4OAQA

Crystal structure of the r-specific carbonyl reductase from candida parapsilosis atcc 7330
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
365
structure length
365
Chain Sequence
KAVPDKFQGFAVSDPKNWNRPKLASYERKQINPHDVVLKNEVCGLCYSDIHTLSAGWQPLQRDNLVVGHEIIGEVIAVGDEVTEFKVGDRVGIGAASSSCRSCQRCDSDNEQYCKQGAATYNSKDVRSNNYVTQGGYSSHSIADEKFVFAIPEDLPSSYGAPLMCAGITVFSPLIRNLGLDARGKNVGIIGIGGLGHLALQFANAMGANVTAFSRSSSKKEQAMKLGAHDFVATGEDKTWYKNYDDHFDFILNCASGIDGLNLSEYLSTLKVDKKFVSVGLPPSEDKFEVSPFTFLQQGASFGSSLLGSKTEVKEMLNLAAKHNVRPMIEEVPISEENCAKALDRCHAGDVRYRFVFTDFDKAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords R-specific carbonyl reductase
publication title Insights into the stereoselectivity of R-specific Carbonyl Reductase from Candida parapsilosis ATCC 7330: Biochemical Characterization and Crystal structure studies
rcsb
source organism Candida parapsilosis
total genus 121
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 1.1.1.195: Cinnamyl-alcohol dehydrogenase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4oaqA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4oaqA01
2QYSA 2HK9A 2JCYA 2VHZA 4IDFA 1ULSA 5ENDA 1E0DA 1E3SA 1KVTA 4Z9YA 2P5UA 2UAGA 4HFJA 1ZMOA 3UOGA 3JQAD 1YL7A 3RUDA 4YA6A 3PZRA 4NMHA 3D4OA 4JP2A 2V65A 4U5QA 3JD3A 1BRMA 2ILTA 2RH4A 3OICA 1UZLA 4E33A 4Y6PA 4ALMA 2WE8A 1DRUA 3QQPA 1A7KA 3W8FA 3H8VA 1LI4A 1DB3A 3AM4A 3OJEA 1BW9B 1JAYA 1DAPA 3BA1A 5CDSA 4MPDA 4QO7A 2PWZA 2VRCA 3C7DB 2C5AA 5DP1A 3WDSA 1PGJA 2FSVA 1I3MA 2VRBA 3INGA 3CXRA 4RVHA 1A4UA 3DDNA 1VKNA 3I9KA 3NRCA 1MXFA 4MJLA 3W8EA 5EIOA 3RAJA 4PFJA 4AJ1A 2E6UX 2GDZA 3KETA 4L4RA 4YJGB 1ZNQO 9LDTA 2E4AA 2AXQA 2GZ3A 1YDWA 3AFNA 3ST7A 1P1KA 1U4SA 4AJHA 2I66A 1U28A 2CF6A 4S3MA 4NHEA 1WNTA 5F5NA 3S2IA 1EK5A 3LQFA 3PGJA 5JDIC 3EUWA 2Z1MA 1BDMA 2AEMA 3GEGA 4C7KA 4LW8A 3PDJA 2WTBA 4B4VA 5BSGA 1AXEA 1YL6A 5B4TA 1FDWA 3AWDA 3NGXA 3A4VA 4PLGA 4CMIA 2PLAA 2C5EA 2HSDA 5H83A 1HXHA 1VSVA 5I9MA 2XOXA 1ONOA 4BNTA 4MVJH 1HTBA 1PZFA 3DZBA 3K31A 4CLXA 2DUUA 2VHWA 4D45A 2VTEA 2C2XA 9LDBA 1BGVA 3LLVA 4YRBA 4Z3DA 5IAAA 5DBGA 5T67A 3WBBA 3IKVA 1JKJA 2I9PA 5BSHA 4NI5A 4QSMA 3TJRA 1YH3A 3GVCA 3P7MA 5I7VA 4W99A 5THKA 1ONNA 1C1DB 2YHIB 1VI2A 1U3UA 1FDVA 1UZNA 3U4HA 4EEZA 1I24A 5HM8A 2PGJA 3BXXA 3TZKA 1R66A 5KVSA 1GL3A 4J7UA 2LDBA 3DBLB 3K2BA 4B8ZA 4JJIA 4RF3A 3NGLA 1PJ3A 1IYZA 1TVEA 2Y68A 4PG4A 1NAIA 3L6OO 1PZEA 2OHXA 3ENNA 3LC1O 1Z45A 4TVOA 4BOYA 1ORRA 4XIYA 2C29D 4XD2A 4OKIA 4C7JA 4TWRA 5U9CA 1K89A 2D5AA 3AUTA 1P1JA 4P8RA 3U4CA 3ZWNA 1XCBA 1LDYA 2HMWA 3JQCA 2C82A 4ZICA 2Q49A 2ZTUA 1NNUA 2FSSA 2V7PA 4W9NA 4AJ2A 4FDAA 1LSSA 2GYYA 4MP3A 1UH5A 1ZFNA 1ZSNA 3N7UA 2EGHA 4DIBA 3OA0A 1W73A 4G81A 4XR4A 5KNLA 3GLQA 5DULA 1SEPA 4EZBA 1H6CA 3R6DA 4J3FA 3ZWMA 5L4NA 5KJ1A 1T2AA 2P9EA 2UUPA 4WE3A 3FNHA 1J0XO 2PGLA 1H6BA 3GG2A 3P2YA 3HHPA 1EFLA 4BO9A 4IINA 3QHAA 2FPGA 4DYVA 1H2HA 3UHAA 4BKOA 3IKTA 1C3VA 1NBOA 4DYDA 3VH2A 1IE3A 1W0CA 2GGSA 5HWSA 2XF8A 4TMFA 3RQSA 5TJ9A 2J3IA 3JQAB 2J5KA 1YDEA 3CMCO 2ZYDA 1MG5A 1RYDA 3T7EA 4QTZA 5JAQA 1RPNA 4Q3AA 1EVJA 4GMFA 3UCXA 4ND5A 3ZNOA 3MTJA 1O9BA 4E5KA 5JDCA 3FHLA 2A9FA 2X9GA 4L76A 1HL3A 4YWJA 4AJJA 2HJRA 4OGWA 5CFZA 2DBVO 2B83A 4GKBA 3ZV6A 3DFZA 1N9GA 3IQDB 1R37A 3TZCA 1X7GA 2A4KA 5A05A 2VWQA 3FD8A 1HYHA 1ISHA 3D64A 1HETA 4J7XA 3LYLA 3ZW8A 1YXMA 3FNEA 3GDFA 1JW9B 1C0LA 1ZKMA 1I3KA 2J3HA 4JCOA 2IZ1A 1DBVO 2X9NA 3TRIA 2IODA 2ZJ0A 3IS3A 1T25A 3WIEA 2O2YA 3B1JA 3W6UA 4BO6A 1IHYA 1U5CA 2G0TA 2RBEA 3HFSA 3JV7A 4QX6A 1EK6A 1R4MA 2HMSA 3ON5A 4Q39A 5A02A 2BI7A 1PTJA 3PWSA 5TNXA 4D3DA 4ZJUA 3FR8A 3STHA 1HYGA 3PLNA 3F6YA 5KJ6A 3NDJA 3BMQA 3OH8A 3TZ6A 1U7TA 1X1EA 3OJOA 2CMDA 4FR5A 4WPGA 5DDIP 5FWNA 1QKIA 1B16A 1BDBA 1QR6A 1XQ1A 4KUHA 4Q3EA 4D42A 1QORA 3AI3A 4BNVA 3PPIA 3MEQA 1YBAA 4AFNA 4BO4A 2VUTA 1DHRA 1PQPA 5KOIA 1I5RA 1JQBA 1ZCJA 4UAGA 1O6ZA 4UVGA 2NADA 5C7LO 1JAXA 4RQTA 2YV1A 4N18A 4ZQEA 5DCUA 1VM6A 3WNQA 2EHDA 1OBFO 1SAYA 1K2WA 3ETGA 4WUVA 4CL8A 3TFQA 4CM8A 2YQ4A 1PJBA 3H65A 5HA5A 4BKPA 1ZH8A 4NBUA 2W2LA 1WMBA 1X1TA 1YQDA 2XPCA 3DBHB 3CE6A 3Q11A 2JJYA 5U1PA 4E21A 1NQTA 2WD7A 5DP2A 4MINA 2AW5A 3HNPA 1GR0A 3ROKA 5AOVA 1HDGO 3GEDA 5JCJD 3FF4A 3WGHA 3RUEA 3WS7A 4E0BA 2VYVA 3VKUA 1KY4A 3L0DA 5EINA 3AY6A 4OXYA 2VOJA 1UAGA 2DUWA 4KZPA 2CVZA 1Y6JA 2D5CA 4MVJM 3WMXA 5G0SA 4PG6A 4RLSA 2I5PO 1LEHA 1B2LA 4P38A 4O63O 4OOEA 2FZWA 2JAPA 2PFGA 1PGOA 3V1UA 5A1TA 4LVUA 3ZU3A 4GVXA 5FYDA 1R6DA 3PYLA 2PD4A 2P9GA 2O3JA 4H16A 1IPEA 3CSDA 4WLNA 4F45A 4K6CA 1LSUA 4M87A 2GNAA 1GQ2A 3WXBA 5AXAA 1WVGA 1NTOA 3GFGA 3L6DA 4UUMA 1BW9A 1H0KA 3JQ8A 2PKRA 4R9RA 5U4QA 1A9YA 4J1TA 1MUUA 3KUXA 3K5PA 3PQEA 2XXJA 2VUUA 4UVDA 3K30A 2X7HA 3KVOA 2IEBA 4OAQA 3PXXA 3VHRA 3L4BC 1F12A 4F6CA 1OC4A 2I3AA 3UH1A 5DNAA 3VH3A 4UUPA 2SCUA 5JXWA 5JMPA 4HFNA 1DC6A 4XRRA 3CZRA 4FJ0A 3DTYA 5TSDA 5BNFA 2JFFA 3HDQA 4QXMA 1ENPA 4HWKA 2WJPA 2QIOA 3JQ7A 2W2KB 4LN1A 1OI7A 5DCWA 1JDJA 1P45A 3JQGB 2BMAA 3L4BA 2RAFA 4DQVA 3C3XA 1LLCA 3ZWCA 2HU2A 3WGYA 2OXIA 3DOJA 4EUHA 4EITA 3M2TA 4XJTA 4DQXA 3JD0A 4ND4A 4WASA 3GC6A 1M6WA 3MJEA 1E3EA 4E13A 3UCFA 1O94A 4XGIA 2EKPA 1DO8A 4GGOA 4GWGA 4KDEA 4RPJA 5HS6A 1CEQA 5AXDA 2Q2VA 1IY8A 1KVRA 4J4HA 2QZ9A 5A04A 5CAEA 1GUZA 2DU8A 3FR7A 4XA8A 3IP1A 3PP8A 1MFZA 3IP3A 1R0KA 4MIOA 5I7SA 4YAIA 3ONDA 3OM9A 4AVYA 4PZCA 1VE9A 4I5FA 1CDOA 2P4HX 2P5YA 2CDAA 2VNAA 4OIMA 4YBZA 5K1SA 3QY9A 3DOCA 3DQPA 4AJPA 4BHTA 1UP7A 2EIHA 4CV0A 1JA9A 1I32A 1AN9A 1MXHA 3VC7A 1GFSA 1NX6A 4I1IA 1F17A 5CHEA 4E4YA 3EVTA 2CNBA 1BWSA 4I9NA 4PLVA 5JFOA 1UR5A 3HZZA 4WLEA 1C1DA 3WYEA 1U9JA 3ROMA 4WLOA 2RIRA 4FFNA 4BNHA 5JYEA 3I23A 4BGVA 4BIIA 2FHSA 3KYBA 3E9NA 3KRTA 4NQZA 1HRDA 4A7PA 1T2EA 2J8ZA 3P19A 1LQUA 3WGTA 4D3FA 3ITKA 4J6FA 1CJCA 2Q45A 4MIEA 4QFCA 1AXGA 3AUAA 2HDHA 4GL4A 1SO8A 1CF2O 2R00A 2FPPA 1PIWA 4Z3KA 4NDNE 4XRGA 5IXYA 2OUIA 3DFUA 3ZWPA 5L4LA 4YB8A 3OF2A 2QRLA 4DMMA 2OP1A 3IJPA 1U8FO 5IN4A 1LBEA 1DRWA 2VHYA 3UCEA 3UW3A 4S1VA 1ISFA 4UREA 4ZQFA 1PR9A 2W90A 3Q3CA 4CR8A 2J3KA 5JMWA 2WD8A 2AMFA 3S8MA 1U8XX 4PRKA 3ANLA 2GPTA 3ZN2A 5HTOA 4BB6A 1OZAA 1F0YA 1ID1A 1WDLA 1VPDA 4NZ9A 3RBXA 7MDHA 1M75A 3NJ4A 4WEOA 3FCOA 3JQEA 2IXBA 1EQ2A 3D0OA 3R3SA 4HXYA 1VJ1A 4W4TA 4RDIA 4ZD6A 4A73A 1C1XA 2J3JA 2BGMA 1U3TA 1Q0QA 2AEFA 2GZ1A 2UV8A 5CP8A 3RC1A 4BMVA 2AQ8A 2C7GA 2FP4A 2C07A 1VLLA 5IG2A 3KO8A 4O59O 2O23A 3VOSA 3ZNQA 4FC7A 1SOWA 4UVEA 1E1MA 4I5DA 3JQAA 4OQZA 2PZKA 2YDXA 5F5LA 5A06A 4RZHA 1A7AA 3B6ZA 4BVAA 1QP8A 1G0NA 4PLCA 3GY0A 3ROPA 4EBFA 3K92A 2C54A 3KLMX 5C5IA 3PWZA 1MGOA 3UGKA 2O3SA 1Y8RB 2IYPA 3GRPA 3QP9A 3QVXA 4ROSA 4ZA2A 4BKRA 3U4IA 1G1AA 4CQLB 2EGGA 2QRJA 1ZMTA 1CWUA 3V2UA 1Q7BA 4CL3A 1XLTA 1E1KA 3QWBA 2X0IA 3ABIA 3MJ4A 4TSKA 2EJWA 1UXJA 3H9GA 1SB9A 5G0UA 1DFIA 1GYRA 3O8QB 4BS9A 4AJLA 5I8WA 2EP7A 2EERA 1QYWA 2XAAA 1HEUA 3WMWA 1I3NA 5K6AA 3HN2A 2FY8A 3GNTA 3EVNA 2TMDA 2P4QA 5DBIA 2BFOA 1NHGA 3G79A 4XYLA 1OAAA 2HK8A 3PTZA 3HE3A 5JAIA 4OYRA 1SCUA 1E92A 1PJ2A 2EW2A 4IS2A 4KMSA 4HV4A 1K6IA 4GLLA 2NQTA 1V0JA 4E3ZA 1KEWA 1GYQA 4IM7A 3DTTA 4WNIA 2Y0CA 1NWHA 5JNLA 4PLZA 1IULA 2JCVA 3SJ7A 1LLQA 2NTJA 2ZYAA 4HNHA 4MVJD 4R41A 3UXYA 3L77A 1F8GA 1P1HA 1LNQA 1V3VA 1P3DA 4LISA 1KY5A 2DPHA 3KHUA 3M1LA 1ADFA 1JWBB 3F9IA 4AG3A 1ZZEA 4PRLA 2G5CA 3FI9A 1ZK0A 5A9RA 2A94A 4RQUA 2O3QA 3QA9A 3DHYA 4NPCA 3A9WA 3WSVA 2PZJA 1FK8A 4AJIA 4DIFA 2H1SA 1BMDA 5KIAA 5KVCA 1I3LA 5JBIA 3VDQA 1B8UA 3ZWOA 2Q1UA 5IZCA 4GMGA 4CLOA 3NJ8A 1PJQA 3W4IA 4CMJA 4IJUA 4FFMA 3OJ0A 4F6LA 1IPFA 1BSVA 3BMCA 4ID9A 4UUNA 2QQ5A 1RM0A 1RM4A 3KXDA 1X0XA 3B20A 3PRJA 4PN3A 1KERA 1E3WB 3EW7A 3KYCB 5ICMA 1YGYA 4JXKA 5TIIA 1PQWA 3HUDA 1I33A 3RKRA 1E7QA 4II3A 3WICA 1Q0HA 3A28A 4RORA 3ZW9A 1U3WA 1JN0A 3AM5A 1N8KA 3H9UA 3I52A 5C7OO 3OQ6A 5ADHA 1V3TA 1MC5A 1NVGA 4RF5A 2R2GA 2OBYA 4PLWA 1NFFA 5DOVA 2NTNA 4H3VA 3RI3A 2CUKA 3ZU4A 1J5PA 2P68A 3R3JA 4K1LA 1C0PA 1DDOA 2X5OA 5THQA 1UZMA 4TRJA 3QE3A 3VZPA 3BTUA 3D3WA 2Y1OA 5FFFA 1LLDA 2ZK7A 3E82A 3ZHXA 4I8XA 4J0EA 1R12A 1GEEA 4DWVA 3D3EA 4I08A 5JW6A 2Y66A 4M86A 3BMOA 2AQKA 3A06A 3GRKA 3I9NA 4RVDA 4FC6A 3TZHA 3AY3A 1U2GA 5IZ4A 3JYQA 2UDPA 1F8FA 2EKLA 3L4SO 3TDKA 1PR3A 1XA0A 4YJHB 3WGIA 5BNTA 2RHRA 3KM0A 1Q2XA 3JQGA 4MVJP 3PIIA 4IDAA 3QW2A 3JD4A 1U1IA 5EJ2A 1E6UA 1GZ6A 1I2BA 1Q1NA 1EUCA 1UDAA 2WSBA 3K96A 1ZXLA 2X22A 2OGUA 3JQ6A 1K6JA 2JL1A 2D0IA 1ZW1A 2QZZA 1WMAA 3QWIA 3ZHZA 1ISIA 4FOOA 1AGNA 1DIAA 5IDXA 3AI2A 4AJEA 1EE9A 3GA0A 1I30A 1GCUA 1X14A 3G49A 1K6XA 3AY7A 2QG4A 5CDUA 1EDOA 1LU9A 2EW8A 3WGOA 3K73O 4WGGA 3INTA 3S2FA 4CPDA 5A03A 1DRVA 2QRKA 1YE3A 2VZ9A 4CLRB 5CDYA 1WZIA 5IZCC 4OJNA 4XQCA 4GSLA 4MOWA 4E32A 1XU9A 2O4UX 2EJVA 1S7CA 4IJWA 2NU7A 3PYMA 4JJGA 3S2EA 4LSMA 2VT3A 1GV0A 2B4TO 2D3TA 3B70A 4YT4A 3W4KA 1HE3A 3OQBA 1KEPA 2BFAA 2AA3A 4NIMA 5L7YA 4A03A 3WWZA 4PG8A 2GERA 4IY1A 1SBYA 4PIVA 3D1LA 2YV2A 1BVUA 1TXGA 2I6TA 1KBZA 3NUGA 4RDHA 4L4XA 2X4GA 4JBHA 1D7OA 1ZUD1 2X9VA 2X6TA 1GD1O 1HDCA 3OEWA 5EQFA 4IXTA 3B1KA 4Z0PA 4LMRA 2PA3A 4BV8A 5I9NA 3R1IA 3SC4A 3MJTA 3ITDA 2PTGA 1E7SA 4PGFA 1XR3A 1DAOA 1DJNA 3G17A 2O2SA 2YFQA 2NV6A 3O4RA 4BNMA 2PK3A 5KVVA 2GLXA 1VC2A 1L7EA 4MP8A 3C85A 3AOEA 4EUFA 5JY6A 2VHVA 2BI8A 4ITUA 4OHUA 3PHHA 2B0JA 1UXKA 1GEGA 5JCJA 4BMNA 4DPKA 5K0ZA 1RM5A 1YJ8A 4B7CA 4PG7A 1DFGA 4QFDA 4J1NA 5JSFA 1P33A 2YW9A 3PFWO 5HRUA 4XGNA 3QLJA 2XXBA 3BZUA 3PI7A 4JX8A 2E49A 4NJMA 4FJ2A 2G1UA 4CUJA 1VL6A 4B7XA 4ZRNA 3ZV4A 1WAMA 4RPKA 4YACA 2JAHA 4UEJA 1BXGB 3WGZA 3E9MA 2ZQYA 2YQ5A 1HE2A 1DIRA 4WCFC 1HKUA 2ZB8A 1FJHA 2E37A 4W9NC 3KEQA 2PH5A 2YY7A 1EVZA 3PHJA 1KETA 2BHLA 3ICPA 4DREA 2IEDA 4UEOA 4L4SA 4A5OA 5H81A 1QRRA 1HF3A 5F3RA 1LUAA 4LK3A 1HSOA 3JTMA 4IZHA 1HWYA 3GNQA 4BV9A 5KVQA 4E2WA 5TJHA 3HDYA 3O9ZA 1EDZA 1YB5A 1ZVMA 4N5NA 4NBTA 4WCFA 3NYWA 5COAA 2GR9A 4JJFA 3RD5A 3C1TA 1N7HA 3PJFA 2JKVA 3ZNPA 2GN4A 4XDYA 3ORFA 3VZRA 3UAGA 5JAMA 2V6MA 2X86A 1QXSA 3AUSA 4FW8A 1H94A 5JLAA 2NM0A 2G76A 1BVRA 4M89A 4JROA 3IL2A 8ADHA 3CEAA 1ZSYA 2HRZA 3QJ5A 3X2EA 3Q1LA 1YO6A 3H3FA 1GPJA 1LDBA 3LU1A 2DTXA 1HE5A 2VNSA 2AG5A 4R16A 4WEQA 1F14A 2O7SA 2AE2A 1IUKA 1Y8QA 2H5LA 4PLTA 1IB6A 5JDCC 3CH6A 3AOGA 2IE0A 3JYNA 3M1AA 3IUPA 3G1UA 3FTNA 4YPOA 3WFJA 4ALKA 1XKQA 1ZK2A 3IDSA 3JQ9A 4N7RA 4RVUA 2DBZA 1P9LA 4R69A 4XB1A 4FN4A 8LDHA 1Z7BA 2E82A 3EDMA 3ZGYA 3VAZA 3QVTA 1NQAO 2J6IA 5EERA 2OMEA 4YJDA 2C7VA 3FBTA 4PVCA 4EJMA 1FDUA 5I8ZA 1A71A 2B5WA 4W82A 3EC7A 4A10A 1KS9A 4B4WA 4DL9A 4O0LA 4YYZA 5B12A 1GADO 1YQXA 2DT5A 3SXPA 1E3LA 5ENVA 4B3HA 2NVUA 1W6UA 4KTVE 5T8KC 4IDEA 1GZ3A 1UXGA 3IC5A 5KWEA 4TZTA 3WBFA 2ZCVA 6LDHA 1GY8A 4ZRMA 3SEFA 1BG6A 5TC4A 4IQ8A 4CM4A 1U3VA 1XGKA 2GN8A 5LC1A 4L74A 4GVLA 3RUIA 3E6AA 4KQXA 1YOVB 4GH5A 1EZ4A 2PZMA 4FFLA 1U2DA 3LVFO 4G65A 4AJKA 5KCZA 5JS6A 2Y05A 5T8KA 4CM1A 1H6AA 1LTHR 2B36A 2OO5A 4BGUA 4JBGA 2AEJA 1R15A 1TI7A 4XYMA 3GMDA 1PJLA 2PKQO 3DAGA 3C24A 3KYDB 4DPLA 2NU6A 3TZQA 3D4NA 4B79A 2Y0EA 2X8LA 4YJFB 3JCZA 3PVZA 3PDUA 3D5TA 3PHIA 1JTVA 1NR1A 3Q2IA 1QYCA 2ZTVA 4I9UA 4EGFA 3ZNNA 4BNXA 4G5HA 4NR0A 2CDBA 1E3JA 5ITVA 2WDZA 3FN4A 1H9AA 3BHJA 4YQZA 2GN9A 5EPOA 5G4KB 2VUSA 3RROA 3ANNA 1D3AA 3HDHA 4P4GA 5HS4A 5F21A 2W98A 4QQRA 4BNKA 3ETDA 2Z1NA 2B35A 3I3OA 3WTCA 4L73A 2AG8A 3NEPX 2O3TA 4CV3A 1XU7A 4B3JA 1DPGA 2D8AA 3HJAA 1LDEA 4IGFA 4IZIA 3KTDA 1V9LA 3OJFA 5KJCA 1PS9A 4KUGA 4R3WA 4RVSA 4WLFA 3QIVA 1UXIA 4MVJI 1PJ4A 4FFRA 1U4OA 1WWKA 2CFCA 5B4UA 3GZNB 1P1IA 3ZWBA 4YT5A 2O7QA 3OIDA 4I5EA 4A27A 1Z74A 2O50A 2Y99A 1HDRA 1S6YA 3PHGA 4YEDA 3RJ9A 3IIEA 1DEHA 1E77A 2VWPA 1ISMA 3H5RA 4PLFA 4E2YA 3LDHA 1LRJA 2ZB3A 4PZDA 4R3NA 2LDXA 3S2GA 2ZB4A 4O6VA 4CLRA 3DBVO 2OZPA 4BNZA 1ISGA 5L95A 3GGPA 4D0RA 3BIOA 4XYGA 4J4BA 4MP6A 5I7EA 2B69A 4D79A 4J1QA 4OO3A 4BQRA 3I9JA 1ARZA 1TT5B 3W4JA 4BL5A 4CUZA 4XQGA 4MKZA 1M6HA 4OOFA 3RC7A 3OETA 1QV7A 1B8PA 1E7YA 3F5SA 4CQMD 2JFGA 4R1SA 3OJLA 2A92A 4CJXA 4CMHA 3UKOA 5H82A 4E5MA 3TPCA 1BHSA 2NVBA 4FPXA 2FR1A 1IZ9A 4YJGA 4BNYA 4X54A 2HAEA 4XR9A 4HUJA 3I6IA 2V6GA 4KWHA 4GX5A 1I36A 4JGBA 1P0CA 1W8DA 1A72A 3DO5A 1BTOA 2DKNA 1LRLA 4IIVA 2BLLA 3GUYA 4IDDA 4XYBA 4J9UE 4JNKA 3ZHBA 4QEDA 4MVJA 7ADHA 2ZJ1A 4FJ1A 4TVBA 1VRWA 2HJSA 4BQPA 5CDTA 2EV9A 3BMNB 4HBGA 1N2SA 1HE4A 1LDNA 4XQEA 1EFKA 1T1RA 4ZQHA 3WOHA 2IXAA 3I4FA 4DMLA 5CEEA 5I7FA 4J2HA 2C20A 4IGEA 3WQQA 4INAA 3DBRB 3CMMA 1ULUA 3BAZA 4K9DA 4IDCA 1EUZA 4EUEA 5JYDA 3PFFA 3JQFA 4CM9D 1LJ8A 1YQGA 4ZQGA 3DMYA 4RO0A 3DZGA 4M8SA 3KBOA 4RF2A 4WECA 5FI5A 3PJDA 4EJ6A 3GEMA 5AYVA 3SBOA 1ZEMA 2BELA 5EN4A 2X0NA 2R00C 5G0TA 3VPHA 3W6ZA 2YHIA 3AK4A 4CM3A 1HSZA 5FF9A 4FBGA 4IS3A 1R4NB 1PGNA 5IDYA 3E48A 3DBLA 1V8BA 3FWZA 3JQBC 5AQ1A 1Z82A 1WDMA 4ZGWA 1P44A 3U0BA 3MTGA 1SNYA 5CPFA 2F1KA 3AUUA 3IUSA 2YJZA 4YRAA 4UVHA 3H2SA 2YYYA 3ZDFA 1ZJZA 4AJ4A 2ZTMA 4FGSA 3IJRA 5TS3A 2CSUA 1HDZA 1E7RA 1JLLA 3CTMA 4ND2A 1PJSA 4E5PA 1QMGA 3U4DA 3JQBA 1DHTA 5ES3A 3AW9A 2I3GA 1LDGA 3LT0A 5ICSA 4RPHA 3ZI0A 4BUCA 3RC2A 5TLSA 3ONEA 2OORA 3NKLA 3MWDB 5HBRA 3RBZA 3TNLA 4BNGA 1K5HA 3ROQA 3E1KA 4O5OA 4BKQA 4XYEA 3WYCA 2PY6A 3EHEA 4OMUA 4GKVA 3INRA 4NG5A 2IZ0A 5C7IO 3GT0A 5CG2A 4NNJA 2GCGA 2DTDA 4U7WA 1P31A 3TL3A 2X0RA 3WLFA 4G2NA 1NQ5A 1MLDA 3DONA 2PZLA 3WYBA 4Y6SA 3AFMA 1PWZA 3DL2A 3H5NA 3T4XA 4CMIB 2NQ8A 4NBVA 1D8AA 1YRLA 4LCEA 4LRSB 3C7AA 1T4BA 1KC3A 4NH4A 3TN7A 1Q0LA 3VTZA 3WX0A 2BFMA 1Y5RA 3OECA 1DC3A 2EWMA 1O5IA 5DN9A 3EK2A 1QLHA 1H9BA 4EYEA 3W8DA 1LC0A 1W4ZA 2NLOA 4OXNA 4J90A 3R0IA 4UULA 4QT0A 4YRDA 4R1NA 4CR7A 4GQAA 1LSJA 5L4SA 3NDIA 4A0SA 4IJVA 2JCXA 4FGWA 2X58A 1HZZA 3GR6A 3ZWAA 2GZ2A 3LC7O 1ADCA 4I9HA 4IDGA 1GZ4A 3F3SA 3I9LA 3M6IA 4Z0HO 5AXCA 3OP4A 4XWYA 1E5QA 3UICA 4ZHSA 1B3RA 1SB8A 4EEXA 3PLRA 3ZWXA 3KZVA 1ZK1A 5K6AC 1R0LA 3L07A 3RWBA 3DHNA 3QV1A 2H6EA 4XQ9A 4YT8A 1U5AA 1HLDA 4D44A 2CY0A 4WOJA 5BNIA 1M66A 4NBRA 2I99A 3VH4A 3WQSB 4CQMB 1NQOA 4DPMA 4OXKA 3COSA 3RFTA 3RUHA 1ZEJA 4YDRA 4GLOA 3BTVA 3RSHA 5A9SB 1X7HA 3CZMA 1YB4A 4ONEA 1PEDA 2VQ3A 4M54A 4OL9A 1YOVA 5IN5A 4TZKA 3EZYA 3F46A 3Q0EA 1TA4A 4U8GA 3WNVA 4OSPA 3ENKA 4YAGA 3TSCA 1WDKA 5JAZA 1XHLA 2IDZA 4Y9DA 3KOUA 1Z6ZA 3HSKA 2OP0A 2AE1A 4XDZA 4BNLA 4Z9XA 3H7AA 3KYDA 3EYWA 3UF0A 4DQUA 4DXHA 2DBRA 3H4VA 3E5MA 1G0OA 4DIOA 1DC4A 3I1JA 5G0WA 4C4OA 4CMCA 1NR7A 2FMUA 4L9RA 3NX4A 3ICCA 3OQ1A 3FNGA 4CLDA 2WYUA 3DC2A 1QYVA 3Q2KA 2X0JA 5AVOA 4EW6A 1H2BA 1GDHA 1IZ0A 3VVBA 4DGSA 3PYXA 1NPTO 4KTTE 2BFPA 2Q99A 4J16A 2PH3A 4YVFA 2BD0A 1JVBA 3DBHA 3QVWA 3FTPA 4PLYA 4BO2A 4BO8A 4GX1A 3TQHA 3MJVA 5T5QA 2BH9A 1T2CA 2IZZA 4DVJA 5BT9A 2BKAA 4NK5A 1E6EA 3IMFA 1DIHA 6ADHA 4D43A 3DMTA 3V1YA 2CD9A 4DTIA 4L8VA 2GN6A 3T4EA 1YJQA 1YKFA 2PNFA 3NTQA 3GZNA 3SLKA 1PJTA 3VH1A 1H6DA 1HDOA 2X5KO 3MJCA 3PJGA 4RCVA 4EJ0A 4LVCA 3DZKA 5L7WA 2VZ0A 4NJOA 4DLBA 1EEHA 2HRBA 4IPTA 1UJMA 3IOYA 5L45A 1CQIA 2HMUA 1ONPA 3DB2A 3FPLA 1HYEA 1Z75A 4TKMA 1N92A 1X13A 3DXFA 3RFVA 3JQDA 1YS4A 1J49A 1J4AA 4I5GA 3RUAA 1TT5A 2CF5A 3GUCA 4TKLA 5CEFA 2YZ7A 2B4RO 3BMQB 1E3IA 1QLJA 3U9LA 2C2YA 4O1MA 4P4NA 2F00A 3M2PA 4J9VA 4M1QA 5FI3A 3ZH2A 4ND3A 2A35A 3MJSA 1GTMA 2E48A 1LA2A 4P4LA 2BGKA 2UVDA 3FRJA 2W2KA 3GN2A 1KVSA 3QRWA 3RU9A 1OFGA 3KEOA 4JQCA 5DCYA 2NNLD 3QSGA 3VDRA 1N7GA 2UYYA 3OHSX 2HLPA 3L6EA 1A4IA 3OFSA 1ZBQA 1UXHA 4OH1A 4CM8B 3MOGA 4B7UA 4CR6A 2VT2A 3SLGA 4IUYA 3HB4X 5CDGA 1DJQA 4ALJA 2BGLA 4CMEA 1DC5A 5F1OA 3CINA 1CETA 1AUPA 2YDYA 1YBVA 3H5AA 4UEKA 4E12A 4IDBA 4CMAA 3JYPA 4D41A 2DVMA 2R6JA 3H9JA 3D7LA 2I67A 2Y1GA 3F47A 3UVEA 1CYDA 2H63A 1T2DA 3CIFA 1O95A 3DBRA 3P2OA 4MKXA 4OQYA 1GAEO 4XZ3A 3F4LA 3CUKA 3JYLA 5GY7A 5LDHA 3BTSA 3UFXA 4U6SA 1TB4A 3K8ZA 1X7DA 5L7TA 1PGPA 1DIBA 4XCVA 5A3VA 4D46A 4IQGA 3EY4A 4GBJA 4J1SA 1WPQA 4JN6B 1R4NA 1GQYA 3JQ8B 3O03A 4IXWA 5TGDA 4NU6A 4AJNA 4B3IA 1FDSA 3PHLA 4RVFA 3I9MA 1FXSA 2IRWA 1P77A 4B4UA 1NYTA 4CMBA 3QVSA 3LK7A 3NTOA 1OMOA 4WJZA 5G2OA 3VPFA 4IJKA 1I01A 4E30A 1AHHA 3W1VA 1DOHA 3AOEC 3GG9A 5JO9A 1IL0A 2NSDA 3LC2O 2JD0A 4BB5A 4FFPA 3GVPA 1D1TA 3DEYX 1CRWG 1CIVA 1KYQA 4OM8A 3JQ7B 4XJSA 3V2GA 3I6QA 4II2A 4B4OA 3VPGA 4BGIA 1HT0A 4E2XA 5TT1A 3TWOA 1E7WA 4DRYA 1T26A 2Y1DA 5BR7A 2I65A 3DOOA 3KLPX 2C0CA 3U09A 1SMKA 5F1KA 1A5ZA 2YHUA 2VOEA 4WCDA 3GOHA 3D5QA 5MDHA 2RHCA 1XSEA 3HQ4O 1E1NA 3E18A 2Z5LA 4BO7A 4BNWA 2DC1A 1YVEI 2AHRA 1PS0A 4F3YA 3PEFA 4XB2A 5KJFA 1LSOA 5DOZA 2VYND 1XDWA 4BO3A 2HQ1A 2GSDA 3DZFA 3ADPA 1QV6A 1C14A 3GHHA 4CM5A 1T4DA 3GGGA 4GI2A 4F46A 4BMSA 4JBIA 3QWFA 1FF9A 4RJTA 3MWEB 1PU2A 1C0IA 2X5JO 5JDIA 1MFPA 3H9QA 4HX5A 4Q3BA 1TT7A 1CQJA 3DAFA 1X0VA 1D1SA 1T2FA 4JIGA 4NFHA 3U3XA 1EBFA 3O38A 1PSDA 3Q9NA 3QVOA 4Q3CA 2GD1O 1H93A 2DBQA 3BHMA 1NPDA 2WM3A 4CM6A 4FCCA 3KB6A 1R16A 5MGBA 1Y8RA 4YQYA 4Y67A 2VHXA 4D0SA 3WG9A 4CQLA 1E5LA 2FR8A 4RL6A 1LC3A 1XELA 5A5EA 2BF7A 1SOVA 4GX2A 1E7MA 1XEAA 2Z95A 3OBBA 4H15A 3SJUA 2VWGA 4CQMA 1H5QA 1JU9A 4OSOA 1D4FA 3O8QA 2GF2A 4BNFA 1A9ZA 2ZCUA 5A9SA 1B15A 4DUPA 1ADBA 5A5FA 1U7HA 3F1KA 5CG1A 4QECA 3WWYA 4WKGA 1QYDA 4ZQBA 3JQ9C 3E5RA 2FWMX 3SX2A 1KVQA 2PGDA 3EGOA 5B4VA 3OMLA 3WTBA 4MVJF 4U0KA 2FN7A 2Q3EA 5J23A 1HZJA 1WW8A 5CPBA 3RUCA 1WZEA 3WSWA 4R5MA 4RGBA 1ZIDA 1RM3A 2O48X 1NFRA 2IYOA 3GN1A 1BXKA 3HB5X 1ENOA 4GX0A 1KEUA 1R0SA 2DFVA 2VN8A 4YAEA 4EDFA 3SVTA 3ZU2A 3E9QA 2OL4A 1ML3A 3HWRA 2Y93A 3DZIA 3AJRA 1C1XB 4GAEA 4LRTB 4PG5A 2PKQP 2QX7A 3OIFA 4WK6A 3RU7A 1DIGA 1WP4A 4YCAA 3RCBA 5TQVA 3TFOA 2NACA 3NTRA 3N74A 4QUKA 1EQUA 3A1NA 3PQDA 1FDTA 2P9CA 2YV3A 3E8XA 4LSWA 4CM9A 1VJTA 1XIVA 1SC6A 3G1TA 3X2FA 1VL8A 4K28A 3RUFA 3K6JA 4L0QA 2ET6A 4MKRA 3JD1A 3VTFA 1LLUA 3GF4A 1M76A 3GPIA 2OOSA 1GCOA 3ASVA 2NWQA 3WJ7A 1ZK3A 1B26A 2NUAA 1ZSVA 4PLHA 5F1PA 1A27A 5K9ZA 1ISJA 1P1FA 3NV9A 4BKUA 1VL0A 2FZEA 4PLPA 1NVTA 5B37A 4FQ8A 3Q9UA 3MZ0A 1E3WA 3KYCA 3OIGA 3RIHA 1UDCA 2V6FA 2QHXA 3U49A 3DHEA 5LDGA 1M2WA 2HMVA 5L9AA 2PD3A 3ZZNA 2VRCD 1E6WA 4MIYA 5EMHA 3ZWYA 2ZYGA 1YL5A 4J49A 4XEHA 1EMDA 1L1FA 2NU9A 2X1HA 2O4CA 1B0AA 1XWFA 2WE7A 1DXYA 1YBMA 4RPGA 1DLIA 1NASA 4TRRA 4M55A 3LSYA 2G17A 1B3BA 4WLUA 4XGKA 4BO5A 3RASA 1WXDA 5TRTA 3GAFA 2DFDA 3DR3A 1IOLA 2PV7A 4FB5A 2EF1A 2QYTA 3F5QA 3V8BA 2DTEA 2I76A 5TX7A 2WMDA 1MV8A 1Y81A 2Y67A 3DZHA 1OOEA 2B5VA 3ONFA 5G0VA 3RVDA 2JHFA 1P0FA 1O0SA 3GHYA 2EXXA 5ILOA 4R1TA 4R4JA 4YJHA 4NFSA 2CVQA 3HG7A 3ZWWA 4RV9A 1UUFA 4ESOA 5BSEA 4ZN6A 1NVMB 4FIZA 4RPLA 2Q46A 2VZ8A 3WIDA 1MB4A 1F06A 5IJZA 4BNIA 4HFMA 4DLAA 2P2SA 4HFRA 4ZU3A 2FRDA 3GVXA 4ALLA 5JC8A 5L53A 1ZK4A 4TRMA 2FR0A 1RKXA 1IHXA 2Q2WA 4PVDA 3I83A 1AE1A 3OA2A 3LLSA 4ND1A 3RFXA 2G82A 4XX0A 3GAZA 2J5RA 2D4AA 5COQA 1BXZA 1RJWA 4ALNA 1PS8A 1Z73A 1EUDA 1PJCA 1PZHA 3EZLA 3FNFA 4CLOB 3DAPA 5JCXA 2Q2QA 4WOKA 4H7PA 4KUEA 3V5NA 5C3MA 3AU9A 2VWHA 3BMCB 4KQWA 4J0FA 3LF2A 5B1YA 3LT4A 1Q7CA 1KOLA 1I0ZA 4DBZA 1VJ0A 1UP4A 1QSGA 4BNUA 2Q1SA 3SC6A 5KKCA 2GO1A 3HDJA 3GNSA 3KSDO 4E6PA 5CEJA 3ZWVA 2EG9A 3FBGA 1LRKA 3A14A 4KWIA 1PL7A 1XQ6A 3BHIA 3OEYA 2Y1CA 2VCYA 3I9OA 3LT1A 4A26A 1FMCA 1SEVA 1DSSG 3B1FA 3Q6IA 3PZBA 1UDBA 2HK7A 3WQRA 2AQHA 1N5DA 3D3WB 5IDWA 2Q50A 4YTEA 2CZCA 4EI2A 4MVJG 1SPXA 2NTVA 4RLHA 1NPYA 3H9EO 3BMOB 5IF3A 3PQFA 4ALIA 4N5LA 2HO5A 1Y1PA 5KTKA 3VZQA 2Q4EA 4HADA 3JQFC 2JHGA 2CDCA 1TLTA 5ER9A 5AXBA 1LQTA 4URFA 4E5YA 5A3JA 3L9WA 4XKJA 1K3TA 3QWAA 5KKAA 1EVIA 1GV1A 4FOSA 3OSUA 4LMPA 4D7AA 2JFHA 1Q7GA 3U5TA 3JD2A 1I10A 1L7DA 3WR5A 4U0JA 4NU5A 1NHWA 5ITWA 4MVJE 1UP6A 3C1OA 2HCTA 2WEKA 5JO0A 4FD3A 3EAGA 4D3SA 5IXSA 3H2ZA 3N58A 2C59A 5ILGA 4E2ZA 4OKNA 3E03A 2POQX 3CPSA 3RBVA 1I8TA 4CLHA 4M49A 1V6AA 1VKOA 4NK4A 1P74A 4IIUA 3ETEA 5L40A 5ER6A 1GU7A 1MX3A 5L3ZA 4R51A 1M67A 1JKFA 4IBOA 4RVGA 1CERA 4W7HA 4N5MA 4R54A 1BXGA 3I5MA 5FEUA 2O3RA 1ZXBA 3V2HA 4BGEA 1JKIA 2X23A 2FPIA 3AI1A 1TEHA 5TT0A 1YB1A 3FSRA 4E5NA 3GDGA 3VPSA 1ADGA 4HNGA 2D2IA 3HN7A 4KP7A 5IFLA 1V35A 1NAHA 4YR9A 1AHIA 3H3JA 4GGPA 1XYGA 2W8ZA 3WGGA 3F1LA 2P91A 4R5HA 4WNCA 3VKVA 2OFPA 4W7IA 3KSZO 1K0UA 4DA9A 5DBFA 3KV3O 4DC1A 2HKIA 2UUOA 1Y5MA 3LT2A 3VPXA 1O8CA 5A9TA 4E31A 2NVWA 4GWKA 1MC4A 3PIDA 3TF5A 2ZATA 4R01A 4B8WA 3EMKA 5EQDA 1HDXA 4GPD1 4RF4A 4J7CA 5BQFA 4LCJA 2DQ4A 2O3UA 4N54A 2J5QA 3LZ6A 3U62A 2B4QA 1PQUA 1EVYA 3NT4A 4CM7A 4IQ0A 4YT2A 1LXCA 1B8VA 5I9LA 4HKTA 3PWKA 2W2LD 1OC2A 4IMRA 2DM6A 1LDMA 3UUWA 3ZCXA 3ZHYA 4BNJA 5T57A 2VTDA 1JVSA 2D59A 1O89A 2GUGA 2WYVA 3VZSA 4JP3A 3O26A 5JE8A 3I4CA 5COBA 2Y1FA 2VYVD 4QO8A 4YAKA 3FWNA 3ZV3A 4NJMB 1KC1A 4R1UA 4TQGA 4IMPA 2RH8A 4PZEA 2EP5A 4Y8VA 3PJEA 3GPDG 5G4LA 3UN1A 5IDQA 3BYZA 4MO2A 3TOXA 2YUTA 4HY3A 1SZJG 4R68A 3ADOA 1RWBA 4CUKA 3AU8A 1X15A 2ZTLA 1P1RA 3NAQA 4A2CA 1HLPA 3PK0A 1GQQA 5EL0A 3HFGA 3GDOA 3MCVA 4AJOA 3GZ4A 3KSUA 2Q1WA 3GFBA 1B14A 4J2OA 4CV2A 5JC1A 3NDRA 3JSAA 3S55A 4YXFA 3BTOA 3GVHA 4FSHA 1VSUA 5DF1A 4RZIA 4Z6KA 2HUNA 4BO0A 1MA0A 4JK3A 4WCFB 4BNNA 4HP8A 3GMSA 3RC9A 4CLEA 4BO1A 1YWGO 1J6UA 5GZ6A 3VVCA 2ZB7A 4KDFA 2QW8A 1RYEA 1ZO8A 1JWAB 3GK3A 2JD1A 5L51A 4GSKA 4Y98A 4YJFA 1HDYA 3C8MA 4MDHA 2PR2A 4YAJA 1PZGA 3GGOA 2D1YA 1EBUA 1WLYA 3GH3A 3T7CA 4AL4A 1G6KA 5T6BA 2B37A 1QYXA 3CKYA 3DMTC 2ZQZA 2OBNA 1GYPA 4Q9NA 5G4KA 4TRNA 4DBVO 5BSFA 4Q3DA 3IAHA 1ENYA 3G3EA 4CV1A 3ULKA 1Y8QB 2YFHA 1YONA 1ENZA 2TMGA 4P22A 4XIJA 2DAPA 3DZJA 3P5SA 4UUOA 3MOIA 3ZV5A 4DC0A 3FPCA 1T1SA 2VYNA 3H6KA 4DLLA 3V1TC 2Y0DA 3NT5A 5DZSA 4JLWA 3TL2A 4Q3NA 2H9IA 3S1LA 1GUYA 4CODB 4FS3A 3TOZA 4PCVA 1N1EA 3G0OA 4J43A 5KJEA 1KIFA 3QWHA 3DWFA 4UVIA 1N9GB 1Z7EA 4NBWA 4R9SA 3HADA 3K9QO 5GZ3A 2HMTA 4CMKA 2NVUB 3WB9A 4Z9FA 5T64A 4AICA 2AQIA 3ANMA 3WFIA 2Q1TA 4CM4B 2Q4BA 3C7CB 1NM5A 2Y1EA 1PL8A 3F4BA 3WGQA 1DLJA 2JD2A 1Y7TA 4L75A 3WLEA 1R4MB 1Y9AA 4NFYA 1C0KA 1KEVA 1QG6A 2W4QA 3GQVA 3ZU5A 2BRUA 4LGVA 1Y9EA 2CVOA 1LX6A 5TF4A 3AM3A 2GASA 2NU8A 1I2ZA 2EEZA 3JYOA 5EESA 2WWRA 2ZIZA 2V6BA 1EE2A 1T24A 1UAYA 1PL6A 1E1LA 1NWCA 4U6QA 1GPDG 4WLVA 5JY1A 3K2EA 4Z0TA 3GVIA 1N1GA 5C37A 4CMEC 4K26A 3NT2A 1I2CA 2FOIA 1PWXA 4K6FA 4Y6RA 3D4PA 2ZKLA 3RJ5A 3L9XA 3LF1A 4KOAA 2PD6A 1MP0A 2GRAA 4CMGA 3WJAA 4W6ZA 5A4DA 4J4TA 1NXQA 5DT9A 2EKQA 3ASUA 1DFHA 2DLDA 4ZVVA 1ZJYA 1MG0A 5LCXA 1KVUA 1B7GO 2WD7B 4TROA 5GZ1A 3PGXA 1NFQA 1XG5A 1V3UA 2DPGA 3BMNA 1PGQA 3C1AA 5JPIA 3RKUA 1NP3A 1PX0A 4J91A 4FFOA 2RCYA 2WYWA 4ILKA 1GUFA 5GMOA
chains in the Genus database with same CATH superfamily
3I1IA 1Y4AE 2P9YA 3CIOA 2R2AA 5BW6B 3CPHA 2C1ZA 2VAPA 2HK9A 1ORTA 4JQYA 2XD4A 3UC5A 3GJYA 4KJZA 1SVIA 5JJCA 4G89A 5D7NA 4A15A 3JQAD 4I1VA 3T1OA 4C43A 1L5GB 4ZXPA 3RUDA 3LV8A 4KHPB 4U5QA 4JP2A 4XUEA 5J59A 3SZMA 3JD3A 1XMIA 2PXHA 2ILTA 1T8WA 4RKQA 1T8PA 3MVEA 7ABPA 2RH4A 3OICA 3IQFA 3MLBA 2ZJ7A 2CCJA 5AHXA 2BMVA 1WCXA 1VRVA 2GCNA 2FGJA 1TM1E 3EXG2 2HGSA 3WE7A 3PXGA 4ALMA 3LRTA 3QQPA 4ARUA 4ZFNA 1U0HC 1LI4A 1ZWKA 2BZGA 2M2IA 3AM4A 3OJEA 4GQBA 4IJMA 5ECYA 3UMYA 4CL2A 3BA1A 1FC0A 4C05A 4YHHB 3IAM1 3RSQA 4QO7A 4E1BA 2PWZA 4K3VA 2VRCA 2FW6A 1N6NA 1WJGA 1PGJA 3GUZA 3TFOA 3WDLA 2QRVB 3INGA 3K9BA 2Q3CA 2GZDA 4NP6A 2CJWA 5FFMA 4HNQA 4BV3A 3AONB 3F6PA 3DDNA 1CLUA 4KR0A 5FBWB 1NMZA 4K6HA 1UBUS 1N0UA 5DFAA 1FTGA 3O2NA 5K6RA 2QTHA 1N3IA 1FOEB 5EIOA 4D9FA 2QE7A 4Y2SA 1BMQA 2E6UX 5HQ3A 3TZBA 3U3OA 1JJVA 1Z4NA 4L4RA 3KEGA 3K5IA 4FSXA 4LQCA 3EXIA 4YJGB 2VS1A 4GSYA 2HI0A 5CURA 3HJUA 4G0VA 3CFYA 3A9SA 4CIWA 1ODTC 3CEMA 2BEKA 4K86A 3AP2A 4UMFA 3VR5A 2HV9A 3NHFA 1ESCA 1MOQA 2MOKA 2I66A 4JBNA 4YJKA 4B9AA 2H16A 2QY9A 3LZCA 2CF6A 3Q3HA 4S3MA 4WXHA 1WNTA 1KA9H 2WUDA 5F5NA 4N5HX 1I7NA 4HLUC 1T0JB 1JHYA 3TB4A 2ZYVX 3PGJA 4TS4A 1V16A 2Z1MA 1BDMA 4J8PA 5SZHB 5K01A 3GEGA 3AUFA 4OYYA 5KWVA 2A9JA 1DV1A 4LW8A 1G2QA 3S5UA 5BSGA 5D5PA 1RCTE 3I8OA 5CAEB 4ZJYA 3VOAA 4OHKA 3EBLA 3ROGA 3TW4A 3N05A 1SK9A 3A4VA 1M2HA 2X76A 3MF4A 5AJYA 5LXTB 1QC5B 1RXCA 2QLFA 3PRKE 3ZLUA 1KI4A 4QBFA 5EMLA 3UPDA 4H1WA 1IJBA 4X97A 3DZBA 5CTAA 1JVNA 1PBNA 1FP2A 3FYUB 4Y1EA 4D45A 2PZAA 3KQVA 2VVTA 9LDBA 3LWZA 1Z4PX 2NSLA 2ZR7A 3KD3A 5T67A 3IKVA 1DOAA 3HN6A 5GTDA 3D6MA 4M0EA 3K0CC 1N2CB 3DZ8A 2CV0A 3T5MA 2I9PA 2BFDB 3WK8A 4KVFA 5BSHA 4PZLA 2GEKA 3BSFA 4QSMA 3TJRA 1REQB 4YGXB 2H5IA 4M7OA 3KPYA 3OUZA 5C1BA 3TXAA 1ODFA 1XLVA 1I1HA 4G4GA 4H3HB 2BKVA 3LKZA 1MIOA 5AM2A 3IEMA 1R66A 2XNKA 1XZPA 4KQGA 3LQ2A 3DDCA 1YTLA 3RHSA 2I4RA 4B8ZA 1EFRA 4RF3A 1PJ3A 1TVEA 2Y68A 1VCHA 1NAIA 2ZWIA 3FPAA 3K0CA 3L6OO 1ODSA 1KJJA 4NPHA 3B6KA 4DIEA 2ZS7A 4MV3A 3KWMA 1P80A 4TZ6A 5F5XA 4H27A 3H0KA 1M1UA 1UOQA 4LGCA 3KXKA 4ZO7A 1WXQA 5U9CA 3NBKA 4CKWB 5IXJA 2E85A 4KACA 4P8RA 1L4FA 4S12A 3ROTA 3FGNA 1XCBA 4B45A 3B13B 4EYOA 3ISTA 1SD5A 1QGZA 4MARA 4MDFA 1WW3A 3NATA 2FSSA 4AJ2A 4TXLA 3WLQA 3VO2A 4EA6A 2OKCA 2C1XA 4QNMA 4JSTA 3BHNA 1HT2E 1QDUA 2CC2A 2IVZA 2R3SA 1W73A 3BK7A 1JDSA 4G81A 3T5DA 3M0EA 4QGSA 3D6JA 2J9FA 3A2MA 3GLQA 3OT5A 1KEKA 1IM8A 2C57A 2JZCA 1VQ1A 1KI3A 4C14A 1Q11A 4J3FA 3ZWMA 1OHHD 1OXUA 1KAHA 3IHLA 3LI2A 4EW3A 1H6BA 2RGNC 5LFAA 2ZJOA 3PA6A 1TZBA 3GG2A 4KKXB 3F7MA 4ZVPA 3HHPA 4TL6A 3O91A 3HJBA 2ZYRA 3FH0A 4O2AA 2Q9BA 4Q93A 3HR8A 4TMYA 5AJUA 1ZIPA 3EGEA 1NBOA 3PNKA 3G0GA 4M7RA 3WWEA 1CUJA 4IAOA 4A5SA 3VH2A 1IE3A 4GU5A 5HWSA 1SXHA 1KH2A 1QIHA 2J3IA 2FMHA 4G0MA 3WIBA 1YDEA 1KAQA 3DCJA 3K32A 3N75A 4UU8A 3W77A 4WKNA 2ZYDA 4IH1A 3KL4A 1XQ9A 2ZUSA 1RI2A 3R7AA 5BNZA 3I62A 5JAQA 1RPNA 4GMFA 4B81A 2I4LA 4D4IA 3IDAA 4ND5A 3ZNOA 4Y2TA 5T4FA 2ID9A 4FE7A 5JDCA 1Y34E 2A9FA 1U80A 3FHLA 4QVKA 1TTPB 4YWJA 4AJJA 4OGWA 4BZQA 1ZQ1A 1SOUA 1SUCA 2H17A 3FDFA 1TUBB 4FCVA 4YRGA 1VLJA 2B83A 2DBVO 4L08A 4YO7A 3LP6A 1OX4A 3TZCA 4F4DA 4IDPA 3TVYA 2CXQA 3FD8A 1HYHA 2WAMA 1ISHA 3VO1A 3PF8A 1QH8A 2C5FA 5DMXA 1HETA 4J7XA 1NBHA 1YXMA 3FX2A 1Y48E 3CN7A 1ZKMA 3U1TA 1E2KA 3SYLA 1T25A 2I2FA 1XALA 1LPMA 1E1QA 4G0ZA 1YAJA 5ALXA 1IHYA 1QZ3A 3GLIA 2RBEA 3PXCX 5IBCA 1R4MA 2Q6OA 3ON5A 4Q39A 2P6PA 1UWLA 5BWCA 3R0XA 3CNQS 3PWSA 3R5JA 2R7KA 4WNAB 2H4XA 3FR8A 5TNXA 4ZJUA 5KREA 1N6OA 2ODEA 5AJXA 4GYJA 3PLNA 1QVWA 4IWNA 4DSZA 1C50A 4NMXB 4MQUA 4YMUA 1H85A 3OJOA 5DBOA 3V6MA 3BM5A 1UKBA 4WPGA 1PQYA 5EA2A 1QR6A 2FRDC 4KMMA 4GOXA 2N0SA 1YHZA 4D42A 4LGMA 4W6QA 1J1IA 5CYOA 1X7YB 3UY4A 5DI3A 3OMXA 4BO4A 4D81A 5K8IA 4JI0B 5EP3A 2BTOA 4C01A 2CLHB 2W0SA 4L5YA 3GEBA 5KOIA 1IAQA 3FFWA 4ZANA 3NETA 4EX6A 1KKLA 4RQTA 4HCJA 1UBSB 4BFWA 4W1QA 2YV1A 2J3MA 5J5CA 1N5JA 2B20A 4H7KA 1OBFO 4WUVA 3RS5A 5KDDA 4LF4B 4HTFA 4CM8A 5JNVA 3COJA 1D4AA 4K9SA 2AG1A 1ZH8A 1J24A 2W2LA 3DBHB 2XPCA 4J3NA 5IYZA 2JJYA 4E21A 2ZROA 3FDZB 3FXAA 4YXWA 2I7CA 5DP2A 2AW5A 2OCKA 2W58A 3F5MA 1WG8A 3ENQA 1FYFA 4KO8A 4LJSA 1CQZA 1UANA 3AVQA 3P2JA 4P3YA 1XV5A 3R5TA 5JCJD 5G3ZA 4IRMA 1MMFB 4AY2A 3LCMA 1YNSA 3BB4A 2XGMA 3RUEA 3URMA 3WS7A 4XASA 3VKUA 1AG9A 4R7TA 3IRVA 5JFGA 4W9RA 2D7JA 1RHRA 4MVJM 2CVZA 1Y6JA 7REQA 3WMXA 5LBUA 2Z3ZA 4EYGA 4DLUA 3WK4A 4NDAA 4Q6BA 3WIUA 4EKNB 1LEHA 4JL6A 3PXEA 3ZVLA 1SIOA 5BVHB 2FZWA 2XCSB 2VXBA 1U31A 4O4JA 3LDAA 3UW1A 4LVUA 4RW0A 2HIMA 1WD7A 4HDSA 3WMGA 2WM8A 1JLRA 4IICA 1R6DA 3PYLA 1GFIA 1P2UA 2PD4A 2O3JA 4H16A 1UJCA 4F45A 4WLNA 4RWEA 4ZCMA 5B30A 5FX2A 1U7OA 2YINC 4YMGA 1VBKA 1TF5A 2HXSA 1KF0A 4GOOD 3WXBA 1NTOA 3L6DA 1IONA 3K6RA 4AG3A 3JQ8A 1RRGA 1RLIA 1MUUA 4W5WA 2JGLA 1MEJA 1PWHA 4IH9A 4UVDA 3K30A 1V26A 3IR5A 2X7HA 2A0WA 1T9DA 5KSWB 2XMBA 4FOTA 1XTBA 1RWOA 1F12A 2I4NA 4NF2A 1OC4A 2J4FA 4KAXA 5B1EA 1TC1A 4UUPA 3VH3A 5JXWA 4HFNA 1DC6A 1MEOA 1V11A 2JI8A 3IBSA 2Q7DA 5BN3B 2RH9B 2ENUA 2F6RA 2X8BA 3DTYA 1SQSA 3AR3A 3MM4A 4HEA1 5BNFA 1SXQA 2XLCA 1EE1A 2OR3A 3CZ5A 4P33A 2ZIVB 2QIOA 3LCJA 3H16A 2EFYA 3WK9A 5JI3E 2PX5A 1OU4A 4LE1A 1K6MA 1US8A 4PAMA 4Q15A 2OPHA 2HRCA 4WXPA 2QTZA 3WDKA 4P5DA 4Z4IA 3HZHA 4BPRA 4DQVA 5JRJA 3C3XA 3PQ3A 1MT0A 3Q87B 1AX9A 4ZT2A 3WGYA 2IELA 2OXIA 1UKVY 2H85A 1EVQA 3DOJA 4V1CI 4I1UA 5FBHA 1FMLA 3OTOB 3C45A 3PUIA 3QPBA 3JD0A 4GICA 3T3PB 3MJEA 3R9IA 4ZO9A 1T9GS 3L84A 3UCFA 4C4SA 2R68A 3LC0A 4JMLA 3RYIA 2B1IA 3BJEA 3C4QA 4XGIA 2G5PA 1DO8A 3GUHA 3T9EA 5HS6A 2OV6A 3SZOA 1ZNYA 5AXDA 3U44B 3NONA 1KVRA 3NU1A 1KTVA 3ZTTA 5IKXA 4U2FA 3ZDAA 1MVLA 3EARA 5DEIA 4XA8A 4Q05A 5LZ4A 5E6SA 1R0KA 1KI8A 4MIOA 4TMKA 5I7SA 5FOVA 1EGHA 2AJ8A 3KJHA 4AVYA 3UNXA 2ZWPA 4PZCA 2PGXA 1M1NA 1TF7A 2H1HA 2ZJ3A 3EQZA 1E61A 4I5FA 4MNTA 2XUQA 1P2SA 1CNFA 4YBZA 5LWHA 4O2BB 4N0QA 1I2DA 1N3YA 1UP7A 2EIHA 3HCWA 4YBRA 3DYBA 1EG2A 1DRKA 1MXHA 3GRFA 4KNVA 1XZNA 2XZPA 3M5CA 3N2GA 1SBCA 4HZUA 1J9EA 1F51E 1L4UA 2A59A 2YYZA 3LBAA 3NWBA 4UMDA 4DADA 4DJ5X 3KXLA 5CHEA 5DHPA 3P9CA 3AO0B 2P0YA 4E4YA 5CFLA 2B2NA 3DKRA 1XNJA 4WLEA 2AKEA 4ZCSA 1H2EA 2QA5A 3EGXB 3B6EA 1U9JA 2JGKA 4WLOA 4YRJA 3ROMA 2ZT7A 5JYEA 1SXPA 5E8JA 1OXTA 3MYRA 4IV5A 1EGQA 3A32A 1T2EA 1KAOA 3T52A 1LQUA 1HA3A 2WSIA 1XDUA 2JGDA 2RGGA 3ITKA 5AW4A 1N2HA 1EX1A 2J0UB 1BS1A 2GYUA 1AXGA 4ZREA 2HDHA 4GL4A 1LPOA 4K6GA 3UATA 2JI4A 2IUUA 1SO8A 3GZTB 1GN9A 1Z8HA 2AMYA 2PN1A 2R00A 4FXOA 1W47A 4LGYA 4XVHA 2CHGA 2ZU6A 4YRZA 5BWLA 4NDNE 5K2OA 4N41A 2OUIA 3E2MA 3CLSC 3U7EB 3ZWPA 4IEIA 4YCLA 3ZCUA 2OP1A 2EDAA 3CRW1 3IJPA 5IN4A 2CV1A 4ZOLB 4YO8A 2IUFA 1DRWA 1KO4A 1V43A 1UBKS 1VE6A 3LHDA 4IP0A 4DABA 4LRWA 5LD2B 4S1VA 2O19A 4UREA 2F62A 2X0EA 2Y2UA 2GN2A 1NA5A 4ZQFA 6NULA 1E63A 2FPKA 2W90A 3Q3CA 1HT1E 3GBVA 3HB0A 4K6MA 4UU0A 5DTIA 1U9IC 2FLVA 4OK3A 5JFTA 4YI5A 5FH9A 1FSGA 1RHQA 4N8SA 3HDGA 4PRKA 1CJVC 2OTCA 3ZN2A 2P79A 1BZYA 5HTOA 4HAOA 4HB4A 1D6NA 2BJHA 3MTEA 1ID1A 5LQUA 1G9TA 1Z4OA 3OOHA 4IHJB 1MNQA 1WDLA 2YY5A 4NZ9A 2WAOA 1M75A 4TKUB 1USIA 3WGLA 5HZGA 2IXBA 2M9MA 4ZD6A 3QEOA 3RSSA 1PVVA 1Y9ZA 1FSSA 2X4DA 3TLYA 4AG6A 2I55A 2C7GA 3CX7A 3I34X 2BVNA 3X43A 4O2LA 2I4TA 3A1CA 4O59O 4TXHA 3UJNA 3E0QA 2B4KA 3LA6A 4FMPA 1OXMA 3IA2A 5IWAB 3BD7A 4QTXA 1JPVA 1E1MA 2QD5A 3JQAA 4I5DA 3TKLA 4C4RA 4G9EA 4QREA 2O6HA 4AP5A 1QK4A 4X20A 4YQFA 5A06A 1AQUA 2PT9A 3N0WA 1EK2A 4EG0A 2AWNA 1JQ3A 3RTBA 1AD2A 1YB7A 1QP8A 1RWQA 4IWXA 3A11A 1QNFA 1AS2A 4F8JA 3TEMA 5CCEA 1F8YA 4ZMSA 1FU4A 1BGXT 3DKVA 1SD1A 3PHBE 3DB1A 3KLMX 1RXSA 1DPFA 5C2JB 4IOMA 5JQGF 1MGOA 2O3SA 1Y8RB 1Z3CA 3GRPA 4ROSA 4ZA2A 3L4JA 2FSGA 3BUSA 4WERA 2IS6A 2HEGA 2QRJA 1ZMTA 3HMKA 3R3WA 1X3LA 4XFKA 4BJ6A 1XLTA 2VH2A 4NJEA 1MJGA 5HF8A 4UMEA 3HK2A 1OA0A 4RKYA 5EHGA 3U9SA 5IULC 2PLNA 4AMZA 2G36A 2C7RA 5LM3A 2ZJYA 5G0UA 1GYRA 3EGIA 2P9QA 4BVFA 3WLSA 3KK0A 3N2NA 2EP7A 2YASA 3K0AB 2EERA 3GLGA 5B53A 5CW1A 1N6RA 1S01A 1HEUA 2VDMB 1PDWA 2Q4DA 2QW1A 1P7VA 5BQ3A 4KE7A 4OHPA 3PIRA 1DI0A 1EBBA 1VJ5A 2FY8A 3OIYA 1EQAA 2WWHA 1NQXA 5C8XA 2FDCA 4EECA 1XA3A 1DKLA 2NYAA 4MZDA 1GA1A 3IURA 4OYRA 1A2QA 1NI5A 5CLGA 5AWFC 1QFZA 1NATA 4HV4A 1VIMA 3W2FA 2G7MC 3ANYB 4HAYA 4Q1DA 2ZYSA 2D5LA 2PJDA 1V0JA 4WNYA 4DIUA 4E3ZA 1KIAA 3OF5A 1SVLA 4WNIA 3DTTA 2B61A 3GLVA 3NOOA 3FAZA 3IQGX 4D8VA 4HNHA 2W83A 4R41A 4X1IB 2Q8QA 1P1HA 3BWBA 5AVKA 3O95A 1P3DA 5BSRA 1EGMB 3RS3A 5BP7A 5AJVB 1UWCA 1CXZA 3G5MA 1FE8A 1GSOA 1JWBB 3HKDB 1VLQA 4G4SO 3UWOA 8ATCA 2H4ZA 1MF7A 3KBBA 4M1YA 1DQSA 4UBJA 1NM5C 1FEZA 3QA9A 1Z47A 221PA 2PZJA 1VP3A 2CVFA 1CEYA 4E46A 2FSIA 1BMDA 2FCRA 3I92A 1JIKA 3G0IA 1P7PA 2UVQA 1TK2A 5DTEA 4Z9BA 5KVCA 2WF8A 4RTOA 4NH0A 2DKOA 1NYLA 1RABA 1X7XB 3GJ0A 3GLKA 4US0R 4Y2JA 4PN7A 4ZAYA 2I2CA 3EEYA 3I37X 3ZTYA 2H1FA 3ZHUA 4BMCA 1DC7A 4I81A 1ZD4A 4UBLA 5UKDA 1WHTB 2FUKA 1LGYA 1B4DA 3UENA 1PJQA 1UK8A 2GA8A 2WKQA 2BP7B 3A6DA 3PTLA 1V8PA 2VT6A 3W7AA 1DEOA 4JLAA 1RM0A 3KXDA 4JELA 1X0XA 5IDVA 5E9WA 1XP8A 1ZU4A 1A98A 2BSAA 1L5ZA 2R85A 4KLCA 3SKVA 4D02A 3K6SA 1GZHB 1VSQA 1LNZA 2ZVQX 4HQLA 4JXKA 4N0PA 2VAWA 4EY5A 1BEUB 1WUTA 5J2UA 1Q0HA 3A28A 3KP1A 4RORA 1U3WA 5EE0A 1NP7A 2ZRHA 1TAUA 1WCIB 3CPEA 5HMMA 3ZCTA 2IWRA 1ZP6A 1Y8CA 1PAUA 5BMVF 1SUFA 4PYMA 1NVGA 3JALA 4KODA 4QGGA 2PRJA 2BEVA 2NU9B 1NFFA 4GI5A 8ABPA 2NTNA 4P7BA 3CUTA 5C53B 1XTTA 1XTJA 2BONA 2D74A 1LWNA 1E9SA 2JZNA 1M7GA 2NSYA 2WIBA 1J5PA 2A1UB 2XOKD 5BUZA 2Z30A 1J06A 3BQMB 1BE0A 3QE3A 3J81A 1O4WA 4YCJA 3VZPA 5IARA 5K3CA 3K9NA 4V2IA 3TH5A 1MJHA 3FBWA 3UUEA 1LLDA 2PRSA 3E82A 3A6JA 4J0EA 4V38A 1XPOA 1TA9A 1R12A 3D3JA 3T5TA 4DWVA 4UTNA 3D3EA 2CHEA 4KW7A 1DS6A 4LV6A 4ZP1A 4JYPA 2OGWA 3VNRA 5JHHB 4H7EA 3E4DA 3GRKA 2E4VA 3I9NA 4X61A 5EAIA 3TZHA 4C2BA 3VUFA 4AC9A 1SUEA 3KOMA 2P1ZA 3JYQA 3SS9X 4QHTA 5EJ6A 1F8FA 4B40A 4DV1B 3LUPA 1UBLS 5E38A 1IQPA 4O1IA 4NPAA 3KM0A 2P2YA 1CJUC 2DMRA 2IYFA 1U0SY 4G24A 2G1PA 1U1IA 3FCXA 1Q1NA 1U9ZA 1UDAA 1CUSA 2A9OA 3N0VA 2WSBA 3TQSA 2J3EA 1SXIA 2KWIA 4P3PA 5I6DA 2J7PD 1K6JA 2H4FA 4ZGBA 1GUAA 4Q7MB 1WMAA 3TFWA 4Y9RA 4D6PA 2BJWA 3QXGA 1NI4B 3OE5A 3ZHZA 3RADC 1JXAA 2ERXA 1ISIA 4FOOA 2GSWA 2UVPB 3A7DA 4V3BA 4EHNA 5BN4A 5K0FA 2ZRDA 5H68A 3OO0A 3G7UA 5HX7A 5IDXA 2QNBA 1EE9A 1XD9A 2QXYA 4HDRB 4DA7A 2GEBA 5F33A 1ECBA 2W6QA 3E53A 2FEPA 4X9XA 4CCAA 1K6XA 3AY7A 1EUDB 2QG4A 3EXHA 1JYEA 4M7WA 1OIXA 2XNDD 1SULA 3QVKA 3GA7A 4WGGA 4EJSB 1UPCA 2JCSA 5HJ2A 1E9CA 2QRKA 4BVLA 1QHIA 3UK6A 4H7HA 5E1DA 2XGJA 4RZXA 2PO7A 1J9ZA 1K8XB 1G9XA 2QP9X 4B6SA 4WVLA 4OLAA 4WH0A 2DLNA 3M6MD 2ZTHA 4DT1A 4D1YA 4X1YB 2O8BB 3MBIA 2VBCA 1XLUA 5SV2A 3O3CA 4E51A 5J4VA 5A7FA 3ESCA 4K5QA 3HXOA 2EJVA 5EYPA 1P81A 3DYVA 4KI0A 4EVQA 5IF9A 2VKQA 4MPRA 1JZSA 2NU7A 3HEAA 4QPZA 1OZHA 2QR3A 5EHIA 4HH4A 3ZD7A 1EIZA 1CUUA 5CB4F 3I1FA 2R7MA 5ECDA 1CY8A 4LSMA 2AGVA 1YCGA 1ZUIA 2VT3A 1GV0A 4OMCA 2XUJA 1AC5A 2DP4E 4QOEA 3T4UA 5JEEA 5LR6A 2WFAA 4A8TA 4YT4A 4DLXA 3AG6A 1BE1A 2AA3A 5L7YA 3RS2A 4QG3A 1KI6A 4RIEA 2OWDA 2BPOA 1UL1X 4Q82A 1BVUA 1TXGA 2QRZA 3AH8A 5J4YA 1KBZA 1SKMA 1OA1A 3CY6A 2CVPA 5EJ9A 1C8KA 1D7OA 2VNKA 2HO4A 2X6TA 4MITA 5H3CA 1GD1O 1TM5E 1X80A 4KWEA 4BCBA 3TOSA 2FW8A 3B1VA 1XVIA 2ZAOA 3B3QA 4CN8A 2Z5VA 3ESAA 3SZ3A 1F1BA 3IIJA 1L1EA 3TEFA 4EARA 5SZKB 4QTUB 2GJ9A 1XUOA 2D62A 2IEYA 2IOHA 2PMFA 2PYZA 3PFGA 3R1IA 4QASA 3V7NA 5GONF 5JJBA 1HNZB 2OHHA 3NVMB 3ITDA 2PTGA 3DT8A 2PL1A 1E7SA 1ZAYA 4PGFA 3AUXA 1XR3A 1BU8A 1DAOA 3G17A 1OGJA 5EVCA 2YFQA 3R6LA 4BNMA 4E1VA 4F3RA 5IUNC 1XD2A 3LXUX 3AB8A 2ST1A 3IT0A 2OO7A 3DV0B 4P5EA 1ODCA 1T5SA 2X19A 4PC2A 2ATVA 4CU2A 1T9ZA 5JY6A 3UMGA 3NM4A 7YASA 1JJFA 1S2IA 1W76A 2EX1A 2RONA 4Q4HB 5KOHB 3PHHA 1FNBA 1QH1A 2AG0A 4G36A 3OZUA 5JCJA 3SKXA 3ZCRA 4B7CA 2YMPA 4P4TA 1E2HA 4IOKA 2PUTA 4QFDA 2VF7A 1NX9A 1AA9A 2UZ0A 2XH8A 3IDZA 2YW9A 4Y1RB 1IVSA 3TAXA 4BRZA 3NUQA 2QUAA 3M70A 1APBA 4DNXA 1RXYA 3O8LA 3TGLA 2VH1A 4FJ2A 1R0YA 1SHZA 4WRRA 2BHTA 2CJPA 3C6BA 3IGFA 4RDXA 4B7XA 2IGTA 3DMFA 1F2UA 4AZWA 4GDMA 2PUFA 3BRQA 1TJ4A 1U6IA 2P6RA 5E2BA 3WGZA 2AS0A 1SY7A 4M8IA 2YQ5A 2JEYA 3QU4A 2Z0MA 3SG0A 5FNVF 4E5DA 1E8MA 3TAUA 2YZMA 4FEAA 2Y1LA 1A1SA 3PHJA 3AM1A 2BHLA 3ICPA 4DREA 3JZFA 4DSOA 4EY7A 3W5AA 4G4JA 5K45A 2V7UA 3KSBC 2IEDA 5LKRA 4EPYA 3DDSA 4L4SA 3IV9A 1HF3A 4FHEA 3PEUA 1LUAA 2R751 1MW9X 2V5AA 3EZGA 1CUIA 1YIOA 4N7BA 5FPSA 1WZCA 4LK3A 4XM0A 5KYTA 2HHHB 3KR2A 1NQWA 4ZVSA 3HXQA 4L3WA 5TARA 1KJ9A 3IP7A 2WB4A 1CE8A 3HDYA 1XQXA 1EDZA 3FWYA 3O9ZA 3PHCA 5EJ7A 5KQLA 5CDFE 3A2NA 4K9LA 3RD5A 4NE2A 4OB6A 5BN1A 1JI3A 1II9A 3F7NA 4O25A 3EIXA 3FM9A 4LJ4A 4XDYA 4D9JA 3ORFA 1NOJA 2OO3A 3VZRA 5JAMA 2YWCA 1W0KD 4MUYA 4OP2A 5JLAA 5JSYA 2KS6A 1MAWA 2QLNA 2O2CA 4EI8A 4XVUA 1VCIA 1FLDA 4IJQA 1IUOA 1GIAA 1WUHS 3B1ZA 1UWVA 1K3FA 3DXXA 3WL4A 1BVRA 2FH5B 3JPWA 3M3PA 2Y1KA 4GYWA 4JROA 4M89A 3LBFA 1N6PA 4OHXA 3G02A 1PV1A 5KI6A 3UJ6A 3QJ5A 2YN2A 3N2YA 3VGPA 3X2EA 5JNSA 3GU3A 1NW5A 2ZE6A 3O4GA 3TS1A 1YO6A 3V8NA 4D56A 1B8NA 4IH4A 3KUCA 1LDBA 2IYRA 2IZ7A 2VJNA 3MUEA 2GNPA 2X41A 4D99A 4Q1FA 2PUCA 3L43A 5ALHA 2OB2A 4MS1A 4LJAA 1O57A 2G72A 2Z57A 3IR6A 3HYLA 3OCJA 4IUDS 4PLTA 4D4GA 3P71T 3ONWA 3AOGA 4IHKA 4TS1A 2XV1A 4U2CA 1ORIA 3JYNA 3QYFA 2QGZA 3L7IA 1P2TA 3G1UA 1G3QA 3B51X 1OH6A 3FTNA 3AVOA 2V7XA 2QD2A 3H05A 4YPOA 4TV8F 1QU2A 4DLPA 1EP2B 1L5FA 2VC2B 2VZLA 4JR0A 4N7RA 5TGZA 3AVUA 1P9LA 2EFEB 4HDMB 4LI3X 1E2EA 2II6A 2W4IA 2NG1A 2WJAA 2XMSA 3H1AA 4PW0A 1UPXA 1W2GA 4PC7A 4Q1EA 1IY9A 3U7QB 5KU7A 5L3SA 3N5KA 4MKGA 3SD7A 2E82A 3AFGA 3EDMA 5LQSA 3ZGYA 2HCFA 5B36A 2AB0A 3V33A 1NDHA 1U0FA 3SOZA 4PVCA 1J21A 2R66A 3W5SA 3AKZA 4UE6A 4HATA 1K5PA 4ZMRA 1KL7A 2J6BA 3CLRC 4QFMA 1P17A 3VR6D 1VL5A 1KS9A 2O20A 1DUSA 2DT5A 5HW0A 3ROEA 4B3HA 2QM0A 5KMGA 1CVIA 2NVUA 1YTUA 1QK3A 4IDEA 1AO0A 4F96A 4NAUA 5DM2A 6LDHA 5H8WA 3EEIA 1CEXA 4ZRMA 3SEFA 4IQ8A 2ZJ4A 4DA0A 4F2WA 4R84A 2HHJA 1GUBA 2QVCA 4HOYA 1PNOA 2GAAA 5LC1A 4MRPA 3VDXA 2XEXA 4RUKA 2PU5A 3CKKA 3W8RA 4BFTA 4GH5A 4K05A 5KNCH 3MGBA 2BKLA 3LVFO 2VK1A 5I7RA 4G65A 4NDZA 1TZMA 4QU8A 4RXUA 1RIFA 2LUOA 5J43A 2H4HA 5JS6A 3V7UA 1PE0A 1C7ZA 3D2AA 1EUQA 4KLRA 3AF6A 1NF2A 1QF7A 5PNTA 2OLJA 2P2NA 3GMDA 3PDIB 3R5KA 1L7PA 1RCFA 3DAGA 4M60A 3KYDB 4DPLA 2BE9A 4GKAA 4OF4A 5AM4A 4CEIB 5MFPA 4B79A 3AL3A 2NUTA 1OLUB 3JCZA 4JDPA 4D9CA 5JYCA 3PFIA 4PR3A 3CRVA 3PC6A 2YJ6A 3T7AA 1O54A 1ODLA 2A4MA 2R4QA 3EDOA 4G5HA 4NR0A 4BNXA 5A1JA 4GLFA 2PS3A 3ZY6A 5LQAA 5M5BA 1XTUA 1H9AA 3B1XA 4YQZA 1WP9A 3PTAA 4PZ9A 4PEVA 5HG0A 1KJZA 4S0ZA 1WU7A 3PR1A 4IUBS 2DH5A 2ONJA 1RC1A 5B6PA 3F73A 2W42A 3UOAB 1HOXA 2BIFA 3C1UA 3FPHA 4ZCPA 5JADA 2VJYA 3LGSA 1C7JA 2B35A 3I3OA 4YRQA 2G1JA 4CV3A 3NEPX 3LY9A 2O3TA 3PFBA 4B3JA 1DPGA 2D8AA 2R6DA 3IPRA 4CTMA 1LDEA 1JIXA 5T7BA 1G8FA 1K9SA 4UNSA 2IYWA 2E9SA 1KYWA 3QIVA 2H07A 3ZIDA 4MVJI 4Q66C 1W35A 4FFRA 1SZCA 4TOIA 5FEMA 1U4OA 1Z08A 3QBVA 3OM8A 3LP8A 3MXOA 3ZWBA 1PFYA 3OPQA 2X6QA 4I5EA 3VYWA 4A27A 2HR1A 1Z74A 4QDZA 5IKEA 2ZZMA 4QYIB 1KK3A 4JAVC 4OA5A 5LNK6 3FMFA 3N87A 3PHGA 3GWZA 4J0IA 3MG9A 3H4TA 1R3UA 1F0NA 2VWPA 4IDQA 1F2TB 2HWXA 5JTTA 3LDHA 5KHAA 1WEKA 3AVVA 1XYVA 2ZB3A 2HSEA 3GBSA 4L4ZA 4LXGA 4X7RA 4OX9B 5JZMA 1HYBA 1OXBB 3TMKA 4BNZA 2I2XB 2OYSA 3O2JA 4WK0B 4MUHA 1MVOA 1N2JA 5EHNA 2F3UA 1A9TA 4AECA 1FRQA 1CR2A 3PE3A 721PA 3G5LA 3OX4A 3QYAA 4J4BA 2Q4OA 2B69A 1A04A 1NJ1A 3AT1A 1IOWA 1DXQA 1N0HA 4BQRA 2XR1A 3I9JA 1E96A 2IS1A 3JZAA 3V00A 4XQGA 1QV7A 5AVUA 3QJYA 2OA0A 1G9SA 2VJCA 3M4ZA 4KQKA 4FZ3A 3SM3A 2YNMD 4IILA 2QTAA 3THXA 1SURA 1T29A 3A1DA 5IBQA 1WMDA 1WOMA 2Q7OE 1TVKB 3PNOA 3LH5A 3NASA 3TPCA 4G5GA 2PWPA 4NE7A 4YJGA 3LYAA 2W2XA 4HMOA 4BNYA 5HUHA 1FNCA 1KJWA 2OCBA 3AESA 1QHXA 4JEUA 1AUOA 3I6IA 3ZDDA 7MHTA 2F9LA 2C5BA 1Y6QA 4H7DA 5JSQA 3HBAA 1SIUA 4WXMA 2YXLA 4HLQB 2H2HA 4JGBA 4ENVA 4B82A 1MC8A 4XE5A 3RKSA 5FPKA 1DG1G 1FVXA 1ZZGA 4LMBA 4LFBB 1V47A 3IVGA 4IIVA 2CFSA 3DAHA 5TDHA 4F86A 3LO8A 3GUYA 4IDDA 4AUKA 1FTQA 4EHFA 3ESXA 2D0OB 4KXUA 1GGNA 2WKRA 3K0KA 5JS1A 1R9JA 1OSNA 3VNVA 1RBYA 4TVBA 4QYXA 5ARCA 2HJSA 3WO0A 4UZSA 3P97A 2YMMA 1N2SA 4K40A 5EWLA 1ULHA 2V59A 2PQMA 3WOHA 1KZ1A 1EFKA 4OJYA 1WD5A 1VKZA 4DMLA 4WAUA 5I7FA 1QC5A 1WQ3A 4F3CA 2JDID 3VGJA 1TK9A 4RS3A 1GFZA 4YFYA 2G28A 1NXVA 1QB8A 2RG1A 4IGEA 4C7OB 1PFGA 3K9WA 3CMMA 1ULUA 2DPLA 3BAZA 4JXZA 1N3BA 3FYUA 2G9NA 3PFFA 3JQFA 5IH3A 1M2EA 5K6TA 1HR0B 4QRDA 4ZOEA 4CM9D 1YQGA 4DMFA 3I39X 5JRDS 1KYIA 4RO0A 2JHCA 3DZGA 1ZRMA 3J80A 1QGED 3KBOA 1W1IA 1XAGA 2EZ8A 4PR0A 4RF2A 4OU4A 1NUQA 2BELA 2Z08A 4TN5A 3VPHA 4MGIR 4HPWA 4ZARA 1E3DA 2RAUA 2OBLA 1PGNA 1TVMA 4J0GA 2TRSB 5BSUA 3LW7A 3PF9A 1XZFA 3E48A 1TGYA 3FWZA 3ZQKA 3JQBC 5EIAA 2P90A 3VNSA 5FR2A 1XCOA 4MWEA 5I4CA 1QIFA 1PR5A 3BD9A 3MPUA 3EVZA 3B8HA 4WKBA 1T3ZA 2PT5A 1BD3A 2JH8A 1SNYA 3MTGA 3DT6A 3K0EA 5AM1A 2L82A 1PF7E 2WJZB 4PPGA 2HFJA 3WL3A 4YRAA 3RC8A 4UVHA 3H2SA 3SK0A 1SC4A 2YYYA 3K1AB 4AJ4A 1EXMA 1QG2A 2XOKA 3W9BA 1R50A 2RI6A 1IWOA 5G40A 4CKWA 2ZYWX 4COKA 1E7RA 1HDZA 1PW5A 1Q16A 1ZL2A 4M1MA 3CUUA 5JS2A 4BMOB 1JEEA 1F20A 4MYSA 1RTTA 2FK8A 3ACBA 4BRUA 3SQXA 2WHPB 3U4DA 3JQBA 1ECPA 2JHAA 2XTAA 3AW9A 4DJEC 5AKXA 1NLUA 5K20A 3LT0A 4B2LA 5TPWB 5AVRA 4RPHA 3TTYA 2FXVA 3ONEA 2OORA 3HH8A 3MWDB 3NKLA 5HBRA 3RRFA 3UJ8A 5EXPA 3WIVA 1SHJA 2XHZA 4UD2A 4OYLA 2NXWA 2LCQA 2B98A 3WP0A 3GLFE 2H5JA 1TYCA 5EJIA 3WYCA 2A3NA 3PNYA 4LHSA 4GE3A 2PY6A 4ZEMA 4OMUA 1CVLA 4GKVA 4BRWA 3HKBB 3INRA 3TIFA 4NG5A 3IKMB 3L0PA 2RKBA 2X2PA 2ZJZA 4UCXA 2ZANA 5CG2A 2GJKA 4FKMA 2DTDA 3TL3A 4E09A 1C4KA 3QEMB 4G8BA 4KQ2A 1BIFA 3FZYA 2PZLA 2ZRAA 2RAPA 4NNPA 4Y6SA 2BKEA 4AO8A 1MT3A 2O5EA 3DWEX 5EXSA 3H5NA 3ZYCA 3PR3A 4DCVA 3U7JA 3EQ8A 1RFGE 4IIYA 4LCEA 5DO9A 3RK1A 5C1OA 3C7AA 1MX1A 3LQ4A 1T4BA 2B21A 3KQLA 3VTZA 3ZDCA 1Z4KA 3IIMA 1DC3A 3EK2A 3Q6NA 2QTTA 2TECE 5EGSA 2G4VA 3R0IA 4J90A 4UULA 5GJBA 4YRDA 4QUHA 2AK2A 3WKEA 3NYIA 3PNQA 4R1NA 2J9RA 4CR7A 2YUIA 2QPOA 2XNDA 3NDIA 3PVSA 4ND8B 5DK6A 1QU3A 2X58A 4QIHA 3R7NA 2NOAA 4EL0A 3MINB 1ADCA 3M6IA 4HH1A 1LPPA 2GZHA 3EVDA 3OP4A 3UICA 3H5OA 1KMCA 4EEXA 2FUCA 3WKBA 2AZDA 4ER7A 4DGQA 2HA7A 3KZVA 1W36B 3L07A 3IEVA 2I4MA 5TVKA 5EXEA 4YWHA 3RWBA 1USVA 3WAKA 2FOLA 2YXNA 3QFCA 2H6EA 4XQ9A 1Y7LA 4QOFA 2Q6LA 1A9OA 3DL7A 1QHYA 1HLDA 1U5AA 3IEXA 2IYNA 3ND9A 1TL7C 2E2WA 3C8HA 2PG3A 1H66A 4FMCB 1BX0A 4ITVA 3SQLA 2WFLB 1W88B 1E6LA 1JNXX 2AI2A 4W5RA 3CH7A 5C51B 4IVQA 4O8CA 4DR7B 3RVPA 3U7RA 1ZEJA 3W6PA 3RSHA 3BTVA 2I78A 3CZMA 5FWXB 1YB4A 5AUPB 2JFBA 1N36B 5CFPA 2ACKA 2ZE8A 4OXXA 1YOVA 4I36A 4N47A 2Z98A 4WNAA 4BBJA 4OEHA 1HORA 3EZYA 3NPAA 4EKIA 1K0FA 3Q0EA 4MKHA 4Y2RA 4RS4A 4U8GA 4U63A 3R23A 2QX8A 4X62B 4NCNA 1U90A 1XHLA 3MGGA 3O21A 4MCJA 4Y9DA 2KLBA 3TVDA 4OMDA 3IQHX 3AHEA 4B3DA 2BFNA 4FYVA 4G1UC 3RIXA 4Z9XA 4AN0A 3EYWA 3UF0A 1JDTA 1X7YA 1GT91 4V1CA 1G0OA 5FIUA 1U1EA 1LPSA 3KU4A 1U2ZA 2CBGA 2OVFA 3I1JA 2MIIA 3Q72A 4FUTA 4HDNB 4MWTA 5G0WA 1GNSA 1M5UA 3L8HA 3REQB 2ZSEA 5KHOC 1N77A 2NGRA 3OQ1A 4GOKA 3BE4A 1PFKA 1QYVA 4GOND 4Q1VA 5TPZD 4MWZA 3RYHB 3FIJA 1IZ0A 4FB4A 2GK4A 3UB2A 3VVBA 2V0GA 3H5WA 1G7SA 3RH0A 1UODA 1U9CA 1QONA 3FSGD 3IOBA 4EJMA 4A6XA 1M9NA 1NQVA 4KTTE 2JLSA 1JMKC 3GJ4A 3D6HA 3W5VA 4C89A 3DBHA 3SIWA 2DY1A 5AVQA 1KSHA 4HN4B 1GGKA 4QSHA 3FDZA 4DE5A 4QOSA 5ICEA 4BO2A 2ILVA 2WIJA 3FVRA 4BO8A 5IM4F 3P96A 5DCLA 3TQHA 4C5CA 4Z86A 3VTKA 4DWOA 3H2HA 3T7KA 5BT9A 4MW5A 4C0HA 4DVJA 2YW2A 3PRHA 2WUWE 3IEIA 1JAHA 4D4HA 3N2IA 1V8FA 4PSUA 1JF8A 2AFIA 2BLNA 3QU7A 1L7NA 4M37A