3WNQA

Crystal structure of (r)-carbonyl reductase h49a mutant from candida parapsilosis in complex with 2-hydroxyacetophenone
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
335
structure length
335
Chain Sequence
SIPSSQYGFVFNKQSGLKLRNDLPVHKPKAGQLLLKVDAVGLCHSDLAVIYEGLDCGDNYVMGHEIAGTVAAVGDDVINYKVGDRVACVGPNGCGGCKYCRGAIDNVCKNAFGDWFGLGYDGGYQQYLLVTRPRNLSRIPDNVSADVAAASTDAVLTPYHAIKMAQVSPTSNILLIGAGGLGGNAIQVAKAFGAKVTVLDKKKEARDQAKKLGADAVYETLPESISPGSFSACFDFVSVQATFDVCQKYVEPKGVIMPVGLGAPNLSFNLGDLALREIRILGSFWGTTNDLDDVLKLVSEGKVKPVVRSAKLKELPEYIEKLRNNAYEGRVVFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords (R)-specific carbonyl reductase
publication title Unconserved substrate-binding sites direct the stereoselectivity of medium-chain alcohol dehydrogenase
pubmed doi rcsb
source organism Candida parapsilosis
total genus 100
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wnqA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3wnqA01
3PFFA 1DB3A 2JFFA 1B0AA 3SEFA 4DLBA 2BGLA 5A3VA 2O2SA 1U2GA 1XGKA 1HYGA 1V0JA 2J3JA 3X2EA 4M8SA 2O4UX 5T5QA 3OH8A 1H6AA 4HFNA 5ES3A 3N58A 4XEHA 3OP4A 2R6JA 4Y98A 2V6GA 3FNEA 5L3ZA 1UR5A 3UCXA 2YV3A 5BSGA 4BNWA 2HO5A 5I8WA 1I32A 1T26A 2WE8A 5JAIA 4XRRA 4WE3A 1EUCA 2PKQO 1IULA 1UZNA 2Z95A 4D41A 3G1TA 4G65A 3K9QO 5DBIA 2OO5A 3HADA 3JQ7B 4W82A 1UZMA 7MDHA 3WBBA 1OI7A 4EGFA 2AXQA 1M66A 2R00C 1DO8A 2OUIA 3VAZA 1QRRA 4FDAA 2GN6A 5B4UA 3WGHA 3VH1A 4QO8A 3RKRA 4ZICA 4ZQFA 3WNVA 3F6YA 1BVUA 2X22A 3FR8A 1T1RA 2GF2A 4OXKA 3JD0A 4W7IA 1LSUA 3PPIA 1I2BA 3WJAA 5LCXA 3MTGA 4GQAA 4U8GA 2Y67A 1ZNQO 1LDBA 3BYZA 4PLYA 4BNHA 1G0NA 4O5OA 4WOKA 1ULUA 3GHHA 1KVQA 2DLDA 4UVHA 2D3TA 4Q3CA 4XB1A 2I66A 1P1KA 4FFRA 4I5EA 3I9NA 1LDEA 3COSA 3UHAA 4Z9FA 1R16A 2GLXA 1DC3A 3W1VA 5F3RA 1WLYA 2NSDA 3VH3A 4J9VA 1NR1A 4BQPA 2NUAA 2DFVA 4OH1A 4QUKA 4IDEA 4Z3DA 4CMIA 4CQLA 4KDEA 1HYHA 1NR7A 4PFJA 1KERA 5IXSA 2CVOA 3NDIA 3JQFA 5G4KA 2FSVA 3H5AA 1T2DA 3D64A 4F45A 3DBHA 4AVYA 1A72A 3BMQA 4QECA 1PZEA 2HMVA 4CMAA 5KIAA 5JCJD 1OMOA 2A35A 3GG9A 4ZN6A 3WBFA 3DTTA 2H1SA 3OJOA 1HKUA 2O2YA 3LC1O 3FR7A 3WS7A 3H9GA 4CMBA 3V5NA 5L9AA 3PIDA 4CUZA 4JGBA 4ND2A 1PGNA 4ZA2A 4IDFA 1G1AA 1E5LA 1IPEA 1VM6A 1HXHA 1P77A 1XQ1A 3PJEA 3G17A 1LDGA 3BA1A 4IQ0A 3ULKA 3WNQA 2EKQA 3DQPA 5KKCA 1WVGA 4MVJM 1MV8A 2GN8A 1DAOA 3OSUA 3I6QA 2VRCD 4ILKA 4RVDA 1F14A 4MVJE 2QYSA 4J4TA 1GY8A 1HZJA 3CEAA 4WKGA 1N5DA 5A03A 3U3XA 4LGVA 3P7MA 4D79A 2B36A 1BG6A 4MKRA 2X5JO 3F5SA 4CM3A 3R3SA 3WYEA 3CKYA 1M6WA 4H15A 1GPDG 4IDCA 1HDXA 4JIGA 4URFA 2B0JA 4IXTA 4O63O 2DQ4A 3WGQA 4JBIA 1P1FA 4Q3DA 4BO0A 3NJ4A 3L9XA 4OJNA 3WX0A 2JL1A 3ZHYA 5FI5A 4CM9A 4TMFA 4B3JA 1W0CA 4J2HA 1JKJA 1B8PA 5TT0A 4XQEA 1LQTA 1YDEA 3RU7A 2PD4A 1RKXA 2GD1O 1EEHA 3NT2A 3P19A 4ND5A 3S2EA 3HFSA 4HNGA 3FWZA 1PWXA 4ALLA 4QX6A 1E3SA 4ZJUA 1YJQA 1UDAA 1SEPA 1UUFA 1WPQA 2YJZA 3N74A 4XKJA 1PU2A 4P4NA 4RVFA 4J1NA 1YWGO 4DPLA 5IG2A 1LLDA 4AJNA 3MJ4A 4FGWA 2GYYA 3QHAA 4R3NA 1TVEA 4BVAA 2DBQA 3E1KA 3V1TC 3UKOA 3PJFA 3ROKA 3W8EA 3E9NA 3RFXA 1DC6A 4B7UA 2A94A 2P4HX 3BXXA 4II3A 4WLEA 3PEFA 3RUAA 4R01A 4RVGA 2ZTVA 4YJFB 4UEJA 2NVUA 4EITA 2XAAA 5KCZA 2H6EA 1Q7BA 1CDOA 2ZYGA 5IDWA 1LQUA 4OQYA 3RUIA 4J1SA 4J0EA 1ZW1A 2CD9A 4MIYA 4E4YA 1VC2A 2Q1SA 2DVMA 5G2OA 1WDKA 3DC2A 2FWMX 3E5MA 3WDSA 4E33A 3HG7A 4PRLA 5COBA 2UDPA 4GVXA 4YRAA 1NP3A 2EIHA 1ML3A 3LF1A 1ULSA 1QV6A 1MFZA 4R69A 4RL6A 3HN7A 4GWGA 2YFHA 4E21A 5BQFA 1NHWA 1ADFA 3Q3CA 5HTOA 3WMXA 4A03A 4RF3A 3JQ9A 5CEJA 4BKUA 2NM0A 2VOJA 3GNQA 4UVIA 3RSHA 3E9QA 1I36A 2X8LA 4RLHA 4YJGB 4YR9A 1NAHA 1AGNA 2J3KA 3IDSA 4J91A 3CZRA 1OZAA 4PCVA 5CDGA 3E9MA 1XSEA 3PHHA 2WD8A 2VYVA 2IDZA 3AUUA 5L4LA 1HYEA 3U09A 4II2A 3M2PA 1HEUA 3QP9A 4LISA 4CODB 3K31A 4KDFA 1UAGA 4PVCA 2BFMA 4EEXA 2DUWA 4BNYA 1O5IA 2PK3A 2DPHA 3DZIA 1DRUA 1PJTA 3D4PA 2E82A 1YL5A 3OF2A 4S3MA 4R9RA 4CUKA 3DOJA 3HDYA 1DIAA 2ZTUA 4E2YA 2GN9A 1R15A 3GR6A 4XIYA 2VZ9A 1GYRA 4XJSA 1QYWA 2Y1GA 1E3WA 3O26A 5L7TA 3FNHA 2BGKA 3C85A 1JDJA 3STHA 1I30A 1TT5B 2H9IA 1ONPA 1ZK2A 4BV9A 1LSOA 1EVIA 3L9WA 2OXIA 5CFZA 3JQFC 1E7SA 2PH3A 3WMWA 4A27A 3UH1A 1YOVA 3I9KA 5KKAA 1W73A 4HUJA 2Z1NA 4QO7A 1PJBA 1YKFA 1G0OA 2IE0A 4BKOA 2NU7A 4RGBA 2VTDA 2Y0CA 2PA3A 2YHUA 1Z74A 1LSSA 4F6CA 2D1YA 1V3VA 2CNBA 3M1LA 3UICA 4YYZA 1UP6A 1YB5A 5FF9A 4CQMD 1KIFA 4N7RA 3RASA 1ZK1A 3WLFA 3NT5A 4XZ3A 4E2ZA 1QYVA 2O3SA 1LUAA 3F5QA 1L1FA 5JYDA 1H2BA 2POQX 4ZQBA 3DMTA 2DUUA 2D59A 5AVOA 2DBRA 3HZZA 4FGSA 4Y8VA 1PS8A 2HK9A 4XR4A 1FJHA 1BXGA 1KS9A 1DC4A 1QYXA 2AEJA 2Q1UA 2ZK7A 3UGKA 5AXCA 4PG8A 4RDHA 3VZPA 3GLQA 3EW7A 2HK8A 3LSYA 4TVOA 2O50A 4IPTA 2X9NA 1PQUA 2BI7A 1NVMB 3UN1A 3L07A 3WGIA 4CMIB 4Z6KA 4CQLB 2NADA 1SCUA 2WJPA 3QWIA 1MC4A 4XWYA 1O9BA 3LT2A 3PDUA 3TL2A 1B3RA 3PYXA 3DBHB 3PYLA 4X54A 3D5TA 3JSAA 4DQVA 2FPGA 3B20A 3FPLA 5A4DA 3MOGA 1NFFA 5G4LA 5ENVA 4PLCA 2J6IA 3ICCA 3V8BA 1M67A 3WSWA 5I9LA 1Y8RB 2EEZA 4F46A 1QXSA 3ST7A 4CM5A 1Y7TA 3RIHA 1T4BA 4NU6A 5JCXA 1MXHA 1P0FA 4YAGA 2PZJA 2AQKA 2O7QA 1LEHA 2QZ9A 4WUVA 3JQ7A 1HDRA 3OJEA 5H83A 2E37A 4BQRA 2YUTA 3DZBA 4D0RA 3RC1A 3NEPX 1Z6ZA 5CDUA 1EE9A 3DFUA 1N8KA 4NDNE 1DEHA 1E3EA 3FF4A 1MA0A 4CR6A 1A9ZA 4U0JA 1NASA 4P4LA 1X7GA 5AYVA 2Q4EA 1XWFA 3E18A 3ZWMA 2Y1DA 4KP7A 1H9AA 3AFMA 4DLAA 4YXFA 2CZCA 4WGGA 4J7CA 3H3FA 4R9SA 4GMFA 2SCUA 2JAHA 4UULA 4NBVA 3L77A 4MVJG 1RPNA 3V2HA 3HWRA 2YW9A 2AEMA 4A26A 2X0IA 1L7EA 2HQ1A 3B1KA 1UZLA 1K6XA 1LDYA 3F3SA 3G1UA 2FRDA 1KY5A 3GNTA 3WR5A 4RJTA 3JQ9C 1C14A 4JNKA 2GGSA 1Z7EA 4YB8A 3LVFO 2ZTMA 3Q0EA 4AJIA 2X4GA 3M2TA 4ALIA 3ZWCA 4WPGA 1KVSA 2R2GA 3DAFA 3TZQA 4BHTA 5J23A 2WYWA 3EHEA 1EFKA 4J6FA 1FMCA 2EHDA 5U4QA 4OOEA 5JAMA 1T2FA 1P1JA 4RZIA 3H7AA 3K2EA 4FPXA 3FD8A 1CIVA 1ISFA 4HNHA 2DAPA 4WLFA 3B70A 3WG9A 1E7MA 4K6FA 5TC4A 3EK2A 3VPHA 3MJVA 2HRZA 1W6UA 1ENPA 1HWYA 1BVRA 2QIOA 2EKPA 1PEDA 4Z0PA 5T64A 3KOUA 5IDYA 1ZJZA 1LRJA 3DZHA 3WGGA 4BKPA 1QYDA 4YAJA 5FYDA 4E5KA 4UUPA 1AUPA 3EDMA 4FJ2A 1H5QA 3QRWA 3AUAA 3PRJA 3VPFA 1PQPA 4QTZA 5HWSA 2EG9A 2QYTA 5ICMA 2NVUB 3WSVA 1ONNA 5C3MA 3A14A 1O8CA 3ENKA 3BMCA 1QORA 2CVZA 3ORFA 4ALMA 3KSZO 4XDYA 1PWZA 4PG5A 4YT5A 3PZBA 4D42A 3DB2A 3RBXA 1EFLA 4CJXA 3CMMA 1U7HA 1GZ4A 5T67A 1EVJA 1B3BA 1BHSA 2IRWA 2P91A 4CR7A 3QY9A 5JS6A 5KJCA 1A7AA 2OP1A 3GRKA 4EJ0A 5IZCA 4BIIA 3BHMA 4M87A 4TKLA 1IL0A 3E8XA 4TROA 5BT9A 4AFNA 1YO6A 5C5IA 2VWPA 5EJ2A 1NPDA 3NTOA 4AJ4A 3D1LA 3VZQA 1UXHA 2XOXA 5TJHA 1GEGA 2XXBA 2DTEA 4JN6B 7ADHA 1DHTA 4FFNA 2QRKA 3VPGA 2UAGA 1QLHA 4DMLA 1A71A 2BI8A 3FI9A 1ZK3A 3K2BA 3I23A 3TF5A 4PVDA 1YBAA 3HDJA 4CL3A 2DT5A 4GKVA 3JCZA 4D3DA 3R3JA 3PLNA 4XJTA 4AICA 3DMTC 3N7UA 2D0IA 1KBZA 2J3HA 1P9LA 4WEQA 5HA5A 2CF5A 1T25A 1HDOA 1XU9A 3I5MA 4TKMA 4WNIA 5DULA 1F06A 2D5CA 3EGOA 3IIEA 3IC5A 4PIVA 3KSDO 2PY6A 3F4LA 2AEFA 2V6MA 4IQ8A 1P45A 1E3WB 2TMDA 1NBOA 3GPIA 2J5QA 4RCVA 4IS2A 5IN5A 3QLJA 1U3TA 1XKQA 4MP6A 4WK6A 3AFNA 1I0ZA 4OIMA 2HCTA 1LC0A 2X9VA 4EBFA 3BAZA 2Q2WA 3PGXA 1EZ4A 2AHRA 2D4AA 5JMWA 4MPDA 2ZYAA 2ZCUA 3UVEA 4O59O 1TLTA 3SX2A 1NM5A 3PYMA 3M6IA 4JXKA 2FR0A 3JD2A 3JQGA 4YQYA 4YJGA 1LLUA 5I7SA 3UXYA 1HE2A 3KTDA 3KRTA 1XLTA 1WW8A 5BSFA 2YV2A 2I67A 3DOCA 1F8FA 3D4NA 4KOAA 1LRKA 3C1TA 5EL0A 4A5OA 4HFRA 5A02A 1GDHA 3HQ4O 2HK7A 3WQSB 2BH9A 4JJGA 3PDJA 4FOSA 3RQSA 5A9SA 1SBYA 1EQUA 5A05A 1S7CA 1ZEMA 2HUNA 2I76A 4KQWA 3P2YA 4UUNA 1JVBA 4IDAA 2QZZA 1KEWA 2HJRA 4RZHA 2V7PA 3SBOA 1E6WA 3ON5A 1K0UA 1UXKA 4CLEA 4DL9A 3W4JA 3ITKA 3KYDB 4MVJD 4R68A 3OM9A 3VHRA 1GV1A 4C7KA 4D3SA 4FFMA 4WCFB 1VI2A 1WZIA 3GDFA 4OXNA 2QRLA 3V2GA 2X1HA 4HXYA 1Z45A 1KOLA 5F1PA 5H81A 1GQYA 1DRVA 3LDHA 1MP0A 1GAEO 1YONA 2QRJA 3UFXA 4R1UA 2H63A 4IJWA 2VRBA 4E6PA 1ZCJA 5JE8A 3JQAB 1PSDA 1TT5A 3TFOA 3I1JA 1WP4A 3PWSA 3DZFA 3KLPX 2IEDA 2JD0A 1KVTA 2NVWA 5A04A 4ZQHA 4PLPA 3ROQA 5TRTA 2NACA 3K30A 4P22A 3FSRA 1FXSA 2V6FA 1VPDA 2IZ0A 1PR9A 3CPSA 3H9QA 1Y5RA 4RPGA 2DBZA 1T2EA 3RBZA 2OBNA 2Q46A 4N5MA 1B7GO 3S2IA 5GZ1A 4R4JA 4DRYA 2PKQP 1ISHA 2JCYA 3RD5A 5CEFA 4BS9A 5EINA 2VWHA 1DRWA 1RM5A 3HHPA 3DBLB 5EERA 1EDZA 4BNZA 5BNTA 4KZPA 1P33A 1ZH8A 1BSVA 4RV9A 4XD2A 4NFYA 2Q1TA 2VCYA 5G0TA 4ZD6A 2NU8A 5A1TA 3GAFA 1HE5A 1GZ6A 4HV4A 2PH5A 2GZ2A 3CSDA 3ZNQA 4GLLA 3KHUA 4LRSB 4D43A 4NBUA 4LMRA 5JO0A 4QQRA 4UEKA 4Q3NA 3MEQA 2VUSA 1TI7A 4BNLA 3A28A 3OA0A 2C7GA 1KEPA 2WYVA 3PQEA 4DUPA 1SPXA 1KYQA 4B3HA 1X0XA 5DCYA 1V9LA 3KSUA 3ZHBA 4I5FA 3IP3A 4LRTB 1P3DA 5GZ3A 1R4NA 1E1LA 4BL5A 4AJHA 3WFJA 3RU9A 4FB5A 1JKIA 2DPGA 4ESOA 4GX2A 2ZQZA 4MJLA 3ZNOA 4E12A 1Q2XA 1I33A 3HB5X 2VTEA 2LDXA 5F1OA 4FD3A 1U2DA 3SLKA 1VJ0A 3GVHA 4OQZA 1NAIA 3DOOA 3BMNB 1QR6A 1IUKA 3RROA 5GY7A 4RVSA 5IZCC 4DYVA 4OMUA 4KQXA 4Y6RA 2Q45A 5L4SA 1U9JA 3EVNA 4NZ9A 2ZTLA 4CV3A 4IMRA 1NQOA 3HE3A 2PZLA 4UVDA 4BNTA 3ONDA 3TPCA 2PNFA 1B2LA 1Y8RA 4DTIA 4OAQA 1XR3A 3KZVA 1E3JA 3WXBA 2I9PA 4E5MA 5F5LA 2EWMA 5DP1A 3ZDFA 4ZU3A 5K9ZA 3VZSA 1YQGA 3QA9A 3WIDA 3GDGA 3LYLA 1YRLA 4R41A 1P44A 4FFPA 1FDWA 2VUTA 1SO8A 1FF9A 1ORRA 4BO9A 5L7YA 1ZK0A 5HS6A 4MVJP 1DC5A 1ZFNA 4CLXA 2PTGA 3VH4A 3H8VA 3DHEA 1I2ZA 5KVCA 1LDNA 1HDCA 4PLVA 4GSKA 3U4HA 2DTXA 3ANNA 3GEMA 1FDSA 4IS3A 4YEDA 3GGGA 3BMCB 5IDQA 4I1IA 4GKBA 1PJQA 4TWRA 4CM9D 3TOZA 4YRBA 2C2XA 1R0SA 3MJEA 2QG4A 2VT3A 2FP4A 3ZWAA 4LN1A 3IKVA 4WECA 5TNXA 4CM4B 5G0UA 4YTEA 4PLHA 1O94A 4R5HA 2GUGA 1MG0A 3GN1A 3W8FA 2VN8A 4NNJA 3C3XA 3GVPA 4TRNA 1N2SA 4W4TA 1TT7A 3JQ8A 3GVXA 3KUXA 4TZKA 3PTZA 3AM3A 3LK7A 4AJJA 5L95A 1HE4A 3AW9A 2C7VA 3UCFA 4BV8A 3LT1A 3TOXA 4BO1A 5LDHA 1K6JA 3VKUA 1B8VA 5IXYA 2QQ5A 4UEOA 4QFDA 5JAQA 1C3VA 1CQIA 1Z75A 4Y9DA 3Q2IA 4ND3A 2VHXA 4ZRMA 4E3ZA 5A3JA 3KB6A 1JWAB 3O38A 5I9MA 1MG5A 4IMPA 3PVZA 3PHJA 3LQFA 4KTTE 5L7WA 1N1EA 4BGEA 2GO1A 1UXIA 1YXMA 4UVGA 5MGBA 1C1DB 1H6CA 5DBGA 1XG5A 4CLOA 4HADA 2BF7A 1J0XO 1YS4A 5EESA 3LZ6A 3OEYA 1Y81A 1GEEA 4RVUA 4DIBA 3JYLA 3KYCB 3TL3A 3IUSA 1LX6A 2EJWA 1Q7GA 2PD3A 3INTA 4UUOA 1MXFA 2GCGA 4DC0A 2G17A 4J7XA 3RJ9A 5JY6A 3I52A 2VT2A 1AHHA 2I3GA 3K8ZA 2VHVA 4YWJA 4TRMA 1E6EA 3WB9A 4FN4A 4L0QA 3A9WA 5TF4A 3L0DA 4FBGA 5MDHA 1GZ3A 1ISGA 4YDRA 3DBVO 4CLRA 3RJ5A 5JBIA 4IJUA 4C7JA 1DLJA 4JBGA 1J4AA 1QLJA 3QW2A 4R54A 3DAPA 2VYVD 1GUZA 4R1TA 3QVTA 2GERA 1O95A 2Q4BA 4ZQGA 5JYEA 1I10A 1D3AA 1ONOA 3DZKA 4TRJA 3JQGB 2C0CA 2O7SA 2IODA 4EYEA 3VZRA 1XHLA 1PL8A 2Q49A 4IZHA 4B7CA 4JROA 3EVTA 2EGGA 4NJMA 2EP7A 1YQXA 2HU2A 4Y6SA 2YQ5A 5GZ6A 3W4IA 5AOVA 1GV0A 1RM0A 4OHUA 4GPD1 1ENZA 1T4DA 3LU1A 1VJ1A 2EXXA 1GD1O 5A9SB 4BO7A 3G49A 2G82A 4IUYA 2O3QA 1QYCA 2GRAA 5GMOA 2NVBA 3PFWO 1NXQA 3UF0A 1PL6A 4DWVA 3EMKA 1HLDA 3FWNA 3H4VA 2B37A 8ADHA 3DL2A 4OSPA 2HMWA 1BTOA 1AXGA 2CSUA 3O4RA 4NBWA 1GL3A 2Y05A 3HB4X 4DPMA 5DBFA 1BXZA 4WLUA 1IY8A 2AQIA 3WTCA 3ANMA 3E6AA 2IXAA 2FSSA 1X14A 3QVXA 4NIMA 3RFVA 2HLPA 3VPXA 3ZWBA 1F8GA 1SB9A 4MKXA 4YJHB 3IJRA 3ZU5A 1GCUA 5KTKA 1D1TA 3NGXA 2EV9A 4XR9A 2W90A 4CMHA 3PGJA 1SZJG 3ZV3A 1JU9A 4XQGA 3GOHA 5AQ1A 2E48A 4ROSA 3EYWA 2W2LA 1X15A 3GHYA 2Y1OA 5IN4A 3IMFA 3RKUA 4CM7A 2GR9A 4FFLA 3KLMX 2YV1A 4E32A 3OICA 3TQHA 5ILGA 4E13A 2D5AA 5AXAA 1MLDA 4R1NA 4ALJA 4BB5A 4B8WA 2PWZA 1GUFA 3H2SA 4A73A 4H7PA 3AUTA 2RHRA 1Z82A 4CMEA 1VJTA 4Q3EA 2J3IA 1K5HA 4OM8A 4CUJA 4W6ZA 2YFQA 4MOWA 3K96A 1E1NA 2B83A 5LC1A 1LJ8A 1DPGA 1SB8A 1I5RA 3LLVA 1SOWA 4DIFA 4AJLA 2BFOA 3KYDA 1PJLA 3SJUA 3L4SO 4IGFA 2C29D 3F47A 1ISMA 2RH4A 3JQAD 1AE1A 4WLOA 3ZNNA 1E77A 1MB4A 3DO5A 4O0LA 3LC2O 4QT0A 4WCFA 5TSDA 6LDHA 1MX3A 4LVUA 1VSVA 3W6UA 1T2AA 3AY6A 3I6IA 4L73A 5HBRA 1SAYA 4RQUA 5DOVA 5TT1A 1R4NB 1Y9EA 4FC7A 2CVQA 5TX7A 1YB1A 2Y99A 2BGMA 3TN7A 1C0IA 3TNLA 3I9MA 1RM4A 2ZATA 5DCWA 5ER9A 4RLSA 5JNLA 3G3EA 3JQAA 2OMEA 1V35A 1L7DA 2P5UA 2W2KA 4LW8A 4I9HA 3DBRB 3JD4A 1M2WA 4J16A 1XA0A 5ILOA 4DQUA 4FFOA 4J0FA 4UVEA 3HDHA 3IOYA 3QWFA 3NUGA 1DJQA 4OL9A 3GMSA 3FBTA 5DT9A 3T7EA 1PL7A 1BXKA 3DDNA 1T24A 2DU8A 5DN9A 2NLOA 1NFQA 2E4AA 2P9EA 4AJEA 1ADBA 2HMTA 1UDBA 2OOSA 1VRWA 1Q7CA 3IQDB 2J5RA 3ZHZA 1YGYA 1ZSVA 3Q2KA 2RCYA 3JYQA 3QVWA 4K6CA 4B4OA 2J5KA 5AXBA 4FC6A 1I3NA 4BGUA 4GI2A 1A7KA 3DBLA 3ZWYA 1AN9A 1ZMOA 2G76A 3SXPA 3PHLA 9LDTA 4FS3A 3ZWOA 1WMAA 2UVDA 3PJDA 2ZYDA 2NNLD 3I83A 3KM0A 1DJNA 2Q1WA 4WNCA 4L76A 4YQZA 1DOHA 1AXEA 2X5OA 3EUWA 2NTVA 2RBEA 1VL8A 2I3AA 1JW9B 3QVSA 4MKZA 4BNFA 3W6ZA 3AOGA 3F1KA 2P5YA 2W8ZA 4ZGWA 4NFHA 3O8QA 4M89A 2PGDA 2Y0EA 1GPJA 4NU5A 1NWCA 1MGOA 4NI5A 3UUWA 3WGOA 4PLZA 4J1QA 3D3WB 2NQ8A 4GWKA 4U6SA 3OIGA 4PLWA 3D7LA 2HMSA 1DAPA 3JQ8B 1R0LA 4B79A 1U5AA 2OL4A 4EW6A 3RUEA 1HSOA 3C7AA 3BMNA 3OJ0A 2X7HA 3PHIA 3AOEA 1I3LA 1QKIA 3ETGA 3T4XA 1BW9B 1VL6A 4RF5A 1U4SA 3I9JA 3AJRA 1NFRA 4QEDA 4F6LA 1B14A 4ID9A 4YCAA 3MCVA 4EI2A 1E7YA 3EZYA 3NYWA 1PJ3A 1TA4A 5K6AA 4ALNA 1HT0A 1NHGA 3MWDB 4MP3A 1QSGA 3KXDA 3JQDA 4GBJA 5HRUA 4XIJA 3PXXA 4OO3A 4IY1A 3U49A 2RIRA 2JD1A 1GADO 1XEAA 5T8KA 1RYDA 2CDAA 4DYDA 4CLOB 3IAHA 2CUKA 4Y67A 1GYPA 1P1HA 1U8XX 4BNIA 3O9ZA 1HZZA 4L8VA 4BNJA 2HAEA 3GNSA 3RFTA 5TIIA 4PN3A 4Q39A 1WWKA 4B4WA 4CR8A 5KVVA 4D44A 1ZXLA 4EZBA 1PJ4A 1JKFA 3GDOA 1LLQA 4OXYA 3NDJA 5I8ZA 3F4BA 4L75A 3GGOA 2C5AA 3WYBA 4DPKA 5KJ1A 3ADOA 4JP2A 2OORA 4MVJI 1XDWA 2UUOA 3RC2A 1E3LA 5HS4A 4CM4A 3GAZA 4CLRB 4K1LA 3IP1A 4TRRA 4F3YA 4TZTA 1PX0A 3CINA 3OFSA 3S55A 3VOSA 1ISJA 1NTOA 4GGPA 1D7OA 3BTUA 1ZUD1 3ANLA 6ADHA 3E5RA 3ABIA 3P5SA 4AJOA 3QJ5A 2Q2QA 3GY0A 3GGPA 3BTVA 5FI3A 4EUFA 3TSCA 1F12A 4P8RA 2D8AA 3W4KA 1W8DA 1DFIA 3OIDA 2H5LA 4DC1A 4L74A 2Y66A 4NJMB 1JA9A 1H0KA 1RWBA 1YVEI 1A4UA 2OFPA 1DIHA 4INAA 4CPDA 3ICPA 1PJSA 3VVBA 4CMEC 1NQ5A 3FBGA 1LI4A 4U6QA 1C1DA 2AQ8A 1NPYA 4J43A 1YJ8A 1K89A 2JAPA 2IEBA 1ARZA 1EVYA 2EW2A 5HM8A 4CLHA 3KYCA 1ID1A 5A5EA 2XXJA 4WCFC 2JFGA 2F00A 1NPTO 3GRPA 1PJ2A 4PG6A 1EUZA 4MP8A 3JTMA 4Z9XA 3PJGA 3I4CA 3GG2A 5JMPA 1ADCA 1NQAO 3ZCXA 1BDMA 4RF2A 1M76A 1N1GA 4KWIA 4EJ6A 2WWRA 4NBRA 2BFPA 4IZIA 4JBHA 3OIFA 3HSKA 4MIOA 4ND4A 2ZB7A 5KJEA 4H3VA 2X5KO 4JP3A 1TB4A 4QSMA 4AG3A 5G0SA 2RH8A 3IL2A 1LDMA 1PZHA 4I8XA 2J8ZA 4LMPA 5JDIA 4GVLA 4G81A 1U3UA 4MO2A 2GZ3A 1X1TA 1ZJYA 3HUDA 3H9JA 1C0KA 3ZWWA 2IZZA 1F0YA 1WAMA 1YBVA 2JKVA 2YY7A 3H5RA 2FZWA 2FR8A 1KVUA 3ONFA 4LCEA 3NV9A 4KTVE 3GF4A 2UV8A 2YHIB 4OSOA 3S2GA 4Z3KA 5B4TA 3EY4A 5A9RA 3UW3A 3NGLA 1BWSA 3F46A 4GSLA 4DLLA 5KNLA 2Q3EA 3R0IA 3JD1A 2FHSA 5K0ZA 1LTHR 1LBEA 2NTJA 1E6UA 2IYPA 3D5QA 4NG5A 4XYEA 4JJIA 2E6UX 1P1RA 4D7AA 1QP8A 3MWEB 5G0VA 1K2WA 3I9OA 3WYCA 2ZJ1A 3HN2A 1H93A 4RVHA 1PIWA 1CEQA 4EDFA 1P31A 4LK3A 4IINA 1D8AA 1Z7BA 2AMFA 5CAEA 1O89A 1GTMA 4WCDA 1DHRA 2HSDA 2ILTA 1ZXBA 5IF3A 1JVSA 5B4VA 5B1YA 2W2KB 2W98A 3ROMA 4L4SA 4IXWA 2PZKA 5C7LO 1UDCA 3B1FA 4CQMB 2QW8A 4YJHA 3WGTA 2O48X 3AOEC 2AG8A 3DTYA 1H6BA 1S6YA 3WLEA 4WLNA 4E5YA 4BGVA 3VH2A 1ZSYA 2Y1EA 3GFBA 3ZV6A 3RCBA 3ZWVA 2Q2VA 3BZUA 2FMUA 1C0LA 3QWHA 3S8MA 1YQDA 2AW5A 4RORA 5K6AC 3AUSA 3F9IA 5EN4A 1LRLA 3U9LA 3VTZA 3W8DA 3AY3A 3L6OO 1DIBA 3A06A 4NJOA 1P74A 4JQCA 1GUYA 3D0OA 5T8KC 5JW6A 2V65A 2ZJ0A 3T4EA 3NJ8A 4NPCA 1Q0QA 3INRA 2WD7A 4GAEA 1ZZEA 1YDWA 1T2CA 2PD6A 3MJSA 2Y1CA 1N9GA 2C54A 5I7VA 1HETA 3QSGA 4E31A 5KJFA 3IKTA 3U5TA 1ZO8A 3BHIA 1FDTA 3O03A 3OEWA 3F1LA 2Y93A 4JLWA 1W4ZA 4J3FA 2FR1A 4KMSA 3VC7A 2PZMA 3OQ1A 3ZI0A 3VTFA 3ITDA 3TJRA 1NWHA 5KWEA 1PGQA 3O8QB 2DFDA 5CHEA 1X13A 4BMVA 3VVCA 1EK6A 4FCCA 2B4TO 1CYDA 2WEKA 4D45A 3FTPA 5DP2A 4C4OA 3RUCA 3TZCA 1Q0LA 1LC3A 3OETA 2DBVO 1PGPA 2TMGA 2X23A 3C24A 2P9CA 4RPLA 5BSEA 5BSHA 3GVIA 1AHIA 1E5QA 3I4FA 3U62A 1CQJA 2O3TA 3DBRA 2FPIA 3RUDA 3RAJA 2JD2A 2OP0A 2GPTA 5CDYA 2DM6A 2Y68A 1ENYA 3U4DA 3Q9NA 4K26A 4GLOA 3Q11A 4XX0A 4JX8A 3VDRA 4BNKA 5CG1A 1OC2A 2ZKLA 4N5LA 3MTJA 3K6JA 3DZGA 3PWZA 1YB4A 4U7WA 4IJVA 4XB2A 1I2CA 4XGKA 5CEEA 3LC7O 4JJFA 4YAKA 1VKNA 3PK0A 3GZNB 3GFGA 4O1MA 1R4MB 1JAYA 2O3JA 4BNMA 5JAZA 3DWFA 4HY3A 5F1KA 3C1AA 1Z73A 3QV1A 3OECA 4M49A 3TZKA 3TWOA 4EUEA 3PHGA 4TVBA 4YAEA 4A7PA 2Q50A 3A4VA 4N18A 4RPKA 2Q99A 5EQDA 3PWKA 2JFHA 3C7CB 2E49A 1Y5MA 4QFCA 1U4OA 1YH3A 3OQ6A 3LLSA 1LXCA 3L6EA 4CM8A 1K6IA 4XQCA 1UH5A 3EZLA 4XYMA 3C1OA 5JCJA 5CPFA 1DFGA 2VNAA 4BMNA 1DDOA 4ZVVA 5L45A 5DZSA 3I9LA 3ASVA 1DIGA 4B4VA 4QXMA 3D3WA 2V6BA 4PZDA 1GYQA 1NVGA 1E1KA 5ICSA 5JC1A 3Q9UA 1XQ6A 1IZ0A 5BR7A 3NKLA 1KC1A 2PFGA 1D1SA 4BMSA 2C2YA 3CTMA 3UOGA 3IS3A 3ASUA 1BGVA 3KEQA 4UUMA 1HLPA 5TS3A 3RWBA 1IZ9A 1I01A 2CDCA 5JDIC 4HX5A 1DSSG 1D4FA 3D3EA 3E03A 3WQQA 5K1SA 4IGEA 1BW9A 4E5PA 2VHYA 4KUGA 4A2CA 2VRCA 1HDZA 4MVJF 3RBVA 1ZEJA 1BMDA 3H3JA 5T57A 4OKIA 3ZV5A 5U1PA 4L4RA 4EEZA 5DDIP 5F5NA 4YT8A 4E2XA 1PGOA 2VWGA 1RYEA 4CMCA 2CY0A 2OHXA 2VHZA 4J9UE 1UXGA 4LSMA 2DC1A 3HFGA 3U4CA 1K3TA 4FJ1A 1R37A 4KWHA 1T1SA 4E5NA 5DOZA 3OJLA 1E7QA 4FW8A 4E30A 4O6VA 1ZK4A 2BFAA 4NFSA 1IB6A 4TQGA 3SVTA 1IHXA 4BGIA 4DXHA 4WASA 4WJZA 2P9GA 1X7HA 4Z0TA 3TRIA 3HNPA 3AU8A 5JPIA 1NX6A 3TFQA 5I7EA 1YE3A 3G0OA 3QQPA 4G2NA 4HWKA 3ZU4A 3L6DA 3PLRA 3GC6A 1Q1NA 2OBYA 1P1IA 2GN4A 2PGJA 4I9NA 1EK5A 1N7HA 1E3IA 1H9BA 4ZHSA 4YVFA 1E7RA 3NTQA 2X0JA 1KVRA 1WNTA 5DCUA 1XYGA 5TLSA 3ZWNA 1B26A 4GL4A 4PLGA 1Y8QB 3AY7A 3ONEA 3JQEA 1A4IA 4G5HA 5A5FA 2WMDA 3PQFA 1HL3A 5JDCA 4OOFA 3KV3O 2BELA 5KJ6A 3NT4A 1QV7A 1ENOA 2GDZA 3KVOA 5CPBA 2EF1A 2RAFA 3Q1LA 5T6BA 2UYYA 1BDBA 2ET6A 4I5DA 1G6KA 5B12A 1MFPA 2QHXA 2PR2A 4BKRA 2B4RO 2EP5A 3ZHXA 4GH5A 5G0WA 1M6HA 1GQQA 2ZB3A 5EMHA 2BHLA 3B6ZA 2NQTA 3DONA 4J4HA 1EUDA 1B8UA 1PR3A 1HDYA 4GX5A 3ZZNA 5EQFA 3GH3A 1YL6A 3WWZA 2O23A 2O4CA 4RPJA 2FZEA 1H2HA 3NTRA 2WSBA 1ZKMA 5JFOA 2GNAA 3CIFA 3NDRA 1I24A 1DBVO 4NH4A 1MC5A 2D2IA 3CMCO 3UCEA 1F17A 2BLLA 4UAGA 2I5PO 3D4OA 3E48A 4DIOA 3ROPA 3DEYX 3KBOA 2JHGA 2FPPA 1CRWG 3AK4A 3DMYA 1UP7A 3EC7A 4XRGA 3JYNA 5ER6A 1HSZA 4DA9A 1U1IA 3Q6IA 4NR0A 5A06A 1J5PA 2CDBA 1Y9AA 4XYBA 1UXJA 2W2LD 4YAIA 1C1XA 1SOVA 1OAAA 2DTDA 4I5GA 4IBOA 2X58A 2JCVA 5EIOA 3OA2A 4K28A 4YA6A 4IDDA 2GSDA 5TGDA 1O6ZA 1ZIDA 4IIUA 4LSWA 4Y6PA 3X2FA 4BO5A 1E0DA 4PLFA 4XA8A 1FDVA 1ZSNA 2CF6A 1GCOA 3GA0A 1XIVA 3JQ6A 1KEVA 3FCOA 4CMKA 1ZBQA 1WZEA 3PP8A 1PTJA 3WWYA 1LLCA 3BMOB 1HF3A 1U3WA 1XCBA 4MVJH 3H5NA 5THKA 4RO0A 2HJSA 2ZB4A 5BNIA 3DHNA 5A9TA 2YHIA 3INGA 4N5NA 5JO9A 4KUEA 1FK8A 4MINA 4BNXA 1HTBA 2YDYA 1LNQA 1B15A 2WD7B 3BTOA 3EAGA 4LCJA 3DR3A 5B37A 3TZHA 1N9GB 1OC4A 2VYND 3FRJA 3QE3A 1DXYA 4WOJA 2O3UA 5CG2A 2BMAA 4XQ9A 2NWQA 3MZ0A 3VPSA 1XU7A 3ZU3A 4J4BA 4BOYA 4CMGA 1JTVA 2NV6A 4BO4A 3QWBA 3NX4A 2YQ4A 4BO3A 3IJPA 1NVTA 4NHEA 2C20A 4XCVA 2VYNA 3ZW8A 2IZ1A 4B7XA 3OJFA 1KY4A 3JQBA 2B4QA 4W9NA 3V2UA 4DQXA 3MOIA 1IE3A 4M86A 1V3TA 5C7IO 2DKNA 1A27A 1KETA 3HDQA 2Y1FA 3PI7A 4DBZA 2O3RA 1QMGA 3GK3A 3C7DB 4M1QA 5FFFA 1U28A 1IOLA 3PIIA 1VLLA 4YRDA 4CQMA 4CMJA 4YT4A 2AE1A 4PG7A 2Z5LA 3K5PA 4NBTA 4EJMA 2PKRA 2VWQA 5KVSA 1UP4A 1VE9A 4IDGA 8LDHA 5U9CA 2CFCA 3FNFA 2AE2A 3A1NA 4N54A 3RC7A 3CZMA 5FWNA 4W99A 3K92A 1X7DA 4H16A 4XYLA 5I9NA 1EQ2A 1SMKA 4PZCA 4YBZA 1E7WA 1J49A 4FIZA 4CV2A 2G0TA 3TDKA 5ITVA 4BNNA 3CE6A 1HDGO 5G4KB 3T7CA 3ZV4A 4YT2A 4A0SA 2B35A 4PLTA 2RHCA 4ZQEA 4J7UA 1O0SA 3BMQB 1IPFA 2BRUA 1NQTA 4NK5A 4RDIA 3MJTA 1I3MA 2EW8A 3CXRA 3M1AA 4FSHA 3JD3A 4XGNA 2QX7A 3AM5A 1R12A 2UUPA 4AJPA 3GN2A 5DF1A 3FPCA 4CL8A 9LDBA 4ND1A 1CF2O 4B4UA 4R5MA 1EE2A 5IDXA 3CH6A 1UJMA 4CM8B 2VOEA 4P38A 3R6DA 1TEHA 4RQTA 4J1TA 1JLLA 3H9UA 4K9DA 3BIOA 1TXGA 3P2OA 3GQVA 4OYRA 2VNSA 4BO6A 2VZ0A 1P0CA 2HDHA 2G5CA 1C0PA 2A4KA 3L4BA 3OQBA 5THQA 4CV1A 4DREA 2VQ3A 1JQBA 1PS0A 3LT0A 5H82A 5L51A 2W4QA 2OZPA 4MIEA 3GEGA 1EDOA 4BNUA 1N7GA 4WLVA 4AL4A 2YYYA 2B5VA 1VSUA 5COQA 1V6AA 5C37A 2X86A 5TQVA 3U0BA 2ZB8A 1JWBB 1MUUA 3AI2A 4B3IA 5JDCC 2PLAA 1J6UA 5COAA 1V8BA 1R6DA 4DBVO 3WTBA 5ADHA 4GMGA 1EBFA 3RI3A 3PQDA 2CMDA 4YPOA 4YACA 5JY1A 3AI1A 1Q0HA 3ZWXA 3GUYA 3PZRA 4L9RA 4CM6A 2PGLA 5CP8A 5JSFA 2VHWA 3GT0A 3GZNA 1KC3A 2FN7A 2Y0DA 1R4MA 1JAXA 2IYOA 4HBGA 3DHYA 1U3VA 1OOEA 2P2SA 4FJ0A 1WDMA 3AWDA 4XDZA 3RVDA 4GX1A 2PV7A 3QWAA 1X1EA 3MJCA 5JLAA 1WMBA 4OKNA 4FR5A 5C7OO 3H6KA 3B1JA 2C5EA 2G1UA 1ADGA 2AA3A 4S1VA 3LT4A 2A9FA 3ENNA 4J90A 2EERA 2EJVA 2EKLA 3RUFA 1WDLA 1ISIA 4EUHA 5IJZA 3NAQA 2R00A 1IYZA 1GR0A 4E0BA 2WYUA 3SLGA 4GX0A 2NU9A 3NRCA 5I7FA 3AM4A 2GZ1A 3SJ7A 3WOHA 3HJAA 4ITUA 3AI3A 4HFMA 1CERA 2NTNA 5CDSA 4RPHA 4TSKA 5CDTA 3KO8A 4IM7A 3S2FA 2P4QA 1NYTA 1R66A 4XGIA 2Z1MA 1DIRA 4OGWA 3I3OA 5ENDA 4Q9NA 1PZFA 2JCXA 1PGJA 2WDZA 3BHJA 3WGZA 3GMDA 1SNYA 3DFZA 4I9UA 3DAGA 1X0VA 4BKQA 4BUCA 1Y6JA 3VKVA 3KETA 3QVOA 4Q3AA 3FN4A 4M54A 2HMUA 4LVCA 1DLIA 2X9GA 2I99A 5IAAA 4BB6A 1U8FO 3E82A 2WTBA 1GQ2A 4L4XA 2XF8A 3OMLA 4I08A 1ZMTA 1VL0A 4GGOA 4CM1A 1YL7A 2AG5A 4RF4A 1XELA 1QG6A 3BTSA 2B69A 2C59A 3K73O 4R1SA 5JC8A 5F21A 1PZGA 1LU9A 4R16A 1SC6A 4KUHA 3FTNA 4PZEA 1GU7A 4D46A 5EPOA 3ZH2A 3SC6A 3U4IA 4AJKA 1HE3A 3GPDG 3KYBA 3S1LA 1CJCA 2JJYA 3IUPA 4AJ2A 4FQ8A 4ZRNA 2X0NA 3WFIA 5DNAA 3ETDA 4NMHA 1EMDA 4BO2A 3H65A 4J2OA 4B8ZA 1R0KA 1HRDA 4Z0HO 2YZ7A 1RM3A 5LDGA 4D0SA 1M75A 4IJKA 4IQGA 2ZIZA 3JQBC 4W9NC 3V1YA 3QIVA 4JCOA 4W7HA 4BO8A 3FHLA 2C07A 1C1XB 1EBUA 2X0RA 2X6TA 1FDUA 1UAYA 3TZ6A 5FEUA 2VUUA 4Q3BA 3ADPA 4A10A 4YJDA 4HKTA 4NQZA 1V3UA 1KEUA 4Z9YA 3ZN2A 2HKIA 1DFHA 3RUHA 4D3FA 1Y8QA 3JYOA 4YJFA 1OBFO 2P68A 1I3KA 3AU9A 1BRMA 3GEDA 4WEOA 3WQRA 4IIVA 2IXBA 5TJ9A 3VDQA 1N92A 3JQCA 3WJ7A 2I6TA 4PG4A 5ITWA 5L53A 3JYPA 3V1UA 4E2WA 1LSJA 3OHSX 1JN0A 3WICA 4FOOA 1SEVA 3SC4A 5IFLA 4JK3A 4XYGA 1U5CA 1NNUA 1PJCA 1E1MA 2BD0A 4M55A 4UREA 2A92A 3FNGA 3LF2A 3DZJA 1LA2A 1YOVB 1VKOA 3JV7A 2EGHA 1Y1PA 3UAGA 4U5QA 2ZQYA 3R1IA 4HP8A 4J49A 3H2ZA 4P4GA 1A5ZA 1U7TA 1PS9A 3GZ4A 4PGFA 5KVQA 3ZWPA 1H94A 3C8MA 3ZW9A 5L4NA 1A9YA 2NU6A 2LDBA 3ZNPA 3CUKA 1I8TA 2FY8A 3ZGYA 2WM3A 1YBMA 3WGYA 4CLDA 3GVCA 1H6DA 2I65A 4CV0A 4BNVA 1IHYA 4DGSA 2VZ8A 3L4BC 3GUCA 1CETA 1WXDA 1RJWA 2ZCVA 3DXFA 4R51A 4PRKA 4HFJA 1OFGA 1PQWA 5AXDA 5BNFA 2GASA 3KEOA 1BXGB 3G79A 4U0KA 1CWUA 2YDXA 3RC9A 3WIEA 4DVJA 1GFSA 3ETEA 4ONEA 3OBBA 4AJ1A 4MDHA 1EVZA 5L40A 1ZVMA 2C82A 2HRBA 4IDBA 3ZU2A 5IZ4A 2BKAA 2JHFA 2XPCA 2F1KA 4R3WA 1B16A 4ALKA 4DMMA 4MVJA 2B5WA 1E92A 4BNGA 5JXWA 2AQHA 2FOIA 2OGUA 2WE7A 3BMOA 3H9EO 5KOIA 4NK4A
chains in the Genus database with same CATH superfamily
2CBXA 3JALA 3TVDA 1DB3A 3AI7A 3R7AA 2CD7A 3L6RA 1QC5A 3RIYA 2JLAA 3SEFA 3ZGOA 4DLBA 3D31A 2BGLA 5KWJA 1JQLB 4WH0A 2O2SA 3T5TA 2H1WA 3CR8A 1E9RA 1V0JA 5D7NA 5CCDA 1BMQA 2O4UX 4M8SA 3CUWA 5T5QA 5I47A 4HFNA 3N58A 3HI6A 1Q95A 2ZIGA 3OP4A 4XEHA 4YI3A 1VHTA 2ZULA 5L3ZA 2VDUE 4Z4EA 1SVSA 5DPMA 4BNWA 1I32A 2B30A 2B94A 4J0IA 4MWDA 3LQYA 5F7OA 3OIUA 4O33A 1DCMA 2G8LA 4EA6A 5JAIA 2ZJYA 2ES4A 4D4GA 2L18A 2BCJQ 4G6ZA 1G3UA 4FNAA 1TKBA 3ND6A 3IJ5A 3TQCA 2WW8A 4NAHA 1ZNZA 3HADA 1THGA 3KR1A 1QPBA 1MB3A 2Q6VA 2QRVA 2V7QD 2A84A 1OI7A 1FMJA 2OQVA 3WBBA 3WGOA 1M66A 5CDFA 2I55A 2GN6A 2ZPTX 5B4UA 3GJ8A 2BTQB 3AVQA 1J00A 3RKRA 2G71A 2NZJA 2R7NA 3FVWA 1Z2OX 3WNVA 3T4PA 5CD9A 1D7AA 1MQ8B 3REGA 3EG9A 4Z99A 3V7FA 1TK9A 3JZDA 2GF2A 5T4EA 4OXKA 3UJAA 1IDOA 3JD0A 2NN3C 5FFMA 4BQOA 5KI6A 2PX2A 4JP5A 1U7UA 4HH1A 1RQ7A 1YC2A 1YR1A 2ATCA 1OPRA 1P3JA 2TECE 3O8BA 4DF3A 2CXSA 3AEQB 4K9LA 3LO8A 3FPJA 5K99A 5HZHA 2EJBA 4BLUA 1O54A 2DLDA 3ECAA 3DMNA 4UVHA 1E2EA 4M0DA 4NBSA 2BF4A 4FFRA 5DXAA 5UKDA 3COSA 2F43B 2WHRA 4YNBA 3CZAA 5F3RA 2C2OA 2V7BA 4J9VA 5TR9A 3DL4A 1Z7YA 2RI1A 3BXZA 3L7YA 4OH1A 1ZNWA 1CR6A 4WFQA 4Z8XA 4Z3DA 3OCXA 2EBHX 3TW6A 4YV0A 1NR7A 4RY0A 4PFJA 2RGRA 2GCIA 1NBME 1ZQ9A 3NDIA 4U3JA 5G4KA 1BJRE 1SUSA 1YAHA 1PVVA 3H5AA 3D64A 2FZ5A 5JHGB 5ECGC 2A7QA 3BMQA 4QECA 4WNAB 3UJBA 4DJ5X 3VYTB 3VSCA 3ZYZA 4F3CA 1B00A 5KIAA 1OMOA 3HNRA 2A35A 5BMVF 5HXAA 3TE7A 3RYCA 1H2AS 1I4WA 1RD4A 3DTTA 4IG9A 3IE2A 3OJOA 3KQUA 2WVHA 4C6TB 2PT5A 3PFIA 2QMQA 2G28A 3LC1O 3DV0A 2OHJA 1G2PA 3Q9SA 3ZE9A 3TZEA 2HLHA 4ND2A 2FUKA 3IYLW 1XHEA 3KLNA 4IDFA 4OU4A 3T1TA 4RTNA 3CNLA 1NZFA 4HGYA 4S2UA 4C4SA 1E5LA 5E6RA 1HXHA 1KAOA 5CUQA 1NNEA 3ABSB 1LVGA 4G5SA 4I4IA 1JIKA 1CY8A 1FX1A 1F6DA 2IUTA 1G21E 3KIPA 4C6HA 2WWGA 1T9ZA 1WVGA 1H3NA 1BA2A 1TM3E 5KKCA 1AS3A 1JKXA 1Z26A 5EXPA 2QXTA 4AKGA 1E9EA 3M49A 1T1JA 2VRCD 3WKCA 5J40A 3NOVA 5CJPA 3TR0A 2F9LA 2Z4SA 4MVJE 2XYRA 3FBWA 2V0CA 4RBNA 3BT7A 2RDMA 2WIKA 1VHWA 3CR3C 1N5DA 6CHYA 1FY2A 3WHIA 3ER9A 3U3XA 4M38A 5AKLA 3VJKA 3CNEA 4IH4A 4LHYA 2WZDA 3FGOA 3P7MA 1QG4A 5FI0B 4Y0AA 2A86A 5FBQB 4A36A 1DEKA 2ACVA 3DTVB 3SYMA 4QIHA 1QQ6A 4HJRA 3V1KA 4HDQB 3TLGB 4D98A 2W70A 4H15A 3MGAA 3OTGA 1N57A 1ZISA 1S89A 5E9JA 5P21A 3WGQA 3WLQA 4JBIA 3ZTWA 4Q3DA 1PVOA 1WEHA 4B6GA 4BO0A 4L0MA 4F72A 2P9ZA 2OAP1 4LC9A 3RAEC 1L7OA 1G41A 1PWHA 3F9CA 4LECA 5ESRA 2V3VA 3ZHYA 4B1FA 3FOZA 3MGGA 1DT5A 1T9DA 2HL6A 2QJRA 3D9QX 1W0CA 2EX1A 4HYEA 4N4AA 3SVLA 1JKJA 5B1HA 4CCAA 2HFJA 1KEZA 1AQJA 1JJAA 1KI1A 1LQTA 3N8HA 2AMLA 5LUBA 1YDEA 2PD4A 2YR0A 4EMTA 1EEHA 2Q41A 3S2EA 2O14A 3HFSA 4ALLA 5ITZB 4PTZA 2I7VA 4QX6A 2ZWOA 3O91A 2F67A 2YJZA 1DTWB 1XCPA 1XDUA 5F7JA 1FUUA 5LZ4A 3KUKA 3T94A 4EGAA 1Z9BA 3QSYA 1IMOA 2XTAA 1MRZA 3FPHA 2R48A 1LLDA 4EMSA 3KAJA 1MO4A 2WJ3A 2FE1A 1PG5A 3CZ5A 3G82C 3QBJA 4FGWA 2GYYA 4EG1A 1ZH2A 4HNAB 1V1RA 1TVEA 3BWMA 4X65B 4S1OA 3UKOA 1WBJB 4RTQA 1G20E 2HRRA 2AGVA 2JGKA 1BS9A 2PG3A 4ZAXA 1SXJB 2N1BA 3QOWA 1RKVA 1EIZA 4II3A 2P4HX 2PXXA 3BD9A 2XYQA 4R01A 4F1JA 5JI2E 1U04A 2ZTVA 4BMPB 4BLRA 4G1UC 4J3JA 2CNWA 4GF5A 1FVHA 4QGAA 2ONJA 4EITA 4NQRA 2H6EA 1Q7BA 1CDOA 4M1ZA 1USVA 2I3BA 1NYLA 5EMNA 3TUZC 1NT2A 4J0EA 1XPRA 1XPOA 1VC2A 2XOKA 2B4KA 2ZLBA 1VCNA 2DVMA 3MJFA 1JEAA 2FWMX 3C3KA 3DC2A 5ERGB 5G2OA 3E5MA 3TKYA 3WDSA 4PRLA 2P6NA 3IQGX 5COBA 4X6UA 4YRAA 5JAPA 3ENZA 2BDUA 4GYJA 3LF1A 5AH0A 1HFKA 3RYTC 1MFZA 2YXDA 1EVEA 4R69A 4OVKA 1N3YA 1USKA 2PRIA 4LVNA 2QRNA 2B8JA 3G8BA 4RLFA 3WLIA 4LJRA 1BX0A 1WXIA 5KQGA 5BQFA 2P9FA 4YN3A 1NHWA 2PH7A 3I39X 1QHSA 3Q3CA 3WMXA 5CEJA 3ROZA 1HNWB 4URXR 3GB9A 4RFVA 3GNQA 3SQLA 4HDSB 1P2FA 3H1EA 3LYAA 3REOA 2YWFA 3A0RB 3E9QA 3O9MA 3R5JA 1AKMA 1D2GA 1I36A 4MRNA 4YJ3B 3B2NA 1TTPB 2YZNA 4J0GA 1Z5WA 2QD3A 3FUTA 4YJGB 4RKYA 3C15C 4YR9A 4YCCA 5JWOA 1UJCA 5E3JA 3BIWA 1XEWY 1OZAA 4HAXA 1T4MA 4D8YA 4B47A 4EJSB 1QOQB 2VYVA 4BJHB 4D56A 1V16A 3T7RA 2J0VA 3W77A 4BMZA 2CT8A 1N5MA 3SEZA 1CJUC 3M2PA 2P35A 2WDPA 3OLYA 3SSNA 2YVAA 4PVCA 4KV7A 4EEXA 2JGMA 4IFIA 3B3GA 5F77A 1RYYA 1E79A 2NUTB 5HEKA 4BNYA 3DBOB 4AG6A 1SC1A 3OCUA 1A9TA 2BP7B 1Y3AA 2YBEA 3A10A 2DKOA 1B8OA 1HOXA 1C80A 2BKUA 4FINA 4JY7A 3OF2A 4S3MA 3QLUA 4R9RA 3EGDA 2G8NA 2PLNA 2XY4A 1P29A 4HUQB 1ZD4A 6Q21A 1JL3A 5KSZA 3LVRE 3GR6A 4MROA 3D4BA 1IFXA 4ZT3A 1WCV1 2GCOA 1XXLA 4CU5A 2BMJA 4JZYA 2BFDB 5L7TA 2HPAA 3KZ1E 4P7FA 3QTBA 4QBHA 5CLQA 1I30A 1PFGA 3DMGA 3OI7A 3I2HA 4RTPA 3IB3A 2RHWA 2IZ5A 4XPIB 3L9WA 1LV8A 1JDVA 3AJDA 3MUEA 2A1UA 2ZJOA 3N6RA 3ASYA 1CJMA 4EY4A 3ZX5A 4UM9B 3RDPA 1E7SA 2FSVC 5CNMA 3WMWA 1IXZA 1DZIA 2AG1A 2XKJE 2YL2A 4F4FA 1U4NA 4N48A 2Q29A 4DANA 5BRJA 5EWLA 5DASA 3FA2A 5LJLA 4QA9A 5C4GB 2ZVQX 4H27A 5KKAA 1PW7A 3SN6A 3ZEIA 1E2PA 3LUFA 3NOOA 3D6FA 1WUHS 3EVGA 3FHCB 2D6FA 4QVGA 1XZBA 2JLQA 4E1VA 3PIRA 2NU7A 3N53A 1O58A 4HGZA 4Q1CA 3LZCA 4JB3A 1MZPA 3L84A 3SEAA 1XCOA 4LFAB 1I7NA 2OCLA 4F6CA 3I9V1 3B38A 4MGHA 1NJFA 2IZ6A 1FFCA 2Y4NA 1G7SA 1IJKA 3UICA 3PUWA 2QRVB 3D43A 1KYIA 4B45A 3NP9A 2TSYB 3PD0A 3CW9A 4DZRA 4MUEA 3H86A 1JP7A 1ORTA 1XYYA 3C5CA 1XFDA 3L1VA 3T3EA 1PV4A 4HEA1 4JVMA 3R7WB 1SD2A 4H3KB 2OXFA 3MPOA 4ZQBA 5DISB 9GPBA 3JS5A 1OX4A 2CJXA 3RVSA 2CNNA 3VOAA 2VBCA 2W71A 3CHYA 4Y18A 2A9RA 2H5IA 1T36B 3HZZA 3DLTA 1UJ5A 1ZOSA 2PZFA 3CLKA 3QA3E 3H0CA 4U7PB 1QYXA 3KE8A 3DVAA 3AUFA 1E9SA 3E2IA 1JIUA 3KAPA 5H3HA 4RDHA 3BF7A 3HBLA 4H7JA 3L7LA 1G7CA 1NJ2A 1YULA 4HPXB 1B6GA 3IGFA 4IFEA 4JXZA 2O50A 1BX1A 3OOYA 1GTRA 5CYPA 4MYTA 2X9NA 3AMVA 5JI3E 1NVMB 1PR0A 2B4AA 3WGIA 1AUQA 4CMIB 1OXUA 4DLTA 3L7JA 5AOCA 5EHZA 1U63A 4UZFA 5IVIA 2BHRA 1Z0UA 3BE6A 3S29A 1MC4A 4U3JB 4IHJB 3QNUA 1WL8A 3GLIE 4JJ4A 1MJGM 3K1JA 5B53A 1B3RA 3PYXA 3VV3A 5EHXA 5K7SA 5IWAB 3RS8A 4IZOA 1PTKA 2ARKA 2QAGC 4B2YA 2ZRPA 1XTJA 5A4DA 3MOGA 4U1RA 5G4LA 3P9ZA 1K68A 2XNJA 2YC4C 3F5FA 3QVJA 2DSTA 1YJBA 2NTYC 3AESA 4JLOA 4P7GA 1P5HA 1V41E 3IIMA 3QYJA 3ST7A 1XO1A 1Y7TA 3DV0B 4HO1X 3RIHA 4I50F 1AKTA 1PRYA 1T4BA 3HYLA 4LS3A 4BE7B 5JCXA 3BILA 3E27A 1WQ3A 2XECA 3GGJA 2PZJA 4J8PA 5FTKA 5JCOC 1ZZGA 1WKBA 3ASZA 2QZ9A 4WUVA 3JQ7A 3WIOA 1FBTA 3ITNA 4EHFA 3OJEA 5AKGA 3T12A 3B9RA 1UBMS 3DZBA 3A6GA 2C2BA 3RGWS 1QBGA 3RVQA 1NVVR 3NEPX 4GIBA 2R6HA 3THOA 4AN4A 5J2UA 3WB1A 1UCFA 4NDNE 3TYXA 3RYHA 2W9XA 1WD5A 2XNHA 1E3EA 1WIWA 2A5LA 4YRLA 4BXOB 2HWWA 1PKXA 3NBFA 2Q5LA 4B40A 1T8WA 1J8DA 2C9OA 3F98A 3PFBA 4TWIA 5F4ZA 3OZCA 3ZWMA 1UK6A 4F6RB 1H9AA 2ZIXA 1IRIA 4LA4A 4MMZB 2CE2X 4DLAA 2X3UA 4ENUA 3SEQA 3C6YA 4R9SA 4DLSA 2A67A 4GMFA 2XUFA 2HQBA 3OCWA 1T5BA 4UULA 1G8PA 1YNSA 3BFXA 4GXRA 4TTJA 5KYWA 2IYQA 3FPAA 5CH5A 2X0IA 4GYKA 3Q85A 3KKPA 3L40A 4FWBA 4XTCS 1I1QB 1UZLA 2HD4A 2VTKA 4M37A 4BEBA 3ZH9B 2FRDA 2QJTA 1GNSA 4TTVA 7MHTA 4KIGA 4I1OA 1UEIA 1QIHA 1C14A 5BSVA 2GGSA 1GSIA 3CWZA 3Q0EA 1XPJA 4H18A 4YMHA 1C41A 3S7TA 4MCIA 3T9FA 3UAZA 4RZUA 4D57A 1MX1A 3KFVA 3DAFA 3TZQA 2BSAA 4Q05A 3HN6A 4LOKA 2XBUA 3W5VA 4PPFA 1I1OA 5U4QA 1L4HA 4ZVUA 1JYEA 1XZIA 5B1SA 2YFKA 4AY2A 1P1JA 2CLLB 2WM9B 4KO3S 3RARA 5JNVA 3DCNA 4FPXA 4JC0A 4C6RA 1CIVA 3QYAA 3UH0A 1G66A 4W7SA 1CEEA 3N6XA 3B70A 2HJWA 2RB5A 3OUTA 2FX5A 1E7MA 1MGPA 3IEMA 1GP2A 1WCXA 2W83A 2VSOA 3BSFA 1ENPA 1HWYA 1BVRA 3MJVA 2YJ4A 3N07A 5LBTA 4CBVA 1RI3A 5BW4A 1V1RB 2WSYB 4S1WA 1E8DA 1W4RA 2PVCA 3BB1A 2OESA 4IIJA 3ZI7A 3WGGA 4F1WA 4BKPA 1G55A 2F8TA 3FFAA 4YAJA 2FMFA 1P75A 4C30A 4UUPA 4KXQA 3FG9A 5MN4A 4OI0A 4FZ5A 1H5QA 1UPTA 2C5LA 3BL8A 1IJBA 2XE4A 2VPQA 2ZE6A 3FVTA 4FE7A 4LOHA 4MDFA 5ALRA 4GZMA 3EY9A 1E1QD 4B73A 4HN4B 4UXIA 2VP2A 3CJTA 1S2DA 1U7DA 4ALMA 4JKOA 3RVMA 3KSZO 1QGED 2FVXA 4XDYA 3GFQA 3EIWA 4MPPA 2MINA 2FWIA 2NGRA 2O0JA 3RBXA 2D8MA 1N5IA 1L6RA 1N9KA 1RBQA 3I1FA 3LSTA 2O7RA 4NPHA 1QVAA 2CYAA 3L1UA 3E0XA 5DGHA 1BHSA 3ZK8A 2OM6A 2D1RA 3KYJB 3B2QA 4YV1A 3SJZA 2Z6VA 5LQKA 4RADA 1E1QA 1YQQA 4CR7A 5LLTA 3RAFC 1YJCA 3MJDA 2YYAA 3LWBA 3P0RA 1SQFA 2ERCA 2V4UA 3VX4A 2AF3C 4ZV9A 3ZHQA 1N2IA 2EQ5A 1KNQA 2IYLD 2QAJA 3GRKA 2JKYA 3PC8C 4RH0A 3AR6A 4M1KA 4EJ0A 1YA6A 4BIIA 4TKLA 2IF2A 2ZYWX 4IUCS 3E8XA 5FOXA 5BT9A 1MA3A 1IQRA 1R6TA 2VWPA 1ZVKA 3AFGA 1NPDA 5TMEA 4ZEVA 3W1WA 2XOXA 3A3YA 5TJHA 1P1BA 2G6TA 2DTEA 3T5DA 3UB4A 1V16B 1QDEA 4N0MA 2J9ZB 5KYYB 3IBYA 2Y1KA 2PUJA 1X8LA 5BWNA 4FFNA 3A2KA 3OOJA 3TMYA 3U7QA 2BI8A 5ALDA 3NONA 1P19A 3N2KA 4ZVPA 3R7SA 1JEDA 1A7UA 1YBAA 2B5OA 3BFKA 1JDTA 3KPVA 4P5EA 3VYRB 3R3JA 1Y1QA 2EFDB 3FFWA 4P2GA 2C5GA 3CF4G 1IXYA 4NAVA 1U5BB 1QH0A 1YZFA 1P9LA 4WEQA 1K7XB 1RCFA 5HA5A 3SBEA 3Q72A 2BJHA 4LHWA 2J87A 4L02A 1QFSA 4FT4A 2VP3A 3OE7D 1RP1A 1CCWA 3G5LA 4PIVA 4EPYA 1G63A 3F8SA 2Q1XA 1ZCFA 1J2RA 1O1YA 2HHCA 1L9KA 1P45A 2TMDA 3T9DA 4RCVA 2C0PA 3U2QA 3K7EA 3OM8A 1U3TA 1LW7A 1XKQA 3RS4A 3WYAA 1TYZA 3ZXSA 4EGSA 3OFNA 3GXBA 1EWYA 3U3RA 1NJ5A 4EBFA 3C5HA 5DYIA 2A1UB 2Q7OE 4NKRA 1ZD2P 1RWWA 2BISA 2PKYX 1Z36A 1GNTA 5EYPA 5JNRA 2EF0A 1Q17A 2ZCUA 2ZYAA 3B9BA 4MPDA 3ZG6A 3REQA 5L6MB 1RI4A 2EL9A 3RRYA 1NMEA 2JH3A 3Q4GA 3PYMA 3AINA 4UCFA 3SX2A 1H0HA 3EFHA 5BWOA 1K7YA 2DH6A 1G2QA 3A37A 3IHWA 2HBYA 4NL4H 1JG2A 1EK2A 3IAS6 5IJ0B 1GWNA 3OPVA 1P2GA 4LJYA 2FR0A 2IOHA 5TVKA 5D8DA 2A0XA 1LLUA 3E15A 4QBGB 3FMIA 1HE2A 1SXHA 3L7OA 2ECOA 1XLTA 5LXTF 1XL1A 4Z49A 3NP7A 2FEOA 3GFVA 2I8CA 3IALA 5BSFA 2I67A 3OZWA 3ACDA 1OGIA 2VSNA 3AIOA 3OCVA 4HFRA 2O8DB 2VDRB 3QLTA 1QGDA 2OC9A 1OA1A 2PRJA 4R1QA 4US0R 1VE1A 3PDJA 4JJGA 2IK8A 2XSZA 4DEVA 3QLEA 4YIHA 4R3UC 3GU3A 3RQSA 4RHYA 4OLBA 5A05A 1S7CA 3C3BA 4RS3A 1EVLA 1KIAA 3C16C 3LHKA 4HQOA 2IEIA 1OX4B 2YMLA 1TGVA 4DL9A 4G0YA 3T9EA 1KMHB 4OBBA 5ECWA 3GFFA 1Z4JA 3MS2A 2WIBA 1EJ6A 3TZLA 4WXRA 1V7QA 1S0UA 4LDJA 4XUEA 1XMPA 2P6PA 3GDFA 1XEXA 5EE0A 4B2LA 3OCJA 4L1KA 4HXYA 2PSDA 5F1PA 3G8AA 2PQ2A 2PWBA 2OBBA 1DRVA 3O75A 2H5JA 3LDHA 1YONA 3LCMA 2SKDA 4IJWA 4FLFA 1FFHA 1JBQA 1AOXA 4IV8A 2YVQA 4N0PA 3O8LA 1JSCA 3JQAB 1TT5A 4C0XA 2PX4A 1JHDA 2ENUA 1YUMA 2HHJA 4INJA 3WL8A 2BFBA 2V6JA 3WRYC 3PWSA 4PSUA 4XTRA 5CMLA 2AMJA 2Z8YA 4LC1A 2LE0A 4ZDWA 3VU1A 2JD0A 1KVTA 2A30A 4HRYA 4BP1A 5A04A 3CJQA 1BHO1 3HI4A 4PLPA 3S0JA 3TW8A 1GG2A 1H1LA 1JUDA 4BX0A 4I2VA 1Z68A 3FSRA 4Q3OA 4QVKA 2XNDD 4YP6A 1ZJ5A 2REQB 1GPBA 2X1VA 5K2OA 4R98A 4DHWA 5C51B 1T2EA 5J4KA 4AMYA 3EASA 3RBZA 4DCCA 1Y4DE 4M36A 4N5MA 3S2SA 2EG5A 4DRYA 5KHOC 4M7PA 5EJ9A 2VT7A 2HIHA 1RXEA 1MB2A 4G9GA 5AM3A 1U3CA 4R7TA 1R64A 1VIMA 5SYMA 5EERA 4JFAA 2XNDA 5L3QB 4BNZA 5BNTA 2QT9A 1P33A 4RV9A 2Q1TA 1BCRA 3LOPA 2NU8A 4MUJA 4P4SA 4QOIA 4GICA 1Z29A 2CK3A 4RYLA 1HTWA 1MPXA 3HFJA 4HV4A 5AESA 2GZ2A 2DR3A 5JRDS 2CNLA 3H7IA 2VUHB 4TS4A 4BKMA 3PRHA 2C2MA 3M7IA 3Q6NA 1ODCA 3HXKA 3MEQA 5I9IA 4BNLA 2XE8A 2YYSA 4K9NA 3OHMA 1JAZA 3PPXA 2C7GA 2WYVA 3AY0A 4BWFB 1KYQA 1X0XA 1GPNA 3KOZA 4ZVRA 4A9AA 5FDFA 3AJ8A 5CB4B 3IP3A 4GZ5A 5GZ3A 2GNPA 3FNQA 3I09A 4NLLA 2II6A 3I5XA 3V9PA 3D6TB 5JT1A 4BVEA 5KYWB 1WQ1R 5EP3A 3CRW1 1GQFA 2DPGA 3TW4A 2IYSA 4MV3A 4CCWA 3VAYA 2ZZMA 2DOKA 5I45A 5IK2D 2EL7A 4RDCA 4PX2A 1K5GA 1TO1E 5KDDA 2C03A 2A0YA 3GZTB 2GBPA 4XASA 1DRKA 3KB2A 3SLKA 3NBMA 1XTSA 3IDAA 4Z7NB 2NXWA 3U3KA 3P9RA 1J8YF 2QOEA 2BZ0A 2PNJA 5IZCC 2DCMA 4EUSA 4ABTA 3C7KA 2Q45A 3G2HA 2JS7A 5L4SA 4PGGA 2P40A 1CHDA 3EVNA 2QL5A 5TXGA 4KHPB 1MX9A 3WK6A 1Y48E 3RS5A 1J0BA 2PZLA 3AX6A 1XYVA 4BAZA 4BNTA 4JHXA 2CBZA 2OV6A 2ZBDA 2I4IA 4DTIA 4OAQA 1D0IA 3C3WA 1GKUB 1CIJA 2XMSA 5KYVA 2O59A 2EWMA 1S9HA 4ZU3A 4H4DA 1JTEA 4IZ6A 2ZSBA 4N6GA 3VZSA 1WPXA 1OV4A 3ENVA 2D5IA 3QA9A 3WIDA 4AZ3B 4BPRA 1YRLA 1AURA 4JU8A 4N47A 5DM70 3L6CA 1SCIA 3OU7A 4RSMA 3SBDA 1FDWA 2HU7A 2QMZA 4FEAA 4AURA 1BD4A 4KQHA 3GELA 2QM0A 3MMNA 2ZTHA 4GLFA 4MVJP 4UPVA 1DC5A 1GSOA 4DDVA 3OQHA 2MMGA 3ZGZA 4QYSA 4WXPA 4Y9TA 1WDWB 3ZJYA 3ZWQA 1G98A 2Q0QA 2WC1A 4CDNA 2PN1A 5GONF 4AZVA 1O94D 2QTAA 4H17A 4UC0A 1LDNA 3DD1A 2GHRA 4ZYZA 4FKMA 4WBNB 2GPSA 3ZHRA 2O8EA 1LJUA 1FDSA 1XTTA 1ODTC 3ADDA 1DXHA 3I9FA 3V46A 4AROA 4MTLA 1PJQA 1Z35A 2WZBA 5EQTA 4TWRA 4CM9D 5K6RA 3RTAA 2C2XA 3IR5A 2FXIA 3MJEA 2VT3A 4CW7A 2FP4A 4X0EA 1TJNA 5HIMA 3IKVA 2AFRA 4OJMX 1O94A 3EQ8A 3N2GA 1FX0A 2XGOA 4S04A 3BXFA 4ZFNA 4NNJA 4BAUA 4TRNA 2PJZA 1XP8A 4N82A 2PSJA 3H2HA 3ZY6A 5IMSA 3AERA 2ADFA 3JQ8A 3F97A 3KUXA 2GAAA 1FC0A 3PTZA 1JFSA 4J0KA 4O2AB 1Q0UA 4JUFA 2IPXA 4R8MA 4JC5A 5ETJA 3UCFA 5L95A 3IMCA 4BV8A 3LT1A 4G5RA 3TOXA 4DRXB 3TSYA 1Z5PA 4F11A 4RKFA 5IXYA 5LU8A 4LRXA 1ZKDA 4RQAA 4A82A 4F7DA 1KDTA 2QG6A 3QOFA 3EUAA 4Y9DA 3UK1A 4E3ZA 4GMDA 1CDEA 4A6DA 1JWAB 2Z4TA 1LQ2A 2H0QA 3W5DA 3KZNA 5I9MA 4CTNA 1FYVA 1CUEA 1N0WA 1SVIA 3LQFA 2DFTA 3NWJA 3PHJA 4DLYA 3N2KB 3WV5A 3KVVA 4ERNA 1CJVC 1YXMA 2J48A 3NPMA 4UVGA 5IVKA 5MGBA 2RJNA 1ZP6A 5DBGA 3ZIUA 1EM6A 3UAXA 2HT1A 1S2IA 2PS9A 3H05A 5JZMA 2I7CA 4P0QB 2VJKA 3NVAA 3B85A 5EESA 3LZ6A 1Y81A 3ZGXA 2J0QA 1G291 1P9RA 3FTEA 4QFMA 3K0AB 3SZOA 4S12A 3IUSA 2EJWA 5F23A 1FL9A 1UWLA 2P2DA 2A59A 4MI3A 4J3NA 1X39A 4UUOA 3UK7A 3JPYA 2QJWA 4P32A 2X3FA 1W25A 1XT6A 3SR0A 5KREA 3I2GA 2AL7A 1V4VA 1AHHA 2FMHA 2I3GA 2J0EA 3BK1A 2QRZA 4LZWA 2OCGA 3VO1A 4YWJA 1IVYA 1JDZA 3OOHA 4BE9A 1J8FA 4EKIA 4C14A 3AQ4A 2O8BA 1XEFA 3A9WA 3I6YA 4L0QA 3KDPA 5EVCA 1EHIA 3RTCA 1G9XA 4CLRA 3KU4A 4KQKA 3HVIA 2IOQA 4REQA 4Q4HB 3CW8X 5JBIA 4PZPA 4IJUA 2W6CX 3KXIA 4C7JA 1DLJA 4DRZA 4JBGA 5C4IA 3SE0A 2Z6UA 4ZYUA 1B76A 1OV6A 1G8YA 2OWEA 3LX8A 5LQRA 3D02A 3REQB 4R1TA 3DYIA 2GERA 3IP8A 3FMFA 2AUNA 4KITB 3WK5A 5BMVB 2ZIWB 2V6IA 4PFSA 2H08A 2QRGA 1KMNA 2PSEA 3T4UA 2EDCA 2Q6LA 1SD5A 4BMOB 2BR5A 5YASA 2ZT7A 2IODA 1Y7LA 2FFAA 3VZRA 1R9JA 1WXXA 4I50A 4OHYA 3DE4X 4QTYA 2BI4A 2BGJA 1Q50A 4Y6SA 1AUXA 4G1FA 5EXEA 5GZ6A 3WNZA 5AIBA 4GM1A 2K2WA 1GV0A 1RM0A 3B1XA 4FEYA 4B6JA 2QN6A 3B1WA 4GPD1 5EWJA 3KQPA 4Q3KA 1CLUA 1PYDA 4Q00A 1LNSA 4FWTA 4YXWD 1CRZA 1EEXB 1KOJA 2PRYA 1GD1O 5DSXA 4EJMA 3E22A 4JVSB 4FCWA 4U8HA 5E6UB 4BO7A 4EHIA 4U2FA 1M7BA 2SICE 1KPHA 3DYBA 2ZJBA 3WYDA 4C2TA 2NVBA 1OAKA 1FTYA 2OHIA 1PL6A 2ZJ2A 1SHLA 3EMKA 3GJQA 5AVKA 1L8XA 4HX9A 4TV9F 1KH3A 2XMGA 3H4VA 1RWVA 4L9AA 3JW8A 2B37A 3E0QA 3MYRA 4YR7A 4HNVA 4AYXA 4NU0A 4AMZA 5F2EA 3FDXA 4B6FA 2ACWA 2ODQA 3HO6A 4FLEA 3G0BA 4JV5B 1AXGA 3QPBA 1H05A 2CSUA 4IHKA 5CA1B 1IBLB 2C4MA 1KKUA 4NBWA 1KK1A 4NZOA 5F4BA 2QQGA 2Z43A 3ZLVA 2BC9A 4M46A 4YO7A 3I64A 4HDAA 4RHXA 2J46A 3E6AA 3V32A 2WOJA 5JAOA 1P5JA 1U0HC 1VE5A 4WCVA 2OPHA 8GPBA 3CCFA 4RHUA 3SGLA 4MKXA 3TW8B 3HWSA 3IJRA 3HPQA 3ZU5A 1D1TA 3NGXA 1NI5A 2IY8A 3PGJA 1TFUA 3PV0A 4MR8B 3BPSA 4DN6A 1EX6A 1TQDA 4PIMA 5AQ1A 1AGXA 3E3NA 3GHYA 2C99A 1O03A 2Y1OA 3TXXA 3N2EA 1PNTA 4BGDA 4XI9A 3RRZA 2EDAA 1A1SA 1PG2A 4OHFA 3AZOA 1UMBB 2HIMA 1EYZA 2D5AA 1CVIA 3F6CA 1Q7TA 4LDNA 4QUEA 5CTJA 2F4NA 4ALJA 2Z08A 1JX6A 1NF9A 2O2DA 5LFAA 3MUOA 4ARIA 2JFBA 1Z82A 5IPFA 2QY9A 1EK1A 1BCRB 3P96A 2NU8B 3TH5A 4CMEA 2ZROA 4P4SB 3V8EA 2J3IA 1K5HA 4RD0A 2C2HA 2ZE5A 2ZBGA 4W6ZA 1GUBA 1VBMA 4IEEA 2OCDA 4CUJA 4E51A 2ZVPX 4CNBA 5LC1A 1FUIA 1DEAA 1FYWA 4IVQA 4G8DA 3LLVA 4KE7A 4KMMA 1U0GA 2BFOA 1AS2A 4B31A 3R8FA 1L4UA 3SJUA 1U1EA 1SFRA 3OX2A 3T1NA 1W581 2X5NA 1XZ8A 3AHGA 4RJLA 5FOSA 5HIJA 3MRXA 4WCFA 2D1SA 1RHKA 2E2WA 1VHLA 3DO5A 3LC2O 1V8FA 2CB0A 4X41A 3ZXUB 1VSVA 5TB5A 2DLCX 1C4WA 5HBRA 1BKYA 3SZUA 2GEBA 1SAYA 1LK0A 3NI2A 2QGFA 2H52A 3ODPA 4BCCA 1U7WA 5FTNA 4GDFA 5CRIA 3OPNA 1HDIA 1H2EA 1RLIA 3ANYB 4IEIA 3TNLA 3UUFA 1UQTA 1BU8A 1RM4A 1TLLA 2RGCA 3P0EA 3PGLA 4RLSA 4EYGA 5C52B 1VMDA 5KOJA 1L7DA 1MH1A 1U8TA 4QKQA 1N2GA 4DNFA 4Q1DA 3CUVA 1M2WA 2PTHA 4FYPA 1XA0A 3JASB 4J0FA 3A6FA 2AEEA 4Q37A 3OEHD 3NUGA 1DJQA 2E5WA 3GMSA 3FBTA 4B4DA 3EZXA 2RAPA 2OPBA 1EFRD 1BXKA 2H9YA 1T24A 1SCJA 4A92A 3AG6A 3AT1A 5DN9A 2E4AA 5FWXA 1QKKA 1OZFA 1KMMA 3LHIA 2CXUA 1K9VF 4NABA 4PGAA 1Q7CA 5BUQA 1KSHA 2H2GA 2J5RA 3ZHZA 4XSHA 1J09A 4G23A 1E9AA 4KE6A 4K6CA 3OX3A 3EXHC 2OXCA 4PX3A 1ETHA 1ZM3A 3HH8A 1I3NA 4O2BF 4IVPA 3DBLA 3SJBA 1MENA 2ATVA 2W0SA 1EA7A 3VU9B 2ZUFA 4FNGA 1T15A 3LO5A 1L5VA 2G76A 3I12A 1GLGA 3PHLA 3ZWOA 3UT6A 2UVDA 3I37X 5GV7A 2B61A 3PJDA 4BE4A 4RK5A 4CI0B 3I83A 3KM0A 1TCVA 2R65A 4HWRA 4YQZA 2B98A 1XNHA 4WKPA 1T9KA 2WY2D 3EMBA 4KW7A 1VL8A 1RC1A 2VK1A 4Z4CA 1KKLA 2DPYA 5B2FA 4MKZA 2ZYRA 1YU6A 3OD1A 1GXSA 2O8EB 3OZXA 4CKCA 4JI4B 2CWDA 1C7RA 2JVIA 3AOGA 1MW8X 2XQIA 2W8ZA 1L5FA 1EWRA 3ZCQA 1ZA1A 1IWOA 3G68A 5LZ5A 1QRTA 1O8BA 1QO0D 3SKYA 4J1QA 3TX2A 5CDGA 10MHA 3N2GB 1FX0B 4JSTA 1XMQB 4PONA 1KSFX 5IAOA 4PLWA 3IV9A 1QPZA 4W5TA 1YRYE 5IX8A 4TYWA 3JQ8B 1R0LA 3UK0A 4D92A 2P6MA 3CVWA 1B42A 2AOUA 4RACA 1HSOA 3C7AA 1X1DA 1VHQA 2D2VA 3BFPA 2G1KA 2IHUA 2J7PD 2IQIA 2Q3LA 3EGEA 3PHIA 4PZZA 1KEEA 3ETGA 1CVRA 1BW9B 5LIRA 4RF5A 1E8NA 2VJMA 4HUTA 3E1GA 3KALA 2RHMA 1B14A 3T0GA 3PNPA 5LXTA 4ID9A 3DFIA 4EI2A 4P5DA 1S2MA 2O8CB 3NYWA 1TA4A 5K6AA 1V39A 1AF7A 4ZZ3A 2RGXA 4A8JC 3WRXC 1SQ6A 5FV7A 2XUDA 5FBVB 5K09A 4HLCA 2J7PA 4XIJA 2XQKA 1PDWA 4JR2A 4C4XA 3GUHA 5DHUA 3U49A 4PAGA 1TIPA 2GZRA 2JD1A 4F60A 3FVVA 3RK0A 3TCXB 3RSOA 2WZQA 1EWQA 1RPZA 2XWJI 3T3GA 3UWDA 4TL8A 3ZE7A 1GYPA 3EWSA 4OHZA 5JADA 4NMMA 5KSWB 4BNIA 3O9ZA 1E0SA 1M6EX 4BNJA 4TKUB 3GNSA 2WV9A 3RFTA 121PA 1WWKA 4B4WA 1XLUA 4I3HA 4KFUA 4OHVA 4U7FA 1R9MA 3AEUA 1D4ZA 1OYVA 1PK9A 1ZJJA 2J7KA 3R24A 3NUQA 4FYKA 4TXMA 1ZD9A 2W6ID 2AC2A 1V37A 4K0KB 3TIXB 3NHAA 3ZDXB 3WYBA 1U1CA 2F59A 4JDPA 3AXSA 1BYIA 2H2WA 3IAUA 4NCJA 4YP1A 2O8BB 2QMUA 2UUOA 2JAOA 4UAUA 3IA2A 2WIFA 1Z56C 4CLRB 1XZFA 4LOIA 2HEIA 3BIXA 3QVVA 4DYHA 1SUAA 1IM2A 2WQ6A 4YP0A 3E9RA 2DWOA 3NC4A 1UMKA 2CMGA 2WSSD 1AA6A 3OFSA 1KIMA 3VOSA 2NP6A 1W19A 3PXAA 5FTMA 3V7WA 3RLIA 3PFNA 2R7LA 3DOIA 4XLTA 5FQOA 3B51X 3N2YA 3AYZB 5KQRA 5JCPA 2R6FA 3X0DA 4QNMA 1Z0KA 3BG5A 1YKGA 2EFEB 4EUFA 4QTUB 1ESCA 4QARA 4ZI2A 2WSSA 5HILA 3UY4A 3MFQA 4M1MA 1JR3A 4IHAA 1JQ5A 4L74A 1WCIA 3ABZA 4HDKA 1M1YA 4C05A 3DW3X 1H0KA 2GZMA 1P0IA 2OFPA 2OZLA 1FYXA 4LXUA 4CPDA 5CIYA 1UMCA 3CH5A 1YUNA 1US8B 1SG0A 4P3PA 2JBWA 1LGYA 3FBGA 4XAQA 4U6QA 1WV0A 2R6R1 2J09A 1C1DA 2AQ8A 4H1HA 4J43A 1E4VA 1K89A 1U2EA 3KOYA 2FZCA 2IEBA 1ZU5A 4TGLA 3CLTC 4MKFA 5DHTA 2D3WA 1AM4D 1QO7A 3EGVA 5HG0A 1ARZA 2N42A 4OFZA 2HF7A 2RK3A 3X1DA 1TKRA 5AI0A 5HM8A 3R6WA 4FGJA 1AKYA 2X8JB 2BEKA 3SHQA 4UBLA 2WHYA 3AR7A 4LXHA 2DZDA 5FOTA 3PT9A 1PJ2A 4RTLA 4HC4A 1DVRA 3FXAA 4HWOA 2DGDA 1CUJA 1NW7A 1OI3A 3JPWA 3JTMA 4ON9A 1F1BA 3SXUB 3RT9A 3I4CA 5FH9A 1YACA 2V74B 1OB2A 2PV0A 4PX5A 5JMPA 1R00A 2E55A 2KBEA 2K7ZA 5ALQA 1BDMA 5C53B 3PE6A 4I19A 1DBQA 1Q22A 2BGNA 1KYZA 1OBOA 1T1EA 3BE4A 4AG5A 4QHTA 2P65A 1W4BA 2OT3B 1XRNA 4JBHA 4MIOA 4ND4A 2G4LA 3GWGA 2HV8A 2AJBA 3TEFA 3TCNA 4H3VA 2D2EA 1KH1A 4KXLA 2Y1WA 1A9QA 3R77A 4NOKA 1WB9A 1NJGA 5KYUA 1KU0A 3HRHA 4F2GA 2QTVB 2RH8A 3H4TA 4DY6A 5EIXA 2IW1A 3AM1A 5JRJA 3JWGA 5JDIA 4C0HA 4KE8A 3RS0A 2GZ3A 4HEJA 1QLWA 1ZJYA 3NM4A 4ZARA 2EBWA 1Z4NA 2GXUA 2A5FA 5EI5A 4G5XA 5JYBA 1Q19A 2VP5A 3H5RA 3IAFA 2UZAA 3SY8A 4LF9B 3D8UA 3OSZA 1R0WA 2FR8A 2OO7A 2DY1A 3A36A 1Y98A 3HYRA 4KTVE 4KRYA 4N0QA 1X2EA 3H2JA 3ZOKA 4BWVA 2P2LA 1W5FA 4Z3KA 4HQ0A 2RMKA 5FX2A 2FFJA 5TMBA 3F46A 4DLLA 4M1TA 3CX6A 3JD1A 4NU8X 2JCBA 3H0EA 4EM6A 3U6KA 5K0ZA 4ND7A 5GONA 4D9IA 2XLBA 3DAYA 2IYPA 3RFUA 4OK6A 3LPDA 3R3HA 4D8WA 4I14A 4FSXA 2YZ2A 3L8FA 1KO7A 3AW8A 5HFJA 4DQUA 1Y1RA 2E6UX 4D6PA 1X7ZA 3MWEB 1VI6A 1NULA 4D6YA 3EBOA 2QDXA 3B9QA 3PD1A 4GOKA 5G0VA 2UXDB 1GGKA 4RK6A 3CO0S 4RVHA 5FADA 4EG3A 3CEJA 1CEQA 1HTTA 1Y5NA 3F78A 3N6VA 1KO4A 1V3QE 3UK2A 2AMFA 1ZJ4A 5CAEA 4AKIA 2HSWA 3SZRA 5B6JA 1N2CB 4KMRA 2QUJA 4CKYA 1F48A 4LXTA 5FUQA 5IF3A 4CEJA 1VG9B 2BBTA 2ID4A