1PL8A

Human sdh/nad+ complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
356
structure length
356
Chain Sequence
AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic and kinetic studies of human sorbitol dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords human sorbitol dehydrogenase
total genus 121
structure length 356
sequence length 356
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.14: L-iditol 2-dehydrogenase.
pdb deposition date 2003-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pl8A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1pl8A01
3BMOA 5JO9A 4B4VA 2PD3A 1OC2A 4DPMA 2X8LA 4UULA 3H2ZA 1AHIA 4IUYA 3WMWA 2C5EA 2GNAA 3S2IA 4AJIA 1MC5A 3OSUA 1PIWA 1PGJA 1SAYA 1IPFA 4GMFA 4NBRA 1DFIA 8ADHA 2O50A 5IAAA 2O3RA 1E1NA 1N92A 1NQTA 4YACA 1J49A 4WLVA 4BQRA 3F5SA 4CM8B 3VKVA 5IDQA 4LCJA 4XQEA 1GCOA 3H7AA 4IINA 1UXIA 4PLVA 4Z0HO 1B26A 5BNTA 2DFVA 3QV1A 4RV9A 3TZQA 4NG5A 1LDBA 4EEXA 4UAGA 2PZKA 4DA9A 4L0QA 4MIYA 4K26A 1YO6A 2NADA 3DBLB 2JAPA 4IGEA 2BRUA 4Y67A 3P2YA 1C0IA 5A06A 2VYVA 4Q3DA 3KSZO 2XPCA 3IKVA 4OQZA 1I3KA 1DRWA 1OAAA 1YONA 5ES3A 1E1LA 3KHUA 4YAJA 5KJ1A 1PJLA 3ICCA 1OC4A 1VJ1A 1K6JA 1YL6A 1MFPA 4H15A 3HE3A 2ZKLA 3RUIA 1NWHA 4W82A 3ZU5A 3GR6A 5ICMA 1PSDA 3H3JA 3VDQA 3BMCA 4LMPA 3WYEA 3X2EA 3DAPA 5L51A 3BZUA 4BGUA 2CNBA 4F46A 3UF0A 5L9AA 4O59O 2JFGA 1GPJA 1P1RA 4JBGA 4D42A 5B1YA 4L4XA 3TSCA 1UUFA 3CKYA 4CMEC 1PGNA 3DMYA 1UJMA 2O3UA 5GMOA 1VL6A 4WECA 3CMCO 4XGIA 4J49A 4DC1A 4EJ0A 3EVNA 2WE7A 2OP1A 3OQ1A 4AJ4A 1OOEA 2YYYA 5KIAA 2YDYA 4HFJA 3EGOA 3DR3A 3JQ7A 4LRTB 1ZEMA 2YDXA 3JD3A 2G17A 2HUNA 1P74A 2GASA 3AUUA 2V7PA 1YDWA 4Q3CA 3WBBA 3ROMA 1HXHA 2B4TO 2QRJA 1T2DA 2C54A 1KVSA 2UUOA 4B79A 3F6YA 4AJEA 4NR0A 4JBHA 5TJ9A 1UXHA 4WCFB 2FR1A 5DBGA 1NPYA 2BGLA 2D8AA 2Y1EA 2HK7A 5DZSA 4DQVA 2BMAA 3DBRB 4B3HA 4KUEA 3C3XA 4ND5A 3HB4X 4W7IA 3Q9UA 3WJAA 3WGHA 4BO2A 1BG6A 1KEUA 2I9PA 2HCTA 4QQRA 2C29D 2Y67A 3PLNA 2IYOA 3OBBA 5K9ZA 1EVZA 3ZWMA 5I8WA 3GNSA 3DMTA 2BI7A 2DUWA 1IUKA 1NVTA 2Q4BA 5COBA 4FGWA 1GADO 3JV7A 4HNGA 4NFSA 4CQMB 5HRUA 1NHGA 3ICPA 3K96A 5L4SA 4YEDA 1GU7A 3DAGA 4FFMA 2W4QA 5A9RA 3ZU3A 1H2BA 2W90A 3NDRA 2AW5A 5KKAA 5JLAA 1FK8A 1PWZA 5C7OO 4M86A 5CEJA 3GGOA 2J5KA 4NU5A 1JAYA 5I9NA 1JVBA 1VJTA 5KTKA 1EE2A 5DCYA 4NJMB 4DL9A 3HB5X 1FF9A 2VHWA 4ZQHA 2ZQZA 3LT4A 5EL0A 3JD0A 2R6JA 1LDGA 4WEQA 4JX8A 4YDRA 1HZZA 2EV9A 5TC4A 1IB6A 4WOKA 4Y9DA 4ALJA 2X86A 1MXHA 2WM3A 3ZW8A 4QEDA 1R4MB 2P5UA 3ZV3A 1RM5A 4QO8A 2JHGA 4ALIA 2NV6A 5CDSA 3DBLA 3DB2A 5JMWA 1Y1PA 4M49A 2PH3A 3CH6A 1W6UA 3WXBA 4I5GA 3OP4A 3I1JA 3HUDA 3V1YA 1U5AA 4MP3A 4NBTA 4LSWA 5BR7A 1QXSA 4IDBA 4OGWA 3JQFC 3IQDB 1NXQA 4BKQA 4Z3KA 5FEUA 4W4TA 4W9NC 4J1SA 2I6TA 3ZNQA 1E3LA 3SC4A 4Q9NA 4XCVA 2OL4A 3GEDA 4L4RA 2GUGA 3S2FA 1U8XX 4PGFA 3VC7A 3RBVA 2ZYAA 2VUUA 4BMSA 3WWYA 3ROPA 2YJZA 2YY7A 2P2SA 1DSSG 4IDCA 3RIHA 1BDBA 2QYTA 3RUFA 3G17A 3TZKA 4I9UA 3RC2A 4CODB 3ONEA 1RYDA 3HNPA 8LDHA 3E9QA 4LRSB 3RROA 5G4KB 1UDAA 4JLWA 3V2HA 5THQA 5AXAA 3WLFA 2DPHA 2HJRA 3BMNB 5F1KA 4ITUA 2NU9A 2ZQYA 2RHCA 4P4LA 3L07A 2G1UA 1F8GA 4D3SA 4R1SA 1NYTA 1U28A 4WK6A 1IHXA 4LK3A 3JQBA 4CM9D 2NVUB 6ADHA 1E7RA 3EY4A 3GN2A 3OF2A 3PFWO 3X2FA 5LDGA 3LF2A 4WJZA 2FPIA 2CVOA 1LX6A 1NQOA 1B3BA 3AUSA 5EQDA 4CLRA 5JDIC 3IKTA 1SOWA 4R1TA 1P0FA 4WLNA 3I9NA 1DRUA 2Y05A 4PLYA 4OKIA 5U4QA 9LDTA 5ITVA 1ULSA 3ANNA 4BB5A 1E3SA 2O23A 2O4CA 2V65A 3U0BA 3A14A 1XSEA 1R4MA 5BSEA 3LSYA 4HX5A 2F00A 2HMUA 2PNFA 3P7MA 3FHLA 1WLYA 4EEZA 1DC6A 2HQ1A 2D5CA 3WTCA 3ZNPA 2O48X 3U4CA 3GNQA 3OMLA 4O6VA 1E3WB 1JLLA 1P1JA 2E49A 1E1KA 3N7UA 4NJMA 4MVJG 3PJGA 3L6EA 4R01A 3DZJA 4YCAA 2YV3A 3GDFA 2WYUA 1ENYA 2I5PO 3DQPA 4TSKA 3TRIA 1V35A 4L4SA 2YFHA 3PJFA 4CM1A 1ISHA 3GVPA 4J6FA 1CF2O 3F1LA 3A06A 4JBIA 3AY7A 3DHYA 4D3FA 1QLJA 2J5RA 3L9XA 3OJOA 4CQMA 5JYDA 1EK6A 3FF4A 2VN8A 5KVCA 4L8VA 3HDYA 4RZIA 4BL5A 3FCOA 2HJSA 4OAQA 2IYPA 2CF6A 2P5YA 4FJ2A 4U8GA 2GRAA 1GD1O 4BGVA 1F0YA 2VHXA 3TFOA 3RU7A 1PJ4A 2EIHA 4FPXA 1J5PA 3DBRA 3FPCA 4C7KA 4GGOA 1VSUA 2W2LA 1DJQA 1XQ6A 1U3VA 2WE8A 3DEYX 1Y9EA 1MP0A 1G0OA 4I1IA 2DT5A 4HUJA 3VZPA 4E2WA 4EUFA 2EF1A 4BNFA 3JQAA 1UXJA 5DBFA 3D5TA 4U0KA 1Q7BA 2ZYGA 3NGLA 4R16A 4B4WA 3COSA 4GGPA 2J6IA 4Z0TA 3E1KA 3DBHA 4II3A 2CF5A 5BSHA 3OEYA 4DLAA 3MJTA 1T1SA 3HN2A 4IJKA 3GVXA 1PS8A 4LGVA 4CLHA 3JD2A 4JK3A 2W2KB 2X9NA 1AE1A 4GLOA 3QIVA 4J7UA 1LRLA 1K89A 2C07A 2NVWA 2BD0A 1C1XA 4YJHA 3UN1A 4B4OA 1YBVA 4B7UA 3WR5A 4A2CA 2I67A 1N8KA 4KQWA 5I7EA 3PXXA 4GL4A 3GUYA 2PD6A 4E5YA 1LC3A 1ISMA 2EEZA 2B36A 2DU8A 2CD9A 1VKOA 2HMWA 1K2WA 3FNGA 4MO2A 3MJVA 1Y7TA 4MVJM 2DTDA 1SZJG 1Y9AA 2VOJA 3C1OA 4CR6A 1DIRA 1JQBA 3R3JA 3ZHZA 5ILOA 1EBUA 3PLRA 3TZ6A 2P91A 4ZQGA 1L7DA 1IULA 4CJXA 4NHEA 1J0XO 1O9BA 4IGFA 2YQ5A 4BNHA 1LTHR 1B15A 7MDHA 1HDZA 5KKCA 1DIHA 4WOJA 1T1RA 1VM6A 2GSDA 1V3TA 3MOIA 3QWFA 1YL7A 5I7VA 4BNNA 1I5RA 3DO5A 4I8XA 1BXKA 1JTVA 1PL6A 2VYNA 3WX0A 3DZKA 4RO0A 3RAJA 4RCVA 2PGJA 5L45A 2Y1FA 4PG4A 4J7XA 4DLLA 4PG8A 4XJSA 5JDCA 1GEGA 1R4NB 3I9KA 4GX5A 5BNIA 5CP8A 5DCWA 1SC6A 2VWHA 4QUKA 1H5QA 4R69A 1ZXLA 2DM6A 1Y8RB 2LDXA 1WMAA 1O0SA 3ZWAA 4BNMA 1KEPA 1NFRA 2HMSA 3PPIA 3ANMA 4FSHA 4JQCA 4L73A 4NFYA 5DOZA 5THKA 3H3FA 3K2EA 4YRDA 4H16A 2AEMA 1F8FA 2PH5A 4XQCA 5B4TA 1P1FA 3FNFA 1MXFA 1NQ5A 3EMKA 1Z45A 2AQIA 1I33A 4F6CA 2CDAA 2GLXA 2PFGA 3HDJA 3G0OA 2HRZA 5GZ3A 4E5MA 3E48A 1ADFA 1RM0A 3DZBA 3QJ5A 3RUDA 4IXWA 2J3KA 5TGDA 3OJ0A 1TXGA 5K0ZA 1GPDG 3VH1A 4XWYA 3I9JA 2NU8A 4EZBA 4FB5A 3JYOA 4INAA 5JAMA 2AHRA 5IXYA 1E5LA 4RVSA 1GYQA 1QYXA 1X0VA 1H94A 4HP8A 2H9IA 1PR3A 3E5RA 5L7TA 2C2XA 4NBUA 1ZCJA 2WTBA 1E0DA 1VL8A 2O2YA 4KOAA 4B8WA 1MLDA 1NHWA 5G0WA 2OOSA 4DYDA 3GZNA 3H8VA 5DCUA 4BMVA 2PY6A 3GA0A 2QIOA 2VHZA 3GG2A 1D8AA 3ZNNA 1I3NA 1DAPA 3TDKA 3EZLA 2NWQA 3IDSA 4RDHA 4DXHA 1WZIA 2SCUA 4XQGA 3PI7A 5LC1A 1DLJA 2HO5A 5I9MA 4UVIA 2Y1DA 1FMCA 2J5QA 5EJ2A 4AL4A 1KEWA 4GAEA 3SVTA 5F3RA 4KWIA 4BB6A 3CPSA 3MJ4A 4J2OA 5JNLA 2ET6A 3ASUA 4PLWA 3GLQA 3ANLA 3RUHA 4YWJA 3QY9A 5KVQA 2BELA 1JN0A 3PHGA 3H9QA 4ND2A 4J2HA 1SNYA 1Z6ZA 4XIJA 3S2GA 3WGZA 3NTOA 2DPGA 3ZV4A 1PJCA 1OFGA 3SXPA 5JAIA 1U9JA 4RQUA 3D4PA 3EHEA 3NDIA 3HADA 4TRMA 4U0JA 5DBIA 3V1UA 2BLLA 3I23A 3TQHA 3Q6IA 1TT7A 3FD8A 2V6MA 2B4RO 3W4KA 2NTVA 1Y6JA 5ER9A 5TIIA 1HDGO 4GBJA 1QYWA 3W4IA 4BNUA 1XG5A 4IY1A 4R3WA 3ZH2A 1KETA 3QQPA 5CEFA 3CEAA 2VNSA 2F1KA 4YT2A 4I5FA 4IS3A 5G0VA 3JYQA 1BDMA 3CUKA 4IQ0A 4M55A 4PG6A 4CR8A 3OIDA 1B8UA 1CWUA 3KETA 3D4NA 3WGTA 4BNVA 4BVAA 3U9LA 4DWVA 1ZK3A 1OI7A 3K2BA 5LDHA 1EDOA 4YJFB 3A9WA 2OO5A 5FF9A 4ONEA 3LLSA 4CM4A 4AJ2A 3UFXA 2IDZA 4G81A 3ZWPA 4YVFA 4XJTA 1XKQA 5H83A 3MCVA 3UGKA 3WYBA 3ZHBA 2WD7A 3PHHA 3VKUA 1K0UA 2C20A 4CMBA 1U3UA 5MDHA 2D3TA 5TQVA 3ZWXA 2OBNA 2IZ1A 1V3VA 3P5SA 3WGOA 1Q2XA 5JYEA 2VOEA 3Q1LA 3FWNA 4BKPA 4N5MA 1HDCA 4E5PA 4R3NA 4IQGA 1P44A 4E32A 4U5QA 4E5KA 3AY3A 1NBOA 3DONA 3F1KA 4O0LA 2AMFA 5CDTA 2Q50A 2Q46A 4Z3DA 5AVOA 5JBIA 4BKOA 1X13A 1AHHA 1HE3A 3ENKA 4EJMA 4DQUA 2Z1NA 1Y5MA 2OFPA 4J0FA 3WOHA 3NJ4A 1E7MA 1HDRA 4Y6SA 5B12A 4PLTA 1GUZA 3VHRA 4Q3BA 1MC4A 3AY6A 2PZMA 4R1NA 1ZJZA 3QRWA 4WCDA 1N9GB 4PIVA 3TOXA 4A0SA 2X23A 4YQYA 4PVCA 3L77A 5JMPA 5A9SA 5KOIA 4CUZA 1LBEA 1PJTA 3ZHXA 4X54A 4DLBA 4PZCA 1EMDA 3RC9A 2ZB3A 3I6QA 1HETA 4Y8VA 5EN4A 1PGPA 5TRTA 1HYEA 2Q4EA 2TMDA 3RUCA 4MVJE 3O38A 4RVGA 2GF2A 5TT0A 1LEHA 3HFGA 1B16A 4Z9YA 3PRJA 1FDUA 2OORA 5DDIP 3TWOA 4CQLA 1S7CA 1LLCA 1YDEA 1ADCA 3IUSA 3C24A 2IZZA 5JY6A 3WG9A 1B8PA 5G0UA 4A03A 5A04A 4CV3A 4KUHA 2JFHA 1HKUA 4MVJD 4RQTA 1LSJA 2A35A 3F4BA 4WLEA 5ENDA 3CMMA 1G1AA 3PHLA 4WCFC 3IMFA 3L4SO 2X9VA 4IDFA 1GQQA 4GWGA 3UICA 3F46A 1CIVA 2GZ3A 3ZV5A 4JJGA 1SOVA 1ZK0A 4W6ZA 3PZBA 5IZCC 2YUTA 3DFUA 1BVUA 1U2DA 2JD2A 4D43A 3A1NA 4LVUA 1MB4A 5T8KA 4XRGA 1NP3A 4Z0PA 1I30A 4FGSA 1T2FA 2AE1A 3WICA 4R1UA 3NV9A 1ONPA 3NT5A 1T25A 3QWIA 2Q3EA 3K9QO 3TF5A 1NNUA 1RWBA 3U4DA 2DLDA 2NQ8A 5JE8A 1UAYA 1B3RA 4RLHA 1CYDA 2EGGA 3GY0A 1BRMA 4E13A 5L4NA 2G0TA 1A4UA 5KCZA 3E5MA 1H6BA 1T2EA 1E7YA 5ILGA 3KVOA 2BF7A 3JD1A 3NTQA 3PYLA 1R37A 3I83A 2ZJ0A 2HKIA 4FQ8A 3K5PA 4BIIA 4HFNA 4BO1A 4DBVO 3OICA 4JJIA 3AWDA 5HS6A 1UP6A 1O8CA 2XXBA 4J1TA 4BO6A 4CMCA 2NQTA 5JDIA 3GDGA 1DJNA 2VT2A 2VUSA 3JD4A 5KJ6A 5A3JA 1PL8A 2GCGA 2Q2WA 4Q3AA 3CINA 4UEKA 2HMVA 3H9EO 3H6KA 3OECA 2BGKA 2PKRA 4ZVVA 2UV8A 3WFJA 2B5WA 4ID9A 4XKJA 1KVQA 1CRWG 4LMRA 3E03A 3LU1A 4FFPA 3H2SA 4ILKA 2Q99A 1JWAB 4Z6KA 5IF3A 3GVHA 2G82A 1YOVA 2EGHA 3KEQA 2BFAA 3WQSB 2FPGA 2E37A 3Q2KA 2A9FA 1ZO8A 4L76A 4ZQEA 1SBYA 3U4IA 4W9NA 1PJSA 1AXEA 1KY4A 3TPCA 3HDHA 1NM5A 3PIDA 4XRRA 4IZHA 3LLVA 1V9LA 2XAAA 1EVJA 4ZRNA 3D3WA 5C7IO 1I3MA 4MIOA 4CM6A 4HFRA 1EFKA 4WASA 1YS4A 3AK4A 1KC1A 4YXFA 4GX0A 5U9CA 1E92A 2WSBA 4YTEA 1V0JA 4E2XA 1E3WA 3RKUA 3KM0A 3E18A 1LSSA 1GTMA 1MA0A 2AA3A 4PRLA 3L4BC 4CQLB 4Q3EA 3DZHA 1A5ZA 1F12A 4CM9A 4XDYA 3TL2A 4CUJA 4PLGA 4YR9A 1Z82A 4JN6B 1Z73A 1WP4A 1ADBA 3PWKA 7ADHA 3B1KA 1ZMOA 5JDCC 4F3YA 3KYBA 3ZWCA 4MVJP 3BXXA 2A92A 4XB2A 3SLGA 3JQ9A 5I9LA 5A9SB 2JAHA 2Z1MA 4XGNA 1PZGA 3KYDB 5T57A 3P19A 4L9RA 1HLDA 1M6HA 2NVUA 4DRYA 2ZCVA 2WDZA 1P77A 5I7SA 4EYEA 4A73A 2YHIB 4IXTA 3GG9A 3BMNA 4XYMA 5B4VA 1HE5A 4XEHA 4DIFA 4UEJA 3GHHA 3MTGA 4TMFA 1HE2A 1FDVA 3FPLA 2JFFA 2IE0A 1YBAA 3UUWA 4BNYA 4D79A 3PWSA 4MVJA 3CZMA 2P9CA 4IJVA 4N54A 2IXAA 4GVLA 4QSMA 4CL8A 3U49A 4RPGA 1YOVB 2Q1WA 1EK5A 4YAGA 1IL0A 1U5CA 1H93A 1LQUA 4QX6A 1P9LA 3O26A 3R3SA 4J91A 3LT0A 4O63O 2EP5A 4IJWA 1H2HA 1ENZA 4BO8A 5I8ZA 1UZLA 1PQWA 1ZUD1 5J23A 4FFNA 4D3DA 4AVYA 2UUPA 2X0NA 3BA1A 1M6WA 2I76A 3OH8A 5EERA 3WSVA 4MP8A 3JSAA 4J90A 1M76A 2ZTLA 1GAEO 2Q1SA 1SO8A 1IOLA 1LLDA 1SB9A 4YJFA 4FW8A 2UVDA 1RKXA 2P9EA 2ZATA 3GFGA 4NBWA 4YAIA 3PJDA 2FRDA 3RSHA 2FPPA 1GYRA 2GZ2A 1B14A 5TT1A 4U6QA 3INTA 3FTPA 2BHLA 1PZHA 4XZ3A 4BNTA 3L9WA 2GZ1A 3AOGA 4MVJF 2HMTA 3I4FA 4OH1A 1VJ0A 2D59A 3NAQA 4NI5A 3UCXA 3UKOA 3LT2A 1U3WA 3VPHA 4L75A 1LDYA 3RC7A 3OFSA 1KY5A 4CL3A 3PVZA 3CXRA 2ZIZA 1P0CA 2VTEA 2HAEA 1WXDA 2Y68A 4WUVA 1D4FA 1IY8A 2OUIA 4OXNA 2R2GA 3KYCB 4JCOA 3VVBA 4BNZA 4RGBA 2QHXA 1E6UA 1HE4A 4ESOA 1D1TA 2TMGA 3OIGA 3DDNA 3NX4A 4AJHA 3PJEA 1MGOA 4ALNA 4Q39A 4XB1A 3PGJA 4UREA 3T4XA 4MJLA 1W73A 1VRWA 1Y5RA 4IIUA 1WZEA 5CG2A 4TKMA 1HSOA 4HWKA 2YQ4A 3QVTA 1IPEA 4D45A 1V3UA 3HN7A 1BXGA 3KOUA 4N5LA 3SLKA 3GH3A 1B8VA 1DIGA 4FFOA 4J16A 2ZB4A 2PD4A 4KMSA 4YA6A 3BHMA 3PWZA 1QSGA 4A10A 4XYLA 3AW9A 5G2OA 4GX1A 5L53A 2FOIA 1NFFA 2X5KO 4O1MA 4UUOA 1G6KA 3G1TA 4DIBA 2Y0DA 3JQ8B 1QV7A 3ZHYA 3ZNOA 3F47A 4XQ9A 2AEJA 1UZNA 2VT3A 2D4AA 2AQKA 5DULA 4YT4A 5DT9A 4WCFA 3O8QB 3WJ7A 4E12A 3AFNA 1LDNA 4BHTA 4D7AA 4QFDA 1YJQA 1GQYA 3O03A 3INGA 4G65A 3LC1O 1PJQA 1YVEI 2VZ0A 5IZCA 4OQYA 1HDXA 3GPDG 4PVDA 4J4BA 4FS3A 3B6ZA 3ROQA 1XR3A 1UR5A 4RZHA 2VRCA 4FC7A 3ZU4A 3PQFA 2IEDA 1Z75A 4HXYA 1C0PA 3NT2A 4D0SA 3QW2A 3WDSA 3D64A 2EW2A 2IODA 5COAA 1X7DA 4UVEA 5L7WA 1E77A 4PLFA 3ON5A 4ZICA 3GVIA 4DGSA 5F5NA 5T5QA 1O5IA 5C7LO 3HG7A 5K1SA 3C1AA 1BW9B 3H9JA 1RYEA 3KTDA 1NVMB 3BMCB 2O3QA 1YXMA 4CQMD 2BI8A 3KLMX 1NAHA 4G2NA 3UAGA 3OJEA 1XIVA 1X7GA 3TJRA 2J3IA 4DBZA 1RJWA 1O94A 2J3HA 3BAZA 1ZK4A 4K6CA 2Y93A 1AGNA 3C7AA 5IJZA 1GCUA 3AOEC 3IJPA 1EQUA 4NIMA 1N2SA 4CMAA 4NDNE 1RPNA 1WWKA 3CTMA 1GZ4A 2X5OA 3RQSA 3ZCXA 2RAFA 2ILTA 3NYWA 1SB8A 3JQEA 1KVUA 4K28A 4E0BA 2PWZA 1I24A 3WGIA 1GR0A 3I9OA 3OJLA 4BO4A 1U7TA 1LSOA 4E6PA 2X9GA 1I8TA 3U62A 1N1GA 3DHEA 3RD5A 3EVTA 1R6DA 4BUCA 2ZTUA 4WLUA 3DZGA 2WWRA 1NWCA 3RWBA 3QHAA 4MOWA 4BQPA 5AXCA 1LI4A 3DWFA 4TZTA 1PQPA 1QLHA 3BTSA 4CLXA 5DNAA 1QR6A 1GZ6A 4LISA 1UAGA 3PZRA 1U4SA 2O3JA 4PLZA 4TQGA 3W6ZA 1JKIA 3VDRA 1I01A 3L6DA 1TI7A 1N1EA 2CVZA 2C2YA 3WWZA 5GZ6A 1F14A 3FR7A 4FCCA 4E3ZA 4TRRA 3S2EA 1KYQA 1BTOA 2DKNA 4NK4A 1P31A 3BMOB 1SPXA 4MKXA 1E5QA 1DBVO 1C1XB 4YJHB 4UVHA 5F5LA 1HEUA 1S6YA 5HTOA 1C1DA 1SEVA 2E4AA 2X58A 4WNIA 1DC4A 2FR0A 3D5QA 3DOOA 4DIOA 4LVCA 5TS3A 1Q0QA 3RKRA 2E6UX 3QA9A 4WLOA 4JP3A 1PR9A 1ZSVA 1FDSA 1DPGA 2OMEA 3TOZA 3OM9A 4IQ8A 2GYYA 2W8ZA 4I9HA 3OEWA 3IC5A 3K6JA 4J4HA 1TA4A 3DBHB 3PIIA 4RF5A 4DUPA 1VL0A 5CPFA 3GN1A 1GY8A 2WJPA 4D44A 4R5MA 1WMBA 4UEOA 4KWHA 3EC7A 3PEFA 2QX7A 1PS9A 1UH5A 1E7QA 1RM4A 3INRA 3JQAB 3LK7A 3GK3A 4N18A 1LNQA 2FN7A 1A7AA 3EUWA 2VNAA 3A28A 3PDUA 3K73O 2AG8A 4IMRA 2B69A 1LLUA 3BYZA 4FBGA 3U3XA 4B7CA 3I4CA 4UVDA 3T7EA 3ZN2A 2I65A 1QYDA 4K1LA 4ZGWA 3ABIA 3OA2A 4DYVA 1IE3A 2FMUA 2G76A 4RF3A 3WFIA 3FWZA 1H0KA 4P8RA 3AM4A 3JQ8A 2FHSA 3PFFA 1ENOA 4QTZA 3VZSA 3I5MA 4PRKA 1RM3A 2YHUA 1C3VA 5U1PA 3ST7A 2GN4A 1WAMA 4TVBA 5HS4A 1PTJA 1A71A 3QVWA 3WS7A 4JP2A 5IN4A 2IXBA 5A05A 1Z7EA 2PKQP 1KERA 4R41A 2H6EA 6LDHA 1NTOA 3WLEA 3ZWVA 1ISFA 3K30A 4YAKA 4HBGA 2DTEA 3Q3CA 1NX6A 1V8BA 3NRCA 3GT0A 4FJ0A 1C1DB 1OMOA 3RFTA 1HWYA 1A7KA 3WBFA 4BGIA 3WTBA 3C7DB 4XD2A 5FI5A 3DZIA 3JQAD 2AG5A 3EZYA 1CQIA 2A94A 1DB3A 1LUAA 5G0TA 4EJ6A 3W8FA 4G5HA 1XDWA 4N7RA 4XR4A 3OQBA 1DEHA 5A5EA 4PLCA 1E1MA 5HWSA 3OHSX 4YT5A 1QG6A 1H9AA 1ID1A 3G3EA 3PP8A 3HHPA 1LXCA 3H65A 1DDOA 1ZJYA 3M1LA 3UH1A 2JD1A 4EI2A 4CM3A 4XYEA 1EUZA 2O7SA 4AICA 4PFJA 2X5JO 2Q2VA 3AI2A 3LQFA 4E31A 3QP9A 2E48A 3O4RA 3WMXA 3QWAA 3QVXA 2EERA 3S55A 3BIOA 2GD1O 3VPGA 2VYND 1EEHA 1SMKA 1P1IA 2WEKA 3RFVA 4IPTA 3HJAA 2DBRA 1BSVA 3TL3A 1Y8QB 1CJCA 4OSOA 4ZN6A 5G4KA 1C0KA 1I2CA 3K92A 4BNKA 5ENVA 3T4EA 3HZZA 4PZDA 1QP8A 2Q45A 4KTVE 5TX7A 4J1QA 1LJ8A 1PWXA 2G5CA 3ROKA 1KOLA 1FJHA 1XQ1A 2EW8A 3IL2A 1ZNQO 4II2A 3LZ6A 4BMNA 5COQA 1M75A 3F4LA 3RUEA 3SJ7A 3VOSA 3JQCA 2HU2A 3L4BA 4YBZA 3UOGA 4HV4A 5L3ZA 3V1TC 3NDJA 3FNEA 3NT4A 4BNWA 1Y8QA 1ENPA 3UHAA 4LN1A 1P45A 1NASA 2C7VA 3C1TA 5IDYA 2ZTMA 1WVGA 4GLLA 4IZIA 1DRVA 3U5TA 2NU6A 4KZPA 2AQHA 2O3SA 4MKZA 1ONOA 2P9GA 5EPOA 3OQ6A 3ZZNA 1QORA 3RASA 3V8BA 2VWGA 3WYCA 4M87A 1UDBA 3PK0A 1VKNA 4XR9A 4NH4A 2V6FA 1BHSA 1HDOA 3KYDA 3ONDA 1N5DA 2JCYA 1ZZEA 4AJOA 2HK9A 2RHRA 2CDBA 2QG4A 4MDHA 2QRLA 1KVRA 3E8XA 3TN7A 2CSUA 3DXFA 4KUGA 3O8QA 4NFHA 1R0SA 4B3IA 2EKQA 3ZWYA 2XOXA 2JJYA 3PQEA 5F1PA 4XYGA 3RJ9A 3GEGA 4AG3A 3QSGA 2HDHA 1EE9A 3FBGA 5FYDA 4OKNA 3VTZA 1Q0LA 1ZK2A 3FSRA 3GVCA 1IZ9A 1QYCA 4TRJA 3GGPA 1UP7A 5AOVA 2W2LD 3ZW9A 1JDJA 5CDUA 3ADOA 4URFA 4HADA 2J8ZA 1DC5A 4MKRA 4IMPA 3D7LA 3JTMA 2CUKA 2PA3A 5CDYA 2B0JA 4J3FA 2VZ8A 4M1QA 1ADGA 1U7HA 3D4OA 1HDYA 1YBMA 3RVDA 3AU8A 5KVVA 4FD3A 1YQDA 2FWMX 3SEFA 1R12A 2Y0CA 4CUKA 1VLLA 2VYVD 3RFXA 1Z7BA 2GGSA 5JPIA 1XU9A 1EZ4A 2QZZA 3CIFA 2C5AA 4H7PA 4FFRA 4HNHA 3TZHA 3ZWNA 3H9GA 3U4HA 5ICSA 3ZWBA 3GAZA 3KSUA 1IHYA 1X14A 3IUPA 4RL6A 3KV3O 3QWHA 4CMKA 2JL1A 4GWKA 2PZLA 1KBZA 1JWBB 3DC2A 1KVTA 3LVFO 4GSLA 4IDEA 1GFSA 2IZ0A 4NK5A 4IDAA 2O4UX 5BQFA 4CLRB 1Q7CA 4AJJA 2B5VA 5JCXA 4MIEA 4FFLA 3AJRA 4QECA 1UZMA 3QLJA 3CSDA 3AI1A 3R0IA 4CLEA 5KJCA 5TJHA 2O2SA 1T4DA 3GOHA 3LDHA 4JIGA 2I3AA 4IJUA 4E30A 2DC1A 5EIOA 2WMDA 4AJLA 3E82A 4NQZA 1QV6A 1PZEA 1MX3A 3H4VA 5HM8A 3PHJA 1WPQA 5CHEA 2R00A 2FZWA 3F3SA 3JQ6A 2EKPA 4JGBA 1YQXA 5B4UA 2WYVA 5T67A 3CZRA 3GNTA 1HYGA 2Q1TA 4NJOA 3RI3A 3WIEA 2GN9A 3K8ZA 2EP7A 2X22A 4EBFA 1E7WA 3VVCA 1ZFNA 3WNVA 1KIFA 3GC6A 1MG0A 4IBOA 1ML3A 3HWRA 2AXQA 2HK8A 3PHIA 1LQTA 4CMJA 1B2LA 2JCVA 1F06A 3W8DA 2ZK7A 1H6CA 1DLIA 3S1LA 3MZ0A 5JAQA 3JCZA 2HSDA 5C37A 2CZCA 3BTOA 2FSSA 5EQFA 2Z95A 4DC0A 4J43A 3GDOA 3I6IA 1F17A 1P33A 1LDMA 5K6AA 4LW8A 5CFZA 2Y1GA 4GX2A 1E6WA 4CV0A 1SEPA 5IZ4A 3ADPA 3WGGA 1XA0A 5T64A 1X0XA 4PN3A 4BNLA 3ONFA 2PGLA 1U1IA 5GY7A 2CVQA 4I5DA 3VPFA 2EJWA 1VE9A 2Y66A 3KUXA 4BS9A 3BHIA 5T8KC 4KDEA 1K6XA 2PGDA 3WB9A 2X0JA 2OXIA 4RF2A 4DREA 4WKGA 1ZIDA 5IDWA 2DUUA 1JAXA 4YRAA 4CM8A 1ZW1A 1FDWA 2O7QA 5DOVA 1T26A 2HRBA 3V2UA 1DXYA 3JQDA 4RVDA 4XX0A 4HKTA 3FNHA 1PL7A 3LC2O 1DHRA 3FTNA 1I36A 4OM8A 2DBQA 4BV9A 3TNLA 4YQZA 2JD0A 2OHXA 2P4HX 2XF8A 1B0AA 2POQX 3I9MA 4KQXA 1GYPA 3TFQA 4XIYA 3OJFA 4XDZA 3IS3A 4IIVA 4F6LA 3OETA 5T6BA 2X6TA 5IG2A 3DFZA 3D0OA 3E9MA 3FR8A 3HQ4O 1A27A 1EUCA 3IP1A 3QVOA 4CLDA 1PS0A 1T24A 2C82A 1A9ZA 3UXYA 2NUAA 3VZQA 4DTIA 3VZRA 1I32A 5L40A 4Z9FA 2FZEA 5IFLA 4J1NA 4QXMA 5G0SA 2YV2A 1I2ZA 1H6DA 1QYVA 2QRKA 1XYGA 3AU9A 4B7XA 5C3MA 2DQ4A 3NTRA 1GV1A 1XGKA 1YJ8A 3KXDA 4ZRMA 1ZXBA 2ZCUA 1FXSA 2CMDA 3BMQA 3N74A 1FDTA 1LDEA 4E2YA 1H6AA 1EQ2A 1ZH8A 4RF4A 2PZJA 4MVJI 2RCYA 1XELA 1HLPA 4GKVA 3ZWOA 1PQUA 3H9UA 4CMGA 5JFOA 1JA9A 1Q0HA 3GEMA 1PU2A 4ND4A 3VH2A 3QVSA 4ZD6A 1NPTO 2NU7A 3KZVA 2OBYA 4ND3A 3D1LA 3O9ZA 3E6AA 5EINA 1CEQA 3W1VA 2E82A 4RVUA 4PCVA 1BWSA 3EAGA 4GVXA 1W8DA 4GH5A 4E2ZA 4NZ9A 1ARZA 3MWEB 2X0IA 3GMDA 1HZJA 4P38A 5A9TA 3VH3A 4OO3A 4JXKA 5L95A 1QRRA 4KDFA 2ZJ1A 3IAHA 5BT9A 4BV8A 4CM5A 3JYLA 3JQ7B 4R4JA 1ISIA 1U2GA 4YB8A 1GQ2A 1E6EA 1P1KA 3LYLA 4RDIA 2D0IA 4P4GA 1KS9A 1NVGA 4M89A 1BXGB 1QMGA 3UW3A 1JW9B 3ORFA 4WEOA 2CY0A 2DFDA 4M8SA 4CR7A 4B4UA 1O89A 5A03A 1LRKA 5JO0A 1JKFA 3JQ9C 1AN9A 4B8ZA 3FRJA 3Q11A 3PDJA 2Y99A 4AJPA 2VZ9A 1T4BA 4GI2A 3JQBC 2H63A 3B1FA 1GUYA 5JS6A 2VCYA 3FBTA 3AUAA 2Z5LA 3VPXA 1E3EA 1H9BA 3JYPA 4KP7A 3W6UA 1M2WA 2YW9A 5TSDA 1IYZA 4BOYA 3MJCA 5CEEA 4U7WA 1E3IA 3QWBA 4ZQFA 1MUUA 1LU9A 2P4QA 1D3AA 3MJEA 4E33A 3LC7O 1HF3A 1JVSA 2X0RA 3V2GA 4BO3A 4MP6A 4P22A 3C7CB 2B37A 2EXXA 1TVEA 5JCJA 4RPKA 4PG5A 2AEFA 3H5AA 3RU9A 3VH4A 4RVFA 4YJDA 4BNGA 1E7SA 4WE3A 5B37A 4EUEA 4WLFA 4Y6PA 1A9YA 1BGVA 2BH9A 1I0ZA 2DVMA 3ITKA 4I08A 3B1JA 1XLTA 3FN4A 1MG5A 1GUFA 2W98A 3RC1A 4GSKA 1K3TA 2UAGA 1NQAO 1E3JA 1KC3A 2JKVA 3PYMA 4BGEA 1C0LA 1YQGA 4H3VA 4E5NA 1UDCA 4EGFA 1ISJA 1DC3A 1VI2A 3F5QA 5CAEA 3DOJA 4IS2A 3E9NA 4ALKA 1DFGA 1N7GA 4RORA 1BW9A 1N9GA 4N5NA 3D3EA 2PR2A 4TKLA 5KVSA 3ETEA 4CM7A 4UVGA 2EG9A 4TROA 1J6UA 3EDMA 4CMEA 3KB6A 3VPSA 4D41A 5FFFA 1X1EA 2UDPA 2AE2A 5DN9A 1PJ3A 1UXGA 1MFZA 1YB4A 3P2OA 1AUPA 4BNJA 4GPD1 3WQQA 2DBVO 1PEDA 4OYRA 2YHIA 4P4NA 5H82A 3WSWA 2H5LA 4R68A 4FC6A 4A27A 4UUNA 3SJUA 1HL3A 5DF1A 3B70A 1Y8RA 1YWGO 2VTDA 1CDOA 4DPKA 5L4LA 4F45A 4CLOA 4OIMA 4RJTA 2NTJA 5AYVA 1OZAA 1V6AA 2WD7B 1GV0A 1YRLA 3RBXA 2VRBA 4HFMA 1R4NA 2OP0A 4NBVA 2X1HA 4WNCA 1CERA 2NVBA 5A02A 1TT5A 4A5OA 1ZKMA 4NMHA 3AOEA 1P3DA 1N7HA 2I99A 2GN8A 4MPDA 4XA8A 4Y6RA 2XXJA 1G0NA 3BTUA 4B3JA 4ZA2A 4R51A 1NAIA 3HDQA 3NJ8A 5H81A 5A1TA 2JHFA 3ASVA 5I7FA 3LF1A 3AM3A 1O95A 1LSUA 3GRKA 1NR7A 4ROSA 1CETA 1D7OA 1X7HA 4XGKA 4CMIA 4IDGA 3MWDB 2YV1A 3R1IA 1WW8A 1B7GO 4E21A 2ZTVA 1U8FO 4AJKA 4XYBA 2RH8A 1PZFA 1XWFA 5JW6A 3DBVO 3AFMA 5F1OA 4PZEA 1D1SA 2PV7A 2VUTA 3DHNA 3TZCA 4AFNA 2DTXA 3Q9NA 3MTJA 2X7HA 4JJFA 3KSDO 1M67A 1LC0A 3OA0A 2JCXA 2D2IA 3KYCA 3GRPA 3ZV6A 1Y81A 3W4JA 3MEQA 5TF4A 4I9NA 4GMGA 1R0LA 3UVEA 4ZJUA 5ITWA 2B83A 2ZB7A 1HRDA 2VHYA 3JQGB 2VWPA 3L0DA 2OGUA 2ZYDA 4Y98A 4MINA 1ZEJA 3BTVA 5LCXA 5JC1A 3DOCA 3GPIA 1A4IA 5C5IA 2FY8A 3K31A 1K6IA 4U6SA 4EDFA 3C8MA 3EW7A 2AQ8A 3ZU2A 3IIEA 3GGGA 1LRJA 1O6ZA 1SCUA 5JSFA 2YFQA 5DP1A 2BFOA 4HY3A 5JC8A 1DAOA 4YJGA 3GF4A 1GL3A 2GR9A 1XEAA 4IDDA 2FP4A 4WPGA 2WD8A 3M2TA 2P68A 3VTFA 1R15A 1EBFA 4TZKA 4YJGB 1DOHA 1XU7A 1YKFA 2CDCA 2NTNA 3GZNB 1MV8A 1HYHA 2UYYA 3UCEA 2V6GA 1QKIA 4A7PA 4FIZA 1Q1NA 1YH3A 4JNKA 5L7YA 2QYSA 3JQGA 4CMHA 1EVYA 1WDLA 1DO8A 4K6FA 1T2AA 5KJFA 3ZWWA 1R66A 1Z74A 1R0KA 5FWNA 1K5HA 2C0CA 4YAEA 2GDZA 4PG7A 4R9RA 3KEOA 3W8EA 1ZSYA 3OIFA 4AJNA 4IM7A 4M54A 3RBZA 3DMTC 3M2PA 5IN5A 4S1VA 1JU9A 2NACA 4E4YA 3NGXA 2NSDA 2A4KA 4C7JA 2RIRA 4J4TA 3AUTA 1BXZA 1ZMTA 3FI9A 4EUHA 2GERA 1KEVA 1WNTA 1VPDA 3KBOA 3SX2A 5JY1A 1EUDA 1BMDA 4K9DA 1YB5A 1BVRA 4A26A 2O3TA 1VC2A 4CMIB 4DMLA 1ISGA 3A4VA 5TNXA 4R9SA 3GZ4A 4QO7A 1X15A 3H5NA 3M1AA 3MJSA 1P1HA 4FJ1A 1PGOA 4RPJA 1UP4A 4O5OA 4OXKA 5AXDA 3ULKA 3Q2IA 5JCJD 1ZK1A 3JYNA 1OBFO 4R54A 2QQ5A 2WYWA 2BGMA 3DTYA 4DPLA 2OZPA 4W7HA 3WGYA 1TT5B 2V6BA 2BFMA 4ALLA 2Y0EA 2Q2QA 2D1YA 1ULUA 5GZ1A 2C7GA 2NNLD 3Q0EA 1TB4A 4YPOA 4ND1A 4OOEA 5KWEA 3VAZA 4NPCA 1JKJA 5FI3A 5BSFA 1GEEA 4YRBA 2PTGA 5TLSA 2B35A 1A72A 2DAPA 3GHYA 4DQXA 3N58A 3D3WB 5A5FA 2NM0A 3PYXA 4EITA 9LDBA 2CFCA 3EK2A 4QFCA 1Q7GA 2GO1A 2IRWA 1R16A 4AJ1A 2QW8A 3EYWA 1ONNA 2H1SA 4OMUA 3I3OA 2Y1CA 1W4ZA 3ETGA 4D46A 4BKRA 1LA2A 2EHDA 3DAFA 4KTTE 1ORRA 1I3LA 3F9IA 3NEPX 1NFQA 3ZI0A 2EWMA 4BO7A 3HSKA 3WGQA 5CPBA 4OJNA 5A3VA 1L1FA 4OHUA 2RH4A 3DTTA 1WDMA 3AM5A 2PK3A 2W2KA 2FSVA 5BNFA 2PKQO 1I10A 3PGXA 3I9LA 3L6OO 4LSMA 4CM4B 3QE3A 2J3JA 4R5HA 2Q49A 4FN4A 3CE6A 1PJ2A 1W0CA 3I52A 4YT8A 5DP2A 3GMSA 1U4OA 1IZ0A 5BSGA 4NU6A 1GZ3A 4RPHA 2VHVA 3RUAA 3WQRA 1EVIA 5AXBA 5HBRA 4OOFA 4PLPA 2VRCD 3RJ5A 1CQJA 4EW6A 1M66A 2GPTA 4W99A 1L7EA 1DHTA 3PQDA 4J7CA 1EDZA 3SBOA 4TRNA 2R00C 1PGQA 3ITDA 4BO5A 2BKAA 3ZGYA 2YZ7A 4DVJA 5AQ1A 3IOYA 1DIAA 3G79A 2B4QA 3MOGA 4CV1A 4UUMA 5IDXA 4QT0A 3SC6A 3HFSA 3UCFA 5JAZA 2C59A 1YE3A 4J9UE 2X4GA 4CPDA 1NPDA 5CG1A 3IJRA 3DZFA 3B20A 3BHJA 2EJVA 1LLQA 3JQFA 4RPLA 4PLHA 4BO9A 1XHLA 2DBZA 5K6AC 3KO8A 1YGYA 1HTBA 1HSZA 3C85A 5A4DA 3RCBA 3DL2A 1ZSNA 4UUPA 3M6IA 1HT0A 2GN6A 4Q3NA 1GDHA 5MGBA 4BO0A 4I5EA 2VWQA 3R6DA 1UXKA 5KNLA 4J0EA 4Z9XA 4OXYA 3WIDA 1PX0A 2NLOA 1I2BA 4RVHA 1T2CA 3KRTA 5EMHA 5JXWA 4ZHSA 3V5NA 5CDGA 3GQVA 4OL9A 1WDKA 3GFBA 5HA5A 4FOOA 4WGGA 1TLTA 4GKBA 2VQ3A 4FR5A 4JROA 4ZU3A 1ZVMA 2I3GA 2EKLA 3ZDFA 2ZB8A 3KLPX 3PTZA 2IEBA 4ALMA 4OSPA 5KJEA 4D0RA 2RBEA 4BNXA 4LCEA 1C14A 1X1TA 1XCBA 1J4AA 2I66A 3LT1A 4YYZA 5IXSA 4FOSA 4L74A 4C4OA 1AXGA 3GAFA 4NNJA 4S3MA 1TEHA 5EESA 3STHA 4CV2A 3U09A 1ZBQA 4ZQBA 3G49A 4TWRA 4CLOB 3GUCA 4FDAA 3ETDA 2D5AA 3IP3A 2FR8A 4MVJH 2BFPA 2PLAA 2Y1OA 3G1UA 1DIBA 3NUGA 5ER6A 1VSVA 1YL5A 3T7CA 3ENNA 3NKLA 3BMQB 2Q1UA 5F21A 4BKUA 5ADHA 1DFHA 3WNQA 4RLSA 2HLPA 3H5RA 4TVOA 1YB1A 5G4LA 3AI3A 1NR1A 1U3TA 2LDBA 2QZ9A 4DMMA 1EFLA 4J9VA 4GQAA 4BNIA 1PJBA 3S8MA
chains in the Genus database with same CATH superfamily
3BMOA 1JEJA 2OHVA 5ULLA 4WXYB 5JO9A 4Y2SA 2NUTB 1VYVA 2R66A 1D0SA 4L15A 2Z2KA 4QSHA 3EWNA 3WL3A 1FSSA 4NZOA 5SV2A 1BKDR 1AHIA 4IUYA 1ZGZA 2JIZD 4LTNA 2C5EA 4LYEA 5HVNA 1FSZA 5HCNA 1JWLA 3DUFA 3DCYA 4JBXA 1JDSA 4C0BA 1DKOA 1C4KA 2NXEA 4R1PA 4DHWA 2N75A 1G60A 2OD7A 3MTAA 4KO2S 3STYA 3V55A 4DCSA 4R2HA 1SVNA 2OHIA 2R5WA 2D0DA 3R9XA 3DG9A 1DFIA 1EZ1A 5IAAA 2G36A 1GKKA 2AFHB 3W2GA 5DM0A 5KTMA 3MYYA 3FHCB 4EG4A 5DN6D 3TTVA 4FNAA 4KE6A 4IDFA 4WLVA 1UJ6A 1Z0JA 1V2HE 5IDQA 3B53X 5KB3A 3H7AA 1F2UB 1U6JA 1YI0A 4B43A 3JVVA 4BYMA 4CCAA 3QV1A 4BTLA 1U7DA 4D4IA 4F3TA 2J08A 3OY2A 4Q3OA 1LDBA 4EEXA 2HQBA 3BICA 4DM3A 1Z4MA 4L0QA 4REOA 4L1KA 1G2PA 3H8WA 4MV1A 1EM8B 4DJDC 4JQYA 7ABPA 2PXCA 5KTPA 3KSZO 2R751 3IA7A 1JALA 4G85A 4DT1A 1QDLB 5FEMA 4F5EA 1E1LA 1U2PA 2VHCA 3KHUA 4B7ZA 4ZCQA 2XEXA 3GT3A 1A04A 4MUKA 4MW7A 1K97A 4R0VA 3FUCA 4MYTA 3U3ZA 3OE4A 2JB9A 2VSNA 1PL0A 3BDAA 3MGKA 2I4NA 3ZGXA 1VCIA 2A1UA 4PNEA 1O0BA 1DTWB 2JAOA 5ICMA 1PSDA 2W6JA 2FOXA 4JP5A 4M88A 1JDPA 3WYEA 2A59A 3EPPA 4IF4A 2DETA 3DB1A 1DAKA 1I1HA 2CNBA 3H9BA 1D0IA 2QENA 2X2PA 2JFGA 1MB0A 3G85A 3K2QA 3GRUA 3PUIA 3SAJA 1Q5PA 5B1YA 4XCQA 1OY1A 1TM2A 3AR4A 3CKYA 5THXA 1PGNA 3IYLW 1UJMA 5GMOA 2R6HA 2H29A 3AEUB 3LLMA 3FOZA 5C5CA 3TX6A 5KMGA 1AS3A 3EVNA 1UWKA 2CMFA 2JJQA 4Q7MB 1BS1A 2F1RA 4GRAA 2Q6IA 4P6VF 3WLPA 4YCNA 3C7KA 3K9CA 2R6R1 3D7KA 4Y1FA 3F5MA 2XMBA 4KQ2A 3LX5A 2A4MA 2GPNA 3WI7A 3T3PB 2NTYC 3EFBA 3EGOA 1WXFA 2QNRA 3DR3A 1G21E 3I39X 4X8MA 1QH1B 1QE5A 1MW8X 2YMMA 4IFBA 1C7JA 2G9VA 2QZ4A 3H99A 1R00A 1TEXA 4MS3A 5TQ0A 3BIFA 1P7YA 1XXHB 4PBTA 2B4TO 2QRJA 2FCAA 1TCBA 1T2DA 3IPRA 2P27A 2UUOA 2WIAA 3BFKA 2CYBA 1E2EA 3U4MA 1QIGA 5KU1A 1XJQA 2XXAB 2V7XA 4ZCMA 3OI7A 1EGHA 1NURA 1LD3A 2WNHA 2X0DA 1F4PA 5FFNA 1YU6A 4X1YA 3GFOA 5CLFA 4B3HA 4KUEA 2GCEA 1YJCA 1FFEA 4ND5A 4DR3B 4ES6A 4JASB 1OLOA 1KEUA 3UXEA 3CKLA 2PX5A 4F6RB 2Y67A 4WVLA 1BWQA 3U16A 2PM8A 3QX8A 3OBBA 5LKAA 4S05A 1MH1A 1B4DA 4M98A 3DL7A 3ZYZA 2HHCA 4Q21A 3EWSA 1UKEA 1F5NA 2WHEA 3MNFA 3K4HA 1IEVA 1AMUA 4OFXA 1WL8A 1GADO 1AGXA 1Y7LA 3DNPA 4HAVA 4HNGA 4IXNA 4KKXB 4KPEC 1RU3A 3DAGA 3OZUA 4FFMA 1JIVA 2Y92A 1NU6A 4JUBA 5J4LA 4UTRA 5GINE 1OH5A 3CVOA 2FSUA 4AY4A 5KQGA 5LSAA 2AW5A 2IX9A 2B1IA 4U2FA 5KKAA 3EZ2A 4JLDA 2B8NA 1ZCZA 3GEHA 1W75A 4MR7A 3GLFB 4NU5A 3ORSA 1AS0A 3FZEA 4TTAA 2RAUA 5KTKA 4NJMB 3LCRA 2J3MA 3HB5X 3WLSA 1JLLB 1KYZA 2VHWA 3OESA 1XNGA 2ZR0A 5DRYA 3EJ6A 3K3PA 3PNYA 1ILEA 5TC4A 1CE8B 3VR5H 2IZ7A 1U11A 2X86A 3VOAA 1UEIA 4CL0A 2WM3A 3ZW8A 2O2EA 4QEDA 1EFRD 1U80A 1OFUA 1Y4ZA 3COVA 4QUJA 5DE3A 1EFDN 1RM5A 3D3NA 5J2UA 2PCJA 3Q87B 3QUTA 4N5IX 1CBUA 1CTQA 4MEJA 4ARIA 1XXHE 4Z4QA 3ZZUA 2ZE6A 1A4RA 3AJ8A 1T8UA 2JGJA 4HX9A 3SC2B 2VDUE 4JDPA 3DQZA 1QX3A 1W87A 4LZAA 4O5AA 4YUZA 1PT6A 1J90A 4JVLA 4KLRA 5KC8A 5LUAA 3L4KA 1A8QA 3HUDA 3V1YA 3IQHX 1I1NA 1U5AA 4HYEA 3A9SA 3GT7A 1L5VA 4MP3A 3SBEA 1ABEA 3RRXA 4D9NA 4UUBA 1TUIA 2Q5QA 5EIBD 2I87A 3Q12A 4HDNA 3T94A 3H8SA 4KK4A 4BKQA 8MHTA 4W4TA 4W9NC 3RYFB 5BV1A 3OT1A 4MCIA 5B2ZA 1YBHA 2QT9A 2XQKA 2FX2A 4J0JA 2UYGA 2Z8ZA 3FA2A 3O4FA 4RV4A 2DULA 4XCVA 4E46A 2IYFA 5HXAA 3F2IA 1U8XX 2W22A 3K16A 4RZXA 3ECAA 2WF9A 1CULC 2RHBA 5BR4A 3TTSA 3LXXA 5A62A 3KLOA 1R6BX 1VPTA 4Q6WA 4LV6A 1MAHA 4YGYA 4IRMA 3W3AD 1P5FA 4Q02A 3WK4A 2D2EA 2DQSA 3ICVA 2CXHA 2XRYA 1VLQA 4F9TA 4I9UA 3I45A 1FP2A 2YVKA 2BKUA 1O95C 3L7KA 3ONEA 1E1RD 2Q6KA 2V54A 4Z1MA 4YRJA 4PYOA 1XCGB 2ZRHA 4GKAA 4GPAA 3UAYA 2QLJA 4DCTA 1TKBA 4EJSA 5G4KB 3DM5A 4C2UA 2IY8A 2O1EA 1N8SA 1QHFA 2WICA 2HF8A 2QTZA 3UQYS 4COKA 2HT6A 5AXAA 3EEQA 4XM2A 5THQA 3GEIA 2YZMA 2ZRJA 2J5XA 4OHPA 1RHUA 1V8OA 3AKCA 4PTLA 4ITUA 1CEEA 2RHCA 2ATCA 4P4LA 3N6VA 3L07A 4A1OA 2G1UA 1F8GA 2OCKA 3K71B 3ETLA 4P3YA 4WK6A 4OQFA 1MB9A 1Y4UA 4CM9D 2NVUB 3VU9B 3GN2A 1ULBA 3VZCA 2HNAA 1Y4SA 2JDID 3GRZA 1RBYA 3LFHA 3LF2A 1SCJA 1XEWX 2JHAA 2CJXA 2FPIA 3I6ZA 4WJZA 4F38A 1WB5A 4O0MA 2E55A 3GL9A 4NV1A 1P0FA 2ZZMA 1YVPA 3I9NA 1DRUA 1H0HA 4OHFA 2Y05A 4PLYA 2FG6C 3AG6A 2GCNA 3RRFA 3VUEA 2VQFB 5CX1B 2O23A 5DIZA 3A14A 1AKQA 1L8QA 4JL5A 3ZDCA 3VV2A 1G291 2HMUA 1ACMA 4OUDB 3CF2A 2MSCB 4OQNA 1SXJE 2VHQA 3ZNPA 4PO8A 2O48X 3NGMA 3GNQA 4J3JA 4KPFC 1SWVA 1ZVVA 4TLCA 1NMXA 3IUYA 3L8GA 4O6VA 1P1JA 2PZBA 1XVUA 1E1KA 2VK2A 1NUHA 5EIBC 5CW1A 4JX9A 4MVJG 5DGXA 3HACA 4O29A 1UT5A 2B94A 2FWIA 1A1SA 1NW8A 3SMVA 5I4CA 2NYUA 3NETA 3GDFA 5EE3A 1IFXA 1T9AA 2EFJA 3B51X 3TRIA 4RS4A 4X66B 4L4SA 3KQMA 2YFHA 3PJFA 1DQZA 1PO7A 2H06A 3K0AA 3L7NA 1SURA 1CD5A 4QOEA 4FYWA 3WLAA 4P4TA 2JFWA 2N42A 3OJOA 5JYDA 1UOQA 3TD6A 1DJOA 2GBPA 1SBTA 1A9OA 1YC2A 3AGPA 3C5CA 3FF4A 3JASA 4OQDA 4RADA 5KVCA 1ACLA 1XWIA 3BOSA 4L8VA 2BDUA 1T9DA 4D3YA 2VA9A 4C6TA 4PN7A 1AD2A 4IFEA 4KPGA 3TLAA 1YDGA 1T36B 4ZK2A 3CNLA 1IN8A 4RD3A 3WGVA 4PFSA 5FTLA 3N59A 3B2EA 1GD1O 2ANBA 2JGEA 4MWSA 4QFBA 2X13A 4QYWA 4TXLA 2VHXA 2WKWA 1J70A 4CI9A 1UM9A 3QOFA 4I46A 3OZWA 1ZOOA 1KKUA 1RJDA 1U3VA 2WE8A 3HVHA 3LM8A 5ECDA 1G0OA 4C1NA 4UD6A 3K1TA 2NN3C 5JH7F 2LXNA 2COKA 2HIGA 3BB1A 4K3VA 3KKQA 3SF8B 5JD5A 1WB4A 2FV8A 1SKYE 4RA9A 3QVVA 2ZYGA 3NGLA 1J0AA 2INGX 1IMJA 1JIQA 2R60A 3MAJA 3OZIA 4GVPA 4IKOA 4G0WA 4MV6A 2QQFA 1F6BA 3E1KA 3V1LA 3CVWA 3SZUA 1NI5A 4MA4A 4YUVA 2W8BB 2HA4A 3H11A 3NYQA 2NP7A 5BSHA 1XTSA 1WPGA 4NYJR 3V7YA 4DLAA 5HP4A 1F2DA 3HN2A 1ZXXA 1UIMA 4HUQA 4LGVA 3T3GA 4BTEA 4M8LA 3ZS8A 1H0SA 3GJRA 2NO1A 4CDMA 3CT6A 3HO8A 1GVNB 4XLZA 1GUAA 3R09A 4QHSA 4F21A 5KQSA 2C07A 3V1KA 1J8DA 2JW5A 4JZYA 4K87A 2BD0A 2FZKA 2VDVE 4L9AA 3T3IA 5LBIA 4ZO8A 2MT9A 1SQ5A 4B7UA 2V6IA 4P92A 1JMYA 1L7QA 2GZAA 4M9RA 5I7EA 2F3RA 3WLIA 3R7LA 4GL4A 1J09A 1TMYA 3GUYA 5G40A 5LYJF 1BQEA 5FBRB 2EEZA 2HLDD 5F2KA 3RVQA 5AJXA 1PFKA 1YQEA 3L5OA 3COPA 5LLTA 2QM8A 4LJ9A 5JNUA 4TL9A 1NF3A 1F3OA 1P2FA 3NRJA 1Y7TA 4MVJM 4RD6A 4TYMA 5JVDA 5K99A 2DTDA 4O08A 1OBCA 1Y9AA 3PUVA 2VOJA 4CR6A 3LVBA 2FWBA 3GJ0A 1QX4A 2P91A 1O6BA 2FUEA 4FDLA 2CV2A 4CJXA 2ZJFA 4NAVA 4BMYA 1J0XO 4H1VA 1TUBB 5HUHA 3PFBA 5BV2P 4BNHA 1GA1A 2ZETA 3PA6A 3AIKA 3DE6X 1YAJA 1OUMA 4G63A 3A6JA 1Q11A 1T1RA 1XD8A 4ZAZA 4F0JA 1AKTA 1YZLA 2M6RA 3EOBI 1RKBA 3JWPA 1JA1A 4DILA 2WYIA 1YL7A 4O4IA 4BNNA 4TT3D 3R7NA 3OQIA 3TVDA 1P2DA 3BK1A 1GNQA 1XZIA 4B84A 4FGJA 3WX0A 1L5WA 3DZKA 2OKGA 1X77A 4QDUA 4ZC8A 2VDNB 1PD1A 4DR7B 4AMZA 1FXWF 1WDWB 2PGJA 5L45A 1JHVA 3FNRA 3N2LA 2JVIA 4PG8A 2OWEA 5JDCA 3SJAA 3PD7A 1ZMRA 4BX9A 3G5TA 4GX5A 1WZNA 5BNIA 2P40A 1JILA 4FYYA 4MH0R 1JEEA 2IP2A 1H5QA 1HM5A 1QF9A 3ZY4A 3GLRA 2NPFA 5KOJB 4XVCA 3ADBA 1ZXLA 3C3CA 1XZAA 5I9SA 3RS7A 2IVZA 1O0SA 4BNMA 5CD1A 5BMOA 2HMSA 3ZLJA 2XDQB 1U8AA 4FSHA 5DOZA 5JFTA 4YJ2A 3T1YB 4FILA 4JGIA 1D07A 4LF8B 2BBOA 1KQPA 2AN4A 2YKGA 4MWCA 3IAS1 1F8FA 1MHPA 1NRJB 2FPRA 3NH9A 1P1FA 4XQCA 3TBFA 2E4UA 4EB0A 1QOQB 4E09A 1E4EA 3DW3X 1GRQA 1GRNA 4UNSA 1Y1SA 2OBMA 2QM0A 3KZNA 2XY4A 2IS2A 2AQIA 4TV8A 4F6CA 1E5DA 1NVWQ 2GLXA 4P0TA 2HRZA 2XB2A 1FVFA 5JNWA 5JJKA 1V16B 1RM0A 4LNHA 3VTAA 3DZBA 1B0ZA 3RUDA 1ZQ1A 1XWWA 1B41A 1ZZGA 2VTKA 1TXGA 2J0UB 4OHYA 4D99A 1AKRA 1G5RA 2QGNA 4FB5A 1PDOA 5DVZA 5CT8A 5K2OA 4YAUA 4ZMRA 1I7NA 1QHNA 2IHUA 1LV7A 2AHRA 4HNAB 5GM1A 4Z7JA 4AMUA 4UQOA 3MK31 3O5AA 2CXTA 4HP8A 2MSNA 3D8UA 2BZ1A 2H9IA 3UC5A 4YJKA 2ZSUA 4JL8A 4NBUA 3UWDA 2FMKA 2WTBA 4QUEA 1E0DA 2X40A 1Q83A 4OUKX 4UHBA 2UZ4A 5G0WA 3LCUA 3RYCB 2ZG6A 3LBAA 3AVTA 5AJUA 4GOOD 3GZNA 3H8VA 5DCUA 1M2KA 1LFAA 3H9CA 1IXRC 1V26A 3GA0A 2B2CA 3GG2A 4W5WA 1A0OA 3TAXA 3SKXA 3ZNNA 1X8LA 1I3NA 1II0A 3HXPA 1K6MA 4NNOA 3TDKA 2CB0A 1A8UA 4A2WA 3OTWA 2QY9A 1SCKA 1WZIA 5DYIA 2SCUA 3GROA 5CA1A 1AU9A 5LQSA 5SICE 4C4XA 5ADVA 1C41A 1HPLA 1RI1A 2XH8A 1DLJA 1PKEA 1S2LA 3LBHA 1F5SA 1TIBA 1AQUA 3QVKA 2Y1DA 4UVIA 5J2TA 3F6SA 3QEAZ 1ZMBA 3OPYA 1KEWA 4RHCA 4EJSC 4GAEA 5ARDA 4UE6A 5F3RA 3CPSA 3EJWA 3MJ4A 2H4JA 4ENTA 3ASUA 1PNVA 4Q48A 3TGWA 2LTAA 1UJBA 3ANLA 1EI9A 4YWJA 1C80A 1URPA 2J6HA 2R6DA 1XX6A 3JZMA 1IN6A 1KO7A 1XV5A 5JOQA 3HCWA 4J2HA 3R8XA 4TX1A 3S2GA 2G83A 4UEWA 1TQ6A 3IQXA 3ZV4A 1L7OA 1TZKA 1U9JA 4M6WA 3ESAA 3NDIA 1G3RA 3S68A 1PK7A 2BLLA 1KYTA 3B52X 3I23A 1N2JA 1TT7A 5JS2A 1X1DA 2Q3CA 4OQLA 4J3NA 1GGNA 3W4KA 1X70A 5ER9A 5TIIA 2XJ9A 2RHOA 2HZ7A 1PVVA 1QYWA 2GB4A 1XG5A 4GBJA 4LX8A 4NONA 4R3WA 4RLQA 3FMVA 3ZH2A 2MINB 3DMDA 1L5MA 1C8LA 2W2TA 3D6FA 3GJ5A 3MS7A 3CN9A 3WK6A 3PKJA 2OK7A 4YT2A 4TMVA 5ARBA 5AOAA 4CTJA 1ITZA 4RZUA 1NNEA 4CCSA 2I1WA 3GAAA 1G5QA 3JYQA 4HNRA 1Z4QA 5FL7D 3A27A 3OPYB 4L5YA 2I7CA 3Q9LA 4EYKA 1XPUA 1BDMA 1M2NA 3CUKA 1S2DA 5FNVA 3UK1A 5A4IS 1GSHA 4CR8A 1PDVA 4NYIQ 2EX1A 1B8UA 5DTJA 4TKUB 3TTTA 3FCAA 1L1EA 2RARA 3D4NA 3IO3A 4BNVA 4EY4A 2VYQA 4V1CA 3WLMA 1ZK3A 1ZINA 3U26A 1Q22A 2NAPA 4HMQA 1X1SA 3TTYA 2O1WA 3I42A 4GOMD 1XDUA 1Y3CE 2DJ5A 1T9CA 4MUXA 1TE2A 1E4OA 2B8WA 5IWAB 2E4YA 1XYVA 4OJYA 4AJ2A 4EKEA 3E2PA 3UFXA 1DEAA 2IDZA 3WLLA 3ZWPA 4YVFA 2IBTA 1C4XA 1BA2A 1W93A 1E6MA 1RPTA 1VSBA 2ZBVA 3K0FB 1L3IA 1CUYA 3ZHBA 3VKUA 2ZBRA 3AG5A 4ZVNA 3LUFA 4HWGA 1M0SA 5K3FB 2YHBA 5TQVA 1BMFA 3IXQA 4DA8A 1Z8HA 1W96A 3P5SA 4P4SB 2QJFA 3C3WA 1V47A 1SUIA 3QTTA 3Q1LA 3U19A 2JIOA 1KDOA 4HVTA 1UBEA 4WK2B 4BKPA 4QQKA 2HW8A 1X2EA 3IILA 4UCQA 4CKEA 2G07A 5P8WA 1JHYA 3OFVA 4ZV4A 5TB5A 2IVFA 4GI5A 4BMVA 3FUTA 1KY3A 1WV1A 4NV3A 4PANA 4E5KA 1QDUA 3O82A 1GZSA 1Q6YA 3VOTA 1DQNA 2Q50A 2O9JA 3B3GA 4H59A 3QFHA 2ZVJA 1YB6A 4GW3A 5KTTA 4S24A 3CLTD 3PDIB 3BJMA 1U1FA 1X8XA 3MD9A 2DFTA 4DC9A 4EJMA 5IRCD 2OV8A 3QG5A 3BGWA 4Z99A 1E8MA 2Z1NA 2W42A 2TECE 2GHTA 3K7EA 3MA0A 1E5VA 3NHYA 4AF7A 1OI4A 2EF0A 4PLTA 4QDJA 3VHRA 3GU3A 2VTVA 1MC4A 3AETB 1G8PA 5DYTA 2CT8A 4LPSA 5FAXA 3HV0A 3TOXA 3TDMA 1UBOS 4Y2QA 5AT1A 2Z2XA 3SYTA 4R40A 5P21A 1KZGB 5A9SA 5KOIA 5K8UA 3FWPA 1JE1A 1LBEA 1LTQA 1PJTA 4N5DA 1NE7A 1QAMA 3ZHXA 4N8EA 4CUZA 4Z1MD 4UE3S 1OXUA 1Z39A 2ZB3A 2P6RA 3OKCA 5B5SA 2EDCA 1SOMA 4WZAB 1NN0A 4KQFA 2Q4EA 4JXXA 3HXKA 1XL1A 4HGYA 2ZRNA 3P2EA 1QUEA 3Q0TA 3TR6A 1Q12A 2QJOA 2PRYA 4D8TA 1P61B 4BKMA 2J33A 3EIQA 3HFGA 3D6JA 3NBUA 2QN3A 4XIGS 1JX6A 1FDUA 4PAOA 4K9KA 1RI4A 1S7CA 3H18A 4WA8A 4L28A 4TKVA 4M7WA 3T3MB 3DAOA 1LLCA 4KQGA 1VJRA 3J81k 1R6TA 3CF0A 3KOZA 1FFWA 5JY6A 4KKVA 1RQXA 5BMVA 1RS0A 1I51A 1FUYB 2YNMD 3Q8XB 2IIVA 1IDN1 1PTKA 1NQXA 5HPYB 4HZUA 4F7DA 3R0QA 2VCEA 5JNTA 1RC0A 1U8EA 3UAVA 4RQTA 3WY9A 1FSGA 2L2QA 3WRXC 4LOIA 5JQWA 2A35A 3F4BA 5ENDA 3STUA 1P9OA 4TVKA 1THTA 3PHLA 3IMFA 4MUYA 4DZRA 2X9VA 1ZITA 1GQQA 3V8VA 1Y3IA 2FN8A 4NBLA 3UMFA 5EIEA 1MB2A 2GZ3A 4MI9A 3ZV5A 4JJGA 3PQ2A 3D43A 4YASA 4FN5A 1M34E 1U28C 4MK4A 4W6ZA 5FV4A 4TWAA 1CVRA 5IZCC 3DFUA 5DTMA 1OJLA 4CVNA 1U02A 1N3BA 3LPMA 5T8KA 4Q7LA 4XRGA 5HIKA 3RTCA 4Z4FA 4UPVA 1JXQA 4MKIA 4Z0PA 1UDRA 1T2FA 3MYRA 1L5SA 1X9HA 2AE1A 3N2IA 2IOQA 2RSLA 3NV9A 5LWQA 2GPWA 5B57C 1Q44A 4G89A 4NICA 1FRVA 3KSBC 4I1SA 1NNUA 3D6TB 3KPWA 3ISJA 2DLDA 2NQ8A 2XMRA 5TARA 2QVZX 1P7WA 2YWFA 4CIBA 4HLCA 5KYUB 5MN5A 2X5NA 2G0TA 1A4UA 2JAQA 4QICA 5TPWA 3E5MA 2OXFA 3N8DA 5DV9A 3PD1A 3VPAA 3OCCA 1ULAA 1ZESA 3KVOA 2BF7A 2WTXA 3JD1A 3FKQA 4GG1A 4TYQA 5SY6A 4AKSA 4EFNA 4JITA 2HKIA 3QLTA 5HZGA 1NULA 2SECE 1DAIA 2VATA 3FSGD 3K5PA 4B6JA 1K7EB 4BJHB 4BIIA 1L4UA 4DBVO 4J76A 1CUVA 4KG7A 3DT6A 2FMTA 1INLA 4EUNA 3TQRA 3G59A 5FT9A 1O8CA 2J3LA 4BO6A 2BUCA 3D2AA 2NQTA 5JDIA 2AFIB 2FEAA 1XZCA 1DJNA 2IEAA 2AMVA 4I55F 4MUJA 1J1UA 1AKEA 1OYWA 3JD4A 5A3JA 3CLRD 1PL8A 2GCGA 1AK9A 1C29B 2ZI9A 4Q3AA 3CINA 4MYHA 4R8LA 2HMVA 2AJDA 1P8JA 3GDWA 3OECA 2NU7B 1UQUA 3W8NA 1DP4A 1UJCA 1IEWA 4QU9A 1UM9B 3O8BA 3WFJA 2AD5A 1H2FA 3EW9A 5HYVA 5LXTB 1PR4A 4ZT5A 1MD9A 4X41A 3Q5DA 1IB0A 4KYVA 1WUHS 4QPPA 3CLRC 1E0SA 3H2SA 2XCIA 3QEBZ 3R5SA 1DWPA 2GK6A 1JWAB 2J6CA 3CUVA 5CJJA 4AKIA 1KP9A 5IF3A 4ZGBA 2G82A 1FNSA 2XKKA 2PT7A 3QKIA 4MKHA 4GP9A 3IIMA 1PYOA 2Z83A 1EP3B 2ZUFA 1ZO8A 4L76A 1FZQA 1O08A 3U4IA 2HJWA 2WJIA 3CZCA 3D3JA 4JKIA 4MLCA 4MV5A 4OBBA 1AXEA 1SIBE 1QK4A 3F3KA 3HDHA 2CW5A 4MDYA 4TMYA 4XRRA 5AM0A 4ZANA 5CFMA 1ECGA 1QS0A 1EDDA 1RYFA 3TAUA 4ZRNA 3N6RA 3O94A 4IKEA 3PNPA 1KE2A 2HA7A 3L05A 4JZKA 5C7IO 3QXGA 4CM6A 4OY3A 1EFKA 3BKWA 3HM9A 4WASA 2P9FA 1YS4A 1Y3FE 1FS4A 3BFXA 3V1MA 2WRZA 1EDEA 1KC1A 5AVSA 4BVFA 2BEJA 2WSBA 4M76B 4OIFA 2PPLA 3V3KA 1IM5A 2PMEA 3VYTB 4HQFA 1XT6A 1E3WA 4QEZA 1L7MA 2DHDA 1BD4A 2J5BA 3E18A 2M32A 3R6GA 3RKUA 1L4YA 1MA0A 1RD4A 1V7PC 3IP7A 3L1HA 4HN4B 4J29A 4UXIA 1P2VA 4O2AF 3PGMA 4JMPA 1E1YA 2QM7A 3CWQA 3IODA 3QF4B 3DLBA 3BWCA 2OD2A 3O8LA 4WBXC 3H5IA 4MQ5A 4PHGA 1MO2A 1VGRA 1U94A 2ZUDA 4A2PA 2J07A 1WP4A 1ADBA 2GZSA 1QOZA 5E2BA 3GT4A 5JDCC 4JOBA 4KGZA 5BW4A 2WTUA 3DDWA 3HV2A 3LBIA 4GF5A 4RE6A 3SLGA 5CYGA 4E2YA 4TGLA 5BN3B 4GMDA 1O0CA 5D6OA 3BQNB 3HPRA 3FETA 4HQNA 4XGNA 1PZGA 5ETJA 5T57A 4W5RA 3P19A 4Y2YA 2GEDA 4L9RA 5FPQA 5A0VA 3KYJB 1Z6YA 3TMKA 1IIRA 1YQTA 4QA9A 1D0VA 4EB3A 2ZCVA 2WDZA 1P77A 3TIGA 3Q98A 1T3LA 2DF8A 2MU1A 2PJRA 1JSRA 4A73A 1SKMA 1EA5A 1QK3A 2YHIB 4UU8A 4DV5B 2BEUA 3GG9A 3BMNA 4Y6QA 2XBLA 3ZLBA 4KWEA 1CJVC 2A67A 2EARA 4D0NA 2C92A 4BNYA 3PWSA 2MR6A 4N54A 2P9CA 4B09A 3EH1A 3WP1B 3VJRA 4OLAA 2C2KA 2OE2A 4GVLA 4QSMA 4F2WA 4BGDA 2I2DA 4O4IF 4XAQA 4EMBA 2XRZA 3IKLA 1OAOA 3EFHA 4RPGA 4N47A 5CCBA 3DVLA 1LQUA 4GC5A 1S2IA 5FOWA 2XKJE 1W1IA 3LT0A 3S4YA 2HK6A 2ZJBA 3LUAA 1OYYA 4KYTA 4WZBA 4CCYA 3W6OA 5EMLA 1ZUD1 1M6NA 1NUQA 4Q7JB 3KWMA 1DAHA 4NU8X 4N7MA 3NM6B 5LA6A 4PAGA 3FMGA 5TV2A 1JR4A 3EAFA 4L3OA 1M76A 4HF7A 1GFZA 2Q62A 1P60A 1SO8A 2PANA 1LLDA 1SB9A 1G2IA 1V2GA 2XNKA 1GN8A 2PWPA 4WXMA 1A9RA 2BMDA 2AW3A 1OFUX 3PC6A 2UVDA 1WQ4A 1YUMA 2CCKA 1RKXA 1T1EA 4P82A 4C0AC 3HFRA 3PJDA 2FRDA 1TYBE 1B14A 5TT1A 4DCGA 1D4OA 3W2EA 1GAXA 4BQNA 4D9BA 1ZVQA 4B5LA 4R2JA 2CLEB 3L92A 1E8NA 1HUQA 3T15A 1A97A 2REXB 2KB0A 2Y4OA 3NTLA 2GZ1A 3AOGA 3A31A 1WSDA 1RRGA 3I4FA 4MVJF 4OH1A 2VK4A 4FTWA 1SULA 1QO0A 2D59A 4NDAA 4IG4A 5DRTA 2H7YA 2KBEA 3H97A 2CNWA 2ZIXB 3UKOA 3LT2A 2GLUA 4Y7DA 2A9QA 2CLOB 1YA8A 1B6RA 1NN1A 3AJAA 4I0WB 4L75A 1LDYA 3ZXYA 5CDHA 2HMAA 3RC7A 3T9FA 2P69A 1FTGA 3UH0A 1DDGA 1VYHA 1JQLB 1RIIA 1TF5A 2R8RA 3IPYA 3M3DA 3GJZA 3MUNA 1VXOA 1FFCA 2SKCA 2ZIZA 3OF5A 1P0CA 3VISA 1YSCA 1M2FA 2VTEA 1L8OA 3CB2A 4GD3Q 2ONYA 1WXDA 2Q28A 3A6EA 1PSWA 3DPSA 5F76A 2JC3A 1IY8A 4CMAA 4JI8B 3KYCB 4H1TA 1DWOA 4BNZA 5EKXA 3PNKA 3IEXA 1I3CA 4J03A 1KPHA 5LQDA 3NX4A 5CMLA 1KHHA 4Q39A 3H19A 2D4HA 3UHOA 4RD1A 1W73A 2VXOA 4TV9F 1QHSA 2IEYA 1PBNA 5GGYA 1ETUA 4HDCA 4RK4A 2V9ZA 2YQ4A 2JLYA 3HN7A 1BXGA 3D8SA 3KOUA 5MF6A 3LJKA 5AKYA 3SZLA 4EFLA 3O9VA 5GQSA 1B8VA 1P4AA 2AX4A 4BB9A 2QUJA 4TT3A 2PD4A 4YA6A 4FR0A 3BHMA 1SC9A 4GUAA 4A10A 4H31A 4FZVA 5G2OA 4XYLA 3PEUA 3A1SA 4JMLA 4B2YA 3MJHA 1CY8A 1NFFA 1Q0UA 2PCLA 1LNSA 3KIPA 4KR0A 4RHTA 3RYTC 5FWXB 1RACA 1QWSA 5CH8A 4ZIRB 4K03A 4K9NA 1U90A 1XZNA 2Y0DA 2W70A 4DIBA 1HA3A 3ZHYA 3ZNOA 1XRMA 4XQ9A 3JRXA 2AC7A 3WDLA 5EP1A 4PXSA 3LMKA 1P2TA 1NJ2A 1ZGAA 1RXIA 2AQKA 2HA2A 2WFLA 3DTVB 5DULA 5C8XA 1UFRA 3O8QB 5DX1A 1Q15A 3FIJA 4EEKA 1QYIA 5DEOA 2GAFA 2PLNA 4CIDA 4BHTA 4HJXA 3DJYA 3ORRA 4U5XA 1WTAA 1HV8A 3ANXA 4ZRDA 3RSSA 3R7BA 4KH1A 4K9LA 4CKYA 1YFKA 1XLUA 3CNQS 3FGOA 2A7XA 1ZJ5A 2FPIB 3E5HA 2JIRA 3L0PA 3LC1O 1PJQA 4EPXA 1Y0BA 2HLDA 2QG9A 1LPMA 5IZCA 4OQYA 2DFNA 3B6KA 3QKRB 4GR4A 5EZYA 5KWIA 4LF9B 4PVDA 3G1WA 3BG5A 3JAWB 1V8FA 4J4BA 4WOBA 5JZSA 4HO1X 2H17A 2JFZA 3ROQA 3LBFA 3NS7A 3WADA 4PCUA 3X1DA 4FC7A 3S5UA 4B5KA 1FEZA 1KAQA 3CNHA 4D0SA 3O2JA 3WLKX 1UFVA 1PEKE 4WACA 4IDPA 1N8NA 4KVFA 3D64A 3LCCA 3M6LA 2R5FA 5JSHA 3EXFA 2HSZA 3I8OA 1EG2A 3O4GA 3ZY6A 2HQRA 5AVZA 1TCCA 2ISCA 2LW7A 5MN6A 2QU8A 4EUSA 3ZKWB 3ADKA 1VMKA 4V02A 4BQSA 1P8AA 2AZTA 2VP6A 4LDZA 3T95A 1UMDA 1WXIA 1D7AA 4LDRA 5F5NA 5T5QA 3VC3A 2WSYB 3LK6A 1Y82A 4PSAA 4DG8A 2NSLA 1YXMA 3OZEA 3CUUA 5FPSA 1MHTA 2H3EA 4CT4B 3WL5A 4PPNA 4AS2A 4IEEA 4G5XA 4DY4A 3S7TA 3ZGVA 3J7AC 5CB0A 3RJMA 1X7GA 4H7JA 3PQ7A 2R0QC 2H9YA 1GPH1 2J3HA 3DMNA 2X8WA 4EY5A 1OXKB 1QFJA 3RYIA 3OMWA 2I9KA 4C0SA 4DM7A 5E38A 1EQUA 1KTVA 2H0AA 1NXTA 1BYIA 1G4UR 1PD0A 3AZPA 2JS7A 3F9CA 3GFTA 2RKBA 1IZZA 3QUCA 1D2GA 1RPNA 4JJ8A 4NDNE 3HK2A 4M1SA 2C98A 1MQAA 3BZWA 4RGYA 1U3GA 4CF6A 3OZRA 2F3QA 3S44A 2GEUA 1G20A 4K28A 5LN1A 4ARUA 1HDIA 5FNVB 4DR4B 1TUBA 1NKSA 3PPYA 1C7IA 1N1GA 2NZXA 3DHEA 1IZ8A 4NYMR 3EVTA 5LQRA 1R6DA 2H00A 4MUIA 2X8AA 5BSKA 2RONA 4G01B 4Y6GB 1NWCA 4N39A 3MC1A 4MOWA 4BQPA 5L3SB 5AXCA 3I5XA 1LI4A 3LA8A 2FMXA 5IVIA 2Q5IA 2QTCA 2BVNA 3NPAA 4XSVA 5FLYA 3I0ZA 1GZ6A 2XJ4A 3PZRA 4FHCA 4IH9A 4KQ9A 4PRZA 3TIIA 4QT4A 1OWMA 2QA5A 3VDRA 4QASA 3MWJA 2GKSA 3L6DA 2AFRA 1TI7A 3UW1A 4TOIA 2GJ9A 2IV3A 2CL5A 3GUVA 3KTAB 3TKAA 2BUBA 5KAMA 5GZ6A 1F14A 2NZJA 2XMQA 5EJ9A 3S2EA 1KYQA 4NZMA 1BTOA 4CT0A 4NK4A 5FRDA 3O47A 2Q21A 2CYAA 3OM8A 1PFVA 4LY0A 1DBVO 1Y3BE 3FOBA 5LP6B 3T5PA 3R40A 1SEVA 1S4QA 3GLHE 1P6QA 3BB3A 3T9BA 2FR0A 1KH2A 2PXXA 3ZBTA 1I6WA 2E6UX 4C7XA 1XB2A 4KJXA 3IGFA 4MVYA 3G2HA 1ZSVA 4WLOA 1U9CA 3KOYA 5CK5A 3TOZA 4ZEWA 3SD7A 1IQPA 2C9ZA 1N2EA 1QZTA 3O0DA 4IQ8A 4MJ7A 1B43A 2JZOA 3OEWA 5DGIA 2J48A 2O2DA 5A4KA 3DBHB 1KI7A 1VZ2A 1Z4PX 3FYUC 1IBMB 4LFAB 1ZGBA 5CPFA 3GN1A 4H08A 3RVLA 1GY8A 2WJPA 3U3DA 2QR5A 4JLVA 2C2ZA 4GUDA 3CLUD 3N2EA 4C89A 3NXSA 2WJVA 2FW6A 2QX7A 2DHCA 1PS9A 3GYGA 1E7QA 3O92A 2AMJA 3INRA 2OUKA 4OKSA 4RWEA 3WL8A 4PZUA 1GPYA 2FN7A 1LNQA 3EUWA 2VNAA 3LQ2A 4PZ0A 1YMUA 4F56A 3NEJA 3PDUA 4JR0A 1F48A 4NF2A 2B92A 1PW7A 3ZTWA 4WJLA 3BDIA 1CUCA 3WB1A 1OLSB 5LD2C 4UVDA 3T7EA 3HH8A 1VE7A 3FMOB 7MHTA 4K1LA 3UGQA 1NJ8A 2IP1A 3ABIA 4WBNB 4QM6A 1ADJA 1XAGA 4LK2A 3B89A 2B3DA 3BCUA 3JQ8A 3KZCA 4YH1A 1FFHA 1ORHA 3PNBA 4DLSA 4IH1A 2YY5A 4RKEA 3WV5A 3VZSA 1MA3A 1PFUA 4Q4LA 1RM3A 1CKEA 1Z2OX 4DCJA 1F0PA 2YHUA 5U1PA 4CDNA 5DI9A 4FDTA 5B1DA 1MC1A 1EFHA 1U9ZA 1VHJA 2GN4A 4N65A 2E4VA 5BSVA 4YUYA 3CJRA 2IEGA 1PTJA 2V3WA 5EMMA 3QVWA 1Q7EA 3SR3A 1MV5A 1ND5A 4JP2A 3QXSA 5ELLA 2QG6A 4EO7A 4Q7EA 2PKQP 2OZEA 2C42A 1NTOA 3QJYA 5T3UA 4ZZIA 3OZXA 2XA1A 1BNCA 2I54A 4LXHA 4HBGA 4FM9A 5JIBA 1USGA 4JB3A 2F4VB 1GNVA 4Q4AB 4EHDA 2OEPA 3GT0A 1ANKA 1C1DB 4L9SA 4BX0A 1ZLXA 2D3WA 1CV2A 1SK9A 3ERCA 4JJEA 4DJ5X 1VB5A 2J9RA 4RTRA 3AZOA 3KC2A 1TM7E 4OBEA 4AM8A 1E3DA 4QJBA 2WWIA 1VJGA 4TLMB 3EZYA 2OV4A 1FU8A 1SD5A 1MVNA 5G0TA 4EJ6A 3AM1A 3B85A 3W8FA 2ECQA 2W2VA 1B6TA 1AK2A 2RHGB 4JP8A 2IQIA 5CVVA 5A5EA 3O0TA 3DFKA 1FSPA 2J9YB 1NLMA 4EABA 1I6LA 1SELA 4EJFA 3KS9A 1LPSA 3LL4A 5FQOA 4YT5A 3ZWDA 1PQYA 5KHOC 1NF2A 3ZQJA 4WADA 4QPZA 1CFJA 1NC3A 3REQB 3TSAA 3U3RA 1NUTA 5MFZA 4XVUA 1BVHA 2BFFA 3G2OA 1Y9ZA 3HHPA 3M6WA 1FXWA 1TA9A 1ZJYA 1LVGA 3AI7A 3NZEA 4BC1A 3Q3JB 4O4IB 2WVAA 3UH1A 3KZ1E 3ZC3A 2WFZA 4YRZA 1AO0A 2IS1A 2CNLA 4O4JF 4OBWA 3P9KA 5AP9A 4EHLA 4QQNA 1Z0UA 2JI6A 2ONKA 3E8SA 1Y6QA 4UXJA 3LQFA 2FWNA 3A1UA 4U7HA 3QP9A 2UZ3A 2E48A 3LLCA 3AYZB 3PCRB 1CHDA 1TU0A 5CT4A 4ZDJA 2P7HA 5J4HA 1QP4A 4NCNA 3S55A 3UPDA 2O06A 3BIOA 4GYYA 1W5FA 1N3YA 2VYND 3ME5A 4DANA 2XB9A 3O4HA 2WEKA 3U3KA 5EHXA 3U7HB 2W0MA 1Q84A 1Z12A 3KQQA 5EKUA 4JUFA 1B0UA 1LPPA 1OIWA 2QX8A 1E6LA 3N8HA 5H3CA 2AR7A 5IJ9A 3A1EA 4HMPA 3ZBUA 3NPMA 1Y8QB 4ARSA 3CM0A 3K0BA 1LW7A 5KQRA 4D9JA 4ZN6A 4URXR 1I2CA 1QF6A 3ISTA 3IOMA 2I2BA 4BBZA 1SBIA 3HZZA 1EFTA 3IXLA 3KDSE 1L7NA 2IOFK 4GQIA 4PGAA 4YFYA 4Q9JA 5TX7A 4J1QA 2PRZA 1ZG3A 4AF8A 3P20A 1KOLA 4BVKA 3M81A 1FJHA 4A6XA 3IL2A 1KSHA 4F5WA 3LZ6A 2QLMA 4I4TB 4L8LA 3F4KA 1WOMA 1UMBB 3M33A 1H42A 2DR2A 3JQCA 1R3DA 5EEHA 1IK4A 2GPAA 3EC2A 4LYDA 4CEJB 4L7VA 2HRQA 3V1TC 5E0KB 1VCOA 4PINA 5IK2A 2GBIA 5CX4A 1Z6QA 2QMOA<