3WNQA

Crystal structure of (r)-carbonyl reductase h49a mutant from candida parapsilosis in complex with 2-hydroxyacetophenone
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
335
structure length
335
Chain Sequence
SIPSSQYGFVFNKQSGLKLRNDLPVHKPKAGQLLLKVDAVGLCHSDLAVIYEGLDCGDNYVMGHEIAGTVAAVGDDVINYKVGDRVACVGPNGCGGCKYCRGAIDNVCKNAFGDWFGLGYDGGYQQYLLVTRPRNLSRIPDNVSADVAAASTDAVLTPYHAIKMAQVSPTSNILLIGAGGLGGNAIQVAKAFGAKVTVLDKKKEARDQAKKLGADAVYETLPESISPGSFSACFDFVSVQATFDVCQKYVEPKGVIMPVGLGAPNLSFNLGDLALREIRILGSFWGTTNDLDDVLKLVSEGKVKPVVRSAKLKELPEYIEKLRNNAYEGRVVFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (R)-specific carbonyl reductase
publication title Unconserved substrate-binding sites direct the stereoselectivity of medium-chain alcohol dehydrogenase
pubmed doi rcsb
source organism Candida parapsilosis
molecule tags Oxidoreductase
total genus 100
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wnqA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3wnqA01
2NADA 4R5MA 2I99A 4G81A 1DHTA 4C7JA 1WAMA 2OFPA 5KVVA 1ZKMA 3VTFA 3BMCB 3FRJA 4RLSA 3DZHA 4JIGA 4R9SA 4QTZA 1T1RA 3GAZA 1DC5A 4ND5A 5JSFA 4NU6A 3MJ4A 4ZQGA 1HDYA 3ZWOA 4YBZA 2ZCVA 1DIRA 1ZH8A 2G17A 4GWKA 2ZB3A 3DBLB 3H6KA 3GNSA 5KVCA 2UUPA 3AI2A 1YL5A 4JBHA 2X8LA 2P4HX 2ZYAA 2QZZA 1NQOA 4FSHA 5JDCC 1BVUA 1N9GB 4I5FA 5C7OO 4OO3A 1DIBA 1Z7EA 3UGKA 3AU9A 4WNIA 3MZ0A 4CQMD 1GAEO 4GX0A 4NFHA 1P1KA 4W4TA 3UN1A 4O0LA 4K26A 1X7HA 2PV7A 1J4AA 1DFGA 1T4DA 1EVIA 3IS3A 5JO9A 4DBVO 3WTCA 5KNLA 2EGHA 2R2GA 1QORA 1WW8A 2H9IA 4L0QA 4RO0A 1C3VA 4Q3NA 2X0NA 3H8VA 2G5CA 3U49A 1EK5A 3GLQA 3DAPA 3WNQA 1GYRA 2CSUA 1GPDG 3I83A 1G0OA 3GZ4A 5A4DA 3E5RA 1MXHA 1DSSG 5IDXA 3C7DB 2PH5A 2XPCA 3AI1A 1VSVA 2DBRA 1HRDA 4BO1A 2VOJA 3U09A 1QLJA 3F5QA 2CDBA 1EQUA 1TI7A 4D0RA 3CE6A 5IN4A 3RASA 3WB9A 2YDXA 5IZCC 1E7QA 1P1FA 3UAGA 3ORFA 5COAA 4S1VA 1R37A 1C1XA 1DIGA 5CDTA 1C0IA 1XSEA 4CV2A 4CV3A 1P77A 1LSSA 3JQDA 3MJSA 1V8BA 1QV7A 2LDXA 1ENZA 4WEOA 1UXHA 1PU2A 3ABIA 1PZHA 1R66A 1UP6A 1LQTA 1LU9A 3FHLA 2VRCD 3DTYA 1ZXBA 1HYGA 4XEHA 4CL3A 1X7DA 4Y8VA 5AXBA 3LC1O 4R1NA 2VHYA 2NU8A 1D8AA 3ZV4A 2GZ3A 2VUUA 4WCFA 2O3SA 3I9JA 3NAQA 5DULA 2NUAA 2IYOA 4P4NA 4XYGA 2AQ8A 2AEMA 5BR7A 1KVTA 4TVOA 3RUFA 1OOEA 5JY1A 1HE4A 4XRGA 5I8WA 5BT9A 4M1QA 4JP2A 4J1QA 4YJGB 1CERA 3RVDA 2FR8A 2AE1A 2OMEA 2JCYA 5A06A 2HK8A 3WFJA 5DOVA 5CDSA 1C14A 3AUSA 1O6ZA 3QVXA 4M86A 2HJSA 4PLZA 3BAZA 4B7UA 3GNQA 4G65A 3ASUA 3VVBA 4YAGA 1T26A 1WDKA 1BGVA 1GZ6A 4UUPA 4GKBA 4IDEA 2B4TO 4K6FA 1PS8A 4RQUA 1U5AA 2AHRA 1JKIA 2PGLA 1GYQA 1EVJA 1YQDA 1RKXA 4DVJA 3MJTA 1FDSA 4I9HA 5KIAA 4XQEA 2PA3A 3BTOA 3PRJA 1RM4A 1UAYA 1E3IA 3BA1A 1K6IA 1PX0A 2JD2A 3CPSA 5JAIA 4D3SA 1B8UA 2VTDA 4E30A 4R3WA 5KTKA 4YR9A 1YBMA 3DQPA 4QFDA 4YXFA 1KYQA 1K2WA 2DTXA 3I9LA 3I4FA 4BQRA 4RPHA 3ZNNA 1HYHA 4BNTA 4WPGA 4YT5A 5LC1A 1OC4A 2A9FA 1WDLA 1X14A 4M55A 4K6CA 3ZHBA 4X54A 2YFHA 4TQGA 5T6BA 3TZCA 4CM4A 3ZCXA 3TJRA 3UKOA 4AJJA 5EQDA 1MB4A 1LLDA 4MIOA 1BWSA 1XELA 1DBVO 5DP1A 4YJFA 4RPLA 3NYWA 1IE3A 1Q0LA 4CUKA 4BNVA 4BO2A 1CF2O 3RFTA 1B14A 3E9NA 4PG5A 3FWZA 4CPDA 2DC1A 4DGSA 1QKIA 3JQ7B 4NBRA 3H5NA 3BTUA 1WMBA 1SPXA 4Z3KA 5MDHA 1JWAB 3A1NA 1HETA 2O3QA 4O59O 5JAQA 5TGDA 1D1SA 4W9NA 3ROKA 1UDCA 3EVTA 3DHNA 3OJOA 1M6WA 2B4QA 3P19A 4FR5A 3OHSX 4Y67A 3NX4A 5JNLA 4AJ2A 5TS3A 5IF3A 5JY6A 2I3GA 2GR9A 2FSSA 4OL9A 3VTZA 4IDDA 4JBIA 3N74A 1U8XX 2V7PA 1R0LA 4RVUA 1Q7CA 3M6IA 3F9IA 1IB6A 4ZA2A 3QV1A 4JBGA 4BNMA 3NDIA 1I10A 3EY4A 1PJ4A 1E3JA 4JXKA 1J49A 4OKIA 2BI8A 3ANLA 4NMHA 4UVHA 2Q1SA 5AVOA 4HWKA 1TT5A 3CTMA 3VZRA 1X1TA 2YQ5A 5ENVA 3I3OA 1U3WA 4HUJA 2OP0A 3PJDA 1HLPA 2PR2A 4UEJA 3JQAA 4NJOA 2UAGA 2IXBA 3PFWO 4EUEA 3ASVA 5G4LA 3H9QA 1T2CA 5KKAA 1U5CA 2X86A 1A4IA 1KERA 4Q3EA 4XKJA 1DXYA 2ZYGA 4AJLA 4J4BA 3DL2A 1U7HA 1YKFA 4CMKA 1KEVA 1K5HA 1D4FA 1H94A 4MKRA 2E48A 1FDUA 4I8XA 5JDIC 2DKNA 2NU6A 4NBWA 1DRVA 4WLVA 3S2EA 2IZ0A 4GH5A 2DTEA 2JAPA 2O48X 2CVZA 4BO8A 1E77A 1OAAA 2UUOA 2VCYA 3OMLA 3UH1A 4UEOA 1XQ1A 4AICA 1F0YA 1NAHA 3C8MA 1CYDA 2CF5A 5CG2A 2OO5A 1ADGA 3AFMA 3OH8A 3KTDA 3HB5X 1FMCA 4GX1A 3QY9A 3EMKA 4J4TA 1LRLA 1W4ZA 3AUAA 4QO7A 3QIVA 4YAKA 2E82A 3PFFA 1OFGA 4E5PA 3GFBA 4EDFA 1NWHA 3JD2A 3NRCA 2W2KB 2AW5A 4D3DA 3EDMA 1YOVA 3VH1A 5KKCA 1JN0A 2C2XA 1YH3A 3TPCA 1B26A 3KVOA 4JNKA 3QQPA 2Q2QA 1YJ8A 2ZQZA 2ZYDA 1OMOA 2BGKA 5B12A 4TZKA 1B8VA 3BMNB 3B1JA 4UVGA 2CZCA 5G4KA 2CVOA 3WGTA 3SVTA 4ZQEA 1E3SA 3KLPX 2O4CA 2EXXA 2W4QA 1VSUA 4J16A 1XU7A 1ZK0A 3BHJA 4RZIA 4ILKA 2Y93A 4XX0A 1MFPA 4I5EA 3PWSA 1LRJA 1M75A 2C07A 3S8MA 1GQYA 3B6ZA 2ZTUA 3DBRA 3DR3A 4BGVA 1E7WA 4FFPA 4IZIA 1ENPA 3JQBA 2GPTA 3GNTA 4EUHA 1ZJZA 4D0SA 1JLLA 3Q11A 5BNTA 1XDWA 4E5KA 5KJ1A 2QG4A 4XGIA 4AJEA 1F8GA 3OJEA 3DOOA 5L45A 1GU7A 5FI3A 3VOSA 5BSFA 3UCXA 3R0IA 2YFQA 3V1YA 3IP3A 3L07A 3WLEA 2OBNA 3CXRA 1YE3A 2W2KA 3DZJA 3D0OA 4C4OA 1BW9A 2Y99A 5COQA 3DFZA 4CMEA 4DMLA 2TMDA 4DWVA 6LDHA 4BMNA 1QSGA 2PD4A 1BDBA 1J6UA 4Z3DA 2EJVA 4YEDA 1NAIA 4GX2A 3PEFA 1VL0A 1LLQA 1Q1NA 2WD7A 3JYOA 1DJQA 2GN8A 2JHFA 4W7HA 2VHZA 4DIOA 4FDAA 3P2OA 4MVJA 2VQ3A 2YZ7A 4MVJG 1EMDA 4YACA 3LK7A 2BRUA 1RYEA 4OGWA 2J3KA 1KVUA 2AQHA 4FJ1A 2NVWA 1K0UA 3Q1LA 4GMFA 1QRRA 2GNAA 5T5QA 4MO2A 4BNNA 3FNHA 4J3FA 4LGVA 3I23A 1ONNA 2CUKA 1X0XA 3VKVA 2EW8A 1PQUA 2P5YA 2AG5A 4JK3A 3ICCA 5IXYA 1E6EA 2X23A 3Q9NA 1M67A 1NP3A 4FOOA 1IL0A 2VTEA 2GCGA 3D3WA 3ITKA 4IDAA 3WNVA 2NU7A 2VWGA 4RF2A 2IODA 3MJCA 4A27A 4JN6B 4YRDA 1C0KA 1PZFA 4J1NA 1G0NA 2JCXA 4QXMA 2C5AA 3LDHA 4UVDA 3RUIA 2JKVA 2RH8A 2XAAA 1LBEA 1KIFA 4KQXA 3HN7A 2Y1OA 4IIUA 1E7SA 3U62A 3QHAA 1B8PA 1LLCA 4P4LA 1NPDA 4KWIA 1HEUA 1AUPA 1JVBA 4ITUA 1RWBA 1ONOA 3NT5A 3LVFO 2CF6A 2C59A 1U3UA 2UV8A 2OBYA 4DQUA 1OC2A 1IPFA 2A35A 4MVJI 4TSKA 4U6QA 1XEAA 1EBUA 3K96A 4B3HA 4I1IA 4ID9A 1E5QA 1LJ8A 1SB9A 4J6FA 5DCUA 2CVQA 4BS9A 3TDKA 2BF7A 1YL7A 3PDJA 3ZU5A 3ZWWA 3PLRA 1GTMA 3FR8A 4L9RA 3V8BA 1HDOA 4EITA 4IUYA 1BSVA 3H65A 1Z45A 2YUTA 4XZ3A 3KM0A 1HDZA 1PGPA 1H0KA 1MG0A 1SOWA 1VKOA 1ZK4A 3WG9A 4Z9FA 4BO9A 4BO5A 1I3NA 4WLUA 4L75A 1DC6A 1E3LA 5G0SA 5J23A 2XOXA 5JYDA 3KEOA 2G1UA 4O5OA 1Z7BA 2DPHA 2DT5A 4XD2A 4GVLA 1F17A 1I33A 1ULSA 3ANMA 4MKXA 3ONFA 2NU9A 1QYDA 3AM4A 1I0ZA 4HFNA 1UUFA 5IAAA 5A05A 1PGOA 2HK9A 1H9BA 2ZIZA 4J2OA 5ES3A 3TOXA 4Y9DA 2E37A 1VRWA 3LF2A 3FPLA 1EDZA 4MP3A 2NV6A 1PJ3A 1U9JA 2I65A 4OQZA 3TFOA 5JMPA 4XR9A 4A7PA 5TIIA 4YCAA 3V2GA 4N5NA 3HB4X 4FC7A 5TRTA 3LLVA 3I6QA 4JX8A 1SAYA 2D4AA 3BMQB 3WWZA 3GZNA 4JP3A 3KYBA 5T8KA 4MDHA 4IM7A 3NGLA 3PK0A 1EEHA 2JJYA 2RBEA 5F1PA 1NQTA 3ZWCA 1HTBA 3OEYA 3P2YA 4KOAA 4GVXA 3LC7O 1I24A 4EUFA 4D7AA 2OZPA 1GUYA 1SB8A 4CV1A 4CM8A 2P5UA 3QWBA 3OP4A 3KZVA 3GH3A 1E1NA 3ZWVA 3IP1A 1HYEA 3LQFA 4O63O 4Q3DA 3ITDA 1H6AA 3QRWA 3GPDG 3RFVA 1JW9B 2VZ0A 3KYDA 5A02A 3GGOA 2IXAA 4QX6A 4PVDA 1FDVA 5ILGA 1GDHA 2G82A 3CUKA 5KVSA 1XKQA 3P7MA 3ROQA 4D3FA 3K5PA 1YRLA 3Q6IA 4PG4A 1NTOA 3VZSA 4TRMA 1A27A 2RHCA 3CIFA 4PLHA 1OI7A 4LSWA 5JFOA 2Q4EA 2JL1A 3WX0A 4A0SA 4YJHB 4FFOA 3RBXA 1SO8A 1F14A 3FTPA 1Y9AA 3E03A 3TZ6A 4LW8A 2B5WA 1UP7A 1I01A 3DHEA 3GQVA 3PDUA 3UF0A 4F6CA 4ZQHA 4BV9A 1PL8A 3ZU2A 1UR5A 5KJFA 3WGYA 2XF8A 4CMIA 4XDYA 4HADA 3WR5A 3EAGA 1YBAA 5L9AA 3JD1A 2NNLD 4NK4A 4WOJA 4C7KA 1KY4A 4XJTA 3U3XA 1ISMA 4XYLA 1BHSA 3IAHA 3CZRA 4CM9A 3LF1A 3KUXA 3NT4A 2EP7A 1N1EA 3GVCA 4BMSA 1NR7A 2D5CA 1HZZA 1EE9A 2GN6A 1NVTA 3H2SA 1XG5A 4ONEA 4YA6A 1LRKA 2VT2A 4AJ4A 4BKPA 5B4UA 2GLXA 5K0ZA 4GLOA 1ARZA 4F46A 2I67A 2QHXA 3UOGA 3W8EA 1XQ6A 3QA9A 2J3IA 3MOIA 3STHA 4LISA 2C7VA 1BRMA 4PZDA 1B3RA 2Y0EA 4RJTA 4ND2A 1KC1A 4AJNA 2PTGA 4NFSA 3TL2A 3RBZA 3LSYA 2PY6A 3GDGA 1AHIA 3MJEA 3PQFA 1C0PA 2OGUA 3B70A 1IZ0A 1KY5A 3JD3A 4CQMA 4CQLA 4NHEA 3X2FA 1ZNQO 3HJAA 1NQ5A 3JQGA 1LDMA 1E7RA 3L4BC 1NQAO 2JHGA 3BIOA 4PG6A 3FTNA 4B4OA 2FR0A 1Y8QA 3GC6A 4OHUA 3LYLA 2V6GA 1PS0A 4B3IA 4Z6KA 4W9NC 4KUGA 3D5QA 4DLLA 4WASA 3JQCA 4XB1A 3E82A 4ZN6A 5G0WA 3JD0A 4EYEA 2GSDA 4FCCA 2I9PA 4LMPA 4N5MA 4BMVA 4F6LA 1ZVMA 2WJPA 2NTJA 4FOSA 4FS3A 3DBVO 4XWYA 3RI3A 4B4VA 3ETGA 1OZAA 3VVCA 2EHDA 3PIDA 4Q3BA 3QJ5A 4KP7A 3WLFA 3HDQA 4R69A 1HDXA 3RIHA 1RM0A 1K3TA 2HDHA 4RDHA 3ZV3A 1C1XB 1JWBB 1R4NA 1VKNA 2X0JA 1HXHA 2VRCA 5A3VA 3VC7A 4NI5A 1LEHA 2EGGA 3H7AA 2NTNA 4E2ZA 4QO8A 1B2LA 2O7SA 5KJCA 5L4LA 1NXQA 3A9WA 1YB4A 2DFVA 5F21A 3AFNA 3B1KA 2P9EA 3FSRA 3HZZA 1T1SA 2WM3A 2D0IA 3PHHA 2VYVD 5FF9A 2EF1A 4WCFB 4J49A 1Y9EA 2NVBA 2PGDA 3I1JA 4NJMA 4OSPA 3RFXA 4DREA 4YRBA 3S2FA 4TMFA 5EINA 2X1HA 3AOEC 4LMRA 5C5IA 3PQDA 2B37A 5DN9A 5THQA 1NWCA 3UCEA 4BL5A 4TROA 1U1IA 1WZIA 4R54A 4ZU3A 3VDRA 1UZNA 5DCWA 4NH4A 1NPYA 4IJVA 3UCFA 2C54A 3JQFA 2ZTMA 1DFHA 1K89A 5KVQA 2ZATA 1GPJA 4CV0A 3L6DA 1O89A 2QRLA 1W8DA 2X5KO 3GGPA 4QSMA 3SLGA 4XJSA 4L74A 1Q7GA 4Q39A 4XQ9A 4BHTA 1QG6A 1ZEMA 4QEDA 4CMAA 3HFSA 1HKUA 2DFDA 3H3JA 4JJIA 4NR0A 4CLOA 2DBZA 3FNGA 4O6VA 3COSA 3D3EA 1IYZA 5DDIP 2HSDA 2DVMA 5DP2A 3CKYA 3RC7A 4EW6A 1DHRA 2FN7A 1P1HA 3INRA 4R1TA 3WQSB 1EK6A 2EV9A 2EEZA 3PVZA 5I7FA 2C29D 3MCVA 1HZJA 2PFGA 2GF2A 2I76A 3KLMX 3HG7A 4E4YA 5FWNA 1GUFA 5KWEA 4KTVE 5CP8A 4GQAA 3M2PA 4QT0A 4QQRA 1Y7TA 4MP6A 2YJZA 3KB6A 1MG5A 3PTZA 2GD1O 4BO6A 2V65A 3OICA 1DC4A 4DIBA 2O23A 4FIZA 1ZO8A 3KHUA 4YDRA 3MTGA 4FJ0A 4CM4B 1IPEA 2E6UX 4BNWA 5DBFA 3F4LA 3AW9A 1I2ZA 4DLAA 3D1LA 2VHXA 1H2BA 4IXWA 5TJHA 1PJ2A 3WGOA 5FFFA 4BNFA 1V35A 4YJFB 5JS6A 1WZEA 1X13A 3LU1A 4WK6A 3LT2A 2J5RA 4KQWA 5H82A 4YVFA 5HBRA 2BD0A 3K2EA 2CMDA 4MVJE 4UEKA 2FWMX 3D64A 1I5RA 5T57A 2WYWA 3K2BA 3W6UA 2O3RA 2FOIA 5F5LA 3GEDA 3ENKA 4CMEC 4ZHSA 5G0TA 2I6TA 2PNFA 4PCVA 4EZBA 5B37A 3GUCA 3QVTA 2LDBA 2Z5LA 1Z75A 2WYVA 3VDQA 2BGMA 1WMAA 3RROA 1ZCJA 4WE3A 5I9NA 3RKUA 3D4NA 1UXIA 2X9NA 4A2CA 1V3TA 4DIFA 1XHLA 5A1TA 3S2GA 4Z9XA 4RL6A 3ZWMA 1B0AA 4R68A 1MUUA 1DJNA 1NVMB 2VRBA 4R5HA 2B5VA 4LCJA 1PR9A 2YV2A 4NK5A 4G2NA 1BVRA 3DMTA 1WNTA 2CD9A 1UZMA 4ND1A 1X1EA 4RQTA 3TRIA 4DMMA 5LDGA 1TT5B 4MIYA 1LLUA 1QYWA 4O1MA 4AL4A 1PS9A 5A9SA 4CM6A 3WGZA 1PQPA 4PFJA 3WGIA 1C1DA 4Z0PA 3JQAB 3GEMA 3GRKA 1M2WA 1Y8RA 2PH3A 3RKRA 1ENOA 1ISJA 1VM6A 4RVGA 3NEPX 4J1SA 3U9LA 4LK3A 4EJ6A 1JKJA 1PR3A 5IDYA 5IN5A 2R00A 2PWZA 2ZB8A 2F00A 3HDYA 1NM5A 3E1KA 5A9TA 1GYPA 1T4BA 3MWDB 3T7CA 1A9ZA 1P44A 1EDOA 2GDZA 4LCEA 3OQ1A 5ER9A 2G76A 4LVCA 1LXCA 1S6YA 1K6JA 2RIRA 5MGBA 1N7GA 5C3MA 1LSJA 1PZGA 1PGNA 4DL9A 2EKLA 4GSLA 1BXGA 1NFRA 3DC2A 1LNQA 3OQ6A 1ZMOA 4IGEA 4RVDA 5A9RA 2PZMA 1KC3A 2JD1A 4DLBA 3C7AA 2BI7A 4IJKA 3VPGA 3OJ0A 4ESOA 3CH6A 3I6IA 3I9NA 3AUTA 3CEAA 1AE1A 4U6SA 1NASA 1PWXA 1AGNA 4YQYA 3UFXA 1WVGA 1YOVB 2Z1NA 2POQX 3GDOA 4ZD6A 4M8SA 4J9VA 3QVWA 3H4VA 4GKVA 5G0UA 5AYVA 3B1FA 2P9GA 4CLEA 4B3JA 4IJWA 1LSUA 5JLAA 1O8CA 3CINA 4TRRA 4N5LA 4PLYA 5G4KB 5C7LO 7MDHA 4NU5A 3WMXA 1JQBA 3RQSA 3D4OA 4YQZA 2P4QA 1ZSVA 4CMHA 3DXFA 1LUAA 3IMFA 2ZK7A 4OMUA 1I36A 2BFOA 3GOHA 4XYEA 4BGIA 3GVXA 2X9GA 4BO4A 1KETA 5U9CA 3DBRB 4HV4A 1U2GA 5IDWA 3WBFA 4WJZA 5LCXA 2X7HA 3AY3A 2VWPA 2NVUB 1KEPA 2C2YA 3KSUA 3F3SA 3PPIA 4E5NA 1UP4A 1QYVA 4NIMA 3F1LA 3W1VA 1CQJA 4PLWA 3FNFA 2ZTVA 1NHGA 3UUWA 4CMGA 2WYUA 1DRUA 1PJQA 3PWZA 2FRDA 4A73A 3ADPA 5IXSA 5T8KC 2EP5A 1BW9B 5TLSA 4OYRA 3AU8A 1MFZA 5JXWA 2CDCA 5AXDA 4CUZA 1A7KA 3S2IA 3BHIA 4DQVA 2C20A 4U8GA 4MVJH 2Y1DA 4EBFA 1GV1A 3CMCO 4CUJA 2JFGA 3NDJA 4CLXA 1T25A 5EJ2A 1Q0HA 2WD7B 2J8ZA 2IEBA 2J6IA 3PHGA 1FXSA 1P9LA 2DQ4A 5K1SA 4FD3A 4RPJA 3OBBA 1KVRA 2PD3A 2QIOA 3OM9A 2W2LD 3ST7A 1YONA 1E1LA 5A3JA 1EFLA 5IJZA 4S3MA 1JAXA 4BNLA 3GDFA 1FDTA 2NVUA 4GGOA 3QWAA 2BFMA 3VPSA 1E92A 1O95A 3DMYA 4GX5A 5ITWA 1W73A 2HO5A 1O0SA 3ZZNA 4E2YA 3ZN2A 4OXYA 3TNLA 2VHWA 4GBJA 3D3WB 2YY7A 5GZ1A 4DQXA 3RU7A 1SNYA 2NQ8A 2VZ8A 1T2EA 4MPDA 4PN3A 3U0BA 2FMUA 3KV3O 5A04A 1ZEJA 4J1TA 4R1UA 1ZIDA 5F3RA 4FB5A 4J43A 1QV6A 3W4KA 4FBGA 1H6DA 1R4MB 1DOHA 1V9LA 2D3TA 2FZEA 3ETDA 2VOEA 3DOCA 4B7CA 4BKOA 3F5SA 1LDBA 3RU9A 4WNCA 2EIHA 1TLTA 3E8XA 3A4VA 3GR6A 3RD5A 4D41A 3BXXA 1P31A 4GWGA 4II2A 1JKFA 2QZ9A 3HFGA 3H9UA 2X6TA 2PLAA 4AJHA 2J3JA 3OA2A 1TB4A 3OECA 2YV3A 3UXYA 2OL4A 3Q9UA 1YDWA 3WMWA 4CLRB 1ADFA 3TOZA 4U0JA 3V1UA 5C37A 1ONPA 4MJLA 3VZQA 1IUKA 1F8FA 1NR1A 5CPBA 1HDGO 1GEEA 3B20A 4HFMA 2YHUA 1JU9A 3CZMA 4TVBA 3WJAA 3R3SA 1YL6A 2ZQYA 4PLPA 3EZYA 1TXGA 4LVUA 4YAJA 4CMCA 2PK3A 3K92A 1YBVA 3FPCA 3C24A 2ZCUA 4BQPA 3GN1A 1ADBA 1AXEA 3PHJA 2GERA 4WEQA 4AJOA 3BTVA 4G5HA 4IMPA 1PQWA 1R4MA 4JJGA 4IMRA 4XIJA 1KS9A 5I7EA 4AJKA 1RM3A 3FWNA 1R0SA 2OOSA 1YVEI 2P68A 4PRKA 4UREA 4PLGA 3GVPA 4M87A 3QP9A 5AXCA 4YRAA 1SEVA 2AEFA 2WWRA 1ZFNA 1U28A 4UULA 3GK3A 1E7MA 3PIIA 3ZHYA 1DEHA 3ICPA 4YJDA 3OF2A 4CLRA 1G6KA 1PJTA 3KO8A 4BGUA 1D1TA 2C82A 3K9QO 3PWKA 4BIIA 3GZNB 1JTVA 4KTTE 1P0CA 4ZJUA 2OXIA 1YDEA 1JA9A 4N54A 3IKVA 5JMWA 1JAYA 4IGFA 4JJFA 1EE2A 5L51A 1ZK1A 4OKNA 1Q0QA 3E5MA 2DPGA 4K1LA 1QYCA 1ZUD1 4GLLA 4UAGA 4F45A 1L7DA 3ZU3A 3VZPA 2Q99A 1SBYA 3QE3A 4CM8B 1O5IA 1R6DA 1SMKA 1ISHA 4KMSA 1BG6A 3PYMA 1QYXA 3DONA 4ZVVA 3N7UA 2ILTA 3KYDB 2UVDA 5FYDA 2D5AA 3KSDO 3F4BA 3KEQA 3E6AA 1GQ2A 5THKA 3JTMA 4NBTA 1PL6A 1KVSA 1AHHA 2DAPA 1PIWA 2RCYA 3JYPA 4B7XA 3FCOA 4AFNA 4DPKA 4CJXA 1YB5A 3BZUA 3IIEA 3C85A 3PZBA 2AA3A 2E49A 3JQFC 3O38A 3JCZA 4E12A 3OIFA 9LDTA 1N7HA 1SOVA 3PYLA 1YGYA 4YB8A 3HNPA 4IDCA 3TQHA 3GT0A 1HF3A 4OAQA 5EIOA 2EJWA 3GPIA 3U4DA 3LZ6A 5JW6A 2W98A 4CMIB 4J4HA 4AJIA 2GRAA 3BHMA 4WCDA 2NLOA 3E18A 1U4OA 3QSGA 3SX2A 3AY7A 3V5NA 4L73A 4HBGA 3M2TA 2NM0A 1B16A 1ORRA 5TC4A 4E5MA 1A9YA 1WXDA 4INAA 4QFCA 4Y6SA 4IQ8A 1LQUA 1L1FA 1TEHA 1VJ1A 3AI3A 3KYCB 1YO6A 1P1IA 4WCFC 4ALMA 4PLTA 1FF9A 1WDMA 2BKAA 1PWZA 1P0FA 3AK4A 3ZHZA 1HDRA 5F1KA 1GUZA 3SC6A 2DLDA 4UVIA 2JAHA 3SJUA 2W90A 1C0LA 1PGJA 1RJWA 4QUKA 4E13A 2VUTA 1UDAA 4OJNA 3WFIA 1U8FO 3M1AA 3K31A 2PZJA 1DAPA 3ZI0A 5TJ9A 1BXKA 3INTA 4J90A 1DIAA 4PRLA 3MTJA 4HFJA 1ZK2A 2BELA 3DAGA 4BNUA 5U4QA 1RPNA 3EHEA 1E6UA 3NTQA 5CEEA 3ETEA 2X9VA 2FPGA 5CEFA 3GAFA 4CMBA 4CQMB 1ISFA 5BQFA 5JPIA 1WPQA 1PTJA 3JQEA 4CQLB 3JQGB 3NJ4A 3U4HA 4AG3A 3GN2A 3JYNA 1MC5A 3WYEA 4D43A 9LDBA 1Y8QB 4DUPA 4K28A 4XGNA 1Z74A 4LN1A 4AVYA 7ADHA 5CDUA 4KUHA 5JO0A 1VPDA 3KXDA 4RLHA 3EYWA 4PZEA 2WEKA 3RCBA 4CMJA 1NX6A 3KYCA 2WE7A 3IUSA 4RF5A 4CR7A 3EGOA 1XR3A 4NPCA 3V2UA 2DUUA 2Q1UA 5H83A 1MX3A 1JVSA 2DBVO 4HFRA 3A06A 3WICA 1AN9A 1PL7A 2Q50A 3H9JA 1J0XO 2DTDA 1A7AA 1SZJG 3FN4A 3MWEB 2D1YA 3WGQA 1IHYA 4JCOA 3QVOA 3OFSA 1V3UA 1BMDA 4BNJA 4YT2A 3PGJA 4RORA 3IC5A 2Q46A 5FEUA 4FQ8A 1GV0A 1R4NB 4IDBA 4ZQFA 4R16A 4RF4A 4BGEA 3TWOA 3GHYA 3IOYA 1UXKA 4YAIA 3DTTA 2VYVA 3BMOA 2A4KA 1W6UA 2XXBA 1Y1PA 1G1AA 1ZSYA 3PJGA 3MOGA 4RZHA 5KOIA 1I2BA 4CLDA 5IG2A 2WDZA 4NJMB 1XYGA 3K30A 1GADO 3GVIA 3LT1A 1MA0A 3CSDA 1BDMA 5K9ZA 4IY1A 2EW2A 5K6AA 4GGPA 1NPTO 3VH3A 1NFFA 3O8QA 1PEDA 1UH5A 3CMMA 2Z95A 1T2FA 2H1SA 6ADHA 5JBIA 3NTRA 2O3UA 2OUIA 4U0KA 2Y68A 2OHXA 2IRWA 3NTOA 4XB2A 5U1PA 3ZW8A 3OA0A 4DYVA 4DTIA 1EVZA 3DBHA 1I8TA 2FY8A 1F06A 2BFPA 5ADHA 1P1RA 4U7WA 4Y6RA 1QR6A 4CLOB 1E0DA 1AXGA 2V6FA 4E3ZA 1IHXA 4L76A 1CRWG 1BTOA 1H9AA 2P91A 2PKQO 2RHRA 3OETA 5CAEA 3U5TA 3JD4A 2Y05A 2C7GA 3FR7A 4BKUA 4J2HA 2X5OA 3OQBA 2B0JA 3H5RA 4CR8A 3WIDA 3WGHA 4OSOA 1N2SA 3ENNA 2B4RO 3G3EA 4WKGA 4FGWA 5JAZA 2DM6A 1I3KA 4TZTA 3C3XA 1CEQA 3OIGA 2AEJA 3LLSA 4XR4A 4D79A 4XDZA 4R1SA 5BSEA 5HS6A 4CR6A 3VH4A 4TKMA 1ISIA 3WYCA 4DXHA 1YQXA 2Y1CA 2WMDA 1J5PA 2HCTA 3WOHA 1K6XA 4BNIA 1XIVA 1E3WA 1QXSA 3LT0A 3JQ8A 3WQQA 2EWMA 4YWJA 2DBQA 5BSHA 2VYND 1IULA 4DRYA 3RAJA 2FHSA 4RDIA 1PJLA 2HMWA 2IE0A 3DZFA 2E4AA 5JCJD 2BHLA 4R01A 1KBZA 4GI2A 3WSWA 5KJEA 2BFAA 4MIEA 1DC3A 4I9NA 3M1LA 4IS2A 5KCZA 1Y81A 2YYYA 1NFQA 1CQIA 4FFNA 3BMCA 4FJ2A 3TSCA 1R16A 3G79A 5DF1A 3RJ9A 5EESA 3FD8A 5TX7A 2HQ1A 4IZHA 2O3JA 3ZWAA 1X0VA 1FJHA 4P8RA 3A14A 3I9KA 5GZ3A 3FBTA 2ZB4A 3QWHA 3R6DA 1QLHA 3H5AA 3Q3CA 2WE8A 4J91A 4J7XA 5EL0A 4J0EA 3ZWXA 4ZICA 3DBLA 1D3AA 4J7CA 4ALKA 2YDYA 2HMUA 2I66A 2Y1EA 3O9ZA 2CY0A 1N9GA 1HE5A 4H7PA 4IQGA 2O50A 3L9XA 5L3ZA 3GMDA 3FBGA 4K9DA 5ITVA 1I2CA 3IJRA 3ZWNA 3JQBC 5JC8A 1P45A 4IDFA 2P2SA 4E2WA 1V3VA 4BKRA 2H5LA 1NBOA 3D4PA 3TF5A 1GEGA 3S1LA 3H9GA 3ZDFA 3HADA 3RUHA 2O4UX 5A9SB 4B79A 3HSKA 1C1DB 3JQ6A 1DRWA 3HN2A 4MKZA 1UAGA 4Q3AA 3AM5A 2NWQA 3I5MA 1Y8RB 2CDAA 4HY3A 2B83A 3JQ9A 1MXFA 4UUNA 1PJBA 4YAEA 1EUZA 1DAOA 3ZNQA 2NACA 4BB5A 1V6AA 2V6BA 3IKTA 3NGXA 1HLDA 3JYQA 2HMTA 1U3VA 1YJQA 3PXXA 4FFRA 4BNXA 4E2XA 3FF4A 1E6WA 3VPHA 5L4NA 3IDSA 4D42A 4YPOA 1TT7A 5CFZA 1E5LA 4IIVA 3WWYA 5BSGA 1ZW1A 4MOWA 4OQYA 4XA8A 4NFYA 4M89A 4CM7A 4TWRA 5JYEA 1M66A 1SEPA 2NSDA 3AOGA 4W7IA 3SBOA 1VLLA 4OXKA 1Y5RA 1EUCA 2VN8A 1BXGB 2UDPA 3INGA 4DA9A 4BNZA 5CDYA 2Y67A 5I9LA 1GZ3A 3ON5A 3KETA 1KVQA 2X5JO 4RV9A 1VJ0A 2WSBA 2Y66A 1WP4A 3TZHA 3DHYA 2VWHA 2HK7A 3TL3A 4OOFA 3AUUA 3SXPA 2ZJ1A 4D45A 3L6OO 3L77A 4YJGA 5HTOA 4R9RA 2FP4A 4JLWA 2PGJA 4I5GA 5EN4A 5I7VA 1E7YA 2JFHA 3RBVA 3ZW9A 5IDQA 2AQIA 4LRSB 1LA2A 2GZ1A 3GUYA 4ALLA 1MV8A 2IEDA 4WECA 1LTHR 5B4TA 4RVSA 5DCYA 1PZEA 5FI5A 2VHVA 3WJ7A 1X7GA 3G0OA 3L4BA 4XQCA 4PLCA 4Q9NA 2Q1WA 5HRUA 1GY8A 3PYXA 4BNGA 3DDNA 5GMOA 2Z1MA 4EGFA 4MVJM 3VAZA 5C7IO 2H63A 3HDJA 2AMFA 1U4SA 5DT9A 1ZSNA 1VL6A 3EC7A 2JCVA 3RWBA 1T2AA 2X4GA 4XRRA 1IZ9A 4HKTA 4Y6PA 4PIVA 4BNHA 4RF3A 4YTEA 1E3EA 3L9WA 2VUSA 1GCOA 4CM3A 1I32A 4RPGA 3R3JA 1CIVA 4MINA 4PG7A 5L7YA 4HP8A 3WGGA 1P3DA 3ADOA 3HHPA 4RPKA 4E33A 1DO8A 3DZGA 1EFKA 3UW3A 1B3BA 1UDBA 5BNFA 4HNGA 4RVHA 2W8ZA 1WLYA 4PVCA 4XYBA 1U7TA 3TN7A 5JC1A 4PZCA 1EUDA 2DU8A 3L4SO 4R41A 4TRNA 4U5QA 2GASA 5TT0A 4URFA 1VI2A 2IZZA 5G2OA 3ZV5A 1T2DA 2FZWA 5ER6A 3EUWA 1M76A 4BV8A 2HMVA 2Q3EA 5JDCA 2W2LA 3PLNA 1XA0A 3JQ7A 5EERA 4HNHA 4M54A 2WTBA 2YV1A 5HA5A 4A26A 1UJMA 2QRKA 1LDEA 1T24A 1DPGA 2A92A 2OP1A 4E5YA 2VNAA 3ZWBA 3ANNA 1KEWA 3WSVA 2RAFA 5L40A 3GG2A 3GFGA 3NV9A 4HXYA 2GGSA 3AY6A 4Q3CA 5DNAA 4OXNA 4BOYA 1H93A 2SCUA 4FPXA 1TA4A 3G49A 3W8FA 3D7LA 3F47A 3HUDA 2Q4BA 4GMGA 2X58A 3AOEA 2O3TA 4M49A 2C0CA 3WIEA 1R0KA 1MGOA 4CM1A 3OJLA 3TZQA 5EMHA 4OOEA 4NNJA 1A5ZA 1VL8A 3VKUA 3GHHA 4MVJP 4ND3A 3ZHXA 2Y1GA 3PI7A 3I4CA 4EJ0A 3FNEA 1ZBQA 2J3HA 2VNSA 3OJFA 4PGFA 5TSDA 1ZMTA 4IDGA 4ALIA 5IZCA 3Q2KA 3ZH2A 3VPXA 2BLLA 4Z0HO 3UVEA 4XGKA 1ZZEA 4YT8A 3IUPA 1KOLA 1NHWA 5AOVA 4CODB 5L7WA 3RC9A 2FR1A 4A5OA 2ZB7A 4BO7A 2EKPA 5L7TA 1DLJA 5TQVA 5AXAA 4WGGA 5CDGA 2Q2VA 2HLPA 3DZKA 3WXBA 3NJ8A 1GFSA 1LDGA 1MC4A 1MP0A 1H6BA 1P33A 3JQAD 1SCUA 5CPFA 1O94A 3NT2A 1A4UA 5ICMA 3GEGA 3RUEA 1Y5MA 3AM3A 1DIHA 2Y0DA 3MJVA 8LDHA 3RUAA 4YT4A 3W8DA 4FN4A 4FGSA 1LSOA 1WWKA 3OSUA 4RVFA 3WBBA 1Y6JA 3N58A 4ROSA 1IOLA 3RJ5A 5A03A 2IDZA 3L6EA 2OORA 3K73O 1Z73A 3Q0EA 1L7EA 1P74A 5EQFA 1UZLA 1EVYA 2PZKA 4CL8A 1N8KA 2Q1TA 1KEUA 4B8ZA 2Q49A 1FK8A 3T4EA 4BO3A 4BUCA 1LDYA 3NUGA 4EI2A 1PSDA 4BNYA 2CFCA 1O9BA 4BO0A 3IL2A 1RYDA 4UUOA 3JSAA 2X0IA 2HRBA 1Z6ZA 3JYLA 1HDCA 4LRTB 4GAEA 5G0VA 5TF4A 1B7GO 3R1IA 3I52A 4W82A 3V1TC 3DZIA 2V6MA 4N7RA 3F46A 4WLEA 4WLFA 1XWFA 1U3TA 1ENYA 4ZQBA 4H15A 5TT1A 1NYTA 3WTBA 4LSMA 3RUDA 5EPOA 3ONDA 5DBIA 1E1KA 4OIMA 1ID1A 4ALJA 4KDFA 4XIYA 2EKQA 1VJTA 4YYZA 4II3A 1Z82A 3O4RA 4WOKA 3ROPA 2HUNA 3S55A 3BMNA 1I3MA 2AXQA 2PKRA 3GVHA 3KOUA 4PLVA 4RGBA 4IS3A 1UXJA 5I8ZA 1ZK3A 4GSKA 1IY8A 4EJMA 2ZKLA 1LX6A 1H6CA 4P4GA 3G1TA 5DOZA 3BTSA 2FSVA 5CHEA 3SLKA 4UVEA 4TKLA 4GPD1 3PHIA 3LT4A 1I30A 3H2ZA 3U4IA 5KJ6A 3EVNA 3ONEA 1ZJYA 1V0JA 3P5SA 3I9MA 3DEYX 3OEWA 3AWDA 3W4IA 2AG8A 2EG9A 4B4WA 5A5FA 4H3VA 3HWRA 1QP8A 5DZSA 4WLNA 2IZ1A 4FFMA 1DDOA 4QECA 5DBGA 1ULUA 1TVEA 3QLJA 2A94A 3DWFA 3TZKA 2P9CA 1EBFA 4F3YA 3PP8A 2DUWA 5TNXA 1GQQA 4JGBA 1N1GA 1LDNA 1CETA 3NDRA 4DBZA 5B1YA 5K6AC 4KUEA 3ZNOA 4L4RA 3L0DA 1Q7BA 4NDNE 3RUCA 4A10A 3A28A 4OM8A 4IJUA 1PGQA 4MP8A 3TFQA 4J9UE 1E1MA 2BH9A 1PJSA 2ET6A 5ICSA 3E9QA 1XLTA 4XYMA 2QW8A 3IQDB 3ZNPA 3PQEA 2X22A 2HU2A 4AJ1A 4J0FA 3HDHA 4MVJD 2D8AA 4E21A 4ALNA 1LC0A 2RH4A 3GY0A 2EERA 1R15A 2B35A 3C1OA 3DB2A 3RC2A 2O2SA 3F6YA 2HKIA 2NTVA 2JD0A 4R3NA 2Y0CA 3ULKA 3GRPA 1HL3A 5L95A 2GN9A 4FFLA 5H81A 4L8VA 2G0TA 1U2DA 1X15A 4E6PA 1ZXLA 2UYYA 4Y98A 3IJPA 3T4XA 3C1TA 3F1KA 4IPTA 2YW9A 3RSHA 3SEFA 3QWFA 3WYBA 8ADHA 3EK2A 3ZWPA 4AJPA 4UUMA 2I3AA 3G17A 4ND4A 5GY7A 3FI9A 4L4SA 2PZLA 4E32A 4JROA 5JDIA 4Z0TA 1S7CA 2QX7A 1Q2XA 3GF4A 4D46A 1ADCA 4OH1A 2BMAA 3HE3A 2O7QA 1GZ4A 3G1UA 2B36A 3JV7A 4NZ9A 4PG8A 1M6HA 4CM5A 2F1KA 2YQ4A 3WQRA 5A5EA 1DB3A 5AQ1A 1UXGA 5HM8A 2J5QA 4EEXA 1DFIA 1YS4A 2AE2A 3ZWYA 2Y1FA 3WDSA 1CWUA 3D5TA 5CEJA 1RM5A 4E31A 2YHIB 5BNIA 4L4XA 2FPPA 3K6JA 2QQ5A 3ROMA 4JQCA 1ML3A 1NVGA 3DO5A 3KRTA 5ILOA 5LDHA 2HAEA 5CG1A 1HT0A 4E0BA 2GN4A 1B15A 4H16A 5L53A 5ENDA 4N18A 4FW8A 2GZ2A 4IXTA 4ZRMA 3UHAA 1N5DA 3OIDA 4DC0A 2ZTLA 4J7UA 5I7SA 4IBOA 4MVJF 3VH2A 4B4UA 4I5DA 4ZRNA 3UICA 5HS4A 2PKQP 2HMSA 3BYZA 3KSZO 5T67A 4IQ0A 2NQTA 4B8WA 1GD1O 1QMGA 1EQ2A 4I08A 2X0RA 3E48A 3C1AA 5F1OA 3W4JA 2CNBA 2Q45A 1DLIA 3EZLA 2D59A 2Q2WA 1H2HA 1XCBA 3ZV6A 3C7CB 3GA0A 3NKLA 1P1JA 3VPFA 3BMOB 2QRJA 5L4SA 2IYPA 5HWSA 1LI4A 3RC1A 3GMSA 3H3FA 3SJ7A 1N92A 4ZGWA 1XU9A 2QYTA 2TMGA 3MEQA 3X2EA 2JFFA 3JQ9C 2YHIA 1YQGA 3PJEA 1YB1A 1I3LA 1W0CA 3BMQA 4P38A 3ZU4A 5IFLA 1H5QA 3O26A 2HRZA 1MLDA 4DYDA 3AJRA 3O03A 5I9MA 3DOJA 2R6JA 4R51A 1NNUA 3PGXA 3O8QB 1CDOA 4TRJA 4BB6A 4DC1A 2VWQA 2VZ9A 5GZ6A 3K8ZA 5COBA 5JE8A 1HE3A 4WLOA 2C5EA 3VHRA 4A03A 3PZRA 4HX5A 1R12A 4P22A 4KZPA 4CLHA 1FDWA 2ZJ0A 1OBFO 2GO1A 3ZGYA 1CJCA 4KDEA 2HJRA 2XXJA 4BNKA 4W6ZA 2QYSA 2FPIA 3DBHB 1GR0A 3E9MA 3DMTC 2I5PO 3H9EO 1GL3A 1HSZA 4PLFA 1VC2A 1GCUA 1YXMA 5IZ4A 3T7EA 3HQ4O 1D7OA 4NBVA 5F5NA 3DAFA 3GGGA 4D44A 1HWYA 1F12A 4DPMA 3QWIA 4I9UA 4RCVA 2VT3A 3DFUA 4YJHA 5T64A 4GL4A 4R4JA 1A71A 1HE2A 2AQKA 3KBOA 3Q2IA 4NQZA 5B4VA 4XQGA 2B69A 3GG9A 1VE9A 2R00C 3PJFA 3QW2A 2WD8A 1BXZA 1XGKA 3I9OA 1HSOA 1ISGA 1A72A 4NBUA 3V2HA 4DPLA 1JDJA 1SC6A 4Z9YA 4BVAA 5JCXA 2BGLA 2GUGA 1PJCA 3W6ZA 2VYNA 1E3WB 1EZ4A 2H6EA 4FC6A 1YWGO 4IINA 4WUVA 3DZBA 3LC2O 3SC4A 3JQ8B 4KWHA 3QVSA 5JCJA 2O2YA 3PHLA 3U4CA 4CM9D 3WS7A 4W99A 4EEZA 2D2IA 1LC3A 3EW7A 2GYYA 2J5KA 2PD6A 4NG5A 5JAMA 4BKQA 4XCVA
chains in the Genus database with same CATH superfamily
2XQKA 4DMGA 2I99A 4ZO8A 1DHTA 3L8EA 3QLTA 2UXDB 1XZFA 2Z56A 4ZVRA 4D8TA 1KZ6A 1T8SA 3RDPA 1VBMA 1H1LA 3L7OA 2J0VA 3FRJA 3AFGA 4RLSA 3OE4A 3OE1A 4PPQA 1DC5A 2KPOA 4G4IA 4QJ5A 4ZQGA 1JHPA 1V1RB 4QU5A 5DKFA 3D8NA 4Z9BA 1QIGA 3KJHA 5J59A 3ZWOA 4EKIA 4NBKA 3ZEAA 1T6XA 3LKZA 2R87A 4BP3A 1TEZA 4GP7A 1DIRA 2BP7A 1ZH8A 2VKTA 4PSVA 1XZAA 2TS1A 1MB0A 2ZYVX 2DFKB 1CD5A 2BN4A 1GNVA 1FYFA 3EE6A 4LOHA 2PRIA 4L08A 4B3RB 5AKEA 4QODA 2R8EA 3IEKA 3GFRA 3M3DA 5JH7A 1U8UA 2P4HX 2PLWA 2X8LA 2ZYAA 3LCVB 3HB7A 3LZCA 2QZZA 3MWYW 3I5YA 4J0KA 4WIAA 3U60B 1N9GB 1EP2B 2QUKA 4A6PA 4UQLA 2G70A 1ZGCA 3SZOA 3COJA 2EARA 3IMEA 2XAUA 1Y37A 4IIJB 1WPXA 3MZ0A 4QPPA 4YRNA 4GX0A 4DJ5X 4CTNA 5K09A 2QLMA 5DYWA 1VB3A 4TN5A 1L6RA 2FVYA 5FPPA 1G6Q1 4YUAA 1CE8B 1RZVA 4O0LA 2YKGA 1BA2A 1EG2A 1X7HA 1DFGA 2PV7A 2IHZA 1NMXA 3B9RA 3MRSA 1D2AA 1N57A 1Z15A 2JGMA 4CTJA 1QQBA 4HZUA 2APJA 3WTCA 4EA9A 1B0ZA 3IVRA 4C78A 2CV2A 4X1IA 5JG7A 4L0QA 1E94E 1M72A 1C3VA 3EOZA 2VVTA 4Q3NA 4WY8A 4DCJA 1EK5A 1THTA 2G28A 1XVUA 2W71A 3DKRA 4ARSA 4AT1A 4EB0A 4KREA 1LGYA 4X1YB 1CVLA 3I01A 3TB4A 3GZ4A 2ZITA 3E5RA 4MV5A 3X44A 1KJYA 1G3UA 4LFCB 5BW4A 5TEVA 2UZAA 1C7JA 3WGUA 1XE3A 2G9RA 4PTZA 1JZTA 3LMKA 5E3HA 4ZOLB 5LNK1 4EPXA 2DWUA 4DLNA 3TW4A 1S8NA 2ZBDA 1EQUA 1FFBA 3CZ9A 3N3BC 4INJA 1ODTC 4Q4DA 1CIJA 3RJTA 1TI7A 2OWEA 4CZ2A 4D0RA 3RASA 2OMKA 2I78A 4ZKDA 3ZYZA 3TG8A 3PXUA 4REMA 4S1VA 1R37A 1Y42X 2IZOA 1XSEA 2C58A 3REQA 8OHMA 4I19A 3QTBA 10MHA 1M33A 5DHRA 5HKLA 1NXTA 3ABIA 1NW5A 5JT1A 4LGCA 1LQTA 4GF5A 3L8ZA 4UC0A 5DI3B 3T0GA 1ZXBA 4EB6A 2O8EA 3OTQA 3L7IA 3UV6A 4ZKEA 1G21A 1CPYA 2YMQA 1E0SA 2E21A 2VHYA 2WG2A 2XYQA 2GZ3A 4O4IA 5EVCA 2CNWD 1AMNA 4YMIA 3I9JA 4WACA 2IYOA 5FUVA 2I7XA 3O8RA 1A98A 4JD5A 2CJWB 2YNMD 2AEMA 3PRHA 5BR7A 3IP9A 2FPOA 3I45A 1HM5A 1OOEA 2EYUA 4OGFA 5JY1A 1OQAA 5FUXA 4XRGA 2L2QA 5BT9A 4M1QA 4JP2A 1UBEA 1PX2A 3EIXA 4NONA 2DLCX 4YJGB 3RVDA 5K4HA 4H27A 4CL0A 4OBXA 2OORC 2HF2A 2OMEA 5A06A 2AS0A 2IKQA 5DOVA 1C14A 3GJ7A 3BREA 3NBFA 2HJSA 4OQ4A 3TLBA 2KW5A 2PT5A 4B3TB 1RD4A 1RZUA 1GO2A 4RJKA 4R2HA 1N6KA 3HCEA 2F67A 1C7QA 2ZSIA 3ASUA 3DE0X 3LQKA 5D00A 3HFRA 5ARCA 4YAGA 3J7AC 4YCSA 4ZC8A 1BGVA 1LJUA 2GEJA 2O5RA 2PGNA 3OO1A 2P67A 4MS4B 5FV4A 2VJPA 1Y48E 3E4CA 4N03A 3Q8MA 4L9SA 1UBJS 1GRNA 3F5FA 4IIYA 5LQUA 2BSAA 1YQDA 4DVJA 3SM9A 3A4LA 4BMOB 1FDSA 3MB5A 5SICE 3MXOA 4KQJA 2PA3A 2YWBA 4IWXA 5E9QA 4AWAA 4CEHB 1C1YA 4BV3A 3LCUA 5H1YA 3WYFA 1VBKA 2JD2A 4EG1A 3ZD6A 4BKMA 2BI4A 1XNGA 1CEEA 5K0TA 1QYRA 2FZGA 4YR9A 2UKDA 1YBMA 5AI0A 3X3HA 3JRWA 2Q0QA 5CXXA 3EFOB 1YI8A 2IBMA 2NO4A 3I4FA 4GWLA 4B6FA 2GPBA 1XZCA 1ZVKA 2WJIA 2HMAA 4WPGA 4I81A 4H77A 4YT5A 3CNEA 4QEKA 1G5IA 1AHPA 5IHXA 4F4IA 5T6BA 3BSSA 1G5FA 4CM4A 3GB9A 3E3MA 1ZM2A 3CF4A 4ZOBA 1SU7A 3TJRA 1Z34A 4AJJA 3I5UA 5T6MA 5KHLB 1MB4A 1LLDA 3B51X 3BKXA 4GXRA 4MIOA 3UGTA 3V3TA 1XELA 4XJVA 1CY4A 3L8FA 1WXIA 1UWLA 2ZUBA 3G85A 1R4AA 3O3CA 1MA3A 4QQ8A 2IU6A 5DGTA 4BO2A 1CF2O 4PPGA 5HZHA 1AV7A 3E9NA 3IMKA 4PG5A 3ZCUA 4UCFA 3LL4A 2DC1A 4DGSA 1QKIA 3WC4A 4R0MA 2K7FA 2VDKB 3BTUA 4D4IA 1JHMA 3VBEA 2VK2A 4KIFA 3H13A 1SPXA 1CF4A 2V7TA 5K0BA 3RJMA 3A1NA 1RWPA 1EFAA 1YT5A 3LFTA 1YQWA 2O3QA 4O59O 4F97A 1YR2A 3GRVA 1D1SA 2KMLA 1OB5A 3HB1A 3MCZA 2MMGA 1WSWA 3DHNA 3OJOA 1M6WA 5C5EA 3HDTA 3IQGX 1M34E 3MWFA 4LF5B 1AGYA 2PO5A 4JELA 1QBKC 1Y6QA 1UEJA 2EFHB 3NX4A 4C7OA 5E6SB 1W93A 3FUUA 5JNLA 4AJ2A 1FSSA 2V58A 1U3FA 3VU0A 2O2XA 3AX6A 5JY6A 1G7TA 2GR9A 3BKWA 3WNBA 1XLTC 3W78A 4JBIA 4Q34A 3PT5A 4MV6A 1XNHA 2CHQA 1GM5A 1ANKA 1GKIA 4B82A 13PKA 2ZUUA 1T9BA 1Z06A 2VNJA 3GGDA 3M6IA 4HWOA 2VDWA 3ZY3A 3GPLA 1E2DA 3KQNA 1XROA 2R2AA 2R66A 1QQ7A 1U2SA 3QF4A 4KXFB 1XB2A 4LJ6A 1H0SA 1MO5A 3A6DA 4OREX 1NY5A 3I58A 3O90A 2QSZA 4EPYA 2EL9A 4Y0VA 1YS7A 5AVOA 5A4MS 2Q6VA 1V9CA 5J43A 1ZMBA 3K8QA 4IOLA 5KYYA 1X1TA 4AZ3B 2NSJA 3AONB 3QEJA 3NCTA 3UT5B 1HLPA 1GWNA 3JQAA 3JXEA 4TXJA 1TFRA 1FS5A 3PFWO 1KI6B 3ASVA 4EHHA 1X3SA 5KKAA 1U5CA 1SCUB 1KERA 2X86A 3K1JA 4XKJA 3TXYA 1DXYA 1SD5A 2ZYGA 3ZDZB 1CUUA 4J4BA 3DL2A 3E4DA 1J2JA 1DQRA 4G01B 4CMKA 4F7WA 5HZGA 1W87A 4NKRA 4GOMD 1K5HA 2C4KA 2OK8A 3EGXA 4ZC1A 1LBQA 4R71A 1UBHS 4WAUA 4YRJA 3HB9A 1D4FA 4UUQA 3PE4A 1SBTA 1H94A 3F3YA 3PF9A 1JR3E 2BDUA 4I8XA 2II6A 1VE3A 2DKNA 2Y6VA 3L93A 3R23A 4NBWA 1DRVA 2G83A 2YWGA 1CY7A 5B3JC 2DTEA 3UMFA 3A11A 1V96A 2HI0A 1QQ6A 4I1UA 1PUJA 2UUOA 2VCYA 2YFYA 1QE5A 4X97A 1F0YA 3U7QA 3KKLA 1CYDA 2IGBA 1MTZA 1UXOA 2XOKA 3C6KA 1ADGA 1QUFA 2JIDA 1OWOA 2F1JA 2ZJ8A 3OH8A 4X92A 2KYRA 2WPNA 3BX1A 4QWWA 5G53C 1FMCA 5BUSA 2HNBA 5L3SA 4MKFA 2P30A 4BZWA 1EX9A 1QH0A 3ZCVA 2E82A 2WUFA 3IQEA 1OFGA 2GM9A 1D6MA 3GFBA 4DIMA 3EX7C 1G8SA 1IXZA 2Y77A 3NRCA 4K81B 3OD5A 1EHIA 1K9VF 2AW5A 3JARA 2FAXA 2H0RA 3W1WA 4HGQA 1T5SA 5FLKA 2V5VA 4WD3A 5KMGB 2C2XA 1YH3A 1M7BA 2OG2A 1E9BA 1B26A 2P2GA 3FG9A 3KVOA 1KI3A 4LYHA 3ZQ4A 3H4IA 4JB3A 1LK0A 2ZQZA 2ZYDA 4OYYA 4S12A 2WABA 2VJAA 1FQKA 3PEYA 3H87A 4UVGA 3EMDA 2YCBA 2CZCA 2O8VA 4TPKA 4YCDA 2VXYA 2ZRDA 2O0HA 4LV5B 2VBFA 4WBSA 1C30A 4RKEA 3WGTA 2AGVA 3N86A 4ZO6A 5F5XA 1URPA 3EMVA 2O06A 4P4SB 3TIVA 1JB1A 3THXA 4J16A 1K7EB 1J8MF 4KXWA 1ZK0A 4P0TA 3OE7D 4FDVA 4ILKA 2Y93A 4XX0A 5DYNA 3RU3A 5JU6A 4BECA 4L8WB 4BGVA 3DBRA 4I50A 2DR2A 1WV1A 4FFPA 3EEFA 4GP9A 1AQIA 2O8BA 5TDHA 4KRGA 4DV0B 2IYTA 1SG9A 4HX2A 3W3AD 4JLKA 4HLUC 3VDMA 1A88A 2CLSA 5L45A 1EFRA 3DVRX 4PC6A 3OESA 4MAAA 4A4DA 4MUHA 4HYQA 3SHFA 4QRIA 3V1YA 16PKA 5ULLA 1VMDA 3C3JA 4HDNA 3VNAA 2QLFA 1CUWA 3E61A 2HIMA 2XA1A 4DMLA 5COQA 5JNRA 2BFDA 4PX9A 1CRLA 4GE3A 3Q8XB 6LDHA 1N6NA 3LDGA 1FRQA 2OOKA 2W6PA 2C83A 2EJVA 4Z3DA 2RK6A 1F0NA 3Q7SA 4U2DA 4CKYA 3B5IA 3W9SA 3EPPA 5D8DA 4GQBA 4EJ2A 4B75A 5GINE 4PC7A 3KE8A 4ZPXA 1YVPA 3UJAA 2C00A 4LRXA 5LP6C 2VHZA 1P7ZA 1ZI6A 4MVJA 2VQ3A 2HJ9A 2J0UA 3MD9A 1I4LD 4YACA 5IC4A 4TL9A 4PY2A 2H85A 3QLVA 2NUTB 4KAAA 3C14C 4GOXA 1KVUA 4FJ1A 3Q1LA 2GEDA 1ZGBA 3P9SA 4P92A 5HSGA 3T8YA 1LZLA 1QRRA 2YMLA 5AHOA 1N2HA 4PSUA 1E2QA 1RRGA 4J3FA 4MPPA 4B83A 4DEVA 1F7VA 4D9NA 3I23A 3F2VA 3KZKA 3B3GA 2CUKA 4RCZA 5C5CA 3F7MA 3K1TA 3OHMA 3S81A 1WHTA 2KQUA 2YZNA 1G20E 5CYOA 4DLWA 1XXLA 2P5YA 1UPUA 1LTKA 3LUKA 3RTBA 3Q9NA 4AIRA 1M67A 2H59A 3A04A 3OZDA 3BRQA 2H7XA 2VWGA 5DTIA 3RHSA 1G7RA 3FWKA 5KCMA 3O74A 4Q1AA 2L42A 4YRDA 1O97D 1C0KA 1EKXA 1SELA 3AB7A 5AVVA 1G0NA 1W6RA 1YMVA 1KZ9A 3LDHA 1MJ5A 3LCJA 1YCHA 1W5TA 2RH8A 3HVHA 1FUIA 2PUBA 4U7JA 4PAOA 2IFTA 4IZ6A 1PHRA 4GC5A 1GILA 3A32A 5AVUA 3S7ZA 5KTRA 2YWHA 2WKRA 3FFTA 4XSGA 2Q3BA 1AUPA 1JVBA 2OQIA 3FDJA 4ITUA 3PX2A 4MH0R 4RM2A 3RVRA 3QFTA 4RSHA 3LVFO 2CF6A 4RK5A 3WAGA 4R2JA 4TL8A 1L7RA 1WXXA 2ZM6B 1OLOA 1JLSA 1IPFA 1OC2A 4HAXA 4JSTA 4MV3A 3SLRA 5ANRB 4C6TB 1CFZA 1J22A 1RLMA 2EW1A 1LNSA 3L8GA 5F33A 3K96A 3QELA 1MO3A 2AG0A 4I1IA 3NI2A 5DX0A 1E5QA 1NXSA 3V42A 4NE9A 4J94A 4BS9A 2BFFA 4L51A 4DVGA 5B36A 5I47A 1VYHA 2PT6A 3PDJA 2FPPB 4PZ0A 3ZVKA 4N39A 1YA6A 3FR8A 4ZYUA 4KSCA 2FA9A 4L9RA 3QOWA 1HDOA 2W8BB 5EIBD 3RAFC 1Z45A 4R8VA 1OBCA 2PN1A 4OQMA 4K9OA 1BS9A 4X65B 4XZ3A 4XEUA 3JSXA 1H0KA 4X6YA 5BN4B 2W42A 2LKCA 3B36A 4BO9A 3W5AA 4TWBA 5AD1A 3LGAA 3V80A 2QOEA 5J23A 1PDOA 2XOXA 4AY3A 3K9GA 4ES6A 4YPVA 3OMXA 4X24A 4M9CA 4WDRA 1Z7BA 3DOFA 4JR2A 5C1IA 1I33A 1ULSA 5CFLA 1NBHA 1JG6A 4MR9B 3IEMA 1XCJA 2D0PB 2NUPB 4JEMA 1D1QA 3AM4A 3GU3A 4HFNA 4YJ2F 1E61A 1KARA 4EFMA 5A05A 1QVVA 2WM8A 1GL7A 3L0OA 4OPMA 1BCRB 3K0AA 5ES3A 5JNWA 2JLVA 3TOXA 2VPQA 4O08A 2XITA 3LF2A 1R88A 1U98A 2F9FA 5HE8A 4V3BA 1WPRA 4TM8A 1NBAA 1PJ3A 1QV9A 3RS2A 3K5WA 1F6DA 4BLWA 3TFOA 3PNBA 2G9UA 4GC9A 4YMLA 2XI4A 2ZSJA 4IAOA 3QLUC 3HBNA 2HADA 4F72A 1ID8A 1ICEA 1PKXA 3EISA 4Q7QA 3JPWA 3C3WA 3GLSA 4FC7A 5TRTA 3I6QA 4JX8A 4S0ZA 3ZHCA 1SAYA 5JQGF 3UK0A 2RB4A 4QUHA 3PUJA 2E4YA 2PMWB 3O4IA 3JVUA 3KYBA 4XIGS 5DV9A 3SM3A 4HDSA 1VCHA 2ZI3A 3T5DA 3TIGA 3ACDA 4OLJA 5T8KA 4MDHA 2D54A 1G8MA 3KOZA 4CTKA 2K6GA 4MLZA 1YULA 2XTAA 3SHWA 3AWIA 2IDJA 2XR1A 1QKJA 1NQTA 1VIVA 4X1OA 1OGIA 5F1PA 3L05A 4KOAA 2FMTA 3LC7O 4B6OA 1V41E 3DCIA 4HATA 2XUQA 2AOUA 4CV1A 2CVFA 5LVAA 2H51A 3UV7A 4HDRA 1BA3A 4GOKA 4XFKA 1SVOA 1QX3A 2X8JB 3GH3A 3ZIDA 3H4TA 1EXWA 4W5JA 4KO1S 5GONA 3LY5A 5FO0A 4EATA 3JR7A 2E5LB 4AJ9A 4O63O 4QNMA 4Q3DA 3CG4A 3VR4D 2ZUSA 5BQ3A 4YUVA 1N2CE 2PQMA 1Q91A 1L7AA 1WPGA 3C3MA 3KKKA 8GPBA 1GDHA 3EZXA 2Q4RA 4D3FA 5KOHB 1E2EA 3Q6IA 2RHWA 3VZSA 3H6HA 4J0DA 2RHCA 1JEQB 4YALA 5KTNA 1AX9A 1QO7A 4RHCA 1SA0B 3UUFA 1ECCA 2GPAA 3LRXA 3MOSA 3RBXA 1F14A 4ZOQI 1L7PA 1NJFA 1UP7A 5EJAA 1CB0A 4I4LA 4RD2A 1HT3A 1EGHA 1XTPA 1UKYA 3BWBA 3UF0A 4BV9A 1R9GA 2AXNA 1PL8A 5BVGA 2LVBA 1UR5A 4GECA 4DG8A 5K8CA 1HFKA 2GF9A 3QYFA 4O2AF 1YBAA 3DCYA 4HXFB 2NNLD 4XJTA 3U3XA 4EY4A 1EVKA 1ECJA 4RA9A 1EYZA 3HPRA 3LF1A 3PEEA 2V7EA 3IAM6 4MHSA 3VYWA 1C9JA 1RRMA 4L0DA 4DA4A 2ZIWB 3GVCA 4TLAA 5H3HA 3VJLA 3TLJA 3GAAA 2Q0XA 2BM8A 4M9ZA 2VT2A 1EI9A 2YN0A 4D5EA 3CLTC 3OCZA 2X3UA 4C05A 2EJUA 1DEXA 5DNUA 2QD5A 2YJ4A 3U7EB 2OD9A 5CT4A 5FOSA 1H1LB 3DDCA 5AMXA 2CXOA 2H1OA 1QB8A 3MOIA 1F2TA 4LI3X 5LBIA 3RSSA 3V6MA 1YS2X 4QG3A 3T1HB 2ECFA 1B93A 2XUIA 4LISA 4DA6A 4ZDIA 1BRMA 3PJRA 4P33A 7ABPA 2ZBRA 5J4KA 1KC1A 3MLAA 5A62A 5I51A 3E0XA 3TL2A 3IOBA 3G0DA 4NCNA 5JAPA 3GDGA 3OC0A 3KUDA 3WL6A 4DUZB 1AHIA 1UBGA 3LBHA 1ZRMA 2WT8A 4E07A 5JH7B 3VR3D 1KY5A 4Q00A 2C92A 2X2PA 2A1UA 3NHUA 2BONA 3UAVA 3CVYA 1UC9A 4NHEA 3X2FA 2D0DA 4EX7A 1NQ5A 2OYCA 1PLJA 2FF5A 1M1UA 2JHGA 3NB0A 4UM9B 4KE7A 4PO9A 4DCVA 2C3UA 2J30A 1Y8QA 1UFQA 4HGZA 3NPAA 3EZ2A 1DXOA 2DT8A 2V6GA 5BW6B 4WA7A 1PS0A 4XTCS 3IUNA 4A91A 1PZNA 3R0QA 4W9NC 4HZUB 1D2HA 4Q9KA 4NTZA 4X1IB 3D5QA 3N8KA 4BASA 4M7OA 2OD7A 3HYTA 4FGZA 1RRPA 2PWYA 3P2KA 4KMRA 4L8LA 4O1HA 4XB1A 1PEYA 2P4SA 5C1DA 9ABPA 1HDEA 1KAOA 3AXTA 2FN4A 3KXPA 3OC6A 2OGZA 3W0LB 4PYLA 2YZGA 4FCCA 1K63A 3L82B 4C0QC 4N5MA 3KJNA 3TLGA 3MWEA 1XMJA 2WJPA 2NTJA 1UODA 2Z8XA 4FOSA 5EAIA 1JX6A 3PGKA 4G84A 4M8KA 4RNDB 1VTKA 1OZAA 1TIPA 3KJGA 4M36A 3PIDA 2AJTA 1K2VN 4YFYA 1XV5A 2ERXA 3N1UA 4QTTB 4A8HA 4EKDA 2GCIA 2REQA 3QBEA 3OD1A 3S2SA 3OT4A 1MW8X 2LKDA 3REQB 1F1JA 3SBEA 3CEJA 3H1GA 1YJCA 2ZIGA 2VYFA 2OLKA 4MUBA 1BWPA 2L19A 4E2ZA 4EB6B 2O8EB 1YNOA 1JWLA 2HMYB 3LVBA 4JWKA 1G21B 1OD6A 2CNWA 1S4MA 2OFWA 2P78A 3FSRA 3HZZA 2Z0MA 5FF9A 5KNCD 3V1LA 5AVYA 4ZVSA 2YNMA 2IV7A 3KSRA 3VSBA 5LWQA 3OP1A 3VU1A 5LLTA 4NJMA 2IYFA 1PV2A 2TYSB 5AK5A 5DI9A 1NATA 5JSYA 3TH5A 4GBED 4KWEA 4MARA 2WINI 1BFKA 1RI3A 4FLFA 1TTTA 2DF8A 4Z4EA 2NP6A 1G19A 4TMFA 4Y9SA 2X1HA 1TAUA 4BWVA 2XRMA 4QC2A 4QXOA 3PCXA 4N9QA 2QNRA 2FQWA 2B37A 4XUDA 3RR2A 2DKOA 3C8UA 4R54A 2BISA 5LYJF 3O6VA 4NH4A 3EPLA 1OCEA 1OX4A 2C54A 4N0QA 1QIJA 2WD9A 1YGPA 4EEKA 2ZATA 5LA6B 1FB5A 1HOTA 4QJBA 2WF7A 4JC5A 3ZVMA 2ETVA 1CUSA 3G9TA 4DJTA 4L74A 4XQ9A 1P2SA 3NHMA 2OHFA 1ZEMA 4RMHA 5EFZA 5HGJA 3H3JA 4D92A 5LU9A 1GNSA 2DBZA 3FNGA 4O6VA 3V9AA 3ZTTA 5CHYA 2RHHA 1OY1A 1T2VA 1U9IC 2OVBA 5EKSA 4L95C 4EW6A 1XLWA 4R1TA 4KIUA 3HVKA 3WQSB 2FDCA 2JW5A 2EV9A 2EEZA 3NZEA 3U5ZB 3RK1A 2WJVA 3BK2A 3MCVA 1HZJA 4XWOA 3U7IA 3L1IA 5B6IA 1UOEA 1GUFA 1DU4A 1QGUB 4RJLA 2XGGA 1Z7WA 3OZAA 4FINA 3M2PA 4GQAA 1Z7GA 4TTAA 4F2WA 1UZAA 3IBTA 1ND5A 2Z57A 1J1ZA 1W5FA 4B6GA 5BUZA 3V2IA 4MP6A 2YJZA 1V9SA 1H5NA 1MR3F 4Z5XA 2V65A 1DC4A 1CY6A 3IUBA 1J90A 1O9HA 1C8KA 2A9QA 4C30A 3F9RA 4YRMA 4CM4B 4PEVA 4FDUA 1FLDA 5K3OA 4MUGA 4BNWA 3F4LA 4A6XA 2IL1A 1UAAA 5IEBA 3D1LA 2I1LA 5ALUA 2FX3A 2PSFA 3WGOA 1L4EA 3JR3A 1UQTA 1V35A 2I4MA 4ML3A 1DAMA 1WZEA 1X13A 2R1ZA 3LU1A 3PCTA 4G86A 1KL7A 2C4TA 4X8LA 4KQWA 4JEHA 3ZKAA 1G5TA 5AHRA 1NUUA 2QY6A 4ZZ3A 4Z1OA 3ANSA 2JVJA 2FWMX 3SR0A 1Y1LA 3CIOA 5KQMA 1KNXA 1RS0A 1FRZA 3WZ2A 4KPUA 3EXIA 4YP6A 4LKOA 5BURA 2J7KA 2QZJA 1R00A 4D99A 4LOJA 4PCVA 4P36A 2GBLC 3OZFA 4G0VA 4C0LA 4JUDX 2Z5LA 4MZDA 4BEBA 3ZCPA 4FM9A 2XXAA 3EF3A 1W76A 2C2WA 2PUVA 3VDQA 3U16A 4C7OB 1IQ0A 2EFEB 5GADl 4E4TA 5I9NA 1XCOA 2IXDA 2QW0X 4JSYA 3A3YA 2G9VA 1QO9A 1UXIA 4W5QA 4KN6A 4WXEA 4A2CA 2OCYC 2RH9B 5A1TA 2QDKA 5IAJA 4CDNA 1Z2PX 2XTZA 3HCFA 2XTJA 4QXRA 1EWVA 2WMYA 1L4BA 1DJNA 1GVHA 1NVMB 2VDWB 2VRBA 1Z9BA 1AGXA 4LCJA 2JZOA 1ZVJA 3EF1A 1WNFA 3ISVA 3QF4B 2AD5A 4KDRA 2YV2A 4M83A 4NU0A 3RADC 1HEYA 8ABPA 1XTUA 2Y27A 2H07A 1GZSA 5LL6P 3T3MB 4KXNA 2RGNC 3D3NA 3PL5A 4RQTA 1X1EA 4WGFA 4AN0A 4M37A 5LDGA 2FGJA 3UWKA 1VG9B 4KFTA 4GYKA 3BGIA 3NHZA 4O1MA 1KI2A 1X8LA 2W48A 3MBIA 4AL4A 4E5SA 2I71A 4PS1A 5KYYB 1ODSA 3WGIA 1U7ZA 4ND8A 4EHAA 1C1DA 2QN6A 3JQAB 4L0CA 3GEMA 3TO5A 4BMXA 2GTIA 1NJSA 4AY6A 5C31A 5HXAA 3NHWA 2P9ZA 3RKRA 1SC1A 2B99A 1ISJA 1VM6A 4NEGA 5A0VA 1OPRA 3AP3A 3OCJA 2R6AA 4KR9A 3WADA 4EJ6A 1K7YA 5EHXA 2ZTHA 1PR3A 3EGXB 3G13A 2V5UA 3H2GA 5IDYA 4HK4A 3CISA 1BKSB 4F3CA 4Q24A 2CL7X 2BC9A 4I55F 2O20A 5J4VA 2I2XB 2F00A 5IH7A 1KZ1A 5H9VA 1NBME 5HVNA 5A9TA 2YXDA 4R8LA 1QF7A 3JVVA 2XDYA 2XLBA 4MTLA 4UJ3A 1XTIA 2H0QA 3RVKA 2O8NA 1EWQA 1S6YA 1K6JA 2ZUTA 2ZRKA 421PA 1HQDA 2GARA 2RIRA 2JFQA 3G2QA 1N7GA 4FI3C 2MSWA 4D4GA 5C3MA 4XJXA 1CVRA 2H9YA 3QU7A 3U7QB 2XW6A 4A0HA 1YMUA 2WAOA 1T3SA 3CM0A 2RKBA 4DL9A 1J33A 2I4LA 4OUDA 1C50A 1BXGA 3LRPA 4FMDB 1LNQA 4DCGA 1ZMOA 4RZSA 3DYVA 3GNLA 3ZJ5A 2PZMA 5ECWA 5CBPA 1H0RA 2A5YB 5L3SB 1NOJA 1T8UA 3V4VB 1IXYA 3PFGA 3H17A 4P93A 5ALOA 3O5AA 3OJ0A 4K86A 5EIFA 1N1MA 2C8JA 3AUTA 2ZJ5A 1OU0A 1IY0A 1GGHA 2OB1A 4HHEA 5BVHA 3JARB 1FP6A 3M6XA 3RVNA 2WUVA 1ZINA 4UNPA 4DJAA 1U2DC 1RZ3A 2RCNA 5F9MA 4J9VA 3T1NA 3DEZA 4KYTA 4GKVA 3B1FA 1UMBA 2CLHB 3DO6A 1YCDA 3DD1A 1B1CA 1LSUA 3ROZA 1W44A 4DAEA 5DTMA 4PZUA 5DSZA 4N5LA 1ZDMA 1EZZA 3HYSA 3KSMA 2QP4A 3A4TA 4UAUA 1C30B 5JOQA 4UATA 3OE7A 4H6WA 4IQ4A 1LUAA 1YU9A 2V9CA 3THXB 3IMFA 2ZK7A 1JHQA 1G5PA 2QUHA 1YR9A 3GOHA 4FYMA 1MHPA 1R6VA 2X9GA 2JI6A 2FQQA 1NN1A 1ZICA 3DBRB 4I50B 1VYUA 1JDZA 3W8RA 3HDVA 2WHQA 5IDWA 2J3LA 4INOA 3BGWA 4KQGA 2O8BB 3QX9A 3W3AA 5HZMA 3SU8A 2R4TA 4Q01A 4ZAGA 5K4AA 1EB9A 1KEPA 4RBNA 5K0EA 2ZLBA 3FPKA 1AK9A 2C2YA 3N7AA 4ZO4A 4BYGA 4MI1A 5L8VA 4DLVA 5E7IA 2Q3MA 3PITA 1DV2A 2V9PA 3G0IA 4NIMA 2Q7OE 1CZOA 3U7FB 1CQJA 5EOVA 2O8FA 3HH8A 3IDQA 3T5GA 5LOVA 2ZTVA 1P5ZB 3W1EA 3QVGA 3KUUA 1AU9A 1MO6A 2JFNA 4HDNB 2ZW9A 1R50A 4G5XA 3QMVA 2FI1A 5F2OA 3IULA 5IXSA 2XCLA 2GKSA 4LGMA 4CCYB 1HO3A 2OZKA 4S04A 1ZD3A 2BFDB 4LF6B 1CJBA 2H31A 4RANA 4ZI5A 2H1WA 2A0FA 5EE5B 2AN3A 3MWKA 4M1MA 3T54A 3WV5A 3TUZC 3IOCA 2ZKIA 3BHIA 1CZLA 4WXYB 3TLYA 5DTQA 4MVJH 3DUFA 1PG2A 4TTJA 3ODGA 4IJ5A 1KJNA 2GJ4A 5FPSA 3KLNA 3N76A 3NDJA 1QFXA 2X76A 4YP1A 4CLXA 2QNIA 2XE6A 1N0WA 1QE0A 2FK7A 3DF7A 3DDSA 4P7GA 3H4MA 2DQ4A 5K1SA 4FD3A 4RPJA 1ZH2A 2PVSA 3OBBA 1Q3TA 1L4YA 2E1PA 2PD3A 3D8HA 4TMWA 4ZCPA 4DXDA 3AZOA 4LZWA 4EHFA 4FYHA 3BHNA 4QELA 4MWBA 1DELA 1BXRA 2M1XA 3AHIA 4GM0A 3CPJB 1QS0A 5HILA 3DOUA 2CCKA 4HC4A 1JAXA 3VMFA 4QDJA 5HOEA 1FDTA 5CLHA 3ZGOA 2O59A 4Y2PA 2NVUA 3WISA 4UEWA 5LKRA 4URYR 3VTKA 1G8HA 3RVBA 1E92A 3WNVA 2Q07A 1K7XB 2LCIA 1GFIA 3ND9A 4GR9A 1W73A 1WHTB 2HO5A 1VE7A 4EQZA 1O0SA 1XYVA 3WWOA 4WOBA 4E2YA 2OFXA 3A9UA 4L5IA 4UUBA 3SHTA 3UWPA 4BIMA 5C46F 3FTDA 4DWJA 3WY9A 2QPTA 2D00A 2WJZB 1NE2A 3IP7A 1YMQA 1MDFA 2VZ8A 2NQ8A 2I2AA 1UDXA 1V71A 2KI5A 3DSRA 4HEHA 1HFWA 3U0BA 2IEIA 2ZWVA 3IKJA 1ZEJA 4M7PA 5AVSA 4NMXB 4G56A 4CU2A 1SPBS 3RRBA 1IEXA 2FRVA 3GJSA 4RXUA 4ZZ1A 1DCFA 3BCRA 1P39A 3UTCA 1V9LA 3O4JA 3NBUA 3W5UA 2FPXA 4V1CI 1GT6A 3L46A 4HJXA 3CWQA 5AJWA 4B35A 4ENRA 5JJLA 3A4VA 3GR6A 3OWOA 1HUQA 1F0PA 4TM7A 5H68A 1IVSA 2YC2C 2OAGA 3CLSD 1QO0D 1SU4A 4YROA 1GPKA 1JKFA 3SDBA 3RHTA 4H7IA 4Y2YA 2GD2A 1CUIA 5CNJA 3MCAA 2JATA 3SX4A 2R86A 3QELB 3OPQA 4Z7OB 1SQFA 4B0OA 3Q9UA 2OQRA 1POXA 4C4TA 1Y6FA 2H2IA 2BFFB 5I5EA 5GWXA 1ADFA 3SY8A 5C37A 3JZIA 5ITZB 1XTRA 1O94D 3BFVA 3K70D 1HI9A 2ONKA 3KDAA 3T1TA 3TS1A 1NR1A 2DY0A 3CLVA 2GPWA 4IOKA 1F6WA 3UAOA 4UCWA 2F1HA 3GBPA 4LWQA 2ZJFA 1PN3A 5I7RA 3RYCB 2I0FA 2BAGA 4KBYA 1QHIA 1ZUIA 3DE6X 2RGCA 4CMCA 2C88A 4G4JA 4D25A 1XXHA 3FPCA 2ZCUA 4LYJA 4C7BA 2J07A 2D5LA 1K6EA 3PHJA 3TTUA 4DB4A 4DIEA 3V9PA 1OXUA 1Q1AA 3ZLUA 4AJOA 1H2FA 1JXOA 1XVVA 4G5HA 1A77A 2DFPA 1ZUWA 4OQFA 5FI0B 1JHAA 3TGPA 1KS9A 2H00A 1RLUA 1P2DA 3EIQA 3EDOA 3QYPA 1RM3A 4QQFA 4EI7A 5HKKD 3TVYA 4IYRA 3MT0A 2FDXA 3K0AB 4PX5A 1E2BA 1QGAA 3I30X 4UREA 1NRXA 4YQFA 3ZGVA 4FYYA 5AXCA 3NXSA 2WWRA 4FHGA 1HL7A 1E4EA 1ZFNA 1FYVA 3F3MA 4DTCA 5BWMA 1Q7EA 2VS1A 2BJWA 1EGQA 3NNDA 5I7WA 2Y6UA 2AVDA 3E1SA 5B3LA 1U9CA 1TJ4A 3F73A 3ZHYA 4BX3A 3N75A 3IVMA 1G3QA 4YJDA 4F38A 4GOLD 4CLRA 3BXGA 5JBQA 3KO8A 3X1YA 3K9QO 4KX5A 3S2YA 1F60A 2YHAA 5FPTA 4M1OA 1JTVA 4JP1A 4XCQA 4HDSB 1P0CA 4ZZ0A 3X1ZA 2OXIA 2H1FA 3WK7A 1Y9JA 1A2OA 5KYNA 3BE5A 3U7RA 4I4CA 5L51A 3M4ZA 1JIVA 4BDTA 2HBZA 2IU4A 4RY8A 5FOXA 3A1CA 3E5MA 2G80A 1BKDR 4RNCA 4U2FA 3RS3A 4G63A 4EIWA 1K66A 4B09A 4DUGD 1FQOA 3HLYA 3UIEA 1AF7A 1GGNA 3CEMA 1QWSA 3ZBPA 1NQUA 4JBYA 2AOUB 3ZU3A 3BFXA 1SBYA 2I33A 1I1QB 1IAQA 1U9YA 5LZ7A 1H8ED 1EGAA 4HDRB 4Q7EA 4CG0A 3IESA 1YQTA 3VR4A 5EC8A 5GONB 5MN5A 4KPFC 1R6DA 1TQHA 5KX5F 3I6YA 3T5AA 1S01A 4JYBA 4GDFA 1ISHA 4KMSA 2R8PA 4OX9Y 1BG6A 3CZ5A 3IIMA 3PYMA 4ZVVA 1MCZA 5CLJA 3VMMA 2XYRA 3CRRA 4ZIRA 2XHZA 4HH1A 2QRNA 3KSDO 4ITRC 3OAAD 2DP4E 3UXEA 3KEQA 2I8CA 4H2DA 1MOZA 4WKNA 3S28A 2YWFA 3JTMA 1VGRA 4B7XA 2RCYA 1Y89A 1W5BA 4CF4A 2QMQA 3GLRA 2PIDA 3BZUA 4MUYA 1KI1A 1KK3A 3GLUA 3LIIA 5ALFA 2AFHB 2ZROA 3M9LA 4KKVA 1ZYUA 2CHUA 3PZBA 3IOMA 2AA3A 3JQFC 4AZVA 2F3TA 5EIAA 3L7AA 4Q5IA 3RLFA 2MT9A 3RTGA 3T3HA 5ALIA 1NW7A 4EY8A 1XN1A 4YB8A 3UT0A 1QOPB 4PYQA 3GFSA 1ZJWA 1N6IA 1HF3A 1QH1A 3D6VA 2NX2A 2ZE5A 4OAQA 5M3BA 4ZCMA 3U4DA 1UBLS 3LZ6A 5JW6A 2IUYA 3P2JA 4KR7A 4TKUA 2UVQA 4WKPA 1TVKA 1N7IA 3E18A 2INGX 3EZNA 2ID9A 4Z0NA 5IH3A 4YCLA 4WZAA 4RA9B 1HNNA 1Y7LA 4BY9E 1SFRA 1O08A 2C1XA 3GROA 4HBGA 5MHTA 1ORRA 2GPNA 1OI2A 4JJEA 4Q0MA 1RI2A 2Z2IA 3UO8B 5ESDA 5AVZA 3QQ5A 3BJEA 5A6SA 4RTNA 3QNMA 1RCTE 3BWDD 5C52B 1VJ1A 2GEVA 3AI3A 3KYCB 1YO6A 1P1IA 4ALMA 3UHFA 1WDMA 1E2PA 4XSHA 1K8XB 1NVAA 3NHPA 3AK4A 1R74A 3UMSA 4KXYA 2PL3A 3DAOA 3ZZ1A 4FNMA 2PSJA 4D9CA 4YPFA 1Z36A 3A9CA 4UBOA 2FX2A 4EG7A 1F2TB 2V7QD 3BM5A 2G36A 2Q4DA 2QF7A 3O95A 2PT7A 1RJWA 1RU3A 1K08A 3QFHA 3CVXA 2VUTA 2Z1DA 1E3TA 4EJSA 3RWOA 2C77A 2PTHA 2VI5A 4QOIA 5FBWB 5LBTA 5BOSA 4QM6A 3ZI0A 1LBIA 3INTA 2G5PA 3MTJA 5FAKA 5LP1A 1ZK2A 2A9VA 3VR3A 5ISMA 1RQ2A 2CBGA 5DNWA 4DOMA 3NMUF 2BFBA 2GJSA 3NTQA 3ETEA 1RYZA 4HYTA 1O54A 4X8MA 2CYCA 5CEFA 3FJ1A 3N2ZB 1OFUX 2A1UB 3PEVA 3SMVA 2JLXA 1PTJA 3JQEA 1JEAA 4UHBA 3NJ4A 3U4HA 3C6ZA 5K3FA 4BQEA 2OWDA 2XB8A 1U7OA 2N0SA 9LDBA 1Y8QB 4DUPA 2QRVA 3GQBA 4LN1A 1E5DA 7ADHA 3N6VA 3I9V1 3KXDA 2IHTA 1MBZA 2WNSA 5IUKC 3RGWS 3QPUA 4AF7A 5ALSA 1ZM9A 4KQ6A 2WE7A 4B6JA 5HJ2A 2BHTA 1JR3D 3HGTA 3BL6A 3OZEA 3B5EA 3SP1A 2BEUA 1D9XA 3EGOA 4NPCA 1J24A 1LF5A 4Z51A 1AH2A 1JZQA 4QNRA 1JVSA 3K35A 5CT9A 5HQJA 4P81A 4DBLE 2PRSA 4OK6A 1IXRC 1XTZA 3GWZA 4L28A 5H9WA 2H4HA 1XI2A 3BF7A 3L1KA 3MWEB 4XB6B 2G9NA 3TLGB 2D1YA 3L5OA 3ESZA 1A4XA 1UBKS 4JFAA 3D6HA 3BS4A 2BBWA 2IITA 5JCZA 1V3UA 1BMDA 4DFDA 4IXNA 5DXFA 4BJ1A 2CE7A 4YT2A 4LRWA 1RHQA 2REQB 1EK1A 3P32A 4JJ4A 4N0PA 5DM1A 2RG1A 5K0LA 3FWHA 1D09A 4JC8A 3ZCSA 1GV0A 4ETIA 2OC9A 3QUTA 5E1DA 1SU6A 1I0IA 1X1AA 4IDBA 4KIWA 4D1YA 1U7WA 3QUQA 5IU6A 3ZDRA 4BRZA 3GP8A 4BGEA 4EBBA 3TWOA 3GHYA 3IOYA 1UXKA 4CN8A 4YAIA 1S2DA 3CJRA 4LK2A 4IHKA 5KNCA 1W6UA 2QM0A 3SDZA 2Z09A 2J9RA 2XXBA 4EUFA 1G1AA 1ZSYA 2GJKA 4MWOA 3GGSA 4GKKB 4ERXA 4RYLA 2WDZA 3O3NB 4NJMB 1Y63A 3OTWA 1FX0A 5G02A