3WNQA

Crystal structure of (r)-carbonyl reductase h49a mutant from candida parapsilosis in complex with 2-hydroxyacetophenone
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
335
structure length
335
Chain Sequence
SIPSSQYGFVFNKQSGLKLRNDLPVHKPKAGQLLLKVDAVGLCHSDLAVIYEGLDCGDNYVMGHEIAGTVAAVGDDVINYKVGDRVACVGPNGCGGCKYCRGAIDNVCKNAFGDWFGLGYDGGYQQYLLVTRPRNLSRIPDNVSADVAAASTDAVLTPYHAIKMAQVSPTSNILLIGAGGLGGNAIQVAKAFGAKVTVLDKKKEARDQAKKLGADAVYETLPESISPGSFSACFDFVSVQATFDVCQKYVEPKGVIMPVGLGAPNLSFNLGDLALREIRILGSFWGTTNDLDDVLKLVSEGKVKPVVRSAKLKELPEYIEKLRNNAYEGRVVFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (R)-specific carbonyl reductase
publication title Unconserved substrate-binding sites direct the stereoselectivity of medium-chain alcohol dehydrogenase
pubmed doi rcsb
source organism Candida parapsilosis
molecule tags Oxidoreductase
total genus 100
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wnqA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3wnqA01
3KM0A 3VPXA 4YAEA 2TMGA 4YPOA 3PXXA 4DIFA 3KOUA 4CM7A 1Y9EA 4Q3EA 3T7CA 4F6CA 3U4CA 1VKNA 3UF0A 1MUUA 2C2YA 4PN3A 3GMDA 4MVJD 4IJVA 3X2EA 1E5QA 2JCYA 4GI2A 3K96A 2PKQP 2X4GA 4BNKA 3EVNA 3SJ7A 3IC5A 1UZLA 3HDJA 3ZN2A 2G82A 3O8QB 1YB5A 1MP0A 3QQPA 4O1MA 4ZD6A 4IDBA 2I76A 1SOWA 2VRBA 2I99A 3FPLA 1WDMA 4DMLA 2UAGA 3GK3A 2PV7A 5IDYA 2V65A 3K31A 3MOIA 4ALJA 5A1TA 4J4HA 1AN9A 3CINA 4WKGA 3ZWXA 5CFZA 4LW8A 4OL9A 3WJ7A 4UUPA 4KUHA 1OMOA 1KVRA 2A4KA 2X58A 5K9ZA 2YJZA 3HDYA 1B7GO 3LQFA 3SXPA 4YAJA 2VUSA 4BVAA 2LDBA 1JAXA 4GAEA 1TVEA 3UVEA 4LCEA 1Q1NA 3ORFA 3WFJA 4I1IA 3PPIA 4AJ2A 2AG8A 4L8VA 1Y81A 2GSDA 2HK7A 4XQEA 1E1KA 1E7QA 1CF2O 3AOGA 3W8DA 1PJ3A 4PZDA 1EQ2A 4IGFA 1F8FA 5C3MA 3HJAA 4QXMA 3AI1A 4EI2A 3O9ZA 5JMPA 2AA3A 2Y93A 1X1TA 5L53A 3BHIA 1HSZA 5CDUA 3JQ6A 4Q3DA 4J7UA 2D59A 3TQHA 4IY1A 1U4OA 1Y8QA 3KRTA 4O6VA 1JU9A 1ONPA 2BLLA 4YRDA 4CMIA 3CSDA 3C3XA 2VZ9A 3D5TA 5EQDA 2ET6A 1YL7A 1X1EA 4HUJA 4K9DA 3A1NA 2FR0A 3JSAA 1DPGA 4WEQA 4ZRMA 2G0TA 1P1JA 2R00C 3DHYA 3GGGA 4OAQA 4DC1A 3MJEA 5DN9A 2HRBA 3GNTA 4WLEA 1GZ4A 4EUHA 4RVFA 3R0IA 3F4LA 2O7QA 1EDOA 4BIIA 2FMUA 1RM5A 3DXFA 3TL2A 4IINA 4Y67A 4JN6B 2YDYA 3CMCO 4H3VA 1JVBA 2H9IA 1HDRA 2X23A 5U9CA 2V6GA 4QX6A 2AE1A 1TT5B 1NWHA 1LA2A 3DFZA 4YDRA 1LRJA 3H8VA 2O3JA 4XYGA 4PLFA 2V6MA 3D3EA 1FXSA 4B7CA 1FJHA 1NM5A 3MWDB 3DBHB 3H9JA 1HRDA 4BNYA 4OMUA 3MJTA 2P4HX 4R9RA 1HL3A 5EQFA 4FFNA 3ETEA 4EBFA 4BNFA 5TIIA 1VSUA 2D2IA 1FK8A 2NU7A 1JLLA 3GNSA 3SEFA 3WNVA 4Y6SA 3RBVA 3ZGYA 8LDHA 4CR8A 1YONA 3BIOA 3EZYA 3HDHA 1VSVA 2DLDA 2O23A 1B8VA 1IZ0A 4U0JA 1QLJA 4E2ZA 1VL0A 1N9GA 2YYYA 3DMYA 2CZCA 2YQ4A 4CMAA 3PGJA 2RHRA 1MG0A 1GPJA 4MINA 4A7PA 4FCCA 2ZYDA 5TC4A 4OSPA 2POQX 2DT5A 2YFQA 3RROA 1C0PA 3U5TA 1NBOA 3QV1A 1XDWA 2GLXA 3QJ5A 2PZKA 3TOXA 5COBA 1R4MA 1KOLA 4G81A 5JS6A 5JYEA 5KKCA 1CQIA 4KOAA 4BKPA 4OM8A 5TSDA 1U2GA 2Q4BA 1GUYA 1ORRA 1UAGA 4RPJA 1EQUA 3GR6A 4PZCA 4R5MA 2DUWA 5LDHA 3NJ4A 3ICPA 1ZK2A 4NBVA 4KTVE 2RAFA 3FTPA 3RKRA 1ZXBA 3IKVA 4L76A 2CMDA 1YBAA 2Q99A 4XZ3A 1QYWA 2FZEA 4YBZA 1EEHA 2BELA 2EP7A 3Q2KA 1C3VA 2GNAA 3NRCA 3QP9A 4EZBA 3D3WA 5T57A 5TLSA 1PJSA 4TZKA 3K73O 3H5AA 3RBZA 4R51A 4DVJA 5B37A 4PG6A 4YACA 2EHDA 2VYVD 4YXFA 1MX3A 1H6DA 4M8SA 4XIJA 5KOIA 3I52A 2DC1A 1TEHA 2XPCA 3UN1A 3F46A 3GUCA 1XEAA 4IM7A 1CIVA 1ID1A 4R1SA 3IUSA 3FRJA 3O4RA 3BTOA 1HE3A 2VNSA 4HNGA 4AJHA 1P1IA 5C7OO 1BVRA 9LDBA 5A05A 2PY6A 3AM5A 1ZSYA 1C14A 3HG7A 5JCJD 3UUWA 1WPQA 3ZV6A 3DHEA 1LEHA 1XWFA 1PZFA 3OMLA 4CMGA 1HWYA 4GX2A 3Q9UA 3U09A 4MVJH 1LXCA 3R1IA 2OUIA 3KYDA 5A9SA 4C7JA 3ZZNA 4WASA 2O3UA 3QHAA 1B0AA 3HWRA 3GLQA 1JN0A 3K6JA 3QVWA 1WWKA 4I9HA 4ZQBA 5JE8A 1ISIA 4GWKA 4GVLA 3QWAA 5JXWA 3ETDA 3DZJA 1EBUA 4XRRA 3L07A 1TT5A 3L77A 1I10A 1PTJA 4MP8A 2X8LA 1IHXA 3IMFA 4IPTA 4D42A 4E5YA 4FR5A 4J3FA 1E7YA 2OL4A 3RUAA 1O0SA 4B4VA 3DBHA 4B4WA 1PJLA 1GPDG 1DHRA 1I2ZA 1KEVA 4JJGA 5DDIP 2DTXA 5HA5A 3NKLA 1YQXA 3WOHA 4JP2A 3H5NA 1U8XX 1SB9A 3GG2A 4RVGA 4AG3A 3JQGA 5U4QA 4JIGA 4BNXA 2PFGA 3QRWA 4XA8A 2GZ2A 2WD8A 2O4CA 4B8ZA 3G1TA 3S2GA 3UW3A 1O95A 3GVCA 1HDYA 1RPNA 4E2XA 4BMNA 1EFLA 4YWJA 3IS3A 3TSCA 1P44A 3GZNA 3TRIA 4BGIA 3RC2A 3K2EA 2YUTA 2EEZA 1VJ0A 3SBOA 2P5YA 1L7EA 3R6DA 3HZZA 3UCXA 1MFPA 1TXGA 2X0IA 4ZRNA 2O3SA 4KDEA 4DA9A 3FR7A 3GEGA 2WTBA 2YV1A 3UCEA 4MOWA 4JK3A 3TNLA 4WPGA 4J2OA 3E82A 2Q49A 3K92A 5AXDA 1VL8A 4MVJE 2PTGA 3Q2IA 4P4NA 4ALMA 2JHGA 1E3JA 4FC6A 3ZU3A 5IXSA 1J6UA 2F1KA 3GVHA 1P77A 4E12A 2Q46A 2B69A 3WTBA 1PGQA 4LRTB 4QO7A 5KWEA 4XGKA 4D44A 1BDMA 1C1XB 2DTDA 1PR9A 4CODB 3OF2A 2VUTA 3GH3A 4CMEA 1PEDA 4TRNA 3AOEA 4NU6A 4ZQHA 4BNNA 2G17A 4H16A 3B20A 3VPGA 4B3JA 4WGGA 1V9LA 1YL6A 3R3JA 4B3HA 2I66A 2ZKLA 3FSRA 4A5OA 2EKLA 1GYQA 1SOVA 3AOEC 4XRGA 1U4SA 4GH5A 2JKVA 3ONFA 3E9MA 3E9QA 5JC8A 1T2DA 1RKXA 4ND3A 1I36A 1R0SA 3TF5A 1UDAA 4P8RA 3UAGA 3GDOA 5DOZA 1U3TA 4XKJA 4Q3BA 4YRAA 4C4OA 3DMTC 1GR0A 1LDMA 5FF9A 5DBFA 3DTTA 1E1LA 1J49A 1GUZA 5HRUA 4ZGWA 4DPMA 4PCVA 3ROQA 2DBZA 3OQBA 1V3UA 4ZICA 4MVJP 4ZA2A 4HP8A 5JPIA 1MV8A 2ZYAA 4LN1A 4XWYA 3ZNOA 4FJ1A 5B4VA 1LUAA 1EUCA 2ZTMA 3I9JA 3LT0A 4K6CA 1ISJA 3OHSX 4NBWA 3RUHA 1XU9A 5JYDA 3PJFA 2UV8A 3LT2A 5TGDA 2HO5A 1XKQA 2X0JA 4IQ8A 1NR7A 4GX5A 4CM1A 4ZN6A 4IDFA 2HMVA 1NX6A 3DFUA 5THKA 3OICA 4CLRB 3F5QA 2O3QA 2H5LA 4LSMA 3GAZA 4EW6A 4CQMA 2Q2VA 1KC1A 1T2FA 4KMSA 2GO1A 4CV1A 5CAEA 1M67A 2WD7A 4CUKA 1ZBQA 3DZHA 3RC9A 1ENPA 4E4YA 5IXYA 4CM9A 1AE1A 5CDGA 4PRLA 3PDUA 5CEFA 2FR1A 4GGOA 1PQWA 1H6BA 5AQ1A 2Z1NA 3O03A 4W7HA 1PGPA 3EW7A 5F21A 4CLXA 1YJQA 1ZJZA 1IHYA 9LDTA 1DRWA 3TJRA 5ITWA 4YRBA 3ROMA 4BO0A 4Z3KA 2OXIA 4PG4A 3EDMA 3RUIA 4CQLB 4NBUA 1NHGA 3QE3A 3S2FA 5L40A 4AL4A 1HTBA 2W98A 1PS0A 5EJ2A 4EJ0A 2VWPA 2V6BA 4HBGA 3LDHA 3GFBA 4WEOA 1LQUA 4WLVA 3C1OA 3U3XA 3CEAA 1BXGA 3VPSA 3D0OA 3PHIA 2BFOA 1DLJA 2FR8A 3JQAB 4XEHA 2BFPA 1MC4A 3DBRA 3DTYA 4OXKA 3GFGA 1B14A 4R68A 4OKNA 1NVGA 4ESOA 5CDTA 4NK5A 1PWXA 4TKMA 1UP4A 1HZJA 4W82A 4HKTA 1JDJA 2AG5A 1IPFA 3WWZA 2FP4A 2O2SA 3MJVA 2UYYA 3D64A 3HFGA 2D1YA 3WG9A 1Z6ZA 3NDJA 2NQ8A 1NNUA 2Y67A 1VPDA 2C7VA 4TSKA 3U4HA 4LVCA 3LT4A 3GHYA 1O8CA 2J6IA 1E6WA 1NP3A 1JKJA 2NADA 3EMKA 3FWZA 3WMWA 4F46A 4R41A 4PLGA 4I9NA 2NTNA 4J49A 3AY6A 4Z9FA 3VPFA 3PDJA 3NYWA 2XF8A 4MVJI 2ZTVA 3S8MA 3EC7A 3GEMA 1I3KA 4U5QA 3RFTA 5AVOA 1T25A 1XCBA 2PGLA 4FQ8A 2J5QA 3NX4A 3PJDA 1NFFA 4DGSA 4L4XA 1A27A 4WOKA 4B8WA 4YT2A 1GTMA 3SC4A 2Z1MA 1E3SA 3DL2A 3PEFA 3SX2A 1F0YA 3ZHBA 3GA0A 1OC2A 2WJPA 5ITVA 3PTZA 1IE3A 1X14A 1X13A 4FD3A 3UFXA 3F1KA 3LLSA 2QYTA 2PKQO 2ZJ1A 2HSDA 1MB4A 5IDXA 1UXHA 2G76A 3FNGA 4L75A 4IDEA 1VE9A 3L4BC 2DFVA 2VNAA 4RGBA 2Q1TA 3VH3A 3VVCA 1U28A 2AEMA 3CPSA 4FOOA 4G65A 4ZQGA 5F5NA 1MFZA 3RFVA 4MP3A 4XQCA 1M66A 4B7UA 1R0KA 1RYEA 1DOHA 1H6AA 2P2SA 3UXYA 1LDEA 4NFYA 2FRDA 1P3DA 1JWAB 1O94A 4YCAA 1LSUA 2X9NA 3FNFA 4KWHA 3KSUA 2HJSA 3ADPA 4YYZA 4GVXA 5H82A 3VDQA 2AXQA 1MGOA 4J1SA 2NTVA 1B8UA 3I9OA 4FFLA 2CDCA 2IXBA 2PK3A 4NU5A 3QWHA 5JO0A 1W0CA 2LDXA 4QTZA 4EUEA 3MZ0A 3RWBA 1GQ2A 5TT1A 4CMHA 1B26A 5EIOA 3PLRA 5AYVA 2B4QA 3DOOA 3GN1A 1T1SA 1NQ5A 1M2WA 1W6UA 3MWEB 5C7IO 4L0QA 1E7RA 1B16A 2I65A 2AQ8A 3JQBA 1OFGA 4BKRA 3IIEA 3E18A 1HT0A 3MEQA 3VVBA 1M6HA 1D7OA 5JCXA 1G1AA 1SCUA 4GSLA 3ZWVA 3ZWPA 4TVOA 4P4LA 4M49A 5COAA 5ENDA 4YT8A 4R9SA 3LU1A 3AFMA 3A14A 4BB5A 2NLOA 1ZK1A 3LZ6A 1Y8QB 4BO4A 3V5NA 1YXMA 4CMIB 4Y98A 2EGGA 5LDGA 4OGWA 2IEBA 2HK9A 3IDSA 2IZ1A 3L6EA 5K1SA 2B37A 3C8MA 4OIMA 1IOLA 5DNAA 3WLEA 1I01A 3JQAA 5A06A 1PR3A 3KETA 5A5FA 1JAYA 1YVEI 4Z3DA 3EK2A 3VAZA 2GRAA 4FIZA 2PGJA 2CUKA 1HE5A 2F00A 3WSVA 3FWNA 3LF1A 4YVFA 1Z45A 3W4IA 4CUJA 1QMGA 5IN5A 3JD2A 1HYEA 3VOSA 2CF5A 5JFOA 3L6DA 4JJFA 4DPLA 3AFNA 1D4FA 4XGIA 4TMFA 1PJQA 1PJTA 5L3ZA 5B4TA 3B6ZA 3JD0A 4JBGA 2EKPA 2PZLA 4BNMA 5KJEA 2PKRA 2IRWA 3DQPA 3GC6A 2VHZA 5AXAA 1LDGA 1ZJYA 1P33A 1OC4A 1DBVO 3KXDA 3NV9A 3PHGA 3GOHA 3QLJA 4NIMA 3BTSA 3BHMA 4J1TA 4II3A 3WWYA 4P4GA 1I33A 4ONEA 3HB4X 1KETA 5DZSA 4NG5A 5JBIA 5CEJA 1YDEA 4EEZA 1Z74A 1N9GB 3OSUA 3ANLA 1CJCA 2YHIA 4ALKA 1A7AA 1ZO8A 3A9WA 3EHEA 2JAHA 1BXKA 1Y6JA 1LLCA 4E31A 3C85A 2Q2QA 2BH9A 4WK6A 1HLDA 4A73A 1R4MB 3GHHA 2QIOA 4G2NA 1EK6A 4YAGA 4II2A 1VL6A 1N1GA 1BW9A 2EJVA 4GKVA 1XIVA 2OBNA 5LCXA 3IJRA 1W4ZA 3SC6A 3HADA 3AM3A 2HKIA 4PG7A 2H63A 1S7CA 3D1LA 3PQDA 4QECA 3VH4A 4P38A 1GEGA 3B1KA 3E5MA 4RL6A 2GUGA 1ZIDA 1UP7A 4IQGA 3IQDB 2WM3A 1Z82A 4RF4A 3FD8A 4OQYA 3HSKA 4E5KA 1NWCA 3E8XA 3PQFA 4PZEA 4XJTA 4PLVA 3D3WB 3WQRA 2OFPA 1BVUA 1FDUA 1AXEA 2VTDA 1ZUD1 2CSUA 1RM4A 2CDBA 3ENKA 3LC1O 1CWUA 4RZIA 1GYRA 1BHSA 4UUMA 3TOZA 1E7MA 3ANNA 2PR2A 3E6AA 1LSJA 1U3WA 2NNLD 2Y05A 3PFWO 1EDZA 3HE3A 3P7MA 4XB2A 3JV7A 4BNZA 4MKXA 5AXCA 1NPDA 5TT0A 1I3NA 4IDGA 4A03A 3W1VA 4YJGA 4AICA 4CM8A 4GBJA 1DIGA 3OECA 2C82A 2R00A 5L9AA 3AI3A 3BA1A 4RDHA 5EN4A 3D5QA 3IAHA 1YL5A 3OH8A 3AUUA 4W99A 2PD3A 4BNLA 4CL3A 1F06A 3V2UA 2PNFA 3M1AA 3OJ0A 3X2FA 3KYDB 1E3LA 4F45A 2I67A 3RKUA 5A9SB 5B1YA 1XU7A 1U5CA 2I3AA 2IZ0A 5DCYA 4I08A 3VHRA 1DXYA 1U3VA 4GGPA 3CTMA 3WBFA 3N7UA 3PJEA 3ZV5A 2DFDA 3K5PA 5U1PA 5HWSA 3STHA 1ADBA 4U8GA 1BGVA 5DBIA 3AU9A 2W2KA 4BO7A 1QV6A 4I5GA 5T64A 1CQJA 1BXZA 1Y1PA 1Q7CA 2VZ0A 4D43A 2DPGA 4BL5A 3PYMA 3WGQA 1UZNA 4UVGA 4CMJA 1MXHA 3OETA 3Q11A 4DQVA 1LSSA 2O4UX 4L74A 2BGKA 5BNIA 3E5RA 3JQGB 5A3JA 2YW9A 4H7PA 2C7GA 1I32A 5B4UA 1I5RA 4PG5A 4BNHA 3V1UA 1A5ZA 1ULSA 1PQUA 5JSFA 1K3TA 5DT9A 3OEYA 4BNGA 4TRRA 1O6ZA 1B8PA 3S2EA 3GZNB 1R66A 1UXIA 4RO0A 1XG5A 2FSVA 1H94A 5G0VA 5T5QA 4FW8A 2QZZA 5TQVA 3QWIA 2EIHA 3SLGA 2QRKA 2EXXA 3FCOA 1O9BA 3E48A 3DZGA 2ZYGA 5IZCC 3SLKA 4URFA 1H93A 1KY4A 1RM3A 2GCGA 3Q0EA 4M87A 5EL0A 4BO8A 1ONOA 3AY3A 3DZIA 3JD4A 1LX6A 4RV9A 4YB8A 4LMRA 3S55A 1T1RA 4UEKA 3GAFA 2HMWA 3GEDA 5I7FA 4JROA 2W2LD 4BO1A 4ND2A 1HDOA 4UVEA 3NDRA 2DVMA 3COSA 4DYVA 4F6LA 1KERA 4XCVA 4PFJA 4PLCA 2E49A 1IZ9A 4J7XA 3U62A 1K6JA 3PFFA 4GQAA 3FNEA 5H83A 3K8ZA 1J5PA 3WLFA 1V35A 4BV9A 5B12A 2HU2A 1GZ3A 5BT9A 2AQIA 5DP1A 3OQ1A 1KIFA 1D1SA 2Y1FA 2EJWA 4HX5A 4IXTA 4CM3A 4L4RA 1OAAA 3DZKA 1QP8A 1B2LA 1BWSA 5TJHA 3OJEA 1U7HA 1UR5A 1F14A 2BRUA 3A4VA 3KUXA 1EVJA 4CL8A 5A9RA 1JKIA 4EDFA 1LBEA 4RF5A 4IIUA 3FBGA 3HB5X 3QVTA 4E32A 3E9NA 5G0WA 4OJNA 3RCBA 3DR3A 4IS3A 3W4JA 2D4AA 3INGA 1P74A 5EESA 2PZJA 3JQ9C 1UDCA 4PG8A 4DYDA 4LK3A 1YOVB 2RH8A 4IDCA 1Z75A 4B7XA 2B4RO 3I5MA 4XR4A 4W6ZA 2X5JO 3KSZO 3TZQA 4R5HA 3U49A 5KJ1A 5KVVA 2ZTUA 4EITA 2FHSA 4FB5A 4Z0HO 4WOJA 2WE7A 5T8KC 3F5SA 1GQYA 3T4EA 5T6BA 5JAIA 2VTEA 3KYCB 1R4NA 2OHXA 4FS3A 3M1LA 1HDGO 4RORA 4W9NC 4EUFA 1K0UA 2R6JA 1K5HA 4JBIA 3WGZA 4EEXA 3ZWWA 1KYQA 3GQVA 3OIFA 4U0KA 3WGTA 1YGYA 1M75A 1DFIA 2WEKA 3AI2A 3DZFA 4BOYA 3WMXA 2RCYA 1PU2A 5ICSA 4GMGA 1NFQA 1XQ1A 1UH5A 4MVJF 4WCFA 3SJUA 1K2WA 3W4KA 4CMKA 1HYGA 4S3MA 3INTA 4BNWA 1DC4A 5DOVA 4CQMB 5J23A 4BO3A 2QYSA 3G3EA 2EG9A 2WD7B 3OIDA 4WCFC 1DIRA 2AW5A 4YT5A 2GASA 4CMCA 2IYOA 1A71A 5HTOA 4TROA 4BGVA 2XOXA 4BGUA 3BTVA 5G0SA 1GV1A 1EZ4A 2P4QA 1Q0LA 1Y5RA 2VYND 1A72A 1ZVMA 1ENOA 4Q9NA 6LDHA 1NVTA 3MOGA 3NT2A 5G0UA 1LLQA 3Q6IA 1DLIA 4JGBA 4LGVA 3HN7A 1CERA 3KVOA 2OP0A 2ZIZA 4H15A 3M2TA 4S1VA 4U6SA 2OO5A 4QUKA 3TPCA 2VRCD 1YWGO 1WLYA 1N7HA 3DOCA 1BXGB 1DRVA 3JTMA 4BKOA 3ZW9A 1P45A 4DBVO 1B3BA 1BDBA 3DBRB 5TJ9A 1FDVA 3AY7A 3KHUA 1B15A 4AJIA 2ZB4A 3JD3A 2VCYA 1LNQA 1KEPA 2PD4A 5IAAA 1WZIA 5L4SA 2NU9A 4UEJA 4LVUA 5I7EA 5KJFA 5GZ1A 2BD0A 3C1TA 3NAQA 5JMWA 3WBBA 4WLFA 2NTJA 5FI3A 3VZSA 1EVYA 3UICA 3GVXA 5L7WA 1I24A 1LC3A 1E6EA 4R1NA 4TWRA 1NR1A 4J16A 1QLHA 1LLUA 4XYBA 4BO6A 1M6WA 3BMOA 5KTKA 3F1LA 2D0IA 1E6UA 1GADO 3CIFA 3D4PA 4YQZA 1Y8RA 4GWGA 4R54A 3W8FA 4CV2A 3I9NA 4HY3A 1TA4A 3NUGA 3WYEA 5IN4A 2Z95A 3GT0A 4NR0A 1NQAO 2EP5A 2YDXA 3DMTA 3AWDA 3ROKA 1TLTA 3RQSA 2FSSA 4FN4A 2IDZA 2P9EA 3D7LA 5G2OA 1YQGA 4LCJA 3ZHZA 3F4BA 2GF2A 3GVIA 3GVPA 1YS4A 2BMAA 4L73A 4WNIA 1YOVA 1ML3A 4PRKA 1S6YA 1UP6A 1ZNQO 2ZB3A 4GLLA 1T4DA 3G17A 5JY1A 2IE0A 2QZ9A 1SB8A 4NBRA 4YAKA 4PLHA 4JLWA 5KJ6A 2BKAA 2YFHA 1KVSA 4GX1A 3CE6A 3RAJA 3JQAD 4CUZA 1ZSNA 3JQDA 4NQZA 1GEEA 4OKIA 1EVIA 3ZW8A 3KYCA 2E48A 1U9JA 3PZRA 5BNFA 4HV4A 4BMVA 3T4XA 2HK8A 1SO8A 1O89A 1V3TA 3I9LA 1PZEA 4CLEA 4DIBA 2J3HA 2PWZA 3P5SA 1A9YA 2B5VA 2FOIA 4RLHA 2ZB8A 3KBOA 5COQA 4OOEA 2BFMA 1D3AA 4WE3A 2RBEA 1EMDA 3BMCA 3JQ7A 3BMNA 4AJJA 3NGLA 1ARZA 2O3RA 3PWZA 2DPHA 4I9UA 1NQTA 1H0KA 3PVZA 2A9FA 5L51A 1EUDA 3OA0A 3VC7A 3VTZA 4RPLA 3PLNA 4YJFA 5KVQA 2Y0DA 1EBFA 1O5IA 3WIEA 4HXYA 2V7PA 4E3ZA 1NAHA 2NQTA 3PWSA 3VH1A 1IYZA 4J9UE 1GCOA 1DO8A 3L6OO 1J4AA 3GRPA 1JVSA 4HNHA 4KQWA 4DLAA 1DC6A 3NDIA 1F17A 2PH5A 3ZNPA 2BGLA 3ZU5A 2VYVA 3EYWA 4DBZA 2HDHA 3IL2A 1HYHA 1X7DA 1ADFA 4AFNA 5KIAA 2C5EA 2JL1A 1DFGA 2NU8A 1GCUA 3ZHXA 4QQRA 3VZRA 5BSFA 1GDHA 1GV0A 5I9MA 4J1NA 3L9XA 4BQPA 1R16A 2SCUA 3EGOA 1N1EA 3FHLA 3WGOA 3PHJA 1AHIA 2GZ1A 3P19A 1T4BA 4IJWA 3IUPA 4WECA 4AJLA 4CM4A 5JCJA 3WIDA 2UVDA 1MXFA 2WE8A 2H6EA 2VUUA 4R3NA 1J0XO 2W8ZA 1HSOA 5T67A 1E77A 5I7VA 1PWZA 4J43A 4YAIA 4RLSA 1FDSA 2I9PA 3WR5A 1BG6A 1GL3A 3RFXA 3D4NA 3KB6A 3ZHYA 2H1SA 3NGXA 1ZEMA 1DC5A 5ILGA 3C1AA 5L4LA 2HMTA 2JFHA 1KVQA 2AQHA 3K9QO 1V3VA 4MO2A 3ZWNA 3H9GA 3ABIA 3QVOA 2Y1CA 4AJ4A 2X7HA 1NXQA 1TB4A 2TMDA 3VH2A 4D0RA 3FR8A 4DUPA 3Q1LA 3GDGA 4NHEA 3RC1A 3PK0A 4E5MA 2Z5LA 3L4BA 2Y66A 1KY5A 2CVZA 2EGHA 3ETGA 1YBMA 3CKYA 4N7RA 1A4UA 2YHIB 1WMAA 2J3KA 2FPIA 2VT2A 3HNPA 1KBZA 3H5RA 4OQZA 4D46A 2BI7A 2QQ5A 4IDAA 1KS9A 4MP6A 4PLYA 2DM6A 3RU9A 2GYYA 3H6KA 2BI8A 2ZQZA 5JW6A 4NDNE 1SNYA 2PD6A 4IUYA 4HFRA 2EWMA 4W4TA 4XGNA 3ZWOA 1BW9B 3OJLA 4EYEA 5F5LA 4PVCA 5DP2A 3DO5A 3IJPA 4C7KA 2NUAA 2OBYA 5K6AC 3QY9A 3WSWA 3DBVO 1U7TA 2HQ1A 4NJMB 1E3WA 4YJHA 2RHCA 5C5IA 2E82A 5KJCA 5KCZA 2QRLA 4P22A 4GX0A 5A5EA 3E1KA 1CRWG 2ZATA 3KSDO 3ZDFA 2Q50A 2YHUA 3TZKA 4BNVA 1C1DA 4CPDA 1QXSA 4HFJA 1P31A 1V8BA 2WSBA 2VHVA 1I2BA 4G5HA 1CYDA 3QVXA 1WVGA 2WYWA 4RVUA 3ON5A 4M86A 1HE2A 4DIOA 1GY8A 4BV8A 4NMHA 2J8ZA 4DTIA 1VRWA 7ADHA 1UXJA 4OH1A 4YJGB 1VKOA 4CM8B 1GD1O 4RPHA 3N58A 4A26A 1NPYA 3GG9A 5TX7A 3VZPA 2CVOA 1BMDA 4N5NA 4E30A 3ASUA 3CH6A 4ZQFA 4CJXA 5TF4A 3NJ8A 2B35A 3RI3A 4Q39A 4FOSA 4ZHSA 3JYOA 3WTCA 2X0NA 2NM0A 2G5CA 3FN4A 1F8GA 1VJ1A 3Q3CA 4N18A 1ZFNA 1LC0A 1WDLA 1WAMA 1PJ2A 4KP7A 1PL6A 1XR3A 3QWFA 4D7AA 4J7CA 5FFFA 2C54A 5ILOA 3IOYA 5EMHA 4ITUA 1RJWA 3ZWCA 2W2KB 3ROPA 1EE2A 1Q2XA 3H2SA 3EUWA 4MJLA 4JCOA 4Z9XA 1D8AA 5A9TA 4QSMA 4XDYA 4JQCA 4KQXA 1PJBA 2P5UA 4MPDA 4O63O 4RVSA 4IS2A 4QEDA 3C24A 4MKRA 3WJAA 1LSOA 4ID9A 4R01A 2DKNA 3GNQA 4JXKA 1K6XA 5IF3A 4QT0A 4TQGA 4CLHA 2P68A 4CMBA 1E3EA 1YDWA 4PIVA 3JD1A 2ZJ0A 3JCZA 3VDRA 3H4VA 1T2CA 3UOGA 3VKVA 5I9LA 3KLPX 3MTGA 4DXHA 1X0XA 5CEEA 1DHTA 2B83A 1U1IA 4BS9A 4RF2A 4PLWA 1HKUA 3G0OA 1DJQA 2VZ8A 1PL7A 3LC7O 2DTEA 4FFMA 4N54A 2HMSA 3IKTA 2E4AA 2JAPA 4YT4A 4YQYA 3ANMA 2GN6A 3HQ4O 3NT4A 4K1LA 4BMSA 3AUTA 2ZQYA 1WXDA 5KKAA 3F9IA 3K2BA 3NTQA 2CFCA 1KEUA 4J6FA 3LF2A 1UXKA 2P9CA 4YJDA 3UKOA 4WLOA 2EERA 2NVUA 1QR6A 1OI7A 3ZWBA 2HLPA 4FFRA 5CP8A 5A03A 3CUKA 1DFHA 3EVTA 4OXNA 3GGOA 4ND5A 2GN9A 3GMSA 2BF7A 1QV7A 3ITDA 4R4JA 3OJOA 4ND1A 4NJMA 1EFKA 4UVDA 1NFRA 2ZCVA 5ES3A 5JDIC 5HM8A 1UZMA 1DC3A 1XELA 2CD9A 5CG2A 1XA0A 2JFFA 4OXYA 3PHLA 3RBXA 5BNTA 4ZQEA 2VWGA 4Y9DA 2IYPA 3OM9A 3PWKA 1DB3A 2BHLA 2PZMA 3UHAA 3JQEA 1ZXLA 4CLOA 4BO5A 5FWNA 4N5LA 2X5OA 4GMFA 3G49A 3RUEA 3T7EA 4JNKA 4Z0TA 4IQ0A 1E1NA 4BKUA 4NFHA 2UUOA 1D1TA 3MTJA 4FPXA 3PGXA 1U5AA 5CG1A 2X22A 3WB9A 4HFMA 4Y8VA 4A27A 3PIIA 2EKQA 4BQRA 4DLLA 3RASA 2QG4A 3LC2O 4I8XA 2Q2WA 3C7CB 2X9GA 2DU8A 5TS3A 4EJ6A 5A3VA 1ENZA 4FC7A 3VTFA 3H7AA 3WGGA 1YRLA 5G4KA 4D79A 1Q7GA 2VHWA 1AGNA 1VM6A 4M89A 4I5EA 3L0DA 4XIYA 3TFOA 4AJ1A 4J9VA 5G4LA 4MIYA 4U7WA 3JYLA 4B79A 3W8EA 2R2GA 3RUFA 1XQ6A 3KO8A 3QA9A 4A0SA 3BHJA 3VZQA 3KYBA 1LJ8A 3RU7A 3JYQA 1GQQA 1QYDA 1P1KA 3NTRA 1B3RA 3DONA 1CDOA 4OHUA 3A28A 1ISMA 1R4NB 1N92A 4MIOA 3BMQA 4R1UA 4GKBA 1VJTA 3DHNA 2Q1UA 3CMMA 3OA2A 1LLDA 1QYXA 4YEDA 4IMRA 1P1HA 3DAPA 2ILTA 2IXAA 1H5QA 1YQDA 3O26A 4DMMA 4EJMA 2OMEA 1OOEA 4FGWA 1XLTA 2VOJA 3ICCA 2J3IA 3OBBA 2FN7A 3OQ6A 3TFQA 5I8WA 4WCFB 3CZMA 2JD0A 3AM4A 1Q0QA 5CDYA 1E1MA 4IJUA 2PA3A 3PRJA 5JAZA 4R69A 3V1TC 3PQEA 4KUGA 1PIWA 4J0FA 3BAZA 4E2YA 3D4OA 3I23A 4K26A 5FYDA 5ADHA 2Q1SA 1UJMA 4UULA 4Y6RA 1HLPA 5BQFA 1XGKA 4WJZA 1ZCJA 5JC1A 1H2HA 5IZCA 5I9NA 3DZBA 3ZWYA 4FSHA 3ZV3A 2AHRA 3AW9A 3BYZA 4QFDA 1ZW1A 1DAPA 1DIAA 2GZ3A 1QYCA 2WDZA 5L7YA 4D3FA 1R6DA 3AU8A 1NVMB 1U2DA 3FNHA 1CETA 1HDXA 3ZCXA 4BO9A 1JA9A 5F1OA 3FPCA 5CPFA 2AE2A 4DC0A 2Y0CA 1PQPA 4DQXA 4Q3NA 1WW8A 2XAAA 2Y0EA 1P9LA 1V0JA 1JQBA 2C29D 2OOSA 2VOEA 3H3FA 2Y68A 3IP1A 3TWOA 4DQUA 1I30A 1ZMOA 3EY4A 2HCTA 5C7LO 1R15A 2JJYA 3I9MA 1JW9B 3OJFA 3S1LA 3BTUA 5IG2A 1HDCA 3AUAA 5L45A 4BNJA 4CQMD 4XB1A 3EAGA 1ISHA 2HRZA 2YV3A 3GUYA 4PVDA 4N5MA 4O59O 3DWFA 3O8QA 3U4IA 4KDFA 4BB6A 3AK4A 2OZPA 1SEPA 3I6IA 3UGKA 4BNTA 4CM9D 3BMOB 2B5WA 4GPD1 1DRUA 3LT1A 3MJ4A 5FI5A 3JQFA 2WYVA 4KZPA 1Y8RB 3RJ9A 4E5NA 5JLAA 3JQ9A 5JDCA 2Y1GA 4UAGA 5G0TA 5MDHA 1LI4A 4KTTE 2WMDA 3WFIA 1Q0HA 4D45A 3L9WA 3JQFC 4IIVA 1DDOA 3WQQA 1W73A 2NSDA 2VQ3A 1DIHA 1LTHR 4JX8A 4UVHA 5CHEA 5JDCC 1JWBB 3ASVA 3U9LA 1CEQA 1ZKMA 1X7HA 1ZK4A 5HS6A 5T8KA 1ONNA 4RQTA 1WMBA 1SEVA 1T26A 5CDSA 5MGBA 4XX0A 4OOFA 1SC6A 4WLUA 4W9NA 1HDZA 3N74A 4E2WA 3OEWA 1K89A 1L7DA 4YTEA 3HHPA 1X0VA 2NVBA 1FDWA 1U3UA 4M1QA 3LVFO 5GY7A 1GYPA 2WYUA 1NQOA 2Q3EA 4I5DA 4I5FA 4GL4A 3W6ZA 4BGEA 2VHYA 4JJIA 4YR9A 2X5KO 4OSOA 1ZK3A 3PHHA 4DL9A 4B3IA 1BTOA 3GGPA 1G0NA 1C0KA 2E37A 2V6FA 3C7DB 5A02A 5KVCA 4L9RA 2BFAA 3PYXA 3UH1A 1LDNA 3QIVA 4MVJA 2I5PO 8ADHA 1YB4A 4NK4A 5ENVA 4CV3A 1BRMA 4R3WA 2ZB7A 2YZ7A 3KZVA 4QO8A 3GPIA 1H9AA 4XR9A 1MLDA 4M55A 4CLDA 2QRJA 2DBVO 2J5KA 1P0FA 3BMCB 3JQ7B 3BMNB 4K6FA 2X86A 4NFSA 1Z7EA 1KVTA 1G0OA 4CR7A 3OIGA 3GY0A 1NYTA 5EPOA 4YJFB 1LRLA 4NJOA 5GZ6A 5ER6A 3DAGA 4ZU3A 5L7TA 3ADOA 4BHTA 3H2ZA 2GR9A 1KC3A 4FDAA 1NHWA 5DF1A 2YV2A 2ZCUA 4FFPA 1XHLA 4MKZA 4XDZA 1ULUA 4E33A 2DAPA 3CZRA 3H9EO 1HXHA 3Q9NA 3ZV4A 4AJOA 1LDBA 2D5AA 2X9VA 4NBTA 1IULA 1MG5A 2JD1A 3P2YA 4RQUA 1PZHA 1NPTO 4OYRA 3HFSA 3RUCA 4HADA 1Q7BA 3ZWMA 3JYPA 1GU7A 1C0LA 2IODA 4RVDA 4XYLA 1ZEJA 4IXWA 2ZK7A 4J4TA 4CM4B 1VI2A 4A2CA 1NASA 2EF1A 2YY7A 1LU9A 2J3JA 3GDFA 1A4IA 3I6QA 4X54A 3WYBA 2A35A 4DRYA 1W8DA 2PH3A 1Z73A 2JD2A 4W7IA 2DQ4A 3F3SA 4NH4A 1DJNA 1I2CA 2B0JA 2W90A 3E03A 4LSWA 4PLPA 4UEOA 1PS8A 1OZAA 1P1RA 3M2PA 2C20A 1LQTA 1AXGA 3DOJA 2QX7A 4AVYA 4PLTA 2VHXA 3V1YA 1PZGA 2GN4A 3FF4A 3WNQA 4PGFA 1I3MA 1PX0A 1Z7BA 4XQ9A 3WGYA 3GF4A 1ISFA 4J91A 3JQ8B 4KWIA 3A06A 3EZLA 5DULA 3PI7A 3I3OA 2Y1EA 1HE4A 4AJEA 2C07A 1ZMTA 3M6IA 5THQA 3PZBA 2VWHA 4TVBA 3HUDA 4LRSB 2GPTA 1G6KA 4XD2A 1N2SA 5AXBA 3SVTA 2Y99A 4NPCA 1WP4A 2P91A 1YO6A 3VPHA 1EUZA 1JTVA 1P0CA 3MCVA 1XYGA 2IEDA 3OFSA 3PIDA 1ZSVA 2VT3A 4CM5A 1PGNA 2ZTLA 3DC2A 3U0BA 4B4OA 2X0RA 5EINA 2AEJA 5JAQA 4CMEC 4MVJM 1IPEA 3WX0A 1IB6A 2D8AA 3ZNNA 4AJPA 4FJ0A 2BGMA 2OGUA 3IP3A 1QRRA 2D5CA 1V6AA 1YBVA 1RM0A 1N7GA 2O2YA 3NT5A 4M54A 4J90A 4BNUA 3QWBA 1NAIA 1T24A 1YJ8A 3ZH2A 3H9UA 4FBGA 1SBYA 5F1PA 1E92A 4WCDA 1I3LA 6ADHA 2I6TA 4E21A 2Q1WA 2RH4A 1EE9A 2DUUA 3O38A 5F3RA 1EK5A 1MC5A 2CDAA 1E3WB 4YJHB 2IZZA 4IMPA 1QKIA 2E6UX 3I1JA 5IFLA 3ITKA 1KEWA 3OP4A 5JNLA 5BSEA 1TI7A 2JCXA 4IZHA 3H9QA 2W2LA 3LK7A 5IZ4A 4RVHA 3P2OA 1QORA 1C1DB 1QG6A 2FY8A 3PYLA 4GLOA 5I7SA 2EW8A 4UUNA 2RIRA 1E5LA 4ALLA 2GD1O 1HZZA 2NACA 2B4TO 5DCWA 1PL8A 1U8FO 1PS9A 4HWKA 4QFCA 4TRJA 5HS4A 1WDKA 2XXJA 5KVSA 3FBTA 2CF6A 2A94A 1YB1A 5FEUA 2AEFA 3GPDG 1SMKA 2FZWA 2EV9A 3FI9A 2J5RA 5IDWA 3H65A 5IJZA 2C59A 2GGSA 2OP1A 4WNCA 1GZ6A 1H6CA 2VN8A 3F47A 2I3GA 3QW2A 3INRA 1XSEA 3U4DA 2OORA 4UUOA 1X7GA 5K0ZA 3NTOA 1SZJG 4ALNA 1OBFO 5BSHA 2W4QA 2DBQA 3MJCA 2HMUA 1LRKA 3ST7A 2YQ5A 4O0LA 3I9KA 1F12A 3TL3A 2Y1DA 4IZIA 3DBLB 3W6UA 4AJNA 1VLLA 2C2XA 3GZ4A 4LMPA 5TNXA 4RF3A 3QVSA 4FFOA 2GN8A 5A04A 4XJSA 3BZUA 1EVZA 1T2AA 3KEQA 4L4SA 3WICA 3ZNQA 2AQKA 3MJSA 4JBHA 4NI5A 1SPXA 3JQ8A 2UDPA 2A92A 4FGSA 3KV3O 3I4FA 4D41A 3WYCA 4J4BA 1IUKA 1ZK0A 4XYMA 5BSGA 2G1UA 4GSKA 1A7KA 3RUDA 4BKQA 2Y1OA 1UAYA 4MVJG 5L95A 1C1XA 1Y9AA 3B1JA 3HN2A 1YE3A 4IGEA 4YA6A 3WQSB 1E7WA 3GRKA 3LLVA 2HUNA 3TN7A 5JY6A 4O5OA 1PGJA 3ENNA 5ICMA 1UXGA 3L4SO 2JCVA 2Q45A 4EGFA 2GDZA 2DBRA 1WNTA 2HJRA 4J2HA 1DAOA 2NWQA 2JFGA 4WLNA 1GAEO 2QHXA 1QSGA 4AJKA 4WUVA 3RC7A 3JYNA 5ER9A 4CR6A 5IDQA 5L4NA 3VKUA 1I8TA 4F3YA 5K6AA 1IL0A 2AMFA 3GN2A 1FMCA 5TRTA 2NVUB 1FDTA 3ZI0A 2NVWA 2FPGA 1A9ZA 1KVUA 4Y6PA 1ADCA 2WWRA 2GERA 4CV0A 2O50A 3WGHA 1T2EA 3BXXA 2VYNA 3WGIA 5CPBA 3F6YA 2CY0A 2Q4EA 1DEHA 3H3JA 5AOVA 2CNBA 1ZZEA 4RCVA 7MDHA 1ADGA 1FF9A 4UVIA 1PGOA 3RD5A 4IDDA 2X1HA 4D3SA 4U6QA 5DBGA 4NZ9A 1K6IA 4IBOA 1E0DA 1ZH8A 5HBRA 4HFNA 2CVQA 1PSDA 2VRCA 2VWQA 3FTNA 4TKLA 3WXBA 4BNIA 4XYEA 3S2IA 4Z6KA 2X6TA 4CLOB 4K28A 4INAA 4R16A 1PJ4A 3ONEA 4JP3A 2C0CA 3JQCA 1LDYA 1VC2A 2XXBA 5KNLA 1Y5MA 4CLRA 1P1FA 3CXRA 3PP8A 4MIEA 1E3IA 4ZVVA 4XQGA 5I8ZA 1JKFA 3LSYA 4J1QA 3G1UA 2FPPA 3B1FA 4RPGA 1HETA 3C7AA 1TT7A 4ALIA 5G4KB 2QW8A 2D3TA 1R12A 3V2HA 2JHFA 3V8BA 2NV6A 1PJCA 1YKFA 1C0IA 1M76A 4DLBA 3JQBC 4E5PA 1YH3A 4E6PA 4UREA 2EW2A 3RVDA 4D0SA 2HAEA 3KEOA 3ZU2A 4OO3A 1GFSA 4CQLA 4RDIA 4NNJA 3KTDA 4RZHA 1N8KA 4ILKA 1H2BA 3NEPX 1UDBA 3DB2A 5C37A 3BMQB 3DBLA 4RPKA 1NTOA 1AUPA 1BSVA 3B70A 4IJKA 1N5DA 4TZTA 4J0EA 3TZHA 3UCFA 4TRMA 4Z0PA 4RJTA 5A4DA 3AUSA 3I4CA 5JO9A 3R3SA 3I83A 1I0ZA 5GMOA 1AHHA 3ULKA 4MDHA 5GZ3A 4D3DA 4ROSA 3K30A 1Y7TA 4Z9YA 1X15A 2UUPA 3TZ6A 3ZU4A 1UUFA 4BUCA 2O7SA 1RWBA 3RJ5A 2O48X 2B36A 5H81A 4B4UA 1E7SA 5LC1A 3PJGA 1R0LA 2NU6A 2O3TA 5BR7A 1H9BA 2C5AA 1GUFA 3AJRA 3ONDA 3RSHA 2PLAA 4Q3AA 4DREA 3RIHA 3TDKA 4LISA 1SAYA 1HF3A 3KLMX 2PGDA 4KUEA 1ISGA 1HEUA 4Q3CA 4ND4A 5JAMA 4E0BA 4A10A 3WS7A 4CM6A 1ENYA 3ZWAA 4ZJUA 1R37A 4DPKA 1IY8A 3HDQA 5F1KA 1MA0A 3TZCA 3DEYX 2FWMX 5EERA 4BO2A 3V2GA 4E13A 4R1TA 4FJ2A 3WDSA 4PLZA 3G79A 1L1FA 3LYLA 1RYDA 3QSGA 1DSSG 1WZEA 5DCUA 4DWVA 3DDNA 1QYVA 2P9GA 3DAFA 1DIBA 5JDIA
chains in the Genus database with same CATH superfamily
3KM0A 2CZGA 3S44A 2HHJA 2TMGA 2F1HA 2KM1A 3ORQA 4KGZA 4NH0A 1WB4A 4RD6A 3E3MA 4GXQA 5FQNA 2QRZA 3O1LA 1EK2A 1XRQA 1PR0A 3GMDA 1IZZA 3LHIA 3NYQA 4IJVA 1IBSA 121PA 5KWJA 2BUCA 3HS3A 3K96A 4NARA 1XJCA 3T8YA 5KREA 2ZBFA 3ZGNA 3IC5A 3HDJA 3AH8A 2A7XA 2Q5CA 1LBSA 1TMKA 3KWLA 3DF9A 3PQ8A 5HYVA 1HQKA 4LFBB 2Q3MA 3T38A 1G6OA 2WJ6A 2Q6KA 3TPFA 1SOWA 1Z34A 2I99A 1W5BA 1G21B 3FPLA 1WCV1 1B00A 5FA8A 4GRIA 5GIPE 5EKXA 3SHTA 2V65A 4JCCA 2XGJA 2XTZA 1ZI8A 5GP1A 4BEBA 1FL9A 2V45A 4OL9A 4CF6A 1VB5A 1OTYA 3NVMB 3LWNA 1KAOA 1Z5WA 2BOVA 3UM9A 3VUFA 4ED9A 2IH2A 3FPBA 1KAQA 3CLTD 3LQFA 5EQTA 3SXPA 4ZYWA 2AFHA 4EDHA 1AXRA 3CA8A 2ZR9A 4PE5B 5HTKA 3TEFA 3ZE6A 4BUJA 1TVEA 1PK8A 4A0GA 2OM6A 5AM0A 5CYFA 2B82A 1Q1NA 2G7MC 2WTAA 3C3KA 1UBKS 4CDMA 2W70A 1HQYE 2FZGA 1E7QA 1GZUA 2J3LA 3HB0A 4XQEA 3AQ4A 3SS9X 3VR2A 4TZ0A 3CO5A 4PZDA 4CEIB 3DZ8A 4IGFA 1GGMA 1F8FA 4JFAA 3LHFA 4QXMA 2ZRJA 1EH5A 3AI1A 4BFTA 3RV3A 4X62B 1UFVA 2I4LA 3O9ZA 5E7JA 1T0HB 2Y93A 1X1TA 5JMPA 3TTSA 5L53A 4UBJA 2BEWA 4JI0B 1GOTA 1EIWA 3JQ6A 4Q3DA 2D59A 2BDTA 4KPGA 4EL0A 4IY1A 1UL1X 3KRTA 4IDNA 3F6RA 1JU9A 5DM4A 1KWGA 1D2HA 4RWEA 1J5EB 2XW6A 2QGNA 2SBTA 3HU2A 1X1EA 2ZE8A 1TC2A 4HUJA 2ZDGA 4KXVA 4YI5A 3K1JA 2IV2X 1U8TA 1DPGA 1YUMA 2HU8A 3UJHA 4Z4FA 1BEEA 3STTA 1NYQA 1OBVA 1IG0A 3RVNA 1TQDA 4H3KB 7REQB 2C99A 4YCNA 3D0RA 5F3DA 2QRQA 1GZ4A 2PMDA 4RVFA 2UXCB 1M2OA 2Q9CA 3CH5A 1NUQA 3FMVA 3NHMA 1IOVA 4H3SA 3QV2A 1W0JA 5I7OA 4TT3A 4JN6B 3WO1A 3WIVA 5HFNA 3ELYA 3CMCO 1ZIOA 3K1YA 5EJ7A 1NOKA 2H9IA 4L85A 4TMKA 3IBFA 5U9CA 3L46A 1FXWA 1RI5A 1UANA 2V6GA 3OF3A 4QX6A 4ARZB 3JVDA 1UBLS 1TT5B 2I6FA 3A37A 4RHCA 2H0AA 1FXWF 3G5UA 1YOBA 5IJ0A 2BGWA 3KP1A 4JLJA 3QKRA 1LRJA 4LE0A 5I45A 2O8BB 1XEWX 1D6NA 4OY3A 2B3DA 1CZOA 1ZHHA 4PLFA 4TL9A 5A7HA 5A9TA 2V6MA 3U1BA 2WWWA 1U8UA 4HNSA 2PMWB 2H1CA 2HSWA 1EE1A 1YJAA 4BNYA 2ZIXB 4OMUA 3MJTA 2X40A 1HL3A 2JZNA 3L7KA 5EQFA 3OPQA 3HB9A 4Q9HA 4WN9B 1A88A 3AERA 1ZDMA 4AG6A 3LCUA 4EBFA 2WU4A 5TIIA 3ZCTA 4S35A 3VC1A 4B0OA 1A2OA 5A4AA 1W4BA 2HXYA 2ZRPA 2EX4A 2NU7A 4KGDA 2O59A 3GT7A 5FP0A 3WNVA 4BMZA 2JHPA 3QLEA 2H52A 3W06A 3QELB 5JQWA 3ETHA 3LY7A 3T9BA 4U0JA 1QLJA 2P90A 3DMYA 2CZCA 2YQ4A 3EWIA 5L3RA 4CMAA 1K92A 3BGSA 4PSKA 2JFOA 1MG0A 2AMLA 2RHRA 2YWCA 3JARB 4Y1FA 2NUTB 4B9EA 4QVIA 1DUIA 1OZHA 4OSPA 2F43B 2POQX 2YFQA 1D04A 2A9VA 3AKDA 3OZDA 3G0HA 2IYWA 4TL6A 3SQOA 2B4KA 1FFSA 1C8KA 3MJHA 3QV1A 1JA0A 2FG5A 2PZKA 4F1KA 2JGEA 5COBA 1R4MA 2QMUA 4UFOA 4CCAA 2Q3HA 3QPBA 2RKWA 4K9SA 5TSDA 1GUYA 1UAGA 4P34A 1R0ZA 3OVMA 2W42A 2ZUCA 4J3NA 3JSXA 1EQUA 4Q7KA 3GR6A 2GX6A 1F4LA 3NNSA 4MGHA 3OZAA 1YDFA 5KBYA 3NJ4A 1QCDA 2HBZA 2F3SA 4XFDA 3G2MA 2ID7A 1DO0A 3RU2A 2QMEA 5JYCA 4L76A 4F8YA 4TSRA 3VU0A 2AVDA 1FZQA 4WL0A 5SYAA 1AURA 2BELA 1Y3HA 2EP7A 2R5FA 1E2HA 1DTWB 2VTVA 3GLUA 1C3VA 2GNAA 3AIIA 1DTSA 2C2BA 4EZBA 1N5JA 5T57A 5ES4B 2PKWA 3BK7A 3WYAA 5B1DA 4ZYZA 4DVJA 5ARBA 1E9DA 3OLZA 4KHZA 2JVKA 2P6MA 3HPQA 2DQKA 4RDCA 4YACA 2EHDA 2ZVJA 1WRBA 4LYDA 4NZYA 1EHYA 1IIBA 3KQQA 3A6LA 5KOIA 1ZMXA 1S2IA 2XPCA 1JEYB 4O4LA 3TRHA 4EI8A 1QVZA 2CZQA 1LPOA 4RYDA 4IM7A 1CIVA 1PJ8A 4O4LF 1TUBB 4JBYA 3AESA 3HRKA 3ISVA 5FD8A 2IXTA 3BTOA 4NENB 3OCXA 3D1JA 1W5FA 2HV9A 1UKVY 2GJ4A 1JPVA 3DPUA 1FP7A 1E61A 3I2JA 5J4LA 3FFBA 2ZTHA 1G41A 1YZGA 4P5PA 3GEBA 2O9JA 3UUWA 5D3ZA 4Q48A 2XE4A 3CLUC 5BYBA 3SNHA 3TM5A 1EK1A 3CC8A 1LEHA 2Q4DA 4XLLA 2GCPA 4M76B 5HIIA 4CMGA 2NV2B 1G64A 2I6QA 3U13A 3HKEA 3B2QA 1A8IA 3Q9UA 4MVJH 5JSHA 3R74A 3H1TA 1MN6A 1Q19A 5D6OA 5A9SA 4C7JA 1MJGA 3ZZNA 1DKNA 3FW1A 1NQXA 2C8LA 3PX3A 2HJVA 2C03A 2VTKA 3HWRA 4ZQBA 3SWWA 3PSHA 4I9HA 4YDSA 4JVLA 3AB3A 5KMGA 5B3LA 5I9SA 4PNPA 1EBUA 3L07A 1TT5A 3L77A 3SI7A 4RHTA 3T4UA 4RHXA 3KL4A 4PAWA 5I7RA 5F76A 2X8LA 4DCCA 3IMFA 1UKYA 4DDVA 4G1CA 2EYUA 2C78A 1PEYA 2RG1A 4ZGBA 2G71A 1GTRA 2AFIE 3RUAA 4BBPA 5F2NA 5KNDA 1KQNA 3TPZA 2WM2A 1CRPA 1TAQA 1I2ZA 1KJIA 4N03A 3KT6A 1TCAA 3NKLA 4GGMX 4KN5A 3B3GA 4Z0NA 5HA5A 1WUHS 4S0ZA 3GG2A 1Q3HA 4RVGA 3JQGA 5U4QA 2P3QA 4AG3A 4BVKA 4JIGA 4E1VA 2CCKA 1L5VA 1WV1A 3WIBA 2Z09A 3HCBA 3QRWA 2H8GA 4YN3A 2QTHA 1WOMA 1GN8A 3K9NA 4WDRA 1OQAA 1KE2A 2QQFA 4RK1A 3K0HA 4PIMA 3EXAA 2OV4A 4QQFA 1W5AA 4WZAB 2X41A 1P44A 2GLUA 2G09A 3TRIA 5KTYA 3GJTA 4G0PA 4X1IB 2DCMA 2YUTA 3RIMA 4KAXA 2P9FA 1MOPA 2V3VA 2YXNA 1P60A 3L7NA 2IPOA 2BPOA 4QC2A 1L7EA 2VUIB 2F43A 3R6DA 1FRQA 3UCXA 4DBLC 4GG1A 1GVNB 1MFPA 2X0IA 1MEJA 3K9GA 1NV9A 4UBIA 1FDOA 3ZVMA 1E6MA 2LXNA 3FR7A 4DA9A 4I81A 2OSVA 3CURA 3GEGA 1E1DA 2WTBA 2YV1A 2HH9A 4FMDB 4OU4A 4QICA 3UCEA 4HT3B 3ZVKA 2O2EA 1YNOA 3CX8A 4J0IA 4KO4S 5JS2A 1FPMA 1GZ7A 4WPGA 5CFNA 4MWTA 4FB4A 1CIJA 4R8MA 4NONA 4A8TA 1VL8A 1IRIA 3PUWA 4I46A 4ALMA 4ZJPA 1E3JA 2FSGA 2G6BA 2OO5C 4KLAA 4XSVA 4DANA 2D2FA 2HO4A 2VS1A 2W2PA 5JXJA 1MT0A 1SVOA 3NBYC 4FZVA 3RRFA 4DCGA 2Y0BA 2Y2VA 1VCNA 3U9SA 4A0HA 4D9BA 4Z4CA 3KPWA 3GA7A 4ZVUA 2ZI7A 2B69A 4H4EA 2X9LA 4XPZA 2EYQA 4ZVMA 3GELA 4GRAA 4NP6A 4DMGA 1F5NA 1RWOA 3RFUA 3UK7A 2Z83A 1M33A 2O0JA 2V4ZA 3P4UA 5EMMA 4CMEA 1Z06A 2W11A 3FJOA 3AOEA 2GJ8A 3OUUA 4S2EA 4GL2A 3VKFA 2WAOA 4Q66C 4EMSA 1WHTA 4G0QA 4YV1A 3RKSA 3VPGA 1JR3E 2G5GX 4XFJA 4J16C 1VE3A 2A1UB 2P69A 2ZKLA 3D0QA 3PGVA 4EY5A 1CY1A 1VIMA 1RJDA 1D6SA 3NV7A 4RJJA 4HYYA 5E7IA 1E6KA 1CKEA 3H19A 4MZDA 4ND3A 4XW2A 1CCWA 1R0SA 2D5IA 2BCJQ 3UWSA 2IF0A 3K0CA 3OPYI 3WRXA 2AS0A 1Y4SA 3CF4G 1QUFA 1K9VF 1AQ6A 3N8NA 3W77A 3DMTC 2HQSA 2W6OA 4U00A 2ECPA 1SPBS 3ISTA 5BSTA 4D9FA 2OCKA 4WWHA 1XXHE 3SOZA 1EPUA 2ZSEA 1L7QA 1O5OA 3MPUA 5CH5A 5HRUA 1K6EA 1AB6A 5FL3A 3V8VA 2QW1A 5BWCA 2DBZA 2O8VA 5CH3A 1TJYA 1V3UA 4FBLA 2J6BA 2ZJ4A 1WUKS 4TWZA 4R81A 3K9FC 1MV8A 2ZYAA 5ADVA 1KOJA 3SFVA 3ZNOA 4FJ1A 1B1AA 5HRAA 1LUAA 3MM4A 2W2XA 3AVPA 3FDIA 1O6CA 3W2FA 3JZAA 1Z17A 4XWKA 1VKHA 3JAWB 3OHSX 4HI0E 3HA5A 4M0MA 5LA6A 2UV8A 3EXG1 2GNOA 1OXTA 1ODJA 5EOVA 5LA6F 1T1EA 4B31A 4GWLA 1Q84A 3AEQA 4DKXA 1N2CA 3W90A 4BPBA 1XCMA 2RHOA 3KKNA 1BCRB 3S3TA 1CY7A 2QTTA 1E1QD 1MW8X 3OICA 1KSHA 2OB1A 1XBTA 1ISPA 3L8ZA 1QZTA 3A6JA 3NWEA 1PBTA 2BBTA 4B5LA 1JDUA 2Q6OA 1BQ3A 4B46A 3KOZA 3GQBA 4DLXA 2Q2VA 3AONB 1OWOA 1SVLA 1YZVA 1MIOB 3DPSA 4CV1A 2ISQA 5C53B 4IIJB 4EZIA 5F9FA 2H4FA 1TF5A 3DZHA 1GNRA 2HCBA 2BHTA 2FJPA 1ENPA 3IEUA 4L3WA 1DP4A 1AOXA 4B09A 2ZRBA 2FQWA 1L5RA 2GCOA 2HUPA 5SY9A 3H97A 5C8VA 4PRLA 1RHRA 2L42A 2XWJI 2FR1A 3CT6A 1PQWA 4RHEA 4UE2A 2Z1NA 4Y2GA 3U80A 1PGPA 3HPRA 3OAAA 1X6VA 4EJSA 1SC3A 1YJQA 2Z0MA 4S1TA 2O07A 1MOSA 2XCLA 4RKWA 1N4AA 3ZQ4A 3ROMA 1KI9A 4Z3KA 2OXIA 4P54A 5L8VA 3AG5A 4LY3A 4H7FA 5BXYA 4CQLB 4PW0A 2BGUA 4QA9A 1NHGA 3UMYA 1NSTA 1PZXA 4KXXA 3TD9A 4Y2TA 3BSFA 5DNDA 1W87A 2BT4A 2QLJA 4D2IA 4LJ4A 5LM3A 1T36A 4EGAA 1U8YA 2V6BA 4CQNA 3WC4A 3PNOA 4MS4B 4WEOA 3H4TA 1YAHA 3PBKA 3K9LA 3C1OA 5HIMA 1NRIA 1RYFA 4KI7A 4RK6A 2PE5A 3LSTA 1TYBE 1WKCA 2OD9A 3CZPA 3VPSA 3UWPA 1DLJA 4B34A 2BFPA 4TS9A 2PUFA 2F3QA 4D6PA 2P2CA 3DE6X 4UTXA 1WY7A 1DI0A 4KR3A 3EZNA 2VDJA 2YZMA 1PWXA 1SXGA 4TKMA 4EPWA 2DXIA 5JMTA 4AY6A 3FUTA 1PR5A 1TUIA 5HF6A 3R8FA 4MYHA 4XWWA 1P2BA 1GXSA 3FPEA 4G09A 1E0SA 1U7WA 1IPFA 2VP6A 5DXJA 4HAIA 1P5JA 4PBSA 2UYYA 5B7QA 2IHNA 2YWGA 2NU6B 1MX9A 3WG9A 1USWA 1NNUA 2NQ8A 3W5CA 4OXQA 2BAGA 2CUTA 2DPYA 2YS6A 3ZCSA 2LCFA 1Q16A 4LVCA 2FLKA 4DZRA 4KWCA 3GHYA 4O2BB 3AHGA 5KI6A 2QTAA 4UTZA 4MUNA 4ZZ2A 3A8TA 4LTMA 1D2CA 5AWFC 5EC8A 1TAGA 4M8LA 2PBRA 3AY6A 3C3AA 3CLKA 1RXEA 1IOWA 5AKIA 3GEMA 4OHRA 1BQ4A 4C4ZA 2FEXA 5IVIA 4R9NA 1S4QA 5B5SA 1XCBA 2PGLA 5JNUA 4FQ8A 3Q0TA 1L5SA 4C6HA 2CJXA 2CXTA 2FWJA 4DGSA 3I6MA 3VNRA 4YT2A 3ZJVA 4OLAA 3D6UA 3T9FA 4JB3A 3DL2A 2I7VA 2CNWA 3SX2A 1F0YA 4B76A 5ITVA 1OC2A 2OHOA 3OZCA 4KSCA 1BU5A 5DLPA 1MO4A 3THXA 3MD0A 3SJCA 3W5VA 2B2NA 3ZY5A 3FNGA 1LX7A 1U0OC 1EHIA 3D2BA 3VVCA 5JZOA 5CHYA 1Z6TA 3LVBA 1XEXA 2WZCA 4X7MA 2PH7A 1IFXA 4MP3A 3TXAA 1YFLA 3L8CA 4ML3A 1IN4A 2JFUA 2W6IA 4X84A 4AMYA 1CQZA 1H6AA 2BGTA 2P2SA 3A11A 4NFYA 3J7TA 3L1UA 5IP5A 2RI0A 3PNLA 3OX2A 1FFYA 3UEOA 3OC0A 4KWHA 1M6NA 3TQIA 1M34E 3KSUA 3L02A 3ADPA 4P4SB 3FOWA 4QGFA 4G1BA 1Z2PX 2C9YA 2GSWA 3BS4A 1II8B 3QM1A 4CL0A 3O3OB 4G5OA 1RMYA 1DBIA 3IAM1 3OJCA 4AS3A 3GCZA 4FFLA 2HU7A 2CDCA 2IXBA 1E0KA 2Q8NA 5A7FA 2ZU6A 2ISSD 4NU5A 2ZZNA 1LVUA 2Q0QA 3BE8A 1YFJA 3ZZTA 1YS2X 1XK6A 3LVQE 4JOSA 5AOAA 3M6AA 4AP6A 4CMHA 4QYXA 1WQ3A 1VGQA 3LGXA 3F5MA 2A5JA 3BDIA 3X44A 5FT9A 2GNPA 5AYVA 1KE1A 4OLJA 3WP0A 5HCNA 4CWAA 4QXAA 1CVLA 1JU3A 3MWEB 4FD2A 5DE3A 2I65A 1B16A 3JQBA 2AQ8A 1ACMA 2FQYA 1Y1KE 2EG5A 3CEPB 2X2OA 3WNCA 5KYWB 2Q3LA 4QJ4A 3BREA 1Q0SA 2C42A 3K0FB 2WF7A 4FHGA 1Z3CA 1OCEA 3K5IA 2RARA 3CR7A 3SEZA 1U2QA 1Z39A 3WYGA 5JCXA 1NKVA 4GE0A 1FDIA 2LTAA 3EG9B 2YV4A 4MR8B 1UBRS 2E89A 3TIGA 4B81A 1YK0A 3G2QA 3K32A 1C7JA 3KE8A 1OXSC 4WGFA 3PEYA 4RA6A 5ENDA 1K3UB 1KMCA 5AVJA 1UPTA 1YHNA 4D4HA 5HKAA 3SYRA 1L5LA 2CYCA 5CB6A 2WU8A 1ZK1A 1P5HA 4CMIB 5E7QA 1VOTA 3ZLBA 2C9OA 3LTEA 1PNRA 2EX0A 3E5NA 3ZHCA 2C4UA 2EGGA 3DOUA 4N4AA 4ACBA 1L4GA 1A2KC 3B1ZA 3IDSA 3ZDCA 3C8MA 3INNA 1IOLA 4MVWA 1C29B 3EZGA 1XZQA 1FP6A 3EXHC 1AB5A 2GTHA 3N2GB 3VDXA 4ZEMA 1L2TA 5ECYA 4DCNA 2REOA 3CR3C 3EBLA 3ZH9B 3HO6A 3ZG6A 1YR3A 4N6OA 4PNEA 3WRVA 2YHAA 2QV7A 1YVEI 2IE8A 2QY6A 3IEKA 2NG1A 3EK2A 5P21A 5A4MS 3JZMA 1SZPA 1GZDA 4KHPB 1G20B 4F04A 3AJAA 4KIJA 4L8LA 1Z4JA 5KDLA 2FW1A 2SHKA 3W4IA 4RC9A 5HPYB 2Q6LA 1QMGA 1R9GA 1FX0B 4C0XA 4KQGA 3HXLA 4B1FA 3CLSD 2VJMB 1K86A 1WW2A 4JJFA 4GBGA 4YYEA 3MUOA 1AUVA 3DOHA 2H4WA 3TXYA 3VR6A 3RLIA 3C5EA 3ZDEA 4TMFA 5C5EA 4FNOA 4K9MA 1KHHA 1HE8B 1Z0SA 5L3ZA 3EEYA 5MN5A 1Z5VA 1Q6YA 2EKPA 3KR1A 4OJKA 2OYCA 3Q5GA 1DAKA 1VPVA 1KOFA 2O0LA 3IQIX 5CT6A 4TGLA 5AXAA 1O57A 4CHGA 1ZJYA 3PHGA 2DB3A 1JLLB 1RDFA 2BFEA 3BXZA 4FEAA 4FEEA 4PSAA 3RS2A 3CEMA 3ETNA 4LJ5A 4OQNA 5EEGA 1RWXA 4UQPA 3FJ1A 1F38A 1PNQA 4F12A 3H2GA 4NG5A 3CF6R 2XUJA 2JJ1D 3BXGA 5CEJA 4N49A 1H1LB 3DV0A 4AMUA 2X1LA 1N9GB 1PAUA 2GI4A 1DPFA 1CJCA 4M7OA 4PPQA 4WZBB 3STXA 1G8SA 4IIBA 2A30A 4QQKA 1VJ5A 3H5OA 4BV2A 1C1HA 1N2OA 1XZ8A 2JLCA 1ZO8A 2JJ2D 1QGDA 3AYXB 3EVBA 5SICE 2JAHA 1LPBB 4DHEA 2Q2QA 3LUHA 2AFVA 3E1SA 4P92A 1KRXA 1VLVA 2AJ8A 1W5TA 4KIUA 3SF8A 4RK0A 5ALRA 2C97A 1A76A 5BNWA 4II2A 1E5XA 4PAGA 1Q3KA 2DX7A 2VDNB 4YAFA 4YCJA 3NHPA 4JI8B 4WESB 3A1DA 3F7TA 2HC9A 3IJRA 1W4ZA 5J5AA 1L5NA 4DR2B 1MKYA 1HT2E 4PG7A 4R83A 2DKOA 2H63A 3D1LA 4J0QA 1C8BA 4G4SP 4XGRA 4JI6B 5REQB 4BC1A 4IF4A 2ZVQX 3F7MA 2NN3C 3GJRA 4QEKA 3U3DA 3M3HA 1U9CA 2AN3A 4IZOA 4IQGA 1IN7A 4OFBA 3OQOA 3IQDB 2A9JA 2RE8A 4OQYA 3SKVA 3OKFA 3PQFA 4B3TB 3R7AA 3CNHA 5CLGA 4RK5A 1TZBA 1QB7A 1U9IC 5A5GA 1OIXA 3D3WB 3QPAA 4NULA 2ZBQA 1DU4A 1B8OA 4P5EA 4S12A 4JZYA 1QKKA 2V7UA 2WIKA 1DIOB 2OB2A 1U0JA 1GYRA 2J6HA 4MUGA 5EMLA 3SSOA 2QU8A 4U8HA 3UK2A 1OWLA 4ZCPA 3K0FA 4S04A 3E6AA 1LD3A 2QVZX 4KMRA 3VM6A 1G3IA 3F2VA 5EE9A 5FULA 3KKKA 2ACWA 4BNZA 5AXCA 3RWOA 1SR8A 3N6RA 4V2IA 1ORIA 1IBMB 1PUXA 2ZJ7A 4P6VF 1TEXA 3W1VA 1KP9A 1D0VA 1E64A 1WULS 1YAJA 2E6KA 3M4ZA 3ZTYA 2VKTA 1VYUA 1DIGA 3WB1A 1JPNA 3OECA 2C82A 4DNFA 1GILA 2Y8EA 1PHRA 1ZL0A 5GM1A 3N2LA 5P8WA 3WA6A 1I4LD 2QD2A 2FG6C 4DCTA 2ZE5A 1C9DB 3OH8A 4AXBA 1ZVJA 3BXEA 4EOGA 2HQOA 4L5CA 4W99A 3DJFA 4BNLA 2V7QA 4CL3A 3LHDA 4OGGA 3VI3B 1CD5A 4Y1GA 3K4PA 3SQNA 3ZY4A 4CKZA 4GC5A 1E3LA 2QSUA 1XU7A 2IZ0A 2I3AA 5DCYA 4C07A 3KKMA 1NN3A 1GPMA 1SGWA 4P3KA 4GKAA 3KHSA 5AM5A 3JAKA 2LPMA 1DXYA 1P5ZB 2H59A 4ER0A 1P5RA 4GGPA 2BLNA 3TNYA 3CTMA 3WBFA 1V96A 2J30A 3N7UA 1OIWA 2RC6A 2QN9A 2ODQA 4B6FA 3SZUA 3STHA 4ANFA 5IU6A 4WSOA 2KE5A 4U7HA 5KTPA 3TGWA 1L1EA 1OLSB 3X1JA 4BAUA 2W2KA 2IWRA 4BO7A 3L8DA 4PICA 4I5GA 1MEOA 2VZ0A 1BXZA 1Y1PA 5SZHB 4ZCTA 4D43A 5EJMA 2FWAA 1HNZB 3FYHA 4MS3A 4QUGA 4QBGB 4UVGA 4MUEA 3B1YA 4PS1A 4AWXA 4PHTA 5KS2A 2H2WA 3EHDA 3G5TA 3VSAA 3M6XA 5LYJB 3Q11A 4DQVA 2O4UX 3HKBB 3HVUA 5AKHA 1Y5NA 5BNIA 3IQZA 1GHTA 3AKEA 2YW9A 4H7PA 5JZSA 3GDWA 1XLTC 2C7GA 2YXPX 4BATA 3EX7C 2J09A 4PG5A 1NUUA 3UJ6A 1R6VA 1ULSA 1WMSA 4BNHA 4P2GA 5JSFA 5DVZA 1ID8A 3V34A 3OEYA 4CN8A 3KEGA 4ENRA 4TRRA 1FXUA 2JEYA 1TM4E 1KWKA 3MUFA 3RSFA 1UXIA 3H2KA 1XG5A 1NRWA 2FSVA 1WCYA 4BX9A 1JAZA 5JZMA 4TUYF 4G8CA 4OGLA 2QZZA 3LYUA 4XXHA 5TQVA 2B0CA 3K5HA 3SLGA 2O2GA 4C06A 2WHPB 3FCSB 4QE3A 1KMHB 2EXXA 2J0QA 2HD4A 1OJ7A 1O9BA 4YLGA 1BYUA 3AI7A 3LMKA 1T8SA 4HZUB 4JP1A 1T9GS 3ZVRA 2WJAA 1MU0A 2PT9A 4GMXA 1H93A 2GCGA 2HX1A 5H68A 4DC9A 3DZIA 1N3LA 1XPJA 2C0PA 3DLCA 4YB8A 4KO3S 2F17A 1X2BA 2D2XA 1NRXA 2HMWA 4C01A 1U6IA 1OXBB 2W2LD 5DYIA 1ZX1A 1HDOA 4PYMA 4ZVTA 2DVMA 4F6LA 5ALUA 2QAGC 3F6CA 4BAGA 1SJ9A 4PLCA 3SBEA 5IJ9B 2E49A 1SXJB 3E58A 3SFTA 2NNWB 4B71A 3KJNA 1E66A 3LUBA 2FHPA 3DV9A 3GLHB 1J5PA 3B3AA 4BGDA 3PC4A 4X3CA 5K05A 4DB2A 3H4IA 2IU3A 5B12A 3KUUA 4ES6A 3VYUB 3PCXA 4ZDWA 4EW2A 3QSYA 4L15A 1NDUA 1N0UA 1P4SA 2ATVA 4HX5A 5ALPA 5BN4B 5BSRA 4PYJA 1UBFA 1OLUA 1OAAA 4HS9A 2A86A 1MJ5A 4F92B 1BWSA 3S28A 1O1YA 4NMWA 1U7HA 1QH1A 1UR5A 2HT6A 1F14A 2RGEA 2BMWA 2J4DA 3NYIA 4IHJB 2BRUA 3IODA 2P2DA 2NPIA 3KUXA 4RSHA 4CFYA 3PKJA 2XUIA 3HXTA 2B1QA 1LJUA 3IR5A 4RF5A 3PNPA 4UMEA 4DF3A 2WTUA 3GI1A 3IVMA 3E9NA 5G0WA 3RCBA 2NPOA 3BRQA 3EIOA 4HEA6 3DR3A 4G5FA 3MWJA 4G6ZA 4TZ6A 4D3ZA 4IH4A 3WJ1A 4ZMSA 1P74A 4R1OA 1EDDA 3P9YA 4PG8A 4F4HA 2FVYA 4KWEA 4LK3A 1YOVB 2DRIA 4DYDA 2GRUA 2RH8A 2VDWA 4H7IA 5I7AA 2JLWA 4FE7A 5DGHA 1JIXA 2W8BB 1J00A 1H8EA 1O6FA 2M6LA 5IAEA 1H0SA 3CNNA 4XB6B 3DP7A 3GRUA 3H6GA 4KLCA 1H2RS 2V4MA 4R5HA 4EPTA 5KJ1A 5IS2A 3K35A 1L7OA 1IY9A 1V26A 1HOTA 4IVPA 2C2KA 4Q6WA 2FHSA 3OBIA 3UB4A 4EITA 5J1SB 1GKKA 1NF3A 3CVJA 5T8KC 2GVZC 1NJSA 1VRVA 5SY4A 5CNIA 4H6XA 1GQYA 3PQ6A 5T6BA 3KYCB 2N1BA 3ABRB 4WW0A 3NTVA 4FS3A 2D7CA 5K0SA 2YXDA 1QHHA 4EUFA 2PX3A 3OTWA 4NEGA 4L8YA 1VLQA 5AM2A 2C8JA 6CHYA 3BK1A 4K6HA 1FFAA 2GMWA 4Y2YA 5CA0B 2D7DA 4BY9E 4LXHA 4RWZA 4U0KA 5HGJA 1YGYA 2Z4TA 4ECEA 1EWVA 3C41J 3KXLA 4KPUA 2WEKA 3AI2A 4KYIB 4L28A 3KTAA 3WMXA 4DV7B 3O1JC 1PU2A 2I7TA 1CHNA 2QTLA 4GMGA 2B1IA 4LX0A 1VHTA 1JFSA 2PRYA 1NUTA 5AMXA 1HYGA 4CMKA 3ZGXA 2VHCA 5KOHB 3ZLJA 2JATA 5DOVA 3C6YA 4B7ZA 5ALTA 2EBFX 4UMFA 5DHPA 3G3EA 1P1CA 2XMDA 2WD7B 4QFMA 4WCFC 1DIRA 1I6MA 1N33B 4G5YA 2HTFA 3C48A 3ELBA 2IYOA 1A71A 3EWSA 4WNYA 1R0CA 2NW6A 4DARA 4IIXA 4TROA 3UJ9A 1NU8A 2XOXA 4BGUA 4FR2A 3SR4A 3GRZA 1COWA 3O8LA 1AO0A 4JBXA 2XXAA 2VYND 2QRVA 1ENOA 5A6SB 1V2HE 4Q9NA 3OCWA 3EF1A 3PR2B 4HZUA 4P31A 1YVUA 3DD5A 4OQ4A 2ZBRA 4NDAA 4QPNA 3F2IA 1DLIA 3MUNA 3QY0A 3HN7A 2YN4A 3GARA 5FTKA 5KNBD 4NCBA 1D2EA 4XDHA 1LPMA 4QVKA 3A9CA 1EGQA 4ZC1A 1V16A 3L7DA 1XTUA 3PFIA 3TPCA 1GKLA 2HA0A 1AKTA 4LJAA 1PG2A 1FYXA 2QNRA 3A3YA 5ICFA 3IQHX 2YJTD 2NZUG 4BZXA 3PI6A 3HCWA 1CU1A 1BXGB 1WXQA 1DRVA 1SXJA 1IMOA 3BWVA 3NCHA 3ZW9A 1E9BA 3DE5X 3DVAB 2WG2A 2XH8A 1B3BA 1BDBA 4DBVO 2H16A 5TJ9A 2GKSA 3PGMA 1QVRA 1XXHA 1T3HA 1TM5E 2PXHA 2ZB4A 2VCYA 3JD3A 3GFTA 2VJQA 2WI8A 1PEAA 3DLHA 1KEPA 4QATA 4NE7A 4UEJA 5KJFA 4LVUA 2YOFA 2BD0A 3C1TA 3DDWA 3ENVA 4OHVA 3UUEA 3S0JA 4B6EA 1LBQA 3IUMA 3OWXA 4ZO7A 3UICA 2XKJE 1M1NA 4HEQA 1R27A 4IOLA 4TWRA 1NR1A 3ONVA 5AVSA 2A0UA 1C81A 1DV2A 1CS0B 1A98A 2AKAB 2V74B 3FKJA 3ID6C 4FI3F 4XYBA 5DTEA 3RTBA 3LOPA 2FW6A 3EXG2 3GMIA 2CBGA 4Q4AA 2EIXA 5JNSA 3KD3A 5MFPA 1M0SA 1TLLA 3MT0A 3PQCA 1Y8RA 4PAOA 4QG7A 5K3DA 3OQPA 3OTQA 1OSNA 1TA4A 2GZSA 1DCMA 3NUGA 3OZBA 4IMJB 3WYEA 2F8SA 3GT0A 4HMPA 3VZCA 1NQAO 2RH5A 1R88A 2BR5A 2Q9BA 3AWDA 1U4NA 4FNGA 4H7HA 3ROKA 2FSSA 2N42A 2YIVX 1JHQA 2P9EA 3L84A 4LCJA 1ZJJA 4GE3A 1P72A 3GVIA 4L73A 4FYVA 1YS4A 2GJ9A 2KPOA 3T95A 1TK2A 2ID8A 4WNIA 4Z51A 3E2MA 1YOVA 3ADDA 2O19A 4A8JB 1JDVA 5JY1A 4LBZA 1ELOA 1L5WA 3BBLA 5FUVA 3L92A 1F0PA 1ZIPA 4PLHA 3RH0A 3U44B 3T12A 1EX1A 4MWGA 5E3JA 1OT5A 1NI5A 2ZS7A 4GX1A 1FPQA 3RAJA 4CUZA 1GJRA 2QT0A 3JQDA 4JGGA 4D56A 4OB6A 5BW5A 4MWCA 1CUVA 4UM9D 1WETA 1CT9A 1XTZA 3JATB 2B7LA 4KQEA 3CU5A 3FJYA 4AECA 1S2OA 3WGKA 3KYCA 1KPHA 2Q5IA 3E9CA 3BM5A 3R24A 4EATA 2HQBA 2Y1LA 2ZBPA 3I2KA 4IILA 3UGTA 1IWPB 2V03A 4HV4A 3C3WA 5BMOA 4HXFB 3O4IA 1CUZA 3W8NA 1N6RA 2HK8A 1I9CA 4XX1A 1V3TA 2WKQA 3HGTA 3UG7A 3MMXA 3EWAA 2RKBA 5DYWA 2HNKA 3AF1A 3D4BA 3ZZ1A 3TZEA 3TR5A 3A6HA 6Q21A 5FR1A 4ZAGA 2ETXA 13PKA 2FOIA 4RLHA 5K0LA 1Z7GA 1XL0A 3KBOA 2BZ0A 2PS9A 4LRXA 1D3AA 2WU1A 3KXPA 4HGOA 3BMCA 5DHRA 3BMNA 4AJJA 4YRKA 3QBDA 1ARZA 4RQBA 5ADWA 8OHMA 5A0VA 1JT2A 2XBLA 1QKJA 1H0KA 3OT4A 5FDFA 5FA5A 3VC7A 3OA0A 3KB1A 3K9WA 3ZE0B 2JCBA 1E2NA 1RXCA 2FOLA 4YJFA 4TSFD 2JBAA 1CJMA 1LH0A 3DHWC 1JJIA 1AF7A 1KPGA 3SPXA 2RDMA 4BQFA 4ER6A 5K3EA 1SCUB 3D6FA 3IAFA 4WXRA 3IE1A 1JEDA 5FNVB 3L6OO 3DVSX 3I5XA 2J45A 4HNHA 2HWUA 1LBTA 1XWIA 3C5VA 4DLAA 4FFVA 2DFNA 1XJ0A 1U0TA 3RE1A 1NX9A 1USUA 1QUEA 2W6QA 4RLFA 4LSGA 2ODTX 3A9RA 3ZNPA 4D8YA 4YLYA 4DBZA 5JZBA 1H4SA 4EYKA 1A1SA 3SM9A 1HM5A 3HV2A 1YBHA 4F6RA 3PD7A 4MR7A 4NXMB 4N39A 2C5EA 2QW0X 2B98A 4C2UA 3HVRA 3X2SA 3BE6A 1RTTA 5FBKA 1JUDA 4ENSA 1NT4A 4TXJA 3KVNA 3FLAA 1SVUA 3UPTA 3RSSA 3BWYA 1A95A 3CRZA 3L9XA 3GLGB 2BR4A 4N76A 2WWGA 2V4UA 1E2IA 2YWFA 3WGOA 2PR7A 1XHFA 3P19A 1V4VA 3N8KA 4MA5A 4Q93A 4EGSA 3GYBA 1GQOA 2DHEA 2R85A 4CM4A 3IEVA 2EFYA 3FPJA 3WIDA 2OORC 4Z4EA 2BUBA 2H07A 2VDOB 2WLTA 2NYUA 4ZPJA 1V39A 2UVDA 2VAMA 2VP3A 1T5IA 2VUUA 4LVOA 3VNAA 4JSTA 3R9IA 1EVKA 3IUYA 4R2HA 4JITA 2I8CA 1SELA 1Q0PA 4ZGGA 2NSLA 4J03A 4YAIA 4L5JA 3FKQA 1FDSA 4GI7A 5AVRA 3KYIB 5M5BA 2KBFA 2I87A 1BG6A 2Q9AA 1GL3A 2KI5A 1W88A 2BM1A 1M34A 1UJ2A 2H1SA 3NGXA 4X45A 5AESA 1E9FA 2C94A 1DC5A 1FQKA 1SKAA 4U2CA 3QE2A 3LLMA 3LRTA 5E6SA 5F64A 3VR2D 4QG3A 4AKIA 4MRMB 3D59A 1G7RA 2FSHA 2XSZA 2HMTA 1J2RA 1KVQA 1BKSB 2AQHA 2WUEA 3RVKA 5C2JB 4JLBA 2D7JA 3DEHA 4O1IA 5K8VA 1V3VA 1YHYA 3H9GA 3ZWNA 2FPKA 2YHBA 3ABIA 4Y2PA 4E11A 1CUCA 3PC2A 1O96B 2Y1XA 4FBMA 4KIGA 3E22B 4DUZB 1ZJ6A 1TCVA 3Q1LA 3GDGA 3MTEA 3FVRA 5AW9A 3BT7A 2Z2YA 1RNLA 3IYLW 1KY5A 1OFTA 4N3CA 2CVZA 2RGDA 3PQ4A 5CJ2A 1J2EA 1A4UA 4EGJA 1MA3A 3OT1B 2B30A 4I14A 2OFWA 3HNPA 4Q82A 4WBSA 5AKYA 4JB2A 4GECA 1K97A 2V96A 3K0AA 4HYQA 4YALA 4XLTA 4AI6A 2J0EA 1RLJA 2BI7A 3AUJB 1V9SA 1W0JD 4IDAA 4TTIA 3ROFA 1K08A 4TT3D 3W2IA 3H6KA 4IFBA 3D4IA 1UCFA 3SVZA 5JW6A 3THXB 1Z2EA 1JSLA 3TO5A 3UZUA 5WRFA 4JI1B 2EWMA 3ZWOA 5JWRA 1BW9B 1K7FB 4KRXA 5LUAA 1KEKA 1KGSA 2XQGA 1NKTA 2QRPA 3GJQA 1PQYA 3PC7A 2E2WA 1XVVA 3IJPA 4HSGA 1G38A 2DPXA 2FK8A 4FQ5A 5G1OA 4NJMB 1E3WA 3QEMA 1CUDA 3LQKA 3KFLA 4URHA 3HACA 3FIUA 1RRPA 2E82A 5KJCA 4MA4A 5KCZA 5A0TA 3OZXA 3SMVA 4LA4A 1VHLA 1K88A 4QNRA 3N75A 3KSDO 1WPXA 2IYRA 2QWXA 1F3OA 2QTVB 1Y0BA 1EM8B 1Q92A 4EM6A 1XVAA 3TZKA 2NT4A 2B25A 1E9AA 2WIJA 3A1CA 2CD7A 4HH1A 4D92A 2HXSA 3R7SA 1DC8A 2D1QA 2G63A 1CFZA 4S24A 1J70A 1XTJA 4C4YA 3MS2A 3QVXA 2WFLB 2X13A 3IX7A 5KYVA 2C5FA 5SYNA 1MABB 5G41A 2FF5A 3CRNA 1GA4A 5FOQA 4DIOA 3R9WA 1T43A 1YCHA 4U3JB 3C3CA 4KR0A 5CNJA 3EUEA 1JIJA 1GD1O 1S3SA 1TQ6A 3NIGB 7ABPA 2JLRA 4JENA 2R6R1 3WK9A 2GPNA 4IFIA 2ZIWB 4GUAA 1AV7A 3FB1A 3GG9A 4BP1A 3B51X 3VZPA 3A3OA 3L7JA 4ZYLA 3W5SA 4CJXA 1SC1A 3ZDBA 1JNYA 5TF4A 3KQVA 3V9AA 4DSNA 3DE4X 5D1HA 3RI3A 3VC2A 1F6BA 1VLMA 4Q39A 4N7JA 4M9XA 2ADMA 1SBZA 3LG2A 3MGKA 3WTCA 2X0NA 3OCYA 2WW8A 4C6SA 1NJGA 2G5CA 3IR6A 2B8NA 4WAUA 1F8GA 1OU4A 2H0RA 1G9XA 3BD6A 4KP7A 1OLXA 1PJ2A 1Y6QA 1C8LA 1PO7A 1XR3A 2ZUBA 3WIOA 2QSZA 3WDMA 3P9QA 5EQJB 1RXVA 1AH2A 1CZHA 4Q1BA 5B3KA 4DYHA 3D6MA 4GZMA 1EFDN 1Q2XA 1FFHA 1HLGA 3QF7A 3CKKA 3LYHA 4MJLA 1GVHA 2VHJA 4Z9XA 1TTTA 1F2UA 5TQ0A 3LIPA 4YRQA 2P27A 2G9RA 2YVKA 4G85A 3CE9A 1YFKA 3JQPA