4OAQA

Crystal structure of the r-specific carbonyl reductase from candida parapsilosis atcc 7330
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
365
structure length
365
Chain Sequence
KAVPDKFQGFAVSDPKNWNRPKLASYERKQINPHDVVLKNEVCGLCYSDIHTLSAGWQPLQRDNLVVGHEIIGEVIAVGDEVTEFKVGDRVGIGAASSSCRSCQRCDSDNEQYCKQGAATYNSKDVRSNNYVTQGGYSSHSIADEKFVFAIPEDLPSSYGAPLMCAGITVFSPLIRNLGLDARGKNVGIIGIGGLGHLALQFANAMGANVTAFSRSSSKKEQAMKLGAHDFVATGEDKTWYKNYDDHFDFILNCASGIDGLNLSEYLSTLKVDKKFVSVGLPPSEDKFEVSPFTFLQQGASFGSSLLGSKTEVKEMLNLAAKHNVRPMIEEVPISEENCAKALDRCHAGDVRYRFVFTDFDKAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the stereoselectivity of R-specific Carbonyl Reductase from Candida parapsilosis ATCC 7330: Biochemical Characterization and Crystal structure studies
rcsb
source organism Candida parapsilosis
molecule tags Oxidoreductase
molecule keywords R-specific carbonyl reductase
total genus 121
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 1.1.1.195: Cinnamyl-alcohol dehydrogenase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4oaqA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4oaqA01
4G2NA 2OO5A 4XQ9A 3ZNOA 4CQLB 1LA2A 3HB5X 2YJZA 5AQ1A 3K30A 4CMAA 4EZBA 2AE1A 1PGNA 2VN8A 3PFFA 4IZIA 4OM8A 5DOVA 1T2AA 1LTHR 4E2ZA 2WD7B 2J6IA 3WMXA 3K96A 3JQ7B 3WGHA 1LLUA 4RZHA 9LDBA 1YB1A 1QLHA 4ZRMA 3QWFA 3H4VA 3A14A 3NGLA 4E5YA 4GH5A 3FTPA 4IZHA 2EJWA 1D1TA 2HAEA 2FZWA 2W8ZA 4FCCA 4BVAA 1I0ZA 2PH3A 2WD7A 3QWIA 2QRLA 2ZKLA 3OF2A 2BLLA 2PLAA 4A7PA 1KVRA 3RD5A 2X0JA 4LGVA 3EZLA 2Z5LA 3JD2A 4BNFA 2IRWA 4RVDA 2YFHA 4DGSA 3KB6A 3H65A 5KVCA 3PHGA 4J90A 4BMNA 4TRJA 3PYXA 3V1YA 1WMBA 3VTZA 4WLUA 1V3VA 1L1FA 3AOGA 4WJZA 4WEOA 1ISFA 4JQCA 4XB2A 1Q7CA 4HFNA 4OHUA 3KBOA 5TT0A 5ITVA 2AXQA 3KSDO 3VTFA 4A27A 3KO8A 4Q3DA 4GWKA 5KCZA 1MX3A 1YDEA 3I4FA 4GKBA 2WEKA 2P2SA 3A28A 1E7WA 4L4RA 5AXDA 2VQ3A 1KOLA 1OC2A 3K5PA 4O5OA 4CLEA 6LDHA 1BTOA 3INTA 4BNIA 4FPXA 3COSA 2GZ1A 1PWXA 3MOGA 1XQ6A 3R3JA 2XXJA 1NM5A 1H2HA 4XR9A 2NWQA 5TT1A 1SEPA 4GMGA 3EZYA 4QT0A 2PD4A 3H3JA 4OKIA 4DIBA 5HWSA 2O3QA 3ANNA 4TROA 3L9WA 1EQ2A 3EHEA 1IL0A 2BMAA 2DBZA 4W9NA 4XYGA 5DBIA 5G0VA 5JFOA 1E5QA 4NFYA 4RO0A 5TJHA 1LRLA 3GT0A 2QZZA 4PZCA 1NQ5A 2FPGA 3ZW8A 4CM5A 4GGPA 4QUKA 4NMHA 4M49A 4ND1A 1IY8A 3ZU4A 1EBUA 3LK7A 4YQZA 3E5MA 4WLFA 4LCJA 3DOCA 1HZZA 5CPFA 3GFBA 3GMSA 4ROSA 3C3XA 4E32A 1DJQA 3ZH2A 4ALNA 2DKNA 3NT4A 4GVXA 3WWYA 1U4SA 1DC6A 1PJ4A 1R0LA 3IAHA 4AJLA 1GCOA 4K6CA 5DCUA 4DQUA 3P2OA 1D3AA 1NVGA 3ZDFA 3N7UA 3D5QA 1UP7A 3ICPA 2GO1A 4RVFA 1MC4A 2DVMA 4FDAA 2NTVA 3FNHA 4R3NA 1E1KA 3FBTA 4B4VA 1ULSA 2HQ1A 3IL2A 1VC2A 5MDHA 1H0KA 5HS6A 1EUDA 3MOIA 1T26A 3V2UA 1ZK0A 3G79A 2X5OA 4L9RA 1Y5MA 5BT9A 4JGBA 1GUZA 3AUSA 4FJ2A 4PRKA 3TZHA 4LW8A 2EEZA 4IDDA 4DPMA 3GPIA 3HZZA 5T57A 4F46A 2P9GA 2PZKA 2TMDA 4Y9DA 3MJSA 5LDHA 3KZVA 3O26A 3PQDA 2BFOA 2VTEA 2WMDA 4IIUA 4WUVA 4RF4A 2YY7A 4AJHA 2QYTA 4YEDA 4OXYA 3AM3A 3DO5A 3GVPA 4TMFA 1BWSA 1T1SA 3HDQA 2C54A 2V7PA 2V65A 5EERA 4PG8A 3E5RA 4GWGA 4PLZA 4B4WA 1YBAA 2W90A 3AOEC 3F4LA 2JD0A 2BI8A 2GERA 2NM0A 2YHUA 1U7TA 1PQUA 5ER6A 3E18A 2B35A 3DHNA 3OJEA 2BF7A 4U0JA 4ND4A 1LDGA 1P77A 3X2FA 2A9FA 1XU7A 3DONA 4UULA 5L3ZA 1G6KA 3GLQA 4P8RA 1A9ZA 4E5PA 5ENVA 1KC1A 2E37A 3JQGB 3QVWA 1OI7A 5G4LA 3S55A 3CSDA 3WGOA 3AW9A 1BVRA 1YQDA 3JQ7A 3F47A 2GASA 2HK7A 4KWHA 5ILGA 1BMDA 2V6FA 4MIYA 5DT9A 3WQRA 2RBEA 4EBFA 4B7CA 1CEQA 5CPBA 3WLEA 3KLMX 2FR1A 1HDOA 2C59A 3R0IA 1C0PA 2Y0CA 1E0DA 4DA9A 2SCUA 1B8PA 4CMBA 4INAA 4LVCA 2GLXA 4J1QA 1HE3A 2QHXA 3ETDA 3QIVA 5A1TA 4JK3A 4A2CA 3VH4A 4IY1A 3ZZNA 2ZTVA 4WE3A 4N5NA 2J8ZA 3JQEA 3GEDA 3F5SA 4R1UA 3E9QA 5T8KA 2BFMA 2O4UX 5AVOA 4K6FA 5LC1A 3V1TC 3JYPA 3W6UA 3NEPX 1YBMA 1UH5A 3ZWNA 4ALKA 3QA9A 1I33A 4FR5A 5I7FA 4Z0HO 1YQXA 3HB4X 4YVFA 4I5DA 1L7DA 1PGPA 2JD2A 1E3WB 1ARZA 4IMPA 1KEVA 3PHJA 4HADA 3WGTA 2ZK7A 2AG8A 1MC5A 5FI3A 4OSPA 5LCXA 5C7LO 1C1XA 1XKQA 3JYOA 3IUSA 2W2LA 3GOHA 1PIWA 3QWAA 5JAQA 3H8VA 4Z0TA 3BMQA 3OJLA 3DHEA 3PXXA 4FSHA 5FFFA 3I23A 3VPFA 1E1NA 3FRJA 1SB9A 1OZAA 2O50A 2DTDA 1I36A 2B4TO 3CE6A 3IP1A 4PIVA 1EZ4A 3GH3A 1B2LA 1B3BA 2C7GA 3FNFA 4L75A 4TWRA 4IIVA 3FWZA 3ZNQA 4DRYA 2QYSA 3JTMA 1YOVB 4OO3A 3ETGA 1DRWA 3GPDG 1P0CA 3GGOA 4YTEA 3UXYA 1HE2A 5ES3A 3CTMA 3ULKA 3WTBA 4DPKA 3A06A 1JQBA 4YT5A 4DBZA 2JL1A 1DXYA 3DZKA 4J9VA 2VT3A 4WOJA 3PLNA 4RGBA 4EITA 1U4OA 1YOVA 3BYZA 3Q2IA 3X2EA 4KMSA 3TOZA 2DUUA 4DLAA 1KERA 3Q9UA 3Q11A 1IPFA 4MP6A 3F1KA 1C3VA 2H63A 3ZCXA 3AY3A 5L95A 3AU9A 4CM9A 5L7WA 3AU8A 3E48A 5DCWA 3WGYA 5A04A 5COQA 4AJJA 5DOZA 4RLHA 1UJMA 3L07A 2VWPA 1KYQA 4CQMD 2I3AA 4D44A 4E4YA 5JY6A 3T4EA 3MJVA 4BQRA 3DZHA 2YYYA 2EV9A 3GR6A 2Z1NA 3U62A 3PDUA 1O9BA 3D7LA 2HMWA 4L8VA 2NNLD 3JQDA 3GY0A 2VRCA 1ZK2A 1X15A 4BB6A 4D0RA 1NR7A 1P1FA 4ITUA 3DMTA 1XSEA 4KP7A 1B8UA 4E31A 1QYDA 2X5KO 3GZ4A 1KVTA 1PQPA 3KYCA 3HN7A 4EUFA 5CEJA 3UCFA 3WJAA 1HLPA 1C0IA 1ZXLA 4RDIA 1JKJA 2Q4EA 3JQCA 3LQFA 4L76A 3OM9A 2V6GA 4Q3AA 3GEGA 4ALIA 4KZPA 4XWYA 3ORFA 4YT4A 2UAGA 4BO9A 4XA8A 1IB6A 3A4VA 2ZYGA 2FOIA 3ENKA 3OEWA 4NR0A 1FDSA 2D5CA 4GMFA 1ISJA 1K6JA 4YACA 1DIBA 5DN9A 1ISMA 3ADPA 1HF3A 1EVIA 1NWHA 2EW2A 3D1LA 2HMUA 2VT2A 4RF3A 4DLBA 8ADHA 4IDGA 1QG6A 4Z6KA 2CVOA 5THQA 1U5AA 1K0UA 2A4KA 1P1KA 4HP8A 4CUJA 1PJLA 4XRGA 3PEFA 4RVGA 5A5FA 2VRCD 1A72A 2ZB7A 4OOEA 1HDGO 1ADCA 4ND2A 1GADO 1DC3A 5JBIA 3KXDA 4PCVA 4E3ZA 2VYVA 1B15A 3ZV5A 1W6UA 5L40A 1YKFA 4XGKA 3RCBA 2VZ9A 3GAFA 5AXBA 2NU8A 3H2ZA 1E3LA 1Y8QA 1ENZA 5L51A 2VHXA 1K3TA 2UDPA 3DFZA 4YDRA 1SO8A 1U3UA 1EVJA 3F6YA 3H6KA 1SOVA 3M2TA 3LSYA 2P5UA 3GG2A 4IUYA 2YQ4A 2NVUA 5DBGA 3RSHA 2Q99A 3BMNA 3DZIA 5L7TA 1WLYA 3MWEB 1ZFNA 2AMFA 1GZ4A 4W9NC 4FJ1A 1I3MA 1HETA 3EDMA 1YONA 1P74A 1DJNA 1MXHA 4KTVE 5JMPA 1PS0A 4YBZA 2J5RA 3NTRA 3U9LA 2V6BA 3M6IA 5CG2A 3ZWYA 4B4UA 1UXGA 3C1TA 2VHYA 5K6AA 1EVYA 1E7MA 4B4OA 4FW8A 2EHDA 2HSDA 4WECA 4PZEA 2OZPA 2GSDA 3A9WA 4GX2A 4ESOA 1DBVO 4NNJA 2NACA 2J3JA 3KVOA 5A03A 2UVDA 1DC4A 4DTIA 1EFKA 3FPCA 2HCTA 5TIIA 3MJ4A 1PTJA 1XDWA 2X0NA 4BO3A 3AFMA 1U2DA 3L6EA 2YZ7A 3GDOA 1NAHA 4XR4A 3B70A 1B7GO 4CQMB 4R5MA 1BHSA 4J91A 5TX7A 1J0XO 1ZSYA 3F46A 1UDAA 5FEUA 2WTBA 2ZJ1A 4Q3BA 1KC3A 4BV8A 4WLVA 3S2IA 2BGLA 3ABIA 4PLGA 2I65A 4A26A 5L4NA 4I9UA 4DLLA 3R6DA 1PJ2A 1A27A 1P0FA 4GBJA 4GLOA 4U5QA 5HA5A 1K2WA 4FN4A 4OKNA 5U1PA 2BELA 3LVFO 5JYEA 3ZV3A 1VI2A 3D3WB 1I32A 1NQTA 5TS3A 1FDWA 2VHWA 1VL8A 3BMCB 5F5NA 1BXGB 1LSUA 4ZN6A 2R6JA 1EVZA 4QQRA 4XJTA 4CMGA 1LC3A 5T8KC 1J5PA 3I5MA 5JCJD 3BHIA 4JJGA 4Q3EA 4R4JA 4KUEA 2HK9A 4O1MA 1BRMA 5DZSA 1LI4A 1Y9AA 3PJDA 4HUJA 1LBEA 3ROQA 5FWNA 1R0SA 2J5QA 3WS7A 3H2SA 4Z3DA 1QR6A 1Z45A 4A73A 4PFJA 4QEDA 4YA6A 1GQYA 3HSKA 4XQGA 5DBFA 1UXKA 5F3RA 3WQQA 2NTJA 1IZ9A 1XEAA 3H9UA 3MTGA 3C7DB 1EBFA 3WOHA 4CR6A 4DQXA 1ZNQO 2Y68A 1CIVA 4L0QA 1VM6A 4JX8A 1EDZA 2CF6A 5EQDA 5IDXA 3PQEA 2Y1EA 3HDJA 2NU7A 3WXBA 4BO2A 1G0NA 2HMTA 2O7QA 2YHIB 3GVIA 1JWBB 3LT1A 4IMRA 1JKFA 3UFXA 1FMCA 4NZ9A 4FFOA 2EWMA 1WZEA 4HNHA 1A5ZA 7ADHA 1JN0A 3VPHA 2QX7A 3DB2A 3G0OA 5CDYA 1G0OA 2EXXA 4J16A 4J6FA 3VOSA 4NBTA 4ZQFA 5MGBA 1QSGA 2FZEA 1VJ0A 2V6MA 2X86A 4NH4A 2NQTA 1XR3A 3QLJA 5L7YA 1X0XA 5A06A 3I4CA 3PWZA 1X7HA 4YAIA 4E13A 1LQUA 4RL6A 4BMSA 4JXKA 3T7EA 1VPDA 5DNAA 3V1UA 2VYVD 3K73O 2CZCA 2PA3A 3WICA 4MKXA 3PWKA 1MV8A 1RKXA 3I9NA 4CL3A 4XRRA 5ILOA 3ST7A 1PJCA 1ZEJA 4D42A 1U2GA 4DBVO 4PLYA 5IXSA 3FHLA 4PG7A 3F1LA 1VL6A 3M2PA 1A7AA 2ET6A 4EW6A 4DIOA 2AW5A 4WASA 3H3FA 4DQVA 5GZ6A 3NDRA 4QSMA 5B4UA 3WIDA 4WNIA 4TKLA 4IQ0A 1LXCA 2FR8A 1BVUA 3IKVA 1KEWA 3BMOA 3C85A 2XPCA 4LMRA 1BSVA 2PTGA 3PYMA 4BGEA 2IYOA 1RM0A 1JDJA 2WE7A 3RU7A 4GPD1 4R5HA 1DFIA 3HADA 2FR0A 4IPTA 3EK2A 4ZQGA 3RVDA 5K1SA 2CVZA 2VUSA 1DOHA 4HX5A 3WTCA 1EE2A 4CLRB 3LU1A 3RU9A 2G0TA 1N1EA 3FF4A 4MP3A 2WE8A 3BMOB 4HKTA 4J0FA 1P1IA 3JQ8A 5AXAA 4BNZA 1JW9B 1Q7BA 1E3SA 2DBRA 2RH4A 3BXXA 5HRUA 4FD3A 4YAKA 5TGDA 4C4OA 1AE1A 4CMIB 3M1AA 2CDBA 1SEVA 5COAA 3RC9A 4NBVA 4CLOB 5H81A 3TDKA 4E5MA 5U4QA 1EUZA 2NVBA 3TFOA 1LSSA 2BI7A 1Y9EA 4YR9A 4YB8A 1TT5B 3DZFA 1PS8A 4M8SA 1QLJA 5L9AA 2RCYA 4X54A 4YJGA 2Q2QA 3QVTA 3GF4A 3G49A 3UHAA 2DFDA 4BNMA 3S2FA 3AJRA 4DYVA 4CV2A 1E92A 2Q2WA 3OIGA 4GSKA 1R12A 3UCEA 3VVBA 3IP3A 2Y1FA 5KJ1A 1D4FA 4BGUA 5JDIA 4IDFA 1DAPA 3VH3A 1LLQA 3OA0A 3DC2A 3OIDA 2EP7A 1F12A 4D3FA 3LYLA 3VDQA 4EJ6A 2WYVA 4LVUA 4BO6A 1I3KA 2UUPA 3ANLA 1H5QA 5JDCC 1QKIA 4PG6A 3UF0A 4Z9XA 5B4TA 2DC1A 4IDEA 1EUCA 2HKIA 1QYCA 3DOOA 3JQ6A 4XQEA 4GI2A 1SNYA 3WG9A 3G1UA 4M54A 4BO1A 1P1HA 3DZBA 4I1IA 1IZ0A 4BL5A 1A9YA 1SBYA 3KHUA 1ULUA 4P4LA 3B6ZA 4W82A 1H6BA 2FSSA 1LLCA 1U3VA 2BHLA 3RFVA 1CWUA 1P9LA 4UEOA 3HQ4O 4UUNA 4XDYA 4DC1A 4OQZA 2JCVA 2WJPA 4ZICA 3OJFA 1IHYA 2RIRA 2AA3A 5TNXA 4LISA 2DPHA 1U5CA 2C2XA 4P4GA 1E7RA 3IKTA 3TN7A 3NGXA 3VZQA 5CDGA 3WFIA 3WSVA 4DVJA 1SOWA 1LDYA 1PU2A 2YW9A 1YRLA 3NTOA 2VNSA 4M1QA 3LC2O 4RDHA 4II2A 5TJ9A 4NPCA 2P4HX 3PZRA 3UUWA 3ZHZA 2FSVA 4N7RA 4TRNA 4Y6PA 4OOFA 4BNTA 4XIYA 2VWQA 3I3OA 2EGHA 3RC2A 3WX0A 2Y99A 4FQ8A 3CUKA 1NFQA 4YJFB 3GGPA 1BDBA 4R16A 3JD3A 4KQXA 1QORA 3GZNA 4UUPA 4DMLA 4Y6RA 1X0VA 2GDZA 2JFFA 2UYYA 3PTZA 3JQAA 3TQHA 3JD1A 2GGSA 4FIZA 1Y8RA 3WYCA 4MVJG 3E6AA 2GN6A 4ZGWA 1HWYA 3NYWA 1T1RA 4N18A 4GSLA 1RJWA 1I2BA 4B3JA 1ZVMA 1SZJG 5I7EA 2I67A 4U0KA 2C07A 3S2GA 1CERA 1E3WA 4KOAA 3B1JA 3AY7A 4P4NA 5KVQA 4GX0A 2P9EA 3W4KA 5KVVA 4BKRA 2NU9A 4UAGA 4XEHA 4HWKA 2E4AA 4IDBA 3VKVA 5FF9A 1XWFA 1U9JA 4ZJUA 2IDZA 4ALLA 1VE9A 1IYZA 1YB5A 1ONOA 1HZJA 4CM8B 3NT2A 4PGFA 4GX1A 2D2IA 3NRCA 2PNFA 4GLLA 2IXBA 2DAPA 4FFMA 3JCZA 3W6ZA 2VWGA 2BFAA 3CINA 2IZZA 1NHWA 4WEQA 3E1KA 3OH8A 4RF5A 1KVUA 2R00C 2C82A 4CODB 5ICSA 2D4AA 1GQ2A 1Q0QA 2EF1A 1V8BA 4J7UA 1ZZEA 3DAFA 1EQUA 1VLLA 1MP0A 3RKUA 3WYEA 1YL6A 3B1FA 1NTOA 2VRBA 4E21A 3KRTA 3OETA 2ZB8A 5CDUA 3OQ6A 3PJEA 1N7HA 3GNTA 3C24A 3C1AA 3DBLA 3WQSB 4J9UE 3KLPX 3GAZA 3CZMA 3OP4A 3KUXA 3JD0A 1GTMA 1XA0A 2PKQO 4IQ8A 2X0IA 4FS3A 4BNXA 4MO2A 3FD8A 5BNTA 3QVXA 5H83A 1V0JA 4RV9A 4E5KA 3MJEA 1RWBA 3NTQA 2W2KB 1DFGA 1HDRA 4ILKA 3I9LA 4BO4A 5JO0A 4TZTA 2PKRA 1HDCA 1ISHA 5A9SA 4IJKA 4NBRA 4R1SA 5I7SA 4BS9A 3WMWA 4E2WA 1R66A 1EFLA 2W2KA 3H9JA 3CEAA 4JIGA 4CMHA 4XDZA 3E9MA 5EINA 4CJXA 4J0EA 1JAYA 3AI3A 4G5HA 2OXIA 4RPHA 2HUNA 2OP1A 4O0LA 5JO9A 1MFZA 5CG1A 1P44A 4ZQEA 5A02A 2Q2VA 3SXPA 3ZWMA 1T25A 1VSUA 2JFGA 1BXZA 1T4BA 3K2EA 2X8LA 4UVIA 4BNYA 4R69A 5C37A 5J23A 1LUAA 1IPEA 4WKGA 4XKJA 4MPDA 2HO5A 3W8DA 4B79A 4OSOA 2G5CA 4QFCA 4WCDA 1GFSA 3NUGA 4FOOA 3NJ8A 1DAOA 5EL0A 2Q4BA 1O8CA 4S3MA 1PGQA 4R1NA 1DFHA 4S1VA 3VAZA 1Y5RA 5IN4A 1QP8A 3E8XA 1UUFA 3CPSA 4OXNA 2GN9A 3TFQA 3ZHYA 4Z3KA 1R4NA 2I9PA 3KSUA 1ZK1A 2FWMX 3PZBA 2WSBA 2X23A 4FFPA 1CJCA 1U3TA 1UZMA 2TMGA 5JPIA 4DC0A 1M76A 3RUIA 3GC6A 2J5KA 3I6IA 3I9KA 3DZJA 5F21A 2HMVA 4KTTE 4D79A 4BO7A 1I8TA 3T4XA 2PKQP 2CY0A 4YJHB 1R4NB 1HL3A 3HJAA 4L74A 1PZFA 2PWZA 3OICA 5IXYA 1VL0A 2OOSA 4JLWA 3I9JA 2X1HA 4ZU3A 1LDMA 4DIFA 1MB4A 1YS4A 1XLTA 2EKPA 3E03A 2C29D 1BXKA 4JP2A 1E77A 1P3DA 4OXKA 4QTZA 1HDZA 3H9GA 4LK3A 1LDBA 4ZA2A 2G17A 2GN4A 1KIFA 2OORA 3Q1LA 1CQJA 4AJOA 1EMDA 4WK6A 3DR3A 1GY8A 2O3UA 3RBVA 2JKVA 2FPPA 3DHYA 4HFRA 5A05A 1PJTA 3ANMA 3EC7A 4I5EA 3O38A 4U6SA 2DM6A 1B14A 3RBZA 2GUGA 1PZGA 4CM3A 4DPLA 5FI5A 3OMLA 3TL2A 3H5RA 4L4SA 3L9XA 2LDBA 2ZTUA 4O6VA 3PVZA 2G1UA 2Y66A 3FPLA 3BTUA 2IYPA 4D7AA 4NHEA 1EDOA 1M75A 3DAGA 4XJSA 3GGGA 4KUHA 4YAJA 3DBVO 1QRRA 3IJPA 2X9NA 1UZNA 4TVBA 3OEYA 3R3SA 4EUHA 1BG6A 1WDLA 3PJFA 4RLSA 3HHPA 5K9ZA 3O9ZA 1ZBQA 3HUDA 4YT8A 1ADBA 1DRUA 3IIEA 4U8GA 1V35A 1E7SA 4CM9D 3GUCA 3BMQB 4UREA 2CF5A 2Q1UA 1PL6A 4PLWA 4ZHSA 3MWDB 4WGGA 2C2YA 5EPOA 4W4TA 3RUAA 4R01A 1Z82A 4AL4A 1J49A 2QQ5A 2I66A 4BKQA 2C7VA 3QWBA 4W6ZA 2X9GA 3LF1A 3Q9NA 1E1LA 1JWAB 2WYUA 3SC6A 4XX0A 2O2YA 3D4OA 4J4HA 5DULA 3LZ6A 4YJDA 5TLSA 1FXSA 3I52A 3F5QA 8LDHA 3BHJA 3VH2A 2JCXA 3BMNB 2YDXA 2NADA 3BTOA 3K92A 3BA1A 3I6QA 2VOEA 3HDYA 1PGJA 2Q49A 4J7XA 3JQ9A 1I01A 1LNQA 3UOGA 2O48X 5C7OO 1HKUA 3DBRB 4JBGA 2FPIA 4W99A 3QRWA 5JDIC 3DDNA 2PD6A 2XF8A 1V3UA 1NWCA 1N7GA 4XYEA 2XAAA 2O3JA 3ZWWA 2Y1GA 2D5AA 3HE3A 3SLKA 5A5EA 3BHMA 4M86A 4MP8A 1PZEA 3CZRA 3TZCA 2X6TA 1YL5A 2VWHA 1K6IA 5T67A 4CM6A 1PR9A 2HK8A 1DHTA 3VHRA 4KDFA 1OBFO 4BHTA 1JA9A 5ICMA 4CQMA 3ON5A 4GGOA 4RZIA 4RVUA 1GZ3A 2OUIA 1GV0A 4NG5A 2BD0A 5EQFA 5JE8A 1HDYA 5HM8A 1C14A 5TC4A 2XXBA 2EJVA 1HYGA 2NLOA 3JSAA 4FGSA 4ZQBA 3NKLA 1PX0A 2B5VA 2D8AA 1GQQA 2JHGA 2W2LD 1LC0A 3AM4A 4NQZA 3ZWXA 1ZSNA 4JBIA 2HU2A 3GUYA 1T24A 1NX6A 4YCAA 2GN8A 4F45A 3OHSX 1EK6A 5KNLA 4CMKA 3WSWA 4EJ0A 5GZ3A 1HRDA 3DZGA 1ZH8A 4PRLA 4AJIA 1Q7GA 3O8QA 1W73A 1XELA 4URFA 1NNUA 3CXRA 4RCVA 4UVEA 2CFCA 1B0AA 1VKNA 2VYND 3BMCA 3DQPA 4A5OA 3ZV4A 3IJRA 3S8MA 4Z9FA 4D0SA 2DTEA 1W8DA 2GNAA 4BNKA 1D1SA 4JN6B 3PRJA 3GN2A 4U7WA 4WCFA 2I3GA 2CNBA 4CUZA 1ML3A 2W98A 2AQ8A 2I99A 4YXFA 3GDGA 2DT5A 4IJWA 2OGUA 4CL8A 3PIDA 1E6WA 3AOEA 4EJMA 5L4LA 3GRPA 3K6JA 4PZDA 5AXCA 1GDHA 3ASVA 2Y1CA 4Q3NA 2GD1O 4EGFA 1T4DA 3Q6IA 1UP4A 1OOEA 3BTVA 4LN1A 2ZTLA 3RUFA 2PZLA 2JCYA 1X14A 4R1TA 3G1TA 1M67A 4UEJA 4E33A 2FRDA 2JJYA 4R41A 3LT0A 2NVWA 3ROKA 4R9SA 5A3VA 3NDIA 4MDHA 4IXWA 2IEBA 2AEJA 3T7CA 4YWJA 3PWSA 4RQUA 3DTTA 3IOYA 5ADHA 3NJ4A 9LDTA 1GEGA 1Y1PA 5T64A 4O63O 1H6DA 3WBBA 3U49A 4IS3A 2D3TA 4IDCA 5CP8A 3JQAB 1AGNA 1B16A 4BNJA 4P38A 1A7KA 2F1KA 1Z74A 4PVCA 4CM4A 5H82A 3PK0A 4A0SA 2H5LA 3S2EA 4BMVA 5CEFA 1E7YA 3ZGYA 4NJMB 3EW7A 3ZV6A 3CKYA 4H15A 4XGNA 1A71A 3VC7A 5C3MA 6ADHA 3FBGA 4KUGA 3EYWA 1TEHA 1LRJA 3EMKA 1E6EA 4TRMA 4CM4B 3FCOA 1CF2O 4MJLA 1F17A 2O7SA 1NP3A 1MUUA 4A03A 3JQFC 3VDRA 1AUPA 1ZW1A 3TOXA 3TZQA 1WXDA 4CLHA 1H9BA 1KETA 1E3IA 4R68A 1KVSA 3RC7A 1Q0HA 5KKCA 4CLXA 1VJTA 1O95A 2FN7A 2W4QA 1T2DA 4BIIA 1I3LA 3RAJA 2VCYA 3K9QO 1MGOA 1GV1A 2QIOA 3RUEA 3I9OA 5F5LA 3DXFA 4IS2A 5ENDA 4R3WA 1FK8A 3QQPA 5I8ZA 1UDBA 4UVHA 4BNLA 4MIOA 2PGLA 3HDHA 4TVOA 5L4SA 1DRVA 4LRTB 4MVJA 4PVDA 4JCOA 2H9IA 1PEDA 7MDHA 2VUTA 3PIIA 1I2ZA 3N74A 3QY9A 4XB1A 4LCEA 2JFHA 2ZATA 3ZI0A 4B7XA 1IOLA 2OHXA 3D0OA 2YUTA 3FN4A 3U09A 1UAGA 1TXGA 1L7EA 4NBUA 2A35A 4J43A 1B26A 2E48A 3QP9A 4IXTA 4NFSA 3DBLB 3LC7O 3BZUA 3S1LA 1JAXA 3EGOA 3CH6A 3JD4A 3PHIA 3PP8A 1N92A 1X7DA 3BIOA 1TT5A 2Y67A 2CSUA 1P45A 4TKMA 3G3EA 1XQ1A 4YJGB 3ONDA 2E49A 1R15A 2VZ0A 3KYCB 2AHRA 3OFSA 2YQ5A 3Q3CA 2GPTA 5IDWA 2P91A 4PLCA 3JQ9C 1HEUA 2IZ0A 4AJ1A 4EI2A 5K6AC 3EAGA 5EESA 3ROPA 1HYHA 3GQVA 4WOKA 5A9SB 1WPQA 2X5JO 4NI5A 2YHIA 2C5AA 2FY8A 3AUTA 1NHGA 1ZCJA 2AEMA 3SBOA 2B36A 4YJFA 3AK4A 3AI2A 3OSUA 1NFFA 4YAEA 1NYTA 3JYNA 1A4UA 5A4DA 5JDCA 2VYNA 3OJ0A 2PGJA 2GZ3A 1NFRA 3U4CA 3WB9A 2Q50A 3DAPA 4AVYA 5IN5A 3HWRA 4Q3CA 3UICA 4PLFA 1IE3A 1PL7A 3WGQA 1QV7A 4H16A 2OBNA 1SAYA 1K5HA 5C7IO 3C7CB 2PK3A 2POQX 3W8EA 4E0BA 3TWOA 3L0DA 5BSFA 1XG5A 4RPKA 3PI7A 5TQVA 5JW6A 3ZWCA 3PGXA 3DBHA 1ZXBA 1KY5A 4WLEA 4A10A 4ID9A 3QJ5A 2I6TA 3GVCA 4I9HA 1UR5A 3C1OA 3L6DA 3O4RA 4TRRA 4D46A 2YFQA 1ONNA 2WWRA 2YV3A 4TZKA 4L4XA 1LDEA 4ZVVA 4XZ3A 5F1OA 3DBHB 4BNWA 2Y0EA 2IXAA 1ZK4A 3ZNNA 1E3JA 4FOSA 4R54A 1TVEA 2G82A 3GFGA 5I8WA 2D0IA 4YRAA 4BOYA 1K6XA 1Z7BA 2PZMA 3FSRA 4PG4A 5HS4A 4OMUA 2HMSA 1HDXA 2Y1DA 3QHAA 3ZHXA 4WNCA 1YL7A 3ZU5A 3H5NA 4BNVA 1LU9A 3K8ZA 1DC5A 1GAEO 5IF3A 3UGKA 1ONPA 4G65A 1O94A 3SLGA 2ZCVA 1JVBA 1LLDA 3UCXA 2HDHA 2O23A 1U7HA 4MKRA 1CYDA 3H9EO 3KYDA 1D7OA 2UV8A 2P4QA 4J2OA 5JY1A 1NVMB 4M89A 2C0CA 2NQ8A 3ZWOA 4F6CA 4MOWA 5THKA 2BRUA 3RC1A 3DWFA 1SPXA 4AICA 3IQDB 3F9IA 4C7JA 1H2BA 4WLOA 5F1KA 1MXFA 4FJ0A 5KWEA 1O0SA 2WDZA 5JC8A 4AG3A 4JP3A 1LSOA 2OBYA 3OQ1A 4HV4A 2NUAA 4LSWA 4EEXA 1WAMA 4IBOA 1GEEA 1ZMTA 4Z9YA 4FC7A 1GYPA 4Q39A 3PPIA 4DYDA 3RUDA 3GNSA 5B12A 4K28A 3ZWBA 4IJUA 1O6ZA 2O4CA 3MTJA 2PGDA 5KJ6A 2EP5A 1SMKA 1UP6A 5COBA 2HJRA 4ONEA 5AOVA 4DWVA 4CV1A 1MLDA 5ITWA 1LX6A 2AE2A 2GYYA 2A94A 3D64A 4CLDA 1DIHA 2VTDA 1JLLA 3SC4A 1ZIDA 4II3A 4DUPA 5KJFA 1BXGA 4M55A 1ORRA 2DU8A 1M66A 1P1JA 5GMOA 2DBVO 2B4RO 2Y1OA 3H7AA 2CUKA 4U6QA 1R6DA 4I5FA 4CR8A 1U8FO 2X22A 1E3EA 4RPJA 1TT7A 3ITDA 2BFPA 2X58A 3ZU2A 4RQTA 1I3NA 4J1TA 2ZCUA 3GA0A 3L6OO 1IHXA 2Q3EA 4DREA 4CMJA 1GUFA 4ND5A 3ZU3A 5CAEA 1RYEA 1GUYA 3RFXA 2I76A 5BSEA 4I5GA 4IDAA 4YJHA 4MIEA 2JAPA 4NIMA 4OJNA 3UAGA 4C7KA 2HRBA 5G0UA 1NPDA 2VZ8A 1CQIA 2HRZA 2BH9A 4J2HA 3KEQA 1HSZA 4RVSA 1I30A 5FYDA 1PZHA 3WNQA 1R4MB 1YBVA 3IMFA 1VSVA 1DO8A 1RM4A 1S7CA 1Z7EA 2AG5A 1FJHA 1ZJZA 4BNUA 4BGIA 1XIVA 1O5IA 3INGA 1PGOA 4UUMA 3RUCA 3ETEA 2B83A 3MJTA 1ZUD1 1U1IA 5HTOA 3JV7A 4FBGA 4MVJH 3INRA 1YH3A 1JVSA 1ADGA 2EIHA 3MZ0A 3ZWVA 3K31A 3KETA 1NR1A 1D8AA 3UVEA 2O3SA 2X7HA 2ZB3A 3GEMA 3VH1A 3FR8A 5IDQA 1UXIA 4BO5A 2VUUA 1YXMA 3FNGA 4BO0A 3W4IA 3RIHA 1FDUA 3RWBA 2AEFA 4N5LA 1UDCA 4JJIA 3ONEA 4UVDA 3GRKA 4IJVA 4BKPA 4MKZA 5BR7A 5GZ1A 3L4SO 1AXGA 2IEDA 4J1NA 2XOXA 4QFDA 1FDVA 3P5SA 1PL8A 1Y8QB 5KVSA 1HE4A 3GK3A 3H5AA 3RFTA 2WM3A 3C8MA 2GZ2A 1YJQA 3PHLA 4N5MA 4TQGA 4CM1A 1H94A 3W1VA 4BV9A 3V8BA 3GVXA 2C5EA 4HNGA 3DMTC 3LT2A 1YE3A 1DHRA 2NVUB 2J3HA 2F00A 5KKAA 1SB8A 4CM8A 3EVNA 5F1PA 2D1YA 3GHYA 1UAYA 1MG0A 2QZ9A 3JYLA 4IM7A 4PLTA 5JLAA 1LQTA 3GMDA 4IGEA 1YO6A 3QE3A 1DLJA 4CMEC 4YAGA 4OQYA 1XCBA 3F3SA 2NU6A 4NK4A 3QVOA 3VZPA 2H6EA 3GN1A 1P1RA 4KWIA 1M6WA 3WGZA 3V2HA 4DL9A 2R2GA 1H6AA 3QWHA 3ROMA 3RJ9A 1CDOA 2GCGA 3DBRA 4Y6SA 3PGJA 4CLOA 1I10A 4E2YA 3U4DA 1OC4A 3UN1A 5EN4A 5G4KA 1GPDG 2ZQZA 1GR0A 3BAZA 3F4BA 3IS3A 4ZQHA 5KJEA 3DEYX 4B8WA 2GRAA 4MVJM 2G76A 4K1LA 3KYDB 4F3YA 4D3SA 4ALMA 3OQBA 4HBGA 4CLRA 2H1SA 4JBHA 3TNLA 3P2YA 2PV7A 2LDXA 5G4KB 4Y67A 5LDGA 2B5WA 3OA2A 2EG9A 3K2BA 4AFNA 4W7HA 5DP2A 3GVHA 1RYDA 4CMIA 1N8KA 1XGKA 4YQYA 4HY3A 4QECA 1F0YA 2AQHA 3JYQA 4FGWA 3RROA 5JXWA 2YV1A 3JQAD 4EUEA 3I83A 3V5NA 1LEHA 2B0JA 2Q1WA 1H6CA 3TJRA 5DP1A 4OIMA 3NDJA 4UUOA 1F8FA 4D45A 1DIRA 1HYEA 5BNIA 1MFPA 1T2EA 1J6UA 4HFJA 5ER9A 1DSSG 1Y6JA 3R1IA 3QW2A 1SCUA 5JC1A 3OECA 5A9TA 1BDMA 1TB4A 3IC5A 3W8FA 4AJKA 2Z95A 1QYXA 3C7AA 3SJ7A 3UKOA 3B20A 4IQGA 2ZIZA 1R0KA 2FP4A 1F14A 1QYWA 1GU7A 1PJQA 2HLPA 4BNGA 3PHHA 3RBXA 4WPGA 1KEUA 2E82A 1WNTA 1Z75A 4H7PA 2X4GA 1IULA 4BNHA 4CQLA 1PJBA 2RAFA 4CV0A 3ITKA 3GHHA 1PJSA 1WVGA 1AXEA 2ILTA 3IDSA 4I9NA 5DF1A 3TZKA 1M2WA 1HSOA 5T6BA 1GYQA 3VPXA 2WYWA 4IGFA 3PJGA 3GDFA 3UW3A 2EKLA 5G0WA 2OFPA 5EIOA 2B4QA 4IINA 1RM5A 3AWDA 3ICCA 5B4VA 1NQAO 4AJPA 1K89A 3Q0EA 3ZHBA 4MINA 5U9CA 3LT4A 4R9RA 1U28A 4QX6A 3VVCA 1EEHA 3ZWAA 1GCUA 4EDFA 3AI1A 3WJ7A 4Z0PA 1NXQA 2QRKA 4RPGA 2PY6A 4BO8A 2HJSA 2IE0A 1G1AA 3HNPA 1P31A 1W0CA 1WDKA 2QW8A 4B3HA 4MVJD 3DMYA 2NV6A 4EEZA 4GX5A 4NBWA 4J1SA 4GL4A 1R16A 5BNFA 3ZNPA 5IZ4A 1VRWA 3VPGA 4I08A 4W7IA 3KV3O 3PDJA 3ZN2A 4BKUA 3PFWO 3L4BA 5KOIA 5TF4A 4PLHA 3RUHA 2VHZA 3OJOA 2BGKA 1C0LA 4GKVA 1ENPA 4DMMA 1WW8A 2Q46A 4CV3A 2CDAA 2DPGA 2R00A 3RJ5A 4Y8VA 4XYLA 2AQIA 5G0SA 2EW8A 2J3KA 1X1EA 5L45A 5IG2A 1I5RA 3SX2A 4NJOA 1KY4A 2VOJA 5CFZA 4GQAA 4K26A 4FC6A 1MA0A 2EKQA 2O2SA 4RPLA 5BSHA 1KVQA 5G0TA 3TPCA 3QV1A 3EY4A 3KSZO 2P9CA 2NSDA 2QG4A 2PR2A 2QRJA 5EJ2A 5IFLA 3WDSA 1KBZA 3HFSA 4NK5A 3OBBA 3MJCA 3H9QA 2YDYA 1QYVA 2JD1A 1EE9A 4E12A 3MCVA 5CDSA 1PQWA 1FDTA 3U4HA 1RM3A 2CVQA 4XD2A 5B1YA 4Q9NA 5JAZA 4OYRA 1Q0LA 2RHCA 2ZYAA 1BGVA 4JROA 4CR7A 3SVTA 5IZCC 1U8XX 1H9AA 4J4TA 3FR7A 4P22A 4CMCA 2ZB4A 2PZJA 1NPTO 3JQ8B 4MVJP 1S6YA 3FWNA 4AJNA 1WZIA 2B37A 3PLRA 4UVGA 3Q2KA 3FNEA 1Z73A 3KM0A 3TL3A 1HXHA 1ZEMA 4FFNA 1WP4A 4CM7A 5KIAA 5BQFA 4FFLA 2DQ4A 3U3XA 4NU5A 1PS9A 5CEEA 1I2CA 4RVHA 3LLVA 4I8XA 4OL9A 3MEQA 2ZJ0A 1LJ8A 3LC1O 1MG5A 3NAQA 1ZSVA 3SJUA 4PN3A 4AJEA 3QVSA 4XCVA 1NAIA 1RPNA 1LSJA 4NFHA 4XYBA 4ALJA 1GL3A 5JSFA 5TSDA 1YVEI 4BQPA 4CPDA 4NJMA 1UXJA 5JNLA 4BKOA 3G17A 4KQWA 1Q2XA 4NU6A 4E2XA 1TLTA 1AN9A 3JQBC 4ND3A 5A3JA 1Q1NA 1NPYA 2O3TA 2ZQYA 2X9VA 5IDYA 3KYBA 1DB3A 1DIAA 4B8ZA 5AYVA 2OL4A 4HXYA 1N2SA 1ENYA 4R51A 3TSCA 3HN2A 2B69A 1X7GA 4E5NA 1YJ8A 3FTNA 1WDMA 2Y0DA 1PSDA 1LDNA 4DXHA 4J49A 3ASUA 2D59A 2AQKA 1NBOA 2A92A 2EGGA 4H3VA 1T2FA 2Y05A 2DFVA 5I9LA 2OP0A 4FB5A 1Y81A 4TSKA 4BGVA 1UXHA 2GR9A 4JJFA 1QV6A 3OIFA 3U4IA 3EVTA 4FFRA 5HBRA 4AJ2A 1JTVA 2BGMA 2DBQA 1CRWG 5I7VA 4CMEA 2Y93A 3CMCO 3NV9A 2PFGA 4E6PA 1VKOA 2IZ1A 3AFNA 4OGWA 5JAMA 1ZMOA 1QXSA 4D3DA 1YDWA 2NTNA 3HFGA 4MVJI 3AUAA 3ZW9A 4LSMA 5JS6A 4WCFB 3RASA 3AM5A 4D43A 1ADFA 1UZLA 2OMEA 1DDOA 4O59O 1E7QA 3VZSA 3W4JA 4RJTA 5IJZA 1HE5A 1OMOA 2YV2A 2VHVA 1B3RA 4YRBA 3WYBA 1YWGO 4PLPA 3QSGA 1KS9A 2CDCA 5EMHA 3V2GA 4PLVA 2Q45A 2ZYDA 2CD9A 1GD1O 5GY7A 2Q1SA 3PYLA 1N5DA 1Z6ZA 1J4AA 3JQGA 1XU9A 3KEOA 4EYEA 4YPOA 1TA4A 1F8GA 1T2CA 2RH8A 4CUKA 1E6UA 1DEHA 1EK5A 1GPJA 4D41A 4AJ4A 4Y98A 2FHSA 5T5QA 3WWZA 5BSGA 1SC6A 2E6UX 3EUWA 3L77A 4YYZA 1X13A 4HFMA 5JCXA 1A4IA 3GZNB 4ZD6A 3ENNA 5TRTA 4JNKA 1ISIA 1X1TA 4J4BA 1N9GB 4E30A 1HLDA 5KTKA 1C1DA 1CETA 1NQOA 2DLDA 3FI9A 2Z1MA 3HG7A 3U5TA 2C20A 4B3IA 3NT5A 1N9GA 3B1KA 3CMMA 3KTDA 2IODA 2UUOA 2VNAA 1C1DB 4XIJA 2Q1TA 1U3WA 2P68A 5B37A 3M1LA 1YQGA 1ID1A 1ZKMA 4G81A 2DUWA 1F06A 3AY6A 3D5TA 4J7CA 1AHIA 1V9LA 4KDEA 3ZWPA 4MVJF 3D4NA 3DTYA 3ONFA 3PQFA 3WFJA 5K0ZA 1Y8RB 1O89A 4NDNE 2BKAA 5DCYA 3WNVA 4UEKA 2CMDA 1C1XB 2ZTMA 1BW9B 5CHEA 3VKUA 1DIGA 1KEPA 3WIEA 3DFUA 3AUUA 4N54A 1JKIA 4GVLA 5G2OA 1GZ6A 3TZ6A 5L53A 1W4ZA 1GYRA 1HT0A 1NVTA 3RI3A 1R37A 2EERA 1QMGA 3TF5A 3BTSA 1BW9A 4GAEA 3E82A 4RORA 1WWKA 3CIFA 1H93A 1JU9A 1I24A 4BUCA 1V6AA 3D3EA 4WCFC 3WLFA 1Y7TA 2PD3A 1DPGA 3GNQA 1NASA 3U0BA 1N1GA 4RF2A 2P5YA 3E9NA 4XGIA 5JAIA 1YB4A 1M6HA 4QO7A 2I5PO 4PG5A 4OH1A 3VPSA 1ISGA 4OAQA 5I9MA 4J3FA 1XYGA 4M87A 3IUPA 1E5LA 4ZRNA 5KJCA 4LMPA 5DDIP 3WGGA 2RHRA 3UH1A 1IUKA 1P33A 5JMWA 3DL2A 2O3RA 1OAAA 3I9MA 5C5IA 3LDHA 4QXMA 2PH5A 1FF9A 4XQCA 3DOJA 1AHHA 1TI7A 2FMUA 3RKRA 1OFGA 3P7MA 2X0RA 3SEFA 1ZO8A 1ZK3A 2JHFA 4BNNA 3I1JA 3P19A 4WLNA 4LRSB 3N58A 4YRDA 5JCJA 3VZRA 5I9NA 4MVJE 2JAHA 1PR3A 3KOUA 3O03A 3WGIA 3L4BC 4K9DA 3STHA 1R4MA 5JYDA 5A9RA 2GF2A 4XYMA 3WR5A 3LLSA 1ZJYA 3WBFA 1V3TA 1WMAA 3O8QB 1DLIA 1LRKA 4QO8A 5IZCA 3GG9A 3JQBA 1B8VA 3ADOA 5IAAA 1E1MA 1PJ3A 1XHLA 5CDTA 4B7UA 4YT2A 1HTBA 3A1NA 4F6LA 2DTXA 4L73A 3TRIA 3RQSA 1YGYA 3LF2A 3D3WA 1VJ1A 1PWZA 4BB5A 3D4PA 1C0KA 2WD8A 3JQFA 3NX4A 1ENOA 2J3IA
chains in the Genus database with same CATH superfamily
5CA0B 4ENPA 1NU6A 2OO5A 3ZNOA 4CQLB 4Q01A 3AHFA 1PGNA 4M6WA 2L18A 2O5VA 3I32A 1JBKA 3LG2A 3PFFA 4OM8A 4HDOB 3C6ZA 3KLNA 2WD7B 3WMXA 1ZIXA 2O5EA 4ZVTA 4JAVC 5C2JB 3U39A 1YB1A 4KLZA 2X13A 1QLHA 4ZRMA 2ZCJA 2C92A 3NGLA 1KI8A 4TV9B 3U1BA 1F48A 3B5EA 4RIHA 5HKOA 2C9DA 2HAEA 4Q02A 1WB5A 1L5OA 2FZWA 2R8OA 2P5TB 4N7MA 5DLQC 2YS6A 1KFKB 3KYIB 1I0ZA 4OFWA 4YRIA 2AYYA 4F96A 2CVPA 2ZRMA 1EUYA 4B40A 5CA1F 4N0DA 4NE9A 2X8JA 3ESQA 4UEWA 3TVTA 4A7PA 4RSHA 1P5HA 3PJRA 2V6IA 1A97A 2D62A 3FYCA 5AOAA 3SIXA 3LFHA 2NUPB 1G5PA 5GOTA 1R6AA 5DNWA 1KI1A 4BLWA 1KJNA 2AN1A 3KB6A 4YIKA 5FX2A 3VBCA 4FFWA 4QTTB 5KVCA 3PHGA 4J90A 2VCHA 4LYDA 2PX5A 3FFWA 1OZFA 4Q4AA 4GUDA 2FRVA 2OWEA 2IIBA 3MJRA 4BKMA 2I8LA 1RHUA 2UXDB 1V3VA 2J7KA 3AOGA 3BD8A 3ZTYA 1P60A 2C83A 2VSYA 2X6RA 3D0KA 1HT3A 5TT0A 5ITVA 2QMUA 1XI2A 2V7WA 2HQBA 4Q3DA 3HDTA 3ETCA 2C7BA 1H3FA 1MX3A 5KCZA 1G4AE 1E59A 4IOJA 5BMOA 4IOMA 1T36B 2VQ3A 3W2TA 5J3JA 3K5PA 1K7FB 4AD8A 3PU6A 4D8TA 1A2BA 2L69A 4BNIA 5GJBA 4IXDA 4FPXA 4IJ5A 2JLRA 1TM7E 4BLUA 3OX3A 4BE4A 4XWWA 3ABZA 4G8DA 3OZBA 4HMPA 4X6UA 1IM8A 4BJ1A 4KLRA 4RY8A 3T5MA 4CIDA 1U8AA 2NWQA 5EFZA 5TT1A 5EZ6B 3CLRC 5GONF 4W1PA 4L9SA 4MR9B 2PD4A 3H3JA 2M6LA 1MO6A 1YQWA 4FFBA 4CL0A 1CV2A 4DR5B 1JUDA 4PCAA 4QOFA 1YNOA 3L9WA 3EHEA 3ZDZB 2DBZA 5C8YF 1V8PA 1Y3FE 4LYAA 4TTIA 4MARA 1EFDN 1E5QA 1MU0A 3L7KA 5FPTA 1S2DA 4ZAFA 2AJCA 2QZZA 4PZCA 1QH1A 3SNHA 2FPGA 2J87A 5CU7A 3ZW8A 4BBAA 1JS1X 2R7AA 4XASA 4LAFA 4M4SA 3KCQA 3FRHA 2JJ1A 3E5MA 2GM3A 2GBGA 4LCJA 2AUNA 1HZZA 2I2DA 3DOCA 3GFBA 4FKMA 4G1BA 5IJAA 4F9FA 4QKQA 2GBCA 4EG5A 1KJYA 4MKGA 4N8EA 3ADKA 2WOJA 4E1AA 4YHHB 1PFKA 3U40A 3DUFB 4JUCA 1XJ5A 3P2KA 1U3DA 3NT4A 4YR7A 4P7FA 3RV3A 1R0LA 1YD7A 1D2RA 4IEEA 1NVGA 4D8VA 4YMGA 4GU5A 3IAUA 3ZIDA 3OO1A 1UP7A 2CLLB 3FROA 4RGVA 2DVMA 4LHSA 1GKUB 1RXEA 1AMUA 1SG9A 3R77A 3A9VA 1R4ZA 2NTVA 2NSYA 3ANSA 4CHTA 1PLJA 3FBTA 3M9XA 4LZJA 4OH7A 2V1UA 3T9BA 3WB0A 5FHRA 1VC2A 2WSYB 4IVNA 1U0JA 1JPUA 2QVLA 3V2UA 3C43A 2X5OA 1N2EA 4L3VA 4RVOA 3SFZA 4G0UA 1PK9A 4OJQA 4KO1S 4JGBA 4PRKA 3TZHA 3BE5A 4G4SO 2XQGA 5G02A 3VFDA 1FP4B 2W83A 1X1SA 3ABRB 3Q12A 4REQB 5FL7A 3VO1A 2RGWA 3GPIA 5CFPA 1I4TD 3GGDA 3RDPA 1WM1A 2V7XA 2R8ZA 1CR1A 3RVJA 4ARVA 3CKKA 2C8KA 1DZ3A 1U99A 5EIEA 4UAVA 4F46A 5KUTA 5ALOA 1CZUA 3MJSA 2AH5A 2PRYA 1IZ7A 2H7CA 5HQ3A 2UYQA 3UJHA 3O8NA 1L5ZA 1M83A 5ERXA 3KZVA 1MRNA 2JZNA 5EG5A 3X1ZA 3EOBI 4TL6A 2DGDA 3A1SA 2C9YA 4RF4A 1KQFA 2XYPA 4GZ5A 2WI8A 4AJHA 5LQAA 3V8PA 3GD7A 4YEDA 3GWGA 4HGYA 3MHPA 2PMKA 3FOWA 3AM3A 3DO5A 3SYNA 2GFIA 4E6EA 1Z0UA 3JZIA 1B0PA 3JWGA 3CRMA 4FE7A 1P72A 3E5RA 4J75A 2IUEA 4OP2A 2XYRA 2VDWB 3V3KA 2C4UA 3AHGA 4PLZA 1FYWA 1IUPA 1NULA 1LLFA 2Q3FA 2W90A 5AHOA 4ASUA 3J80A 3ESCA 3AOEC 2R86A 2JD0A 3F4LA 2G63A 3AV0B 3EXHA 3N28A 4L3OA 4YHBA 4ZZIA 1V8OA 5KSPA 1E2HA 1PQUA 1UT6A 3JATB 5DYIA 3IOBA 4YP9A 1KORA 2B35A 2PGXA 2Q2NA 3NU1A 3DHNA 2GCOB 3H99A 3OJEA 4U0JA 1IWOA 1LDGA 3GQBA 4UDXX 3SHFA 1XU7A 3DONA 4C7VA 4RKWA 1MX1A 3EQ7A 5EUQB 2TMYA 1EWRA 2P9JA 3GLQA 3DE7X 4P8RA 4ZVOA 1KC1A 3JQGB 1DC7A 5G4LA 4Q3OA 1E9RA 3WGJA 2F67A 5IJWA 1BXRB 3F47A 1L7RA 5ILGA 4ZYZA 1BMDA 3OPYB 4M7OA 5DT9A 3WQRA 4JBLA 4DMKA 1OH5A 2VDUE 3AHEA 4LBZA 4EHAA 5EZQA 1GPAA 4B7CA 1X3SA 1CEQA 5F7ZA 3GRAA 1YV9A 5ESRA 4LZLA 3RRYA 3NM4A 3QLVC 1EB8A 1G6OA 5AH0A 4X93A 4LVCA 4W8OA 3LQ2A 2JHCA 4P5DA 2WVJA 4CF3A 4HDCA 3S27A 1ZCFA 3MUFA 1X6VA 4HSEA 2QHXA 5A1TA 4JK3A 1YK0A 1LPPA 2R8EA 2Z8YM 5DSXA 1C3OA 4DCNA 4FHCA 5FLYA 4YC7A 3VH4A 3ZZNA 4HXFB 2HY7A 1W5BA 2ONKA 4B6EA 1Q7TA 2W6QA 3AF2A 4N5NA 3LX8A 3KPUA 3LX6A 1JPJA 2RHLA 2PMEA 1L7AA 3NWOA 4P36A 1V5FA 4GKJB 4K6FA 4BPRA 1I14A 2BGRA 1X80B 3JYPA 4OQQA 5CNJA 1RJ9A 2ZAYA 2AJTA 4HDMA 1CB7A 2C5FA 1W30A 4ZCTA 2JGNA 4Y6GB 4G0NA 4YVFA 4I5DA 2ON6A 1E8DA 4AMGA 5KPDA 1NQWA 1QGUB 4BCDA 4TTVA 2AG8A 3F74A 4KODA 4NEHB 5FI3A 4N3AA 4H1UA 3TJMA 2H4FA 4EPTA 1PFWA 1XKQA 1DJPA 2GF0A 4S1TA 1Q1GA 2FW8A 5AW6A 4RFLA 1KOGA 1W5TA 1BHO1 1E9FA 1JB9A 6CHYA 5F9HA 1ULTA 3P0EA 4TWAA 4A3SA 3OJLA 4KRYA 3RYFA 3PXXA 3SFVA 2VQDA 4DNFA 2WOOA 3I23A 2UZ0A 5LD2B 1XZ8A 3B36A 1BX1A 1EGVB 1JJFA 2BBTA 2RHDA 4OQ4A 4ZI3A 2H5EA 2XUPA 4LJ8A 3V46A 1ZA2A 4PIVA 3JVEA 1EZ4A 5BVGA 1B3BA 1NLMA 5HDBB 4L75A 3AZQA 4REMA 1GPYA 5IX8A 1QZUA 2QYSA 5GOZA 4B3SB 1OLXB 1EFVA 3GGOA 1NA5A 3PTLA 2C8JA 2COEA 3IBCA 4I4IA 1HE2A 5FD8A 5LYJA 3ULKA 3LM8A 3B3AA 3E9CA 4JVLA 1DXYA 3OAAA 4MH0R 4QOEA 1DKUA 4AZ3B 4BN4A 2QOEA 4R31A 5IC6A 5U9CA 1WQ4A 2JIQA 1AV7A 3NIGB 4QD3A 5J5CA 2QN9A 1HG0A 1YOVA 3BYZA 3OD5A 3Q11A 4MWDA 3MCTA 2WJ3A 2HK6A 1P7YA 4QPZA 3ZCXA 3AY3A 4Q9AA 3HPQA 2RHGB 1O6CA 2AXEA 2YJGA 1EXDA 5JQWA 3CKMA 3EVGA 1VE5A 4AJJA 2NV0A 4RLHA 1VG1A 3L07A 4ZO8A 4CQMD 3W05A 4E4YA 2W2MA 3MWYW 1HGXA 2BJWA 3DZHA 3FG9A 2EV9A 2P7HA 1EZ1A 1RMQA 1Y3DE 3GR6A 4P08A 2CSXA 1T5BA 1Z7WA 5E9AA 4LY3A 7MHTA 1W4RA 1O9BA 3BXGA 2PHZA 4XUGB 1Z7YA 1XZLA 3VNVA 1WCIA 2G9ZA 2WHXA 2XTMA 3AFHA 2ONCA 3JQDA 1OY1A 3JRNA 5CX1B 3QU7A 4ZODA 4GVPA 4C76A 3R0XA 2OXCA 2C2BA 1XMPA 3K2EA 3KVNA 3WLKX 1X38A 2GN1A 3OKAA 4ITUA 3EVCA 2XDAA 4LXGA 1HNXB 1WCWA 3UXEA 4ZZ2A 4HVLA 1B8UA 4J0QA 1XLTC 3CLKA 4OB6A 4QGBA 4LYYA 4RC9A 4WI1A 5ADVA 3R3UA 1SXJC 3N2IA 2I4OA 5CEJA 4QBFA 3MILA 2PA0A 2ZI6A 4ZVPA 3WJAA 1QH9A 3BWDD 1JJVA 3R8CA 3TXYA 3TM4A 5FTKA 4A0FA 3EXFB 3DDZX 4L76A 1P0IA 2KHZA 3K0FA 3OM9A 2AJBA 2QD4A 1XA4A 2QVGA 1VBMA 2OE2A 2XGSA 3MD0A 3LCRA 3IR7A 4Y18A 5K09A 1PJZA 1O6GA 2ENWA 3IKMB 4R7ZA 3NGMA 3HUTA 5JNUA 2HYIC 5ESXA 3ZVMA 2E0IA 2FOIA 4DFDA 3W5BA 1SRRA 1JNXX 4GMFA 2VRNA 4JB3A 1K6JA 1XD9A 1DIBA 1KF0A 4FINA 4GXTA 4YACA 2IQ5A 1ES9A 1VYTA 2HDOA 5DI3A 5DGTA 1HF3A 2JI8A 3EBOA 2P90A 3D1LA 4FX2A 4MQEB 4RF3A 1SWVA 2XHEA 2WWTA 1KKUA 4Q7EA 3MHTA 4RZUA 3K6KA 3DTVA 2D7CA 1QG6A 3AEQA 1KNQA 3KQSA 2DRIA 4OP3A 1UQUA 4KQJA 5H02A 4Z6KA 621PA 2CVOA 4MYCA 1U5AA 1D6SA 1K0UA 2A4KA 2F1IA 1MO2A 1IN8A 2OO3A 2Z4SA 4HP8A 4LYHA 4MO9A 2CEAA 1PJLA 3UOWA 4CUJA 1L4UA 3CB2A 2VRCD 9MHTA 4OOEA 3REQB 1ADCA 2WBLC 1ORDA 2ZRDA 4PR0A 5E4JA 4EFLA 2MSKA 3FB4A 2PE5A 1JJBA 4PCVA 5GVRA 2F6RA 1FEZA 3WGUA 3A6DA 4LY9A 3K0SA 3EQ6A 5C81A 4ZTUB 4D74A 2VZ9A 1WXWA 1L0BA 4JI8B 5AXBA 2NU8A 3OTOB 3X1XA 2O8EB 1IM5A 3SQOA 3H2ZA 1J9EA 1E3LA 2OBBA 3VV2A 4CFZA 4CETA 1HZZC 4EX6A 3SLRA 1QQBA 5TEWA 3K5HA 3W0LB 5KEIA 2UDPA 1GFWA 4YDRA 5EJMA 3BFPA 2ZUFA 4ZC8A 5HKKD 3IP5A 1EVJA 2NXEA 4QQ8A 4YYEA 3F6YA 2YWEA 2WZDA 3S68A 1OT3A 1TJ4A 3O9VA 4UCWA 5JSYA 4BLVA 2JH3A 5L7TA 3DZIA 3RYHB 3CVOA 1GZ4A 4W9NC 1QBKC 3CYFA 3HJGA 4FJ1A 4QU8A 3RIGA 3DKVA 4LFCB 1FW8A 3VISA 5D1HA 2KX7A 4KTVE 5JMPA 3OQMA 4ZAGA 2NUBA 4GQIA 5BNWA 4BYGA 4K46A 1W1IA 2V8OA 2WZQA 4EUNA 4U3JB 1UXGA 3C1TA 2VHYA 1DZIA 3HV0A 4FDLA 2ZUWA 4LDZA 1E7MA 4R83A 4BQIA 4F2HA 3RRFA 2JDID 4IGAA 5EUCA 2O57A 3Q15C 1C9YA 3TLYA 2I3ZA 4HB0A 5CVVA 1DBVO 1L4NA 2CNNA 2NACA 2QX8A 1Z4NA 3IIKA 3K5IA 4JB0A 1Q74A 4OKSA 3U80A 1EWQA 5AUQA 2WSIA 3I04A 2J6HA 1Y4UA 2X3UA 4QYWA 3SZUA 3UMFA 4B85A 5IHPA 5LU9A 2KWIA 1XDWA 2OT3B 1U2RA 2BKUA 3DLCA 3GLKA 4HAWA 4LDNA 1YHYA 4JI5B 3AFMA 1U2DA 1JLKA 2YZ7A 3L6EA 5BW6B 5K8UA 5LWHA 3GDOA 1TUBA 3V42A 4CF7A 4BVKA 1XZPA 4BLTA 4XR4A 1A88A 2PZAA 5DPMA 4KIGA 3NC0C 4O2BB 1UWKA 3FOAA 3IVGA 4F4HA 1J0XO 1VYVA 1ZSYA 5JSHA 4JSYA 1HM5A 1UDAA 3ED1A 2XGOA 4WJKB 3DEJA 2XYGA 2D54A 1TZBA 1KC3A 2QUIA 2B99A 3AR9A 4WLVA 3N0VA 3T4PA 5HKBA 5F78A 2IOFK 3W9YA 2QIPA 5EVJA 5L4NA 3PUZA 4GBJA 1A27A 5CTAA 2R48A 2WJAA 3FDZB 4RKRA 1M6VB 1TC1A 4OKNA 1MC1A 2R66A 2BELA 4DRZA 3LVFO 4RFSA 2G7ZA 3HVRA 1U8ZA 2CXPA 5DYGA 2QORA 1M73E 4ZO4A 3X3HA 3PX7A 2VHWA 2H8KA 2R7NA 1BXGB 2R6JA 1JHOA 3MT7A 4OJYA 1GZDA 3RGGA 4IYRA 3E0XA 2B2XA 5FADA 3MN1A 2QRGA 2EF0A 4O8CA 4CMGA 4P2BA 4Z2YA 4BLPA 1IY9A 2ZSHA 4RY0A 4L28A 1CQIB 4FYWA 1T1EA 1MQ9A 4IQFA 4EY6A 5IEBA 5LQSA 3PR1A 1RHRA 4R4JA 3CV3A 4KO8A 4DRXB 1Y80A 2P9FA 3O1HB 4O1MA 5DZSA 1LI4A 2DLCX 3ROQA 3UC9A 5AMXA 5AKJA 1NDHA 2YOGA 2ZITA 4MAFA 3HSKA 4J7AA 1B6TA 2GI4A 3ROGA 5AD1A 5M29A 1EBFA 1SD2A 2YMQA 3F7OA 3G8BA 4B31A 4TWBA 2Q21A 2GPYA 1VM6A 5CA1B 2A0FA 2KBFA 3FIJA 1OXVA 1EDZA 1XRRA 1G18A 5AW4A 1XU4A 5IDXA 5GGXA 4FZJA 1QHNA 2NU7A 3QOWA 4IKEA 2V7QA 1ZESA 1LS1A 3GVIA 1AKUA 4IMRA 2AN4A 2KLHA 2OCLA 2FZKA 3D6MA 2G0AA 2GHIA 4NZ9A 2EWMA 1OJLA 1U5BB 1X42A 1O7JA 2OCXA 2PUDA 3TQCA 5CBPA 1Z0SA 1A5ZA 3AB3A 3IALA 4D98A 3IMCA 6REQA 2QX7A 1TL7C 2HSJA 4LOIA 1XTUA 1J8VA 3KSAC 1G0OA 2ZE8A 4GYWA 1KFJB 2JS7A 5LA6F 2LNDA 1NL3A 3R20A 1V5EA 1QSGA 4ARUA 4BVBA 1BFUA 2JGAA 2P9YA 2HMAA 1X7WA 4NH4A 1XR3A 1I6WA 1RWPA 4BCBA 4FEAA 3I4CA 4KXXA 1L7XA 1G3RA 1R7RA 2A9KA 1LB1B 1X7HA 4HTAA 1CUGA 1MHTA 1LZLA 2JLQA 4BP9A 1LQUA 3H3XA 1N6PA 1QYRA 4B46A 5JJKA 3QGMA 2INGX 3O8OB 4I1SA 5DNAA 2ETVA 3O1JC 4HDKA 2IWHA 2QEQA 1GPMA 2NT4A 2PA3A 3Q7SA 1KSJA 1Z2PX 3LY7A 4KCGA 1OKKA 4MKXA 3THSA 1XA3A 3TTXA 3HSSA 5CVJA 3I9NA 5DLEA 1SKMA 4XRRA 5REQA 4GYKA 1AS3A 3HXMA 2W6PA 3FYTA 3LZCA 4PLYA 1P1CA 3NWJA 2CV2A 1IN4A 1VL6A 4LJKA 2ET6A 4AQDA 5KAMA 4QODA 4CW7A 4EW6A 4DV4B 5TEVA 2FMHA 4ZOLF 4R9UC 5EZ5A 4BMCA 5JJIA 4KXYA 3ESDA 4TM7A 3HJFA 1JDBC 3U9SA 1HMYA 4EL0A 2FSIA 4WNIA 4TKLA 3A36A 2ZVJA 3FLAA 4IQ0A 2FR8A 1BVUA 2DG2A 1Y89A 1M2KA 2IHKA 1PYDA 3BMOA 3C85A 3IKVA 3NHAA 1W85B 4KV9A 4TKVB 1NQVA 2PTGA 3PYMA 4DLWA 2LPMA 4YV1A 3HGQA 4P1ZA 5I8PA 2WE7A 4IEFB 5A5GA 1VFNA 4ZQGA 3RVDA 3UENA 4RTRA 5K1SA 4UC0A 2Q1XA 4QICA 3WAKA 1U11A 2VUSA 4M7WA 3U60B 4M1MA 4L5JA 1BFDA 5U4XA 5IYZB 2HWWA 2P7IA 2VPYA 3MUEA 1F6BA 4P83A 2FPIB 2AXPA 3N07A 1CLUA 2NU6B 2XUKA 3LW7A 4QFBA 3HDVA 3K09C 5ABPA 2WYOA 2VDNB 3PFKA 4RANA 2RH4A 3S1AB 4OU4A 1EB9A 2GN0A 5HRUA 2XB9A 4AKHA 5TGDA 3FVTA 1P3JA 4HQNA 3GFQA 2HTEA 1OH7A 5KMGB 1DKLA 3EZXA 2NX2A 3RS0A 2X7XA 4RHEA 1GO2A 2F2TA 4M8LA 2Q0XA 3KJIA 5G1OA 3FVVA 5U4QA 4E5MA 1S89A 1ZS9A 1U65A 4I5IA 3LUHA 4Z86A 3TFOA 1LSSA 4BB0A 2H4WA 2YFYA 1JH9A 1U0HC 3BDVA 2UYHA 2FA9A 1PS8A 2RKBA 5TQ2B 5CK4A 1TM1E 4FUQA 3KAQA 5L9AA 1E9SA 3AINA 3K7EA 4CWAA 2H2IA 1DP4A 1EEXB 4YJGA 1LVGA 3V7YA 1Q17A 3I2HA 4H3SA 1GLNA 4DDTA 1T3SA 4CV2A 1DX9A 1E92A 3ZOKA 2FP4B 1B73A 2VQSA 1XQWA 4PIMA 1ZGCA 5FNZA 1MO4A 1FRFS 2NPOA 3LW8A 3WK6A 5KYNA 1N2GA 1QC5B 4JLBA 3RVNA 4BGUA 4TM8A 5IBPA 3EXEB 5EFOA 2FFRA 4IDFA 3PCRB 4GE3A 3UMGA 3JSXA 5B58T 3SKVA 3Q7EA 1F12A 4DABA 1OI4A 4DIMA 2OECA 3LYLA 3VDQA 1RBZA 3KPYA 4LVUA 4BO6A 3AKZA 1I3KA 1DQSA 1H5QA 1LI5A 2TSYB 4PG6A 4Z9XA 3TX2A 3ZIAD 4K9QA 3LUBA 5A6SB 4XQEA 5KYXA 2FPUA 2WJJA 1UKYA 3WG9A 2ZT8A 3MTDA 4M54A 1ZC3A 4U39A 1D2NA 1GHTA 5DTEA 5AJUA 1TUEA 1JECA 2R60A 1A9YA 3KHUA 3T0GA 4EPVA 3K0CC 2Z04A 3KHSA 2G80A 4H0NA 4Q9DA 4X24A 2A5LA 1EYZA 2QNBA 1KJQA 2Q6TA 3B6ZA 4IZOA 4F2PA 5ALVA 1DOZA 1KAGA 1H6BA 4IFBA 2G6BA 2ZUBA 5JECA 1P9LA 3PUIA 3HQ4O 3LPAA 1U98A 4GYYA 1N4AA 2BUBA 4RK0A 3WWPA 1ZGHA 5JSZB 1BCSB 1L8LA 2YXNA 3GA5A 1EP9A 3LY5A 1IHYA 1O2DA 1RWVA 4HDSA 4I55F 4HN2A 4LISA 5AM3A 3IKTA 2GPAA 821PA 3JXEA 2I03A 3D3KA 3NGXA 4DVJA 3AHHA 1LDYA 4TSRA 1PU2A 1XZCA 1ZD3A 1RQRA 4FYJA 3WL6A 5TJ9A 1W35A 1I6LA 3DE1X 4QNMA 4JV5B 4Y6PA 2AI1A 5F52A 3UUEA 2IU0A 5BSVA 1AVTA 4EF5A 3OESA 5HFNA 1W4AA 4L5CA 1Z62A 2VF2A 2VWQA 2X42A 5A4AA 2EGHA 3AR6A 4UNPA 1HC7A 1U1DA 2Y99A 5FPYA 3RIXA 4K9KA 4DNQA 1CEYA 1G5QA 3ZY4A 4AO7A 4YJFB 4UATA 3L43A 3GGPA 1BDBA 1ZGJA 4R16A 3TEJA 3DQZA 1Q0SA 5TQ0B 1P9WA 1D6MA 1DXOA 2OESA 3T5DA 4D4KA 2BJVA 3ZZ0A 2IBSA 2R5WA 3GP8A 3HB1A 4GPAA 4X7PA 1RWQA 4EVRA 5IKXA 1D5CA 2QRHA 3HJHA 3JD1A 1SCDA 4FIZA 1R6BX 4MVJG 2GN6A 4ZGWA 1T1RA 3OTIA 2AKYA 4FMDF 4N18A 1OBOA 1RJWA 1GIAA 1SU4A 5KWVA 1XMSA 1I2BA 3UHOA 1GSOA 3IP9A 2ZBVA 2O8NA 2CDNA 2I67A 4NBKA 3I2YX 1Z5GA 4D9IA 2HOQA 1Q20A 4Q4DA 2NAPA 5JNVA 3L7MA 1ORWA 1CERA 3OOSA 5A6VA 2P35A 2EFHB 4O4LF 2X0FA 1YQUA 3QLTA 3E7DA 2VHJA 1BROA 1VRVA 3CIOA 1GP2A 4RHCA 3X2SA 4BKRA 4UAGA 3QKSA 2WMOB 2CCJA 2RAVA 2QPTA 3IT2A 1RJEA 2PJUA 1HOXA 1R8YA 3KKPA 3TUZC 2R6CA 4IDBA 1KRWA 3RRJA 1JFVA 3OZ7A 3K9GA 4EW1A 4ZJUA 1BU8A 2E89A 2ZJBA 4Q0MA 4ALLA 1QH1B 1IYZA 1VE9A 2ERCA 3D9QX 1V6CA 4GMXA 5HCNA 3WRXA 1OXSC 3H5IA 1HZJA 1SD1A 1TM5E 4XWTA 3TE7A 4BP8A 2W2NA 2IA5A 3AY0A 3NRCA 4GLLA 5CCEA 2IXBA 2GJKA 3LP5A 3U61B 2VDPB 4CTKA 4MWTA 2BFAA 1MTOA 1NHWA 1DL5A 4WEQA 1NVFA 5ECYA 5HIKA 2OXRA 3MS4A 1Y42X 5CCBA 2YUIA 4DADA 4ZVKA 2D4AA 2QN7A 4GICA 1M8JA 4Q18A 4DCUA 4E7OA 1K8YB 2EF1A 3T3HA 3DAFA 3O4GA 1ABFA 3AW8A 1QIHA 4V3CA 1RW4A 3RKUA 4PPFA 4B0PA 1YL6A 2J7PD 2ZFUA 3B1FA 4KDCA 5AK5A 3ECSA 3V7WA 2H00A 3KRTA 2CXRA 3OETA 2G4LA 2IEGA 2ZB8A 4BB9A 1RVV1 3GNTA 3LT5A 1N2IA 3LVRE 3TYXA 5CCDA 3WYGA 2R84A 1E2NA 3PITA 5EJ4A 5EPUA 3HKEB 1E1CA 1EUDB 4H2DA 3A1UA 4IVRA 2EZ4A 2VSNA 3H97A 4JQOA 4HQ6A 4FS3A 4YV2A 1Q0RA 1NVXQ 1Q95A 1QQ7A 1CE8B 1J33A 3KQUA 3THXA 1VLMA 3QVXA 2DFTA 1YIOA 2I29A 4DEYA 1EFPB 1T35A 3KOWA 1ZRMA 2W2KB 3QFSA 2VHQA 3W6OA 1M2HA 1ST2A 3ZXYA 2PKYX 4ILKA 1OYVA 5JO0A 3HABA 1RR6A 2ZXEA 3GAAA 1RHKA 1RYYA 1USVA 2MDTA 4O4LB 5GJWC 1JIQA 1PK8A 2HF2A 2I2BA 3KC2A 4TT8A 4L72A 3S2YA 4M99A 4RTJA 2B6HA 3H9JA 4FGLA 3ICEA 4CMHA 5AICA 1G9XA 1E1QD 2QX4A 4O4JB 5EHXA 3AI3A 1NUHA 3IP8A 2OP1A 1MFZA 5CG1A 1R6TA 4N7JA 3NWEA 2WF8A 1N33B 3PNOA 5F98A 4FBLA 3IV9A 1JSRA 3AWIA 4L2IA 1LUAA 1IPEA 4AP5A 4MPDA 3T1VA 4MW2A 3GJ3A 4C7XA 5TB5A 1SKQA 1XTRA 3NUGA 1P5ZB 4M6WB 3A6LA 2C78A 1V1JA 4UZSA 5DHFA 5C52B 4HF7A 4NCNA 4XWGA 4YMTA 4CKCB 2VQFB 2ZG6A 4MWGA 4D8WA 4RK4A 1O8CA 3ONWA 1G8GA 3UGQA 1GCGA 4R1NA 2C61A 3E8XA 3IVAA 4DMCA 5EJ6A 1AZTA 5KHAA 1AA9A 2O8BB 1UPUA 1F9EA 2A5YB 1TRHA 1YI1A 4Z3KA 4TS4A 3WMFA 1SIWA 4RENA 1CQPA 3UJNA 2GQ0A 1NMSA 4QWWA 4OLFA 3ED5A 5E2AA 5HF9A 4DCJA 3RUIA 4OGFA 4JQZA 2J5KA 1U04A 3FNBA 3TMYA 4BLSA 2HMVA 4KTTE 4C4ZA 3MBOA 4D79A 2YL2A 2QTAA 3N6RA 1Y7IA 4YJHB 1O97C 2H2AA 2YJ3A 3VUEA 1R4NB 4GZLA 3GZJA 4WN9A 4LWPA 1GT91 1PZFA 1OZHA 4Z7OB 4C7OA 1VL0A 1XZMA 4JLWA 1XMIA 4E94A 4BGDA 3OZRA 1LDMA 3O93A 4DIFA 3F6RA 2XGMA 1YASA 1F0NA 3E03A 1U2SA 1RWKA 2ZT5A 3GPBA 3TK1A 1TF2A 1ZHHA 3DEHA 1NC3A 4OXKA 4FCVA 4QTZA 1HDZA 1LWNA 1CFZA 5KSOA 2FGJA 1LDBA 2QMZA 2XNSA 4QWMA 1WLSA 2NSLA 2GN4A 2EGUA 1KIFA 2OORA 1KK1A 2JF0A 3RGWS 1M0TA 3PUHA 4AJOA 1P5FA 3EH1A 3H8SA 2IEAA 4IDHA 4ZCIA 2NTYC 4NKRA 4DIKA 3Q5DA 1NZDA 1SC9A 3DHYA 4HFRA 4HK4A 3ANMA 3O38A 3VR0A 4U6SA 2LUOA 2DM6A 3ZK8A 3JQQA 3EE6A 4A2PA 2IOFA 2R68A 2HW8A 3L7NA 3TL2A 3D1JA 5IJ9A 1XMOB 1T43A 3L9XA 3S81A 4M46A 4KREA 2G1UA 2Y66A 4UBIA 3STYA 3WK4A 1NP6A 1ISSA 1RKUA 1B42A 4HRAA 4D7AA 3AXSA 4A8JA 3N70A 1T3GA 1VCHA 2FSPA 3H18A 2Q28A 3M6FA 5H3CA 3B6EA 4KUHA 1HFKA 3AEQB 2CJWA 3K2QA 1VTKA 2VNHA 3M4YA 4X20B 2V55B 4TVBA 3R3SA 1IRXA 1PUJA 2VYCA 3K1ZA 2FEKA 1AOXA 3HHPA 5K9ZA 3O9ZA 2RE8A 1ZBQA 3ICWA 3HUDA 5EJ5A 5LMZA 3KPWA 5LR6A 1FJGB 4NABA 5FXMA 3BIXA 2CGEA 3LUGA 1P2DA 2ASEA 5FTNA 1NSFA 4IIXA 5C8XA 4H60A 3PQ2A 2PRKA 2Q1UA 4XX0B 4YJ2B 1XEXB 4OXRA 2BZ1A 3MWDB 4P92A 4ETNA 5C46F 1U1GA 1II0A 1YQEA 1Z82A 3WKDA 2OQ2A 4A6EA 4AL4A 4LQLA 3AUYA 2I66A 1PUXA 4NXMB 3NTLA 3O94A 5J5VA 3LWZA 1USKA 3TTVA 1I5OA 3M4NA 5HNKA 2WYUA 2A1UA 3H19A 3I73A 4GS5A 1BGXT 3KHKA 3A3NA 4YMVA 5KQRA 4HPJB 4DM7A 2QX6A 2NZWA 2O2YA 4G1UC 4X00A 2VPXA 2BVNA 3HEMA 3LZ6A 4BQEA 4FONA 4YJDA 3RT9A 1FXSA 3I52A 1VL5A 4JB8A 3W2EA 3INYA 1FTGA 5FBHA 2JCXA 4NZYA 4REOA 4C0AC 1Y3AA 2F9MA 2YDXA 4KBYA 4P53A 3K92A 3AF0A 5JQGA 4IH1A 4JL8A 1Y5IA 2ZUCA 1EVKA 4KQFA 1AURA 2ARKA 3VPAA 4WN3A 5J9FA 1I4LD 4JVMA 3ORRA 3JQ9A 2FPGB 2J0UA 2XUJA 1OCEA 5BSUA 1TPYA 2HHAA 4ZI7A 5JNTA 3BIJA 3DBRB 3ANTA 5KS2A 2C4WA 2FPIA 3SR3A 4I99A 5JDIC 1OZGA 5EXPA 4MUFA 5K4GA 2OHJA 4QHYA 1VDMA 5TMEA 3R3XA 1NWCA 3DZCA 4INZA 4KQ9A 2IYFA 2O3JA 3DEZA 2Y1GA 3SLKA 3ICQB 4ZP1A 4M86A 4J6EA 4MP8A 1PZEA 4DDWA 2ZTSA 3EUFA 2OGSA 2CHQA 3CZRA 4P9NA 1SJ9A 2BUCA 3BBPA 1DHTA 4G67A 1QE0A 1O6BA 1UPTA 1WHTA 1M2OA 2OZVA 3IPYA 4NFLA 3TGPA 2LCIA 4L8YA 4MRPA 4ECAA 1NOKA 2Z57A 4CQMA 3ON5A 4B82A 4OY3A 4G86A 1J5EB 1K6MA 3CO0S 3DV0A 3Q8LA 4D9GA 2XXBA 1H4VB 4LPKA 1SD5A 5BUQA 1SFRA 2GFQA 4EIWA 1OFUX 1XBTA 2O6LA 3I92A 3NKLA 4ZOEA 4DM4A 1E66A 1SURA 1Z4LA 1JAHA 3R0ZA 2D0PB 1Z0IA 2C96A 2JHGA 4NQZA 1LC0A 1WD5A 3ZDCA 1ZSNA 4X7MA 3JY6A 1V5GA 3VPBA 1T24A 1NX6A 3DDCA 4YCAA 2J0QA 3WRYC 1IMOA 2GN8A 4F45A 1XTKA 4W5HA 5KYKA 2CV1A 4JEIA 3FCYA 1SXJB 1WZNA 3QKRB 1M6VA 2H65A 3CUVA 4F6RA 2EBUA 2PT6A 3K05A 1EI9A 4I4CA 1Z4OA 4UFPA 4JJ8A 4PRLA 1RJFA 3O8QA 1KJ8A 1QOPB 3MMNA 4QU0A 2O19A 4LOHA 3JATA 4NTZA 3OC0A 3P27A 4A5OA 1EESA 3IJRA 1I5EA 2BM1A 1TE2A 2K7ZA 4Z9FA 3EGDB 4D0SA 2GNAA 3HFJA 1GKLA 1PI3A 3ZR4B 1D1SA 2HLHA 1N7IA 3GN2A 4U7WA 4NDAA 2I3GA 2VZLA 4RK6A 5T3YA 4Z3OA 1TZ2A 3BE6A 2C2OA 1XEWY 2ZIVB 1GA1A 3TIVA 3QVKA 2DWQA 3P4YA 4PU0A 4EJFA 1NNSA 1NLZA 4OA8A 3RRMA 2DEUA 1VQ1A 4I66A 2OK7A 3FCUB 3GDGA 2QN1A 2I4TA 5C8YB 1BCSA 2EZUA 4HDSB 2EHJA 1QPZA 1ODJA 3STXA 1ZD9A 5FOVA 2JCGA 3SNKA 1E6WA 3U1TA 3PXDA 4HN9A 4JUDX 3GRPA 3SYRA 3SR0A 4EHLA 1RYHA 3ZH9B 3BREA 2WB2A 4TYQA 2Y1CA 2OAP1 2WC1A 1YRYE 5EP4A 3TCNA 4EGFA 2F3UA 3VRHA 4ZDKA 4OQDA 3FAZA 4RIFA 1J1ZA 1T3TA 3DP7A 4F9TA 1P39A 2JGRA 4TV9A 1PBTA 3A9TA 3OJXA 4FYXA 4L95C 1F2VA 3G1TA 2FQ1A 4UEJA 1ABEA 1HY3A 2FRDA 4B74A 3ONVA 2ZI7A 3VKHA 3F6SA 4R9SA 5A3VA 2QRPA 4MDHA 1B6SA 4U2GA 4YIHA 1GITA 3ODPA 3NALA 4U2FA 4H18A 3C8HA 4TTQA 3DMRA 3OE1A 1UM8A 3DTTA 3Q8XB 4J0KA 3RS2A 4B6JA 5ADHA 3RJMA 4X62B 4X63A 3A3KA 1Y1PA 2HA5A 3EVZA 3L6UA 3UHJA 6REQB 3DHVA 3QPCA 1F4PA 5A62A 2W2TA 3FMGA 4JWKA 5EZYF 5CP8A 2GZHA 4BNJA 4DSOA 5C7YA 1AGNA 1YVPA 1JQEA 2RGEA 3JARB 4RTOA 4M0MA 5DT2A 1A7KA 4PVCA 4CM4A 1AUOA 2H1FA 4PYQA 4BMVA 1P2UA 3C3WA 3EW7A 4X1KA 4OL0A 4DNXA 2YOFA 3TBHA 3CKYA 1ONBA 4S05A 3CFYA 3TIIA 3G9TA 3S2ZA 2LGJA 4EPRA 1NW5A 5CB4B 3GJ7A 6ADHA 3ZLVA 1KDPA 4BASA 1ACJA 1TEHA 4Y2QA 3KWMA 3KWJA 3W5DA 2YOHA 4TV8B 2I78A 4H7DA 3FCOA 2PUJA 2MOKA 3FDXA 2Z83A 5CJ2A 5EA2A 2IX9A 1QDUA 4A03A 4I1YA 3JQFC 5E4FA 1G38A 1WXDA 1TTHA 2BWJA 1KETA 2XA2A 4UUBA 3U6KA 4R68A 4F91B 4D97A 4R6WA 3NTVA 3TR0A 4BEJA 1W4BA 4CLXA 5JJCA 1W44A 2M2IA 1O95A 2FN7A 2POCA 3DDHA 3VTAA 4TMVA 3RAJA 4CNQA 1H85A 1PNQA 2BV3A 2OHVA 4DIDA 2OZLA 3H1TA 4YNBA 3MAJA 4Z7QB 5ES4B 1YR1A 3KLOA 1L5MA 1JR3D 4R3WA 2IITA 2N46A 5I8ZA 4BLQA 1RFLA 2FN8A 1AO3A 4MIOA 2GPWA 3S4YA 3T3PB 3R76A 3T9CA 3DPIA 5EIAA 1KNXA 1NUTA 2IL1A 3DCJA 4GPTA 3W1WA 4B3GA 3GEHA 3ZX4A 2CLKB 1KH2A 4JCOA 2H9IA 1OAOC 3IVMA 3R9KA 5HOQA 1I2ZA 2P3LA 4LCEA 3WIOA 2JFHA 5BVGB 4Z7NB 5K0TA 3TCKA 4B7XA 2J3QA 3UTCA 1IOLA 4CEIB 2YUTA 3SSMA 1T1JA 1TXGA 1G19A 2XUFA 3GLSA 3K1JA 3LQ4A 2A35A 3PQ6A 4GRIA 4IXTA 1ZMBA 4J43A 4NBUA 1U1EA 1SOUA 2FU5C 3DBLB 4HYTA 4NFSA 3TSYA 5K0NA 2P2YA 3VJLA 3S1LA 4Y2YA 1FJXA 4UASA 4ZO6A 1LX7A 3EGOA 2ZRBA 3CH6A 4UM9D 3TD9A 2XMBA 3GCWA 4BCCA 1HT2E 2OYCA 3QVUA 2FJUA 5LP1A 4NH0A 3ILXA 1FP6A 2F3TA 1P45A 3C3EA 5AI6A 2NVOA 3OCWA 2FETA 1U8EA 1XQ1A 1MZVA 3MS2A 1ADYA 4OLAA 2Q1YA 4J03A 4QE3A 1SK9A 2VZ0A 4MKIA 2AHRA 3OFSA 1XX6A 2UZ1A 3AT1A 1KP2A 1KHTA 2WMNB 3Q3CA 4IIDA 1L8XA 4PLCA 5KCMA 3DOHA 2JH8A 2IZ0A 1AHNA 3NHUA 1B41A 2F4VB 1Q77A 2X5XA 3E2IA 2J30A 3L05A 1O03A 5K6AC 4TV8F 5FTMA 2F8TA 2Q29A 1MBZA 2AOUA 4LZZA 2NO0A 2X5JO 2CHVA 4MB2A 5FI5A 3ZC3A 2A0KA 2YHIA 2C5AA 3U37A 1RI2A 1MO5A 2OSVA 1NHGA 1RBMA 3G8AA 4KBFA 4XLZA 3ZS9A 3NHMA 4O3MA 3A9RA 3AK4A 1RXUA 2QTHA 3OHPA 1NFFA 1QZ3A 1A77A 1G1MA 3IAM1 3KYJB 4YCDA 4R2IA 1JHQA 3JYNA 4LNUB 5A4DA 4I1OA 4DZTA 4JI0B 4G9GA 3OJ0A 4HXGA 1OTYA 2A78A 3QLUC 1IXSB 1Y1SA 2G0NA 3I39X 2ANCA 3CONA 3DF7A 3NNNA 2FVXA 3LGSA 3VI4B 4PLFA 2VC2B 4XVCA 3AVVA 4MQ6A 1RCFA 5CD1A 3UFBA 2AEEA 2J4CA 1VYUA 1MIHA 1SAYA 3CUWA 4UMFA 4ENUA 4DN6A 3C7CB 5ALFA 2HNAA 2WPNA 2ZR8A 3R41A 1ZBDA 4JUIA 4MUBA