3WNQA

Crystal structure of (r)-carbonyl reductase h49a mutant from candida parapsilosis in complex with 2-hydroxyacetophenone
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
335
structure length
335
Chain Sequence
SIPSSQYGFVFNKQSGLKLRNDLPVHKPKAGQLLLKVDAVGLCHSDLAVIYEGLDCGDNYVMGHEIAGTVAAVGDDVINYKVGDRVACVGPNGCGGCKYCRGAIDNVCKNAFGDWFGLGYDGGYQQYLLVTRPRNLSRIPDNVSADVAAASTDAVLTPYHAIKMAQVSPTSNILLIGAGGLGGNAIQVAKAFGAKVTVLDKKKEARDQAKKLGADAVYETLPESISPGSFSACFDFVSVQATFDVCQKYVEPKGVIMPVGLGAPNLSFNLGDLALREIRILGSFWGTTNDLDDVLKLVSEGKVKPVVRSAKLKELPEYIEKLRNNAYEGRVVFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unconserved substrate-binding sites direct the stereoselectivity of medium-chain alcohol dehydrogenase
pubmed doi rcsb
source organism Candida parapsilosis
molecule tags Oxidoreductase
molecule keywords (R)-specific carbonyl reductase
total genus 100
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wnqA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3wnqA01
3QWAA 2I66A 4N7RA 4WECA 2P5UA 2NLOA 3UCXA 1MC4A 4NBVA 1T26A 3IOYA 4E32A 2Y93A 2EXXA 2CSUA 3KZVA 1F0YA 3DTTA 3WGYA 1NPTO 1QYDA 3EGOA 4UVEA 1BVUA 1W4ZA 3JQAB 1O94A 2BFAA 3NGLA 5C37A 3PJGA 2PWZA 1JVBA 1ZJYA 5BNIA 3EK2A 3F9IA 4BIIA 4ALKA 2X9GA 4Y98A 1JWAB 2CVOA 2IODA 2DFVA 2X9NA 3LC7O 4BO7A 1L7EA 4CMEC 5TJ9A 1P1HA 2P91A 4TWRA 4E3ZA 2C5AA 2ZTUA 2AHRA 3ZH2A 4PIVA 3Q2IA 5DOVA 1MG0A 4UUOA 5U4QA 3UICA 3PWZA 5U9CA 5IZCA 2GCGA 1NVTA 3C1TA 3HHPA 4YACA 1HE4A 2VRBA 3DZKA 3JD4A 4YT8A 1VC2A 1YKFA 3QWHA 4CQMB 2Y0DA 4N5LA 2HSDA 1HDYA 4FOSA 4BGUA 3BHMA 5L7TA 4OYRA 4L74A 4DUPA 4OSPA 3DHEA 4W99A 4BNKA 1JTVA 4MVJH 4YJGA 2O3TA 3OECA 1TI7A 3GG9A 1EFLA 3QQPA 1E5QA 1UJMA 3H9GA 4NK5A 5K9ZA 2IZZA 1ONOA 2PR2A 2NVUB 4MIEA 4Y8VA 3ZWYA 4AJIA 2WD8A 4RF2A 1E1LA 1YB5A 1PGOA 1ZEMA 4B7XA 3KM0A 3PWSA 2ZTVA 4R1SA 1U5CA 1CEQA 5EERA 5JNLA 4NJMB 1V8BA 4KTTE 3BMQA 2VYNA 3PTZA 3HDYA 3OH8A 4CMIA 1IE3A 1J4AA 8ADHA 1YH3A 1E3WA 3H9JA 2PD3A 5KIAA 3MJCA 5B1YA 5B4VA 3QV1A 3UCEA 1ZK4A 2EGHA 1Z82A 3KEQA 1RPNA 2P4HX 5ILOA 3BMOA 4NZ9A 2O2YA 4B4WA 3EVTA 1E3IA 1P45A 2JD0A 1XQ1A 3DONA 3TOZA 5JAIA 1E1KA 3IAHA 3QJ5A 2EF1A 4BB5A 4BNFA 4RDHA 2A35A 3PYLA 4AJ2A 3VKVA 2HU2A 2BI8A 4IMPA 2PGDA 3GNQA 3O38A 4J90A 3PJDA 4PLWA 4GPD1 1O0SA 4FJ0A 3B20A 2VHVA 2ZTLA 4PLFA 1DB3A 3RUEA 5JY1A 1A5ZA 3H7AA 3P19A 3Q11A 2B69A 3CSDA 3MJEA 3FTNA 1X15A 1YRLA 4IUYA 4WK6A 4XYMA 3WIDA 2EERA 2Z95A 2VZ9A 3NT2A 2BRUA 2DPGA 2VWHA 4CQLA 1JAYA 3GGPA 3QLJA 2PZJA 2ZIZA 1WDLA 2D0IA 5F1PA 1AHHA 4N5MA 4IJWA 4S1VA 1SEVA 2OP1A 3K73O 1R4MA 5IDXA 4DLLA 4J2OA 1QV7A 2FOIA 3JSAA 3WG9A 4WLEA 4GSLA 1ZCJA 1YJ8A 2OL4A 3U4HA 3I3OA 3ZWPA 1A72A 2GF2A 2X8LA 3LZ6A 4RVGA 2CDCA 2TMGA 2WE8A 4OM8A 5CPBA 3VZQA 3MTJA 3B1FA 1MA0A 5A04A 1AXGA 1Y1PA 4BO2A 5EINA 1JAXA 1V3TA 5F3RA 3RASA 1LA2A 3U4CA 3FI9A 4IDDA 3VVCA 4XR9A 2I9PA 4FIZA 1GEEA 1XA0A 2OZPA 2B4QA 4ZN6A 3P2YA 3PHGA 1W6UA 2VOEA 4KQXA 1GQYA 1V35A 3DMYA 5L53A 5IDQA 2VZ0A 1B0AA 3VH1A 4CMIB 2AXQA 2C7VA 2Y1GA 3ROPA 3ZGYA 1C3VA 4WUVA 2OUIA 1U7HA 5DZSA 3PYXA 3GVXA 3E18A 1T2CA 1TEHA 1GCOA 3WYCA 4BQPA 2BELA 3ANLA 1DRVA 3AWDA 5JE8A 3JQ8B 5KKCA 4K28A 2EV9A 3GEDA 3M2PA 4FR5A 4Q3NA 2GDZA 4XRRA 1DJQA 4J7UA 5EIOA 4W7HA 1LJ8A 4XGKA 2ZB8A 3OIFA 4IJUA 4WE3A 3NUGA 3A14A 3LQFA 4WGGA 5EQFA 3V5NA 4A2CA 4CMBA 5IXSA 1UXIA 4CV1A 1MXFA 4EJMA 2R00A 4F6LA 3KYCA 5ICSA 3QE3A 4KWHA 1YL7A 3CZMA 3GG2A 2PA3A 3PFWO 4J1NA 4E5MA 2BI7A 3V8BA 4LGVA 1D4FA 2VYND 1WAMA 1IULA 3VDRA 2HMSA 1BW9B 5K0ZA 3WTCA 4ZQBA 4RL6A 2H9IA 3BMNA 1ARZA 1A4UA 4ALLA 4JJFA 2Y67A 2FHSA 2YY7A 2V6GA 3F1LA 5JFOA 3MOIA 4RO0A 4BV9A 3OJLA 3R3JA 2EEZA 3I6IA 4B7CA 5HRUA 1H0KA 3IUPA 2DUWA 1QG6A 3A06A 4PG4A 1IZ0A 4IXTA 4YJDA 5BSEA 3QVSA 1EUDA 4P38A 4FBGA 3ONFA 3S8MA 2GSDA 4DYVA 5ITWA 2WSBA 3DDNA 2CUKA 3RI3A 1YXMA 5HA5A 3GZ4A 3DOJA 1B3RA 1O89A 4I5DA 4WJZA 5ER6A 1LQUA 2EGGA 5AXCA 5TIIA 2DVMA 2HK7A 3ENKA 3ZW8A 1N2SA 2O3RA 4IINA 4Y6PA 4NI5A 1C0IA 1KIFA 4I5FA 3RJ5A 4EYEA 2NQ8A 3IP3A 4CR7A 4ALJA 2DLDA 2GGSA 4WCDA 5G0WA 4JGBA 4K6CA 2DC1A 1NFQA 3D4OA 3JQBC 1GEGA 4YDRA 2Q1TA 2Q4EA 1QORA 3E1KA 4YA6A 4O5OA 4CQLB 1ORRA 4DBZA 3I52A 3E9MA 3KXDA 3WOHA 4QFCA 2VUSA 3JQGA 1P3DA 4HY3A 1QYWA 4NIMA 5TS3A 1E77A 3HZZA 3P7MA 4CLHA 1R0SA 1GZ3A 4JX8A 5IZ4A 1HKUA 1T2DA 5F1KA 5L4NA 5TT1A 1YQGA 1U5AA 3PVZA 3P2OA 4TRJA 3OHSX 3DO5A 3V2UA 4F6CA 3L6DA 2AQKA 3RQSA 5JAQA 3AM5A 3OJEA 4XZ3A 7ADHA 3B6ZA 1MUUA 1BG6A 2B0JA 3CUKA 4ZQHA 1A7AA 2JCVA 2NU6A 4Y6SA 1ZSNA 4D3DA 2GYYA 3AK4A 3K8ZA 5JO0A 1AUPA 3GUYA 1JWBB 3O26A 4II3A 3D5TA 1HXHA 3TOXA 4OAQA 5L3ZA 5K1SA 2X58A 4XA8A 3NTOA 2AEJA 3L0DA 3JQEA 5A3VA 4CM8B 1HZZA 1PS9A 1P1KA 1OMOA 1V0JA 3DBHB 4CLOB 5GZ6A 4TRRA 1B14A 3U49A 4DPMA 3WFJA 4B3IA 4MOWA 2ZTMA 3ABIA 2I76A 4L76A 4CM4A 1EQ2A 3GH3A 5LDHA 3A9WA 9LDTA 3RC7A 5HM8A 1EVIA 2A4KA 1OC4A 3UN1A 4RV9A 1G6KA 3O4RA 3RD5A 1AGNA 3UOGA 1CF2O 2UDPA 2X86A 5FI5A 1HYEA 1QP8A 1E7SA 1BW9A 1R4MB 1LXCA 3Q1LA 5T67A 1LTHR 3BMQB 3I9OA 4TQGA 4RJTA 2C07A 3IS3A 3VZRA 1RM4A 2GZ1A 3WICA 2HK8A 2W8ZA 4Z0PA 2FPIA 4RQUA 1SC6A 1NVMB 1U8XX 2G0TA 4JK3A 4Z0TA 5IDWA 2Q4BA 5AOVA 2GN4A 4IS3A 1NHGA 1YB1A 4GKVA 4XQEA 4IM7A 2V65A 1GYQA 4ZQFA 3H4VA 4TRMA 3I4CA 3WFIA 4CMGA 5KTKA 3O8QB 4Q3CA 1I2ZA 1N7HA 3EY4A 1Z45A 4YJGB 3ZWNA 1DAOA 3DB2A 2Z1NA 1KEPA 4BNGA 2EIHA 3GHHA 1CIVA 3FWZA 4X54A 3PEFA 3M1LA 3OEYA 4ND3A 2J3IA 1HL3A 2PZMA 3GLQA 1S6YA 1P44A 3C7AA 2X0IA 3JQ7A 3WGTA 1PZGA 4CM7A 2E48A 5BR7A 4BO4A 3G79A 5B4TA 4IDAA 1YOVA 4QEDA 3WQQA 1Y7TA 5AXBA 4FB5A 2IXAA 4B3HA 2AEMA 5AXDA 2Y99A 3GGGA 1DC3A 1EFKA 2H1SA 2YFQA 3QIVA 4FCCA 3UHAA 2E49A 2EHDA 2DFDA 1QV6A 4UUPA 3QP9A 3I6QA 2FMUA 2GZ3A 1R12A 4AJNA 1RKXA 3IDSA 2AG5A 1HDOA 3I83A 1DC6A 1IHXA 4CM1A 2JD1A 5DBFA 4CV0A 3CPSA 1FF9A 2CNBA 4EUFA 4KQWA 4YAKA 4J9VA 5CDUA 4DMMA 4XIJA 1DIBA 3KEOA 1H6CA 2BD0A 3DXFA 3NAQA 4YQZA 1XYGA 4FFLA 4ND1A 4XDYA 5GMOA 3FCOA 1ULSA 1EUCA 3D3WA 3ULKA 4HP8A 5FF9A 1ZZEA 1I36A 3ICCA 5I7VA 3TFOA 4JIGA 1JKFA 5IDYA 3PHHA 5DOZA 3GC6A 1VRWA 3PRJA 4I08A 2QHXA 2FPPA 5A05A 3LC2O 1GPJA 3VH2A 4R54A 3RFXA 5GY7A 2PGLA 5U1PA 3VPGA 4MVJD 4PG5A 4U5QA 3OETA 3VDQA 5A9TA 1KOLA 4DPKA 5THKA 4UULA 5L4LA 3L77A 4R69A 4AJ4A 4M55A 3GNTA 1HRDA 1MFPA 2NM0A 5F1OA 3AOGA 2B5VA 4B3JA 2O23A 1D1SA 4NBUA 3SLGA 5F5LA 4DXHA 4KDFA 3UAGA 3KYDB 3RUCA 1Z7BA 5JCJD 1I3LA 5TT0A 2JCXA 1E3WB 1NPDA 4M8SA 2WD7B 3PDJA 3EYWA 1JKIA 4TZKA 1H2HA 4RPHA 1PJ3A 2OFPA 4OIMA 4BGEA 4MPDA 4IDCA 3OBBA 4OXNA 4LCJA 3D3WB 1BSVA 3JD2A 1ENOA 2IEDA 1LDMA 2FSSA 3HWRA 4GGPA 2WYUA 5CHEA 5EQDA 4KUHA 2ILTA 3EZLA 4YRBA 1IB6A 2G5CA 4CMEA 3VKUA 4YT2A 4YYZA 1NR1A 3BMCB 1T1SA 3VTZA 1LX6A 4S3MA 1Z74A 2YJZA 3UKOA 2F1KA 1ZO8A 4J3FA 1AN9A 4FSHA 3D3EA 2GERA 4OKNA 3GMDA 1ULUA 4CJXA 1Y81A 1XEAA 1HF3A 1NXQA 3ZDFA 2C0CA 5AQ1A 1GQ2A 1E1NA 1EVJA 1FDSA 2X22A 3I9NA 2C7GA 3GY0A 5TLSA 1DIGA 3SVTA 2NSDA 4FOOA 4EJ6A 5CPFA 1N92A 4YB8A 1AXEA 3GMSA 1QMGA 5L7WA 4YQYA 3GPDG 1LI4A 2IYOA 4QO8A 1X13A 2Z5LA 1PGJA 4J4TA 4KDEA 3ZWBA 5A4DA 2OBYA 1U2GA 3QVXA 4DYDA 5T57A 1HSOA 4XGIA 3V1TC 1WMBA 2IXBA 3IIEA 1LU9A 3TZHA 4NFYA 4Y9DA 1YBAA 5DCYA 4BKPA 4YJHB 4R9SA 1K6IA 4OJNA 2ZB7A 4J91A 4WLOA 3WMXA 1H93A 1LSJA 4J16A 3ZNNA 3WGIA 3SLKA 1XR3A 3BAZA 5IN4A 2ZCUA 1M67A 3DEYX 2PD6A 3RUHA 3I9KA 4E31A 3Q9UA 4ZQEA 1N7GA 3CIFA 1U3WA 3QW2A 4YT5A 5KOIA 4D3FA 4JN6B 4KZPA 2XAAA 4ITUA 5JY6A 1XHLA 2IRWA 2AE1A 3G17A 4XYBA 4DTIA 5ER9A 2Y1DA 1EDOA 1BMDA 1XDWA 4RVUA 1XIVA 2OHXA 2CFCA 1PIWA 2EW2A 1I30A 1CDOA 1H6AA 2C2YA 2HRBA 1Y6JA 2P9CA 4PG7A 1U2DA 4RLSA 2GUGA 4RVSA 2OBNA 1VI2A 3FHLA 2D8AA 4NMHA 4QFDA 3NX4A 4CV2A 4DC1A 4D0RA 3EW7A 3KRTA 4NHEA 5J23A 3F1KA 5JCJA 3HDHA 2D5AA 2YHUA 4QO7A 1C1DA 2WDZA 2I65A 1I32A 1ZBQA 2OP0A 2YYYA 3H2ZA 4HFMA 2NVBA 2WYVA 4D0SA 2JD2A 4ZGWA 1GTMA 4HADA 4L4RA 1WZIA 4D45A 1J6UA 3F5QA 3MZ0A 5JLAA 3CH6A 5LDGA 4HKTA 4U0JA 2EKLA 3BYZA 1PZFA 1E6EA 4LVUA 1BRMA 1R6DA 1VL6A 1YQDA 1ZMOA 2ZYGA 4IGEA 5CG1A 3WS7A 5K6AC 1CWUA 1DIRA 3GEMA 3F4LA 2HMVA 3ETGA 1GU7A 1HZJA 5KWEA 3N74A 3PLNA 3ZWVA 1O6ZA 1ADFA 1Y8RA 3O03A 2O50A 1WWKA 2X23A 3C1OA 4QT0A 3KSUA 1PX0A 2GR9A 4I8XA 4XX0A 2Y1OA 1ENYA 1ZSVA 3BZUA 1YWGO 4YBZA 3WTBA 2OMEA 1N1GA 3KOUA 5KVQA 6LDHA 4DQVA 5JYDA 2CD9A 3ZNQA 1EVZA 4JBIA 4U7WA 3WWYA 1QSGA 1ZSYA 2AA3A 4HUJA 5I8WA 2DTXA 1Y8RB 3NJ8A 1NM5A 4K1LA 4R1NA 1KY5A 3RFTA 2W2KB 1WZEA 3JD3A 1DLIA 1M6HA 2PKQO 4G2NA 2BHLA 2DM6A 1EDZA 4GWKA 3H9QA 1I3MA 4BOYA 5JW6A 2ZQZA 1O8CA 2NQTA 1T2EA 5IAAA 3VZSA 2VWPA 1LC0A 3H5NA 4BNWA 5CFZA 5I7EA 1E3EA 3JTMA 3Q3CA 4BMNA 5JCXA 2O48X 3OEWA 2BMAA 4KUGA 4E2YA 2IYPA 2RHCA 4CM3A 2BGMA 4UUMA 4BB6A 4R3WA 1R15A 3ONEA 1V9LA 1KVRA 4O59O 4EBFA 4E0BA 2UUOA 3IKTA 1OAAA 3C3XA 4E33A 1DJNA 4YJHA 5TSDA 4WEOA 2WE7A 2QZ9A 1GDHA 4DMLA 4LMRA 3RBVA 5JAMA 2OORA 3DL2A 5THQA 2J5RA 2AE2A 4CQMD 2GZ2A 2VT2A 3NGXA 5KJ1A 4BGVA 4YJFB 3TQHA 3TN7A 4J2HA 5L40A 2A92A 3ADPA 3GVPA 5EL0A 1NX6A 3EUWA 3E82A 1U1IA 1ZXLA 3OQBA 1E1MA 1PS0A 4UUNA 2PKQP 2ZB3A 1RM3A 3PFFA 2NNLD 4UVGA 2ZYAA 3ZZNA 4ND5A 3VPSA 3ZWOA 4B8ZA 1M76A 3OIDA 4ZD6A 2VCYA 4A27A 1RM0A 4CM9A 2YQ4A 1BVRA 3OJ0A 5KVVA 1QRRA 3R0IA 4IJVA 5ENVA 4M49A 4RZIA 2RHRA 2QYTA 3WJAA 3I5MA 3BXXA 4XQ9A 1RM5A 1QYXA 1G1AA 2YZ7A 4TVBA 1NFFA 1KY4A 3G1UA 1JKJA 1R4NA 3AFNA 4YTEA 3R1IA 3RJ9A 1N9GA 3NV9A 3ZN2A 5CAEA 3B70A 4K9DA 2I99A 4E2ZA 5T5QA 2YV2A 1E3SA 1JVSA 4TRNA 5I9LA 2FP4A 3FD8A 4W9NC 1YBMA 3F46A 3UCFA 6ADHA 3GVIA 1SB9A 4K6FA 3Q0EA 4PLZA 5G0TA 5TGDA 5JDIC 4E30A 4MJLA 2X7HA 2HCTA 4WLFA 1X0XA 2O4CA 4IMRA 2HMWA 3V1YA 3FPLA 1H94A 3RKRA 1GUFA 4BO9A 3D64A 3H5AA 3KVOA 4YCAA 1UP6A 3DHNA 1KVSA 4MP3A 2WD7A 5G2OA 4E21A 3QY9A 3EZYA 4U6SA 2B83A 1XSEA 4EUEA 5JYEA 2V6BA 4PLHA 3KO8A 5EESA 5A9RA 3DBVO 2GASA 1X7GA 1YL6A 3L9WA 1YJQA 3FN4A 3KB6A 2F00A 2RBEA 1ADBA 1T4DA 3UGKA 4CL8A 4P4NA 3T7CA 3WGZA 4NR0A 2GPTA 3KUXA 3JQCA 4RGBA 3TZKA 2UAGA 4RF3A 3AOEC 2J6IA 1YONA 4H16A 4U6QA 5C7OO 4BKUA 4LSMA 2GN8A 3JV7A 1WXDA 2C2XA 1CETA 2O2SA 4OQZA 4ZRNA 3K5PA 2WEKA 2JFFA 4QXMA 2W2LD 1PJBA 1C0LA 4AJLA 3D0OA 4H7PA 5A02A 3AUSA 3K6JA 3BHJA 1DBVO 1C1DB 4MKXA 4NNJA 4C7KA 2VWQA 1T1RA 1T24A 2QW8A 3SJ7A 4CUZA 2NTVA 3KETA 2PY6A 3W4JA 1WP4A 3TJRA 1KVUA 4DGSA 3ETDA 3VOSA 3L9XA 2RH4A 4URFA 4WOJA 1L1FA 3DMTA 3JD0A 4JJGA 5FYDA 1GV1A 4RCVA 2FY8A 5CDGA 3KYDA 5B37A 5KVSA 1JLLA 2W98A 3HDJA 2Q99A 4Z6KA 5JS6A 1A4IA 4OKIA 4Q3BA 3QVTA 1XELA 2EW8A 1ZFNA 1B2LA 4ESOA 1B16A 1XCBA 1LEHA 3NDIA 2PV7A 3ETEA 4WPGA 2AW5A 3KYBA 3VVBA 3ZHYA 3DBHA 4CLOA 4P8RA 3HB5X 1W0CA 3V1UA 1A9ZA 4DLBA 4NK4A 4GL4A 1NNUA 3MJTA 5DN9A 2LDBA 4NPCA 2Q2QA 1ZK3A 4TMFA 2YDYA 2FZEA 3JYLA 2O3QA 3GAZA 4LRSB 3KSDO 5HBRA 5I9MA 3ZV4A 1YL5A 3ZU2A 1NR7A 4GX5A 2RCYA 5EN4A 1C1XB 1PZEA 4FS3A 3SC6A 2EKQA 3RUFA 1VSVA 1ZH8A 5ICMA 4GH5A 3FRJA 5BNFA 4DVJA 1E7QA 5EJ2A 4YR9A 3CINA 3OQ1A 3ANNA 1ENZA 3NEPX 1PWZA 1F06A 1KYQA 1LBEA 4Q3EA 4UEKA 3EHEA 1PR9A 2SCUA 2DBZA 1VL0A 4BO8A 1F17A 3AY7A 3P5SA 1PJLA 1TVEA 1U7TA 2C54A 1NYTA 1G0OA 1V3VA 4PG6A 3C7DB 4IIUA 5EPOA 1HE5A 5JC1A 5GZ1A 1NQOA 3RUDA 2B36A 2Z1MA 3DZHA 4WASA 5JDCC 4CLEA 2DBVO 1TXGA 1LLQA 5B12A 4M1QA 3I9JA 2EP7A 5KJFA 3F6YA 3I1JA 3WB9A 3TL3A 3GZNB 1GZ6A 3H65A 1DAPA 3GHYA 4J1TA 3PK0A 3W4IA 3QA9A 1F8GA 3ZHZA 3NDJA 2JKVA 2PZKA 4Z9FA 1E7MA 4XQCA 3WDSA 3LLVA 4I1IA 2NWQA 3PI7A 1FMCA 4AICA 4BNYA 4BNLA 4H3VA 1SCUA 4NJMA 4GMFA 3SXPA 4BNNA 2VYVA 1DXYA 4UVHA 4Q3AA 4R9RA 3PQFA 4FC7A 1KC1A 4E5PA 1OOEA 1S7CA 1TT5A 4BNIA 4A26A 3PIIA 4D3SA 5DF1A 5HTOA 2W2LA 4XJTA 1ADGA 2XPCA 3ZWCA 4R51A 2FWMX 4FJ1A 4GI2A 4HX5A 1H2BA 4FN4A 3GVHA 1DRWA 1ENPA 1YB4A 1PJCA 3H9UA 3MJSA 2X0NA 3AI1A 3DHYA 4GWGA 3HE3A 4B79A 2W4QA 4NFSA 2ZCVA 1CERA 3L6OO 2V6FA 3GGOA 1U4SA 3G3EA 3OIGA 3MJ4A 4CPDA 2QIOA 1NWHA 3WX0A 1IYZA 8LDHA 3RCBA 4UVIA 4R5HA 3OP4A 4CLRA 3LT1A 4NFHA 3X2FA 1LDGA 5ITVA 4OXKA 1R37A 4B7UA 3IKVA 4QX6A 3F4BA 4ZA2A 4NJOA 1K89A 5TQVA 1C14A 3C85A 1E6UA 1UR5A 4EZBA 1Q0HA 1NVGA 2Y0EA 4JJIA 4YVFA 3UXYA 2ZKLA 2BFPA 9LDBA 3DBRA 4MIOA 4LSWA 1LLDA 3WBFA 3HADA 1PZHA 3T4XA 1GV0A 1XQ6A 4W9NA 1E6WA 2YDXA 1KVQA 3DZGA 4J7XA 1VKOA 3PDUA 2YFHA 4DPLA 1UXHA 5LC1A 4RPJA 4PG8A 4W7IA 5C7IO 3GRKA 1CRWG 4GMGA 3VH4A 3KHUA 4OOEA 2HMTA 1ZW1A 3LF1A 4OH1A 4XYGA 4YAIA 3JQ6A 3U3XA 3RUIA 2OXIA 1HYGA 3ST7A 4NG5A 1GADO 2Q45A 3MWDB 4HFRA 4RPGA 1NTOA 3HB4X 3LT0A 3MWEB 4LK3A 4BKQA 4CLXA 3E9NA 1Q0QA 3JQDA 4RQTA 3RROA 3WLFA 4RLHA 4BNZA 5JXWA 4FPXA 1MC5A 3H3JA 1M75A 1CJCA 3W6ZA 1BXGA 2UV8A 1PR3A 4JNKA 3W6UA 5JAZA 1B8VA 2VTDA 1OFGA 4BNTA 3T7EA 1PGNA 1D1TA 5C3MA 3RBZA 3FR8A 2X5JO 1TB4A 2GLXA 3PWKA 3RSHA 3GPIA 2GN6A 4WKGA 3IUSA 4DA9A 3U4IA 4XKJA 2DBRA 3U4DA 3ZNOA 3AUTA 1ONPA 1KBZA 4JBHA 3ROQA 4E5KA 5B4UA 4D43A 1Q7CA 4O63O 2B37A 1EZ4A 2E6UX 2JFHA 2IZ1A 3PGJA 2BFOA 3HQ4O 4TSKA 4W6ZA 4Z3DA 2NU9A 4BMSA 4F45A 3VPFA 1N1EA 4CLDA 1UZMA 5KJEA 4CM8A 2R2GA 1PJQA 1LRJA 3F5SA 3QVOA 1ML3A 3LU1A 1GUZA 3WGOA 4O1MA 2NTNA 4J1QA 1E3LA 2PH3A 4U8GA 4DQUA 1H9AA 3PZBA 4I9UA 4ILKA 4LCEA 5CP8A 3U5TA 2E4AA 4HWKA 4BO6A 3AFMA 4BKRA 2X5OA 4KOAA 4UEOA 4NBTA 5KNLA 4P4GA 5KCZA 4JP3A 4E5YA 4CR6A 2Y0CA 5DT9A 1QLJA 1RYEA 5DP2A 4QUKA 1XU7A 2QRLA 1HDXA 1BTOA 1X7DA 3H5RA 1VJ1A 3KLMX 2X1HA 3BMNB 4A5OA 3ROMA 1PSDA 4BV8A 3G1TA 1SMKA 1PJ4A 2FR1A 5MGBA 1ZMTA 2VRCD 3WQRA 1ZJZA 2AQIA 3ORFA 1BXKA 3DFUA 1T4BA 5LCXA 4N18A 4EITA 4R68A 3V2HA 4AJJA 1TA4A 4D7AA 5FI3A 4Q3DA 4IDBA 4AJKA 4PVCA 4AVYA 1V3UA 4GLOA 2D59A 2DT5A 3PJFA 3OJOA 3OICA 3KSZO 5F21A 1SOVA 4U0KA 3H2SA 2Q1UA 4DRYA 3VPHA 2VHYA 4L75A 2C20A 1DFGA 1KERA 3ICPA 2NV6A 3X2EA 2Y66A 3ZNPA 4D44A 1EK5A 4BNJA 1VJTA 3BMCA 5JC8A 1T25A 2O4UX 2YV1A 3DBRB 3DBLA 2EG9A 2Q2WA 1A71A 3NRCA 2EWMA 2D1YA 3BTVA 1PWXA 3HG7A 1U3UA 2IZ0A 4ZICA 3SC4A 1HLDA 3U62A 1I8TA 2LDXA 2DUUA 5L45A 1QXSA 3KBOA 1ISGA 3F47A 4TKMA 4RVFA 2FR8A 2JCYA 4L4SA 4PZDA 5CEFA 2NADA 1IUKA 1SZJG 1Q7BA 1P33A 2Y1FA 1F14A 4IS2A 3INRA 4OSOA 3E6AA 4JROA 2FPGA 2E37A 4D79A 1Q0LA 4WEQA 3R6DA 2X9VA 1NP3A 3JQ7B 2FR0A 1IL0A 1LUAA 1I2BA 4E12A 1PGPA 1EBUA 4CM9D 1IHYA 3GEGA 4AJEA 3ROKA 3WGHA 5A9SB 4YRAA 3PP8A 5COQA 3HFGA 3PIDA 4BO0A 4B4UA 2C29D 4AJHA 1F8FA 1L7DA 2P9EA 2DPHA 2B4RO 1T2AA 2X6TA 3EVNA 4CQMA 3O8QA 3BHIA 1KC3A 3GZNA 3WXBA 3GAFA 1IZ9A 1QKIA 4ZJUA 1BXGB 1X1EA 3AY3A 1U9JA 3GFGA 4Z3KA 3OSUA 4L0QA 3NT4A 4TZTA 2XF8A 1WVGA 1HT0A 1LRKA 3OM9A 2O3UA 3K92A 4J0FA 4WOKA 3E5MA 1SEPA 2FRDA 1DOHA 3QWIA 2J3KA 3R3SA 4G81A 4L9RA 3TRIA 1SNYA 2GN9A 4RF5A 2VHZA 4L8VA 1E7YA 2O7SA 3DAFA 4GLLA 1UP7A 4JQCA 1MG5A 2P68A 1ADCA 3WYEA 1E7RA 2YHIA 4ND4A 1D8AA 3E48A 1B15A 2PZLA 4KMSA 2DTDA 3S2FA 3LLSA 4FFMA 2DBQA 4KUEA 4YWJA 5IFLA 2YV3A 3UH1A 1GFSA 4J7CA 4HBGA 4XRGA 3VZPA 1OBFO 4LVCA 4WLVA 3DBLB 3C24A 4II2A 1YVEI 2VWGA 3E8XA 4Q9NA 4RORA 4QQRA 2EKPA 5I7SA 4OOFA 3BA1A 4ZHSA 2X4GA 1FK8A 2UUPA 1U3TA 4O0LA 1SPXA 2VNAA 2J3HA 4BNXA 1UDAA 4L73A 1WPQA 2VQ3A 1QLHA 1I01A 3DWFA 4GVXA 4MVJP 4J43A 4RZHA 5JDIA 1UZLA 4Z0HO 2AQ8A 5ADHA 2PGJA 2HO5A 5H82A 5HWSA 3CMMA 3DC2A 4YRDA 3QVWA 4ALNA 1G0NA 3AOEA 3HUDA 4XWYA 3JYQA 1C0KA 4TROA 3DFZA 3FNGA 4HFNA 5KVCA 5BSFA 5IJZA 4P4LA 3PJEA 1IPFA 1EE9A 1ZNQO 2CVQA 5IN5A 4Y67A 3NDRA 2HAEA 4IZHA 4FFPA 4RPLA 1U4OA 2ZB4A 3ADOA 3WSVA 3OA0A 1QYVA 3CTMA 2CY0A 1I10A 3ZW9A 2CDBA 1YQXA 2ET6A 3D7LA 1UZNA 1YOVB 4PVDA 1P1IA 1Q2XA 2HUNA 1Y8QA 5BT9A 3TF5A 3U9LA 3LC1O 2Q1WA 5TJHA 3NT5A 3PQEA 2O3JA 1B8UA 1GYPA 3NJ4A 3U0BA 3E03A 3FBTA 5JSFA 4NU6A 2C59A 4RVDA 4DQXA 3GN1A 3DQPA 3JYPA 4MO2A 5HS6A 1WW8A 4B4OA 5BSHA 7MDHA 1K3TA 2JHFA 5JPIA 4QTZA 2A94A 3VAZA 1XKQA 2NACA 4R5MA 4D42A 1AE1A 1CQJA 4FQ8A 4NU5A 2WJPA 1N9GB 4LRTB 5A1TA 1QR6A 2YW9A 1LDYA 4J9UE 2RIRA 1LLUA 4EGFA 1A7KA 3RVDA 3G0OA 4A73A 4ZRMA 4ID9A 2ZJ0A 3ZWWA 3UW3A 5IG2A 1K6XA 2Q49A 1UXKA 2B35A 3K9QO 1VE9A 4R1UA 3FPCA 2BKAA 1ZXBA 4PLTA 1HLPA 4PZEA 1VPDA 1B26A 4YEDA 2Q2VA 3FBGA 5CG2A 4PZCA 1M6WA 3PZRA 2HJSA 4G65A 4RF4A 3RAJA 3B1JA 1U28A 5AXAA 1FDVA 2CF6A 4HFJA 4ZU3A 3RFVA 5JBIA 2PNFA 1P1RA 3WMWA 1H9BA 2ZJ1A 3WGQA 4AG3A 1EK6A 1LDNA 1NQAO 3ZWMA 3QWFA 1LQTA 3RU9A 3D4NA 4PRKA 5G4KB 1EE2A 2D5CA 4BS9A 3KV3O 3MCVA 5H81A 3Q9NA 5L95A 2G17A 1BWSA 4ZQGA 5MDHA 4BUCA 2I6TA 3PHIA 3K2EA 1KETA 1IOLA 4XGNA 3S2IA 1NASA 1I33A 2AEFA 3WGGA 4MVJF 1I5RA 1KEVA 4WNIA 4DLAA 2B4TO 1PL7A 4MVJG 4R16A 3V2GA 3PHLA 4BO1A 3BTSA 3K31A 1N5DA 3AU9A 3VTFA 4YJFA 3RU7A 3DMTC 4IBOA 3BTUA 1O95A 2QG4A 2VN8A 3ZV3A 3ZWAA 1I2CA 3RC9A 1DDOA 1LSSA 1Y5MA 3ONDA 5CDTA 4EJ0A 3COSA 3GNSA 3IJPA 1EMDA 5CDYA 2I67A 2OGUA 5TRTA 3OQ6A 3PPIA 4P22A 1YDEA 3TSCA 1K5HA 1NAIA 1HDZA 1SBYA 3L4BC 1VSUA 2NUAA 2VHXA 1NQTA 4PGFA 4EUHA 4MVJA 2P9GA 4AFNA 1D7OA 2X0RA 5DP1A 2C82A 3W8FA 4MKZA 1LNQA 2HLPA 3AUUA 3H9EO 1WDMA 4WNCA 5AYVA 1ZKMA 4AJ1A 4DIBA 5L4SA 3IC5A 3LT2A 2EJVA 3LDHA 5BSGA 3LK7A 3DZFA 1TLTA 4PLYA 4CMHA 4RVHA 4IJKA 3D5QA 1I24A 2BH9A 3INGA 3JQAD 4TVOA 1BDMA 4YAJA 3DZIA 3PGXA 5T6BA 3CXRA 4BNUA 3VC7A 1WNTA 4W82A 4YXFA 1ISIA 3ASVA 1NFRA 5TX7A 3C1AA 1H6DA 3UUWA 2RAFA 1MX3A 3FF4A 1ID1A 4J0EA 4XJSA 1R16A 5I9NA 2AMFA 1WDKA 1XU9A 2G76A 4GGOA 1DC4A 2HJRA 4MINA 1MB4A 4DREA 1YO6A 1DC5A 4ONEA 4H15A 1GYRA 4ZVVA 1J49A 1IPEA 1FDTA 3I4FA 1OC2A 4XYLA 2IEBA 4MKRA 4XR4A 3GA0A 2AQHA 1R0LA 3S55A 4FW8A 1MV8A 3TZCA 2NVUA 4R01A 4PFJA 4IQ0A 4OO3A 2PFGA 3IJRA 4BHTA 3JQ9A 4MP8A 1VL8A 3PXXA 2ZYDA 3CEAA 3WQSB 3PLRA 1R4NB 4UVDA 4Z9XA 3CMCO 3TL2A 2AG8A 1FDUA 4CR8A 1HDCA 3DOOA 4CUKA 5KJCA 1HETA 3W1VA 4IPTA 4FGWA 2BGLA 3LT4A 1Z75A 3GN2A 2BFMA 2D4AA 1PS8A 3ON5A 1W8DA 1JN0A 3GFBA 1X7HA 3D1LA 2YUTA 2DAPA 3F3SA 5TC4A 3WIEA 3FR7A 2QRKA 4IDGA 3S2GA 4IDEA 4N5NA 1X14A 5L51A 3TNLA 4KTVE 4O6VA 1B7GO 3OJFA 5IZCC 3FNFA 2QX7A 4FFOA 3GK3A 2P2SA 4MP6A 3W8EA 4KWIA 5IF3A 1JDJA 4OXYA 2NVWA 1YDWA 4R41A 3TDKA 5KJ6A 4M86A 2WMDA 1JU9A 4HXYA 4PLCA 1GUYA 2DU8A 3JQFA 4EW6A 1ZK2A 2FN7A 2Y68A 4D41A 1PU2A 2WWRA 1Z7EA 2B5WA 1J5PA 3BMOB 3AW9A 1HDGO 2QQ5A 4CV3A 1EVYA 5L9AA 5BNTA 2ZQYA 1EBFA 1ISMA 1A27A 3SX2A 1K2WA 4OMUA 1Z73A 2TMDA 3FNEA 2VHWA 3JCZA 4I5EA 4DIFA 3I9LA 1UDCA 3AU8A 4E2WA 2WTBA 2ZK7A 1P0FA 2Q1SA 3AUAA 3QRWA 2CMDA 1ZUD1 2HRZA 4OHUA 1C1XA 2XOXA 1LDBA 3DZBA 1DPGA 2JAPA 4IIVA 2Q50A 1X0VA 1DRUA 3MTGA 1HSZA 4I5GA 3SEFA 2DKNA 3NTRA 3EAGA 2W2KA 5CEEA 3NKLA 3DAPA 3ZCXA 3IL2A 3ZU4A 1GPDG 3Q6IA 1B8PA 3L07A 3DZJA 2EJWA 1KEWA 2Q46A 5A5EA 4AJOA 3GF4A 1PJTA 2J3JA 4Q39A 1P1JA 4UREA 3UF0A 1TT5B 4EEXA 1K6JA 3GR6A 4HNGA 1ISFA 4XEHA 4E2XA 3ZI0A 3HNPA 1LDEA 5JDCA 1GY8A 3W4KA 3NTQA 4GVLA 2QYSA 2JAHA 4PLVA 3B1KA 1UP4A 5KKAA 4JXKA 2G82A 2I3AA 3JQ9C 4FC6A 1D3AA 1ZK0A 4BO3A 2FSVA 3E9QA 1YBVA 1PL8A 2PTGA 4C7JA 2GNAA 2YHIB 2IDZA 1HEUA 4R3NA 4BVAA 3MEQA 3OA2A 4PRLA 5BQFA 4WCFC 3GUCA 3TFQA 3DOCA 2A9FA 3W8DA 4WCFB 1HTBA 1LSUA 4GKBA 1P0CA 3WBBA 3RC2A 1JQBA 5A06A 3CE6A 4ALIA 3PHJA 2BF7A 3E5RA 1DIHA 3JQAA 4GX1A 3LF2A 3AY6A 1SAYA 1XG5A 1I3KA 1GL3A 3O9ZA 4IDFA 3S1LA 4WCFA 3TWOA 3VH3A 2GO1A 4XD2A 4AL4A 4CM6A 2WM3A 1HE3A 1W73A 2Y1CA 4K26A 4MVJI 1SO8A 1GCUA 1E7WA 1DHTA 1GQQA 1BHSA 4DBVO 4R4JA 1BDBA 3GRPA 3U09A 3KLPX 5F5NA 1GR0A 3WLEA 4JCOA 4R1TA 1H6BA 2J5QA 4CMAA 2H6EA 2V7PA 1ISJA 3RC1A 3L4SO 2NU7A 1H5QA 1CQIA 4TKLA 2HKIA 5DBIA 3HFSA 1DLJA 2WYWA 3DR3A 4FFRA 4PLGA 5DNAA 5COBA 1ISHA 1M66A 3A4VA 4XDZA 3GDFA 2EP5A 1JA9A 4GX2A 1LSOA 2UYYA 4GX0A 3SJUA 4BKOA 1RJWA 1I0ZA 1R66A 3GOHA 1Y8QB 2X0JA 5G4LA 4UEJA 2DQ4A 2PKRA 1E92A 2NTJA 3IP1A 3M1AA 4IQGA 3ZU5A 3JD1A 5A3JA 4FJ2A 4DIOA 2I5PO 4F3YA 1BXZA 2JJYA 2D3TA 1P1FA 4RDIA 3UVEA 4BNVA 2J5KA 1ZIDA 2UVDA 1EQUA 5K6AA 1NAHA 1X1TA 3H6KA 2DTEA 4L4XA 1GD1O 1EUZA 3C7CB 3WWZA 2HK9A 1T2FA 1ZK1A 4BO5A 2POQX 1UXGA 4LISA 1LLCA 4ND2A 2HMUA 3JYNA 4NBRA 3ANMA 2Q3EA 3AM4A 5DULA 1TT7A 5A9SA 5IXYA 5DCUA 4J6FA 4GAEA 1EEHA 4XB1A 1WLYA 5EMHA 4JLWA 1FXSA 4I9HA 5CEJA 4M89A 3WR5A 3HSKA 4J4BA 3VPXA 2O7QA 4PN3A 2CZCA 1KEUA 3D4PA 3RKUA 4EDFA 4IY1A 4OQYA 3AI3A 3JQBA 4MVJM 3HJAA 5C7LO 3QSGA 1E0DA 2XXBA 3FTPA 3TPCA 4INAA 1PEDA 1GZ4A 2FZWA 4WLNA 3RWBA 1J0XO 4NH4A 2P5YA 3GQVA 2HQ1A 3CKYA 4C4OA 1R0KA 2VNSA 1UUFA 4CM5A 1PL6A 3GVCA 1P31A 2XXJA 1NPYA 1DFHA 2PD4A 3L6EA 4WLUA 1C0PA 4FFNA 3LSYA 2VRCA 2H5LA 4IZIA 1YS4A 5I8ZA 3AI2A 3WJ7A 3GDOA 4LMPA 4G5HA 2HDHA 4CMJA 4CM4B 2BLLA 4J4HA 2CF5A 3N7UA 1NQ5A 4KP7A 5G0SA 5G4KA 1UXJA 3BTOA 3OF2A 2JL1A 3GDGA 4YPOA 3VHRA 1PQWA 3DAGA 3H8VA 4NBWA 4CUJA 4DWVA 1YE3A 4XB2A 5ENDA 3I23A 1XWFA 1DIAA 1MLDA 1K0UA 1SB8A 1HWYA 3BIOA 3JQGB 3HDQA 4D46A 5L7YA 4CMCA 2E82A 2C5EA 5JMPA 1PQUA 4A10A 4AJPA 1DO8A 3EC7A 4LN1A 4LW8A 4NDNE 1SOWA 1DFIA 3ZV5A 3FNHA 3HN7A 1HDRA 2I3GA 4JP2A 3T4EA 4A0SA 3A28A 2H63A 2O3SA 3A1NA 4MIYA 3S2EA 5JMWA 4E5NA 2Y1EA 3PQDA 3I9MA 3WYBA 4XQGA 1NHWA 1RWBA 3M6IA 4XIYA 4OGWA 1UAGA 4GQAA 1Y9EA 5T8KC 3TZQA 1VJ0A 2NU8A 4A03A 1I3NA 3FWNA 4E13A 1ZEJA 1E5LA 2Y05A 3EDMA 5JO9A 5C5IA 2ZATA 4N54A 5AVOA 3QHAA 2VUUA 3C8MA 3AM3A 4B8WA 4QECA 3UFXA 3ENNA 1DEHA 3ITDA 4W4TA 3ZV6A 3K96A 5FEUA 3RUAA 3OFSA 3OMLA 1BGVA 3ASUA 1V6AA 1NWCA 2P4QA 1AHIA 4BGIA 4FD3A 3G49A 1HE2A 5HS4A 2PLAA 4YT4A 4M54A 5G0VA 5TF4A 2JHGA 1OI7A 3SBOA 1PGQA 4CL3A 1P74A 5ES3A 4YAGA 3WSWA 3QWBA 2J8ZA 1FJHA 1U3VA 1HYHA 4GSKA 1WMAA 2W90A 3RIHA 3K2BA 4GBJA 5G0UA 5T64A 2GRAA 2QRJA 4FDAA 4PLPA 2R00C 4MDHA 1MFZA 2OO5A 4BL5A 2VTEA 4M87A 3ITKA 3HN2A 1ZVMA 3N58A 1UAYA 1VM6A 1N8KA 1IY8A 1O9BA 3KYCB 2PK3A 4E4YA 4ALMA 2IE0A 1VLLA 4ROSA 4QSMA 5GZ3A 4CLRB 4BMVA 2BGKA 3INTA 1XGKA 2QZZA 3JQFC 2VZ8A 1YGYA 4EI2A 3TZ6A 1LRLA 2VUTA 3M2TA 3H3FA 5TNXA 4CMKA 4Z9YA 4E6PA 1FDWA 4J49A 1A9YA 3ZU3A 1RYDA 4J1SA 3DTYA 4XCVA 1DHRA 3ZHBA 1ONNA 1M2WA 4JBGA 1PQPA 1PJSA 3KTDA 3STHA 1GAEO 5A03A 4OL9A 5DDIP 1F12A 1Y9AA 4HNHA 4F46A 1PTJA 1DSSG 3ZHXA 5CDSA 2VT3A 5FWNA 3AJRA 4CODB 4RPKA 2JFGA 4HV4A 4BNMA 2V6MA 1E3JA 4B4VA 1O5IA 1QYCA 1MP0A 3CZRA 5DBGA 1U8FO 5ILGA 4NQZA 3ZWXA 3JQ8A 1LC3A 2CVZA 4YAEA 4FGSA 1PJ2A 4XYEA 3Q2KA 4IQ8A 1JW9B 1P9LA 3LVFO 5T8KA 3RBXA 4BQRA 4IGFA 2GD1O 3LYLA 4I9NA 3JYOA 2R6JA 2YQ5A 4PCVA 1VKNA 4Y6RA 1NBOA 3WNVA 1KS9A 1KVTA 1B3BA 3PYMA 3L4BA 2X5KO 3WNQA 3EMKA 5FFFA 5DCWA 5H83A 3NYWA 1CYDA 2RH8A 2CDAA 1P77A 3MJVA 5I7FA 3K30A 3IMFA 4BNHA 1OZAA 3IQDB 3GT0A 5A5FA 4DL9A 1MGOA 2OOSA 4IXWA 1Y5RA 2D2IA 4A7PA 1Q7GA 3MOGA 1XLTA 1Z6ZA 2G1UA 1UDBA 4MVJE 4EEZA 1MXHA 2VYVD 2PH5A 4UAGA 1UH5A 3FSRA 2VOJA 4DC0A 5COAA 1Q1NA
chains in the Genus database with same CATH superfamily
2V98A 3QWAA 2FW9A 1K3FA 4DR6B 1EGHA 3UCXA 1UPUA 3HPQA 1T26A 2CXXA 4R40A 1SC3A 4JKYA 4C07A 2R96A 3KZVA 3ZLTA 4KYVA 1OFUA 2WBLC 2WIDA 3EGOA 3AG5A 3ZQ4A 1D7AA 1BVUA 1FP7A 3NUZA 3R3ZA 4MQLA 3KC2A 1W4ZA 2ONJA 4N03A 1DNPA 5AKXA 3A1VA 5G53C 4V1CB 4GZ6A 3ER9A 2NSHA 5BWMA 3NWPA 2SKEA 2R79A 3AKYA 1OD6A 2X9QA 4FT4A 3R7WA 1ZM7A 1UZAA 1ZJYA 4RD6A 4G8DA 1VMKA 2I7VA 2JLSA 1SKAA 3DZDA 3F9IA 3FIUA 1N6NA 1A9TA 3G59A 4FIDA 4WSOA 4BIIA 1RCFA 3AIKA 3ACDA 1PZMA 1A8IA 4Z99A 3PRHA 2YW2A 3HWX1 4F04A 3WI7A 1SOMA 1K1EA 2ZYRA 3F49S 2XW6A 4JJKA 1L7EA 1LJLA 3ZE1B 5INTA 1P1HA 3K15A 4KX3A 3R5SA 1IZ8A 3CF2A 4UNRA 1YS6A 3GFVA 2C5AA 4BU1A 2FGKA 2QR2A 2ZTUA 4X91A 4BIMA 2AHRA 2QZSA 3CKKA 1QVVA 1KJYA 4QFMA 4TKUB 3ZH2A 4RFLA 1FFAA 4AYXA 2JIDA 2NYUA 4KQFA 1MG0A 1RBQA 1MQ8B 2MHCA 2B4KA 2O2HA 3PWZA 2JDID 3IVRA 4ASUD 4EWLA 1FQJA 3CKMA 4HGOA 3DZKA 3JD4A 4Z7QB 1QC5B 4CQMB 1UEXC 2FMXA 2ONKA 3KQTA 4IP0A 1HUQA 3D8BA 3GJ6A 4OYRA 5C1IA 4OSPA 1MTZA 5DRTA 4DZZA 1W88A 3IP6A 5C31A 5EE9A 3W2TA 3CVXA 1N77A 1JTVA 1PW5A 2O3TA 2VF8A 4GI1A 2HZ7A 2QLJA 2WNIA 3QKUA 1EFLA 2JAUA 4Y2VA 3S5UA 4O3MA 4JYPA 4CGYA 1UJMA 3AF5A 2IZZA 3O93A 2PR2A 2ZSEA 4BNDB 1QONA 1Q2UA 4MIEA 1YJXA 2BDTA 1IJFA 4RF2A 3LDGA 2P2YA 1ZEMA 3RVQA 4RIIA 1D2HA 1HE8B 4M6WA 1E5XA 4CT4B 3HMKA 3Q7PA 3SKVA 2NQ2C 1R18A 4GYKA 3OE4A 4WN3A 4BTVA 5IVDA 1Y4UA 1N5LA 3WYDA 5EERA 4KGDA 3BD7A 5TY0A 1KSGA 2DFLA 2ZAOA 1TZKA 3SYKA 4L9AA 1YS9A 1OASA 4HWTA 4PSCA 5HJ2A 4EMUA 2HD4A 2HLDD 2OB2A 4BQSA 1U6IA 3EXHB 3MBOA 3OH8A 4CMIA 1IE3A 1E3WA 2JFWA 2PL1A 1FBTA 4CNQA 1QH1B 5KIAA 3QV1A 4OJQA 3UCEA 5HOEA 3IJEB 3NIBA 1AQUA 4RSMA 4FLMA 4WXPA 1ZK4A 2EGHA 5ILOA 1NC1A 2CXHA 3HBFA 2OGTA 1A9SA 2ZP1A 1YZUA 3KJHA 4HATA 1FVOA 1EXNA 1KZHA 1JECA 3GCGA 2F7SA 3MS4A 3DA8A 3PV0A 3C87A 3V3KA 5JAIA 3PE4A 4JEIA 1KI2A 1TJ3A 1B1AA 2BCEA 3I5AA 3QJ5A 3ZIAA 4BWVA 1HX7A 2WYOA 1RZ3A 2HBRA 4GMXA 4N39A 1IXZA 2WICA 3TPFA 1G8SA 5D2CA 1NI3A 5E4YA 3F5DA 1F7VA 1OE0A 3EDQA 3O38A 5JMOA 3T1YB 3PUWA 1SUAA 3EA0A 5DPMA 5AESA 2AJLI 2JARA 3B20A 1P17A 3K70C 2VHVA 2ZTLA 3W05A 2PEZA 3H7AA 1U28C 3U56A 2VKQA 1BWPA 1JPVA 3PL5A 3K9FC 4IUYA 2IW3A 3OWOA 2JG3A 1Y6RA 3BJMA 4PBSA 2DJ5A 1QG4A 5FRDA 3NANA 4F5DA 4HX9A 1TM2A 4BASA 3NT2A 5ELMA 4WZZA 3II6X 3KKLA 5JADA 4CQLA 1EA5A 4QQNA 2PXCA 4UDXX 2PZJA 2XSZA 4U7HA 4DWJA 1GDDA 1J09A 3U7EB 1DMRA 4PEVA 3W0LB 5C2JB 5IJWA 1CRLA 3N2KA 1M2JA 1P2DA 4CT5A 2FQWA 5IDXA 1ISPA 5EQFA 3C0KA 1J24A 5FA6A 3KTOA 3UJPA 1QV7A 2FOIA 3OQIB 3IUBA 1EU1A 1PLKA 2FW8A 4LI0A 4B6SA 1YBFA 4MQEA 3PIRA 1A72A 1H22A 1TYEB 2X8LA 1T6BY 1FJXA 1EI9A 2Q5LA 1U2QA 1ZWLA 1S96A 1UXOA 1KNXA 2GPYA 3LZ6A 3L06A 4H7DA 4RVGA 2IHNA 1NUTA 3B1FA 5MFZA 1HMPA 4X1YA 3S2YA 1MA0A 5A04A 1H2XA 1DCMA 1Y1PA 3D8SA 2XUFA 4YCDA 4UARA 2GXSA 3ZS8A 3HXOA 4DV1B 2C4HA 4LECA 1V3TA 1XZ8A 5D1HA 3RASA 1RQ7A 3U4CA 4B34A 3FI9A 3MRVA 4IDDA 3RSFA 1KO1A 3VVCA 4DCUA 1WXWA 1VGRA 2ONCA 4FDMA 1JYSA 1XA0A 2OZPA 2NZXA 5FNVA 2B4QA 2XB9A 5CIQA 5F1YA 1EWQA 3Q5GA 3PHGA 2BFCA 3R20A 1QOQB 1GQYA 1V35A 4V03A 1A9QA 5KYNA 1B0AA 4DMHA 2PFSA 2AXQA 2C5GA 2H2GA 2VDQB 2Y1GA 2QE6A 1C3VA 2HHAA 2OUIA 3LQRA 3P0JA 5DZSA 1QOZA 1D4ZA 1KJZA 1Z18A 2DERA 2P2DA 1GCOA 2IS6A 5AVWA 1C9YA 3USES 1DRVA 2VK1A 3AWDA 4KK3A 4ON9A 4L3VA 4TL9A 1E18A 1ZNWA 1SCIA 2Q5JA 3HP1A 2NO6A 5KKCA 4L9SA 4Q3NA 3IE1A 1T5SA 2XGSA 4IF4A 4J7UA 4J16C 1U3DA 1ZHHA 4GZ3A 5CT5A 3OIFA 3RTBA 4BVJA 3LQFA 4QNRA 2NYVA 5IXSA 1YTUA 3DMHA 1MXFA 5AJVB 2PMCA 2R00A 5CD1A 3ZD9A 4D3YA 3A3YA 4EHJA 4ZMRA 1J9EA 2Q0QA 3PFWO 1KGDA 4DM3A 5K0FA 4E5MA 5KYTA 1L5VA 4WD3A 3V8BA 4LGVA 1EB8A 1FFGA 1WAMA 3VDRA 4UMFA 1BW9B 5K0ZA 2CLEB 3KQOA 2WAAA 2H9IA 3BMNA 2NUPB 3L8EA 2EBUA 4GOLD 1DBIA 4IOJA 2XXAA 4R8SA 1BMFD 2Y67A 2GK7A 3H9CA 3BD6A 3HUFA 4IWYA 3SC2A 4RC9A 2C7BA 4BV9A 3OCJA 3ABQB 3OJLA 1WEHA 1WMEA 3I6IA 1BFUA 4G3XA 4ARIA 3IUPA 2GHQA 5HRAA 1IZ0A 2NZJA 3JATB 3TEJA 2W2QA 3K6SA 3KUCA 2OD9A 2ZTSA 4QEZA 2PZAA 1CUZA 1EUDA 4FBGA 1YIDA 4KPFC 5JS1A 2XEXA 1FLVA 2QN9A 1YA4A 2WF6A 3KHTA 3OEHD 4L85A 1KDTA 4E70A 1V1MB 2CUKA 3MMZA 1R2QA 4UMDA 1GTL1 4A91A 3R0XA 3WGLA 1B3RA 5EYPA 3HDVA 1MOZA 1OBOA 4I5DA 5LIRA 2A14A 2AN4A 3C45A 2X8JA 4LRYA 1LQUA 2EGGA 1ZCBA 4OLFA 4PWYA 2ZS8A 4LZNA 5AXCA 5TIIA 1XN4A 4ZEOA 1QH0A 2PRKA 3FCEA 1ZPDA 2K87A 4HQOA 4OHVA 2XGOA 5B58C 4NI5A 3VUEA 2ZE7A 1IRXA 1S3IA 1ZD5A 2A33A 3KQWA 4HTAA 3LW8A 3JZAA 5H59A 1FS5A 1VSBA 2HT6A 4MKHA 5ALRA 2NT4A 4CG3A 4WCDA 5G0WA 1UKCA 1KYVA 1ODLA 2WIBA 1BC5A 3GCDA 4JGBA 4EH1A 5AI0A 4KBYA 4ZHQA 5AVKA 1IDOA 2BZ1A 3V7NA 4P84A 1WBJB 2Q1TA 4DV0B 1TM7E 4YA6A 1EVKA 3DD1A 1ORRA 3NYQA 3NOVA 4DBZA 2DWQA 2VXBA 3WOHA 2Q3DA 2JA1A 2VUSA 5GM1A 4WN9A 1P3DA 1P6XA 2EZ9A 5TS3A 3RARA 2ODEA 2WZDA 4YRIA 3DPSA 1LY1A 1PFQA 1GZ3A 1QK5A 3KE9A 4JX8A 4WKBA 4CLHA 1HKUA 4N3BA 3ZQUA 3G2LA 4DR7B 2WPDD 1XLVA 5TT1A 4UFNA 1XFAA 4NEHB 2ODPA 1C9EA 1QCDA 3DO5A 3HJTA 1JHRA 1YQEA 3RQSA 2Y3IA 1CS0A 2V54A 2X1VA 3K0FB 3QVJA 5JAQA 7AT1A 5LQKA 1CHNA 1DRJA 4XZ3A 2PUFA 2DCMA 3B6ZA 1BCSB 1PHRA 4RMGA 3W04A 2UUCB 1YAJA 1FYXA 1A7AA 1ZSNA 2Z9CA 1QFMA 3A0UA 4MITA 2QR3A 4Z2YA 3ESDA 4TMYA 2C94A 1IY2A 4JLJA 1AUPA 1GZ7A 1JWBB 2GS9A 3GUYA 1WHTA 3NPAA 4LQCA 1SA0A 2PZBA 4RJJA 3X1WA 1CQJB 3WGUA 1XZDA 4BVLA 5BV7A 1HXHA 3P52A 1F5NA 4K2AA 4OHKA 2AEJA 5AO9A 1CLEA 4RTNA 5A3VA 4CM8B 1SZDA 1VIYA 1PS9A 1H1LA 5LQSA 1P1KA 1JHZA 1XZNA 3LPNA 1UF9A 1P7CA 2FB9A 3WLTA 4B3IA 3LDUA 3CRW1 2XMQA 3ABIA 1L1QA 3OCXA 5J5VA 4I4TF 4LOAA 1VYTA 3LD9A 4L76A 4CM4A 4DLRA 1ZC4A 4HF7A 4D1YA 3A9WA 1OXVA 4RHFA 3RC7A 3UN1A 1NULA 4GD3Q 3KZ1E 2JFUA 4C0LA 2OXTA 1FFEA 4K9QA 2X86A 3ZV7A 1G5HA 5TMEA 5FI5A 4BV3A 1HYEA 2AG1A 4IH4A 4HWRA 4CI9A 4OQQA 4I7EA 2A1TS 3W6NA 1Q15A 2O54A 3Q1LA 3N2KB 3IEKA 4XQ0A 5D00A 5T67A 1NNEA 1Q6ZA 3BMQB 3ZIDA 4C1BA 4COOA 1Z7YA 3C39A 4TQGA 2PWYA 3AKEA 2F3RA 5ETJA 4RJTA 3HM9A 3SNKA 3IMEA 3IS3A 3QG5A 5HOQA 3VRHA 3PQ5A 2C3PA 1RM4A 3FPJA 5HF8A 2J5BA 4MS4A 4ZCSA 5FA5A 2OMKA 2VNHA 5F2EA 1SC6A 2BMEA 3NTXA 3NEJA 4UXJA 3TGPA 1VYVA 4N6OA 2UYHA 5JG7A 2G0TA 2XMZA 5LWHA 2V55B 1I6WA 2GN4A 2H85A 3BWYA 2HWXA 1OH8A 2I4OA 3EXFB 4C4RA 1GSIA 1SXIA 2V65A 1P7VA 2JZCA 3H1GA 4TRMA 4UHCA 4RKWA 3WFIA 4CMGA 5KTKA 2JC3A 1Y7PA 2UU9B 3O8QB 2HRDA 4DY4A 1BX0A 3CB2A 3VR1A 1N7HA 3U60B 3RNLA 3UJ9A 3OAAD 4YJGB 4GPZA 4ESHA 1WPRA 2BRUC 1DAOA 1RFGE 4LVOA 1Z22A 5KYUA 3ZJYA 4AXBA 4ISBA 3CX6A 3IAM1 1LPAB 3I64A 2LCFA 2YWHA 4FILA 4G23A 1JR2A 1CIVA 3FBWA 4LJLA 2VP5A 3KZCA 1YR7A 3F9CA 3QEJA 3E15A 5ALXA 5J9FA 3TW8B 5F7XA 1HE1C 1HL3A 1WEKA 3FHCB 3GLQA 3GWGA 3RSLA 4JDUA 3WGTA 5DNVA 4FYWA 3KKEA 3PWTA 5E4TA 3TSAA 1ZGGA 2MINB 1A82A 1BXRB 4M1YA 4NOLA 5AXDA 3A6GA 1SIOA 2FJPA 3BA6A 1IJBA 2CLKB 3KJEA 1DC3A 1EFKA 4X8LA 1RPZA 2NPIA 4FCCA 2H1IA 4UUPA 3I6QA 5FAXA 4WJLA 1UIRA 2X2EA 2GZ3A 1WBDA 2HHHB 1T6ZA 3WVNA 3PLAE 1R12A 1QZ3A 1YB7A 1HDOA 2FKNA 1DC6A 1R88A 1UDXA 1AQIA 3I83A 5JXGA 3I2YX 5BV8A 4CF7A 4OLBA 4TT3A 2ZIWB 2B3TA 4KQEA 4X85A 2UYCA 4QGHA 4LGYA 2H07A 1BOFA 1A50B 2HQOA 2WA1A 4KQWA 2XCTB 3R2JA 4XIJA 1C8KA 4D0GA 1G63A 2BD0A 1NKSA 2QM8A 3CLUD 3CR7A 1XYGA 3GJZA 3GELA 4LDJA 4XDYA 4WADA 5GMOA 1Y42X 5IJ9A 4JELA 3RSGA 1Z37A 1X42A 3D3WA 3MYYA 4HP8A 2Z6UA 4UOQA 1DGQA 4IOLA 1ZZEA 5I7VA 5EOVA 3P9IA 2H5IA 3TFOA 4DXAA 2Z5VA 2KBFA 2F8SA 4DMGA 4U1RA 2ON6A 2ZIEA 1IQUA 3KQSA 4I08A 1U0JA 2ECFA 4Z9AA 4LWOA 4O4HA 3VH2A 3NNSA 4JU8A 2GJ8A 5DGHA 1RYFA 4CKZA 3CH5A 4IYRA 3RFXA 3SXUA 2V3CC 5U1PA 1UJ5A 1VGQA 2AOXA 4CIBA 3QZUA 3OETA 4YMLA 4KFTA 1GARA 1R50A 4EY3A 3C5VA 1M1YB 2V8BA 3IPRA 2IITA 4IX9A 4P33A 2OUKA 4DEXA 2YBDA 1QRDA 2WZCA 2V3VA 3OZIA 4H0FA 5JNRA 3DMGA 2CCGA 3WXMA 4R69A 1U2PA 1HRDA 1E4EB 2H4JA 2NM0A 3A9UA 3AOGA 2GPJA 2QTNA 4QUGA 4B3JA 2WJ4A 2M32A 3FCUB 4NBUA 2BKVA 4HZGA 3QEBZ 3FLBA 4RS4A 1XP5A 3BZWA 2JCXA 1E3WB 1U0EA 1E1YA 2PYIA 3L05A 3OHPA 2WD7B 4RS3A 1JTFA 1DKLA 1QHHB 3EYWA 3F7NA 4MPJA 3EDCA 5KYUB 3QG1A 3O8LA 4RPHA 1FLNA 4GLBA 4AG5A 4F12A 2YKGA 4OIMA 1GLNA 2Q7DA 4BGEA 2GK6A 4FI3C 4IDCA 2JAXA 4CIVA 3PDHA 1EUCB 4LCJA 3JD2A 1ENOA 2VAPA 1X19A 2IEDA 5K3FA 1ODCA 3S29A 4DLYA 1D2GA 4EY6A 3TEFA 4TYQA 1QDUA 2VAWA 1Y4SA 2G5CA 4JH0A 3A25A 1IFXA 3DGFC 4ZKEA 1Q77A 1GTJ1 1T1SA 1H0RA 2G9NA 2H8GA 3H42B 3KFLA 4GEGA 4J3FA 1S5PA 5F2NA 4G5OA 3D3EA 3KR1A 5JCOC 5I4IA 1BE0A 1K06A 3CPJB 1NYRA 3QI2A 4N1AA 1YDMA 1MJNA 2QORA 1WZNA 1FDSA 5TLSA 1FW6A 1KHTA 4FOOA 4WESB 5FNVF 2RHOA 3VX4A 5JWRA 1N92A 4CF6A 4YB8A 2OK7A 2J9GA 1AXEA 2C9MA 1YD7A 3LAWA 3NHMA 3GPDG 3K9LA 1H3NA 2EFHB 1LI4A 2IBMA 1RQRA 1KAMA 2IYOA 3NOOA 3O3NB 3QPWA 1PGJA 4J4TA 5ESRA 2AWNA 4G2TA 4C03A 4HDSA 1E9BA 1MHPA 3DLHA 3VO9A 2AZXA 4LOLA 3GRAA 3GLKA 2OBYA 3PKIA 1GNVA 3QVXA 3FWKA 4BBAA 4REQB 5ED4A 1K9SA 4L72A 3SG0A 2XQVA 2MDTA 3HHEA 5DHRA 5H9VA 2XGGA 1EE1A 2BFFB 4YJHB 4R9SA 4C6TB 1R27A 1K6IA 4M0CA 1QVZA 3QMPA 3D0RA 5LA6F 4K9LA 2XYHA 4HN4B 5CLLA 3UUGA 3H6HA 3DB1A 3ER6A 4J16A 3ZNNA 1RPJA 4YJ3A 2Q9BA 2ZCUA 3WHPA 1M67A 1U2TA 2PD6A 1PR2A 3RUHA 1JLHA 3UXEA 4E31A 1RC8A 1GM5A 4R8KA 4RK0A 4JB2A 4D3FA 1N6RA 4KZPA 4AUMA 1DKMA 1WP9A 2XAAA 1E96A 1WY7A 2PT5A 2GTHA 3CONA 1XD2A 2AE1A 3PA8A 5FP0A 3A4LA 1DCFA 4UMVA 4W5QA 3UK7A 1EDOA 1CP2A 2BWJA 3IO5A 1XDWA 4JENA 4RVUA 5EVCA 2WV9A 1OFUX 5FIUA 4JL8A 1SD5A 4LC9A 4FZ3A 4JC5A 3THWB 2P9CA 3TSWA 3T9DA 1UT6A 1XWWA 4EYOA 3D8UA 2O6LA 3SEZA 2FFHA 2JBAB 3MUNA 5B64A 4NYMQ 1S8NA 4CTJA 1CQPA 4NMHA 4DY6A 3JY6A 3ORRA 3X1DA 1GPKA 4QNNA 4CV2A 1A88A 5C1PA 3WKAA 3LW7A 3C1UA 1POXA 1V1RA 2PLRA 3EW7A 3FMVA 3KRTA 2R6FA 4MRNA 4NS4A 4OHYA 3HDHA 3LG2A 4OYYA 2DE0X 3ILVA 2RDMA 5F73A 4H9GA 3UJDA 4RTSA 3OTIA 1B4DA 1MNQA 2JLXA 5KTRA 2A9QA 1NMSA 4YCLA 2WDZA 2HCJB 1ZBQA 4AKEA 3QLUC 4G1BA 4E1AA 1WU8A 3DWGA 5J2TB 2RMKA 3R7BA 4IIEA 1GTMA 1DX4A 2IUEA 4ECAA 5GIPE 4EB0A 2SKDA 3MZ0A 1NQXA 4MYDA 1F1JA 5LDGA 5HP4A 3RT7A 3U13A 4FGLA 1AKEA 2CYCA 1E6EA 1X7XB 2ZYWX 3HVUA 4L1KA 1R6DA 2BEVB 4PW0A 2XT9A 4UCFA 4ETIA 1S89A 1JDBB 2QN8A 1VL6A 1YQDA 3AEKB 4N8SA 4CEHA 3EZ9A 3WS7A 3E8MA 3WLAA 2DXIA 3GEMA 2C96A 2HMVA 3ETGA 2KW5A 3ELWA 3F4LA 5AHRA 5CXXA 3AYXB 3VAYA 5C8YB 3HACA 3NG1A 4E2FA 5LQNA 2WG1A 2WWYA 3FWHA 3INNA 5B3JA 4QZVA 2CLDX 3A37A 3R5FA 3B8EA 1IJKA 4UQLA 5FADA 1L5RA 3JVVA 3U4HA 1GCIA 1ZQ9A 5CX1B 5FQOA 3SYMA 1ZSVA 3C3JA 4QPPA 2OMEA 4NNPA 3GJQA 3V7WA 1PUIA 3QUTA 4Y1RB 2CD9A 3W7VA 1EVZA 4ZCTA 1T8RA 1ZSYA 3LH5A 2JLBA 2VXCA 3PUHA 3SJCA 2Y9PB 3NJ8A 4LZOA 3AGPA 1NM5A 2ZUSA 4OLJA 4QOGA 4EG1A 3FDZA 1M5RA 3LBNA 2F8MA 1PBTA 2OSVA 1M6HA 1L5GB 1FUKA 3VYUB 4W5WA 1EDZA 5EZYB 5SYMA 5JW6A 1GA6A 4YV0A 1KI9A 2F59A 2JZNA 3X44A 4LJ8A 5IAAA 2Q3JA 3VZSA 2MR6A 1E2EA 4AF7A 1LC0A 4BNWA 1UADA 3OMXA 3QX3A 2B7CA 2JB9A 5HIKA 5JCXA 3BXEA 2IYPA 3ZDBA 1QQ6A 1YA8A 4CM3A 1L5HB 4F11A 4ETNA 2WHRA 2GHIA 3MWDA 4LKRA 3OKPA 1WABA 5I9BA 3ZBTA 1IMOA 2XNHA 3O8CA 3AEUB 3G7NA 5GJWC 3ZJVA 2IEYA 4N48A 1YMUA 1J5XA 1DJNA 3MCTA 4Q02A 2F90A 3VDMA 4ZI5A 1S3FA 1T5IA 3KD2A 2X2OA 4J0DA 5A4KA 2OORA 1ORWA 3PC7A 2W22A 2AE2A 4CQMD 5TEWA 5K0EA 3MF4A 2YZKA 1GT91 4H1TA 4S1WA 3U4QB 4BGVA 3WZ2A 3WJ2A 3CNLA 4S04A 1Z2CA 3R3XA 3LY9A 3VV3A 3AUKA 5LQCA 1O95D 3QF4B 4J2HA 4JOCA 4JVSB 4PO9A 3FYTA 3VUFA 1L4BA 1VE6A 2A0KA 4F72A 3EUWA 4RJKA 4B81A 4F9GA 1Z2DA 3OQBA 3OD1A 2RKOA 1DAEA 3AFGA 4ZU1X 3R8CA 1WHTB 2GJ9A 1JQJC 5IBQA 2X9LA 1RM3A 1FDOA 2XWPA 3MJDA 3PX3A 4UVGA 5JV5A 2LVBA 2BE7A 3RTCA 4INOA 1EFTA 4UOEA 3GQBB 4Q93A 3TUJC 4CM9A 2YWXA 3KOYA 1U7PA 4WQMA 3I8XA 4IJVA 1AIPA 4M49A 4RZIA 3G2KA 2EFEB 3NOQA 5F7OA 1QYXA 5BQXA 4IVNA 1JX6A 2YZ7A 2B7BA 1NFFA 1UWKA 5CDFE 4DDHA 1WPGA 4NBLA 2QS9A 4FZ5A 3RJ9A 5LZ5A 2EIXA 4IDPA 4XIFA 1NW3A 4QATA 3DKKA 3LCUA 4HAOA 5FFMA 3DVAA 2CVFA 4JHXA 4BMXA 1VHWA 1ESDA 2B8JA 2UVQA 4D8WA 4X66B 1E3SA 4O2BF 3DH0A 3TLMA 1EINA 1P2UA 2FP4A 5KTPA 4W8HA 3ZHUA 1YBMA 3F46A 3UCFA 4F6CA 3G6WA 3NC4A 4K6FA 3BRWD 3MVEA 3RWOA 3SOPA 1XZCA 5HGXA 5JDIC 3UMMA 1T1JA 4KMOA 4PTLA 2HCTA 3NCHA 3PXAA 3R7AA 2IKQA 3HJRA 2XOEA 4IMRA 2HMWA 4EA8A 4JJ6A 1AD2A 4DJAA 1L9KA 4HB0A 3RKRA 1GUFA 1XNHA 4KAFA 3H5AA 1NXWA 3EZNA 2EWVA 1A2KC 2ZZNA 3KQLA 4MICA 3K1JA 2TSYB 2P6PA 5A2QA 4GOJA 5DLQC 4EUEA 7MHTA 5AM3A 5HFNA 2V6BA 3SYNA 3ELBA 4GC9A 4GXNA 4J29A 4X6XA 1RJ9B 5I7OA 1NXSA 1QGOA 4RM3A 5KYWB 2IP2A 2P2ZA 1X7GA 4P35A 4PXYA 3L7MA 2RBEA 4RFVA 3TX6A 3T7CA 1PTJC 5K3AA 1QQTA 4U39A 4P0PB 2GPTA 2JAWA 3JQCA 4L07A 2FFRA 1PV2A 3EXEB 3PFHA 4WZAE 7REQA 1A95A 2J1LA 1C1HA 4OMDA 4LTDA 4HAIA 1GFWA 4OLHA 1MVNA 2DQSA 2G9QA 1H0SA 2P1ZA 2YS7A 3JV7A 1G5QA 2QP3A 2YC4C 3LBFA 4ZRNA 5HMLA 1T0JB 2JFFA 3TIGA 4DPMA 5JZBA 2O8CA 1Z5ZA 4AJLA 3GLFB 4X62B 1NUPA 2Z57A 3EPHA 5JAPA 1MRNA 2AC2A 4YQEA 3UXMA 3EPKA 1C1DB 2MMCA 4E51A 4C7KA 2C9ZA 1UPFA 3ROXA 2W6ID 1T24A 3K9NA 2YHSA 2X7JA 1T0PA 1SXGA 2QM0A 3KB2A 2PRJA 3NBYC 3OT1A 3W4JA 5K3FB 2XUIA 3OUUA 5JJBA 1RKQA 1II8B 3VNAA 5JATA 3TJRA 5IS2A 3F5MA 1KVUA 3PSAA 4F5ZA 4F3KA 1VOTA 5CB4B 3ORSA 3SM9A 2RH4A 4M1MA 1KQNA 4Z1MD 1GG8A 5HKAA 5FWYA 4QDOA 1Y7IA 4FZVA 4RCVA 1Y63A 1LW6E 5EQTA 4F38A 2OK8A 1A9XB 4FW9A 3NEAA 5B1EA 1TLFA 5JS6A 1FSZA 1DAHA 2QQ0A 3O73A 5AWFC 5CR9A 4KR9A 4AKGA 2X14A 2FMFA 5DASA 1ZFNA 4ENUA 1Z2NX 1U0BB 1MR3F 3MK31 5HUHA 1FVHA 1XCBA 4LFBB 3R7LA 4EA9A 3NDIA 2G88A 4MI3A 2GAAA 2E1PA 1ZD8A 3KYBA 4WZAA 1P8AA 5DO9A 4KSCA 5T41A 3RR2A 2FW0A 3WWEA 3ZHYA 4CLOA 1Q92A 1YZTA 3O4IA 2DHRA 4O2AB 3EVZA 4YASA 5E4FA 4P8RA 3HCPA 5EE1A 3TRHA 4B3CA 2G9RA 5LQUA 1A9ZA 3OQOA 3TVTA 3ANTA 5KTYA 3OM8A 4HUQA 4NK4A 4GL4A 4D74A 1DAFA 2W2OA 3TLXA 1HNZB 2P69A 2LDBA 2QDKA 1XXHB 1ZK3A 2YDYA 2FPXA 3BK7A 4B6PA 1WXHA 2XA2A 1X77A 2FN4A 3GAZA 4UJ5A 1Z33A 4A0HA 2O8EB 5EKSA 1BHO1 3ZUGA 1YL5A 5DXFA 2V8OA 2XB8A 3NHRA 3OPMA 3PD0A 1LVUA 4GBMA 2O2CA 1TO1E 3B3QA 5AJWA 4GX5A 4NARA 2RCYA 2XF2A 4TLLB 3FJYA 3C14C 2BGRA 1VSVA 1XVUA 4GH5A 3VDNB 2X1MA 3UJBA 5D8DA 1KJIA 3U7HB 1D8TA 2XD4A 2IT1A 4O33A 4HDMA 4TXNA 1RHQA 3OQ1A 3FSGD 3G8CA 4PZ0A 3DNPA 2XI4A 4X45A 1AA6A 3EEIA 4Q3EA 1PVVA 3IVAA 4IRMA 4PBTA 2AL7A 4B47A 2DBZA 4TUYB 2HA7A 4E3WA 2PUAA 1V6CA 4FYIA 4N3AA 2ODAA 3E23A 4WY5A 1TW3A 2PJDA 4OQLA 6NULA 1JU3A 1E9DA 2XQKA 5FI0B 3WGKA 4ZJPA 5EZYA 3RABA 4C04A 1VKHA 3FY4A 3TBKA 1G3IA 5EPOA 1HE5A 1ZC3A 1RHKA 3BCRA 1FZQA 3FZQA 2AMVA 3PQ2A 5JDCC 3HR8A 4XOUA 3RUDA 4HQ6A 2ISSD 1DV1A 2WILA 2OQIA 5HGJA 5JQWA 3L04A 5G1PA 4MS4B 1W5FA 4MJ3A 4LHXA 1AUOA 1N6KA 1SCAA 2QVXX 1EJ6A 1JKJB 1R8QA 2F3TA 1QG0A 2QZ4A 3HI6A 4QJIA 5DXAA 1M2NA 2I9KA 2VSNA 4FYHA 5DB4A 3PK0A 3ECCA 3W4IA 3ZBPA 2XYQA 3NDJA 4ENSA 1MC8A 1HKHA 1E7MA 2DWOA 4XQCA 3T41A 3WDSA 5C8VA 1Y0BA 3CVJA 2QAGA 1HL7A 1ODTC 2NWQA 2QGFA 4I1IA 3PI7A 5CT9A 9MHTA 1XRQA 4AICA 3FRHA 1GPAA 4H3VA 2K7FA 1K4YA 1SCUA 2DHEA 421PA 4ER6A 3SXPA 4RA9A 1ZJWA 4WUTA 2I03A 1DKQA 1CIJA 3CUYA 1DXYA 1VLZA 4M22A 2L18A 1DDIA 1I4OA 1TIKA 5LP6F 4MR7B 5LXTA 1UOOA 1KC1A 2R5NA 4Y2SA 4E5PA 2BISA 1OOEA 3D1JA 3C6MA 5CFRA 2FSGA 4D3SA 1JSZA 2FUNB 3O1HB 2ZSIA 1BYUA 4UNQA 4XJTA 1M0WA 3BMXA 3ZWCA 4Z53A 4R51A 1C7EA 5D85A 2WTAA 1AZLA 5J2TA 4GI2A 1CULC 3A8TA 5H7XA 4FN4A 5DT2A 4A6PA 5BOVA 1RKVA 3L8FA 3V34A 1YB4A 2Q5HA 3G9XA 2B1GA 1KK1A 1U80A 4GWGA 1E3QA 3M6AA 2YJ4A 1PWHA 1M6VB 3ED5A 2ZCVA 4JLSA 5ED0A 3PQ4A 2DY1A 3TTWA 3DVAB 4ARZA 4IV5A 2D1QA 4EO9A 1M2VB 3L6OO 2V6FA 1U8CB 2GKGA 4Q15A 4WI1A 4YFYA 2PL5A 5B5SA 4HNTA 5LLTA 1UBJS 2B7LA 3VR4H 1N6LA 3GO4A 1G98A 3U1BA 3N0WA 4LJ4A 2GM5A 1LGYA 1ZAYA 1WA5A 4DLSA 4BE4A 2QGNA 6Q21A 4CLRA 4NFHA 3TH5A 4DIDA 4HDOB 3MM4A 2CLCX 3T9EA 3SJZA 1YJCA 4QEKA 4AMZA 2PJZA 1H2WA 2ZVQX 4QX6A 5JNSA 4DCTA 2WG0A 1UC8A 4GR5A 3T95A 1K89A 1P4RA 1ZD4A 1E6UA 3OOWA 4ZVSA 1UR5A 3V6MA 4CKEB 1IM8A 4JJEA 2VDWB 1NVGA 1R0WA 2HR1A 4YJ2B 3WLRA 4CIAA 1TM1E 3M89A 2VT6A 4EHKA 2NAPA 1XU4A 1GV0A 1MF7A 2AR7A 1B1CA 1AHNA 4K88A 4W9NA 3WL8A 4DPLA 1QZZA 1FJ2A 4YJ3F 1GG9A 1XAJA 2YFHA 1XNJA 1TTHA 3ESZA 5EJMA 4DN6A 2JRCA 1UXHA 1KU6A 5LMNB 1IAVA 4M0EA 4NH0A 3MWFA 1CRWG 8AT1A 5CM2Z 4J8PA 3VH4A 4AUNA 2Q4DA 4Y9RA 1XCGB 1EFVB 1DAIA 4QU5A 3A2KA 1OXMA 3ENQA 3JQ6A 4BLPA 4Q82A 4CL0A 4OHRA 4P32A 5E8JA 2YWGA 5FT9A 2OXIA 1XMJA 3VR3D 2V7TA 3ODGA 4NG5A 1JEYB 3MWDB 4EX7A 4BB9A 1NTOA 1ZM4A 3EOBI 3MAAC 3PUVA 1G42A 2IXTA 1U2RA 2H0AA 3ABSB 4KE9A 4RHEA 1YK0A 4BVEA 1GG5A 1PJ8A 1Q0QA 1RBZA 2DPMA 1VZ3A 3H3JA 1M75A 5CBPB 2IYSA 2Q3CA 1BXGA 5LB4A 3IBFA 5EP2A 1J07A 5JAZA 1T35A 3UV3A 3I1FA 1K8RA 1PGNA 1HBJA 2EZ4A 1ZN8A 2GJAA 4PQFA 1OWPA 1TB4A 3FDIA 3RHSA 3RSHA 3SFVA 2GN6A 1NOKA 2IPXA 3GV0A 4OMFG 4WKGA 3IFSA 3JARA 3OURA 3A70A 1UANA 3U3KA 3WO1A 1QCCA 4DA9A 3U4DA 3RRJA 1SKQA 5AUOB 2JANA 3BQ9A 4BFCA 3BIWA 3C97A 3V1NA 2AZDA 3OU6A 2WFLA 4DDWA 4REMA 4Q4CA 2E6UX 4I5IA 5LLDA 5ES4B 2IZ1A 2CLMB 2VYQA 5K0GA 4QOEA 4YRTA 2OXCA 5DKFA 3BDAA 2V7EA 4CF5A 3MRXA 3X1XA 3ZHCA 3VPFA 1X1BA 2MYUA 4CIWA 1JQ3A 2Y2UA 4CGZA 2VH2A 2ZXFA 1DG1G 1WUYA 4G9EA 5CA0F 3O92A 5FXMA 1R8XA 2W6PA 1U9CA 2C88A 3ER8A 3BE8A 4LTMA 1ML3A 2CYAA 1MAUA 5FV7A 3TOVA 5AW0A 3KEMA 4O1MA 3TK1A 4J1QA 3D0KA 5GVRA 2PH3A 4U8GA 1Z0JA 4LY0A 5ELXA 3PZBA 4ILKA 1WXEA 1S01A 4MAFA 4DUZB 5T3YA 4JVMA 2BFNA 4HVTA 4P08A 4PSUA 1AKMA 4JSYA 3T1QA 2X5OA 4JY7A 4KOAA 3AMVA 4BKRA 3OKFA 5E6SA 5IJXA 3QOFA 2VLIA 5LA6B 4OG2A 3BXPA 3FMPB 1C9NA 1JJVA 4RHCA 5HKKD 1WB4A 3G5UA 2HWWA 3KKOA 3NP9A 4NWIA 4O4HF 2N42A 1ZLXA 3BZBA 1QLJA 5DP2A 3EFEA 5KKNB 2XCUA 5LOVB 4PC2A 3IUJA 1WB5A 2D2EA 2OGSA 2VTBB 1O3YA 3HVJA 4A5OA 1PSDA 1SVSA 2ZI9A 4G1MB 5FTKA 2HIAA 4F4UA 2BL4A 1V48A 1ZJZA 1V5IA 1LI5A 4NONA 3DFUA 3OOHA 4M7RA 4ZO8A 4EITA 3V8EA 4MYHA 4R68A 5I47A 5IULC 3D6HA 2XIJA 4AJJA 1TA4A 5C8DA 2I8LA 4D7AA 4UBOA 1TVKB 4Q3DA 4IDBA 2I62A 2ZUTA 4CDMA 1E79D 5FA8A 1FB5A 4NNOA 1W36C 2ZT6A 4HLQB 2AUMA 2AJ8A 2AR9A 3W7BA 1KA9H 4FOLA 4XD7D 2HPAA 1KR2A 5LMZA 3TMKA 5ALWA 3VHQA 4UTNA 1KERA 1G6OA 4GHWA 3WP0A 1KY3A 3F6EX 3QYAA 5HDBB 3GLTA 4DNFA 3DAOA 3DAHA 1KSJA 3GD7A 3QTTA 5DBFA 3SFZA 3TE7A 1M8KA 1T25A 2O4UX 5KCMA 4Q3LA 2EG9A 1A71A 1AKWA 2EWMA 1RZVA 1G20B 1U3UA 2HOQA 4ZICA 3N05A 1HLDA 3SC4A 3ORHA 2LDXA 1WOMA 3EUAA 1N78A 1GNTA 2LP4Y 2CXNA 2FXVA 2BEVA 4RVFA 2HUPA 3TO5A 3TR0A 5BPFA 1C1YA 3GBVA 4MVXA 4JCCA 3HA2A 2VHUA 2XA1A 4PHHA 4ZCIA 3QMVA 3UNXA 1JFFA 1FFYA 2OLKA 2VDJA 3T1TA 2R7LA 3KQKA 1F14A 4IS2A 1XEFA 4DM7A 2Y1WA 2DWPA 4QTXA 4D79A 5AW2A 2VEDA 4E6EA 3R6DA 1KIAA 4G4IA 2H2FA 4L57A 3MIIA 3CY6A 9ABPA 5IBCA 2QRMA 5LP6C 3C5EA 2WRZA 4AJEA 3ROKA 4GM1A 1KJ9A 1XQYA 2V4MA 2TMKA 5HIMA 4YRAA 5J2UA 3PP8A 4MB2A 3HFGA 4IDQA 1IPHA 2GK4A 2MU1A 3EG9B 2ZYIA 3HXLA 2FN3A 4AJHA 5LR6A 3K8YA 2JVKA 4GBED 4ND6A 1PHPA 3F9RA 1XLWA 1F8XA 2X6TA 4TMXA 1P9RA 1GNPA 2ZAYA 3GZNA 3IE2A 4EG6A 1AK1A 1FU8A 1J33A 3N07A 1G64A 1NKTA 3MFYA 3MOSA 1BXGB 3IESA 3M33A 1ZINA 4K0RA 5CBPA 1ZOSA 2W2TA 3LIPA 4NMWA 2O8FA 2OD7A 2JLQA 1ZA1A 2ADOA 4WOKA 3OM9A 4R8LA 4RTRA 3K92A 4J0FA 1NN0A 1OU0A 1XZAA 2X8BA 4GICA 1HG1A 4OVKA 5HG0A 1SEPA 1ZI9A 4RK1A 4U2DA 4B3GA 1ZQ1A 1DOHA 2QRVB 1SD2A 3R3SA 2CXTA 2ZVPX 4IZOA 1H4TA 4LF6B 1E1QD 3FNQA 1Q74A 2O7SA 2ZLBA 3STWA 2CHQA 1MG5A 3FUXA 1QIDA 1XRSB 1XVIA 3H11A 3HP4A 3OX4A 4UHDA 1NW8A 5ESDA 3ITNA 1L4YA 5FO0A 4DJJA 1TYZA 2XDWA 3T5AA 2YHIA 4YRQA 2HNAA 3EVGA 4BC0A 2I34A 3E48A 1B15A 4FBLA 4KMSA 1TZMA 2G6BA 4H18A 5B58T 5L6MB 5DX0A 3K9GA 3LLSA 1X1SA 2HCBA 1RE0A 2DBQA 1D9ZA 4BE9A 3LVBA 5AI4A 5GM2A 5IFLA 1SXHA 2JK1A 1TUEA 2ZSDA 3E0XA 1BA2A 2YV3A 3KZMA 3SDSA 1Y6FA 2QN2A 3AP2A 4J7CA 4HBGA 4QYWA 4KGVA 4KWEA 3VZPA 4YUXA 3H5TA 1VHQA 1B6SA 3FCSB 2R8RA 5B2ZA 2X0EA 3G85A 2GXQA 3DBLB 3C24A 4QWWA 2WP8J 4EZEA 4RHUA 3E7XA 1JXOA 2EKPA 4QQRA 3TI9A 5I7SA 5JFTA 4RTOA 4OOFA 1VMAA 3AVOA 1D0VA 4KDRA 2REQA 3BA1A 1ZMXA 3GJ3A 1GGMA 1YDHA 2UUPA 2FJUA 1SPXA 1Y1RA 2VNAA 1GZUA 1QNLA