3WNQA

Crystal structure of (r)-carbonyl reductase h49a mutant from candida parapsilosis in complex with 2-hydroxyacetophenone
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
335
structure length
335
Chain Sequence
SIPSSQYGFVFNKQSGLKLRNDLPVHKPKAGQLLLKVDAVGLCHSDLAVIYEGLDCGDNYVMGHEIAGTVAAVGDDVINYKVGDRVACVGPNGCGGCKYCRGAIDNVCKNAFGDWFGLGYDGGYQQYLLVTRPRNLSRIPDNVSADVAAASTDAVLTPYHAIKMAQVSPTSNILLIGAGGLGGNAIQVAKAFGAKVTVLDKKKEARDQAKKLGADAVYETLPESISPGSFSACFDFVSVQATFDVCQKYVEPKGVIMPVGLGAPNLSFNLGDLALREIRILGSFWGTTNDLDDVLKLVSEGKVKPVVRSAKLKELPEYIEKLRNNAYEGRVVFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unconserved substrate-binding sites direct the stereoselectivity of medium-chain alcohol dehydrogenase
pubmed doi rcsb
source organism Candida parapsilosis
molecule tags Oxidoreductase
molecule keywords (R)-specific carbonyl reductase
total genus 100
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wnqA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3wnqA01
3E48A 4DC1A 1IUKA 2ZTLA 2WD7B 3M1AA 3AOEA 4J4TA 4GX0A 3I23A 4R9RA 4RJTA 3A06A 3MWEB 4OYRA 1NVGA 1GPJA 1PL6A 4W7HA 5FI3A 5JAMA 5B4UA 3H5AA 1JDJA 2BLLA 2QYSA 5TC4A 2AMFA 3UAGA 3QV1A 5JCJA 5CHEA 1TB4A 1YDEA 2X1HA 3RROA 1DRVA 4Q3CA 4YT4A 3UXYA 3R1IA 1SNYA 2JD2A 1ZMOA 5T64A 5K9ZA 1H6BA 1IZ0A 2PWZA 4UVEA 4JBIA 3ROMA 4DWVA 4QO7A 3KV3O 4J9UE 2WDZA 5A3VA 3RFTA 4CUZA 2DUUA 3ZWBA 1KVRA 3BMNB 3C1OA 2BGMA 3JYOA 1BVRA 4BVAA 2G0TA 1D3AA 4K1LA 4OJNA 3TL3A 4D43A 4X54A 1GUYA 1BXKA 3VHRA 1I3KA 3WFJA 3ZHZA 4A73A 3GHYA 1Y6JA 4ZQHA 5TNXA 2P91A 3PXXA 4HFNA 2ZK7A 4PG8A 3SJ7A 5AOVA 4O6VA 1I2BA 2ZTMA 4FS3A 1B8UA 2V6GA 3K6JA 4U5QA 3ZV4A 3KYDB 2NVUB 4QFDA 3INGA 1GYRA 5IFLA 4YJFB 4A5OA 1EE9A 2X5KO 4AJLA 1A7KA 3O8QB 1VSUA 4TVBA 5IJZA 3ZW9A 2GO1A 4D46A 5A02A 4BNFA 2P68A 4U8GA 9LDTA 1NASA 1PJBA 2FR0A 2EW2A 6LDHA 3PHIA 2YJZA 1D8AA 3P2OA 4YQZA 1PTJA 1Y8QA 3QRWA 4NFYA 1PJ2A 5C3MA 2BD0A 2Y0DA 1ML3A 4AJHA 1DOHA 3I9LA 3JQEA 4IJUA 3FPLA 1P3DA 3GAZA 3H3JA 1F14A 1ZXBA 1PJ4A 1ZNQO 1R4MA 1GL3A 1LUAA 3CSDA 1X0XA 1T2CA 3LC7O 4IQ8A 4L8VA 3DMTC 2AEMA 4XYGA 4ZQEA 1NFQA 3EK2A 3LF1A 5CFZA 4A7PA 5I9MA 4CMIB 4N7RA 5F3RA 1SB8A 3WIEA 1X1TA 4YWJA 3ZNPA 3L6DA 4J7CA 4XWYA 4QO8A 4HFMA 3M2TA 1D7OA 4PFJA 4A2CA 2HAEA 4B7UA 4JN6B 4IBOA 4DREA 1XSEA 3NDIA 4CLOB 3OA2A 5DOZA 5AXCA 2Q2QA 3WJ7A 1HDOA 3JQFC 4WOKA 4FC7A 1QYCA 2EJVA 3CE6A 4RVDA 4CMGA 2W90A 1KEWA 5TIIA 1ULSA 3IQDB 2AXQA 2IEBA 4HNHA 2Y66A 1XG5A 3H9JA 2OP0A 2DTDA 4FQ8A 3ZCXA 1E3LA 1IYZA 2YYYA 2X86A 4R5HA 2NU7A 2O2SA 1T1SA 3AW9A 4OO3A 4RPGA 3W4KA 1DIHA 5T5QA 4RQUA 2XOXA 4IS3A 3RI3A 1BXZA 1MUUA 1ONPA 5B12A 4NBVA 1DJQA 3RKUA 1Z74A 4ALLA 3GH3A 4FSHA 1C1DB 4YJHA 4ZQBA 3NT2A 2PK3A 3JQAA 1LSJA 2VRBA 4EYEA 5KKAA 1G6KA 2DFDA 1U2DA 1WDLA 3F1KA 1PWXA 3FF4A 5DN9A 5EN4A 1MXFA 4JJGA 2GERA 4YR9A 1LDMA 3E9NA 1YVEI 3DAFA 5I8ZA 3VOSA 4BV9A 1W4ZA 5T8KA 3DONA 1NQ5A 2I99A 5F1PA 3PGJA 4BKPA 5B4VA 1FMCA 1ADFA 4ND5A 5A3JA 2VWQA 3UICA 1PS9A 3ZWVA 5KNLA 3R3JA 4CM1A 1DLIA 2IZ1A 3UCEA 1MA0A 1V3VA 1ZEJA 5I8WA 4Q3AA 3EYWA 4ID9A 3BTUA 1IHYA 1N7HA 4DA9A 1UAYA 4BKOA 4PRLA 1YB4A 3EC7A 4N5NA 1PZGA 1UR5A 1NHGA 2X0IA 4RVUA 3JYLA 1S6YA 2PNFA 1SAYA 4EW6A 4B79A 5LDHA 3E1KA 4Y6SA 1BTOA 1WAMA 2OXIA 3PWZA 1GUZA 4R1NA 3LLVA 4B4OA 1KY4A 5G0VA 2GASA 2PKQO 1LJ8A 3PI7A 3V1YA 5K6AA 2V65A 4G65A 4RV9A 3ZWPA 4WKGA 5EQFA 4BO9A 3ZW8A 5T8KC 2FPIA 4KTTE 2BH9A 1DIRA 4MVJF 4AJIA 2EKQA 2O48X 1CF2O 3HFGA 1IPFA 3S2IA 2G82A 1K0UA 3HQ4O 4NJMB 2PD6A 2C20A 3NKLA 5G0UA 2VNSA 4DBZA 1GV1A 4G5HA 3STHA 4PLCA 4M49A 3SBOA 3BA1A 3A9WA 5A9SA 1JVSA 1GEEA 4DTIA 5BQFA 2ZQZA 3JQCA 3KEOA 2Y1EA 3DEYX 2P5UA 2NWQA 1UZNA 5TLSA 1B3BA 4KQXA 1KVQA 2O23A 2VOEA 1LEHA 1VJTA 2R6JA 3ZWNA 5CPBA 4HADA 3QVWA 1MFPA 1PWZA 1ISIA 3I6IA 3PTZA 3GDOA 4FW8A 4IPTA 2P4QA 4RF2A 3TRIA 3EVNA 4JBGA 3VH1A 4NBRA 3SC4A 2X7HA 3OIGA 4BNKA 3ZWYA 1P31A 1Q1NA 3QW2A 2HRBA 4LRTB 4EEZA 5G2OA 2YDXA 3UF0A 2EHDA 4LMRA 5DBFA 3QIVA 2Q49A 3RJ9A 1WW8A 1HDGO 4JGBA 2RBEA 3GEGA 5IZ4A 3WGIA 5L53A 2CVQA 4JP3A 3WQSB 3F6YA 2Q1WA 3F46A 3E82A 4IY1A 5KJ1A 1NQTA 3AUTA 3WMXA 1NAHA 2B4QA 2O3QA 3HNPA 3DBRA 3MCVA 3H5NA 3RIHA 1DFIA 4WUVA 2WYUA 5JYEA 1GR0A 4PLHA 2HK9A 4DRYA 1Z6ZA 2JJYA 1ADCA 3D5TA 5BSFA 3P5SA 3EZLA 1ZK0A 2EJWA 3HWRA 2EGGA 1MLDA 3WGHA 3GEMA 3K2BA 7ADHA 1ZEMA 2ZYDA 4H3VA 3LC2O 4GAEA 4PVDA 1SB9A 3LF2A 2RH8A 3S55A 3DHYA 5JO0A 3WGZA 4ZICA 4OOEA 1IY8A 3SVTA 2JD1A 3DAPA 3U4DA 3F9IA 2OO5A 4RF4A 5GZ1A 1Y8QB 4PGFA 3GQVA 4PZDA 1H2HA 3H65A 2EG9A 1P74A 1Z45A 3ASVA 3QA9A 1VJ0A 1E7SA 1P0CA 4NFSA 1ZBQA 1LSOA 4ILKA 5KTKA 1B14A 1FDTA 2AEJA 2TMGA 2V6FA 4P4NA 4PVCA 1R12A 3RUAA 4NBUA 5BNIA 2XPCA 2W2KB 1BRMA 1C1DA 1IL0A 4XB2A 4OXYA 1NVMB 3O26A 2UVDA 4R51A 4U6SA 4I5FA 3HB5X 1BW9A 4A26A 4TZKA 3Q1LA 4R01A 5KJFA 2VHZA 3F4BA 4IJKA 4MOWA 3GG9A 1I2CA 4BHTA 3W8DA 3IAHA 1ZK1A 1ZSVA 4Q9NA 2EERA 2CDCA 2NV6A 1X7GA 3GRPA 1AXEA 4LVCA 4E2WA 2GDZA 2I9PA 1LTHR 4HBGA 4WLNA 2H9IA 4ZD6A 1LLCA 2O4UX 2PD3A 2Q3EA 4OXNA 1YRLA 4WASA 4Q3DA 4F46A 3RUEA 2GD1O 3VH4A 4YRDA 4PZEA 1C0IA 2CDBA 2WYWA 3ZHYA 1I30A 3G1UA 5JMWA 3FI9A 1E6UA 1QV6A 4TWRA 4YJGB 2ET6A 1JAXA 1ARZA 3GT0A 1FDWA 4DVJA 3P2YA 1IHXA 1NFFA 1PZFA 2VN8A 3OEWA 1WP4A 1MX3A 3FRJA 1KBZA 4ZJUA 3I9NA 1HE4A 3C7CB 4JROA 4YCAA 4WCFA 1YB1A 2A35A 5I7EA 1R4MB 1TXGA 3ROQA 3DBRB 4AL4A 1GZ3A 2IODA 2VRCA 4L4SA 1H2BA 4ND2A 3UGKA 2VRCD 1BDMA 2YDYA 2W98A 3KYBA 4NNJA 2D59A 1XIVA 2P9EA 2JFHA 2DVMA 3IP1A 3HDYA 1U5CA 3KUXA 3DBHA 2HK8A 3OBBA 5EESA 1B8PA 5COBA 1E0DA 3DOCA 1GD1O 1KS9A 5GMOA 1V8BA 4MP3A 2EXXA 3IKVA 3DBLA 1O94A 3WJAA 5TF4A 1VL8A 4GWKA 5A04A 5B4TA 4BQPA 1Y1PA 1SCUA 1UXJA 4RPLA 1U4SA 3LLSA 1E5LA 3MOGA 4YDRA 5JC1A 3M6IA 3DOOA 4AJJA 4CMBA 1N5DA 2QRKA 1R0SA 2I76A 5U1PA 4BKQA 1HTBA 2DPHA 2X9NA 2O3UA 1FJHA 1WMBA 3IUSA 1PZEA 3H2SA 2DBRA 4R16A 2EW8A 4E2YA 9LDBA 2DBVO 4J6FA 1U9JA 2OUIA 1NPTO 1YGYA 4UUPA 1DC4A 3K30A 2NTVA 1M66A 2HMUA 5BNFA 4OAQA 3GVCA 1EQ2A 3ASUA 4NBTA 1KVTA 5F5NA 5IDWA 4YA6A 2X9VA 3KEQA 2QHXA 4XYMA 3BTVA 3GVPA 1EVYA 3IS3A 4CQLA 3TZHA 3D0OA 2Y0EA 1XGKA 4J90A 3VAZA 4A10A 3WG9A 4EJ0A 4RDHA 1T2EA 2Q4BA 3FD8A 2AQKA 5DF1A 5EINA 3MJSA 5G0TA 2JHFA 1HYGA 2C5EA 3KHUA 3OMLA 4D3FA 3JYPA 1JKJA 2ZYGA 3PQDA 4JXKA 3HFSA 4CLRA 1XYGA 1RJWA 1O8CA 2NVUA 1Q7BA 4XGKA 4QX6A 1B15A 3AOEC 4Z9FA 4CV1A 5JSFA 2NU9A 4DC0A 2A4KA 1YXMA 3JQ9C 5A9RA 4QECA 1QYVA 1PJQA 5TS3A 5A5EA 3GNQA 3PJEA 1X7HA 5T6BA 5JCJD 3LQFA 3QVXA 4XGNA 3RBXA 1LRLA 1YO6A 1O5IA 1AHIA 5DDIP 1KVUA 5ADHA 2DC1A 3PHGA 1YH3A 5KWEA 4J2HA 4URFA 2BFOA 4B7CA 4BL5A 2CVOA 3K31A 4QTZA 1M2WA 4WPGA 1B16A 3GVHA 4DUPA 1M67A 4LISA 1TVEA 3ONFA 4UVGA 4XJSA 1XELA 5ICMA 1B26A 4ZVVA 4J4BA 5TJHA 1GYQA 1X1EA 2J8ZA 1NR1A 4IQ0A 2CUKA 2D0IA 2ZTUA 4FFLA 1R4NB 3SJUA 3EUWA 1B0AA 5KCZA 4XR9A 1YQGA 1OFGA 2J5RA 4A0SA 2PLAA 1PSDA 4XA8A 1YOVA 3TN7A 2NTNA 3PZRA 3W6ZA 5JFOA 3AM3A 2BI7A 1P1HA 2RHRA 5F5LA 5LC1A 4BO4A 4KUEA 2JFGA 4PLFA 3CZMA 1G1AA 4BNLA 5CDSA 3WLEA 3Q2KA 3GMDA 3TSCA 4J2OA 3QWIA 4NBWA 4WE3A 3TFQA 4II2A 1FDVA 1QRRA 4A03A 3NGXA 1RYDA 3BIOA 3ZU5A 4MKZA 1KOLA 1W8DA 2O7SA 1Z7EA 2VYND 3OF2A 1PJSA 1HT0A 2JHGA 4BO6A 4E5MA 4Y6RA 2DUWA 1T4DA 3FTNA 3AUSA 3RC1A 2CVZA 3PIIA 4Y9DA 2Q2WA 4CUKA 4DMLA 4GX5A 5L9AA 1PU2A 1Y7TA 2DLDA 5IF3A 1I10A 5THQA 1C0PA 4RCVA 4CLEA 3PIDA 3WIDA 4CM6A 5G0WA 4UUMA 3H5RA 4YBZA 1O9BA 2FSVA 2HCTA 4K26A 1U8FO 4TRRA 2BGKA 2IEDA 2DM6A 3GUYA 2AEFA 2POQX 1SEPA 4NMHA 3PYLA 1LDYA 4CV2A 1LA2A 4A27A 3H4VA 3MTJA 3RU7A 3GHHA 2B35A 3V2HA 4AJPA 1FK8A 3N74A 1AUPA 2BGLA 3GFBA 2YW9A 3PFFA 3WFIA 4ALNA 5CDGA 2O7QA 3NAQA 1D1SA 3H7AA 1BWSA 2Q99A 4BMSA 1SBYA 4RVGA 5I7FA 4GLOA 4BNYA 4B3JA 1NFRA 1ISGA 2B5VA 2VHWA 1O89A 2BFAA 1LI4A 1E5QA 3V8BA 2UUPA 1J5PA 2QG4A 1EUDA 1GEGA 4CMEA 3BMNA 1MC4A 1NPYA 3ZDFA 3JQGA 3S1LA 1UDCA 2BMAA 4FC6A 4TKMA 4AJNA 1Y5MA 4BNNA 1H93A 4EGFA 4OKNA 1DXYA 1Y9EA 4GLLA 2FSSA 4KDEA 1FDUA 1E3SA 1PL7A 2C29D 3A4VA 4R4JA 4YQYA 4ESOA 1MC5A 4LCEA 3BMQB 4L9RA 3ZWXA 1DDOA 1M75A 1P33A 1NHWA 2QYTA 2DTXA 3RAJA 4MDHA 3MOIA 3JQAB 4LK3A 2LDXA 3EDMA 3GN2A 4BGIA 2ZJ1A 4YXFA 4GX2A 5JY1A 1HXHA 5AXDA 3MTGA 5A4DA 4XEHA 2JL1A 1ZK4A 4Q3BA 4CMIA 2HJSA 1ZJZA 3VPSA 3VH2A 1ONNA 2FRDA 4EUEA 2Y1FA 4AG3A 1HETA 4UULA 2WE8A 2OL4A 1CIVA 2J6IA 3Q9UA 4GKBA 4MVJM 2G76A 2DFVA 5TT0A 2H1SA 5EERA 3NEPX 1NXQA 3VPXA 3GA0A 1CERA 1DHRA 2YQ4A 1A7AA 3I5MA 1OMOA 3WWZA 2VCYA 1D4FA 4HP8A 4KWHA 5L4LA 2QX7A 4OL9A 3KSUA 4GPD1 3UW3A 5KJCA 4AVYA 1E1MA 4XRGA 4P4LA 2VOJA 2P9GA 2Y1GA 2Y0CA 1VSVA 4LSWA 5ILGA 4UUOA 3LT1A 1QYDA 1G0NA 4J1SA 1C1XA 1WVGA 1KVSA 2AG8A 3G3EA 3H3FA 3I9JA 3KYCA 2Q1SA 4NHEA 5A06A 3D3EA 4FFNA 4GWGA 5CP8A 4YTEA 4WJZA 3WXBA 1KETA 4B8ZA 6ADHA 1K6IA 2NUAA 4FFMA 3D4NA 5C7IO 4J4HA 3ANNA 1EQUA 1QLHA 3FHLA 1U3TA 2X58A 2H6EA 1PGJA 1A71A 1R0KA 2G1UA 4RF5A 5K0ZA 3ZV5A 2B69A 1HE3A 3RKRA 1LU9A 4BNTA 2GSDA 4Y67A 4BO5A 1PR3A 1TT7A 1HDXA 2GF2A 5TX7A 2NSDA 1QP8A 4I5EA 4EEXA 3TZKA 2OGUA 2J3KA 3TDKA 3SEFA 4E2XA 3SXPA 4MP6A 1U3VA 1PS0A 1ZSYA 3EVTA 2PZMA 2ZB7A 3TQHA 1NYTA 2PGLA 3L6EA 5ICSA 1B8VA 2ILTA 2V6MA 1A4IA 3M2PA 2BFPA 2EGHA 5A9SB 4IDFA 1UZMA 5HA5A 3FWZA 3KO8A 1DFGA 3EAGA 3ONDA 3JQ8B 4NFHA 4TMFA 1E1LA 4QSMA 4YACA 1Z73A 4RQTA 5JCXA 3ZZNA 1N9GB 2WYVA 2WSBA 4CPDA 1X15A 5ES3A 1CEQA 4XCVA 3GPIA 5JPIA 2QRJA 4UVHA 1SOWA 4R5MA 1MGOA 1DC6A 4XR4A 4O59O 4GMFA 4NDNE 5IZCA 3JV7A 2VNAA 3GGPA 1ZIDA 4CMKA 4MO2A 1U1IA 4GI2A 3PHHA 3H8VA 4E31A 1VRWA 3SLKA 2AQHA 1VL6A 5DP1A 3JQFA 1I01A 3OQ6A 3JQGB 1ISFA 3KB6A 4J9VA 5IXYA 3L9WA 2CY0A 1X13A 3MJCA 2V6BA 3W8EA 1B3RA 4N18A 1TI7A 3PQEA 1FXSA 5JDIA 3ZI0A 1R6DA 4P22A 5FFFA 3JQBC 3NRCA 3QWAA 4XQGA 4BO0A 2AA3A 1TA4A 3DQPA 2VZ9A 2HO5A 4AJ2A 2W8ZA 4GKVA 1A9YA 3SLGA 3PJFA 1KERA 4H16A 3GR6A 4YJHB 4YAEA 3T4EA 4I9NA 1HF3A 2NACA 3QHAA 4IDAA 4WNCA 3DO5A 3RBZA 3WX0A 1YB5A 4L73A 2JKVA 5IZCC 1HSZA 4XDYA 1HYHA 5HS6A 1RM4A 5AQ1A 1PIWA 3BHMA 4ZN6A 3BAZA 3GRKA 4ND3A 3GDGA 4IUYA 1GADO 1I36A 4OQYA 3KXDA 4Z0PA 4ZQGA 5T57A 3ORFA 3V2GA 3L07A 4BNGA 4M87A 4ALJA 3DTYA 4OIMA 4GH5A 1F06A 3NJ8A 2ZTVA 4RZIA 3S2EA 3WSWA 1QKIA 2DT5A 4Y6PA 1V6AA 4IJVA 4BIIA 1PGQA 3ZHXA 2ZB3A 3JCZA 2FWMX 2ZJ0A 3RUIA 4M86A 3OH8A 3L6OO 4NR0A 5EMHA 3KLPX 1KC3A 3PYXA 1QMGA 3U49A 8ADHA 4YAIA 2VT2A 3AY3A 4CV3A 2HMVA 4CUJA 3Q3CA 2E4AA 4WLFA 4JLWA 4HV4A 5FWNA 3QVOA 1H6AA 3JD3A 4J7XA 2HSDA 3Q9NA 4GGPA 4MKRA 3T7EA 3WGGA 4LRSB 1OZAA 2WEKA 4IDDA 2IE0A 4RLHA 3BMOA 3WNVA 3ZNQA 1NQOA 4GL4A 1HWYA 2AG5A 3IUPA 3ADOA 4YT5A 2X0JA 2F1KA 2EV9A 3JTMA 4PLPA 3G1TA 3C8MA 3UFXA 5AYVA 4Q3EA 4HKTA 4NJOA 4ZHSA 2Y68A 1HEUA 4ONEA 1ZK3A 3NV9A 1RM0A 4K9DA 3PQFA 5JBIA 3DZHA 1L1FA 4L4XA 1XU9A 3O9ZA 1DAPA 4ALMA 1H9BA 1ZZEA 3JYQA 5CG1A 4JJIA 3RUHA 3TWOA 1I3NA 2CSUA 4EBFA 4CMAA 4EUFA 4YPOA 3PFWO 5JY6A 3PRJA 3CH6A 4CM4B 2FY8A 4KWIA 3C3XA 2WWRA 3EMKA 3L0DA 2C82A 1EE2A 3PLNA 2W2KA 1VPDA 4MJLA 4FJ1A 3ANLA 2JCVA 4MVJP 4OSOA 4IMPA 5DT9A 2I3GA 5L95A 4PLVA 3PVZA 4JIGA 2PY6A 1EK5A 4K6FA 2ZKLA 1L7DA 4EZBA 3U62A 1WZIA 1UZLA 1ENZA 2VHXA 5HS4A 4TRMA 4ZGWA 3PPIA 5L4NA 3RSHA 1P1JA 1EUZA 1T24A 1PEDA 2OP1A 4UVDA 4BKUA 2W4QA 3ETGA 1LX6A 1H6CA 3R3SA 4HFRA 4HUJA 4DYDA 1PZHA 4C7KA 4BB6A 4WNIA 4MVJH 1HL3A 4NIMA 3KLMX 3WTCA 2WM3A 3R0IA 3DZIA 3BMCB 5A9TA 1HDRA 3MJ4A 2QIOA 3ONEA 2GRAA 5DCUA 3JQ7A 3OFSA 5KIAA 3MJTA 4GX1A 2GPTA 5CDYA 3NDRA 1SZJG 2GNAA 4ZRMA 1C0LA 1ISHA 2D8AA 4Z3DA 4CLHA 3HG7A 3GEDA 1LC0A 3AU8A 2WD7A 3L4SO 5THKA 2QZZA 3CTMA 3W1VA 4CLDA 1HDYA 4E32A 3D3WB 2W2LD 2GYYA 5DBGA 5KOIA 1RM5A 4QQRA 3T7CA 4DGSA 4XYLA 4TVOA 3ZNOA 5IN4A 4K28A 2EIHA 2HUNA 2R2GA 2A9FA 3PK0A 4G81A 4M89A 1ADBA 4E13A 2C7VA 4OGWA 4CM9A 4CL8A 1DJNA 4B4VA 4GSKA 3TFOA 4CM8B 2XAAA 2FZEA 1U3UA 2Y93A 5I9NA 1EVIA 4IDEA 1O95A 3H2ZA 1H0KA 3G49A 1J0XO 4IDBA 1GV0A 4DLBA 3QY9A 5JXWA 3N7UA 1M76A 5MGBA 1DC5A 1WPQA 3ZWAA 4YAKA 2VYVA 5JDIC 1XKQA 3CXRA 4CQMB 4K6CA 3I4CA 1XQ6A 3MJEA 3LVFO 3RVDA 3I4FA 3ZN2A 1OI7A 1ID1A 4DPMA 4E5YA 1Q0QA 1V3UA 1ENYA 5JLAA 3NJ4A 1WLYA 2CF5A 1BXGA 2GN4A 1CYDA 2GLXA 2XXBA 1T2FA 1TLTA 4I5DA 3F1LA 1Z75A 4B7XA 2X0NA 3GG2A 1G0OA 1IPEA 5L45A 4E30A 1VKNA 1XR3A 1PR9A 3P7MA 1DC3A 2VQ3A 1YKFA 1LLQA 4NJMA 4AJ4A 5L4SA 2P9CA 3UVEA 1F8GA 1DFHA 2BI8A 2Y1OA 1DRUA 5L7YA 1E7WA 4RVSA 4R54A 1YQXA 1MG0A 5ITVA 1HE2A 4YEDA 4CR7A 1NBOA 3LSYA 1DB3A 4E2ZA 1M6WA 4ITUA 2OMEA 3UCXA 1XCBA 4B4UA 3K5PA 3OJOA 2HKIA 4JNKA 2D5CA 1I24A 3KYCB 4PLYA 5JW6A 3OECA 3H9GA 3NYWA 4YAJA 4LSMA 3VZQA 1EFKA 1P1FA 3QP9A 4CM7A 5L3ZA 1KEUA 3I52A 2X6TA 4IGFA 4IJWA 3GF4A 3RD5A 3K73O 1BSVA 1GDHA 1XEAA 3U4IA 4NZ9A 1EDOA 3UCFA 2PV7A 3CEAA 3M1LA 2NQ8A 4XYBA 3B1KA 1XHLA 1JW9B 2GZ2A 3W6UA 4RGBA 4W7IA 3ENKA 4JBHA 4H15A 3F5SA 1JTVA 2Q46A 4UEOA 1ZVMA 4P4GA 4TRNA 3HHPA 3KTDA 4NK5A 5COAA 3UKOA 1PL8A 4CR8A 1LDGA 1EZ4A 2YV3A 2HLPA 2C7GA 2D2IA 1GFSA 3INRA 2FMUA 5L7WA 4IQGA 5DOVA 4BGVA 5CDTA 4D0SA 1PJ3A 3A14A 3E6AA 3CZRA 2NU6A 1UH5A 3OJ0A 5CG2A 3AJRA 5IDQA 1F12A 2A92A 4DQUA 2NLOA 1I32A 2C59A 3WYEA 1NQAO 4AFNA 2F00A 1RWBA 1HRDA 1LLDA 2YUTA 3IIEA 1RKXA 4XQ9A 1K89A 3OP4A 1EVJA 3GMSA 3Q6IA 2JAHA 2IYOA 1A5ZA 4NH4A 4OSPA 4I8XA 3ZU4A 4LVUA 4YYZA 3OJLA 2IXBA 4LGVA 1LNQA 2VWPA 4HX5A 1Q0HA 4ZRNA 4JJFA 3C1TA 3GZ4A 1ZKMA 4C4OA 2J5QA 2OZPA 3VZRA 3WLFA 3GC6A 1QORA 4J0EA 1L7EA 2VYNA 4RPJA 5A05A 4J91A 1ZMTA 3F3SA 1LDBA 3LT2A 1ONOA 4DLAA 4BQRA 1E3IA 3CPSA 2GR9A 3OICA 2Y99A 2CDAA 3B20A 3D5QA 3DHNA 4BNIA 1X14A 3QVSA 1CDOA 3ON5A 4EJMA 1Y9AA 1QXSA 3DMTA 1QSGA 4MVJA 4XD2A 2C54A 3DBLB 4RL6A 2IDZA 2YHIB 4CQLB 3P19A 2UAGA 5IAAA 5I7SA 2VZ0A 4YAGA 1LDNA 3ANMA 1DBVO 2NU8A 3AWDA 2VTDA 3GK3A 1K3TA 2HMSA 3NT5A 4D3DA 4YT2A 3BTOA 4IINA 3DOJA 2HK7A 1O0SA 2BELA 1HZJA 4KDFA 3NUGA 4FCCA 4WLOA 1HYEA 4R1SA 4D3SA 1QYWA 1CQIA 3ROPA 1YOVB 4BO7A 1I2ZA 1OAAA 1WZEA 4F6LA 3NGLA 2GUGA 3KBOA 1U7HA 4W6ZA 3FTPA 2FP4A 5BT9A 3WQQA 4BMNA 1GCUA 2O50A 3AI1A 3ICPA 3DL2A 3OQ1A 3DZBA 1E7YA 1Q2XA 2JCYA 2O2YA 4NI5A 2AHRA 3ZWCA 2IYPA 3FNGA 1T2AA 4IS2A 2IRWA 3RC7A 2Z95A 2VUUA 3TZCA 1U28A 3AI2A 5LDGA 3HDQA 5HTOA 3ZHBA 2YZ7A 3DZGA 3R6DA 3BYZA 4OKIA 2B4TO 4UAGA 4XX0A 1N9GA 3RU9A 2O3JA 4NG5A 4BUCA 3GZNB 1PQWA 1FDSA 5GZ6A 1CWUA 3ULKA 3DZJA 3JSAA 4NU6A 2J3JA 3PEFA 1UDBA 3FWNA 3CKYA 1R15A 5C37A 3O4RA 5U9CA 4YT8A 3KVOA 2JCXA 3IP3A 3ZWWA 5EPOA 3WDSA 1ORRA 2UDPA 4RLSA 3B6ZA 4PN3A 2FR8A 3PLRA 1ZO8A 1O6ZA 1VJ1A 1DLJA 2FN7A 1YBMA 5ER9A 4JQCA 1E3EA 3VC7A 1A9ZA 3KETA 2HDHA 4DQXA 2I6TA 4MIYA 1Z82A 5JDCC 4D41A 4L0QA 3G0OA 4CJXA 2VWGA 4EJ6A 2CZCA 3FCOA 3ABIA 5JO9A 3LT0A 4RF3A 1DSSG 4BS9A 3VPGA 1Y8RB 2WJPA 4E5PA 2C2YA 2Z1NA 4J3FA 5CEJA 3AI3A 3I9MA 4D44A 1VM6A 2ZYAA 3PP8A 5F1OA 1GY8A 4YJGA 4P8RA 1K6XA 3TF5A 2EEZA 3VVCA 1HSOA 4GVXA 5BR7A 3RC2A 1NAIA 4B8WA 2LDBA 5CEFA 1M6HA 3JQ8A 1V3TA 4ND4A 1CQJA 2C07A 2C5AA 1YE3A 4IIVA 1EVZA 3FR8A 3QE3A 3BXXA 4PG7A 5G4LA 3WYCA 3WYBA 1QYXA 2PTGA 1DAOA 1NNUA 4R1UA 5G4KB 1NWCA 4PZCA 5JDCA 2WMDA 3EHEA 4OXKA 3WGOA 2ZB4A 3GVIA 2IZ0A 3U4CA 1CJCA 4DMMA 4L74A 3BTSA 3D1LA 4Z3KA 5J23A 1YONA 3QVTA 2FZWA 4GVLA 1SOVA 4WLVA 2C0CA 1HDCA 4MPDA 5KJ6A 5G0SA 4S1VA 1ISJA 3QWBA 2EP7A 3CMMA 3V1TC 5HM8A 5TT1A 3VZPA 1B2LA 4KOAA 5KVCA 1SC6A 1LQTA 1EK6A 4M1QA 1BXGB 2EF1A 4N5LA 3N58A 1U2GA 3WB9A 4BNXA 4BO8A 1NR7A 4RDIA 2Q50A 4IDGA 2CFCA 2HRZA 1VL0A 4J1QA 4XIYA 4OHUA 4XIJA 4CQMA 3C85A 4INAA 4F3YA 1U5AA 3OEYA 4L75A 3PJDA 3WQRA 1LDEA 1C1XB 3TNLA 5FYDA 1DIBA 3DB2A 1P1KA 1U7TA 2ZCUA 4BV8A 1H6DA 3HZZA 1NM5A 1P9LA 3GNSA 3DDNA 1ZJYA 1ZH8A 1X7DA 3D4OA 1SO8A 2O3TA 5B1YA 4CODB 1U4OA 4CM9D 4FJ0A 4D7AA 4R69A 1E1KA 4F6CA 2PGJA 1JKIA 2PZKA 3JQDA 1MP0A 2Q2VA 2Y1DA 4RVHA 1TT5B 5L7TA 4M8SA 3FN4A 3WNQA 4FR5A 4Y8VA 4BMVA 2FPGA 1WDKA 2I65A 4XKJA 4WCFB 5L51A 3UH1A 5JYDA 4UREA 5AXAA 1Q0LA 1ZSNA 3TZQA 1T26A 4FBGA 1JU9A 3F47A 2B4RO 3OM9A 4MKXA 5HWSA 2QW8A 2VWHA 2WD8A 1Y5RA 1VC2A 1HLPA 4Z0HO 3UHAA 1R37A 5BSGA 3X2EA 1F17A 1IULA 4I9UA 4R68A 2EKPA 1ENPA 2FR1A 5BSEA 2PH3A 2PFGA 2J3HA 4TROA 1HKUA 5H81A 1AXGA 5DCYA 3ITDA 2DAPA 4YRBA 1YBAA 2X9GA 1ISMA 3FPCA 4S3MA 3HJAA 1GTMA 3EGOA 4FD3A 3ROKA 3LDHA 2YHIA 1NPDA 1UXGA 1DIGA 4ALIA 1BHSA 1GQQA 3OA0A 4IXWA 1A4UA 4TZTA 5JE8A 4FIZA 1BMDA 1HE5A 4D42A 4OQZA 1E3WB 5A1TA 1JKFA 2O4CA 4ZQFA 1E7MA 2B83A 3IDSA 3Q11A 1U8XX 3U0BA 2D1YA 3VTZA 5A5FA 4O63O 1LSSA 3F5QA 5G4KA 3B1FA 3LC1O 3HB4X 3RJ5A 4DIFA 1PJCA 3IMFA 1BVUA 3HDJA 5C7OO 4MINA 5GY7A 3IKTA 4XDZA 2I5PO 4AJ1A 1DHTA 3KRTA 1EBFA 2P2SA 1R16A 4PLZA 1UUFA 3BHJA 3DBHB 3K2EA 1MG5A 4UEJA 5EQDA 1D1TA 4HNGA 4PG5A 3MEQA 4JX8A 4WOJA 2VTEA 1UP7A 3JYNA 4N5MA 3B1JA 3FBTA 3OIDA 1R0LA 4PRKA 4CMHA 3H9EO 2OHXA 1P77A 1E6EA 4BNMA 3GOHA 4MP8A 1PJLA 4FN4A 3AU9A 4R41A 1YBVA 3RQSA 4CLXA 1MXHA 3RCBA 4OM8A 3FSRA 4EI2A 2DU8A 4KTVE 5BNTA 2R00A 1XLTA 4RORA 4WCDA 2E49A 5KVVA 4AJOA 3AUUA 3AK4A 1UP4A 2X5JO 3BHIA 1OOEA 2PKRA 3K9QO 4R9SA 3UOGA 5DZSA 1PGOA 3GY0A 3NT4A 2NM0A 1Q7GA 3FNEA 3IJPA 1YL6A 1PQPA 3IOYA 5JAQA 3TOZA 5DBIA 3AUAA 2SCUA 5C5IA 3BMOB 1KIFA 3U09A 2B0JA 2GZ1A 3TJRA 2P5YA 3D3WA 5GZ3A 1XWFA 4OOFA 3VZSA 4YRAA 2E37A 3WGTA 4BNUA 1GQYA 3EZYA 1GZ4A 5CDUA 2ZIZA 4O0LA 3LT4A 4WEQA 3DR3A 1N8KA 4FPXA 2HJRA 3V5NA 2VT3A 3C1AA 1YQDA 1V9LA 2ZCVA 5HBRA 1GYPA 1WWKA 4BNVA 4YJFA 3GLQA 3RUDA 1EEHA 4BNWA 5K1SA 1R4NA 2UV8A 4BKRA 3ST7A 2QQ5A 1GUFA 1E6WA 2GZ3A 3F4LA 3JQ6A 4GMGA 4IXTA 2H5LA 4UEKA 3AM5A 4C7JA 1GAEO 4CM3A 1IB6A 1BGVA 1Q7CA 2QRLA 3ENNA 3I1JA 4MVJG 1EBUA 3O03A 4OMUA 4R3WA 1E92A 1JWBB 2GCGA 2X4GA 1T1RA 4PG6A 5I9LA 4BNZA 4GBJA 3E9MA 5F21A 4DYVA 3OQBA 3ICCA 1PJTA 5FF9A 1KYQA 2CD9A 5JNLA 3C7DB 3FBGA 3WS7A 3H9UA 1PGNA 2IXAA 3O38A 1LQUA 3L4BC 4O5OA 4L4RA 3JD2A 4CMCA 1LBEA 1E7QA 2TMDA 3D4PA 2YY7A 4NQZA 4Q3NA 4RVFA 2AE2A 5DP2A 1K5HA 2AQ8A 3OHSX 5DULA 1H94A 2HMTA 3JQ9A 1C0KA 1XQ1A 3H6KA 1LXCA 4QFCA 2VYVD 3DC2A 4QEDA 3WMWA 1C3VA 4QT0A 1E3JA 4IZHA 2O3RA 3ZV6A 4B3IA 3GVXA 3UN1A 3V2UA 2BF7A 2E48A 2I67A 3JD4A 3L9XA 1DIAA 2QZ9A 3JQ7B 4ZU3A 3A1NA 1KEVA 3Q2IA 3WOHA 4DXHA 4DIBA 1TT5A 3VKVA 4B4WA 3WICA 4FB5A 2PGDA 5JMPA 1BG6A 5K6AC 2FPPA 4XRRA 3LYLA 3DBVO 3BMQA 4XQEA 4E5KA 1N1EA 3K8ZA 1ENOA 2PA3A 2HU2A 1FF9A 2DKNA 3S8MA 3QQPA 4Z9YA 3D64A 5A03A 1V0JA 4PIVA 4EITA 4J49A 4NU5A 4DPKA 1N1GA 1P0FA 3OIFA 3OETA 2Z1MA 8LDHA 3HE3A 3GDFA 3FNHA 1HZZA 3L77A 1J4AA 1CETA 1YJ8A 4DPLA 2AQIA 3U9LA 5TJ9A 3WWYA 3D7LA 2Q1TA 3O8QA 4E21A 4E4YA 1IE3A 5ENVA 5CAEA 4NK4A 3HSKA 4FGSA 5H82A 4KP7A 5B37A 1E3WA 2WE7A 4LN1A 4KMSA 4BO1A 1T25A 2O3SA 1A27A 2BRUA 3EY4A 1MV8A 5IDYA 2VUSA 4LCJA 1BDBA 1I5RA 3W8FA 2WTBA 1CRWG 4I9HA 4TSKA 4FFOA 1HLDA 1MFZA 3HDHA 1YDWA 1IOLA 2V7PA 4IDCA 1LLUA 3CINA 1W73A 4E5NA 4ROSA 4RZHA 4RO0A 3QLJA 1ULUA 3E03A 3IJRA 7MDHA 1VLLA 3E5MA 3VKUA 1DPGA 3PDJA 4IM7A 3ZU3A 3E5RA 4J1NA 4II3A 4NPCA 3WGQA 2FHSA 2NNLD 4D45A 3AOGA 2Q1UA 5FEUA 2GN9A 5JS6A 4J0FA 4W9NA 2Y67A 4WEOA 4W9NC 4CL3A 2D4AA 2X23A 5IG2A 3TOXA 2Q45A 1U3WA 1F0YA 2W2LA 3I6QA 3L4BA 3BZUA 4H7PA 2DTEA 5KJEA 4M55A 2EKLA 3ZNNA 4BGUA 5IN5A 4WECA 4RPKA 1GPDG 4DLLA 4E6PA 4HWKA 3WBBA 3ITKA 3UUWA 1I0ZA 2DBZA 1VE9A 2NTJA 3JD1A 3PZBA 4HFJA 1P45A 2RH4A 3S2GA 4WK6A 2RIRA 4Y98A 4WGGA 3VVBA 3KZVA 1ZCJA 3LK7A 3QWHA 3X2FA 1SMKA 3RASA 2JD0A 1ZW1A 2J3IA 2OBYA 4E12A 3TL2A 4GQAA 4DIOA 1K2WA 3PDUA 1ZUD1 2YQ5A 2RAFA 2ZB8A 1UJMA 3AFMA 5CEEA 3DAGA 1KEPA 5IDXA 5ITWA 3FR7A 2UUOA 5KVQA 3T4XA 1VI2A 2X22A 1AGNA 3NTRA 2GN6A 5TSDA 3V1UA 4EDFA 4AJEA 1JAYA 1PS8A 4CQMD 1JA9A 2UYYA 2EWMA 2PD4A 4PLWA 1PX0A 3HUDA 3ZU2A 3E8XA 2VUTA 5AVOA 1UAGA 3PWSA 1E77A 3ETEA 3ZWMA 5L40A 2NVBA 2P4HX 4O1MA 2Q4EA 4FFPA 5KVSA 5ENDA 4ZA2A 1QG6A 2Y05A 4FJ2A 5TRTA 3G79A 3CMCO 5JAZA 2Z5LA 3H9QA 1UXHA 4IIUA 3PHLA 3NDJA 4TKLA 5EIOA 3CUKA 1YJQA 2JAPA 3PHJA 4TQGA 1ZXLA 5KKCA 5LCXA 3GZNA 4I5GA 5JAIA 2R00C 3QSGA 2D5AA 3VDRA 4F45A 4AJKA 3NX4A 3WGYA 4L76A 2GGSA 1P1IA 1Z7BA 4R3NA 3AY7A 4W99A 4BGEA 3U5TA 1WDMA 4ND1A 3GPDG 5I7VA 1WXDA 5FI5A 1A72A 3JQBA 1AE1A 3PYMA 1EUCA 5COQA 1GCOA 4BO2A 3VH3A 2A94A 4CR6A 3GGOA 3MWDB 4CMEC 4GGOA 5H83A 3PJGA 1F8FA 4CLRB 3DMYA 5T67A 4E0BA 5BSHA 3QWFA 1XA0A 4Z0TA 4E3ZA 3A28A 2I66A 4BNHA 1EFLA 3GNTA 3U3XA 3RBVA 1Y81A 4LMPA 3GN1A 1N2SA 2YV1A 4R1TA 2PR2A 4XQCA 5U4QA 3GFGA 4CV0A 1J6UA 1NVTA 3GAFA 4FGWA 4IGEA 2AW5A 3EW7A 3ADPA 4PG4A 4Q39A 4M54A 4W82A 4WCFC 3PWKA 4CM5A 2CNBA 1H9AA 2PH5A 3OJFA 4U6QA 4YB8A 2VHVA 4XGIA 4U7WA 2H63A 2AE1A 1WNTA 3SC6A 1DEHA 4IZIA 3COSA 1JLLA 4PLGA 3W4IA 2J5KA 1LSUA 4Z6KA 3KSDO 1QR6A 2PKQP 1QV7A 5IXSA 3WR5A 2BKAA 2RCYA 1DO8A 5ER6A 4KQWA 1TEHA 5EL0A 3S2FA 1KY5A 1NX6A 1XDWA 3MZ0A 3KYDA 5C7LO 3I83A 2I3AA 1BW9B 1R66A 4BNJA 1WMAA 2HMWA 4UVIA 4ALKA 3DFZA 1LRJA 1C14A 1YL5A 3LU1A 2CF6A 5JC8A 3I3OA 3VTFA 3ZV3A 3GUCA 3KOUA 4KZPA 2YHUA 4EUHA 4G2NA 2BFMA 1OBFO 2G17A 2VZ8A 1AHHA 1JQBA 5EJ2A 3HADA 5AXBA 2HQ1A 4XZ3A 1GZ6A 3RC9A 2YFHA 3ZH2A 2VHYA 3DZFA 1DRWA 2X5OA 3ETDA 2FOIA 3TPCA 4B3HA 5CPFA 4KUHA 4J7UA 4J16A 3DFUA 4P38A 2NQTA 4Z9XA 3QJ5A 1GQ2A 4J43A 3NTQA 1KC1A 1GU7A 3LZ6A 4J1TA 4U0KA 2E82A 1T2DA 5DCWA 1SPXA 1XU7A 4CM4A 4FOSA 3WSVA 1B7GO 4KUGA 1ADGA 1H5QA 3OJEA 5ILOA 3VDQA 1RM3A 3DHEA 4I1IA 1JVBA 4MVJI 3IL2A 4W4TA 1ZFNA 3DWFA 1W0CA 2ZATA 2OOSA 1X0VA 1OC4A 3RWBA 4IMRA 1NP3A 3FNFA 3AFNA 3DTTA 1ZK2A 3C24A 1JWAB 2YV2A 1T4BA 2B37A 1SEVA 2DBQA 3INTA 3KM0A 4QXMA 5HRUA 2C2XA 2IZZA 2JFFA 1S7CA 1UP6A 3I9OA 3IC5A 4CLOA 5DNAA 4DBVO 3AY6A 4LW8A 2RHCA 1I3LA 1P44A 4PLTA 1EDZA 2ZQYA 3B70A 1LRKA 1UXIA 3DXFA 3Q0EA 1Y8RA 4MVJE 2B5WA 3BMCA 2EP5A 3E9QA 4E33A 1P1RA 3I9KA 4OH1A 4MVJD 1HDZA 3KSZO 1YWGO 1MB4A 4DQVA 4BO3A 3U4HA 3ZGYA 4MIEA 5MDHA 3OSUA 4U0JA 4N54A 4XJTA 1I3MA 2NADA 4WLUA 4BOYA 4TRJA 3E18A 4DL9A 2OBNA 4D79A 4AICA 2PZJA 1N92A 1RPNA 1RYEA 1LC3A 1W6UA 4QUKA 3WTBA 3G17A 3HN2A 4HXYA 1N7GA 1QLJA 2E6UX 4YJDA 1J49A 1NTOA 2PZLA 2OFPA 2D3TA 1EMDA 4MIOA 2DQ4A 1PGPA 4XYEA 1UXKA 2Y1CA 3GGGA 5F1KA 2BHLA 3SX2A 3RUCA 2G5CA 1YL7A 3MJVA 4FOOA 1IZ9A 4CMJA 5TQVA 1UDAA 4PCVA 4UUNA 3DZKA 2OORA 3RFVA 4JP2A 4YVFA 3JQAD 1VKOA 3VPFA 4GSLA 1K6JA 2CMDA 3WBFA 2B36A 2DPGA 2X8LA 3C7AA 3HN7A 4HY3A 3CIFA 3VPHA 4D0RA 2XF8A 3AM4A 2NVWA 3RFXA 3TZ6A 4BB5A 3PGXA 4FDAA 1PQUA 1I8TA 2GN8A 4JK3A 3K92A 3RUFA 2X0RA 2YFQA 1YS4A 5TGDA 4CM8A 2XXJA 1AN9A 1OC2A 3W4JA 3NTOA 1V35A 1JN0A 4I08A 4JCOA 1E1NA 1I33A 4FFRA 4RPHA 1NWHA 3K96A 4WLEA 3ZWOA 4XB1A 1E7RA 3JD0A
chains in the Genus database with same CATH superfamily
1JFSA 2J5BA 3TUIC 4DC1A 2NZ8A 2GPYA 2WD7B 2C97A 3AOEA 3CPJB 4O4LB 4US1R 4DANA 2QQ0A 4KNYA 3VKFA 4ZAFA 1PL6A 1G55A 4I8IA 4X97A 2X41A 1RJ9A 1Z0SA 2QF7A 4LYYA 1L5SA 1P5RA 1K6EA 2BGJA 5IHPA 3HI4A 3WRYA 2VRNA 3LY7A 1XALA 2CWDA 2FEKA 4TTJA 1TB4A 2E0IA 1ABEA 3CZ4A 4JOBA 4LOAA 4G0NA 1YZKA 2FV8A 5C18A 2OSBA 2H07A 5TS2A 4D4HA 4JBIA 1GFZA 2E21A 4QO7A 3FCYA 1M2VB 3KV3O 1A5BB 2WDZA 4J9UE 4UZFA 2PWBA 3WADA 4CUZA 3IYLW 3ZWBA 2W42A 2XCLA 1JWLA 3C1OA 2BGMA 1GFWA 2ECOA 5TMEA 4EB8A 1JF8A 1JLLB 2CJPA 2PQMA 4NEQA 4OJNA 4LDRA 3K0FA 1OXKB 4QRHA 1DWQA 4XGRA 2X2FA 2GZDA 1E9DA 2A2ZA 3LGXA 5LP6A 1H3EA 3HEAA 2CKMA 3LQKA 1Y6JA 3HKDB 4ER0A 5JQWA 2P91A 4HFNA 4CQJA 4TKZA 1XQ9A 5AOCA 3PEEA 2PX0A 3E23A 2ORVA 5AOVA 1A8PA 2PVCA 1TMYA 4FS3A 3SZMA 3WGNA 2V6GA 3K6JA 1WSBA 2RHWA 3M70A 4U5QA 3KYDB 2NVUB 3SEZA 5C1DA 5F2NA 1ZW6A 1EA7A 2ZWIA 3B1XA 4XWGA 4MICA 3I64A 2FFQA 1VSUA 3FJ1A 4ZOBA 4C30A 1GG9A 3ZW9A 2IDKA 5F1YA 2WJ4A 3BFJA 2JATA 4BNFA 1ESMA 5KSZA 3U4QB 2WKQA 2VJAA 1GT6A 1VLZA 3URKA 3W3AH 3CRNA 3PHIA 1CUXA 3P2OA 3VSEA 3TZEA 2FMHA 4KRGA 4G63A 3HR7A 3QRWA 1CD5A 3ME5A 5ULLA 4FHZA 1KO4A 2Y0DA 1ML3A 3A6LA 4KSCA 3I9LA 3JQEA 4S05A 4L9SA 3BWXA 2E9SA 4TSRA 1P2SA 5TVKA 5KYXB 1X7ZB 5J1TB 2I91A 1P3DA 5CD1A 1KPGA 1VP3A 3H3JA 3TSZA 1PJ4A 1R4MA 1KFBB 1BHO1 4QGBA 3MB8A 2ZBPA 1DEKA 3RV4A 4L8VA 1EXVA 2W83A 1SG0A 1T1IA 3IV6A 1NFQA 4N7JA 2F67A 4X1YA 4A7PA 1NN1A 4X45A 3V8EA 1SU4A 4BQFA 4PWYA 5K0TA 4GXTA 5CCBA 2GBLC 3M3HA 2YXBA 4J7CA 4Z5XA 3M2TA 5EHNA 4YJKA 1ZJWA 1YS9A 3AHCA 2Y0PA 3JSXA 3MM4A 3AIOA 4RESA 3CVXA 2OG2A 1XSEA 2ZJ8A 3OA2A 4IX1A 3IQEA 2P9ZA 4FFWA 1RKBA 1G21B 3M81A 1ZI9A 2HA0A 3EQZA 3JQFC 1NOJA 2YYZA 3CKMA 3QMWA 3BSFA 5CB8A 1RVV1 1YSCA 2EJVA 3CE6A 4BAUA 4CMGA 1JFTA 2RHJA 5TIIA 1ULSA 5HUQA 3EN0A 3DYBA 2IEBA 3EFOA 3OOSA 1IOWA 1EFVB 3FYUB 3HCBA 4HNHA 4LUCA 4ZVNA 3TNYA 1RQPA 4ENWA 2IBTA 4BAGA 3VNUA 3AL3A 2JBWA 4FQ8A 5NLLA 2ZBFA 3AV3A 5A0FA 3O92A 2FMFA 3ZCXA 1IYZA 2J3EA 5DTMA 3DPSA 4BFTA 1SCKA 1VLQA 3Q3JB 4R5HA 3WLTA 5AMXA 1KDZA 1F2VA 1T3TA 5EIHA 3C7KA 3W4KA 5EMNA 4I4NA 5TF0A 4KIJA 4WKBA 4IYRA 1N2BA 1RXEA 1ONPA 1ZGAA 5B12A 5F7XA 3GH3A 2AI2A 3RWMB 2PK3A 3JQAA 3EIWA 3VISA 5AW1A 1PKXA 1E2JA 2HBQA 5ALLA 1N2OA 1U2DA 1QZTA 3FF4A 2N3ZA 3PC2A 2VDVE 4JJGA 1LZLA 4MTLA 4C22A 4Q4HB 4PSKA 3JAKA 4EKDA 3D8UA 4Y2YA 1LDMA 5EZYA 5K4HA 3UWMA 1HG1A 1EM6A 1OTXA 1W4ZA 4TX1A 4YCBA 2DHRA 5HDBB 2BTQB 4NRDA 2VXYA 1ADFA 2EOAA 2CK3A 2XB6A 5EQJB 3MWFA 1PBTA 2PMKA 5KNLA 2EKBA 3F7OA 2J3LA 5KYWA 1ZRSA 3G0IA 3A37A 3CCFA 4NEGA 3UCEA 1MA0A 1G41A 5DHPA 5E38A 1A8HA 4BEWA 1IHOA 2ZUWA 5B5SA 4PXSA 1W47A 2WTEA 4WOPA 1I0LA 2P0EA 4ID9A 1Y7IA 3FHTA 1SXGA 4IIDA 2XUOA 5L3QA 3NBQA 1BGXT 2HBYA 2VP6A 3B6IA 1YB4A 3EC7A 4LPKA 4C3OB 1Q15A 4L72A 3NPMA 3F98A 3HMQA 3G0GA 3TQCA 1HA3A 1YC2A 5BN5A 5LDHA 3I32A 5BRNA 4Y6SA 1KU6A 4DE5A 3JR7A 1GUZA 3LLVA 4DSAA 1WBDA 3AVYA 3NHLA 5B7QA 1M8PA 2OZVA 3REFA 2GCEA 4FU0A 4EQ6A 1LB1B 3ED1A 2WYOA 3V1YA 5K6AA 1EWTA 1YR9A 4MR8B 4DWJA 4Q6BA 4LTMA 1UBFA 4RD1A 5FQOA 4BO9A 1GO2A 3ZW8A 5T8KC 2VA9A 4G37A 3OZDA 4BJHB 1AV6A 3KQLA 1B00A 3PTAA 4QUAA 2G70A 1SVSA 3B82A 4MVJF 4DF3A 5IKEA 4TYPA 1W4CA 2V7QA 3ITEA 4D26A 5ALNA 4O2AA 5JMTA 1U0SY 4I8DA 5BXYA 3OQPA 4R8SA 5K51A 3RSSA 2EZ8A 5KNBD 2IYUA 3G5TA 3STHA 2XB8A 2W2QA 4PLCA 4BP8A 1QFYA 1U3CA 3OPYB 1XZIA 3IOBA 1RWMA 5JS8A 3FNBA 1GEEA 4HDNA 1RXVA 2I87A 3MMZA 3N87A 1JYSA 3SYMA 2WU0A 2P5UA 1YC5A 2IXTA 2R8OA 4B1FA 5TLSA 1B3BA 4KQXA 2O23A 1LEHA 1DIOB 1A77A 4OH7A 3TBKA 1SK9A 2R6JA 3WWEA 5LBIA 2J9FB 3UKDA 5JNTA 4F11A 1SQ6A 3I6IA 1J1UA 3PTZA 3TRIA 2P4QA 1QUEA 3EVNA 2ZB2A 3OAAA 4IMJB 2ZRFA 3V8NA 4CXMA 2VHCA 1FX1A 3GWZA 2ZBDA 1H2ZA 1DV1A 3NGMA 3OIGA 1MO5A 1AZTA 1IVYA 1P31A 3QW2A 3SJBA 2HRBA 4H3KB 1R0YA 3D6UA 1SGWA 1FUEA 1C3OB 4YP6A 3IMCA 4GZMA 5TVGA 3CUYA 4H08A 3Q4GA 4BJ5A 4ZJYA 1WW8A 3L1IA 1ZD3A 5DJ5A 1U0TA 2IPLA 3IE0A 3L0BA 1UL1X 4U7DA 1ZRHA 4JP3A 5ED4A 3QY0A 1UADA 2HIAA 2Q1WA 3OMWA 4FLEA 4IY1A 1F8YA 3K09A 2I80A 2PKYX 1LWNA 3WIDA 1KYWA 4ZVRA 1KK1A 4ABYA 1GZUA 2W00A 2WWHA 2O3QA 3A1DA 2ZAIA 4ZKEA 3DBRA 1GJRA 4DR4B 2IU0A 4WUVA 5FWXB 2WYUA 5ESXA 1JJBA 4EIWA 3DPIA 3IAUA 1TJ4A 3CKKA 1ZHOA 4I7EA 5IRCD 3D6AA 1G2OA 5H59A 4PZUA 4NZOA 3FWKA 2EC5A 2DH5A 3P5SA 1X1QA 4FDLA 3TLCA 2HV8A 5EJIA 3KWFA 4NDAA 4CHGA 1IHUA 5A4KA 4J16C 1CEYA 2YJNA 5FUYA 3K70B 5AVJA 1SC9A 4H3VA 5BWBA 5L8VA 1SB9A 3LF2A 1JFLA 4KXMA 3M5DA 4QC2A 2WAMA 4M8LA 4KAXA 4IEFB 3FUXA 3CH7A 3U9TA 4RKFA 2OO5A 1O95D 2I6GA 3E0XA 3VYTB 1A82A 1Z8FA 1NC3A 4DZZA 3C2QA 3HCCA 3H65A 3FE2A 3RRZA 4R6WA 3GEPA 3N6RA 3NDPA 1VKHA 5IC4A 2CEAA 3NTVA 3WL7A 1U80A 1V8ZA 2PL9A 2WNIA 1E7SA 4WKCA 4C4ZA 1ZBQA 5CIWA 5IASA 5KTKA 1FDTA 2L69A 2YUIA 4TSFD 4U9IS 3AXTA 3RIMA 4IOKA 2V6FA 4P4NA 4X8OA 1R12A 4HN2A 1NF2A 5AJHA 3RUAA 1E96A 1XAIA 5B6PA 4US2R 1E60A 4HWOA 3VU8A 2QRMA 2FJPA 2ZUVA 2PYDA 4U6SA 3SOZA 4I5FA 2KM1A 3L0YA 2OAEA 2JI6A 4IJKA 3GCXA 3H2JA 2FB9A 1RI4A 1I2CA 1SZCA 2O2ZA 4UFOA 1A69A 2GB4A 5BQ5A 3DDSA 4QUHA 3FLAA 3W8DA 3MSCA 1ZSVA 3UH0A 4B4DA 1KP3A 1OGJA 2NV6A 2XBUA 5BN4A 4FMDB 5KYGA 2GKSA 3O9VA 2AV6A 2QX9A 3L7AA 2XZDA 4JEMA 4LVCA 4MQLA 3ZCUA 3OQMA 1QE0A 3AC0A 3Q3EA 2SKDA 4IR7A 1FFXB 5JXIA 2AK3A 4TV8F 1NLFA 3HFRA 2Q3EA 2XMRA 3CRMA 3PF8A 4OXNA 4B2PA 2A6PA 2TRSB 1E1QA 4WASA 3LY9A 3SOPA 2HU8A 4MAFA 3RUEA 4F46A 4N0QA 4NZPA 3VH4A 3W04A 2Q3BA 4E08A 1CUYA 1C0IA 2ZJBA 1Y8CA 2YINC 4P08A 5KINB 2UXCB 4LIPD 4EGSA 1LBHA 3FI9A 3DO6A 4DBLC 2ZJFA 5B2EA 2GYVA 5JS1A 2ET6A 3P2YA 4JV5B 4PEVA 1PZFA 3ORSA 2ZVQX 2DETA 1O9HA 3DEFA 1MNQA 1EA5A 1WB9A 1W0JA 2VHEA 4HZGA 2H65A 4B76A 5JCOC 1SUAA 3MBIA 4K40A 3ZVLA 3UAZA 1IVNA 3VJKA 3K53A 2HU5A 3WRWA 4OI1A 3T94A 3PE4A 4ZT6A 1NRXA 4ENUA 5HZHA 3ROQA 1KEKA 4D74A 5FFNA 4ND2A 5K3SA 5TQJA 2VRCD 3KWLA 1UMKA 4UM9B 1H3NA 3O73A 4CKXA 2BLNA 1H8HD 1L8XA 1ZICA 2I9KA 1F6WA 1JHQA 3QE2A 4YUVA 4Q9KA 3PLNA 2BMJA 3N2ZB 4JI3B 3IQGX 4B34A 4DQLA 1MNAA 3HDYA 5HK9A 2DFTA 3H1EA 2IHYA 3SHVA 2HK8A 4CIWA 5DK4A 3AL2A 3QE4A 2YOFA 1E0DA 3DOCA 5GQSA 1UOPA 3IBFA 4POAA 1PWHA 5GMOA 3TM4A 4ACAA 4D57A 4TWIA 4E11A 4MP3A 4ML3A 1N3YA 1CUIA 2OPHA 1CXZA 2W6OA 1I9GA 1IZYA 1JHYA 4GNRA 1K7XB 3MUFA 5J9FA 4BVKA 2DYKA 4F4JA 2YFKA 3UBTA 2QSYA 4D8WA 2ZS7A 4GWKA 1K63A 2H06A 2P9BA 2WPDD 3AIIA 4MA5A 2FVXA 4BQPA 4DCTA 5LU8A 1SCUA 4CF3A 1IK6A 1AS2A 2PSJA 4JC4A 2C4HA 4N1AA 1KMMA 4QOFA 1MTOA 4YDRA 2WY2D 4DSNA 1ZL2A 4D98A 4LYGA 3CVWA 5K01A 3M6IA 1GXSB 3DOOA 4B5KA 5IT9A 2YWDA 1TAQA 2OZLA 3H9CA 4OHYA 3T9CA 1XXHB 2POCA 1RRCA 3JQQA 1KIMA 3L1UA 4RPIA 4JP1A 3RW9A 3ZY3A 2EJBA 4JC0A 3R7LA 1FJHA 2PUVA 5K0BA 3G9XA 1G5FA 5EXTA 2WV7A 3GA5A 4DWWA 4R16A 2EW8A 2ZTSA 3FTFA 3P71T 1UJNA 1U8CB 1WUHS 1X3LA 3EGDB 4J6FA 2OUIA 5EEGA 4UUPA 5J2TA 1KI4A 3ZGNA 2CT8A 1U99A 2J07A 1XEXB 1SVIA 5G1NA 5TPZD 3L1KA 4OAQA 4C2AA 1KBQA 1QHXA 1IIBA 4Q3KA 1COWD 4XEUA 4MRNA 1KVTA 2B2CA 3GIDA 4N40A 5KOHB 1HPLA 1XZMA 2OBFA 5LQDA 1K86A 4WFIA 4HT3B 4NONA 5DASA 2ORYA 4IJQA 3PD1A 1G8FA 3D0OA 3VAZA 4EJ0A 1A9XB 1FTQA 4A10A 2TS1A 4M0EA 3S0JA 4RDHA 3ZDCA 1IJKA 1T2EA 2Q4BA 5EINA 2HFKA 2RJOA 4M99A 3SVZA 4RMNA 1XBTA 2NTYC 2ZJ4A 2R6ZA 3A25A 4NDZA 2HRRA 4BVJA 1U90A 1E4EA 1W1UA 3KQKA 4DN6A 2CXUA 1R6TA 3JVIA 4L7QA 4CLRA 4K9OA 1RJWA 1ODSA 1O8CA 1T6NA 4RFLA 1FLDA 1KARA 1U8ZA 3LX8A 4E09A 2XYHA 3JQ9C 4O1HA 3NKFA 1USIA 1W8IA 3KT0A 3B85A 4JLNA 5A5EA 1ZD9A 2CJYA 2Q5FA 2ZIXB 2DZDA 2DPXA 2W8BB 2OXFA 3BA6A 3PUIA 4U7HA 3QVXA 1DEOA 5AHRA 2FW6A 1ZNWA 2RGDA 5DDIP 1ZQ1A 1KVUA 4D97A 1E98A 3LQ4A 1CE8B 2H1WA 3PX3A 1RZ3A 2P90A 1ZGBA 2DC1A 2VJMA 4N0PA 4PZ0A 3A6JA 4B7CA 2J45A 4Q1VA 2FVYA 4LMAA 4G1FA 2AMYA 2C5FA 2C7BA 4J3JA 4WPGA 4G5OA 3LT5A 2OK7A 2WKPA 4QUJA 4U4AA 3SC2A 5EPUA 3LZCA 3K8QA 4LISA 1TVEA 3ONFA 2C9CA 4FKMA 5TPZA 5ICMA 1RACA 3MUNA 1EI9A 2JLAA 1UAAA 4LFAB 3VXKA 2BCJQ 2HJHA 2PJZA 3B3QA 4AF7A 4P9NA 4AUEA 1X1EA 2QTNA 4QUIA 2LP4Y 3D6TB 4PQRA 5JLJA 2O1XA 3WYDA 421PA 3V33A 721PA 5I9IA 4OMCA 4O4LF 4RK0A 2CBGA 1TJ5A 3L41A 3EXHA 4IDQA 4XR9A 5KCZA 2NZYA 4LQLA 5F98A 5A0VA 2ONZA 2G09A 2R4QA 4ZO4A 2BM9A 1JIUA 2H1HA 1CVIA 3PZRA 1TGVA 3QKSB 5D3MA 5JFOA 3IODA 2PEYA 1WXEA 1DNPA 2ZYVX 4G1BA 4O3MA 2WJJA 1P1HA 3PICA 4MW6A 3STXA 2OOKA 4NNOA 1UOOA 2PRJA 4O4HA 2HIGA 1GKLA 2HJGA 2PGNA 1RP7A 5ALQA 3ZWQA 2ZUSA 3DAOA 2AJCA 4ZVSA 4CW7A 4II2A 2LKDA 1RI5A 3OZSA 3X1KA 1F48A 1N3LA 2VYCA 3BF7A 4JJAA 3L7LA 3NGXA 1Y33E 1RYDA 3BIOA 2YWXA 2IK8A 2Q5LA 3CLRC 3ZU5A 1KOLA 2O7SA 4ASUA 5KYYA 5JU6A 2JHGA 4E5MA 4LDJA 1T4DA 3FTNA 1F38A 1XE3A 2HK6A 3IJEB 4R9UC 3RC1A 2JA1A 1JNXX 1SKUA 1KQ3A 3NTXA 4Y9DA 4E88A 3RQIA 1EB8A 1MJGA 4J7AA 1EU1A 2C2ZA 2R8XA 2QYOA 2ZEJA 3CZ9A 3QE0A 4H7KA 4R2WA 4A0QA 4AQDA 3DEAA 1PU2A 2DLDA 3M4ZA 4KWCA 5IF3A 5THQA 4LI3X 5LYJB 3KR1A 1C0PA 1Y3IA 3RREA 4RCVA 2YWJA 3PIDA 1P2UA 3UGQA 2IYSA 4QYIB 1XZFA 4WMLA 1ECFA 2EHJA 2G36A 3GYGA 3ASYA 1HYQA 3H8SA 1UKAA 3HJRA 1AA9A 2OZKA 3OPXA 1DI0A 3R0VA 1O9BA 4K26A 1KJ8A 4DEYA 1XZEA 2WVHA 2BGKA 5FLXA 2DQKA 3TW8A 2DM6A 1T8RA 1S7GA 4XVQA 3VNAA 1SEPA 1ZVKA 3ROXA 4JL5A 1LA2A 4XSVA 4A27A 4F4DA 3MTJA 1AUXA 3HYTA 5AK5A 4YQFA 1RPZA 3SU8A 4ADSG 4DLZA 5HKKD 2IA5A 1FK8A 3ISVA 4I4IA 5LZ9A 1RMTA 4FXOA 2XT9A 3VO8A 2O7QA 3NHWA 2I3DA 3U2QA 1D1SA 4ZGGA 2NSLA 4CKWB 3G0HA 2JZNA 3X1ZA 1Y34E 2Q99A 4BMSA 3AVTA 1SBYA 4FZVA 5FHRA 3NP9A 4BNYA 4H3HB 1NFRA 5FBLB 1RKUA 1ISGA 3H2IA 4LZOA 1REQA 2XE8A 2WILA 3A26A 2GQ0A 2ODEA 2UUPA 5AR1A 3W7VA 1RLMA 2OY0A 4ZOLB 3BMNA 2VXBA 4AMBA 4MJ7A 1CIJA 2CFRA 5EWMB 3TPFA 2V58A 1NLYA 2DR3A 1AUQA 1Z5UA 3WLQA 4BNNA 1OAKA 1H93A 1NUTA 4OKNA 5DHQA 2ORED 3TK1A 1D2AA 2NYVA 1FDUA 3ZWDA 1LBTA 3ADCA 1E3SA 1EB9A 3ONVA 4LRUA 4P4SB 3BMQB 2IVZA 3VSCA 4MGIR 5T41A 4PSUA 4ER6A 3RHZA 3KK0A 3ICQB 3UYKA 2ZRKA 1DT3A 1GP2A 4Q1AA 3RS0A 2FZGA 3TAHA 5CXQA 2JHPA 1AGYA 2H31A 1E32A 2LDXA 3I92A 3GN2A 3U0VA 5LYYA 1CFJA 2HQSA 3ROTA 3G8DA 5E1OA 4LZAA 2NXCA 2ZI7A 3MTGA 3T9FA 4UCFA 2WHRA 4L07A 6REQA 1W48A 2YXEA 1ZK4A 4MS4A 1MENA 4NMWA 1XZHA 3QXCA 1ULZA 5B3JC 4CMIA 1DL5A 3VH2A 4LDZA 4Z49A 1ONNA 2OCBA 1OTYA 2WF9A 5DGXA 4ZEVA 4N7MA 3GEBA 1V25A 2ZLBA 2GSWA 5F9HA 2DFVA 3UK0A 5FBQB 1UMCB 1GFIA 2PL5A 2GCPA 2C9ZA 4F3RA 4V2UA 1CJSA 1ORHA 1OMOA 2J33A 3EIHA 1CKEA 2JLUA 5KDLA 4PIMA 3NHYA 4GPEA 1KMHA 1YZ3A 2DWQA 2XI4A 5L4LA 5LMUB 5KJCA 1NNEA 3UW3A 4Y2TA 4AVYA 1H1DA 3P2JA 3OZXA 2OAGA 3UV7A 2P9GA 2R6DA 2Y0CA 3ICVA 3WLNA 3A7DA 2ZYRA 3MK31 5E6SA 4LSWA 2A78A 3BB4A 3FYCA 3LUBA 1R9GA 2IYLD 4J1SA 1WVGA 2AG8A 3G3EA 3I9JA 1R10A 2CL7X 4CKCA 3KYCA 5ERGB 2Q1SA 3N2KA 5C46F 3UMGA 1AUVA 4GWGA 7MHTA 5CP8A 1ECBA 2ZIGA 4YTEA 1D4AA 2NUAA 2Z30A 2XZPA 3D6NB 4JLAA 5E0OA 4KZKA 3ANNA 3H42B 1MPXA 4G25A 5K0EA 1WRBA 1NG9A 2JHAA 3NALA 5C31A 1J2UA 3UT5B 1R0KA 2G72A 2PZFA 2G1UA 4RF5A 1RQGA 3IHKA 1IBKB 2B69A 2YN2A 4D8XA 1HE3A 1P19A 2HTEA 3GFQA 3RKRA 3NYQA 5DM70 2C03A 4CEIB 2AR0A 1KYVA 4Y67A 2YVKA 3FRHA 2P6OA 3R6TA 3ICOA 3BC1A 4QYMA 2C2OA 2J9ZB 4X3OA 3TDKA 1AA6A 1KS2A 1O8BA 3SEFA 4A8PA 2QT1A 4EB3A 1VCNA 4YP9A 2XVYA 4MP6A 1U3VA 1JTFA 2ZB7A 3V00A 4YI5A 4L08A 1T8TA 5KNDH 4OBEA 4DJDC 1B8VA 1BRTA 4E6EA 2BFPA 2EGHA 2JFUA 4B7ZA 3IRUA 3FWZA 5HEKA 3E15A 4I2NA 3JQ8B 4AZ0B 3U3JA 1E1LA 2JI8A 2VJMB 3I4LA 3G8AA 1UMBA 3K09C 2NZWA 2QMOA 4RQTA 1N9GB 4UXHA 1Q1ZA 2QTAA 1X15A 2WSBA 4U7JA 2NYAA 2VPXA 3QIAA 1IJFA 2J59A 2VI5A 3NBXX 4M0MA 4R5MA 1MGOA 4YAOA 2C7OA 1MOZA 1DC6A 2EAUA 1JE1A 4O59O 5DFAA 5CIYA 1QMPA 3OIUA 4GMFA 4U1RA 4NDNE 1KJIA 4MRPA 5H9VA 4BVBA 2WT9A 4DMUB 1TC2A 3GGPA 4J1TC 3RRFA 2Z5FA 5BXQC 1XCJA 4D4MA 1DAEA 1PSWA 3SLKA 1M1ZA 4RHXA 4UBLA 5FWAA 3W06A 3ZGLA 1I01A 4ZZIA 4LXTA 5AOAA 4J9VA 4KO1S 5H80A 1DQYA 3L9WA 3PFGA 3PPWA 3KLOA 1H0RA 2AR7A 1R8QA 1B0PA 2CY0A 3MNFA 3NO4A 3T5TA 2GUWA 1CK4A 3C14C 3M34A 4FE7A 2V6BA 4ZGBA 3Q8LA 1TI7A 4IUCS 3EZFA 3SX4A 3UWDA 2BUAA 4TMYA 1LPAB 2WJWA 16PKA 4XQGA 5E6RB 5SZIA 4F8YA 5JJIA 1KY3A 4Y9RA 2VKQA 3DQPA 4JUFA 3GT4A 3RSOA 5AT1A 3ESRA 3GR6A 1YJCA 1NF3A 4YJHB 4YAEA 3WGVA 1JAIA 3AF0A 1USUA 3QHAA 4IDAA 1QO7A 3ROZA 1YR1A 2VL7A 1M8GA 2EZTA 3AY0A 3HJHA 3EEYA 1ODJA 1ORIA 4L6IA 1P5ZB 2G4LA 4B48A 3IHWA 4G9BA 3WL6A 1R88A 3ET4A 5CM9C 1PIWA 3KHSA 4ZN6A 3BAZA 4Q16A 3AF1A 3V4FA 2PXAA 1COWA 4IUYA 4K5QA 1GADO 2IE8A 1XCOA 3KXDA 3GLGA 1XX6A 1V47A 1NJ8A 3V2GA 3AHHA 3CWQA 4AY3A 4FNOA 5AW5A 4OIMA 3V4ZA 3NJ8A 4RZIA 3ZS9A 2A84A 2PEZA 3E9YA 4Q02A 4X20A 1RKVA 2BBWA 1XXHE 1QKIA 3GD7A 2JFYA 3K2IA 4IJVA 3TRFA 3IMGA 5BPFA 2PDAA 3ZHXA 2CLCX 3KBBA 2CHVA 2ZQ5A 5MHTA 2WF7A 2GKOA 4QU0A 3E8SA 3LM8A 4JD5A 1GN8A 2A14A 2Y27A 3OH8A 5A4JA 2GJ8A 5JMOA 3WYAA 3D1VA 4WUTA 3PYXA 3U49A 1J0DA 1QMGA 3REOA 2M1ZA 5I7WA 4CEJB 4JHLA 1CUUA 1C30B 3AY3A 5ALPA 1NI3A 1KY2A 4FX2A 4CFYA 4CV3A 3T4UA 3GJYA 2RK3A 4LC9A 1D4OA 1E2IA 3PF9A 2WHEA 3Q3CA 3Q40A 4GC5A 2XAUA 2UVPB 4JLWA 5FWNA 3F8TA 1G59A 2GM4A 2Z4RA 3FOZA 2COUA 3MMPA 3JD3A 4J7XA 5C32A 1TMGE 5EP2A 3Q9NA 3U5ZB 1ES9A 3ANSA 4I3FA 5AW8A 4ARAA 1ZXXA 2WEKA 4EQ6B 1TVMA 1K4YA 5K8UA 2PLNA 4XTCS 1L0BA 2REXB 2SNIE 3HLYA 2JS7A 1PQYA 4NBKA 5A4AA 1HWYA 3IUPA 3FETA 1BX0A 4G85A 5JSYA 4CLDA 1NVUQ 2GZSA 3G1TA 1KSJA 3C8MA 1OFHA 1VJCA 2EFCB 4CNQA 4Q3EA 1FEZA 4Q9IA 1U1GA 3GBVA 1BD4A 3E3NA 3LFUA 3P0HA 3RTDA 2ZWAA 5JBIA 1R64A 1JEQA 1AKUA 1U7WA 2ZI5A 1XU9A 1V96A 3PV0A 4LWOA 3S1SA 3JYQA 1TW3A 2G0AA 2JA2A 4OB8A 4A82A 2PUEA 3TWOA 1SOUA 4LXUA 4KVFA 4RTQA 1XVLA 5B2FA 2MWMA 5JY6A 1R5OA 3PRJA 1JDNA 1WSDA 1ZN7A 2ZVPX 5ALWA 4FLFA 4AM8A 1SBIA 1UBLS 2B7LA 1GGKA 1K08A 4CM4B 4OYYA 5HX7A 3F73A 3T3OA 4IGAA 2XA1A 3UZUA 1EE2A 2PZ8A 2P2LA 1L1QA 1XVTA 2R96A 2XRYA 1TM5E 2ZULA 3DNMA 1CUZA 3O4IA 4M0LA 4MJLA 3ANLA 5UKDA 3TLBA 1C7IA 1QIHA 3DMGA 1FSGA 2B34A 3U3KA 4DSUA 4CTOA 1IOVA 4MYUA 4PLVA 2IUSA 3PVZA 4TWAA 4JIGA 3CNNA 3RDPA 1RWPA 2R1VA 4G5SA 3IV7A 4HZUA 4GHWA 3SEAA 2Z9DA 4NZZA 1WZIA 1UZLA 1ENZA 3PUYA 4IO0A 2VC2B 1XUOA 1UFQA 2I1LA 1VJ5A 4TRMA 2DMRA 4ZGWA 1U0HC 3GROA 5BW8A 5L4NA 1PT7A 3PPYA 3QVKA 1PEDA 3JX9A 5B3JA 4MUJA 2QM7A 2GETA 5IM4F 4CGZA 4HFRA 3SC3A 1GG2A 1G4HA 4TYQA 5K8LA 2PX8A 1VLMA 4LJKA 2HA5A 5F23A 4IXMA 4JI6B 1RYMA 3N2KB 2IPAB 3A3YA 5DK6A 3TBHA 1HL3A 3WTCA 3KLMX 2PGAA 1M7BA 1MCZA 1G63A 3R7BA 4LRYA 2EFYA 1SXJE 4YLGA 3KOMA 1OH6A 4YWHA 1KOJA 1VL5A 2F8LA 2HQOA 1XTRA 2XQJA 3ABOB 5FEMA 4NF2A 3U7RA 3B53X 2WTMA 3EC2A 3HJGA 3UJHA 1N8NA 3M9WA 3ONEA 3AP1A 4XQ0A 5DCUA 3LVBA 3FCUB 4BQQA 3W2TA 1UBEA 5CDYA 4FNAA 3ICWA 1F7UA 2A0UA 3DTVD 5DBOA 1JDPA 4GDFA 1E2NA 2D8AA 2IPXA 2R60A 4Z3DA 4PPFA 4CLHA 1CUEA 3GEDA 5JQGF 4M1ZA 1NMSA 3L4SO 4ZXFA 3TIVA 4PSVA 5I45A 4KIGA 4C87A 1ACJA 4N0MA 4E32A 4K3UA 2W2LD 4M7PA 5DBGA 3AKCA 4EYGA 3CN9A 2GRUA 3KB2A 3CSSA 3ZXSA 4F85A 1A1VA 2LCFA 4JH0A 2EIHA 4G81A 1HRKA 2DULA 5D6NA 1ADBA 4W1SA 3KPJA 4OGWA 2P8JA 4JFRA 2IVFA 3HCDA 1QH1B 4P3NA 1ZWKA 2QK4A 2XAAA 2XT0A 3AYZB 1FFWA 1O95A 5T4BA 3G49A 1VCMA 1KAOA 4IIJB 4I6EA 3N7UA 3GLHB 1TCVA 1VMIA 5BWOA 4MR7A 1EAMA 1WPQA 5EJ6A 2VYVA 4X61A 2VR1A 3P9CA 3PQ4A 4U00A 3CRQA 3MJEA 1WETA 1P81A 1ZD8A 5KYNA 4Q00A 2Y9PB 3L8FA 3NYIA 1P5HA 2RG7A 2B99A 4E5YA 5LKAA 2FSIA 3CRVA 4UBKA 3AVWA 2XXAB 1OI2A 4EKYA 3TRJA 4IIEA 5ALMA 2QLNA 2GN4A 2X19A 3IE2A 5FRDA 2ZI4A 2B2NA 2VSXA 1MJNA 1JZSA 1TMKA 2WP0A 1RE0A 1YQQA 2ZJ3A 4H59A 4PANA 4XSHA 3F1LA 3KEMA 1Z5WA 2X0NA 1ESCA 3GU3A 1IPEA 5L45A 2GO7A 4UTXA 2YWBA 2PQ2A 4WL0A 2IIVA 1PR9A 5KNDA 1DC3A 4NJMA 1R5JA 2P9CA 4KACA 5FTNA 1J5XA 3MJDA 4PHTA 6CHYA 5FPQA 4HGRA 4QPPA 4QUDA 3OOHA 1TUEA 4ZVQA 1GG8A 2MYUA 2XWQA 3LCVB 1HMYA 3KOYA 4IIFA 3JWGA 2GM5A 4CR7A 2XCQA 4ITUA 2H1IA 2JIZA 3VI3B 1MJGM 2HDWA 4B4UA 4EDHA 1XDZA 3K0FB 3OOWA 4WGFA 3H9GA 3GLSA 3NYWA 1NZFA 4QBKA 4UBNA 4B32A 4TTIA 4LQ4A 1YDGA 2XJ4A 5L3ZA 3T34A 1IUNA 2A1UB 1I0IA 2A5LA 2I7DA 3RD5A 3K73O 1BSVA 3OZGA 1U2GC 2OYCA 1JEQB 2H18A 3SJZA 5JH7B 5BUZA 3QELA 1QONA 2B8JA 2OGWA 2AFIB 2XW6A 2PV7A 3EXG2 1JDUA 2HH9A 2NQ8A 4M0UA 3B1KA 4Z9BA 1QK4A 1XHLA 1XCPA 2AXNA 2QVLA 4HGQA 1MIOB 3AUFA 4RGBA 1FFAA 3ENKA 1TM7E 1JTVA 4IMIB 5K3AA 4PCLA 1NJSA 5BW6B 3AVUA 3KE9A 2ZE5A 4MWDA 4GPIB 4XUGB 3VR5H 2G1AA 1H2RS 2GCIA 3GX1A 3PNSA 2YV3A 4HGOA 2R6GA 2X4IA 2XGMA 3E27A 3INRA 5H3LA 4IQGA 5DOVA 4WZBA 4LJRA 3ZG6A 2V98A 4KXUA 4D0SA 2EGUA 3ZDBA 4L51A 1UEIA 4V0OA 2XKKA 4JNCA 1L4FA 2IPNA 3CZRA 3QX7A 3S3TA 3AUXA 4Y0NA 2Q3LA 1UH5A 3G2JA 3V1LA 3TZLA 1F12A 2DFPA 1KEZA 2ZT8A 4B35A 4EPRA 5EKXA 5C1OA 4DQUA 1BKDR 1UJCA 3WYEA 1XXLA 4C4SA 3NWEA 4MB6A 1NQAO 3F71A 2RHMA 4RIHA 1T8PA 2F00A 3H5IA 3PDWA 5AUOB 2ZJ6A 1O94D 2QMUA 5JPDA 1G2IA 3GUVA 3OP4A 3OLVA 4JX9A 1P75A 4MQEA 4ZCMA 3C5CA 1JHPA 2JAHA 1UJBA 1A5ZA 4B43A 4DMCA 3CSUA 4LVUA 3UMRA 4YYZA 3Q12A 1Q0SA 4KAFA 1OH8A 5FBKA 4TTRA 5FBRB 5EJEA 4LHZA 1Q0HA 4ZRNA 5K4AA 5E7QA 2PX6A 4F97A 5BWMA 1JUDA 1MVLA 4G0ZA 3EWAA 5CTJA 2Y77A 1ZUNA 3H5TA 2WIGA 3EXHB 3IVXA 1V8DA 4UFNA 4X1KA 3WLFA 2P1ZA 2V3WA 5D00A 4J0EA 4BX8A 3NOOA 2VKTA 4FFBB 4RPJA 5A05A 4TL7A 5JG7A 4A15A 3F3SA 1LDBA 5EFZA 3CX6A 5AW9A 4KPFC 3WKCA 1QZUA 1FQWA 2E18A 2GR9A 5HE9A 4BNIA 1ND6A 3AM1A 2IS2A 1CDOA 2Q9UA 1X3SA 4QPZA 2AOWA 2XCOA 5IHXA 3SYRA 1QB7A 1ZH0A 3KSRA 2JH3A 1G9XA 1L7AA 1UPBA 3BXPA 4RJKA 3HO1A 1Y7PA 4IXNA 3OT1B 3I37X 1MORA 3QVJA 5JFGA 3D59A 2IDZA 3UO8B 1P29A 1V7CA 1P39A 4JOCA 2D1TA 1AT1A 5IAAA 3C5EA 3O83A 5I7SA 2UZ3A 2OC4A 1GITA 1LDNA 2VZ0A 2QP3A 3EGIA 4WTOA 4A2QA 3ANMA 1ULBA 2HRCA 5G3YA 1JFRA 2B1IA 2NU8A 2VTDA 2Y76A 3BH0A 3GK3A 4HVAA 3FAKA 5J59A 4M76B 5CCEA 2JIZD 3I6MA 2ZZKA 2GLTA 3BTOA 4IINA 2V8OA 3ELYA 1DQZA 3F6BX 1OH5A 2BMWA 1FP6A 3DOJA 3W6UA 2HK7A 1O0SA 5CB0A 1M1NA 1E1RA 3NM6B 4X71A 4UOZA 5FFMA 3G2IA 3IIIA 1AO0A 4DM3A 1QYWA 3Q98A 3ROPA 1YOVB 4BO7A 3HJTA 1Q2UA 3ISTA 4PZ9A 1WZEA 3BPSA 1THZA 3PI6A 1EIZA 2QP9X 4A8HA 4AF6A 1Z2AA 5ARBA 3RABA 4ND6A 4W6ZA 2V7TA 5BT9A 1G64A 2Q5IA 1GCUA 3SK0A 2O50A 2IYZA 1W1WA 3ICPA 2BEWA 4QREA 1L4NA 5I6DA 3OQ1A 1CUGA 3DZBA 1PVOA 2V55B 4K6MA 4QGHA 1BD3A 2FMIA 3F8SA 4ZI3A 2ZFUA 4W8OA 2DECA 3K9CA 3ZWCA 4NPHA 3KSBC 2ENWA 3FNGA 4B0PA 1T9GR 5EKSA 2GD0A 3WVNA 3TZCA 3BFXA 4XM1A 5KAMA 4E4TA 4B2LA 3RWOA 4E03A 1XOIA 3HDQA 4GUDA 4HVTA 2JIDA 2YZ7A 2LBPA 3BWMA 1O4VA 3BYZA 3WNZA 1C3EA 1BVHA 3Q5GA 1H1LA 5CXXA 5DI3B 1EDDA 4S24A 4UAGA 3E5NA 2C4MA 3RU9A 3BDIA 1GPNA 1WMEA 3D54D 2Q6VA 1PQWA 1UBHS 2W0MA 2XUIA 3ILVA 3KJXA 1XKLA 3M4XA 3DZJA 4NU6A 2KJQA 3TEMA 3WLRA 3ZXYA 1MF7A 3C4JA 1JR4A 1YCGA 2HIMA 3ZBUA 1XMQB 4WINA 2Z8YA 1NIPA 3PCRB 3A4IA 4YT8A 2XV1A 4P7JA 4UU0A 5AKYA 2NYUA 4PM4A 3IP3A 3CUUA 4UOQA 1ORRA 2UDPA 1YE5A 3GRUA 1REQB 4RLSA 3R6LA 2WA1A 4JL6A 4UBJA 2DPMA 1H4TA 1Q50A 3BXEA 5L3RA 3PLRA 5C34B 1WD7A 3QLVA 4GOOD 3S7ZA 3KTAB 1CY0A 2WSLA 1DLJA 3Q3IA 4KGZA 2C88A 3OEEA 1U2TA 5ER9A 4OY3A 4C6TA 1N2CB 1A9ZA 3SS8A 3HYCA 5DMXA 4DQXA 3PCXA 1SXJA 1Z82A 1HKHA 4URUR 3D7NA 4D41A 3H5WA 1D6MA 2PUDA 3FCOA 2VP0A 4MMZB 1DSSG 4BS9A 4BXOB 5CW2A 3THXA 3Q0IA 2C2YA 1NVDA 3JS5A 4E5PA 1ESZA 2VFAA 1YZHA 5CEJA 5ICCA 3NJRA 3M3PA 5EIBC 4LZNA 3WO0A 1VM6A 1RCTE 2E5WA 1T5TA 1GY8A 3PSAA 4KO8A 1KMHB 2ATEA 2JI9A 4P8RA 1J0CA 3CLSC 3H0CA 1H4QA 1QQBA 3IXMA 1HSOA 4JJ6A 2PBFA 3A3NA 2XUJA 5AD1A 3ESZA 3RTCA 1NAIA 2PYZA 2W5UA 4DXAA 1NY6A 2FQQA 4DLUA 3HDTA 4GW3A 4B8WA 1VP9A 4BCDA 3BB1A 3AONB 5CEFA 3IP7A 2V7GA 4NFLA 5H16A 1P72A 3CEPB 4ND4A 5CK4A 2C57A 3NIFB 3RIXA 1SOMA 2C5AA 3ZOZA 2NO5A 3KEFA 1I3CA 3KDAA 5KTRA 4YV1A 3FR8A 4HLDA 1BE1A 3BXXA 3WV5A 4E7PA 2I34A 2Q6IA 1ECPA 1QYXA 1XLWA 3WE7A 4OXRA 2OECA 3VR4D 4YRSA 3U44A 1NNUA 5G4KB 5IMBA 4EHJA 1U31A 5AVQA 1QH8B 3E2PA 1RJGA 1NWCA 3MAAC 2WMDA 1BMFD 3WGOA 3IXLA 2JG3A 4JXXA 4S2UA 4KGXA 3U4CA 1CJCA 3FNRA 4QEKA 4L8LA 3D1LA 2XGSA 3NV7A 5ARCA 1NLUA 4GVLA 3DKRA 5EE3A 4WLVA