3A 1QHHB 2AXQA 5CA0B 4RK1A 1XVLA 3FRHA 3SBDA 2EFCB 3E3LA 1RNLA 1G3UA 2AD1A 2IHJA 3WLSA 2CMKA 1Q74A 4P3YA 2WIFA 4ZMSA 1VCIA 1M6YA 4D8VA 2XT0A 2IZZA 3OZSA 4ZIRB 2W8BA 3CZRA 2XQIA 3LUHA 2ZUDA 2RGXA 3F7OA 4R81A 2G0TA 1XTUA 4HN2A 1U0FA 4IHJF 2DT8A 2JDIA 3JSXA 4EAAA 4L8LA 3AL2A 3UJ3X 4BYGA 5BUSA 5G41A 1GNPA 3QMWA 3NEJA 5F73A 3ZYZA 5DN6D 5FWXA 2XF2A 2J5XA 4MV7A 3I62A 4RVGA 1TKRA 2GXSA 5WRFA 3RJTA 1ZWLA 2OAGA 4U7PB 4US2R 5HM8A 1IWPB 3W3ZB 4AJLA 3K96A 4PYLA 3HXLA 3MEQA 4LWZA 1A4RA 4YR9A 1C41A 1KI4A 5GMOA 4CGZA 2PCJA 1YR1A 1NUQA 5TARA 3NM6B 3PRKE 2O52A 4OOFA 2G1AA 2X3FA 2ZTSA 4EVRA 1SO8A 3DMYA 2VYNA 1ADJA 1E5XA 1O94D 1SUSA 2AFIB 2OAQ1 2Q1UA 3S8YA 4YJ2B 3NH9A 4CQMD 1SK9A 2GARA 3ZV4A 1Z5GA 4ZANA 2RHLA 2WA2A 5FA5A 2XWSA 2ZDQA 3HJCA 4IQFA 5E8JA 2R87A 3L79A 4AJOA 5I7RA 3IBFA 3AJ8A 2W6CX 4GBMA 2INGX 2CC2A 5BWOA 5JYBA 5LA6F 5FOVA 5K45A 4BFYA 1XQVA 2VJOA 4XB6B 2WJ6A 1OYVA 4RA9B 3VU8A 5KYXB 1I36A 2AN9A 1I4TD 4HB4A 1Y9ZA 3PUXA 2Y0EA 2LVBA 2ZXUA 3TXAA 5D01A 1U81A 1L7NA 1NNI1 2ODQA 3KKZA 3NM5A 1COWD 3HLTA 4QULA 4U9UA 1DAEA 2QN3A 4UCWA 2VTKA 3C41J 3KE8A 3HB1A 2PMWB 1CQJA 2W2OA 2YJGA 1DBQA 2PIDA 2QUAA 3UFBA 4ZRDA 3UV7A 1JFTA 3T3OA 1YS7A 1ACLA 3K31A 4HRAA 3SNKA 1FDIA 1KR2A 2MSEB 1O6CA 1M9NA 5EVJA 2C3YA 2YXNA 3V33A 1JI0A 1RC1A 4GI5A 3N7UA 1V39A 5ABPA 2A5FA 2VC2B 3DE3X 2AX4A 4GIBA 4NTZA 3EGDB 4M46A 3L06A 2ODEA 1Z74A 2CXOA 1MVNA 1Z4LA 3PFFA 2JFUA 4R2XA 3L5OA 1ISPA 2FN7A 4MDFA 3DOUA 1ZAKA 2C3OA 1P2DA 2LD4A 4EY4A 4Z3DA 2M6RA 2XNKA 4G1UC 4NFHA 4BNNA 4F3KA 3F7MA 1FFBA 2O2GA 4J7UA 1GR1A 2BT4A 4GP7A 4UXHA 3RJZA 4R05A 1NVTA 4GXQA 2NVUB 1QC5A 4LF5B 1Z2CA 3AFHA 1PW5A 1I4EB 2GNOA 2C9DA 2BGMA 1Y4UA 2KHZA 3ABOB 1HNZB 1ZL0A 3PFWO 4AMUA 1PBTA 1J2UA 3R8CA 2MR6A 2WWYA 3PGJA 2JFZA 4K9MA 4QICA 4FYVA 5LWHA 5C80A 5HP4A 2GN1A 1NFFA 2DG2A 4IVNA 1NW9B 3NBXX 5B30A 4OK5A 4BNGA 3FJYA 3KJHA 3CUWA 3C3JA 1AHNA 1DB3A 2OKCA 2B21A 4JU9A 4QUJA 4NCKA 3MB8A 5ARDA 3ZIDA 1NOIA 2A7QA 3WIBA 4EFMA 2JJQA 2A58A 1VG0B 2VVTA 4WESB 3PRHA 4P3XA 3HLKA 1D4ZA 3WB2A 1GCUA 3PXAA 3W06A 4C2TA 2YJ4A 1Y6FA 3A4TA 1CQPA 3T99A 2FSGA 3C4QA 1IYZA 5JVDF 5LXTB 4DMHA 1LVGA 4IIFA 4OQMA 2OK8A 1XXHA 3I42A 4YRQA 3EZNA 4HUJA 1CJTC 1JDZA 3ITDA 1MRNA 2HO5A 1VYVA 5D00A 3O8DA 3ACDA 2PUFA 4I46A 1IONA 5CT9A 1KAOA 1ZK3A 2QVGA 1GM5A 2WINI 2BE7A 3OZ7A 1U02A 2VJBA 1E5TA 3S2SA 3LY8A 3ZCRA 4NJOA 1T5BA 4WJKB 2NSLA 1KJ9A 1SVWA 3WHKA 1WXXA 1ECFA 2DY0A 2IVZA 3W3AH 2WT4A 2J6IA 4L0QA 1I10A 1EPUA 4QYIB 3HKBB 2AXEA 3QLTA 2AR9A 1JDVA 1HOTA 4ZC1A 5GJWC 3SHQA 3BHIA 2I6QA 3TL3A 3IOEA 4EKGA 2A9VA 1K92A 1M74A 1ODKA 1W0JA 2H9AA 3T7JA 3FTNA 1R9NA 2NUBA 3FGPA 4I9GA 2XEXA 4IMPA 4U2KA 5TQ2A 1S7GA 3TLMA 2X1LA 2RGEA 2FGKA 3EJWA 1P2BA 1JI3A 3GGOA 3VPHA 4F2GA 3TD6A 1HT1E 1LC0A 5ALEA 4A7PA 4BNYA 4CT0A 1KZGB 1JYFA 1FUUA 5K0BA 1RKQA 2C92A 3LWBA 5DCWA 3WZLA 1DC4A 3A1FA 4XYMA 3BAZA 3IIKA 1XPJA 3E53A 8ABPA 3IP8A 4IMJB 5JO0A 4IJKA 1XKLA 1QH1A 3PF8A 5CVDA 4N5HX 3L92A 1FJXA 2YV3A 1TQDA 3V4RA 4CFSA 1I3CA 3G9QA 1WHSB 2WD7B 2I2XB 5CTAA 5B6PA 1S8OA 5FBRB 2ZCVA 3K6KA 4GU5A 1N6RA 2FLWA 1IEQA 4LQLA 2VK8A 1JG7A 1LNQA 4KMRA 4Q7JB 1TO2E 1K8YB 4XQGA 1G18A 2B8WA 2G71A 1W581 2R7MA 1KO1A 3H83A 4OXKA 2Q29A 5A4MS 5CDUA 3GLIB 1P6QA 1D2AA 4LHWA 5A5GA 2O9JA 5KQMA 1YJQA 4AROA 1RWWA 2Y4OA 2YHAA 5AK5A 1KAMA 2CNOA 2PSJA 3AHEA 2Q27A 1VBFA 5FOTA 1H1DA 2CMDA 3KPYA 5HKOA 1SBIA 2CL6X 2YWDA 4UAUA 1Z5NA 4QJBA 3LWZA 4JT4A 2QLFA 5CJPA 5HEKA 1V7CA 3FJOA 4D8XA 4RHCA 1ZC4A 5BR8B 3HO1A 4EI2A 3A4NA 1JIIA 3NTRA 3ESQA 3TECE 2WZBA 4FNAA 3A1EA 2RHTA 3FX2A 1NI5A 3UICA 3AU8A 5T4EA 1L4GA 2HUNA 1E8NA 1KVRA 1MAHA 5JC8A 1GADO 4HVCA 1GU1A 5ED0A 4JJEA 2YV1A 2X9VA 1OX5A 2N46A 4M0FA 4BV9A 1Q77A 1USKA 1D9ZA 1S2MA 4FMCF 3ZHVA 2V5VA 3R6TA 4M1KA 5EIBC 3MUFA 1XK7A 1IZ9A 2LPMA 3L8FA 3ADCA 1O9BA 1OXBB 4L76A 4GS5A 1SCKA 4TV9F 4BFCA 4V0ME 2XTAA 1GXSA 4KXNA 4A3SA 5FTLA 2OCBA 4NULA 1KEEB 2HJVA 1Y3DE 1R12A 4TT3A 2PO7A 1FDSA 5ECGC 1I4OA 3FHLA 3PEWA 2C5LA 1XVTA 4RH3A 4N3GA 1P1RA 5E95A 3IEIA 4CM9D 1OZAA 3ZUGA 1X8JA 4YPVA 2AOUB 3JQBC 1XLVA 5JHGB 3KOOA 3IKTA 5JAPA 5IEJA 4ZQIA 4NONA 4TLLB 3X2SA 2O8EB 3E23A 1ONBA 3FNBA 4HGYA 4WOKA 3VR3A 1Q20A 1R0YA 4A5SA 1E9VA 1KYVA 2R00C 1SBYA 4O2RA 4TYPA 2FDRA 4E5DA 1W36D 2Q6KA 2OXIA 3GPBA 2UZ3A 4WT7A 5KQLA 1XL1A 5T64A 2XH8A 3H2IA 3F96A 3W1VA 1L5ZA 1K3FA 3B3QA 1E2FA 5F3WB 4BE9A 2C9CA 5AVOA 4U7JA 3EC2A 3ORFA 2O8CB 1BU5A 1YDFA 2C9YA 2PUHA 1GU7A 1VKRA 2VAMA 4IDHA 2ZWPA 1JHPA 1F8XA 3LLCA 3ER9A 3WFIA 5DBOA 1WVGA 3DVLA 4N5IX 3MOSA 2A9OA 3N2YA 4NV0A 1T1SA 4R9UC 5FUBA 5FH9A 1SMKA 1YI1A 3WRYA 4YDHB 1DJLA 5AJHA 3OE4A 3EGVA 2ZM5A 3BZBA 1V26A 1KJJA 4FXPA 1RRCA 4WE3A 3PC2A 4MJ3A 1GPLA 3DBLA 1T6ZA 2QR5A 1SXIA 4AQYB 3ON5A 4OP3A 3DT9A 1OIWA 4NOKA 3VMMA 1LK0A 5BMVF 3K4PA 4OGKA 3D81A 2FH5B 4B9AA 5IJZA 2C9BA 2I7CA 2ZQ5A 4GZ3A 5KYYA 3ICVA 2AFHB 3RUEA 1YZYA 1TLFA 5JJ5A 1QV7A 4TQ9A 4CCYB 5MGBA 3B12A 1FBNA 4RULA 3ND6A 4CKBA 5ILQA 4PO3X 5HKBA 4Z9BA 5AW6A 1I1QB 1RMYA 4Q18A 1SURA 5JH7B 3WIOA 3HU3A 3G7UA 2PMFA 4B2PA 4OO3A 5IT0A 4TZ0A 2XDWA 4Q4HA 4RVSA 1O77A 1POXA 1PHRA 3MWDA 4DCMA 3IUQA 3PFIA 3PHLA 3ANNA 4WNYA 1YCGA 3TLZA 2A88A 1G17A 1GILA 1VRWA 1Q19A 2VSQA 2YYSA 3B1ZA 3GFBA 5BO5A 2X9QA 4KQIA 3NBQA 1IJKA 1THZA 4FNOA 1UDCA 2DHDA 4CIDA 3QELB 1JE0A 2J0QA 3NTXA 4G5GA 3B3JA 1CRLA