1PL8A

Human sdh/nad+ complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
356
structure length
356
Chain Sequence
AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords human sorbitol dehydrogenase
publication title X-ray crystallographic and kinetic studies of human sorbitol dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
total genus 121
structure length 356
sequence length 356
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.14: L-iditol 2-dehydrogenase.
pdb deposition date 2003-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pl8A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1pl8A01
3E8XA 5F5LA 4KTVE 4RPJA 4LRSB 4MPDA 3ULKA 2Y67A 4YAEA 3DZKA 5BSFA 2I67A 5JY1A 5EQDA 2OXIA 3BAZA 4D3SA 3W8EA 2E48A 1TT5A 4Y6RA 3LF1A 3PJEA 3U9LA 1P0CA 2Q2WA 3H9UA 3DFZA 4P38A 3ZW8A 5BQFA 1WMBA 2HJSA 1CERA 5A5EA 1YOVA 1W73A 2FPPA 4CM4A 3MJSA 4RF2A 3R6DA 1EDOA 1LEHA 2Q50A 1WMAA 3IQDB 3JQGA 5JDIA 3S2FA 2HDHA 4S3MA 4Z3KA 4ZRMA 1JKFA 2GASA 3K8ZA 5TQVA 5TT0A 4E31A 4YQZA 1HLDA 3G49A 2BGKA 1FDUA 2ZJ0A 4FC6A 4QECA 1YDWA 4S1VA 4BNXA 2OBNA 4MIEA 1EVYA 3BMNA 4FR5A 3H9EO 4R9SA 4D43A 4K1LA 3ZWWA 4JP3A 1PJ3A 3X2EA 1E5QA 3GUCA 3ZV5A 4A10A 3DXFA 2QG4A 4J1SA 1NYTA 1EVJA 1EBFA 5DCWA 2I3GA 1KC3A 2B5WA 4IQ8A 4B4WA 5ICSA 2PKQO 5CDTA 3C1OA 1T2AA 2QZZA 3GDGA 2C7VA 4PIVA 4RLSA 3GH3A 3EGOA 1JLLA 3DDNA 1LDMA 3KHUA 1FXSA 3ETDA 4GLOA 5COBA 5CDGA 4OQZA 2W90A 1OC4A 1MFZA 2JL1A 5DOVA 1LTHR 3BTSA 2WEKA 2GZ1A 2PWZA 2DUWA 2HJRA 5TNXA 2IEDA 4B79A 4GKBA 5JYDA 2ZIZA 4MKXA 5DT9A 4BNVA 3RUCA 4YJFB 4BO1A 4B7CA 3FSRA 4GGPA 3HSKA 4CMIA 4FSHA 2BI8A 4R16A 1ONNA 1U3TA 3E5MA 4R4JA 5EESA 5JYEA 2PFGA 4AJLA 4CLOB 1BRMA 2C59A 4CUKA 3ANNA 1BMDA 4P8RA 1JN0A 3I9MA 1L7EA 1P31A 2Y93A 3PZRA 4TKLA 3GHHA 1ZMOA 1BDBA 3GHYA 4PG5A 4XIJA 4HWKA 3VOSA 4Q3NA 3TFOA 1YB5A 4DLBA 3ZWBA 2CVZA 4ND2A 2EJWA 4R51A 3ROKA 3WBFA 1GR0A 1MXHA 1KOLA 4I8XA 3VKUA 1BXZA 3HJAA 3ZCXA 2RHRA 5JDCA 2FPIA 4IMPA 3D1LA 4IDFA 3OETA 1ARZA 1E92A 1EE9A 4ND4A 1FMCA 5GZ3A 3KLMX 1DXYA 3D3WB 3NGLA 4R1NA 4QO8A 4NFYA 1PL6A 1PSDA 2Y0EA 3WG9A 4IIVA 4BMNA 3WGYA 3CH6A 2DFVA 1JA9A 1A27A 4NBWA 3C24A 4QSMA 1HE2A 2Z5LA 1NPDA 2VQ3A 4N54A 5COQA 3TPCA 5I9LA 4Q3CA 1KVSA 1Q7GA 3KO8A 3RUIA 4BNGA 4WGGA 2P91A 4ZRNA 3QJ5A 1IULA 1ENPA 1B3BA 1DEHA 3MZ0A 3OF2A 2NTVA 4XD2A 3RU9A 2FZWA 3WGHA 4W4TA 3IUSA 3JD3A 4Y9DA 3O4RA 1PJSA 2Q4BA 4ND3A 3IS3A 1DC4A 4MOWA 1S6YA 4RV9A 5EN4A 4TZTA 3BHJA 4JCOA 1M6HA 2RBEA 1WDMA 1P45A 4E2XA 4JLWA 2YJZA 3M2PA 1MP0A 1RM3A 3AY6A 3RFTA 2VOEA 2O3UA 4TZKA 3HADA 4RCVA 3GPIA 2EKPA 2PK3A 3T7CA 4NHEA 2XPCA 3FF4A 4RF5A 3U4IA 3VHRA 4J91A 1PWZA 3KRTA 4WKGA 4IIUA 1CYDA 4M86A 4EI2A 4BO2A 4PLGA 3BTUA 1PL7A 1A9ZA 4Y6PA 1V3UA 3NT2A 2EIHA 4RGBA 1DJQA 4IINA 2UVDA 3WYCA 4GPD1 1VJ0A 2YHIB 1QYVA 4JN6B 2E49A 3EY4A 3GAZA 3TQHA 4OYRA 4GKVA 3PDJA 1PWXA 3A1NA 1E1LA 2O2YA 3ROQA 5BSGA 4WLOA 4XA8A 1SB9A 1Y8RB 3BHIA 1RM4A 1T4BA 1EDZA 3ROMA 3ZWXA 1ONOA 1H6BA 5ENVA 1VC2A 3HNPA 1ENZA 4J3FA 4ALKA 3R3SA 4KDFA 3GAFA 3O9ZA 3H9GA 1GTMA 4YXFA 2B37A 4ESOA 5A04A 4DVJA 4GSLA 3IIEA 2AQ8A 2VTDA 2EKQA 4LN1A 1NFQA 2JFHA 4Q39A 4XDZA 4BO0A 4WOJA 3G1UA 1PZFA 3LDHA 3U4DA 1QV6A 4E33A 1X13A 3PWKA 2I6TA 2PR2A 3B6ZA 3EW7A 4D42A 1N92A 1B3RA 3GVHA 4GMGA 2NV6A 1YBAA 2HRBA 3PYLA 3QWBA 4YJFA 5BSEA 1M66A 5IJZA 3JCZA 2YHUA 1I30A 4MIYA 1ZCJA 4E2YA 1RYEA 5F1OA 5T67A 4G5HA 3W4JA 3F46A 2BHLA 2XOXA 4ND5A 4XJTA 4EDFA 1V8BA 2BF7A 3JSAA 4E4YA 2H63A 2F00A 4J1QA 1PTJA 4U0KA 3QRWA 1I3MA 4R01A 5G4LA 4FB5A 4BNUA 4RO0A 1ZK0A 2YDXA 3FI9A 5CG1A 5JCJA 1A7KA 5I7EA 4WLUA 2PZLA 3ADPA 3PIIA 4J49A 3HDQA 2AQKA 4PLPA 4WEOA 4A5OA 2VOJA 2D4AA 2FZEA 4HY3A 2GPTA 3SX2A 1I01A 1QYWA 2EGHA 3ZHZA 4XR9A 4HFNA 3D3WA 2ILTA 4FCCA 5BNFA 1U3UA 4KZPA 3EZLA 3F1LA 4LVCA 2C0CA 2O7SA 3A28A 5I9NA 3RVDA 1MB4A 1ISHA 3UCXA 4CM9A 1JVBA 1Y5RA 1JU9A 1D1SA 4XGNA 3DOJA 4IXTA 1IUKA 4YJDA 4YT8A 5EERA 4CM9D 2O50A 3RSHA 3JQAB 1H9BA 1SZJG 5KOIA 1ZK1A 3OSUA 1YL5A 3VH1A 5U9CA 3NGXA 4ZQGA 4E32A 4FQ8A 2W98A 3R3JA 4DQUA 2GUGA 3WR5A 3SJUA 3NX4A 4PZEA 2HCTA 3GZ4A 4PCVA 1DRVA 4ZICA 2FR0A 1RKXA 2P4QA 1ISIA 3ITDA 3NJ4A 3WGZA 1J0XO 4R1UA 4QTZA 3FBGA 3I52A 4GX5A 4DQVA 2O4UX 4QX6A 4ZVVA 1I2BA 1EVIA 1AGNA 4N5MA 1NPTO 2ZYGA 3KEQA 1TLTA 5CDYA 1LJ8A 3PK0A 1WAMA 3GF4A 3H2SA 1RJWA 3HDJA 1K89A 4BKOA 1NR7A 5GMOA 4MKZA 1R12A 5GZ1A 3C1AA 1MG0A 3OIGA 3NRCA 3JV7A 5EMHA 5HBRA 5A3JA 2VHVA 1QSGA 1KY4A 1VE9A 4CV0A 5A02A 1F06A 1Z82A 2PTGA 5CPFA 3RAJA 2NWQA 2BKAA 5G4KB 4OSOA 3RIHA 5KCZA 4MVJI 4Q3EA 3MWEB 4W82A 4YQYA 2DTEA 4AICA 4WPGA 1Q0HA 1T1SA 3GUYA 1H93A 5I8ZA 4AJOA 3PVZA 1PIWA 5L4LA 3MJEA 2HK8A 4WCDA 4I5GA 3RBZA 4CR8A 3ENNA 1EVZA 3AM4A 5DULA 5AQ1A 2YHIA 3DOCA 2GF2A 4R41A 4XB1A 4A26A 5K0ZA 2P5YA 3E48A 4ALLA 1U9JA 3WTBA 4LMRA 3JQ7B 5ICMA 2OUIA 1R4NB 1X14A 4FD3A 1LRJA 4B3HA 1J4AA 5IN4A 5EINA 2HMSA 1LI4A 1CRWG 3RD5A 4YVFA 1QMGA 3AUAA 2IXAA 1GPDG 1JTVA 4FFOA 5ES3A 1DSSG 3S8MA 4L4SA 1PZHA 1T24A 4WNIA 1TEHA 4HNGA 1XHLA 3WQSB 3CKYA 4L8VA 4O59O 3NYWA 1ZK4A 3FPCA 1LU9A 1YKFA 2AEMA 1ZIDA 2DPHA 3NDIA 3IP3A 4CLEA 3SEFA 1N5DA 4PLZA 1GPJA 2CDBA 1LNQA 4BKQA 1KEVA 2WE8A 4CMKA 2V6MA 1V0JA 4IZHA 3NT5A 1E7QA 1E6WA 4UUOA 4RZHA 4DC1A 4ZA2A 1UDBA 2O3JA 1YH3A 1B14A 1LC3A 5B4VA 1XGKA 1U28A 4QO7A 3FD8A 1P1HA 5KKCA 2B69A 3P2YA 5I7FA 4KP7A 1LSUA 1J6UA 1VKOA 4GX2A 4MVJP 4TVOA 1P3DA 4CODB 5FWNA 4EJ0A 3CTMA 3UGKA 1WDLA 4RDIA 3UCEA 2ZTMA 2ZTVA 5DP2A 2AMFA 5BT9A 3AI2A 1H2BA 2CF5A 3P19A 2NVUB 3WMXA 1NQOA 3VZRA 1B8PA 3IL2A 4KQXA 3RKUA 4NG5A 4UEOA 3ZV4A 1B8UA 2HUNA 4YT5A 5L95A 1IE3A 2QZ9A 1ZK2A 2DBVO 2WM3A 4FIZA 2AQHA 4IDAA 4A0SA 5JAMA 4XGIA 3MTJA 3OBBA 4CR6A 4D45A 2VHXA 4E21A 3AWDA 1CETA 1KYQA 5ITWA 1C0LA 2F1KA 2I3AA 3AUUA 3GR6A 1OBFO 4PLTA 4XIYA 5LDGA 2DLDA 4I5FA 4Y6SA 1D3AA 3F5SA 2FN7A 4IDDA 5THQA 1BSVA 4GSKA 3RASA 2BFAA 2FY8A 1I8TA 2HAEA 2G82A 3JQAA 4CPDA 1JKIA 1B7GO 2B4RO 4XQ9A 5KJ1A 4BO5A 4CLHA 4ROSA 2P4HX 2Q99A 3WYBA 1IPFA 5IXSA 4YRDA 2Z1NA 3JQAD 3E9NA 3H5RA 3WIDA 5KJFA 1E3SA 4DREA 2QW8A 2B83A 3ZZNA 4WASA 4BL5A 4D0RA 3JD0A 4P4LA 3PHLA 3TF5A 1WDKA 4FS3A 5EPOA 5H81A 4WNCA 1DLJA 4BNYA 3LLVA 5JAIA 1LQTA 4RDHA 1JDJA 3H8VA 4XYLA 4GX1A 4OHUA 1GV0A 3RJ9A 3ZWPA 1PJBA 4RVDA 1WZIA 3GVPA 2DBQA 3V2HA 4JBIA 2EW8A 1XYGA 2GLXA 2P9GA 4KTTE 4D7AA 5FI3A 1U3WA 1ZFNA 2NTNA 1SEVA 1HYEA 1E3WB 2WE7A 4RVFA 4BNWA 5JO9A 3VKVA 3CSDA 5B1YA 2XXJA 4I5DA 4E12A 1ISJA 4D41A 1O6ZA 4BV9A 3MJVA 3E18A 2DTXA 5G4KA 4RF3A 2DFDA 1NX6A 1PU2A 3QY9A 3DR3A 4XR4A 4RF4A 1ZW1A 5AXCA 2IDZA 1ISMA 4BO9A 3L9XA 4CMEC 4YTEA 3C3XA 3ITKA 3QQPA 2R00C 1PGQA 1Y9EA 1DHRA 3ZW9A 4BO3A 2YQ5A 2A4KA 2CVOA 3MOIA 3GNQA 1HSZA 1L1FA 1ENOA 3WYEA 3HE3A 1MUUA 5IFLA 3COSA 3S2EA 4YBZA 3WBBA 1Y6JA 4D3DA 1JWAB 3CMMA 1PJLA 1E3EA 1SMKA 4NIMA 1E1KA 3JQ7A 4PZCA 4W99A 3UF0A 2QRKA 4HBGA 3BIOA 4WE3A 4OOEA 5A5FA 1R4NA 1TVEA 3GN2A 4JX8A 1A9YA 3A14A 1Z7BA 4AJEA 3EDMA 4GMFA 3RBVA 4YT2A 1HDCA 5L45A 3CXRA 2X9NA 4XRGA 1LLCA 3RBXA 3QVOA 2JD2A 2P9EA 3GZNB 5A9SB 2Y1FA 3KSZO 4B7XA 1LSJA 4BIIA 3KVOA 2HMWA 1BG6A 1PJ4A 1EQUA 2JCVA 4U6QA 2Q1TA 1I2CA 4FOOA 3GG9A 1KBZA 2ZTLA 1P1IA 4Z0TA 2EV9A 2ZJ1A 4IQ0A 3HFSA 1E3IA 3G79A 4GQAA 4GVLA 5JW6A 1DOHA 1O94A 3JYPA 2GDZA 2NADA 3G3EA 3SJ7A 4EUHA 4MVJA 4DC0A 3ASUA 3I83A 3K2BA 3PWSA 3OICA 4XZ3A 3HDYA 4OM8A 4J1NA 1E7SA 1B0AA 4NR0A 3OJEA 4CMJA 3WXBA 2RCYA 3OJLA 1E5LA 1HZJA 3F1KA 2DU8A 1DDOA 3LK7A 4F3YA 5JLAA 5MDHA 3JD4A 3RUFA 4DIFA 1K3TA 3LYLA 4EBFA 4BO7A 1VL8A 4HADA 4OO3A 1F0YA 1Y5MA 3FNHA 2YV1A 3HWRA 1LLUA 1V3VA 4QFDA 1DB3A 1R15A 1NR1A 2Y0CA 2ET6A 3F4BA 1ZK3A 2W4QA 5KTKA 3JQFC 1E6EA 1H5QA 1NASA 1Q0QA 3D7LA 3K31A 3VPXA 3WGOA 3WOHA 4BUCA 5IDQA 1ZEJA 3DZGA 1Q7BA 3KBOA 1GZ3A 3S2IA 4IDCA 2JFFA 3PTZA 1PX0A 2C2YA 5DF1A 1NFRA 4RZIA 1XKQA 4DIBA 4DRYA 2DTDA 3ICCA 3RU7A 2Y1DA 5TJ9A 2IZ1A 4DXHA 7ADHA 3MJTA 1PZGA 2D0IA 3BZUA 5C7OO 2A9FA 2I5PO 1TXGA 2O3SA 2OO5A 3ZWOA 3NEPX 1U7HA 4L75A 4FN4A 1IHYA 2NVWA 4FJ0A 3SC6A 1U8FO 4FBGA 3OJOA 4DLAA 1IL0A 1YONA 5THKA 3DZJA 4CMEA 1MG5A 4WK6A 5HA5A 1UXJA 1OI7A 2JD0A 3ORFA 3D64A 4CLRB 2R00A 2BD0A 2ZB4A 3PGJA 5F1PA 1SAYA 2BLLA 3QA9A 4Z3DA 1UR5A 3DBRB 3ZU3A 1PJ2A 4TMFA 3A06A 1YS4A 2RHCA 5EIOA 1PL8A 3L6EA 3V5NA 3HG7A 1F8FA 4YDRA 3GGPA 1W4ZA 1BVRA 3CE6A 5A3VA 4YB8A 1T2DA 2X9VA 1Q7CA 4BB5A 2FMUA 2NU9A 1DC6A 5B37A 4Z9FA 3MWDB 2NQTA 4IJVA 4PG4A 4BGEA 4PN3A 2A35A 3ZU4A 3VH4A 5GZ6A 3RUHA 3T7EA 4AJKA 4I1IA 3V2GA 2RH8A 3LF2A 1E3WA 1Q1NA 4QFCA 1SBYA 4KDEA 5B4UA 4RORA 3KEOA 3IP1A 3DTYA 4J7CA 2V6FA 3KLPX 3I3OA 1OOEA 2FRDA 2QIOA 1YQDA 4K28A 3V2UA 1ZH8A 3NDJA 3S55A 1QORA 5JC1A 4B4UA 1GUZA 1WP4A 3IC5A 1K6XA 1ZEMA 5KNLA 3JQEA 2ZQYA 1C0IA 4UVHA 3TOXA 3UW3A 4E3ZA 3R1IA 2WD7B 4BNNA 2D2IA 4YCAA 3PHJA 4IJWA 4CR7A 1DC3A 1QV7A 2JCXA 3TOZA 3F9IA 2NQ8A 2DM6A 4XQGA 1D8AA 1I32A 3GG2A 3CMCO 2GGSA 5DBGA 1C1XB 2HRZA 4R9RA 5H82A 1R6DA 1CJCA 3E1KA 4OOFA 4YAJA 3WJ7A 4EUEA 4CV1A 4FGWA 5TJHA 2GERA 3ETEA 3AW9A 5DBIA 1GFSA 2FPGA 4CM8A 5CFZA 5ITVA 1W0CA 2V65A 1XQ6A 3SC4A 3DMYA 2JFGA 1MGOA 3NV9A 3QVSA 1SOWA 1EMDA 1AUPA 4FGSA 1FF9A 4AJNA 3AI3A 2AG5A 4PRLA 3L4SO 1R4MB 3ANMA 4OKNA 3GOHA 3B70A 3PLRA 4BV8A 5U4QA 1GU7A 2BFOA 4N5LA 3AU8A 1O9BA 2R2GA 3RC7A 2P9CA 3SLKA 2Q2VA 3JQDA 1DRWA 1L7DA 3GQVA 4HKTA 4TVBA 5A9SA 2VYNA 1YWGO 1A71A 4DYDA 1B15A 3JQFA 3WWYA 1ENYA 1WPQA 3I1JA 3H9JA 2VYND 3CZMA 4R5HA 3GN1A 3D5TA 4RL6A 2B35A 1GYRA 1WVGA 2FSSA 1CF2O 5KIAA 1S7CA 3I9NA 9LDBA 1LC0A 1ZJYA 1VJ1A 2C07A 3PRJA 3HQ4O 3RFXA 1O8CA 4WUVA 3DWFA 4N18A 2PGDA 1LDEA 3AOEC 1I3KA 3LZ6A 1MV8A 3WGQA 5L7YA 3UFXA 5EJ2A 3QSGA 5T5QA 4YACA 4LSMA 3M6IA 1NWHA 3U4HA 3G0OA 4ALJA 4NMHA 4GGOA 3A9WA 3L6OO 4XX0A 5TC4A 4MP6A 3O8QB 2WDZA 3OECA 1EZ4A 2E6UX 1C0PA 3HHPA 1XCBA 3KYCB 4BS9A 1UP7A 3VPFA 3H2ZA 1DFHA 2J5QA 3I4CA 3G1TA 4J9VA 3V1YA 4TRMA 1HKUA 1UXKA 1RPNA 4IPTA 5T64A 5I9MA 3K2EA 3D0OA 3MEQA 3B1FA 4FFMA 2HKIA 5KVQA 1FDSA 4MVJH 4A27A 3QVWA 4ALNA 1F8GA 4Z0HO 5CDUA 3WLFA 1NQ5A 3D4NA 3GK3A 3JQ8B 3IOYA 4PG6A 4OXYA 4BVAA 5G0UA 2Y1GA 4H15A 4CL8A 3LQFA 4CQLB 4C7JA 4CLRA 2WWRA 3WLEA 3OMLA 5IDXA 1FDWA 3EAGA 3QVXA 4I9HA 3DBRA 3MJCA 4ITUA 1Z6ZA 3JQBC 4NFSA 1U2GA 1SPXA 1K5HA 2NLOA 4W6ZA 1IOLA 3ZWAA 3H9QA 1GUYA 2CVQA 2VZ0A 3KETA 1P1RA 1YE3A 1M67A 1PQWA 2R6JA 4EJMA 2HQ1A 1GQYA 4BO4A 2E82A 3RFVA 3W6UA 3KOUA 2CUKA 2CNBA 3E03A 3UN1A 4A03A 4DPMA 4D0SA 3I6IA 4LVUA 3VH2A 3TZQA 4PG7A 4WLEA 2C54A 2OGUA 3U09A 3WWZA 1OZAA 1MC4A 4YAIA 2RH4A 2O3TA 2CDAA 2C29D 3FWNA 4J16A 4B7UA 2UUPA 4ZD6A 2YV3A 3U5TA 2X5OA 2Y68A 3PYXA 1UH5A 4IUYA 4U7WA 4N7RA 3ZWMA 3P5SA 3FNFA 2GN6A 1C0KA 2WD7A 3AK4A 3EHEA 4DPKA 4CMBA 3C1TA 2PGJA 4CLOA 4J4HA 4OL9A 4RVUA 4E5KA 3LT2A 1MC5A 3H7AA 1ISGA 2OL4A 2GNAA 4CV3A 2EXXA 3PXXA 4LCEA 4XYMA 2X8LA 3B1JA 3DZHA 1C1XA 4PRKA 1NNUA 4IGEA 3ZGYA 4XYGA 4BGUA 4RJTA 4D79A 4YT4A 4J9UE 5CP8A 2J3IA 3AUSA 4YAKA 2JHFA 1KY5A 1NTOA 3AOEA 4HNHA 1VRWA 4IQGA 1NHWA 2IYOA 4CJXA 4NDNE 4Q3DA 3U49A 5TLSA 2HK7A 1QKIA 1R4MA 4ZQHA 5JCJD 4NBVA 1YQGA 4L76A 5HM8A 2AXQA 2QYSA 1R0LA 2W2LA 3JYNA 5H83A 3D4PA 3DFUA 3F3SA 5KJ6A 2ZYAA 4Q3BA 3NJ8A 1A4UA 5JC8A 2QHXA 5ILGA 3K96A 2QYTA 4R5MA 3TFQA 3Q6IA 1N7GA 1ORRA 1DHTA 4RPLA 3EZYA 2OFPA 1M75A 4TWRA 1NWCA 1ZXLA 1ZKMA 1HYGA 1KEUA 1ZSVA 1NVGA 4K6FA 4GWKA 1QLJA 3LU1A 4E2ZA 4EJ6A 5K1SA 4RPKA 4IS3A 4K26A 1KS9A 5TRTA 4BB6A 1E0DA 1Z75A 4GLLA 1YDEA 4IZIA 2OBYA 5CHEA 3RI3A 3LT1A 4A2CA 4OIMA 4W7IA 3UHAA 4XWYA 5C7LO 2BMAA 3NTQA 1OC2A 2Y1CA 1QR6A 1ADGA 1PS0A 3GDFA 1EFKA 2UV8A 3JQCA 4A7PA 5HWSA 2H1SA 1P33A 5HS4A 4E6PA 1I2ZA 3FN4A 1NQAO 3AI1A 2CFCA 1AXEA 1PZEA 1VLLA 2CMDA 4L73A 4B4VA 4E5YA 1JW9B 3O8QA 5IXYA 4PLFA 1HDYA 3ICPA 3NUGA 3KYCA 1HDZA 4II2A 1HEUA 5KJEA 4MINA 3JD1A 1EBUA 2O3QA 1BXKA 1ZZEA 3WMWA 1Z45A 4CM3A 2CSUA 4LSWA 4PGFA 2PZJA 4CV2A 2D8AA 3AFMA 1ZO8A 1U4SA 1C1DB 2O2SA 3V1UA 1SC6A 4JNKA 2HU2A 4O0LA 3UXYA 5ER6A 3W8DA 3TSCA 1P1KA 2C2XA 4DTIA 4D44A 3LLSA 3JQ9C 3JQ8A 3WICA 4U0JA 3ST7A 3FTNA 3UKOA 3EYWA 4CQLA 2WYVA 1YGYA 1U8XX 2B4TO 1E77A 4GWGA 4CL3A 3VH3A 1Y8RA 4F6LA 5I7VA 1BDMA 5AXDA 3AM5A 3K9QO 1ZSYA 2QX7A 4LK3A 1EK5A 1LDYA 2AA3A 2PD3A 1FDVA 3UCFA 1P74A 3IJRA 4AJJA 4JK3A 4RPGA 3WDSA 1DJNA 3VDRA 5CEFA 4BNHA 2P2SA 4MVJE 2NVBA 5IDWA 1QXSA 1X7DA 2VWQA 4R3NA 3KYDB 5L53A 1WXDA 3VAZA 1LDBA 3A4VA 3KSUA 1YO6A 1VI2A 1SB8A 2X1HA 2BGMA 1DIGA 4MP8A 3IMFA 4GH5A 5TX7A 1ISFA 4IDGA 4RVGA 3ZU2A 4D46A 1LSOA 4JJIA 3VPHA 1ZUD1 3N58A 4WCFB 2IRWA 3DBLB 4IBOA 3WB9A 3FNEA 1HDRA 4J0FA 3GT0A 2NM0A 3GNSA 2X0RA 2TMDA 3LSYA 1F12A 4QXMA 1N1EA 3DOOA 5JPIA 2VUSA 2O4CA 4KMSA 2G1UA 5JE8A 2QQ5A 4AJPA 3LT0A 3JTMA 3U0BA 2HO5A 1OMOA 1WZEA 1JKJA 5T57A 4ZGWA 3KM0A 2D1YA 4J43A 4KWIA 3PWZA 2YYYA 1SO8A 3B1KA 4U8GA 4YA6A 5DBFA 5DCYA 1U4OA 1EQ2A 1NM5A 1ADCA 1I3LA 1NVMB 3WX0A 3KSDO 1HE5A 2Z95A 3C8MA 2GCGA 3VC7A 1HTBA 2BELA 1CEQA 3I5MA 1C3VA 5L3ZA 5U1PA 2C20A 4O5OA 2C7GA 3INRA 2PKRA 1YXMA 4PVDA 2G17A 5G0WA 1QYXA 3WGTA 1PS9A 3F5QA 8LDHA 3STHA 2UAGA 1ZJZA 2BH9A 2VHYA 3PQDA 2HK9A 2IZZA 3DC2A 4LCJA 4K6CA 4WCFC 1HYHA 3DHEA 4Y67A 1Z74A 1KVQA 2GN8A 2JJYA 1CQIA 3PDUA 2PKQP 2EHDA 4UUPA 3GVIA 5F21A 4RPHA 3I6QA 3HB4X 4EZBA 3JQ9A 2HMUA 5TF4A 4WEQA 2IEBA 4MIOA 4CMGA 3ZHXA 3N74A 2X86A 1YB4A 2X4GA 4C7KA 4E5PA 3N7UA 4K9DA 3Q1LA 1MA0A 3IJPA 3KYBA 2V6GA 1M6WA 3LT4A 5C3MA 3GA0A 5LDHA 3QWAA 1PS8A 2O23A 1X7HA 1BW9B 2VWGA 4UUMA 2ZKLA 5CAEA 2HMVA 3VZSA 5KWEA 5BSHA 4QT0A 3MJ4A 2YUTA 2DAPA 1GL3A 4PLYA 1PGJA 4XYBA 2Z1MA 1PJCA 3H4VA 4YEDA 4BGVA 2X0IA 2X0JA 4JBHA 2C5AA 4URFA 2YY7A 3ZI0A 3ZWNA 1D7OA 2AE2A 1E7RA 3OHSX 5COAA 1PQUA 3ETGA 1GZ6A 1PGPA 4UVEA 1HZZA 5JCXA 1C1DA 4AFNA 1LLDA 1KEPA 4P22A 3TJRA 2NU7A 4FFLA 4BNJA 1PGOA 5L40A 3O03A 3IUPA 1H6DA 3Q3CA 5IDYA 3ZHYA 4XGKA 1QG6A 4UUNA 2G76A 3GFGA 3W1VA 4BO8A 2UDPA 4OGWA 2PGLA 3O26A 5CDSA 4QEDA 4O1MA 4XJSA 4D3FA 5ILOA 1O5IA 1VSVA 4BOYA 1MXFA 4L4XA 4UVIA 1UP4A 4BQPA 2DC1A 3GRKA 4BHTA 3EC7A 3HDHA 3PYMA 4BNTA 3H3JA 1YVEI 4WLNA 1HRDA 3PI7A 2B36A 3OH8A 1G6KA 1KVRA 2OMEA 4UULA 4B8ZA 5L4SA 1HE3A 1JVSA 1K2WA 1XU9A 2XXBA 2FSVA 2EGGA 2VCYA 3KYDA 1NPYA 3FR8A 3KUXA 5K9ZA 1NHGA 3IKVA 3F4LA 1E1NA 3E9QA 4ZN6A 1YBVA 2I66A 4R1SA 4RLHA 5IN5A 2NTJA 3C85A 1FJHA 2NU8A 3L77A 1YL6A 3V1TC 3VVCA 4HV4A 2A94A 5A03A 1IPEA 2FOIA 3H5NA 3QV1A 4JJFA 4EEXA 4OMUA 2GO1A 4WCFA 1IB6A 3DBLA 4H7PA 5A9TA 1Y8QB 2BRUA 5L7TA 5ENDA 1KETA 5G2OA 4JIGA 3K30A 4UAGA 3G17A 4MVJD 5IF3A 1WWKA 4IGFA 2VN8A 5AXBA 1I36A 1LRKA 5DZSA 5BR7A 5L9AA 4GVXA 3VTZA 5T6BA 1LQUA 1XG5A 2EEZA 4IJUA 3NDRA 4W9NC 4DGSA 4XEHA 1DPGA 2JHGA 3QIVA 4KUGA 9LDTA 1U7TA 2B4QA 4ZJUA 4BGIA 3TL2A 1Z73A 3PHIA 2EP5A 3SXPA 4DYVA 1BWSA 2NVUA 3FWZA 2B5VA 2I99A 2X58A 5HTOA 3AUTA 4NU6A 2XAAA 1SCUA 5F1KA 4NNJA 3NTRA 3TL3A 2VWPA 5AXAA 3X2FA 4CM5A 2ZATA 3W4IA 1D4FA 3RUEA 1DFGA 3C7AA 5JDCC 2W8ZA 1GD1O 1BHSA 1PEDA 1RYDA 3PZBA 5FI5A 4YR9A 3H65A 3DEYX 2PZKA 3OJ0A 1GDHA 1V6AA 2AE1A 4GAEA 3PGXA 4E5NA 5K6AC 3PPIA 2YQ4A 3OJFA 3PQEA 4ONEA 3I23A 3WSWA 4BNZA 1K6JA 1UJMA 1T2FA 3FR7A 1XEAA 3I4FA 1HSOA 5CEEA 2NU6A 2PY6A 2X6TA 4IXWA 4YPOA 1SOVA 1QP8A 1P44A 4NJMB 4MVJM 2JKVA 3OFSA 2FHSA 1C14A 1A7AA 3JYOA 1UZLA 5EQFA 3WNQA 2PD6A 2ZK7A 3AJRA 1DO8A 3GMSA 5LC1A 5IZCC 4QUKA 3QP9A 3ZNPA 4BKUA 1LDNA 1VM6A 4J2OA 4J6FA 3QWHA 4JJGA 5JY6A 3F6YA 1RM0A 4DL9A 1Z7EA 1H94A 1BW9A 2J3KA 3B20A 3D3EA 4YWJA 3TDKA 2WJPA 1ADBA 3QWFA 5JMWA 2CY0A 3PHGA 3RC9A 4EGFA 4JGBA 4YYZA 4ZQEA 3UUWA 1KVUA 3KXDA 5TS3A 4MP3A 2GZ2A 4NBRA 3OIFA 1E7YA 1DIBA 2YW9A 1N9GB 2DVMA 2O3RA 2VT3A 4FJ2A 1LX6A 4ZQBA 4ILKA 4DQXA 2D5AA 1DRUA 3DMTC 4PLWA 3BMQB 1I10A 2CDCA 2AW5A 1ULUA 2EKLA 5JFOA 3JD2A 5T8KC 3GVXA 1UAYA 1HDGO 4LISA 4J7XA 4OXNA 1AN9A 5HRUA 3L0DA 5F5NA 4MJLA 1UUFA 1T2CA 2DKNA 3DAFA 1DIAA 2GYYA 1N8KA 3AU9A 1BGVA 2POQX 5TT1A 1AXGA 3MCVA 1HDXA 4XB2A 3K5PA 2GN4A 4MVJF 1F14A 1N2SA 2J5KA 1UZNA 4MDHA 2G5CA 3O38A 2WTBA 3DBHB 4AJ1A 4NBTA 3HN7A 4BNKA 3AY3A 3C7CB 1KIFA 4ND1A 4TROA 5TSDA 4W9NA 4DWVA 4XYEA 5KVSA 2HSDA 2ZCUA 2GR9A 3CZRA 3VPGA 4UEKA 3QVTA 2X7HA 1LLQA 4BNLA 3GZNA 3D4OA 5JXWA 1TI7A 1OAAA 5L4NA 4INAA 4LMPA 2Y66A 4L74A 3NT4A 3ZU5A 3ZNNA 4DBVO 2AHRA 2H6EA 3ZDFA 3ZWYA 1X0VA 5I8WA 2ZCVA 4L9RA 3WSVA 3U4CA 2RAFA 1YJ8A 1I24A 4PLCA 5K6AA 1KERA 3PHHA 4G65A 3VDQA 1YQXA 1GAEO 4M54A 1UZMA 4NK5A 4Y98A 1Y8QA 2YFHA 3OQ1A 3DZIA 1WNTA 2I65A 3ZNQA 6LDHA 4UEJA 3BXXA 1X1TA 2VUUA 3L6DA 4UVDA 3FPLA 1GV1A 5FYDA 5C7IO 1GY8A 3RJ5A 3NKLA 3ZV6A 2EG9A 3M1AA 1ID1A 1R0KA 2BFPA 1H6CA 3PFFA 4Z0PA 5IZCA 5L7WA 5JAQA 2EERA 4DBZA 4AJ4A 3GVCA 2IODA 3T4EA 5TGDA 5KVCA 2Y05A 3GEDA 3WS7A 1HT0A 4BO6A 3DAGA 1P1JA 4OSPA 2YV2A 1KVTA 4XKJA 1FDTA 4BMVA 1UXHA 2H5LA 1D1TA 2P68A 4NQZA 3E5RA 2PZMA 4IDEA 5BNTA 1Y9AA 4P4GA 2VTEA 2VUTA 2Q45A 4NZ9A 1PR3A 3WFIA 4XCVA 4BQRA 4GBJA 3FBTA 4F45A 1LUAA 3AFNA 3DONA 4HUJA 2X23A 3GDOA 5JS6A 2WMDA 3FHLA 3OM9A 3DMTA 4YRAA 5B4TA 4YJHB 3WIEA 7MDHA 2GZ3A 1R66A 3OA0A 4Q3AA 4OAQA 2D59A 1IHXA 4ZHSA 5DN9A 3MTGA 1M76A 5T8KA 1NXQA 3OQBA 1TA4A 4KOAA 1YRLA 4PZDA 4DPLA 4NJMA 2EW2A 3M1LA 1VSUA 3DL2A 4M49A 3RC2A 4DIOA 4FJ1A 2IE0A 4NJOA 4LGVA 3WQRA 1E7MA 3T4XA 3EK2A 2J5RA 3VTFA 2EJVA 4RQUA 2Q4EA 4FC7A 4JQCA 4H3VA 2DT5A 4J4TA 2Y1EA 4FPXA 3KB6A 3INTA 2NSDA 1LRLA 3NAQA 1EUCA 3JQ6A 2P5UA 4TSKA 2D3TA 3OA2A 3E6AA 4II3A 2WYWA 1J5PA 1YJQA 1DAPA 1N9GA 4FOSA 4N5NA 1QRRA 3MOGA 4JP2A 1B26A 2Y99A 2Q46A 4AL4A 4AJ2A 4EUFA 1K6IA 1B2LA 3S1LA 1EFLA 2UUOA 3BMQA 3C7DB 4EITA 8ADHA 1DIRA 3LC2O 4YJGB 1EEHA 1XR3A 1UXGA 3UICA 4P4NA 5KJCA 2EP7A 3TZKA 3I9OA 4CMAA 1Y81A 1XDWA 3E82A 3W6ZA 5LCXA 1SEPA 3IAHA 4KUEA 2CZCA 3TZHA 3GMDA 4L0QA 3UVEA 3ONEA 5JAZA 2BI7A 1GCOA 3ZN2A 1N1GA 4OXKA 4RQTA 4MKRA 3H3FA 1GCUA 4BNIA 1IZ9A 3ONFA 4AVYA 3PEFA 4ZU3A 3HB5X 3DBHA 2GSDA 2XF8A 2QRLA 1H6AA 1ULSA 1T25A 4O63O 2I76A 2PH5A 5CEJA 3PIDA 4XRRA 3Q2KA 1YB1A 1X15A 3Q9UA 2JCYA 3ENKA 3GC6A 1BXGB 1A4IA 1U2DA 1GYQA 2W2LD 3JYQA 3ROPA 4A73A 3ZH2A 3SLGA 1V35A 1ADFA 4ID9A 3TZ6A 4U5QA 4XDYA 2X9GA 4RVHA 3AY7A 4J2HA 2PH3A 1ZBQA 4Y8VA 4OJNA 4NFHA 2VRCA 3I9JA 4PFJA 1LA2A 1MX3A 3PFWO 4WJZA 1AE1A 5ADHA 1P77A 4CMHA 2FWMX 1UXIA 1I3NA 3PJDA 4TRJA 1U1IA 2X5KO 3OEYA 1SNYA 2VRCD 3BHMA 5A05A 2Q1UA 1I0ZA 3M2TA 5DP1A 2OOSA 1UP6A 4I9NA 4HXYA 3QWIA 1JWBB 2IZ0A 1I5RA 1JQBA 4OQYA 4R54A 1NFFA 4FDAA 4E5MA 3ABIA 1A5ZA 2I9PA 2ZB3A 3WGIA 3JQBA 3GEMA 4B4OA 2PNFA 1DFIA 4R68A 2X0NA 1EUDA 3AM3A 1GADO 4ALMA 3SVTA 1QYCA 4B8WA 2Q2QA 4TRRA 1R37A 3AOGA 4CM1A 5TIIA 4RVSA 1KEWA 5EL0A 5FFFA 2PA3A 4E30A 1UAGA 4G2NA 1H2HA 2DQ4A 2LDXA 1IY8A 4M89A 1VL0A 3PLNA 4HFRA 5MGBA 3WJAA 2D5CA 3K6JA 5DCUA 3CPSA 5JO0A 1LBEA 3U3XA 3F47A 3E9MA 5I7SA 1T4DA 1YL7A 1ZVMA 1EK6A 5CG2A 1T26A 3ON5A 1LSSA 5FEUA 3WNVA 4C4OA 5JSFA 4NH4A 3WGGA 4OH1A 2OP1A 3VVBA 3JYLA 1XELA 4J1TA 4WOKA 4YJHA 3BYZA 4HFMA 1NVTA 4XQEA 2TMGA 3IDSA 4X54A 3VZQA 4EEZA 3DB2A 4TKMA 5BNIA 4JROA 4L4RA 2J3HA 3DHYA 1QYDA 1PGNA 3DHNA 4FFRA 4I08A 3RWBA 4F46A 1VKNA 1DC5A 5IG2A 5L51A 1GQQA 2YZ7A 2GN9A 1BVUA 1CDOA 1PQPA 1X1EA 4I5EA 1HLPA 4JXKA 3CUKA 3GGOA 3W8FA 3H6KA 1X0XA 3ZHBA 4R69A 1H0KA 4UREA 5G0SA 2Y0DA 2X5JO 4CQMB 4IJKA 4DUPA 3BA1A 5C5IA 1A72A 1HXHA 2W2KB 2NACA 1DIHA 3DZFA 4H16A 2DBRA 2YDYA 2BGLA 3PJFA 4NPCA 3L4BC 5JNLA 4I9UA 4J4BA 1Q2XA 1T1RA 2PLAA 1PJQA 5G0VA 3RC1A 3GRPA 3GY0A 1P0FA 4NBUA 1GUFA 2IXBA 2JAHA 4O6VA 1ZSNA 5F3RA 1IZ0A 4J7UA 3WTCA 4WECA 3GLQA 2Q49A 5FF9A 5A06A 4M1QA 1V9LA 3CIFA 1JAYA 4NK4A 3SBOA 2OORA 2SCUA 3RQSA 2GD1O 5KKAA 1MFPA 1F17A 1AHHA 3DTTA 2VRBA 4R3WA 1MLDA 3BMCB 2IYPA 5AOVA 4Z9YA 3S2GA 4E2WA 1GEGA 4YJGA 3UOGA 1O89A 2J3JA 5A1TA 3EUWA 2A92A 1AHIA 1P1FA 1HDOA 2EWMA 2VHZA 5DNAA 5HS6A 1U5CA 3EVTA 3UH1A 3GNTA 4CM8B 2H9IA 4QQRA 1DLIA 5DDIP 2DPGA 2WD8A 1LXCA 2ZB8A 2Q1SA 2VT2A 1RWBA 2AEFA 3LVFO 1KC1A 1VL6A 3FCOA 3LC1O 1WW8A 4M87A 4J90A 4J0EA 4YAGA 3RCBA 3DO5A 3QW2A 2ZTUA 3ZV3A 2VWHA 3BMOB 5JBIA 3TRIA 1HL3A 3K92A 1PJTA 1Q0LA 4Q9NA 4PG8A 3TWOA 3LC7O 3OP4A 1H9AA 4Z9XA 3TZCA 1U3VA 4PVCA 3QHAA 4GL4A 2FP4A 5IZ4A 4PLVA 2Y1OA 1BXGA 2Q3EA 4WLVA 4ALIA 4FFPA 3HUDA 4F6CA 1ONPA 4YRBA 1J49A 4HFJA 3BTVA 3DAPA 5IAAA 2PD4A 2DUUA 3KZVA 4ZQFA 1VJTA 3HN2A 1TT5B 3ONDA 4FFNA 4M8SA 3RROA 1GYPA 2QRJA 1V3TA 1W8DA 2HMTA 1YOVB 3OIDA 4CM4B 1XQ1A 3Q2IA 3L07A 1NQTA 1W6UA 2CD9A 3JQGB 2VZ9A 3Q11A 1B16A 2V6BA 3IKTA 1G0NA 4CLDA 4M55A 3R0IA 3PP8A 2X22A 3TN7A 2AEJA 3HFGA 2C5EA 4CM7A 3P2OA 3TNLA 4E0BA 2V7PA 2O7QA 2AG8A 3RKRA 4BMSA 1ZXBA 3ZWCA 5C37A 4DA9A 2C82A 2VHWA 3BMNB 1DBVO 3PJGA 3PQFA 4CUZA 4LW8A 1OFGA 4G81A 3RUAA 2LDBA 4IMRA 1HE4A 2JAPA 1E1MA 5DOZA 2BFMA 5G0TA 3WQQA 1UDAA 1VPDA 1UDCA 1WLYA 1NAHA 1XWFA 2FR1A 3NTOA 4HP8A 4BNMA 3INGA 4DMLA 1GQ2A 2EF1A 3L4BA 3VZPA 1R0SA 1HWYA 4CM6A 4R1TA 2VNAA 1G1AA 3WFJA 4KUHA 2NUAA 1XU7A 5B12A 4AJHA 1YBMA 1Y7TA 4AJIA 4BKPA 4DMMA 2YFQA 2NNLD 2AQIA 3FRJA 5A9RA 5A4DA 1U5AA 3U62A 1X7GA 5AVOA 1LDGA 4MO2A 1GZ4A 2OHXA 4CUJA 2DBZA 3FNGA 1I33A 2VYVA 4NI5A 5JDIC 1B8VA 3GPDG 4HX5A 4CMCA 1TT7A 4EYEA 2ZYDA 3UAGA 1O95A 4CMIB 1RM5A 2ZB7A 2UYYA 2ZQZA 1R16A 3ZNOA 1EUZA 3KV3O 2VYVD 5CPBA 1NAIA 2G0TA 2WYUA 3GFBA 1O0SA 4U6SA 4IDBA 4BNFA 4CQMA 3I9KA 1T2EA 3GEGA 1E7WA 2W2KA 1ZNQO 2Q1WA 1JAXA 2B0JA 1E3JA 4GI2A 6ADHA 1GEEA 1PR9A 5KVVA 1HETA 5JMPA 4CQMD 4LRTB 3DQPA 4BKRA 1CIVA 1TB4A 4OKIA 3V8BA 5J23A 4WLFA 2VNSA 3RUDA 3W4KA 5AYVA 2OP0A 4B3JA 3FTPA 1XSEA 3D5QA 2FR8A 3Q9NA 3Q0EA 3H5AA 1DAOA 3DBVO 1ML3A 4CLXA 3DZBA 3EVNA 4JBGA 2RIRA 2J6IA 4NU5A 3BMCA 3OEWA 3ADOA 2OZPA 4KQWA 4EW6A 4IM7A 2E37A 1FK8A 2J8ZA 2JD1A 4IS2A 2VZ8A 4PLHA 5ER9A 2GRAA 1QLHA 1HF3A 1CWUA 2E4AA 2HLPA 3EMKA 1BTOA 1G0OA 3P7MA 4FW8A 2WSBA 4TRNA 1CQJA 3GGGA 1EE2A 4B3IA 1NBOA 3L9WA 3ASVA 4E13A 4Z6KA 2PV7A 3K73O 1XA0A 4XQCA 1E6UA 1P9LA 1ZMTA 3BTOA 4W7HA 3KTDA 1M2WA 3BMOA 4TQGA 4KWHA 5GY7A 3CEAA 2CF6A 4UVGA 1NP3A 3I9LA 1XLTA 1Y1PA 4DLLA 1XIVA 3ZWVA 3QE3A 4MVJG 3OQ6A 4AG3A 3QLJA 2O48X 4IY1A 1IYZA 1E3LA 3ANLA 3HZZA 3VPSA 1K0UA 1N7HA 3CINA 4GX0A
chains in the Genus database with same CATH superfamily
2F43A 1N5LA 4RPJA 2EJTA 5F73A 2I7XA 3B78A 4IVPA 3D1VA 3TXYA 5ES4B 2NZUG 2ZZKA 3A6ZA 5JQGA 5F23A 1X1RA 4IV8A 5EQDA 1FQKA 3CY6A 3MERA 3T41A 1TT5A 2NN3C 3QY0A 4OK5A 1S2GA 3GH1A 2B8EA 2Q2WA 2Z9CA 3O1LA 3NVKI 821PA 5JNSA 4F85A 1KO5A 1N5KA 4CFZA 1TDJA 3I1FA 1CERA 1EXNA 4MYTA 2GJKA 5D86A 1W73A 2FPPA 1E1RD 3E3NA 1GRVA 3MJSA 1KJNA 2QXTA 4H3HB 2MWMA 1TYCA 1IBMB 1EDOA 1LEHA 3UJCA 2EZ8A 1L9XA 1WMAA 2GYVA 4B6SA 7REQB 2XADA 3TZEA 2IIPA 4S3MA 1DCKA 1TZKA 3EWSA 1CR1A 5EXDA 1IVNA 2XZPA 2QRQA 3RVLA 5TT0A 3ESCA 4G2TA 4DT1B 3T1HB 1MJNA 3EUEA 4MVWA 4JT9A 5BSKA 1G5TA 2OXRA 3A6HA 4LKRA 3EY9A 1PVDA 4BNXA 3QKSB 5AJWA 3QSYA 2OBNA 3H9EO 2ZYWX 2BL4A 4CIWA 1X87A 3DV2A 3AVXA 3BX1A 3DZCA 5ELXA 4BV3A 3VYWA 1W5AA 2NNWB 2OD9A 3X2EA 1E5QA 1BRTA 1QZXA 2CB0A 3DNPA 3LYHA 3D4IA 2FG6C 2ZPAA 3Q41A 4A10A 1M0WA 1NYTA 3JPWA 2YY5A 2ZJ3A 4J1SA 2GXQA 3OZSA 4E1AA 4V1CA 3ZVNA 5DCWA 4TXJA 5DGHA 2FEKA 3L5KA 2B5WA 3GJ3A 4IQ8A 2G40A 4QRHA 4BCDA 4B6OA 1L4EA 1NA5A 4DKJA 2JIZD 1FYFA 2PKQO 3E22B 4JLOA 2WHRA 1X74A 4PIVA 1V5IA 3C5CA 3KFVA 4ZOEA 1IFXA 2WNIA 1BX1A 2NXCA 3THYB 5DU2A 4NS1A 1KQOA 4QOHA 1MAHA 4DDUA 5COBA 3GJYA 1XDGA 4G8CA 4Y9TA 3W2TA 2WKRA 4OQZA 4PXSA 2W90A 4XPIB 4IDQA 5HCNA 3K94A 4PTYA 1PI3A 5DW3A 3ZDXB 4D74A 3NXKA 2YCBA 2WEKA 2GZ1A 2PU7A 5DM70 2H07A 2PH7A 5DJ5A 1VDZA 3MGBA 3NWOA 2AEEA 4L8FA 2UZ3A 1XZJA 5FA6A 1P5JA 2JIBA 5LVAA 4MHOA 3LHIA 3FSRA 3GRAA 3HXLA 5ALMA 1AXRA 4GGPA 2H1HA 3ZE6A 1SU6A 2ZVJA 3HSKA 1GUDA 1QZUA 4CMIA 1X1BA 2QYOA 4NV1A 5I4KA 5KTNA 3D2LA 1SKUA 3LUGA 3V8EA 5DNWA 2Y2UA 1U3TA 2FG5A 4R4JA 1RXEA 2HPAA 3DWIA 2YR0A 4PYMA 3RSOA 5A3QA 1CJTC 5JYEA 5IT9A 5KWIA 3THXB 3OE1A 4C2UA 4G0PA 3ZQUA 1RTKA 3GJ4A 2B3DA 5IPFA 2GZDA 1FVXA 2O54A 2X2PA 3NC1C 4NV0A 5DNYB 2I4OA 5I9IA 1CUCA 4TKLA 3R8XA 4MUBA 4EVQA 3TD9A 3AY0A 4P3YA 4LNUB 3GHYA 2PKYX 3OZGA 3PHCA 4XIJA 2XMRA 4TYQA 5AQEA 5D6OA 5JUWA 3EASA 4DLBA 4CVNA 5JJCA 4X1IA 5IF9A 4HBZA 2AOTA 2M32A 3EGDA 2CLIB 1MPXA 2ODAA 1WV1A 1T3TA 2B82A 1TAHA 2P9JA 4QBGB 1JHRA 1X7ZB 2MJLA 3SBDA 4YROA 4EZEA 2VXCA 1M2KA 1ARZA 3D8NA 3H16A 2I34A 4R40A 5FUVA 1XMXA 2QUKA 1D5CA 2Z9BA 1DBWA 3KLMX 5LIPA 3NHFA 4P3OA 1PEKE 1ZM4A 1DXYA 4Q5IA 3RANA 5D3KA 4R1NA 4OLFA 4B75A 4QO8A 4BQQA 4JT2A 2RGXA 4COOA 1PSDA 2EGUA 2LNDA 2V98A 1JZQA 2XW6A 2Y0EA 3FB4A 5JHHB 5JQGF 1N33B 1ITZA 3QKUA 2A3NA 3CWZA 4GM4A 1DCTA 2DFVA 1W4BA 3QF4A 5EIXA 3U7JA 4QSMA 1HE2A 5JCOC 1NPDA 3R6WA 4AMYA 5B3JA 4K9LA 2VQ3A 3M4XA 1L4MA 3JAKB 4BY9E 1Y1KE 3IA2A 5COQA 3TB6A 2WYIA 1XJCA 4Q3CA 3GLRA 5HILA 3ZZTA 1ECBA 2BBOA 2PL3A 1C1HA 2GAOA 5LKRA 4UXIA 1GL9B 1W4AA 1POWA 1H5NA 4XSHA 4WMLA 1U9YA 3O8OB 4ZRNA 2QTTA 4Q4HA 3AV0B 1IG3A 4HD8A 3TCNA 3MZ0A 2FZWA 2BP7A 4MKIA 3BZWA 3WGHA 4W4TA 1TM5E 2VRNA 5FFNA 2EKBA 3JD3A 3NIGB 4GM0A 1RYZA 1KO1A 2Q4BA 4P81A 4MOWA 2Y0PA 1W44A 1FUUA 2V7QA 3N53A 1QFZA 3AP3A 5HIKA 1U8TA 2VDUE 4M9ZA 4XWAA 5D84A 4B31A 4DLTA 4E51A 4ZZ0A 4RQBA 4UXHA 4AF8A 1KH2A 1QE0A 1B8OA 1NIPA 2H0QA 2RHJA 1RM3A 3M2PA 4RK1A 4RKYA 3G2LA 4MI6A 3ZUGA 1ST2A 4N47A 5EMLA 2C9YA 2O3UA 2RHWA 3HADA 4TZKA 2XRFA 2PX4A 2ZIEA 1P5RA 4PFKA 2QZSA 3T7CA 1Z28A 4D97A 1HFEL 4F3NA 4DV7B 2NYAA 1Z6TA 5K0TA 3F8TA 2XQKA 3KRTA 3C3KA 4C0KA 4ZEVA 2W9XA 4MB2A 5FOUA 4GE0A 1Z4OA 4M86A 2XHEA 4YCBA 4BO2A 3U4AA 4EI2A 1QTQA 7REQA 4PLGA 3WJ1A 3BTUA 5E6UA 2OAGA 4RSHA 4UCQA 4XVRA 3HR8A 2OBLA 5FJIA 4Y6PA 4DT1A 3NT2A 3EMDA 5F4ZA 3KKMA 1U65A 2DHCA 4AQ7A 3H05A 2X3FA 3WYCA 3GMTA 4GPD1 1TMGE 1J99A 5IABA 1Z0KA 3Q5GA 3HWX1 1AK9A 1X70A 1PWXA 2IP1A 2QLFA 3E7FA 3VR3D 2QP9X 2JS7A 3ISJA 2O2YA 4DEXA 1BX0A 4WLOA 4QIHA 1J0AA 4FE4A 4URUR 4X3PA 4RNDB 2GXAA 1EUQA 1RM4A 3QELB 5EQJB 5BYBA 2EZ4A 2ARKA 4NZYA 5LBUA 1H6BA 1Z6QA 3ZWXA 4B0OA 5LMUB 2JLYA 3JAWB 2B1JA 5JPDA 1ENZA 3B2EA 2ZI5A 4LOLA 3VU8A 5A7FA 2G0AA 3KAKA 4ESOA 4HAOA 4L0CA 3AQ4A 3E22A 4TYWA 3BH6A 1KHHA 1IMJA 3ETHA 4DVJA 1KOJA 1BMTA 2V7XA 4GSLA 4ZV4A 3J80A 1CZKA 3THYA 1K4KA 1C3JA 1X3LA 3LWDA 9MHTA 1NFQA 2P6NA 4GZ5A 4KBGA 1TAUA 5KTSA 4BO0A 3QXJA 4XPIA 5IVPA 2F48A 4MNTA 2OHFA 3FRIA 3HA5A 1J5EB 2NZJA 3PUYA 2Q9UA 3DNMA 3UHJA 1IY9A 2WYHA 2FPUA 4WI1A 4YCDA 4Q7LA 5BNWA 4OJYA 3IVCA 1SKYE 2HRBA 4LDAA 4UJ5A 4F2PA 1A8IA 4B3GA 3TQFA 3L6UA 1LK7A 1QDEA 1WCXA 1W1UA 2YHUA 3OQJA 1DBIA 2MSKA 1A4XA 1D09A 5CRIA 4ABTA 1DQPA 1IZZA 4TTTS 1QANA 2OEPA 3THXA 2W6QA 2VQSA 1XKTA 1Z4LA 1E8NA 1NBIA 2XOXA 2WWXA 1CJMA 4KSCA 4C1NA 3LCUA 1V8BA 3DKRA 2Q0QA 2G4CA 3H5TA 1WQ1R 4RM3A 5DNVA 1WU8A 1RDFA 5ERGB 3C4JA 1RQPA 4P4SB 3QRWA 3KJHA 4R01A 2Y2VA 1RBMA 5G4LA 1FCJA 4LYHA 4LNUA 1DDIA 1R6VA 1G291 4G56A 1O6GA 3PR3A 1VSQA 3WLRA 1QX3A 4QJ5A 4WLUA 2JLWA 2N0SA 1DTEA 3OKFA 1KARA 3ROFA 4J49A 3HDQA 2AQKA 4PLPA 4WEOA 3WJ2A 1VMKA 1X7ZA 2LP4Y 2VOJA 3NH6A 1E61A 3IMEA 5EJMA 4HY3A 1ZGJA 3ZCUA 4NU8X 1CUUA 1IZYA 4QM6A 4Y9SA 1SVUA 4FGLA 4X6XA 2Q3LA 5C53B 5HK8A 2ILTA 2XTZA 1CF4A 1UKVY 5BNFA 1AT1A 2AZTA 4I4NA 4IIYA 3EZLA 4G24A 4M9RA 3RVQA 2IS6A 3A28A 1XFAA 1C3XA 1MB4A 1SG9A 3QE0A 3SS8A 4L57A 4W7SA 5TVGA 1Y3IA 1JU9A 3L7IA 4ZCRA 3I2FA 4L72A 3AVTA 3FZYA 3H5OA 1W30A 2ZROA 3L8DA 2W2PA 1VHQA 5FBKA 4YT8A 2O50A 2AFHB 2PS1A 3JQAB 1QNFA 4MWTA 1ZK1A 3JAKA 3L0ZA 3VH1A 3ZDEA 3NGXA 4RNCA 4ZQGA 3ENZA 4POOA 3BEOA 3L84A 3HB0A 3R3JA 2RK3A 4GQBA 4U3JB 4IIBA 2GUGA 3LHSA 5BORA 4Z4EA 1EFCA 1RXUA 2XWBF 4E03A 1J22A 3C6ZA 1FUKA 4KMOA 3TIXB 1VECA 4CGYA 3KVYA 2JVKA 3O8OA 4HI0E 3C39A 2I7VA 3EZ2A 2ZI3A 1RTTA 4GMKA 4EOGA 2CLCX 4F8JA 3AM1A 1T4CB 4R1UA 5DMXA 4J0QA 2GEVA 4DQVA 1G1MA 2JFPA 5KPDA 4ZVVA 4N0PA 1EVIA 3EEFA 3UTCA 2AS0A 5A71A 2NAFA 4FZ5A 3NFRA 3W9SA 5J47A 3CLSD 5FT9A 4MEAA 1TLTA 1NSTA 5CDYA 1ORHA 4J75A 2BHTA 3OCZA 5CNIA 5CAEB 4MLDA 3H2SA 1B00A 1UBOS 3HDJA 4WZBE 1KK1A 1NR7A 5HKLA 5J40A 1S5PA 1F4VA 4BKOA 4RVOA 1R12A 5GZ1A 4E94A 1BMQA 1MG0A 3NRCA 4YO8A 4R7GA 4A6EA 5EMHA 2VHVA 4HB2A 1I4DD 4M3NA 3DCYA 3WWPA 2REQB 2OCXA 2OD7A 2PQMA 3H1BA 5A02A 1WZ2A 1LBTA 5ALTA 4YR7A 4S05A 1S8NA 2PTGA 2GTHA 1M6EX 4BQSA 4MHTA 3DEAA 3ZD9A 3K2IA 2R6CA 2YHSA 3RIHA 2HPVA 1P7YA 2P4SA 3WB2A 3IOEA 3ZJVA 4KLRA 1NRXA 3RYIB 1IVYA 1K88A 3JWPA 1JJIA 1IQ0A 4A16A 3PVZA 1ZUWA 1PJRA 3LXMA 2IV7A 4B44A 2GKOA 1E2DA 3ZZ1A 1L5VA 2B8TA 3BDAA 4I5GA 4LE1A 4BUJA 3OZRA 4UM5A 2AMJA 3WMRA 3AM4A 3HKCA 2UYGA 1BGWA 3KCNA 1ZLXA 5KQRA 4D9IA 3EPJA 5KQGA 2BM9A 5KYVA 1DGQA 1I14A 2ZTSA 1TU4A 3H2IA 5K51A 4JJ6A 4XAQA 4A26A 2R5FA 3UWKA 4C88A 1IZ8A 1X7WB 4H35A 4W1RA 3DYVA 4MR8B 4QFMA 4URHA 3TI7A 2M6KA 2WZDA 3KJXA 4LJ9A 4LMRA 5AWFC 3GOQA 4N49A 3D0KA 3QELA 3HXQA 4MRAA 2AJDA 4DSUA 5K2OA 1A9SA 1N2HA 4OHRA 3ISTA 4DR1B 1M5UA 2ECQA 3D7NA 3JAWA 4RTJA 3SQNA 5LQMA 1IM2A 3ASZA 3RD5A 4ZZIA 1W5TA 1YVDA 3EC1A 1V11B 3IHTA 5KHLB 1NNI1 3C8DA 3A9VA 2AFRA 3O8BA 3S8MA 3SQLA 4G5GA 1KQPA 1L5QA 2JCSA 2YWRA 3AJDA 3EPPA 1T24A 1TUEA 2X4LA 3LX8A 1RAIA 2JANA 1HQKA 4O59O 2WF8A 5JSZB 3PQ4A 3L0OA 3NYWA 3COVA 1ZK4A 2UZIR 3RVJA 3EFOB 2DPHA 3NDIA 2QS9A 3IP3A 4NNOA 4H6VA 2R65A 5DTIA 4RYLA 2Y4NA 1OB2A 4ACAA 1GPJA 3IXQA 5FI1B 3FVTA 1LNQA 2JGDB 4RACA 4DJTA 1M0SA 2YXLA 2QUIA 2IJGX 4CMKA 1NQVA 1NVWQ 4ES6A 4J0IA 4UU0A 1E7QA 2QUAA 4UUOA 1UCFA 1LJLA 1UDBA 3RYHB 3UGQA 4B7ZA 1FNMA 2QN3A 4YUAA 3D81A 3KU4A 4DZZA 1LC3A 2BM0A 4RANA 4JNCA 5EHQA 5B4VA 5LU9A 1RXWA 1U28A 1G7SA 5LWHA 2K6GA 3FD8A 3TUIC 4HATA 3W04A 5ALIA 5I7FA 3TQOA 4P4SA 2Q5EA 3B1WA 1Z7YA 3KTOA 2R47A 4WT7A 4XM0A 4JA0A 2W93A 4CODB 5FWNA 2GN2A 3FWYA 1T0UA 4MDEA 3OUTA 1MVOA 3W2EA 3WLLA 4RDIA 2BPOA 3TSOA 4HB4A 3IUYA 4EYSA 5BT9A 2AMFA 1UPFA 4B09A 1R27A 2BISA 2G5PA 1NQOA 4BVLA 3R3YA 1CW2B 2Z4TA 4KWCA 3VZRA 5BOSB 1SXJB 4KR7A 1PFGA 4Y2HA 4UEOA 5HRAA 3MLAA 4MH0R 1SQFA 1B8UA 1Q7RA 2HUNA 5L95A 2XMQA 1I13A 3NRJA 3QKIA 4K8RB 2DBVO 2WM3A 4FIZA 5CGQB 5ICCA 3S99A 2JFOA 1JRLA 2YVLA 5KO2A 4XGIA 4EG8A 4V0RA 1Z13A 3MTJA 3OBBA 4IOLA 4KLAA 1MO2A 2PBRA 4P5DA 3UANA 4D45A 3AWDA 1KYQA 1W48A 3CNQS 4JIMA 3AUUA 1BS1A 1QYIA 5CT5A 5IK2D 1XCJA 1EFDN 9ABPA 1R9MA 2DY1A 2JLAA 2CC2A 4IDDA 5ERXA 3JARB 2FY8A 4M7PA 3CF6R 1W36D 3DS8A 2AFHA 2WUGA 1UJBA 3JQAA 5CJ2A 1JKIA 4FR0A 4LJ7A 4LZAA 4KWTA 1B7GO 3DTVB 5CR9A 1IXSB 2JJ8A 5KJ1A 4U3JA 4ROSA 1D7AA 1ZCZA 4MDYA 5AKXA 2ZJYA 3TI9A 2FPXA 3GBPA 1IPFA 3N2YA 1NMEA 2GAAA 2Z1NA 3FPHA 1I6MA 3E9NA 4UEQA 4DRXB 2DCMA 4U1RA 4RTRA 2BKVA 4BL5A 4D0RA 4XVCA 3ZD7A 1T4CA 2CD7A 2IU4A 4FS3A 1B6RA 4WNCA 1DLJA 4BNYA 2AZDA 4NY1A 1RMYA 3LLVA 5JAIA 1JDJA 4XYLA 3GFPA 1F2UB 3R77A 3C41J 4DCMA 2DBQA 1UPUA 3J7AC 3QK7A 1T35A 2QVXX 3M83A 4RMIA 4QTTB 2GLXA 5CNJA 2MYTA 1SN7A 3VSCA 4D7AA 4YQFA 3EGIA 1ZFNA 4XM2A 1MB0A 1OI4A 3OHPA 4DB4A 4OBBA 4ZO6A 1HLGA 3C3EA 4ETMA 1IN5A 1CUAA 3VKVA 5EP3A 1SCJA 2VP2A 3ABRB 5JYBA 4M1TA 2XXJA 4CG0A 4YMGA 2REQA 4EI7A 2P6OA 1FYWA 5J1TB 5JANA 3CX4A 3HM9A 1VOTA 1ZUNB 3DMRA 2YMQA 3E18A 1M2HA 2DTXA 2I6GA 3EQ2A 4MO9A 1HR0B 1OI2A 3GZTB 3PSAA 1S8FA 4RABA 4BU0A 1R8YA 2P2YA 3FPEA 1X7XB 3M4JA 3QY9A 3SIRA 1NMSA 1LS6A 5E6RB 1ISMA 3UAWA 3RYIA 3C3XA 1O9HA 1BKSB 2A8YA 4TOIA 4GYKA 2X8BA 1IOZA 1V26A 1Y9EA 1JNXX 2N47A 1AGXA 3I5AA 3DDZX 4XLZA 3VNQA 3GGDA 4R7TA 4QU5A 2GUWA 2HV8A 2CVOA 2UVQA 3B36A 3MOIA 4C0LA 4JB8A 1L1FA 3HE3A 5IFLA 2HA6A 1E6LA 3COSA 2TYSB 3AR8A 3JATB 1ZNXA 4YBZA 1OASA 3UMGA 1VKRA 3UUEA 1CUXA 1YQUA 4JI6B 1X7WA 1J5XA 4MR8A 2H5JA 1F4LA 3QLUC 2WKQA 2BR5A 4OQ4A 1AQ6A 4HBGA 4BP9A 2C3OA 4PWZA 2UYHA 2Y1XA 3AEUB 3KCQA 3W5UA 2WWVD 2X42A 3A14A 1EEXB 1GKYA 4MWEA 4CKCB 1ZM2A 2H7XA 4P33A 3WL4A 4UUAA 3EDMA 1XRNA 2EIXA 4B47A 2GPSA 3RBVA 1FP2A 3O92A 4BZPA 1HDCA 4BLPA 3MK31 1V11A 5L45A 1ZI9A 3CX6A 1F2VA 4KAAA 2LTAA 1N8SA 2VP0A 2FRDC 3HDGA 4XIIA 5JXHA 3O8CA 1VRVA 1EX9A 3SI7A 4YMUA 1I7NA 4DMGA 1LSJA 4I4TB 3LBIA 5JSZA 2RI6A 4RXUA 1RJDA 1CUEA 3KVOA 4BIIA 4RFSB 1XTTA 2ATIA 3L8EA 4FE3A 4GPBA 1R4ZA 2H1OA 3QTBA 5LJIA 1XVUA 1Z9BA 2H4YA 2JCVA 3QNWA 4FMCB 4GNKA 2REBA 2ZUBA 4JI3B 3BT7A 3EDCA 3UPUA 1KBZA 2GZAA 2JGDA 2I2BA 4WOPA 1T5OA 2EV9A 4TWJA 3CRNA 4IQ0A 3G79A 4GVLA 3G2QA 5F33A 1W5FA 4JXZA 4CNQA 4RTOA 1NUPA 1MCZA 3UK2A 3SJ7A 3FJOA 3HA2A 4AP6A 5DTJA 3FTQA 1DMRA 3R0ZA 4RIFA 4J76A 3CU5A 1E7SA 1B0AA 1AQUA 1XJ5A 2FF5A 2IU3A 1O94D 2WNHA 3IAAA 5EMKA 2PSEA 2DWOA 3NHUA 4D3XA 2PJUA 4S24A 1AKMA 1HZJA 5AHRA 4B43A 1D2AA 3K7EA 3TRDA 1DDOA 3FLEA 5JLAA 1JECA 3O74A 2JLXA 3JD4A 3L4KA 1K3TA 1ZGAA 2QRUA 1LY1A 3LYLA 4EBFA 3S44A 4MV1A 2JC3A 2PX3A 1YRQA 1E60A 3HP1A 4HADA 1TO6A 1F0YA 4XX0B 3MHTA 1SIBE 1H2WA 2YV1A 2DGDA 5FLYA 2AKYA 1ZN9A 3DMPA 4N65A 3NIFB 4GW3A 3JQRA 2IKQA 2VPZA 4Q9KA 2QW1A 3BFXA 1GP2A 5C8YB 1NZJA 1ZK3A 2W4QA 5BOSA 4HEQA 1SXJA 4LOKA 1NASA 1H5QA 4FHCA 3TKAA 3WOHA 4BUCA 5IDQA 5TQ2B 3OMXA 1JPVA 3HXKA 3B13B 5JRZA 2C2YA 3SNKA 4PZYA 1JT9A 2NSJA 4TXLA 4DIBA 2DTDA 3RU7A 3UT0A 2IYVA 1PZGA 2VH5R 3ZG6A 2A9FA 2I5PO 2W58A 2O3SA 4WRRA 2GI4A 5I45A 3R7LA 3KR0A 3GLFB 3LVQE 3MBIA 1U7HA 3NEPX 2OB1A 3DLIA 1APBA 4FN4A 4G63A 3WK5A 2IHKA 2JZNA 4NNPA 1TO2E 3JARA 1ML4A 3VISA 2HRDA 2XNHA 3C6BA 4FBGA 4DLAA 1IL0A 2YS7A 2Q07A 3SX4A 4EHHA 1JS1X 4WK6A 5HA5A 3ORFA 1OI7A 1DWOA 3MC1A 5HZKA 4CXMA 3KQMA 4KVGA 2XEXA 2ZB4A 3DTVA 4H7KA 5F1PA 2BLLA 3HY3A 4Z3DA 2Z5GA 4B2IA 5C2JB 1YRYE 3PDWA 3W5HA 1Q57A 5H59A 1GCIA 1XQXA 2Q8PA 4KLZA 5DGDA 4PO1A 2V03A 4OP1A 2RKBA 3ZU3A 3R23A 1P61B 4MGEA 3VO2A 1H4TA 1KI7A 1M8FA 3GGPA 1BVRA 2GZRA 3CE6A 4IWXA 1RE1A 2PVPA 4J8PA 4DVGA 3SWWA 2QX4A 2VSYA 2GBLA 1MQAA 4YDHB 1G7TA 1DC6A 5BY2A 1O6BA 2QY9A 4LECA 4PG4A 1F2UA 1CUZA 3RS7A 1UFQA 1DAKA 3VV3A 4Z2AA 1TUBB 2V7WA 5EKUA 4YCLA 3ESXA 4Y2QA 3T7IA 4ZVKA 1U7ZA 2BZGA 3VH4A 5GZ6A 2C7QA 1SVOA 2QRVB 4AJKA 4QT4A 5DX0A 3V2GA 3HNOA 3LF2A 6Q21A 1Q1NA 2EW1A 5DRYA 1EP1B 1FSSA 4EX7A 3U6BA 3HVHA 5B4UA 1VKZA 1HLFA 2XJ4A 4AWAA 4J7CA 1TKCA 3KLPX 5C1BA 4U6NA 1D2RA 4EPRA 3U13A 2I7TA 3HO6A 3WK6A 2HIGA 4IHQA 3H2HA 4P4UA 2MR5A 3S55A 1JEQB 4AWBA 4B4UA 4C06A 5JCPA 1GUZA 2O0HA 1ZUNA 1NBMA 1WP4A 5IHXA 1J8YF 2M9MA 2YJ6A 3IC5A 3JQEA 2ZR7A 3TOXA 4ENRA 5BT8A 1YI8A 1X7XA 3W9UA 1KAGA 5E6RA 3U4MA 4RSGA 2HF2A 4IJWA 1R3UA 2HEGA 5J4YA 4XXHA 2FV8A 4QHYA 3W5SA 1CRZA 3FSJX 2JCXA 2IHUA 5DHSA 2CLMB 5EEHA 1D8AA 1XTVA 4ATNA 2GPNA 2GGSA 4LWOA 3E53A 4NOLA 1SU7A 1R6DA 3JATA 4UM8B 1H4QA 1P9WA 4QWMA 3WJ7A 4BRZA 4EUEA 4W1PA 1GTSA 4MARA 2JLQA 5EXTA 3LPAA 3SIPA 3ESAA 3ETEA 1J2TA 1GFSA 3DBOB 4KPFC 3IAM6 3EXG2 4JHLA 3AEUA 1MGOA 3BGSA 3RS5A 3SF8B 1SOWA 3CZAA 1NQUA 4HNVA 4FGSA 1FF9A 3AI3A 4CKCA 3L4SO 5EGNA 1RBQA 1G8FA 3KZKA 4K9OA 4OKNA 4WK2B 4C14A 4F60A 4RK4A 4ZGBA 1KRWA 1OFVA 2EEPA 2J7PA 2BFOA 2CMHA 4IIEA 5U4QA 4BN4A 5AKYA 1J33A 1COWD 4P1ZA 2P9CA 4EB8A 3SM9A 5G3YA 2DY0A 4J16C 3SVZA 1TOAA 2QQFA 4G67A 1TVMA 1UL1X 3GRVA 4I4TA 4IKPA 4KIFA 2V5AA 1A2BA 4UNPA 1KI2A 3CPHA 4RFSA 3TPFA 2ZYSA 1V25A 2VSNA 2ZRPA 2VYND 2FUG1 1TM2A 4TS4A 2ZJZA 3FDIA 4LDPA 3UJHA 5I4IA 3ZJTA 5E95A 2OOKA 3ANSA 3GN1A 2H4ZA 4LPSA 5HFAA 2BGGA 1U2ZA 4CDGA 3CE9A 1GYRA 1UAAA 2FSSA 2YWDA 1V5GA 3A10A 1CF2O 4PAQA 3WWCA 1VLJA 4BX9A 9LDBA 1XMIA 5KIAA 3V1KA 3CR7A 2PLNA 1S1CA 3O75A 5KYXB 3PRJA 3RFXA 3OPMA 1LF5A 1NXWA 2HRCA 2O2GA 3TVDA 4M9SA 4FEYA 4BQFA 3DWFA 2RI0A 4KW7A 3AL3A 1TIBA 3J7TA 5GOTA 3LZ6A 3OUUA 2DE0X 3F8SA 5DISB 3QSGA 5T5QA 1WDTA 3DEIA 4YACA 3AKZA 4LSMA 1Z0AA 2FFRA 3M6IA 2WTEA 3U4HA 4ALJA 3B7WA 3DFMA 1W88B 4XDHA 4L7VA 5EKSA 5A5GA 4C2TA 4XX0A 4KKVA 4ENUA 4GO1A 5BQOA 2WDZA 1OJLA 3E15A 3OECA 2CB9A 2E6UX 1C0PA 3WC4A 3KYCB 1GKLA 1UP7A 2ZREA 5C8YA 1JHVA 4AIIA 1CXZA 3TFWA 1GSIA 2PT7A 1G9XA 4Y2UA 3MWLA 3VPFA 1U2DC 3H2ZA 3ACCA 3B38A 1ZIXA 3FOAA 1T5DX 5TQ2A 4EVRA 2J59A 4J9VA 3T61A 3OX3A 2BFDA 1TJ4A 1ECJA 1TF2A 4IOKA 2YIDA 3D59A 1U2TA 4E1BA 1U1CA 3K2EA 3GLFA 5GGYA 3ZPXA 2KLHA 3B1YA 1TFUA 2HKIA 1E9DA 4FFMA 4H7DA 4K9PA 3OKAA 4J3NA 1MJGA 5CDUA 1GT6A 4NX2A 1NQ5A 4ZREA 5E9AA 5CFQA 1KDYA 4DUGD 4OXYA 1H2YA 3SBOA 2Y1GA 4X0EA 1WX1A 4CL8A 3BF7A 2GA8A 4CQLB 4JUDX 3FOEC 2IYQA 2O0LA 2Q27A 2I78A 3OURA 1CP3A 1PHPA 4OLBA 4PHTA 1YCHA 2CLDX 4GKKB 2Q9BA 2QVLA 2Y92A 1C0EA 1RACA 4JELA 4NFSA 4GF5A 1BMFD 4UEWA 1PNTA 1W5BA 3H0KA 3TLAA 2F3TA 1MAWA 2NZYA 1G38A 1GUYA 4U02A 1AZWA 3FFXA 5HQ3B 4I1UA 4LNAA 3L8GA 3CEHA 4OJKA 1YE3A 3KETA 1PQWA 1TUBA 2EWVA 2HQ1A 1I7LA 4RIEA 1R9JA 4RY9A 4H17A 1ZL2A 2QRVA 2C00A 4ZVNA 5LR6A 4ON9A 4WWHA 1GN8A 3UN1A 2QOEA 3I6IA 5B5SA 3OESA 3TX6A 2WWHA 3VPAA 4RTNA 1KRXA 2C04A 4HPJB 1BWQA 2AHOA 4F84A 1BKDR 2GHIA 1KYYA 1MC4A 2DUNA 3K4PA 5J4LA 2O3TA 5B3KA 1UBEA 4NP6A 1JEQA 2IT1A 4QICA 4AXBA 4DV1B 2AYXA 3L04A 1DZ3A 3WI7A 4AKHA 3S2YA 2UUAB 2Y1LA 2YN4A 4IUYA 1BOOA 1PP4A 2UYOA 1UQUA 2C83A 2MDTA 3WLOA 1UC8A 3P5SA 1P1CA 2OZEA 3CR8A 1WVMA 2MYNA 4I4TF 4ZQCB 1Z18A 4D9CA 2PGJA 5FOQA 4LK2A 4J4HA 4Z53A 4DS3A 1SCDA 4RVUA 2FN4A 3PEUA 2QZPA 4N5HX 1RI3A 1ISGA 2OL4A 4FMCF 3UW1A 4HAXA 3IVAA 1KFKB 1L7RA 2PIAA 5IVDA 1XZKA 3I6BA 3BULA 3QG5A 3TBHA 1D6SA 3ZGYA 1PR5A 3VC3A 1V37A 3PGMA 1RWWA 4RJTA 5BOVA 3F2VA 1E4EB 4HX2A 4J9UE 5C52B 4TN5A 4YAKA 4DLSA 5A3VA 1TL7C 1YRBA 4HNHA 4IQGA 3TTSA 5J2TB 3L0YA 1JKJB 2DERA 3OT1B 3QFCA 1NHWA 1U0JA 3L02A 1PZMA 3L7DA 4QARA 4CJXA 3SF8A 2HBRA 3P52A 1JLHA 3NWBA 2IHTA 4ZO9A 3U49A 1MEEA 2AFHE 5TLSA 3RG8A 1U1GA 4RD6A 4UHHA 1B0PA 3ZGZA 1F8YA 5HM8A 4ZCLA 4TXHA 2FJ0A 2BTEA 4AM8A 4G4JA 5JYCA 1FYDA 3LI2A 4HN4B 4F4FA 4Y18A 3GI1A 1Z29A 2QN1A 1WBDA 3EDOA 1EVQA 4RHFA 3D4PA 2FDRA 3I30X 4KQ6A 5JNTA 5KJ6A 2J30A 2W6MA 1UK6A 5F77A 2CYAA 1JPUA 4QLOA 2CBGA 1DAFA 2BW0A 4Q3BA 1M1XB 1CYEA 1CE8B 3R9KA 3RGWS 3K96A 1D4AA 2QYTA 1F51E 4J0HA 5AHOA 1N7GA 5HCIA 4DCPA 5C8YF 1DHTA 2R97A 1GL6A 1Z6AA 4GEGA 3VX3A 1M75A 4Y2RA 4TWRA 2ZG6A 1ZXLA 3I28A 3IAXA 5ALJA 5TGTA 2QN2A 2HPHA 1N0HA 2VJQA 2XKJE 4GWKA 3D3JA 1QLJA 3LU1A 2IBTA 5EZSA 3SE0A 4RPKA 1JSZA 4K26A 4TQ9A 5KYXA 1VIAA 4UTNA 5JR3A 1VPEA 3QNUA 4G1VA 1YDEA 1DKRA 2CJPA 2OBYA 1E32A 3BREA 4OIMA 3K2QA 4RAOA 1W2GA 3AF1A 5C7LO 4PQFA 1Z26A 1W9HA 2O8DB 4LJ5A 1QR6A 4Z8XA 1ADGA 1CUVA 3GDFA 2UV8A 4Q7QA 3K6SB 1EX1A 4ZV7A 3U4GA 4OMDA 4G6ZA 1W88A 2OM2A 3BK2A 3FN4A 3AI1A 2CFCA 1M2EA 2CMDA 4L73A 5JS1A 2BCGY 3A1FA 4LV6A 1LKZA 4US0R 4FMDB 3EFBA 4UBMA 1WB6A 3IPCA 4IH1A 4KBFA 1WBJB 121PA 4PLFA 3PTAA 1TE2A 4GGMX 2P2LA 3KYCA 2QV7A 2XUPA 4GR5A 3II6X 4I99A 3OPYB 4R83A 1WMSA 1Z0DA 4OQEA 1ZA1A 4TXNA 4AY3A 1RYFA 1FS5A 4JP8A 5KJEA 4AT1A 3IBYA 3JD1A 3RHSA 2HF8A 1ZZEA 3QPDA 2GN0A 1FNDA 2GFIA 2F8TA 5HRCA 2QUBA 2PZJA 4LOHA 5KOHB 3AVWA 1BWRA 1QR2A 1ZO8A 1TUGA 3CRZA 2JASA 2UYQA 1CK4A 3CTPA 4F3RA 1SC6A 4JNKA 4FFVA 1M2OB 4LJKA 2HU2A 2NZ2A 3LUKA 2QG9A 4O0LA 1UT8A 2NU7B 3QUBA 4G4SO 5ER6A 3W8DA 3BE8A 5HKAA 1VCNA 1U94A 1ZBDA 3TG2A 5KTRA 4K0KB 3LO5A 3LLSA 3JQ9C 3LOUA 3TXXA 2KI5A 5K7SA 3IP9A 5E6SB 2FG7C 4M0KA 1ILEA 5E3HA 3H8SA 4CQLA 3RFCA 1GGEA 4X64B 1E77A 4OLJA 4WVLA 4GWGA 1GWNA 3A9TA 3DLPX 4MW0A 4UAVA 1HQYE 3VH3A 5KSYA 1P0MA 1Y8RA 5F7XA 1JWLA 1K08A 4UTPA 1PKEA 1TCBA 3VU9B 3TTYA 3BRSA 3IEIA 4MCAA 3AM5A 1OBVA 3SHTA 3QENA 2QX7A 4G85A 4LDRA 4O4IF 4LK3A 3RLIA 2OFFA 5EP1A 1QHIA 2FX5A 2XUZA 3IPRA 1KQGA 2PD3A 1GARA 2YCLA 1FDVA 4JOBA 5B55A 1ZWLA 3E5HA 5HQ3A 4AJJA 4D96A 3WQBA 4HJXA 3ND6A 5BWMA 2QGZA 4XOUA 1WD5A 2PZ8A 4IMJB 4L9WA 3UMCA 5DK4A 1DUIA 5IAGA 1H9CA 2FFHA 4LZWA 1JILA 2RJNA 4U00A 1FC0A 2XTMA 3HH8A 4YASA 2D8MA 5IC4A 5B2FA 3OEHD 1YDMA 2GCOB 3W7VA 1GTZA 1DPFA 5ALDA 2R8XA 4EFKA 1SGWA 1ZHOA 4KFCA 2GCNA 1GRQA 4MP8A 3WDKA 5TX7A 1ISFA 2OB2A 4X62B 5DI9A 4Z7JA 1DOZA 5ED4A 3CGWA 4B3MB 4IFEA 3ZU2A 4HZGA 4D46A 2XA2A 1T2UA 2X2EA 2XKAA 3GLUA 4KL8S 4RYDA 1U1DA 2RK6A 4YFYA 5BPFA 4WCFB 4UTVA 3DBLB 5F5XA 3DE4X 2JRCA 3CB2A 1HDRA 1SXJE 3GT0A 4I50B 4J0FA 1VIVA 3PTLA 3DXZA 3QYAA 4NBSA 4LGCA 2XGJA 5K3DA 2VUSA 3TQQA 4UM9D 4OAPA 4X8OA 3ESZA 3LCRA 5JE8A 2CMKA 3F3YA 2R8PA 3M3PA 4AJPA 1E4EA 4FSXA 4FYMA 1BU5A 2LWIA 2P2ZA 1WMFA 3DEFA 5EYPB 2HU5A 2VJYA 5J2TA 4KQ2A 1D6NA 3O2NA 1JKJA 1OHHA 4MGYR 1N2CB 3OT1A 1N0VC 4TYPA 5KKNB 4YAFA 1YRHA 2DOKA 2UKDA 2YY6A 3PWZA 1WUTA 3X1JA 3GLIA 5DBFA 3N0WA 4V38A 1U4OA 4WCVA 5LMCA 1JALA 1ADCA 1I3LA 1N2ZA 1NVMB 3GBSA 1QHGA 4FT2A 3WX0A 2UUCB 2X7JA 3O84A 1F2TB 4K7JA 3BB1A 4BVBA 1NVEA 5NLLA 2WU0A 3FMGA 1UBLS 2GCGA 5KB3A 1HTBA 3I5MA 4YLEA 5LZ4A 5CIYA 3AG6A 4O5OA 2C7GA 4PVDA 5DHAA 1MQ9A 2G17A 4O8ZA 4EKDA 3I9V6 4UMEA 3T5CA 3BHNA 2I9KA 2I2CA 3STHA 1W5EA 4LPKA 1AQLA 2QTAA 1CE8A 1WNFA 1NDHA 2ZSBA 1XDSA 1LX7A 1YK0A 4FUQA 3D43A 4FSDA 1ZJZA 4FNAA 2BH9A 2ZSIA 4BTLA 2HK9A 2IZZA 3DC2A 1G64A 4JV5B 4K6CA 1WKVA 4L0DA 1NTRA 4YFVA 4ESVA 3HUUA 3UJDA 4AMUA 1HDIA 3CSSA 2JJYA 2GCIA 3Q7IA 1CUDA 3CLRD 2X7XA 3N05A 1RMQA 2HIHA 3ZS9A 4UUPA 3GVIA 4NQRA 4L6CA 4EZBA 2XECA 1BD4A 2VDPB 2EL9A 5CIWA 5AOCA 1NT4A 2J9XB 2X86A 3DP7A 2XB8A 2D13A 1JSLA 2I4LA 2XMBA 3KR9A 4IHJB 4X41A 5D2CA 3V8QA 2O8DA 3IJPA 3ENVA 4OATA 1M6WA 4ZAWA 1J0DA 5B7PA 5GINE 5IBQA 1TA0A 2Q5IA 5LDHA 2O23A 1N6OA 1BW9B 1QWSA 2VWGA 3OAAA 4UUMA 1C30B 1QHEA 2AXPA 2D2XA 4HH4A 4U63A 4A15A 1U0HC 1HMPA 1WD7A 2OAP1 4QYXA 5AK0A 3ADKA 1LS1A 3W1WA 2IDMA 4PLYA 1EK0A 1JBEA 2XR1A 2DQZA 3M6WA 1YHYA 3PUWA 3RTCA 4LTNA 3RUPA 2H2FA 1R9GA 4XD7A 3UAVA 4A82A 1Y7LA 2PT6A 3A6LA 1JHXA 1SVMA 3OPYA 4YEDA 3Q88A 5JHGB 5JD5A 5KVAA 3ED1A 4Q03A 3TLYA 2AE2A 2WTNA 5DYNA 1E7RA 2PDAA 3MILA 3NZEA 3OHSX 3TKYA 5KNBD 4YCNA 5COAA 1PQUA 1ZVKA 4EY4A 5KNCA 3KJQA 4KV9A 2P78A 5KOHA 4QUGA 4UVEA 3RSZA 5JCXA 2VPXA 3BD8A 5LDDC 1MZPA 4UHKA 1PD0A 3H86A 5AVRA 5KPJA 1SXIA 4UARA 1M2OA 4G5FA 2VPWA 4P22A 5J5AA 1PT5A 4TLBA 1Q92A 2NU7A 2W2TA 1KIAA 4BNJA 1PGOA 1WCWA 1EGHA 2OZVA 1T0BA 3N1UA 2CCKA 3IVMA 1FDIA 5ALOA 1GQRA 3GYBA 3PDHA 3MBKA 3QTLA 5E6SA 5E2BA 1QG6A 4F5ZA 4Q3OA 5BWLA 4K40A 4MWOA 2CL0X 1JQLB 4BO8A 2BJWA 1NU6A 2UDPA 5JSHA 3WNCA 1JLMA 2QM3A 3ZQ6A 3O26A 1NYQA 4CF3A 1W6RA 1YI1A 3B9QA 4D3FA 2C4MA 3FY4A