4OAQA

Crystal structure of the r-specific carbonyl reductase from candida parapsilosis atcc 7330
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
365
structure length
365
Chain Sequence
b'KAVPDKFQGFAVSDPKNWNRPKLASYERKQINPHDVVLKNEVCGLCYSDIHTLSAGWQPLQRDNLVVGHEIIGEVIAVGDEVTEFKVGDRVGIGAASSSCRSCQRCDSDNEQYCKQGAATYNSKDVRSNNYVTQGGYSSHSIADEKFVFAIPEDLPSSYGAPLMCAGITVFSPLIRNLGLDARGKNVGIIGIGGLGHLALQFANAMGANVTAFSRSSSKKEQAMKLGAHDFVATGEDKTWYKNYDDHFDFILNCASGIDGLNLSEYLSTLKVDKKFVSVGLPPSEDKFEVSPFTFLQQGASFGSSLLGSKTEVKEMLNLAAKHNVRPMIEEVPISEENCAKALDRCHAGDVRYRFVFTDFDKAFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R-specific carbonyl reductase
molecule tags Oxidoreductase
source organism Candida parapsilosis
publication title Insights into the stereoselectivity of R-specific Carbonyl Reductase from Candida parapsilosis ATCC 7330: Biochemical Characterization and Crystal structure studies
rcsb
total genus 121
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 1.1.1.195: Cinnamyl-alcohol dehydrogenase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4oaqA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4oaqA01
3KEQA 3A06A 3E9NA 1UUFA 4PZEA 2H6EA 3OJEA 1B15A 2OOSA 1Y8RB 2HK7A 1WPQA 5F21A 1BG6A 4EZBA 1E3JA 4YAGA 3E9MA 1YL5A 3KYCB 5F5NA 1V3TA 4MKZA 5DCWA 1M67A 2Q2WA 3L6EA 2X0IA 4Q9NA 4FOSA 3QWAA 4FFPA 4WOJA 4E3ZA 4ND1A 4LSWA 4U8GA 2ZB7A 3PYMA 5T8KA 4F6LA 5K9ZA 4WNIA 4BKRA 3IAHA 5C7OO 3UVEA 3I4CA 4CMEC 3AI3A 3WSVA 3E6AA 1ZBQA 2JCVA 2YV2A 1IHYA 1SCUA 3KRTA 5CFZA 4RPGA 2VHZA 1ONOA 4D44A 1SMKA 2HK9A 2P68A 3JQ9A 1SEPA 3DEYX 1SOVA 1ENZA 4IXTA 4S1VA 1AXEA 1JW9B 4YAIA 1Q1NA 1DC4A 1RM3A 1JQBA 1LSSA 1PSDA 4RQTA 3WQSB 2VRCA 2J5KA 2AW5A 5JDCA 2B37A 2B5VA 3UH1A 1EFLA 3FNEA 4M86A 1UAGA 1RJWA 4DL9A 1ZJYA 2F1KA 3DBVO 1QLHA 1F0YA 1LDBA 3UCXA 3P2YA 3ZV4A 3F4LA 3FN4A 1YQXA 3ZNPA 3DBRA 3GMDA 2BHLA 5JDIA 5IXSA 3GDFA 3IC5A 4QQRA 2IYPA 5CDUA 4G81A 1NFQA 4R41A 5FI3A 2P91A 4XX0A 1QR6A 3AUAA 1I8TA 4GSLA 4TRNA 4UVHA 5AXCA 4EUHA 3O8QB 1ULSA 4J90A 3OJFA 3JCZA 3WXBA 2EKPA 1PS9A 3QWFA 5F1KA 1J49A 3HB5X 3QP9A 3EDMA 4R1SA 3FBGA 3FBTA 4W82A 5HA5A 5T64A 3UW3A 4BB5A 5G2OA 2BF7A 3UF0A 2P9EA 1UXGA 4TVBA 1HE2A 3E48A 2YHUA 1ADCA 2WSBA 2Q49A 4U0KA 1JAXA 4BO2A 2CY0A 2CF6A 2PTGA 2VZ0A 4IGEA 1CJCA 3HQ4O 3WLEA 3OETA 1YWGO 2YZ7A 3PTZA 4O6VA 1GYPA 2UV8A 3DZJA 3TZKA 3I5MA 3PYXA 3TL3A 1HZJA 1ZK3A 1MFZA 3A9WA 3JQAB 3O9ZA 4L4RA 4IS2A 3OJOA 2ZJ1A 3AUTA 4IXWA 5CPFA 5FF9A 1I2ZA 4NQZA 4YT2A 4XR9A 2AEJA 4BO0A 3KYDA 2P9CA 3HADA 1B16A 4R01A 4XB1A 4YVFA 2X9NA 3DHEA 2FOIA 2AE1A 4PG8A 4BMVA 3NJ4A 4UUOA 1FDSA 1HSZA 4P38A 3UCEA 5I7EA 2FPIA 4QUKA 3NEPX 1R4NA 4KWIA 3QE3A 1HDXA 2A9FA 4CMBA 2NLOA 1Q0QA 4D79A 3I52A 1E6WA 3ORFA 3QA9A 4U5QA 1XDWA 2EKLA 4QO8A 4XJTA 4BNJA 2R2GA 4XGIA 3WQQA 1ZSYA 1K6XA 1GFSA 5JLAA 4WE3A 1VE9A 4EJMA 4BV8A 1GAEO 4PLTA 4IUYA 1XQ6A 4PZDA 3GUYA 3IMFA 4Z3DA 2VWPA 4YYZA 4TVOA 4AJ1A 1AE1A 1CF2O 3FD8A 3MTJA 4BO7A 5B4UA 2P5YA 4DQUA 2RCYA 4IGFA 1CERA 5H81A 1ISFA 5TRTA 1NR7A 4WCFA 1FXSA 3JQ9C 2ZJ0A 3C3XA 2ZB3A 3H2SA 4I5FA 3SX2A 4GMFA 4ZU3A 3DFUA 4UEOA 2BKAA 2IZ0A 1UP6A 1DLIA 4CQLA 1LRLA 4DQVA 5CDSA 5TIIA 5EQFA 4J0EA 1G6KA 1OBFO 3AK4A 3PJGA 4CV3A 2HMSA 3HHPA 1N7HA 2O3JA 5T5QA 3ZV6A 1T1SA 4B79A 2ET6A 2UVDA 4CPDA 2J6IA 2ZTVA 4DBVO 5A5FA 4DVJA 1OMOA 5KJEA 4H3VA 1CYDA 1IE3A 1E7MA 1NAIA 3NX4A 3RFVA 2VQ3A 1LDNA 3ZU3A 1V9LA 3T4XA 1NXQA 4HXYA 3VHRA 4ALIA 3H5AA 4GVXA 1E3IA 1ADBA 4PIVA 4OKNA 5KJ1A 4J6FA 4A10A 3NV9A 2YDXA 4YRAA 4MDHA 2RHCA 3D7LA 3R0IA 3HE3A 4M49A 5I9NA 1H93A 3QWIA 5EPOA 4Y9DA 5JC8A 3W6ZA 5JMWA 3U49A 1OZAA 1ZMTA 2O7SA 4YPOA 1N9GA 1TEHA 2RH8A 1LUAA 4ROSA 1JVBA 3QSGA 5KOIA 1VL6A 2EJVA 1BXGA 3BZUA 3IDSA 3EAGA 3EC7A 1LLQA 4R1UA 3ONDA 4Z9XA 3BTOA 3HFGA 1LU9A 1UDAA 2ZTMA 5ILOA 2Y1CA 3ROQA 3WGGA 4QFCA 4FR5A 4R5HA 3CZMA 2QRJA 1QYXA 4FCCA 1CQIA 2PY6A 5G0VA 3D3WA 4WCFC 3MWEB 1OC2A 1OC4A 1PR9A 1VKOA 3CSDA 4ALKA 3FPCA 3WS7A 3ZWWA 3S1LA 8ADHA 3F46A 4CMIB 5JPIA 4BNUA 2YDYA 1QLJA 3HN7A 4K6CA 2PKRA 3L4SO 3LC7O 1NASA 1B3RA 3T7EA 1K0UA 3S2GA 4YACA 1Q0HA 3I23A 3VOSA 1UP7A 3MJSA 5G4KB 2W2LD 3HSKA 3KO8A 3WSWA 4JIGA 1GUZA 1HF3A 1C0KA 3G49A 2OBYA 4KUGA 4LRSB 3JV7A 4PLCA 2WJPA 4ZA2A 4MVJP 2FPGA 4QX6A 4RVFA 4E5NA 3B1JA 3JQCA 4CQMD 3PHIA 3RKRA 1H6DA 4CMIA 4E21A 3ZDFA 2NVWA 5TT1A 4BO5A 3K5PA 4ALJA 1H6AA 4F3YA 5IDQA 1GQQA 5G0TA 4WCFB 4WLNA 1DXYA 4BS9A 1KVUA 4YJFB 5C37A 3AI1A 1T4DA 4L75A 1R37A 2C82A 1JAYA 3K96A 1A5ZA 2PZLA 1YE3A 4IS3A 1HT0A 2JFGA 3DOOA 5DP1A 3RUCA 2G1UA 2H1SA 1J4AA 3ICPA 1GEGA 3GPIA 1PJSA 1U7HA 4F45A 1I33A 1XU9A 4IPTA 3ASVA 4HNHA 2D4AA 2V6FA 4M8SA 1JTVA 4RF2A 5JO0A 1GTMA 2VUUA 4YRBA 4AJNA 2EG9A 3VZRA 3DOJA 2Y93A 2QX7A 2SCUA 3ONFA 2DTDA 1C0PA 1ZSVA 2BI8A 3CEAA 3GDGA 4IJVA 1C1XA 2ZQZA 3W4JA 3B6ZA 4NDNE 1E1MA 1E1LA 4MVJI 3S8MA 3GHHA 2O48X 4YTEA 5CAEA 2BFAA 1M2WA 3QVXA 2P5UA 1KVRA 2FN7A 4PRKA 5H82A 3WGYA 2ZYDA 3AY6A 3DQPA 1G0NA 3RU9A 1PJ4A 3OFSA 4GX5A 1MA0A 1MGOA 5MGBA 4OGWA 1GUYA 2JD0A 3QVSA 1EVIA 1NX6A 3EVTA 4LISA 5G4KA 1I36A 2PKQO 5KNLA 4NFYA 3U4DA 2IODA 3KZVA 1PS8A 3JQEA 2GZ1A 1N2SA 5DP2A 4AJJA 5G0UA 3GR6A 1RM0A 1E6UA 1N1EA 4B3IA 4BNHA 2O7QA 4ZQFA 4A27A 4DA9A 1E7RA 3NTRA 3FPLA 2PLAA 4E0BA 4BV9A 3FHLA 2GN6A 2VT2A 4IBOA 3UHAA 1XEAA 4DGSA 1FK8A 3RWBA 2O3TA 3WR5A 5L7YA 1JLLA 1DBVO 3F47A 1PWZA 5CEFA 1E1NA 3PHLA 1G1AA 2BI7A 1WZIA 4R4JA 2X8LA 3GEGA 2VTEA 5A9SB 3K30A 1T26A 1EQ2A 1EUZA 3GN1A 3TPCA 2DQ4A 3ZU5A 1HETA 3D64A 1IUKA 5TQVA 5CEJA 4UULA 1ZUD1 4FIZA 1HDYA 4WECA 3DTYA 3K31A 1X15A 5IZCC 3HDHA 3T4EA 4J2OA 2UUOA 1HE3A 5BNIA 4O63O 4A03A 1YKFA 1OFGA 2DVMA 5BSGA 1C3VA 3AM5A 4J7CA 2W2KB 4RZHA 5TX7A 4L8VA 2B69A 2NV6A 5TLSA 4TZTA 5BQFA 2XPCA 1QG6A 1LRKA 2I6TA 3UCFA 2X6TA 1VRWA 1D7OA 4LGVA 4N5NA 1X1TA 3VDQA 1Q2XA 4XYBA 5BR7A 4EEZA 3QVOA 4A2CA 4RORA 3L6DA 3QLJA 4RF4A 4BMNA 1JVSA 1SB9A 2LDBA 1GV1A 2I3AA 1A4IA 3RFXA 3I9NA 4B4VA 1R4MB 2EIHA 5FEUA 3OHSX 1HDOA 1YQDA 2YYYA 4U6SA 1DEHA 1CRWG 5COAA 1BW9B 4CLEA 4CM3A 5JC1A 3SJ7A 5B1YA 2HKIA 3DL2A 3OQ1A 1DC6A 2TMGA 3Q6IA 1O5IA 4MJLA 1GL3A 4OO3A 1YGYA 1NVGA 3LU1A 3C24A 1K6IA 2CUKA 4XDZA 4E2XA 1YQGA 2DTEA 4YJGB 3BMQB 2JHFA 4NZ9A 5A3VA 4IZHA 3WGTA 5L3ZA 1Z7BA 2GGSA 4B4WA 2O3QA 3H65A 3IJPA 4KMSA 2DPGA 1FDTA 1P77A 1PIWA 4IM7A 4NH4A 3ICCA 4O0LA 4WK6A 3HG7A 1HE4A 3OIDA 3RJ5A 5GZ6A 3C7DB 1ADFA 3DHYA 2VYNA 3L9WA 4I9NA 1PL6A 1GQYA 1GD1O 4J49A 1Y8RA 5JFOA 2GCGA 3I9JA 1PJQA 5T57A 2VTDA 3S55A 1EDZA 2BFMA 1NWHA 3LT4A 3RSHA 4WUVA 4PLVA 2Y1FA 3EUWA 1BVRA 1DB3A 1DDOA 2NTVA 3ZV3A 3NGLA 1LDEA 3SJUA 4XB2A 1A4UA 3IUSA 4PVDA 1WWKA 2G0TA 1U4SA 3ANLA 2FRDA 1K5HA 1MP0A 1XA0A 1E5LA 4OAQA 3VZPA 4EEXA 3KETA 1I32A 3GHYA 4L74A 4IIVA 4HX5A 2DBVO 4LMPA 4JJFA 4XGKA 4Y8VA 2B5WA 3GFGA 3KBOA 2B36A 4FS3A 1MFPA 5A5EA 1VSUA 1J0XO 1LJ8A 4J9UE 4I9UA 3TDKA 1FDUA 1T24A 4YJDA 1YJ8A 3IOYA 1NVMB 3KUXA 4JJIA 4ONEA 3U09A 2CVZA 5DOZA 1MB4A 3TWOA 1UH5A 2WD7A 4QXMA 1UZLA 3PHGA 1C1DB 5JBIA 4XQCA 5JSFA 1P0FA 3PK0A 2HAEA 5JE8A 4RVGA 1BSVA 2Y1GA 1U9JA 3OQBA 4PRLA 1X1EA 3L77A 5AQ1A 3H9UA 1HDZA 3X2EA 1ZO8A 4GGOA 1X7DA 3HFSA 3H2ZA 2ZKLA 3ON5A 4J1NA 4XCVA 1PU2A 1FMCA 1S6YA 4DYVA 2D2IA 1DO8A 3W8FA 1I2CA 3D3EA 2DPHA 2I76A 1HEUA 3ZWVA 3B1KA 4DMLA 4CR6A 1FDWA 1UXIA 1A9ZA 3NTQA 4WCDA 1NQTA 1R16A 1ENPA 2QZZA 3BMQA 3GH3A 4ZQGA 1O89A 2G17A 1BTOA 3HZZA 1UDCA 1KEUA 2ZATA 4GGPA 1YBAA 3S2IA 4JCOA 4YBZA 5A9RA 2PFGA 4W9NC 1E3LA 2CD9A 1I01A 4DRYA 5IXYA 4KZPA 1PZEA 1X7HA 4IZIA 3MTGA 2Q50A 4AJ2A 5JCJA 1GPDG 4HUJA 1PJBA 1ZXLA 1J5PA 5KTKA 1N7GA 3AOEA 2NVUA 3KSZO 3OSUA 5L4SA 5JYEA 1PGQA 2Q45A 3H9QA 1HYHA 5EESA 3MJVA 4AFNA 1DRUA 1IOLA 3OP4A 4MO2A 4FQ8A 3DZBA 1BRMA 2C5AA 3E5RA 4TMFA 1YBVA 2EF1A 3VVCA 4EW6A 3LDHA 3DBLA 4J4TA 5I9LA 5B4TA 2G5CA 3JYPA 5DT9A 5AYVA 4W7HA 4DIFA 4O59O 1N5DA 5DF1A 3DHNA 1ZK4A 4I5GA 5C3MA 3GGPA 3LYLA 5KKCA 4NBUA 3V1TC 3ZN2A 4L9RA 3P7MA 3DZHA 3D4NA 4M1QA 4Q3AA 1I3MA 4EUEA 4E5PA 2DU8A 1T1RA 1TT5B 4FJ2A 5COBA 1Y7TA 1FJHA 4PLPA 2DFDA 2CSUA 2VHYA 5I7FA 1LC3A 4XYGA 3F6YA 4FPXA 5L45A 1DSSG 1VLLA 2NVBA 3HUDA 4GKVA 5JMPA 3GT0A 4QECA 4I5EA 5MDHA 1HYGA 3DMYA 1EK6A 3DOCA 1NQAO 2EERA 1X0XA 3WGHA 2B4TO 3WWZA 2DAPA 4NI5A 3DDNA 4BO3A 1NP3A 2GN9A 4DXHA 2CMDA 5BNFA 4CV0A 1BDMA 2FWMX 2DC1A 5KVSA 1CEQA 4Q3EA 4Y6RA 2EKQA 3LC2O 3E82A 4URFA 3LLSA 1LLCA 4QFDA 5A4DA 5F1OA 4P22A 3SBOA 4J1SA 2BH9A 3M1LA 3UKOA 3ULKA 4CR7A 2E6UX 4OSPA 1NTOA 3BHMA 2ILTA 3E5MA 3IJRA 3IUPA 3N7UA 4TROA 4Z0HO 5LC1A 5ICMA 4GWKA 1LTHR 3D3WB 5L4LA 1C0LA 3P5SA 4Q39A 2YJZA 4DC1A 1ISIA 4BNNA 2FZEA 3R1IA 1UXKA 2ZCUA 1U8FO 3O03A 4BO6A 5BSHA 3PZRA 1IPEA 1F14A 3BYZA 3LT0A 3LQFA 2BMAA 4AJLA 4UUNA 2D0IA 3TOXA 2OHXA 1TT5A 3OEYA 4YDRA 4D43A 2X4GA 3FWZA 4NIMA 1Q0LA 4P4GA 3F4BA 2VYVD 3NT5A 3N58A 5THKA 5ITWA 4RQUA 3GMSA 3BHJA 4XEHA 2HDHA 4E30A 1KYQA 4RCVA 3HWRA 1DC5A 4CM9A 5ITVA 3E8XA 1Y8QA 4U7WA 2BRUA 2CZCA 1E3EA 2ZTLA 2GZ2A 3H8VA 1EBUA 4Y6SA 5JW6A 4J43A 1P44A 4JK3A 2C0CA 3BAZA 1RWBA 1ZK1A 1TA4A 3IP1A 3I3OA 2EP5A 3AUUA 3E03A 5GZ1A 1XCBA 1T2EA 4LW8A 1DFIA 3UICA 4CM8B 4YT4A 2PD6A 4H7PA 2CDCA 1YB1A 4GLOA 4IIUA 1YH3A 3C1AA 3OECA 2RHRA 5CG2A 1QYDA 1OOEA 4IINA 4TRMA 1XHLA 3MJCA 3PJEA 3DXFA 3WJAA 4WGGA 3WFJA 4EJ6A 1FF9A 4AJEA 3ZW9A 4B3JA 4XZ3A 5EMHA 1U5CA 3D0OA 4EUFA 1C0IA 5CG1A 4KQXA 3WX0A 1MV8A 1ZNQO 4I9HA 2EGHA 4G65A 2IXBA 3FTNA 1Q7GA 2B83A 1I30A 1U2GA 2VWGA 3I9OA 4UAGA 5CP8A 2PZKA 2BFPA 4YJHB 1VJTA 4J4HA 2FY8A 5GZ3A 2YHIB 3V1YA 2FMUA 1ZW1A 2GZ3A 3GY0A 3PWZA 2PZJA 2XXBA 5HWSA 1P1HA 1GZ6A 1HXHA 4K28A 2PH5A 1N9GB 4OIMA 2CVOA 2ZCVA 4RV9A 1UXHA 1X0VA 1B7GO 3GEDA 4A26A 2HMUA 4EDFA 3L0DA 5A3JA 4IDDA 3IL2A 3M2PA 1SAYA 1PL8A 1W73A 3VZQA 4PCVA 2EJWA 1P0CA 3ZWXA 1ULUA 4FBGA 1U5AA 4CMAA 5ER9A 3ZWBA 1EQUA 4RVDA 1P1JA 5A9TA 1ZIDA 2HSDA 3FRJA 5DOVA 4F46A 1UJMA 5KJFA 3VKUA 2DBQA 4U6QA 2Y1DA 2Q99A 4C7JA 2OFPA 4UVEA 3L07A 1NNUA 1PEDA 3V2GA 4DREA 3G3EA 1E7WA 1CWUA 1YDWA 2W4QA 2NUAA 3CZRA 4CQLB 1EVZA 1IHXA 1NHWA 1W0CA 4AJOA 4HFJA 1YL7A 2H9IA 4K1LA 2IRWA 2Y66A 4PLHA 2O4UX 4BQRA 1L7DA 4J3FA 1GQ2A 4XYLA 4TRRA 5TJ9A 4JBGA 3DWFA 1U7TA 1LRJA 2WYUA 1Y8QB 5T6BA 4CMHA 1D3AA 3RUHA 5JCJD 2NTJA 4UVDA 1A72A 4JBHA 4MPDA 1JKIA 1X7GA 1NPTO 5DNAA 3WYEA 1P74A 1KEVA 4DBZA 2BGMA 3RAJA 4XKJA 2X5KO 4Q3BA 1K89A 3GZNB 4NJMB 5L51A 2JHGA 1NWCA 3PHJA 3F5SA 4HFMA 4ZN6A 2W8ZA 3ITDA 4ZQHA 4OXYA 1P31A 3JD4A 4D3FA 4ZGWA 4EJ0A 3PWSA 4R1NA 5U4QA 3UN1A 4DPKA 1M6HA 1H0KA 2CDBA 1SEVA 3H9JA 3JQBC 3VAZA 1R66A 2O2YA 1A7KA 3UXYA 3JQ7B 3KB6A 4QO7A 1A27A 2LDXA 2HRBA 2Z1MA 4OMUA 2PA3A 2YQ4A 1HDCA 4FN4A 1LNQA 3VTZA 3IKTA 4NPCA 4PG4A 2IEBA 3Q9NA 2GN8A 3LT2A 5KKAA 3NDIA 2Y1OA 3NJ8A 1LEHA 3QIVA 3ZWYA 4BNFA 2FHSA 4OQZA 3L4BC 4WLUA 1GEEA 7MDHA 5A05A 3CMCO 4AJKA 2GNAA 6LDHA 2YUTA 4J9VA 1T2AA 1S7CA 3OM9A 3BIOA 4N5LA 3HDJA 3H6KA 5DDIP 1PJ3A 4I08A 4JROA 4TSKA 3QHAA 1GCOA 4IDBA 4NMHA 1LDYA 4IDGA 1E5QA 2Q3EA 3H7AA 2OL4A 1DFGA 1P1KA 2X0RA 1SC6A 2X23A 1VM6A 1Z82A 3KVOA 3CUKA 3KHUA 4G2NA 2AA3A 1B26A 1BMDA 1B8PA 1H9AA 3U9LA 1BXGB 1ORRA 3G1UA 4ND2A 2PZMA 2WEKA 3PPIA 3C7CB 1YONA 2NU8A 5TNXA 3WBFA 2XF8A 1U3VA 1KC1A 2Q4EA 4W7IA 5T8KC 3ZWOA 2JAPA 1I24A 4Z0TA 3HJAA 5JAIA 1O94A 5AOVA 4GKBA 3BMNA 1P1RA 1DRVA 1P1IA 2I9PA 1RM5A 3D4OA 5I9MA 4BGEA 4R16A 2VNAA 5HS6A 1QYCA 3ITKA 4NHEA 3KEOA 1Z6ZA 1ZKMA 5THQA 3LZ6A 3PIIA 3FCOA 3GA0A 4LVUA 3BTUA 4D3SA 1KBZA 2EP7A 3A4VA 3U4HA 3AI2A 1BHSA 2FZWA 3NTOA 1HWYA 3DC2A 3DMTA 3H4VA 2WMDA 2WE7A 5EINA 1GDHA 4FC6A 1UZNA 1NYTA 3MZ0A 2EW8A 3WGIA 5DZSA 5JDCC 3EZYA 1UP4A 5CDYA 4E12A 4J4BA 2GRAA 3RBVA 3VH1A 1UR5A 3SC6A 1DLJA 4BO1A 4HV4A 3ZHZA 5I7VA 1TT7A 1GUFA 3AJRA 1EVYA 3NYWA 1HKUA 5IDWA 1WW8A 2GSDA 4CV2A 3R6DA 4BB6A 2ZK7A 4JP3A 4DIBA 3I9LA 5A1TA 4BGUA 1P33A 3JTMA 1IPFA 4BNLA 3RI3A 3NDJA 1V6AA 1WDMA 1Q7BA 2OMEA 3TNLA 3TL2A 4IMPA 4JN6B 3K2EA 2O50A 2VYND 2GN4A 1LSJA 4YJGA 1MC4A 1YDEA 3U62A 5IJZA 4IDAA 2VOEA 1EK5A 4PVCA 4S3MA 1WMAA 1RM4A 3W8EA 3H9GA 2GR9A 3AW9A 2VCYA 2Q46A 4DQXA 5A04A 4Z3KA 4Y98A 4YT8A 4K26A 4IDEA 4JP2A 4II2A 2J3JA 3GNTA 1GV0A 3PVZA 5B4VA 5G0WA 2JJYA 4GBJA 2QHXA 4BO8A 2DTXA 3C1OA 4WEQA 5JY6A 1H2HA 1NQOA 3G17A 2G76A 4TZKA 4ZQEA 1F8GA 2DBZA 3RBXA 2Y0DA 4XQGA 1XU7A 2C54A 4OQYA 4MOWA 4BKPA 4CM1A 2A92A 1ARZA 1WDLA 1H5QA 1PQUA 1HDRA 3PXXA 3I6IA 2C2YA 3F5QA 2JFFA 3DZFA 3RUIA 3VTFA 5J23A 4E2WA 1B8VA 3RJ9A 1H2BA 3C1TA 4AJ4A 1EFKA 3BHIA 3ZWAA 4M87A 2Z5LA 3RUFA 3GZNA 1F17A 4ALMA 2V7PA 4WLEA 3VKVA 4J7UA 4CL3A 1ZEJA 1X13A 2X22A 3PQFA 5AXBA 2O23A 1DOHA 3S2FA 5CEEA 3JQFC 3ST7A 4IDCA 4WPGA 2XXJA 4HBGA 3WQRA 1O9BA 2RIRA 3I4FA 1QORA 3OICA 4O5OA 3COSA 4JNKA 3HDYA 2IEDA 1I10A 4UVIA 4KUHA 4XD2A 1XG5A 1XYGA 5U1PA 1Z75A 1LI4A 1LA2A 1O8CA 1YRLA 1VL8A 2FP4A 5KCZA 4D41A 4Z9YA 1CIVA 2NTNA 4EYEA 2QG4A 3AU8A 4OSOA 1Q7CA 1PS0A 3CINA 5ES3A 3H3JA 3ZCXA 2X58A 2CVQA 3WNVA 4E32A 5HM8A 1I3KA 2WTBA 2E4AA 3DZKA 2NU9A 3INTA 1PGOA 2OP1A 1U1IA 4RPLA 3KLMX 3QRWA 2DUUA 3RKUA 5EN4A 1ZK2A 4R9RA 1XGKA 3EW7A 1FDVA 1HRDA 1QV6A 2EGGA 3JQ8A 4WLOA 4OYRA 1MX3A 2WYWA 2I3GA 2PD3A 4H15A 1HLDA 1EE9A 1AN9A 4E33A 1GY8A 1C1XB 2CNBA 3JQ7A 3ZZNA 3JD0A 3I83A 4BO9A 2W2LA 3JSAA 2WWRA 2A94A 4OOFA 3ZGYA 1NFFA 1SPXA 3B1FA 1DIHA 1VJ1A 3R3SA 4RDIA 4MVJD 1O0SA 2BGLA 5JCXA 3JD3A 4XJSA 2OORA 3ETGA 2EXXA 4OXNA 3CPSA 3E9QA 4MINA 3TZ6A 1ZFNA 1EVJA 3MEQA 1K3TA 1Y5MA 4F6CA 4KTVE 5L95A 2DM6A 1ZZEA 1OAAA 1P1FA 4N54A 1XWFA 4U0JA 4WNCA 3EYWA 4CLHA 5F5LA 1ENYA 2X0JA 1PTJA 4A73A 4FB5A 3GVXA 1DIAA 4DLAA 1NVTA 4MP8A 1NAHA 4G5HA 2QW8A 3RFTA 2F00A 2NWQA 3W6UA 1LQUA 1YXMA 5JAQA 4E13A 5FYDA 1MG0A 1AHIA 3OJLA 4OJNA 5IDXA 4KDFA 1L1FA 3CE6A 3K9QO 4DUPA 4CMEA 3DZIA 2J3KA 3PGJA 2YV1A 1VC2A 3RASA 1A9YA 1I3NA 5EL0A 3ZNQA 2WYVA 4CLDA 4CQMA 2VUSA 2VT3A 3INRA 3PZBA 5JY1A 3FNGA 2QRKA 2JCYA 2UAGA 1QMGA 3JYNA 1GYRA 1K6JA 3QV1A 4ESOA 4PLFA 3FNHA 1I0ZA 4MKRA 5T67A 3VH4A 3WFIA 4ILKA 1V3UA 4YAKA 1HL3A 1AGNA 4NU6A 3MJTA 3PWKA 1BVUA 1M76A 5H83A 3TN7A 2UYYA 1KERA 1D8AA 2A35A 3VPFA 3WGOA 1GCUA 2D8AA 3BMCA 4D45A 1Y6JA 4IY1A 4CLRB 1KY4A 3U0BA 8LDHA 3NT2A 4O1MA 5I8WA 4DLLA 2P2SA 1LBEA 5L4NA 2YHIA 4IQGA 3GRKA 1D4FA 1U3WA 1F8FA 3ZV5A 5K1SA 3O8QA 4AG3A 4FD3A 2DT5A 3VDRA 4A7PA 4BVAA 5CHEA 1KIFA 4BNTA 3IKVA 4FC7A 4LCEA 1EUDA 2C7GA 2Z95A 3JQGB 4XIYA 3RQSA 3H5NA 1WLYA 2AHRA 1ENOA 2NNLD 4FDAA 4YEDA 1WAMA 4ID9A 3A1NA 3LF2A 3WIEA 3NT4A 2D5AA 4QT0A 1LSOA 3RCBA 3WYCA 2HLPA 2C59A 4HNGA 1XIVA 4CLRA 1LXCA 5K6AA 4FSHA 1U28A 3DZGA 4BNXA 1H94A 2E37A 3ZI0A 3DAFA 5U9CA 3NAQA 1T25A 3JD1A 5BSFA 3ONEA 1UZMA 2ZYGA 1ZJZA 3OH8A 3PQDA 4K6FA 4BO4A 2UDPA 4CUKA 4A5OA 4GL4A 4FGWA 4CM6A 2AEMA 5B12A 2O4CA 4QTZA 4FOOA 4MKXA 3GAFA 4YAEA 1LSUA 4PN3A 1R0SA 4AJIA 3MOIA 3E18A 1U2DA 2C5EA 1HLPA 5JAZA 5L9AA 4D0RA 5L53A 3C8MA 2J8ZA 1ADGA 3AOGA 1M66A 3B70A 4B7UA 4BIIA 4J91A 4MVJH 5DCUA 2POQX 3WTCA 2QYSA 1YBMA 3K6JA 4IQ8A 4XA8A 5F3RA 4XYEA 3TZHA 2Y05A 4EITA 1LLUA 2EEZA 2Y1EA 2V6GA 4J2HA 2E49A 1A71A 2EV9A 1KETA 3F1LA 3GZ4A 4B7CA 1WVGA 1ZSNA 3FR7A 4MVJF 3D4PA 1PZGA 4NJMA 4XRGA 2VWHA 4GX0A 3Q2IA 3ZWNA 2Y68A 4FW8A 1ISGA 4YRDA 3BTSA 1TB4A 1AXGA 5TT0A 3ZHYA 2R00A 4LN1A 4LRTB 4KUEA 3U3XA 4BHTA 4CJXA 5JDIC 4J0FA 2QIOA 3VH3A 1AHHA 5G4LA 3CXRA 3JQDA 4CMJA 2R00C 4E2YA 4YR9A 3ETEA 5A03A 4YJFA 1N92A 4B4OA 2H63A 1Y9EA 3O4RA 3A28A 4PLWA 4RVHA 3WB9A 1R0LA 2Q1TA 1ID1A 2FSVA 4XDYA 2BGKA 4CUZA 3KTDA 4E31A 2DKNA 3VPHA 4B3HA 1DC3A 3C7AA 4WEOA 3KYDB 3WMWA 1EBFA 1DHTA 4BNKA 4P4NA 4W99A 5ENDA 3V2UA 5C5IA 5TC4A 1MC5A 4FJ1A 2C20A 3KLPX 2PD4A 1TVEA 4BGIA 3ZU2A 1XR3A 5HBRA 3ZWMA 2HJRA 2BD0A 2GUGA 3GUCA 2AQIA 3ADPA 3IS3A 4D42A 4PG7A 3AFNA 2D3TA 3JD2A 3ZHBA 4N5MA 2O3SA 3QJ5A 4HP8A 1IB6A 4IQ0A 3LT1A 4NBRA 4OL9A 4CODB 4RPKA 2HRZA 1JWAB 4IJUA 4TRJA 5LCXA 1E7QA 1TI7A 2GLXA 4UUMA 2G82A 5G0SA 3OJ0A 3WYBA 5IFLA 3TRIA 1O95A 2BFOA 3WICA 3ANNA 3GGOA 5I8ZA 2IDZA 4DPMA 3L9XA 1ISJA 3GOHA 3IIEA 3TFOA 4E2ZA 4CMCA 3EMKA 2PGDA 4E5KA 3Q1LA 1I3LA 1UDBA 3KSDO 5EERA 3HN2A 4NK4A 5FFFA 1JDJA 1PQWA 3ADOA 5HTOA 4ITUA 1Z74A 1KVSA 4BNIA 3I1JA 2WE8A 1PWXA 4XQEA 3TFQA 5JYDA 3WDSA 4RGBA 2YFQA 3GVPA 3QWHA 1KOLA 1EDOA 3I6QA 3TJRA 2PGLA 3PDJA 3PYLA 3JQBA 3BXXA 1C1DA 1NFRA 3GLQA 5DBIA 3RVDA 5L7WA 1WMBA 9LDTA 3GFBA 2AG8A 4ZICA 3DBRB 1GZ4A 3OBBA 2AQHA 2AEFA 1QSGA 3K73O 1DIBA 2GPTA 1H9BA 4LMRA 5IN5A 4DIOA 3DO5A 5C7IO 4GSKA 2C7VA 3M2TA 4CV1A 5GY7A 4CM8A 2GD1O 1KEWA 2J5RA 5IZ4A 4MIYA 4D0SA 2HO5A 5ENVA 1H6CA 2ZB8A 4MP3A 4CQMB 4TKLA 3JQ8B 4EGFA 2Y99A 1CETA 3R3JA 4PLGA 2FSSA 3S2EA 3N74A 4NBVA 4DC0A 1VI2A 2VRCD 3WLFA 3I9KA 3NUGA 3SC4A 1IY8A 2NQTA 2D59A 2JAHA 3CH6A 5TJHA 4B7XA 4L4SA 3PFWO 2W90A 2YFHA 3UUWA 4CM4A 1XKQA 1LQTA 3KOUA 4J1QA 1QKIA 2IYOA 1ML3A 3RC9A 3SVTA 1PJLA 1PR3A 3ROKA 1F06A 2B4RO 4Q3CA 3RIHA 4YQYA 1GZ3A 3JQAD 1TLTA 5CDGA 3P2OA 3K2BA 4UVGA 1MG5A 2HUNA 1HE5A 4LVCA 1E3WA 1Y9AA 3EGOA 2C07A 3WNQA 5IG2A 1IZ9A 2XOXA 1DPGA 2FR0A 3SLGA 1G0OA 1IYZA 3W8DA 3KXDA 1V8BA 1SOWA 3GNQA 2A4KA 5IDYA 3FNFA 3CMMA 4RJTA 4JQCA 3ZU4A 1E3SA 3EHEA 5L7TA 4P4LA 4Z0PA 3WWYA 3GVIA 1YJQA 4YXFA 1Y5RA 1E1KA 1N8KA 3ENKA 4BNGA 4HKTA 1RPNA 2J5QA 2GDZA 3BMCB 1JWBB 1BW9A 2Q4BA 2ZIZA 2ZYAA 4K9DA 3QVTA 4MVJM 3RROA 9LDBA 2DUWA 4CM7A 3F1KA 4CL8A 4J7XA 4ALNA 1DJQA 1TXGA 4YAJA 4ND5A 5AVOA 1QYWA 4CMGA 4UEKA 3WMXA 2CF5A 2HMWA 2R6JA 3PJDA 5GMOA 2VWQA 4JLWA 3AY3A 1GR0A 5BT9A 4DYDA 4Z9FA 3D5TA 3EK2A 1QRRA 3PIDA 3WBBA 1RYEA 2P4QA 3ABIA 4RF3A 5K0ZA 1HYEA 1DIGA 4ZHSA 3TZQA 1SB8A 4JBIA 3AWDA 3BTVA 4KWHA 1QV7A 4MIOA 3GK3A 4UUPA 4GPD1 3HB4X 2BELA 1NQ5A 3OEWA 1BWSA 4GQAA 4PLYA 2VHWA 3FR8A 2FR1A 2HJSA 2VRBA 4MP6A 1NPYA 1W6UA 3HDQA 2HU2A 3O38A 2VHVA 3VVBA 1YS4A 3QWBA 4GX1A 4XWYA 4BUCA 1LC0A 2VZ8A 4PLZA 4HFRA 1C14A 2PNFA 5A9SA 1KEPA 2AXQA 1SNYA 1E92A 1LX6A 4HADA 2X5JO 1M75A 4OHUA 1PGPA 1E77A 4GX2A 2E82A 4B8WA 5DN9A 4PZCA 3OMLA 4BKUA 4M55A 2HQ1A 5LDGA 1PJTA 4RO0A 4DPLA 1L7EA 3D5QA 2JD1A 3PRJA 1YO6A 4IDFA 2Q1SA 1WNTA 1OI7A 3DBLB 2CDAA 4INAA 3I9MA 4L0QA 3GF4A 5DULA 3VPSA 2OP0A 4FFOA 1ZXBA 2I99A 3TZCA 1YOVA 4D46A 1ONNA 5KVVA 1XELA 5C7LO 3OQ6A 4YB8A 3PEFA 3A14A 3G1TA 2AG5A 1R4MA 1PL7A 2CFCA 1LDGA 4FGSA 5DBFA 3RBZA 4I5DA 3MJEA 3Q0EA 1U8XX 3GPDG 3KV3O 1ZCJA 3HNPA 2NVUB 3ETDA 1ZMOA 5AXDA 1IZ0A 4EBFA 1Y1PA 2GERA 3MCVA 4LK3A 2NQ8A 1QP8A 2B4QA 4NJOA 3AM3A 4PGFA 5ICSA 2ZB4A 1GU7A 4NG5A 3OA0A 4MIEA 1XLTA 5DBGA 2RBEA 2W98A 3ZNOA 4GI2A 4DTIA 2B0JA 4RLHA 1EEHA 1QXSA 1LDMA 5CDTA 4ND3A 4RVUA 4W4TA 1WZEA 5BNTA 1R15A 1VL0A 4Q3DA 3TSCA 2TMDA 3KSUA 1QYVA 2HCTA 2IZ1A 4MVJG 4L4XA 3PI7A 3ANMA 3G79A 2Y0CA 3RC1A 3JQ6A 4YCAA 4NFHA 1T2DA 2X0NA 1W8DA 3B20A 4J16A 1BDBA 5JXWA 4WLVA 3WGZA 1IL0A 1D1SA 3LC1O 1BGVA 5IZCA 4OM8A 1VJ0A 2YQ5A 1B0AA 5IF3A 5I7SA 1KY5A 3GN2A 3AM4A 1A7AA 1GYQA 2QRLA 3JYQA 2O2SA 4E4YA 4L73A 1HTBA 3ENNA 4Z6KA 3OIFA 1EUCA 3K8ZA 4PFJA 4XYMA 4Y6PA 5F1PA 4Y67A 4BOYA 1WP4A 4HY3A 2WD7B 2GF2A 4UEJA 2AMFA 2FPPA 1E7YA 3LK7A 3DAPA 1PJ2A 4ZVVA 5A06A 4R51A 1VKNA 3WIDA 4C7KA 3U4IA 2O3UA 4R68A 2X9VA 2B35A 2EWMA 1W4ZA 3C85A 2J3HA 3PDUA 3JQAA 1DHRA 1H6BA 3RD5A 2I67A 3UGKA 1CDOA 4CMKA 1U4OA 3BMOB 4QSMA 2JL1A 4BNVA 3E1KA 4QEDA 5AXAA 4BNMA 5TF4A 2NADA 2NM0A 4C4OA 5JAMA 1V0JA 3H9EO 4NU5A 4BNWA 2HMVA 4AL4A 3GGGA 3V8BA 4GWGA 1YB5A 1MXFA 1SO8A 3GC6A 2X5OA 1I5RA 3SXPA 3M6IA 3AFMA 2IE0A 3VPGA 4N18A 3TQHA 3AU9A 1WDKA 2V6MA 1IULA 2QZ9A 2YW9A 3V5NA 3BMNB 4FFRA 3JQGA 2UUPA 3F3SA 4R54A 4R69A 4RF5A 5TSDA 1PJCA 4I1IA 4H16A 2JFHA 5EQDA 3ZW8A 5JNLA 2DLDA 4R3NA 1E3WB 1J6UA 3INGA 2GYYA 5TGDA 4DLBA 2P4HX 1Z45A 2D5CA 4FFMA 1MUUA 4KQWA 4ND4A 4II3A 4R3WA 3Q3CA 3FI9A 3ZH2A 4TWRA 1ONPA 3PP8A 4AVYA 1ISHA 3BA1A 1R4NB 4CM4B 3FSRA 4GVLA 3VPXA 1Z73A 3PGXA 3RU7A 1E6EA 3WG9A 4D3DA 1U3UA 4RPHA 1ZK0A 4RZIA 2C29D 1ZVMA 2X9GA 5IAAA 3IP3A 1MXHA 3G0OA 3PLNA 4GLLA 4B8ZA 3L4BA 4NBWA 1B8UA 4DWVA 1XQ1A 1DFHA 3Q2KA 4BGVA 1PQPA 3D1LA 5TS3A 3LLVA 3DBHA 1R6DA 2C2XA 2GASA 1HDGO 4PG6A 2BLLA 1GPJA 2Q2VA 2W2KA 4ZRNA 1JN0A 3OIGA 4YA6A 2D1YA 4KDEA 4CR8A 2AQ8A 4BMSA 4GH5A 3SLKA 3PHHA 1KC3A 4J1TA 3RUEA 2NU7A 2X86A 3U5TA 1P3DA 2EW2A 2O3RA 3AUSA 2V65A 3TOZA 3RC7A 4KP7A 4R5MA 3VC7A 2E48A 4RLSA 3KYCA 1YL6A 4OXKA 2GO1A 3SEFA 3ZNNA 2ZTUA 1VSVA 1JU9A 1NR1A 4BL5A 2I5PO 2PKQP 4OOEA 4XGNA 3FWNA 4ALLA 5JS6A 4YJHA 3H3FA 4R9SA 1R12A 3L6OO 1B14A 5KVQA 1D1TA 2VUTA 4BKOA 4IMRA 1PZFA 2PH3A 3PJFA 2IXAA 4L76A 1PGNA 3LF1A 3DB2A 4FFNA 3GEMA 4CLOB 2Q1WA 2VHXA 1U3TA 4HWKA 5L40A 3DFZA 3MWDB 2VOJA 3QW2A 2P9GA 1T4BA 2RH4A 3ZWCA 3O26A 3GNSA 4AICA 3K92A 1KVTA 3V1UA 2JCXA 3F9IA 1NM5A 3GG9A 3GAZA 1T2FA 1MLDA 2PR2A 4RL6A 2WDZA 1UXJA 1NPDA 2OXIA 2X1HA 4YWJA 2QYTA 5JO9A 2PWZA 4N7RA 3CTMA 5DCYA 4DMMA 3DR3A 4Q3NA 5HRUA 4W9NA 1EMDA 4LCJA 1V35A 3M1AA 4D7AA 3QVWA 5CPBA 7ADHA 1GADO 2QQ5A 2RAFA 2YV3A 3ROPA 2Y67A 2I66A 2YY7A 3NKLA 4HFNA 3UFXA 4R1TA 1CQJA 2PK3A 5HS4A 2WD8A 5COQA 3PQEA 4BQPA 4CLOA 1B2LA 3GDOA 1YB4A 3OA2A 3DTTA 3CKYA 4B4UA 5IN4A 1KS9A 2VN8A 1T2CA 2JKVA 4BNYA 4CLXA 1BXKA 3RUAA 4JX8A 4WOKA 3T7CA 3FF4A 4KOAA 5FI5A 4MVJE 3LVFO 3WJ7A 3GG2A 1F12A 2Y0EA 4WASA 2X7HA 3GQVA 1M6WA 4NFSA 3PLRA 1NHGA 3JQFA 1EE2A 5A02A 4P8RA 5K6AC 5KJCA 4JGBA 1V3VA 4ZRMA 4ZJUA 3Q11A 4GAEA 4RPJA 3EY4A 1HZZA 2AE2A 4KTTE 4FJ0A 4RDHA 1SZJG 3OF2A 3AOEC 3GVHA 3PFFA 4WJZA 4JXKA 3U4CA 4X54A 2IZZA 1X14A 3UOGA 2NU6A 3W1VA 3NDRA 4PG5A 4E5YA 2H5LA 3DBHB 1DIRA 5EIOA 3VH2A 1O6ZA 1VPDA 1BXZA 2OO5A 2J3IA 5BSEA 1UAYA 4UREA 4ZD6A 3H5RA 4MVJA 5EJ2A 1DRWA 1RKXA 3MJ4A 1P45A 3CIFA 4LSMA 3TF5A 4M89A 1KVQA 3ASUA 3ZWPA 2FR8A 5FWNA 3GVCA 4IJKA 2PV7A 5KVCA 1PGJA 3MOGA 5B37A 2JD2A 1Z7EA 2PGJA 2VZ9A 4NK5A 1ZH8A 3V2HA 2HK8A 3UAGA 3FTPA 4JJGA 3X2FA 1K2WA 1NBOA 1SBYA 1E0DA 4YT5A 3W4IA 1JKFA 3WOHA 4WKGA 5KWEA 3WTBA 2ZQYA 4NNJA 4IJWA 5KJ6A 4XRRA 3EZLA 3RUDA 1P9LA 4AJHA 4M54A 3P19A 5ER6A 4BKQA 4FFLA 1DJNA 5ILGA 2Q2QA 1ZEMA 3KM0A 3WGQA 1LLDA 4OH1A 2I65A 3DONA 3RC2A 1PZHA 2OUIA 2Q1UA 3STHA 1JA9A 4CM5A 1RYDA 4ZQBA 4AJPA 2AQKA 4W6ZA 1YVEI 2NACA 3QY9A 3QQPA 4NR0A 6ADHA 3IQDB 3DAGA 3NRCA 4OKIA 5ADHA 3KYBA 2OBNA 1PX0A 4CM9D 4TQGA 5KIAA 4RVSA 1EZ4A 1R0KA 4XIJA 1AUPA 1JKJA 3LSYA 1Y81A 1XSEA 4XR4A 4YQZA 2VYVA 2WM3A 4BNZA 2OZPA 3W4KA 2XAAA 3JYLA 1DAOA 4TKMA 2VNSA 2OGUA 5LDHA 1HSOA 2EHDA 4EI2A 1N1GA 3NGXA 3BMOA 4I8XA 3VZSA 1DAPA 4E5MA 1B3BA 1WXDA 4WLFA 2Z1NA 3DMTC 4CUJA 3ROMA 2V6BA 3JYOA 3GRPA 3EVNA 4XQ9A 2NSDA 1ISMA 3Q9UA 2DBRA 3AY7A 3ZHXA 4E6PA 2DFVA 4GMGA 4NBTA 4A0SA 1YOVB 1I2BA 2HMTA 1E7SA
chains in the Genus database with same CATH superfamily
4WSOA 3A06A 2Y2VA 3V00A 3ZBQA 3CLTC 3LWDA 3ZQKA 1T0IA 3H4MA 1THTA 1JXMA 4Y30A 4YP1A 5F21A 2BEUB 4TKUB 4YAGA 2CZGA 3EY9A 3E9MA 4C01A 5BQXA 3EIQA 2K2QB 4E94A 1Y3CE 5JZMA 5DNVA 2VT6A 4ZP1A 5C4GB 3ZDCA 2HT1A 4PRZA 1KZ9A 3LCRA 2C0PA 4LGMA 1PN3A 3QWAA 4FFPA 1CUZA 1MGPA 3JWGA 4DLSA 4ZVUA 4MI6A 4G1BA 1EA5A 2OHJA 3WKCA 1SH7A 2ZB7A 3PYMA 4P7JA 4N40A 3EARA 1FUYB 5I6DA 2HTFA 4ER7A 4TTQA 5HF5A 5JI2E 2PBRA 3CLSD 1IM8A 1NMSA 3UVEA 5JSQA 2CNNA 2R5FA 3E6AA 3K0AA 4FYHA 1SCUA 2MYNA 2AXEA 2NV2B 1U65A 4DLVA 3CLHA 2E4YA 3KRTA 4IZ6A 4BLRA 4HGYA 2A5FA 5LP6F 5DBOA 3LFUA 4UM9B 4MCHA 3NKVA 5DNUA 3ELBA 4ABTA 2P68A 1SEPA 1QCYA 3ASZA 1XLTC 4RH1A 1ZM2A 3MINA 2R1ZA 1BWQA 4IXTA 3T5MA 3V6MA 2QJTA 4AO6A 1Q1NA 1UDXA 1TW2A 2CCKA 1LSSA 1HFWA 1PSDA 1XFAA 3QPWA 4ZAFA 1XQ9A 3EIWA 1Y1TA 2J5KA 2REBA 3Q0TA 1ISPA 1NW6A 2B98A 4M53A 5JDCA 1LGYA 1WQ1R 5F77A 3NGMA 2GN2A 2ETXA 4IR7A 4K87A 4UC0A 5A4KA 1RAEA 3CRRA 3UAZA 4B3BA 5AUPB 4ZEXA 2NW6A 3KXKA 1FX1A 1HA3A 1I7NA 1XRJA 3ANTA 3HV0A 3W3AA 1YF3A 3IXLA 1ZJYA 1SUWA 1E4EB 2F1KA 3AKYA 3KJFA 3F6CA 3WP1B 1QLHA 2D74A 5IXJA 1OXXK 1KP3A 1X1SA 3QOXA 5MN4A 4M1YA 2PEYA 4BQEA 5AM1A 3W7AA 3MTQA 1Z88A 3IC5A 1NNI1 1I6MA 5FI3A 3G0CA 2P91A 3NHUA 3AUAA 3P4UA 4KVFA 3OE1A 1O5TA 3FROA 2JIMA 4IRMA 1QQBA 1RXUA 2HYDA 2YOHA 1PF7E 2QGNA 3OJFA 3JCZA 4C9BA 3F4KA 1PS9A 1J49A 1L8QA 2VF5X 2G67A 3HB5X 4P58A 2I2BA 3WLTA 1C7IA 1TA9A 3EDMA 3PTAA 5T64A 3FBGA 1EX9A 1FCJA 5HA5A 4BB5A 4JSYA 5DXJA 5H4HA 5AUNB 2BF7A 3UF0A 2P9EA 1UXGA 3ONVA 3HCOA 1TIBA 1AQIA 1JLLB 3G0GA 3LA6A 1U31A 1F6WA 4K81B 2R5WA 3VOBA 2WSBA 5I5EA 3IIKA 4X85A 1KZHA 1CJCA 1EK0A 3HQ4O 3OETA 4F4FA 1YWGO 2W58A 1QRSA 2I1WA 1CEYA 1BNCA 2JGKA 1G55A 3SE7A 3K8QA 3WOVA 3NIDB 3K5HA 1RLJA 1GYPA 4G89A 1HT2E 1M1XB 4WA8A 2UV8A 1WSBA 2H92A 3CR7A 3DZJA 4YNBA 1DO2A 3D7MA 3TL3A 3Q2OA 4AZVA 4F92B 4BYGA 1YR1A 1HZJA 4DT1B 3OIYA 4B2LA 3VVLA 5DU2A 4RGQA 3KNZA 4LYYA 5LZ2A 4C22A 3VOTA 2AEJA 2GJAA 5EJ9A 3F6RA 3H17A 3KYDA 2A7XA 2O1SA 4QUJA 4L5CA 4YVFA 4LI0A 1PNOA 4QBTA 1THMA 1QO7A 3EG9A 5P21A 4PG8A 4FI3C 2ZT8A 3ESAA 4RM2A 5JCXA 2OTCA 4JBXA 4ZAWA 4AZ3B 4Y1RA 4PQGA 3U1BA 3MM4A 3B7GA 4MV5A 2EJUA 2FPIA 2LV8A 3OX1A 1P0MA 1LPBB 2NYVA 4KQGA 4TL6A 3UO8B 4MGIR 1X77A 5DISB 3T54A 3LHKA 3QNMA 4D79A 5MFZA 1N7IA 1JG1A 5EWMA 1ZAKA 3E9CA 3P9YA 4XJTA 4XGIA 5IHXA 1UPBA 3DLBA 1GFSA 4LJKA 4M60A 1V8DA 4WE3A 5GTDA 1VE9A 1ZGGA 2FX3A 4PLTA 2PIDA 4HDKA 4IUYA 3BREA 4LJYA 5C1DA 1U80A 4BE7B 1USVA 2KSQA 3CZ9A 2CJWA 2W5UA 4S12A 1AE1A 1W2GA 2GBLA 4AJ1A 5AVWA 1CF2O 5KPJA 2XB4A 3U4AA 4BO7A 5AT1A 3VKFA 2IU6A 2RCYA 4Y6QA 3LXXA 4IGFA 4P35A 3AF4A 4EUKA 4DSAA 1ZAYA 4CHGA 4DB2A 5LQMA 1ISFA 4MQ6A 5CVVA 3HDGA 1UPUA 2ZJ0A 3JU3A 4BJ1A 1ZD8A 2ZB3A 4F7DA 4LZPA 2YJ5A 1AVTA 5BRAA 3ZD8A 2BKAA 3P2MA 4ZJYA 4ZCSA 1P2VA 2L82A 1LRLA 3MMPA 2JASA 5TIIA 1JQDA 1TW3A 1E1QA 4LXGA 1UEJA 1G6KA 1BFKA 3COYA 3PJGA 2FN4A 4RTKA 2AZXA 1UODA 2GYWA 4Y9UA 2O8CB 1L9XA 4CPDA 1YD7A 3TLEA 1OMOA 5KJEA 3DDZX 4DLZA 1E7MA 1NAIA 1VHTA 3Q12A 4ZIRB 3NXSA 5DTQA 3ZU3A 4U7HA 2V7QA 1PFGA 2BJVA 4WZAE 4XOIA 4KMRA 4F5WA 2Q8NA 4PIVA 1TZ2A 1P73A 2NO6A 2XA9A 3SYNA 2H1IA 5CFOA 5K0EA 4J6FA 1GKYA 3S5UA 4Y7CA 1U99A 4HMQA 3STVA 2RHCA 3D7LA 2ZAIA 1QZXA 3W79A 2GILA 5I9NA 4M1OA 4DA6A 3HKBB 4ATNA 2N0SA 5CB4F 3OM0A 3HI4A 4Y9DA 2VF2A 5JC8A 1XCLA 2FGJA 2MR6A 4KQ9A 4QM6A 4YPOA 1KMQA 3MB8A 2CNOA 3EVFA 1OHHA 3QZUA 1TEHA 2BHSA 1X80A 2BSXA 3TXYA 5B3LA 5IX8A 4MRVA 4CIVA 2C1EA 1RLMA 3X1WA 4OI0A 1LUAA 4ROSA 5DYNA 5DYYA 4GOMD 3QSGA 4CKWB 4R1UA 4Z9XA 3RVMA 3EAGA 2P3QA 3QEBZ 5D3MA 2CXPA 3ROQA 4UW9A 4R5HA 1SXJD 1L5ZA 5B7QA 4Q4HA 4QFBA 3FYCA 5FA5A 2H1OA 1YMQA 4B74A 3HZHA 2C7PA 3ZW7A 5FKJA 1A82A 4Z4HA 3I1YA 2EQBA 2PCJA 3O90A 1C8KA 3QKRA 4FWIB 4ALKA 2VJNA 3CSDA 3L04A 4FFSA 4BV2A 3FPCA 3U7RA 1EVLA 2PS3A 3MC1A 4NARA 3G8YA 3WS7A 4C76A 1ECGA 2XDAA 3ZWWA 3EJ6A 3S1LA 2KYRA 4DV1B 2IEAA 3H6GA 3ND8A 2Q3MA 1J97A 3DZCA 2PKRA 1R0RE 3L4SO 1NASA 1G8SA 3LC7O 3CRQA 4HTFA 1DCFA 4ME6A 3P9ZA 5IVIA 3S2GA 4M98A 4YACA 3T7EA 3I23A 3W5JA 5HK8A 1L5FA 4NPHA 4V24A 2YTZA 2P1ZA 1DAEA 1JDZA 1K88A 2F6RA 1F20A 4GHWA 4H7JA 3WHIA 2GHTA 4JIGA 3C15C 2C4NA 3JV7A 2WJPA 1G5IA 5ALSA 2OCAA 5E6RA 1SCJA 2OXFA 2PJDA 4DCGA 5KNDH 2FMKA 3KZKA 1USIA 1P6QA 2CJFA 4MVJP 1IEXA 4B5KA 1OTHA 4E5NA 4KQ1A 2NU6B 5I48A 2WUGA 3PHIA 3RKRA 1JFTA 3FM9A 1H6DA 3MTIA 1ZCFA 4QLBA 5EHNA 4F8EA 1NBMA 4IO0A 4LSZA 1JIUA 1QG2A 4CCWA 3K5PA 4NJEB 1QIGA 4DV4B 1GQQA 4WCFB 1VPWA 3K96A 2UYQA 1A5ZA 1YUNA 2JLUA 4AUMA 4IS3A 3FYTA 4WAUA 1PAUA 1WKVA 4GPZA 4YMGA 1WPRA 3IBYA 1IBKB 4JXZA 3L2OB 1J2RA 3AQ4A 1I33A 1SBQA 3ASVA 4L3OA 2PYIA 2D4AA 1N3BA 1MABA 2WWXA 4RF2A 5A4FS 1P1CA 1YC5A 4KR7A 1ANKA 2VUUA 3IAEA 3G2HA 1LQ2A 4DARA 5KQRA 3DJFA 3CKKA 1C29B 1G21A 2SCUA 5KI6A 3ONFA 4H6PA 4NV0A 4D0GA 2HWKA 4NZNA 4WBNB 4INZA 2HF8A 2HSZA 2Z04A 5A1JA 4IJVA 1C1XA 2ZQZA 4O2LA 1N5IA 1QWOA 4MVJI 1S01A 3ZXIA 1TEZA 3GHHA 2XCLA 5CAEA 1ZHOA 3T9FA 1QZUA 4HNQA 4LRYA 4PHTA 4O4LB 1Z5NA 2ZRPA 3OZAA 4HNSA 5H82A 4QGSA 3NWOA 3DLTA 3AY6A 1DOZA 1F1JA 1EEXB 1NVVQ 4BFWA 3DPIA 1I80A 4QYIB 3ZWQA 3WLIA 4ZAZA 3QVSA 3E7XA 1QZZA 2E55A 2PUTA 1K7YA 2XOEA 4JT4A 1Z5GA 2JCSA 3NBFA 2I4MA 5E3HA 2UXDB 2IELA 3ZHVA 3D9QX 5BN1A 2WSSD 2X4LA 2C2MA 2JIQA 3JQEA 1H22A 3OEHD 1CFZA 1KOGA 4NAHA 3R0ZA 5CCBA 4J94A 2P4UA 5I7WA 5M04A 2UZIR 1N1EA 5BW4A 1E0JA 2V58A 4A91A 5LKRA 2PVCA 2O7QA 4ODIA 1Y3HA 2B21A 1I7PA 3PFKA 4S1PA 3W2HA 4WRRA 4A27A 3FPLA 3FIUA 2FEAA 3LJKA 1Z5UA 3UT5A 4DLRA 1KI7A 1GT6A 4BV9A 3FHLA 1T3ZA 5ESWA 4M0PA 1FYFA 1PLLA 2HA7A 3IELA 4RJLA 3I01A 3UHAA 3RAEC 4UE6A 4BE9A 4DM3A 3HA7A 5L7YA 4Q6BA 3TB6A 2IUTA 1PWZA 2OBLA 3KQOA 4ADSG 3OLYA 2BM9A 3TCXB 1G1AA 1VYHA 3HM2A 6Q21A 1V1MB 2VTEA 4Y6OA 2IIBA 3RUPA 3K30A 2PT6A 4DCJA 1UAAA 4PS0A 3MERA 1RC8A 2Y2UA 2FE4A 5K3SA 3RSQA 2ZJBA 1HETA 3K09C 4F4HA 1BXRB 1IUKA 1TUGA 1CNMA 1WB4A 2MSLA 2QWXA 1L3IA 4OHBA 4FIZA 1HDYA 1E8DA 3A3KA 2ZOSA 3DTYA 4NTZA 2IEGA 2IYQA 1DRJA 2QLTA 5J3JA 2ONYA 4RVCA 3PCXA 1C2YA 4J2OA 2NIPA 3KSBC 2MOKA 1QGYA 1P81A 2X6RA 3HUTA 5DLQC 1JSLA 2AWOA 3O3CA 4OPMA 1C3VA 2AC4A 4E14A 2ATEA 3CZAA 3T3OA 5TLSA 1XCGB 1E99A 1HURA 1GTJ1 1LRKA 1O1YA 3PGLA 1VRWA 3NOXA 1TZKA 1VHWA 1BE1A 1SULA 2PG3A 3UCFA 1JSRA 3VDQA 1Q2XA 3IGFA 3SSOA 3NZEA 2HR1A 2BKLA 5BR7A 4OX9B 5ALNA 4Q03A 2WUWE 2OO7A 1VLJA 3H7IA 3N7TA 4G3XA 4RORA 5CK4A 2IH2A 4KR6A 2IUFA 3NQ41 2C2KA 2P8JA 3FUUA 5M29A 5FUMA 2VSFA 1T5BA 3R3ZA 4YH1A 2WM8A 5EPEA 4B4VA 4JB3A 1R4MB 1WZCA 3OHSX 1YQDA 2BUBA 2J0UB 3OKPA 2QUZA 4AROA 1W2WB 1B00A 1WCXA 1SBHA 1CRWG 2V5AA 3GWGA 2BV3A 2H31A 2I1VB 4CLEA 3P0JA 4Q4JB 4EB0A 5JC1A 1Z5ZA 3SJ7A 2E5LB 1PCXA 1NW9B 3BXPA 2NPIA 2OWEA 1DC6A 4QBKA 1EJ2A 2TMGA 3G5MA 3IODA 1GL3A 1XBTA 3HK2A 3LU1A 4HEA6 3C24A 5BRJA 1K6IA 2CUKA 4XDZA 4DCCA 1M0TA 5CB4B 5IBQA 3AIOA 2DTEA 2JI9A 2F1HA 1YASA 1CZUA 1OXVA 2JHFA 4O2RA 4MDYA 4IZHA 5D6NA 3FPEA 3R77A 5A3VA 3T5CA 1ESNA 2PO7A 3MA0A 2Y71A 3SIWA 4ENRA 4B4WA 2O3QA 1NBIA 2DWOA 2W6ID 4PZAA 1QMPA 3O0TA 4IV8A 4YFVA 3CX4A 2HIMA 4DAOA 1L7OA 3L41A 4NH4A 2X0DA 4O0LA 1CHNA 3JQPA 2JGIA 3QKSB 5H70A 5DSZA 1TVMA 1UWKA 3C7DB 3DHYA 4MQEA 5GZ6A 4B1FA 1J70A 3TGPA 1N8NA 4HCJA 5E7QA 3LQ1A 3VDMA 1V11B 2OZEA 1W5SA 1U9YA 2VJOA 5K4GA 1PJQA 3DWEX 4TMTA 2VTDA 1Z5VA 1DBPA 2O0KA 2BFMA 3G5AA 1D6SA 3R20A 5CITA 3LT4A 2VQEB 2H1VA 3AEXA 4WZAB 1DEOA 1C81A 4N8DA 1BVRA 1UMBB 2NTVA 3ZV3A 2JJ8A 1LDEA 1OT5A 3PSHA 1ORHA 3ASYA 4XB2A 1JIXA 3IUSA 4PVDA 4RANA 2G0TA 3HYSA 3PUKA 3IQHX 1GTVA 1VHQA 2CB0A 2PMBA 2YWEA 1MP0A 4PTLA 4KGVA 4H7DA 3W78A 1VJGA 5I3ZA 1I32A 2W2OA 5CXUA 3GHYA 3ZOKA 4XARA 1QU3A 1MD9A 1RP7A 3E3NA 2B5WA 1QB8A 5I7HA 4PBTA 2OYSA 2XQJA 2P3OA 3KBOA 4LJSA 4CU2A 3CUSA 4P83A 5A5EA 4WW0A 5MN5A 3I34X 2VAWA 1UJ6A 1YR9A 1J0XO 2RJNA 3OFND 2PYZA 4O08A 3R75A 4BP8A 1REQB 1YGPA 4R9VA 2WKPA 1T24A 4QC2A 3IOYA 2JJMA 5CA0A 2OESA 4V0QA 3WQHA 5CU7A 3U09A 1XNHA 4AF7A 1GGVA 3MQFA 4AQYB 3II6X 3E1GA 4CIBA 2WD7A 4DY6A 1UC8A 1UZLA 2PWPA 3T61A 2IYAA 3LRPA 3RG8A 4OQFA 2NTEA 3QXJA 1KMHA 5EA2A 3ZYCA 1J0CA 1BU5A 1T35A 2P6NA 3JRNA 1UPAA 1I1NA 2EQ5A 4EABA 3OQBA 5LYJA 4A0QA 1Y3BE 4YJ2B 5IC4A 3K8OE 1QO0D 1GP2A 2IYFA 1I1OA 2OQ2A 5AQ1A 3X2EA 4RVNA 4Y2UA 1KIAA 1ZO8A 3VFDA 3PKZA 4MKHA 1UBJS 1N6LA 2CLEB 2VHEA 1AMNA 3LUHA 2GFIA 3QKSA 1FMCA 1W2HA 2V03A 2HMAA 3NFRA 2D2IA 4RV5A 3D3NA 2FLWA 2VJMA 1E9AA 3W8FA 2CL6X 3FKJA 1OUMA 5AM3A 1RD4A 4OHMA 4DMLA 2DJIA 3WA7A 1FDWA 3CT4A 3SOZA 4MW5A 1PYOA 3NTQA 3KTAA 4PX5A 2MSKA 2JI6A 4NE2A 3BMQA 1HYBA 4ZQGA 1K8QA 3JZFA 4LX0A 5JSYA 2AS0A 4GGPA 1SUDA 3D4BA 4KLAA 2XVAA 5TF0A 1C1HA 1L1EA 4JCOA 3CW9A 4WBNF 1G3RA 3SZLA 1HT1E 3D1VA 1VLQA 1ZOPA 3H11B 4IZIA 3MTGA 1QAQA 1IUOA 4MR8A 1GPDG 2XWBF 4AJ2A 4L95C 1T6ZA 1V39A 2YWRA 1EE1A 5IANA 1J5PA 5DNCA 5A2QA 2OEPA 1N7GA 2NVUA 4N41A 2NAFA 3UIEA 1E9RA 4TWBA 2HF7A 2Q45A 1XPOA 3H9QA 5EESA 5D1HA 4IRUB 4B3GA 4G0UA 3DZBA 5LQNA 2E7ZA 6ABPA 5BUCA 1CIPA 4DWVA 3E5RA 3K2QA 5EP1A 3SYRA 3BSFA 4TKZA 3DZDA 1YBVA 2EF1A 3O1JC 3VVCA 5HX7A 3ODGA 2ERXA 2I71A 4F9EA 1WKBA 3AHJA 5KHLB 3STYA 4ZDJA 1EESA 1M1YA 1OD6A 1H5UA 2WFLB 3LKVA 4NZOA 3B85A 5I9LA 2Y1XA 2YVAA 4UBOA 1H3NA 2OENG 4L2IB 1GTRA 4DIFA 1N5RA 3VYWA 3AETB 3HI6A 4N3CA 1PBNA 2NV0A 3CF4A 4O59O 3R5XA 1K8XB 5P8WA 3QM1A 4M8NE 5DF1A 3DHNA 2GCIA 2R65A 4B09A 1PWEA 3AV3A 2B1QA 1NRXA 3LYLA 1G5PA 3L8ZA 5TARA 1GA6A 3N1UA 4OJTA 4PM4A 3PL5A 3P52A 1YHYA 4NZZA 5D5QA 3ZK7A 4L9RA 4MPJA 5KHOC 1HNZB 2AKEA 1VSQA 2BC9A 1EGAA 4EUEA 4BX0A 1JT2A 2QXTA 4FJ2A 3NV7A 3L0IB 5E1MA 4CKYA 4MQBA 5IKPA 1R6VA 2DFDA 2VHYA 4HDCA 4UUAA 4XYGA 4K9KA 1M1YE 5AKJA 5AJHA 4YRZA 5CT9A 2IHNA 1H9CA 4XXHA 1QCCA 5F51A 5L45A 4CN8A 1TK9A 2NVBA 1Z0SA 1RYHA 1Z0UA 2H1FA 2CDRA 3BE5A 5EP4A 4I5EA 4WVFA 1HYGA 2VZLA 5DGCA 1G8HA 4CN9A 5JBQA 4JY7A 3DMYA 4KN6A 2F2TA 3NDBB 2EERA 2Y1LA 2GMWA 4IOKA 1ZNYA 2BDUA 1X0XA 1T10A 4DRXA 4NCIA 4EHIA 2B4TO 3GX1A 3SYTA 2DAPA 4NI5A 2O2JA 3GRRA 4BO3A 1NP3A 4LXXA 4DXHA 4M22A 1WB9A 3AEYA 2R8PA 2CMDA 3FHOA 1GKKA 1Y3DE 1RC0A 3D8BA 4XFDA 3KPUA 1VPVA 1CUFA 2YZ2A 2OBFA 3JZDA 3QG1A 3RC3A 4XWKA 5B2ZA 2AF3C 4Q3EA 3E82A 1FVXA 3GUUA 2QRUA 1GUAA 3LLSA 4GW3A 4IIDA 3GLFE 1Q21A 4HHEA 4MLCA 4LZAA 5LP6C 3TLJA 5AKGA 4EYSA 1VIDA 2OBMA 3C5CA 4P22A 1JG4A 4QQKA 5JCZA 3CISA 3MLBA 2E89A 2EFHB 5IWCA 3HUEA 4ZO8A 4R8KA 5EHZA 5KYKA 3VKGA 1R3UA 3AJ9A 4B3DA 1NJ6A 5F2NA 4GC5A 1JDBC 3SEAA 2ILTA 3WIOA 2VDNB 3IUPA 3N7UA 4GKAA 4MRSA 2W70A 2OA0A 4JJAA 4C4ZA 5EIXA 1H2EA 1PDOA 1P4JA 1YCGA 2EF0A 4J1TC 4DEXA 3P5SA 4Q39A 4R2WA 2YJZA 1XTIA 4PICA 9GPBA 2AG1A 3GJ7A 1ISIA 4BNNA 2FZEA 5C8YF 2UUAB 3ZCRA 2EBFX 4PTYA 1GGJA 1U98A 4BJ6A 3O03A 4BO6A 2QE7D 2IEZA 3ZEAA 3TECE 4UD6A 2MMCA 4JFRA 1ZVQA 2VDVE 1XA3A 3PZRA 1IPEA 2WNHA 4FTWA 3U40A 4HQFA 4Y2JA 3LX8A 3N28A 1Y63A 2O1XA 2PSDA 1ZUHA 3N3BC 5EC8A 1T1IA 4AJLA 2QK4A 3HU5A 3MB5A 4D43A 2R8OA 2X4GA 3FWZA 4TS1A 3JAWB 5FOSA 2WMOB 4P4GA 3SNHA 4QZVA 3ADDA 3JWEA 1QIMA 3BG5A 1ULHA 5THKA 2HDHA 4JELA 2DUMA 4HNRA 4WKBA 4M7WA 3IDZA 1CS4C 1DC5A 3GPBA 3VU9A 4CM9A 5ITVA 3T95A 3RE1A 3BGIA 4L8GA 3GU3A 2WTUA 4PQFA 2R25B 3IH5A 4B4DA 4UHHA 4EH1A 1JEAA 3FZYA 2ZTLA 3P0FA 2X1LA 1F60A 3B51X 4TMVA 4TOIA 1EBUA 1EJ6A 4J0QA 4ZVTA 1C3XA 3BORA 3T15A 1L5QA 5F7ZA 3SR3A 2J0UA 5AVZA 2NUAB 1JKXA 1SA0A 3HKEA 1EGQA 1TA4A 4MDFA 3NHYA 3TPFA 3SAJA 2CXOA 1G9XA 3IP1A 4O29A 3AUUA 3E03A 3I8OA 3DLCA 4AULA 1DFIA 2V45A 4AMYA 3D3JA 4L02A 4H7IA 3WLRA 3ZE9A 3L7KA 2PD6A 4H7PA 3T7AA 3W1EA 1CDZA 4E22A 5LN1A 1DCTA 4QAJA 4X64B 4UPDA 1YB1A 2DHDA 2GEVA 3D7RA 4ZOAA 1YH3A 1XMXA 2RHRA 3OU6A 2HJHA 2QTFA 3HXPA 2FI1A 4W1PA 1NIPA 1KDRA 2XDQA 4YP0A 5DXAA 3GCWA 3SK0A 3E2IA 4MUXA 4GOND 3WJAA 4JV5B 1FF9A 5BW5A 4XZ3A 4KQXA 4QHYA 1ELOA 4R8SA 2ORIA 1B43A 2O0HA 4MGHA 2C9YA 1J1IA 1BE6A 4JZYA 4I9HA 2EGHA 4KV7A 3BRCA 1CDEA 1YQWA 4RESA 2JARA 4F8YA 1Q7GA 1HM5A 1I30A 4YRIA 4DIEA 1KMIY 2D0OB 4NS4A 3T5PA 2ANCA 2OD2A 3I9OA 1N6RA 4UAGA 2JAOA 5CP8A 2XDYA 4AP5A 1QGUB 1EIZA 4REOA 3OTWA 1JA0A 5K8IA 1KOJA 3V1YA 2FMUA 1ZW1A 1JAZA 1NI4A 1PUXA 3X1JA 2XXBA 4OI4A 4F21A 3O8LA 1U3DA 2KE5A 2QRMA 2J4DA 3HGMA 3OFNA 4RHXA 1EHYA 4DCNA 2CVOA 4YBRA 3GBSA 3MGKA 1T8WA 4U9UA 1B7GO 1RJEA 4GE3A 2UU9B 1MEOA 3IL2A 2RHLA 3B3FA 4GOXA 1AZTA 5HDQA 4TL7A 2JLCA 3M2PA 5FI1B 3HWX1 3U3OA 1K5GA 1PHPA 2R1TB 2HLHA 3PI6A 2YIMA 1PL8A 3HJCA 1JP7A 3ELWA 2N75A 3TRJA 4EY4A 1IG0A 4OHXA 3BJRA 3ENVA 3JARA 4CMAA 3D0KA 2CKDA 2IYWA 5BXQC 1J07A 3QNUA 3DYIA 5SY4A 5I3CA 2ADFA 1MHPA 2R0QC 1M7BA 2GPAA 1SU8A 3M9WA 2BBSA 4L5YA 4FI3F 3GD5A 5A9TA 2FNAA 1OTXA 2R11A 2IQ5A 3LGXA 4B5LA 5KJFA 1IY1A 1ZESA 3IUJA 5CVEA 1CS0B 1RPTA 4K6HA 4A15A 4M9UA 3HSSA 1AUOA 3D6TB 3GJRA 2OFPA 3HJRA 1GTL1 5HZKA 3MWYW 2ZS9A 4ND8B 4UVEA 2UYCA 1TUBB 2VYQA 2BP7A 3V2GA 4DREA 1ATZA 3G3EA 3G6KA 4LDQA 1VSTA 4YRTA 2X3FA 5FQOA 1YDWA 4JQYA 1M1UA 4BFYA 1K4MA 4EHHA 2WWIA 5H5JA 3VPAA 4DCOA 1IHXA 1NHWA 1Q1EA 2W0SA 2Z9CA 3I6BA 1YL7A 4PFQA 2AOTB 3MWDA 2Y66A 1EJBA 4TL8A 5FX2A 4PLHA 3JPWA 1SXJE 2O4UX 2ZI3A 1XU4A 2TRSB 3I12A 5DX0A 4J3FA 1DAIA 3GJQA 5DIFA 2HRCA 1T8RA 2P9FA 4OUKX 1JWLA 5TJ9A 4KQMA 1C0EA 4I4TA 2WWTA 1LRJA 4CMHA 3NHSA 2A9JA 4DJEC 1O9GA 2FCRA 2Q9BA 4R8VA 5GP1A 5M34A 4G0MA 1J25A 1R6AA 1RRGA 1XO1A 2A1UA 5D3KA 3MBOA 5AKYA 4UJ5A 1S8AA 3PT5A 4QDZA 4XX0B 5I7OA 3RAJA 2X5KO 4Q3BA 2JKZA 3E70C 3B1VA 3ZVRA 2GBGA 4R8RA 3EXIA 4BMOB 4EW2A 3AINA 1J24A 3SKXA 1YRHA 4JL6A 2R7MA 1CV2A 1P31A 5KU7A 3K16A 1RPZA 4DA8A 1CQWA 4R1NA 3UN1A 1JB9A 1E2KA 3O8DA 5ADWA 1G38A 1GFWA 2ZRIA 2ZANA 2QMHA 1RKVA 1SEVA 2WB4A 3C2QA 2QUIA 3IFSA 3JQBC 1H4TA 3PWTA 2O8FB 1OAOA 2JEYA 1W34A 5EJ7A 2B30A 1N9ZA 5EIFA 1FMFA 3D3KA 4BZQA 2XZOA 4QO7A 3RYCA 4JU9A 4C04A 1G18A 1E66A 2PKEA 2YJ6A 3UWDA 2JFWA 5FWYB 4DR6B 4R7GA 4LAFA 5CX1A 3VTZA 4KW7A 3IKTA 3L1JA 1V8FA 5AJUA 5I7RA 4AU1A 4C6HA 1N75A 3Q9NA 2FPXA 4N5HX 4R6WA 3AFIA 5FL7A 4DT1A 1K6EA 2D62A 3RS0A 2DSNA 3TZBA 2WWFA 4IJMA 4YRMA 1DRKA 4BNFA 3ZWYA 3TTUA 1FS5A 5EZYB 1IXRC 3L4BC 3WB2A 1PFUA 5T3YA 4LHVA 4ZAXA 2V9ZA 4PCLA 3RU3A 3RF6A 4PPYA 3T0IA 4LJ6A 1BYUA 3BFXA 3WO0A 3GRFA 6LDHA 5AH0A 1ORTA 1GR1A 5FJJA 1X7YB 3GJTA 4UAJA 1PJ3A 1WDWB 2EX1A 3O73A 5HUJA 3P9CA 5CYGA 1C8BA 4Y2PA 3GPLA 2XR1A 2C2ZA 1GCOA 3HLTA 2GPSA 4EGCB 1E5QA 1E3QA 1TEVA 3HVIA 3NDPA 3NEAA 2X23A 3PQ7A 1J00A 4P32A 3I45A 3IHTA 4P08A 2IZ5A 1BMDA 5BWCA 1H9AA 4ENWA 3U6KA 4ND2A 1GPBA 1NBMD 5AW6A 2PZMA 1E2UA 2CZQA 2F1JA 4MRMA 1V4VA 1SVLA 1OV4A 4FUTA 5EIBD 2QQFA 3L4KA 5TNXA 3WBFA 1U3VA 1UM9A 1FX0A 1SUSA 1FSSA 2JI4A 2PJZA 2WQZA 2WZQA 2XF8A 4W7IA 3ZCVA 5CA1B 1FUIA 5LYJB 2FW0A 3OEHA 2XRMA 3L79A 4EUNA 3BMNA 4N0PA 2BEJA 4YRSA 2OD9A 4HF7A 1DRVA 1Z6QA 1JEDA 3LO5A 3G88A 1OV6A 2NUPA 1MT3A 5KCMA 1CR2A 3A6KA 5DGXA 4X63A 1ZL2A 5HS6A 4YUAA 1XTRA 1DQZA 3ITKA 1AKUA 4NHEA 2GTPA 2H65A 5THQA 2BGRA 4MYUA 5KTMA 1V16A 4K3VA 1KU0A 2COKA 2ZUSA 4LVUA 5T7BA 4Y2SA 1E3MA 3HP1A 3S1SA 1XRQA 2ON6A 1TK3A 3CX8A 1Y1RA 4UZFA 2ZSAA 3NHWA 3ANSA 1USGA 3QYFA 4JI2B 3BWDD 3GAAA 1OU0A 3MMZA 3MZ0A 4CTMA 1JKMA 2ZIGA 1CUJA 2EW8A 3WGIA 2ZJ6A 5JDCC 2GM5A 2LGJA 4I9FA 3L82B 4NWIA 4BCCA 3C7TA 5CDYA 1U0SY 4NC9A 2GRAA 3L7NA 3DGFC 4L22A 3JWJA 1GM5A 3SC6A 4BO1A 3PQCA 4DBLE 2ZAYA 1F9EA 4OHWA 4P7KA 1AKNA 1NN1A 3WRWA 1WY7A 2A1TR 3EC1A 3GZJA 1B0UA 2R68A 1ZX1A 1QBGA 3NYWA 1HKUA 2I7TA 4RGVA 5C46F 4Q93A 1FVHA 2VJYA 1RWNA 3L1KA 1O96B 3PNQA 3R6DA 4GECA 5EP3A 3SSNA 4BB6A 4CL2A 4C5CA 4JI0B 3I9LA 5A1TA 1YAHA 2J3MA 1NQUA 3JTMA 3Q1KA 3RVNA 4U7TB 1N78A 3UJ6A 3ZIAD 5ECYA 1G20A 3NM4A 1DAMA 1FBNA 2PU7A 3FPBA 4RS4A 4EX7A 3MYYA 1OBOA 2YOFA 1OIVA 3PEWA 4EKIA 5BN5A 4A8TA 3A1UA 3IQIX 3CEHA 4PYKA 4C03A 1KEEA 1WXHA 3TSAA 1LV7A 5EEGA 4AQDA 2VYND 2B7BA 2GN4A 2QW1A 3O8OB 1MC4A 1QKJA 2BOVA 1YJ5A 4EG1A 1PVDA 3BCHA 3GMIA 5HNKA 2PX2A 5E9JA 4PVCA 2VXCA 2I1LA 1QP4A 1QANA 3W6OA 621PA 1GARA 3WL6A 3TTXA 1KO7A 3L7YA 4UDOA 3FCSB 5BOSB 2Q46A 5K8JB 3MJFA 3VR2A 3MCWA 3EPKA 4LE0A 5A04A 3SQNA 4IDEA 4JP2A 1GV0A 4U7GA 5EUCA 1QFZA 3ZY5A 4G1EB 1YS6A 1U2RA 1L7RA 2B34A 2XUZA 4GBJA 5BVHB 2QV7A 4KDRA 4UCWA 1AMOA 2Q9CA 8MHTA 3U39A 2NPFA 1PFQA 3ETHA 1WETA 4OTZA 1YRWA 4LFAB 1ONSA 4CF7A 2XBLA 4J6EA 1W8IA 4HAUA 2H08A 1VL1A 1XU7A 1X8KA 4M8IA 4OQYA 1DTSA 4YN3A 5C51B 1PYGA 1VG0B 5DGTA 1T2VA 2M9MA 2O7RA 2ODNA 1ARZA 1K98A 1QFSA 1PQUA 1HDRA 2AN9A 3DE5X 1QKKA 1Q57A 2WSLA 2JFFA 4P5PA 3M70A 1NMEA 5E3JA 3VTFA 5J23A 3T9CA 1CJVC 2FSPA 2H2FA 1B8VA 1IM5A 1RDFA 3DOIA 2FPUA 3MBKA 4IUDS 4JDPA 1EFKA 3BHIA 4JEUA 5JWRA 3FDJA 2P9TA 4TWIA 4PNEA 2XSZD 4AP6A 3GZNA 1F17A 2C1XA 5JJBA 4WLEA 4KGXA 5B53A 4ZMBA 3HRKA 4RHCA 1N8SA 2YKGA 3KZXA 2CC2A 3ZU6A 4V1CA 5CEEA 1ESCA 1BVHA 2HRQA 3O3NB 3M9XA 4LYEA 2Q4DA 1AS0A 3O83A 1O9BA 5EZQA 3OICA 3U2QA 3V6LA 4YPFA 4I4TB 4WNYA 1I10A 3VU0A 1W5TA 4DDKA 1XJQA 2GN1A 1XYGA 4OUDB 1Z75A 4YGXB 5U1PA 1LI4A 4XUGB 1XN1A 2E4XA 2LBPA 3EFHA 4YRQA 5BSVA 3JAMA 1AQLA 5E6UB 2NXJA 3TIXB 2IYNA 3NBUA 4HAIA 4G4SO 2Z8ZA 1F0NA 1CIVA 4WN9A 4Z9YA 3RYIA 1JBQA 1FPQA 2NXWA 5CFRA 3RFFA 3PE6A 4J2TA 1TUBA 1AD2A 4HPXB 4OQLA 1QZ3A 4G01B 4OSOA 2O54A 1PS0A 1MTZA 1B1CA 1UKVY 2TSYB 3CINA 1M2KA 4M0FA 2QUBA 1Q6YA 4UD2A 3LXUX 4DNOA 1R5JA 2CVQA 2OT3B 2VA8A 3LY5A 3VMFA 2MHCA 1GZ7A 1FMTA 1DARA 2E4AA 3DZKA 1EPUA 3OVMA 4FGKA 4HH0A 1P5HA 4R2IA 1U5BB 4ETIA 4RPLA 2J08A 1OX6A 1IIRA 1W85B 4JP8A 4RH0A 1FDOA 3QRWA 3EUFA 4DJDC 2YZNA 5EN4A 4Q48A 4HH3C 4OQNA 1K0FA 1XGKA 3EW7A 5DLEA 1QV6A 2BHNA 5B3AA 1L5OA 1GGFA 4TSFD 1KYIA 1YK1A 4OYRA 4P82A 3CRMA 3ME5A 3Q7SA 3SS9X 4D9KA 3NB0A 2I3GA 1O2DA 4HMPA 2VH5R 3LRTA 1AZSC 3AESA 5GJVC 5H1YA 1ZI6A 1LPPA 1G19A 2C7OA 3JQ7A 4LHXA 3SJCA 3K7EA 3QMMA 5DN6D 2HF9A 3JD0A 1XEXB 3UJNA 4BO9A 5K0BA 3KBBA 4NNPA 5JNWA 3FGNA 1K7EB 5CVJA 4ZJPA 1OXSC 3MNFA 1H8HD 1DIHA 4RDIA 4RMJA 2X15A 2BGLA 2EXXA 4OXNA 4MINA 1Y48E 1DQRA 1IN8A 2QMOA 4UMDA 2O05A 4B46A 3ENWA 3GEEA 3NOOA 5L95A 3DL7A 1ZZEA 4WNCA 1BWRA 1CUYA 1XWFA 2VJMB 1XMJA 5C80A 4JQSA 2C99A 3QYPA 5EWJA 1UJ5A 5ULLA 3LECA 1RHKA 4D56A 5KSZA 2AUTA 4YQEA 1EHCA 4A73A 1Y1QA 3NBKA 3GJSA 3GQBB 3GLGA 1PRYA 4DB4A 1DIAA 1EAMA 1AXRA 1NVTA 1QCZA 3ADKA 3IMGA 4I66A 4MP8A 4G5HA 1VZ2A 4Q37A 2QW8A 2NWQA 2GF0A 1TZMA 4K9SA 3M6UA 4RTMA 4I55B 4V38A 1NG1A 3W6UA 3P8ZA 1MG0A 1N0UA 1TAQA 3CUEF 5FV7A 4AF6A 4IEIA 5D01A 4B44A 1NVUQ 4DSOA 1GPUA 3UPTA 2RHBA 4OJQA 2CYCA 5G53C 2OOKA 5B64A 4NCAA 1U28C 3W2EA 2E2WA 2WZDA 3CE6A 4GGMX 2G06A 4DUPA 2P6PA 2O8EB 2YBEA 1WPGA 4R9UC 1Z0FA 4N65A 4X1IA 1OBVA 2GYVA 2A9KA 2PWYA 4WZZA 4OL0A 3O2NA 3PGJA 3CVYA 3D8UA 4C6RA 1UT5A 1TTQB 1VC2A 4BJ3A 4JLPA 3ZLBA 1WHTB 5EE5B 5BR8B 3G2KA 4CQMA 4TTSA 3ZGLA 2VUSA 2UZAA 3INRA 1Q1AA 1YC2A 3FUTA 2QY6A 1P4HA 2JC3A 2PZ8A 3HDTA 5REQA 2C03A 4HTFB 4Q4DA 3UMFA 821PA 3K2IA 4MKRA 4A8HA 4RKEA 3VH4A 3N0RA 5KNBH 4N0MA 4ILKA 2NU9B 4D5GA 4FM9A 1E6CA 1OA0A 3MJTA 3WL8A 2N47A 5HGJA 2HL6A 3TN7A 2OKGA 1D8AA 3HCPA 3IEXA 1L4YA 3BF8A 3DE7X 3C16C 1P7VA 2A35A 3IMKA 3PUJA 3UMCA 4KREA 1CTQA 1EJ0A 3BMCA 3QVUA 3ZKWA 3IP7A 3IVGA 5CCDA 4AWAA 3PPVA 3CX7A 2GX6A 3GRUA 4L85A 4MV9A 4IY1A 1DBSA 5CUQA 5TGZA 2PVPA 1X6VA 4DLLA 1O03A 1V48A 2P2SA 4DCUA 1F2UA 2ZYSA 3EUAA 4IQGA 1D4FA 1PR5A 4MW0A 1B74A 2XX3A 4GVPA 3IYLW 1SU7A 4NMXB 1U3WA 1J42A 1F8FA 2X1MA 3DMPA 3O8QA 3EH2A 4U2BA 1M72A 2VP9A 2YY6A 4A7PA 5BY2A 2HW8A 3DOEA 4EFLA 1G5FA 1EUDA 2Z95A 3QEKA 3JQGB 4BY9E 2AHRA 3P96A 4M46A 1OLOA 1JXAA 1R6TA 2OHFA 3LF2A 2D2EA 1C41A 1XTSA 3DV0B 3PX2A 4QT0A 3R3UA 5B2EA 4RTPA 2FMFA 3OE7D 5HUHA 1XV5A 2HLPA 4BDTA 1JG3A 4HGRA 4RE6A 2RHWA 5K6AA 2BFDA 3DZGA 4RE5A 3FTCA 2G9NA 3OAAD 1H94A 1QFMA 4BNXA 3HYRA 4R1LA 1BHJA 1GLNA 2WU8A 3MJDA 1T25A 3WBKA 3WLPA 2ACWA 4URZR 4RK0A 4C7BA 2IYXA 4ZYLA 1E9DA