1PL8A

Human sdh/nad+ complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
356
structure length
356
Chain Sequence
b'AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords human sorbitol dehydrogenase
publication title X-ray crystallographic and kinetic studies of human sorbitol dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 121
structure length 356
sequence length 356
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.14: L-iditol 2-dehydrogenase.
pdb deposition date 2003-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pl8A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1pl8A01
4D45A 3WQSB 3EDMA 2J8ZA 3F6YA 3Q2KA 3SBOA 1GAEO 1PGPA 5A3JA 1WVGA 3VOSA 5I9LA 2X8LA 4J91A 5AOVA 3CMCO 1YONA 4NK4A 4B79A 1ENOA 3EVTA 3U4HA 2BFOA 3WGHA 3K92A 4TROA 4WOKA 1Y8RA 3T4EA 4AJ4A 4AJLA 3AUTA 4NJMA 1NQ5A 4BNFA 5ES3A 3DMTC 4NU5A 5BSFA 1E3WA 1YH3A 2YHIA 2B83A 1LDGA 4RF3A 1PJ2A 4Y98A 5TIIA 4L8VA 2WJPA 4D42A 3ROKA 1DIBA 2CF5A 3A14A 4DC0A 5CHEA 4LSWA 3JQAD 4Q3CA 3H9EO 3MJCA 4E5YA 5A5EA 4B4WA 2PZLA 3FWZA 5U4QA 3VPHA 1ML3A 1HL3A 2UAGA 1JWBB 1N92A 1Y9AA 3DOJA 1EMDA 4M8SA 3ZI0A 4CM4A 3DBRB 5DCYA 3ZNPA 1P74A 2G5CA 3OETA 3D3EA 2VHWA 3PVZA 1NP3A 2DPHA 3Q2IA 4HNHA 3EAGA 4NG5A 4ZVVA 2G17A 2Y99A 4PIVA 2AMFA 1YDWA 4WCDA 2NLOA 3RC1A 2HMWA 4M54A 1NYTA 3OMLA 2W90A 1DIGA 4EUEA 2IE0A 3ZGYA 1SBYA 3OJFA 3QWHA 1OFGA 5CFZA 1EZ4A 5T67A 4PG8A 1ZW1A 4YCAA 4JP3A 1JTVA 1TI7A 3LLSA 3ZHYA 3D7LA 4RLHA 2CDBA 4GKVA 4IZIA 2VUSA 1E3LA 5C5IA 1O95A 4Q39A 4IDAA 1IL0A 1RM0A 3H2SA 1X7DA 4E2WA 3PJDA 1LX6A 2Q3EA 4XYBA 5DT9A 4MVJE 1U2GA 2BGLA 3LT2A 3D3WB 2CVZA 5FYDA 5TGDA 1UZNA 3HB4X 4Q3AA 3BTSA 3HFSA 4IDDA 1DJNA 3LC7O 4YRAA 2QW8A 5L53A 1HDYA 1HE5A 2AE2A 4FDAA 4H16A 2FR8A 3IC5A 1ZBQA 3D64A 4GX0A 3RJ9A 3EMKA 4D44A 1PSDA 1DEHA 1ZIDA 1FDUA 1X1EA 2Q4EA 3R3JA 1YKFA 3HZZA 4J90A 3IL2A 2DKNA 4GWGA 4BNWA 3TF5A 1AGNA 3CKYA 1XHLA 3KSZO 5FI3A 4CMAA 1ZMTA 1YBAA 3D5TA 3V1YA 1F8FA 2XAAA 1K6XA 4U8GA 2DM6A 3ZDFA 4CL8A 2E6UX 1KETA 1ADFA 3GUCA 3E8XA 3PYMA 4NIMA 5LDGA 4BQRA 3M2TA 5JAIA 2X0NA 4M89A 3BTUA 2G76A 4JCOA 3C85A 2NVUB 2O7SA 3WGGA 4D41A 3I3OA 5JE8A 3GOHA 1LC0A 1RKXA 1ZKMA 3WX0A 1ISMA 4I8XA 4IMRA 4BGVA 1W73A 2IEDA 5H81A 1NAHA 2P68A 2PKQP 3I4CA 2HQ1A 4I5GA 4RQUA 1ZXLA 2ZB3A 3ZN2A 4D3DA 3K6JA 1OAAA 4UVHA 5A9RA 3ZW8A 2Q1WA 4HXYA 2VTDA 3F47A 1UDBA 3PGXA 2FZWA 1ISJA 3QLJA 2X5KO 4WLEA 1KERA 2Q45A 2AEJA 4BB5A 3LSYA 4MO2A 5A9SB 2VTEA 1FDSA 3LC2O 1C0PA 4NHEA 3H2ZA 4CMIA 5JXWA 1WPQA 2FZEA 4CMCA 1OBFO 1YJ8A 4DUPA 1LRKA 3WBFA 3F4LA 3OQ6A 2X6TA 2Q2QA 3DBHA 3HJAA 3ONEA 4MKRA 2VN8A 4FS3A 1A9YA 4WNCA 5L7WA 3GN1A 5FFFA 1I30A 3FNGA 4XX0A 5T64A 1K6IA 3K96A 5G2OA 1EDZA 2NACA 3JQDA 5B4TA 5AVOA 4YJGA 3BXXA 1LJ8A 2VZ9A 5CDUA 2X5JO 2E82A 2QYTA 1XELA 4OGWA 3AOGA 3JYNA 3ORFA 1MP0A 2YQ5A 4FFPA 4II2A 3TZHA 3AFMA 3ZV4A 1HF3A 3LQFA 1O8CA 1BXZA 3P7MA 1OC4A 2HMUA 3OJ0A 2C59A 3U0BA 4FGSA 4AVYA 4RVHA 3SC6A 3GVPA 4CM9A 1E77A 4RLSA 3IAHA 4R69A 4CV0A 1U7HA 1WZEA 1MX3A 4ND1A 1ENYA 1LSOA 2QX7A 3W6ZA 5I8WA 5JC1A 4WCFB 2H5LA 1H6AA 1DHRA 3ADOA 3IKVA 2AQIA 2GGSA 4J1NA 2C2YA 1C0KA 1IZ9A 3ZHBA 4BQPA 1VL8A 1D8AA 1B3RA 1GPJA 3RFTA 4E32A 2D5AA 1ONOA 3HDHA 4NBTA 4R41A 3BA1A 4YYZA 1VPDA 2AG8A 2Y67A 3S8MA 3IQDB 2C29D 1GCUA 3H4VA 3WGYA 1H94A 5TC4A 4BKPA 4B4UA 3WGIA 4J1TA 3D4OA 5CPBA 4R9RA 3RQSA 3GHYA 1VKOA 2WD8A 2Y1FA 1BXKA 1E92A 4RV9A 2OP1A 4PG4A 4IJWA 3B20A 5G4KB 5HBRA 4K28A 3VC7A 1IHXA 4M87A 4GX2A 1PZGA 4ZQEA 3W4IA 5DNAA 3CINA 5JW6A 4URFA 4AJJA 1SEPA 4NFHA 3G3EA 2NTJA 3GQVA 2H63A 1DB3A 3FNFA 3KYDA 3NGXA 3U9LA 3PEFA 1ZZEA 1MFPA 3OEYA 4OAQA 4BKRA 3KLPX 4EDFA 1W4ZA 3FD8A 3NTOA 1W6UA 2HMTA 4I5FA 5FF9A 1PJQA 1Y6JA 2C7VA 3GNQA 3BTOA 3GK3A 3BMOA 4J6FA 3EUWA 4RGBA 3EY4A 3QJ5A 4I9HA 4FOSA 2XOXA 4M1QA 1H93A 3W1VA 1NFRA 2ZB7A 4IZHA 3AI2A 1M67A 2D3TA 4II3A 4Q3NA 4E2XA 3IUPA 3PHLA 2ZQYA 1Z75A 3V1UA 3BMQA 1PQWA 3DAPA 2NU6A 3OHSX 4JXKA 4O5OA 4PGFA 3TZKA 5EESA 4JK3A 8LDHA 4AJEA 4Y6SA 5DULA 4XQGA 4A27A 3GEMA 3JQFC 4OH1A 4RPGA 3NV9A 4HFMA 5J23A 3GDGA 2X0IA 3KTDA 4N5NA 2HK8A 1JW9B 4JIGA 4W9NC 1JKIA 2AQHA 4BGEA 4F6CA 3PWZA 4MKXA 1Y8RB 4FGWA 4NJMB 3BMNA 4UAGA 2JAPA 2IEBA 1P3DA 1XCBA 1VJ1A 3ONDA 1QMGA 1E3WB 2DTDA 2YHIB 2UDPA 5COAA 4R16A 2ZTMA 4XDZA 2CD9A 2X7HA 2D1YA 1U4OA 4RVGA 4PLZA 5CDSA 5A5FA 1BVRA 2PZKA 4FJ1A 1EEHA 3GGPA 4CMJA 1U3TA 4FFMA 5A4DA 4WLUA 4WCFC 4UUNA 1ONPA 1O9BA 4CLXA 1ADBA 2WTBA 4PLGA 4LISA 3ZWVA 4CM4B 1GFSA 5LC1A 2FR0A 3KETA 1CJCA 1BRMA 1A71A 5JNLA 3PK0A 5JMWA 2GN9A 4S3MA 2BKAA 2W2LA 1GZ6A 2NTVA 5ENDA 1HTBA 3H3JA 4DPMA 5DCWA 4E5KA 3E48A 3PWKA 3I5MA 1P1KA 1SMKA 1NQAO 3AM4A 4ESOA 5ER6A 5IZCC 2NVBA 2DBVO 3DZBA 4DIBA 5KJ1A 4BS9A 7MDHA 1JQBA 3FHLA 1VSUA 2YHUA 2YFHA 4NZ9A 1EK6A 5I9NA 3GUYA 4BOYA 1PQPA 1VLLA 1P1RA 5B37A 4ZQFA 3R1IA 1OMOA 4UUPA 4IXWA 5GMOA 1GV1A 4EJMA 1NNUA 2VWHA 5U9CA 3L0DA 4P4LA 4DBZA 4R3WA 3HE3A 1KEPA 3R3SA 3IP3A 4QT0A 4TMFA 1K3TA 1U2DA 3RUFA 1NPTO 4JJFA 3CH6A 2VZ0A 2RH4A 1SNYA 5DN9A 2I65A 3BMCA 2WSBA 3DTTA 3VH3A 4BNXA 4BL5A 2EW2A 2BGKA 4CR8A 2X4GA 4BO8A 2NWQA 2ZYGA 4MP3A 5B4VA 1I32A 1HDZA 1P9LA 5KJ6A 3AY7A 4JJIA 2P5UA 4ZGWA 4XQ9A 2GN4A 4W99A 1BGVA 3HUDA 4DTIA 3BYZA 3RU7A 1ENPA 4BB6A 1U4SA 4KQWA 4PCVA 1B15A 3AI1A 1K6JA 3D0OA 1LA2A 4OIMA 4YJFA 3ZWNA 5L40A 5A04A 2PK3A 4J16A 4BVAA 3Q1LA 1FJHA 4I1IA 4DREA 1JA9A 2PH5A 1X15A 1I2BA 2PGJA 3LF2A 4OOEA 5DOVA 4E5PA 1GD1O 2P9EA 4IJKA 4EBFA 3F1LA 1NQOA 3RBXA 5BT9A 5FWNA 4CV2A 5CDYA 1XEAA 1LSJA 2GDZA 4MIEA 4IXTA 2RH8A 3F1KA 1P31A 3E9QA 4CUZA 4E6PA 1V3TA 3JQ6A 3C7CB 2AHRA 3E18A 4DMMA 4YAKA 2JFFA 4LMRA 4FR5A 1PJSA 2E48A 5MDHA 4BMNA 5T8KA 5JCJD 1E7YA 5IXYA 1LDMA 4RCVA 1GQQA 4NBUA 1VL6A 1IPEA 3NTQA 4DBVO 2VHVA 4WECA 2OXIA 4CMIB 4GLOA 2OMEA 5IDQA 2CZCA 4M55A 1UDCA 2E4AA 4NPCA 4BNNA 4CLDA 1DRWA 2WYUA 3WGZA 1ISFA 2CNBA 4DL9A 4KTTE 4B8ZA 3DBHB 3EC7A 2Q2VA 2JHGA 1GU7A 2J3IA 4FJ0A 4YWJA 1CETA 3Q9UA 4J0EA 4J4TA 5F5LA 3K9QO 5BNFA 1P33A 5I7EA 3NX4A 1WLYA 3CMMA 1DC4A 1VM6A 1EUZA 1LDNA 3B1KA 2PGDA 5EN4A 3TSCA 1PGQA 1EK5A 1FDWA 3G79A 3OBBA 5JLAA 4YJGB 1I3LA 3U49A 3WQRA 5K6AA 4Z3KA 1U5AA 3PDJA 4RPKA 5TT1A 1PGOA 4GMFA 1DC6A 1DC3A 4ZICA 1R6DA 1I3KA 3DEYX 1G1AA 1V6AA 1VRWA 4KZPA 1KBZA 3NJ4A 4H7PA 2J6IA 1ZSYA 3I52A 1R0KA 1MV8A 3WLEA 4F45A 3AY6A 1YRLA 2V65A 3ETGA 3ZWOA 4ALMA 1XWFA 4D46A 2BFAA 1QRRA 1XDWA 3ITKA 4FQ8A 3RIHA 1EVIA 4Y6RA 1LUAA 3ROMA 3KEQA 1T4BA 4XZ3A 1MXFA 3D4PA 4L4XA 1CQIA 2HU2A 3MCVA 4HFJA 3SX2A 2BI7A 3I6IA 1LDYA 2ZJ0A 2DAPA 1QG6A 3PTZA 4P4GA 1I3NA 1PWXA 1E0DA 4YAJA 1Q1NA 3C1TA 4D79A 3WGOA 2UV8A 3ST7A 5KCZA 6ADHA 1PL7A 3CXRA 1DIAA 3H8VA 4GH5A 5CEJA 3H5NA 3LU1A 4BO6A 4Z9YA 1Y8QA 1TT5B 4BMSA 3DZIA 3P2YA 4G81A 2DQ4A 4KWHA 3GG2A 3AFNA 4B3JA 3FBGA 2Y0DA 2CY0A 2O3UA 2EGHA 1N2SA 3GMDA 3KYDB 3DXFA 3LF1A 2NM0A 3PHJA 3PWSA 3GH3A 2FHSA 2VHXA 3RU9A 1EFLA 4FJ2A 3BMOB 2OHXA 1NWCA 3ENNA 3AI3A 3DAFA 2JHFA 4D0RA 2Y1GA 4YAGA 4MINA 2QRLA 1CERA 4I5EA 2X23A 3HDJA 5AYVA 2I99A 3JQ7A 2P9GA 3S2FA 3RSHA 4TSKA 1FMCA 1O6ZA 4C7JA 1QV6A 4J3FA 2VHYA 2I66A 4YT2A 1C3VA 4OO3A 1V8BA 3ZV3A 4ITUA 4KWIA 4P22A 3U09A 2OGUA 3GVHA 4IJVA 4BNGA 3TQHA 1KVTA 5GZ1A 4YDRA 4KP7A 4N7RA 1X0XA 3KEOA 1JWAB 5COBA 4Q9NA 5JO9A 3UF0A 1DDOA 3WTBA 3EZLA 4Z9XA 1B7GO 1Y7TA 3Q0EA 2D59A 2GYYA 2P5YA 6LDHA 2Z1MA 2RHCA 3QRWA 3D4NA 1XA0A 4RZHA 4LRTB 1ZUD1 3GFBA 3IKTA 3WYCA 4CMBA 3RKUA 1R4NA 1B2LA 1CDOA 2DLDA 1U8FO 4FC6A 5AXCA 3G49A 2JFHA 4A2CA 4E13A 5BSGA 2EV9A 1T2AA 3QWIA 4FIZA 4JBGA 3E1KA 4UVEA 5FI5A 3BZUA 1DSSG 3UGKA 2O3RA 3DC2A 3E9NA 1QKIA 2Q99A 1A4IA 3PQDA 3U3XA 2W4QA 3TL3A 1DJQA 2O48X 2V6MA 5BQFA 1U3VA 1O5IA 1QYWA 5ILGA 3GC6A 4CMEA 5KVSA 1C1DA 1R4MA 3DONA 3F9IA 4EJ0A 1WAMA 3DOOA 4BNHA 4CL3A 1SCUA 2Y1CA 4XQEA 7ADHA 1T25A 4IINA 1MA0A 1KY5A 3C3XA 1MC5A 4J4HA 4GSKA 1NVMB 1U28A 2GF2A 5EL0A 3F46A 4YBZA 3UUWA 3V2HA 1EUCA 1X1TA 3ON5A 3LLVA 2JKVA 2GSDA 2WMDA 1DAPA 2VWGA 2D8AA 3FTNA 4DA9A 2RBEA 4O1MA 4NH4A 3SC4A 2BFPA 1NVGA 1UP4A 4ND3A 3OA0A 2VZ8A 4IQGA 4R1UA 1PQUA 2RCYA 3ZWMA 2F00A 4K6CA 2VHZA 3B6ZA 2Y0CA 1LLUA 5K9ZA 2QYSA 3NAQA 2A9FA 5G0SA 4TRMA 3GGOA 4Q3EA 3SXPA 1L7DA 1DXYA 2GD1O 2Q1SA 5KJEA 3T4XA 3UCXA 1XR3A 4YA6A 3HDQA 1R66A 3VPFA 3BTVA 3W4JA 1DRVA 5L95A 4YJFB 3GEDA 1EBFA 2HRBA 1YQGA 2B4RO 4R5HA 1Q2XA 3IOYA 2LDXA 4YQYA 1GADO 2C0CA 3TFQA 4BHTA 3G1TA 3L6EA 1MG0A 1VE9A 1JLLA 4HV4A 2C20A 1E1LA 1YL5A 3PHGA 1NAIA 3BHMA 4R51A 1PIWA 2FN7A 3ZU4A 3GPDG 1UR5A 4JLWA 2YV3A 2A94A 3JD3A 3PDUA 5JSFA 3UW3A 1YB4A 4BNUA 1G0OA 3UOGA 5IFLA 3A4VA 4RORA 3PZRA 3VZPA 3KYCA 4IY1A 4L75A 3TPCA 4KDFA 2AEFA 5L4SA 3H65A 1DFGA 4YRDA 1GYRA 4DIFA 4EI2A 1M6HA 3T7EA 1NWHA 4BNMA 3MTJA 5BR7A 2B0JA 3NT5A 3DHEA 5C7LO 3CTMA 1YOVA 3AK4A 3ZWPA 1A27A 4D0SA 2PTGA 2FPIA 2OUIA 1J0XO 3ETDA 3F3SA 3GMSA 3ZV6A 1BDBA 1IZ0A 3E03A 3QP9A 1YVEI 2V7PA 2YDXA 2ZYAA 4Y9DA 3WNQA 3KSDO 4CQLA 3WMWA 3TFOA 4K26A 3EW7A 4R4JA 3JD4A 4U0JA 3WIEA 1AN9A 4MVJA 4E3ZA 2NUAA 4YTEA 4MVJP 2AE1A 1F06A 2A92A 1HRDA 5C7OO 4NBRA 1LU9A 4RVSA 5JC8A 4GGOA 3PZBA 1PWZA 4PN3A 1FK8A 3RUIA 2FR1A 4A7PA 3JQGB 2YUTA 2BI8A 4CM8A 3JD1A 2ZTUA 4IS3A 4LMPA 3ANLA 4DWVA 4BGIA 4OKNA 3UKOA 1GEGA 3E82A 4GX1A 2EERA 1VI2A 2A35A 3UHAA 3DR3A 5BNIA 4BNTA 1PJLA 3QVXA 4K9DA 4MJLA 5T6BA 1PR3A 3DTYA 3F5QA 1HZZA 4J7UA 3OEWA 4AG3A 1NBOA 3AOEA 1Z82A 3M1LA 3VDQA 4U5QA 4YJHA 3PIIA 2X0RA 1CIVA 1TA4A 3MJ4A 1LRJA 1E1KA 2DBZA 1RM5A 2B4TO 2VRBA 4QTZA 5IXSA 2ZKLA 2EKQA 3UH1A 3MWDB 1EQ2A 1EE9A 3GVCA 3BIOA 1F8GA 1O0SA 3FI9A 3MJTA 4IUYA 2VYVA 1HDCA 4XDYA 1G0NA 1H2HA 3ROQA 2QZ9A 4DYDA 3U4IA 4GI2A 1NM5A 3JSAA 4L73A 3ONFA 4RVDA 4W7HA 2HLPA 4IQ0A 2GNAA 3GZNA 3WWZA 1SO8A 1KY4A 1GQYA 4JP2A 1NHWA 3W8EA 4BMVA 2XF8A 3Q3CA 1U7TA 4AFNA 2FP4A 2IZ0A 5KKCA 1HWYA 1M6WA 3OIFA 4ALJA 4XJSA 3KO8A 4JBHA 5HWSA 2WD7A 5GY7A 1V3VA 5CDTA 4YPOA 4FBGA 1N7GA 2GZ2A 3LT1A 3OM9A 4A5OA 3GVIA 3OF2A 3WS7A 1Y8QB 3PI7A 3ENKA 3W8DA 1DBVO 5I7VA 2DUUA 3B70A 4BO0A 3PQFA 4BKUA 1PZFA 3PLNA 2EGGA 3ZNQA 1YB1A 2EIHA 4PG5A 1UDAA 4JBIA 1YGYA 4BV8A 4ZQGA 4R1NA 1LRLA 3RUDA 4WLVA 5T8KC 1A9ZA 1I36A 1KS9A 1IE3A 2GZ3A 3CUKA 4RQTA 1ZO8A 3G1UA 5ADHA 3FNEA 4UVIA 5TJ9A 2POQX 1RYEA 1Q7BA 4GAEA 3GR6A 2C07A 3JYOA 1LXCA 2I3GA 4XJTA 5I9MA 4Z0PA 2NV6A 4MVJI 1MC4A 3U62A 2PKRA 2CDAA 4XYLA 4Z0TA 4TVOA 3VH4A 3KZVA 4QUKA 3C1OA 2WE8A 3H7AA 3JQ7B 5IF3A 3ICCA 3ITDA 4IM7A 4TRJA 1ZEJA 1QYDA 4RL6A 2H1SA 4L4SA 4WJZA 2PD3A 2X58A 3PXXA 3RUEA 1TXGA 5JFOA 1XYGA 3FRJA 3H9UA 1HEUA 3HNPA 1SB9A 3O8QA 1YL6A 4E12A 1JAYA 5JDIA 4PLPA 2JCYA 4TQGA 3ICPA 5K6AC 1ZK0A 1ONNA 2UUOA 3R6DA 2P4QA 1AHHA 3IDSA 4FOOA 2V6GA 4Z3DA 4EYEA 2OBYA 5KVQA 3MJSA 3WOHA 4W7IA 2YDYA 2UYYA 1UUFA 5CEEA 1TT7A 2FMUA 5A1TA 1UXIA 1ZH8A 1HDGO 2EHDA 1MGOA 4CM9D 2YV1A 4Y67A 5B4UA 3KXDA 1P1IA 3PGJA 2AW5A 1TVEA 2DFVA 2VYNA 1R4NB 5LDHA 1CQJA 1DO8A 2VT2A 3TZCA 2WWRA 1NFQA 1PGJA 3GGGA 4AICA 4TZTA 4ZRNA 4MIYA 2EJVA 2PR2A 1WW8A 4YEDA 5DF1A 4ZQBA 5A06A 4EEZA 3U5TA 1XQ1A 4KUEA 3RUCA 4NMHA 1S6YA 2OOSA 2HJSA 2IZ1A 3RWBA 4Q3DA 4Z9FA 3NRCA 3PFFA 5JAZA 3DAGA 3K5PA 4E0BA 1C1DB 3N74A 3AJRA 2PWZA 5EMHA 3G0OA 3KB6A 3NYWA 4HY3A 1E6UA 4AJ2A 4NBVA 2FOIA 1E6WA 1XG5A 2C2XA 4XIYA 5JCXA 2Y05A 4YVFA 1LNQA 3L9WA 5THKA 4MP8A 2D2IA 1E5QA 1JKFA 1I3MA 4OXYA 4DPKA 4PLVA 3EK2A 2EKLA 3CE6A 2O2YA 1WDKA 2Y1DA 4J7XA 4XCVA 1XU9A 1GTMA 1I01A 1S7CA 3INRA 4G5HA 4XYEA 5FEUA 5B1YA 3KRTA 2GZ1A 4KUHA 2ZB4A 3FWNA 3C7AA 4RO0A 1U1IA 3LK7A 1P1FA 3I9JA 2I9PA 3RBZA 3HADA 3RC7A 3S55A 3GLQA 4AL4A 1M76A 3DMYA 1NTOA 2B4QA 5ILOA 5JY6A 3V2UA 4J7CA 3PJFA 3O9ZA 1AXEA 4MKZA 3PLRA 4J4BA 3SLKA 1K89A 3OFSA 3KHUA 4BO4A 4HUJA 1RM4A 1AUPA 1HYHA 1WNTA 1JAXA 4PZEA 1WMAA 2QRJA 5TRTA 1I0ZA 4I9UA 2NQ8A 4HADA 4O6VA 2PD4A 1BSVA 1NPYA 3LDHA 4CV1A 4BNKA 5IAAA 2I76A 4YQZA 4Z0HO 4ZN6A 4I08A 1VL0A 2J3HA 1NR1A 1E3EA 1RPNA 1R0SA 4WKGA 4B4VA 2PZMA 2B37A 4LRSB 1N5DA 1IY8A 4QX6A 3ZWXA 1YQDA 3KYCB 1RJWA 2ZYDA 3AUSA 3L4SO 4CR6A 4I5DA 4UEOA 3WG9A 4JN6B 1NASA 1FDTA 2VOEA 4WGGA 2YV2A 3B1JA 3IS3A 5EJ2A 4NU6A 3N58A 2AG5A 5JDCA 4FFNA 1SEVA 4X54A 1YOVB 2W2LD 4JQCA 4QO8A 2EJWA 4MP6A 1JDJA 3FR7A 3PHHA 4CMEC 4RDIA 3UAGA 5L4NA 2HSDA 1ISHA 4CQMA 2Y0EA 4CQLB 5JS6A 4L4RA 4L76A 4IDCA 1Y81A 4RF5A 3V1TC 3KM0A 3PYLA 5CG2A 4GGPA 4FCCA 2DBRA 1O89A 1F14A 1FF9A 4E5MA 4J0FA 2I6TA 1MUUA 1EVJA 3FPCA 5IDYA 3ZHXA 3LZ6A 3DBRA 4YAEA 1A5ZA 3IJPA 4CM8B 4NQZA 4GMGA 1HDXA 4HP8A 1HE2A 2X5OA 3ZU2A 1PL6A 4DXHA 1HLDA 3LYLA 3PJGA 3H9JA 1ZK1A 2X9VA 1CEQA 4R9SA 1KIFA 1Y9EA 4LGVA 2R6JA 3KYBA 1GPDG 3WMXA 2B36A 2AXQA 4JROA 3TZ6A 1A72A 1HYGA 3L77A 1WDMA 4YJHB 3OJLA 4H3VA 3VH1A 4CMHA 2X22A 4EGFA 4GPD1 1UAGA 3EVNA 3GFGA 3MEQA 2EP7A 5L45A 3ZWWA 4DLBA 1I2ZA 1B0AA 3S1LA 2EG9A 5KVVA 1I8TA 3VTZA 1V0JA 2DVMA 5F1KA 4MVJM 3D3WA 3GZNB 1LBEA 2NSDA 3UICA 2VQ3A 4CR7A 1DOHA 1F0YA 4M49A 5TF4A 4K1LA 4UEKA 3ZWCA 1WDLA 3GPIA 1X7HA 3I4FA 4F6LA 4R3NA 4Z6KA 4L74A 2WD7B 1I33A 4CLOA 2O3QA 3FR8A 4EUHA 4BO3A 3DZGA 3DZJA 4UEJA 3NGLA 5G4LA 3ANNA 4J1QA 3UXYA 5BNTA 1GDHA 3LVFO 5KKAA 3A9WA 1MB4A 2ZATA 1U9JA 2VRCA 1T26A 1OZAA 4JGBA 4NK5A 1C0LA 2BMAA 5F1PA 3OICA 4IQ8A 4ZQHA 2GLXA 3RUHA 4F46A 1JVBA 1CF2O 2X0JA 1GCOA 3H5AA 5L7TA 3NDIA 2CF6A 2ZTLA 3U4CA 4J43A 3GAFA 3R0IA 4TZKA 4PG7A 4GWKA 3S2IA 4Q3BA 1DC5A 3I9LA 1ADGA 3PHIA 1N7HA 2SCUA 3WICA 3ZCXA 4IDBA 3UCFA 1DPGA 4IDEA 1Z7BA 4PZDA 5KJFA 4HWKA 4FFLA 1PS9A 4LW8A 2PD6A 3KUXA 1C0IA 3UCEA 4PG6A 2YYYA 2BGMA 3EHEA 4WEOA 5JY1A 3GRKA 4QEDA 4FC7A 1E7MA 1J49A 4E2ZA 2VT3A 3O8QB 2G82A 2EWMA 2HK7A 3O03A 1YS4A 3K2EA 2TMGA 2ZK7A 3OIGA 1H6DA 3TWOA 4PLHA 2W2KA 3VPGA 4D3SA 1I24A 3UFXA 1KC1A 3AU8A 4XRRA 1IPFA 2O2SA 3AOEC 4J9VA 2IRWA 4PLWA 3GY0A 1E7WA 4IDFA 3ZNNA 4EUFA 4N5MA 5G0WA 5KJCA 4CM7A 3NT4A 3Q9NA 2GN6A 4IIVA 1P1HA 2WE7A 4N54A 1YBVA 1X7GA 1QLJA 3O26A 3RBVA 1UAYA 1L1FA 2EXXA 2R00A 4XKJA 2GRAA 4OYRA 4J2OA 4OSOA 2AEMA 3JQCA 1U3WA 4J9UE 4UVDA 3PFWO 1LEHA 4RF4A 4IMPA 1YJQA 1UJMA 5GZ3A 2OP0A 2AA3A 2VOJA 2X9GA 3ULKA 3Q6IA 1HYEA 4RZIA 4DYVA 1Z45A 3INTA 4WEQA 3V2GA 3ZH2A 2B5WA 1IULA 2I5PO 3I9MA 1X0VA 3BMQB 3G17A 2NU8A 3HQ4O 5DZSA 2PNFA 4LCJA 3H9QA 4XGKA 1C1XA 3WIDA 3ZWYA 2C5EA 4BO5A 1B14A 1VJ0A 2NQTA 4D3FA 4O59O 5H82A 1DFIA 1PS0A 5F21A 1X13A 1LQUA 3QHAA 4MPDA 2V6BA 1GQ2A 4E5NA 1YWGO 1EQUA 3JQ8A 4RF2A 4CMKA 1PZHA 1XQ6A 3BMNB 3KV3O 4XEHA 3UVEA 5TS3A 1R15A 4R01A 1ID1A 3HFGA 1LC3A 1TB4A 2EP5A 3GNSA 5L7YA 3RROA 4J1SA 4ND4A 4NI5A 1DIHA 1YB5A 2DUWA 4B4OA 1GZ4A 2EW8A 4IIUA 5TJHA 1N8KA 1XU7A 4EJ6A 5JBIA 3O4RA 2HO5A 3GA0A 1SB8A 3I9KA 3AY3A 4INAA 1Z74A 4YXFA 4E4YA 1HT0A 3S2GA 5L51A 1EVYA 5G4KA 4CLRA 4N18A 4QECA 4BO7A 4FFRA 5JPIA 3VZQA 2R2GA 1D1TA 2O4CA 2X86A 1KEWA 4YT5A 3JD2A 1ZJZA 4CLHA 2BHLA 4TKMA 3L4BA 2CMDA 5BSHA 2B5VA 5JDIC 4YR9A 1KVQA 2OZPA 3TL2A 4C7KA 4OOFA 1ZNQO 2EEZA 4QSMA 1H2BA 3ZNOA 1NX6A 1QP8A 1XKQA 2PGLA 3P2OA 1KVRA 4BKOA 1U5CA 2NU7A 3LT0A 5IDXA 3O38A 1ISIA 1P77A 1PJ3A 3F4BA 3QWAA 2CDCA 2D5CA 2VNSA 3WDSA 5KOIA 3DHNA 1PTJA 1HETA 1YDEA 3ZHZA 2QZZA 1E3JA 3JQAA 2A4KA 1E1NA 1LDEA 4WLOA 4BNLA 2I3AA 3K30A 1B8UA 2QQ5A 1RM3A 1C14A 1JU9A 4RDHA 3F5SA 1I5RA 3QVOA 1PJ4A 4GLLA 3SJ7A 1P1JA 2O7QA 1N1GA 1HLPA 1UP6A 1ZXBA 1EFKA 2NTNA 2PV7A 3MOIA 4FN4A 5H83A 3WYBA 1CYDA 4A03A 1UXKA 2XPCA 3VHRA 3X2FA 1EBUA 5LCXA 1KYQA 3BMCB 4BNVA 2OFPA 1CWUA 5CAEA 2JL1A 3C1AA 2ZB8A 4OXNA 4QQRA 1GL3A 1E6EA 1ZCJA 4FPXA 2IXAA 1GYQA 5HTOA 3KSUA 4MVJF 1LSUA 3B1FA 4CQMB 3CSDA 2X1HA 2DPGA 2Y93A 1ULSA 1D1SA 4BNIA 5IZ4A 1PJBA 3UN1A 1MXHA 4CJXA 2GCGA 1SPXA 3PP8A 4R1SA 5F5NA 2OL4A 3JQ9A 4TKLA 1H9BA 4M86A 3ZU5A 5A02A 4OXKA 5HA5A 4BKQA 4IGEA 2IDZA 2C7GA 4KOAA 3QIVA 1UZLA 3RCBA 4KMSA 5DP1A 3QVWA 5EINA 5I8ZA 1CRWG 4XR9A 3RFVA 2C5AA 4R5MA 5A03A 4AJPA 1GUZA 2DT5A 1FXSA 1WMBA 2GERA 1QXSA 4JX8A 1DHTA 4DPLA 4CODB 2FSVA 2Q1UA 1NQTA 4WNIA 4AJKA 1ORRA 1UH5A 3MTGA 3JQBA 2PY6A 4OM8A 4CLEA 2FSSA 1R12A 4CM5A 5JAMA 2JD0A 3AM3A 2O50A 3VH2A 4CM3A 3P5SA 3RJ5A 1PZEA 1T1RA 3ANMA 5KTKA 1R0LA 4PLFA 1T2EA 5JYEA 4Y8VA 4WLNA 2HDHA 2WEKA 1ZJYA 4DQUA 3JCZA 2ET6A 1H0KA 3K73O 4HX5A 4R54A 4PRLA 2IYOA 4B8WA 1Q0HA 4PFJA 3CIFA 4D43A 4O0LA 4EITA 3KLMX 3NKLA 1NVTA 1F12A 2XXJA 3WSWA 2DU8A 4GX5A 1N9GA 4CLOB 4AJNA 3PIDA 3L9XA 4UUMA 1LLQA 2ILTA 3GN2A 3CEAA 3GHHA 1EVZA 1YQXA 2PA3A 1B26A 2C82A 1MLDA 2HRZA 3EZYA 3JYLA 1Z73A 5L3ZA 4A73A 2CVQA 4CUKA 4CM1A 3CZRA 1N1EA 2VUTA 4WPGA 4IS2A 2Q1TA 5T57A 1ARZA 1ZK4A 1Q0LA 3WLFA 4DQXA 5DBFA 2YFQA 1PJCA 2G1UA 3K31A 1UXHA 2VWQA 2YY7A 5JDCC 2CFCA 3MOGA 3FSRA 2HMSA 4YB8A 5DCUA 4OQYA 3IJRA 4ONEA 3VAZA 1RWBA 1U8XX 1IYZA 3RFXA 1I2CA 1OC2A 1XLTA 1QLHA 2EF1A 4MVJD 4E33A 2WDZA 4W6ZA 2Q4BA 2AQKA 5MGBA 1AHIA 4ZA2A 1X14A 2JCXA 2QIOA 4HBGA 1W0CA 3WSVA 3DBVO 4ALLA 2DTXA 4UULA 5BSEA 1KOLA 3QA9A 3C7DB 4CMGA 3QE3A 1D4FA 3VVCA 1U3UA 4O63O 3DZFA 1FDVA 2O3TA 2W2KB 2D0IA 3KOUA 4BIIA 1EUDA 4MDHA 2P4HX 1Q7GA 1PEDA 1SOWA 1ZK2A 4EW6A 4XGIA 3DBLA 1KVUA 5TNXA 4WUVA 5TT0A 4PLTA 2VUUA 1HSOA 2FY8A 2NU9A 4LVUA 4ZJUA 1LSSA 3OA2A 4IGFA 2WYVA 4OJNA 5AQ1A 2VYVD 4RVFA 4BGUA 3INGA 2ZJ1A 4XD2A 4AJHA 4D7AA 1G6KA 3JYPA 3L07A 3QWBA 2RIRA 2UVDA 1E7RA 2Y1OA 3AM5A 5CG1A 2RAFA 3WNVA 2VNAA 2RHRA 4PRKA 2PLAA 1ISGA 4WLFA 3NUGA 4KTVE 3GG9A 4FFOA 4HFNA 1EDOA 3WJAA 1V3UA 3L6OO 2O3SA 3EGOA 1XGKA 2CUKA 3WFIA 5COQA 1K2WA 4PZCA 4ZRMA 3GEGA 1BMDA 3WQQA 1TEHA 1C1XB 3DQPA 1K5HA 5F1OA 1M2WA 1T1SA 1JKJA 1UZMA 2PFGA 3CZMA 3OH8A 3W4KA 3FCOA 3I9OA 2CVOA 1ZSVA 4AJ1A 3QW2A 3H3FA 3JQ8B 3I1JA 3ABIA 1KEVA 1GR0A 1BXGA 1Z7EA 3BHIA 3ROPA 2LDBA 3GF4A 2YW9A 4MOWA 2D4AA 4HFRA 9LDBA 4RPLA 3NT2A 1HXHA 4OKIA 1PR9A 4CPDA 1H9AA 3TDKA 3DFUA 1W8DA 1D3AA 4ZD6A 4FW8A 5CDGA 3VPXA 5EIOA 1H5QA 4LCEA 1P0CA 3TOZA 4GL4A 1TT5A 2PZJA 4CLRB 4BV9A 4TRRA 4HNGA 3C8MA 4XB1A 4DC1A 5ITWA 2YJZA 3NEPX 3NTRA 2X9NA 1SAYA 3H5RA 3QSGA 4NFSA 1A7AA 2NADA 1BHSA 4UREA 3ZV5A 4WK6A 5JYDA 3E5MA 5K0ZA 1DFHA 4AJIA 3M1AA 4B7XA 3DZKA 5ITVA 2DBQA 3EYWA 1B8PA 3PYXA 1E3SA 1R4MB 5AXBA 1ZSNA 3BHJA 5TX7A 3RC9A 3DMTA 3GZ4A 1AXGA 3TRIA 4BNZA 2GR9A 1T2DA 3DDNA 3VKVA 5DBIA 1T2FA 4GVLA 3FTPA 5IN5A 4BO2A 3KBOA 4ALIA 3OJOA 2B35A 4KDEA 5KVCA 4DRYA 4DQVA 3JQAB 4RPHA 4GBJA 1IHYA 3QY9A 4B3HA 2VYND 3DOCA 3V8BA 1Y5RA 1A7KA 1BVUA 2ZTVA 2R00C 3PQEA 4LVCA 5C37A 2Q49A 5IDWA 1LLDA 4YRBA 1HDOA 2Y68A 3QVTA 2O4UX 1IUKA 3DWFA 4J2HA 4S1VA 2DTEA 1DIRA 4WOJA 5L9AA 1TLTA 4G65A 1P44A 1GZ3A 1PGNA 2QG4A 4ND5A 4B7CA 1M66A 3WGQA 4E30A 4W4TA 1UXGA 3WWYA 1OI7A 4Y6PA 2BLLA 2Q2WA 1LTHR 5L4LA 2HAEA 1B16A 4L9RA 2GPTA 4I9NA 1DLIA 1M75A 1ZK3A 1SZJG 3S2EA 4MVJG 3JTMA 5T5QA 4NR0A 4BO9A 3Q11A 3SLGA 3ASUA 2QHXA 5EPOA 3NDRA 1P45A 1ENZA 4W82A 3WFJA 2Z95A 5ENVA 3ZWBA 5AXAA 2WM3A 1YL7A 3I83A 3WBBA 4BNYA 5IJZA 3DZHA 1HDRA 1A4UA 1HKUA 1GUYA 3N7UA 5U1PA 4R1TA 1BW9A 4RJTA 3VDRA 4KQXA 3MJEA 5TQVA 1V9LA 1DRUA 3ZWAA 3RASA 3DB2A 5A3VA 5ER9A 4B3IA 1R16A 1ZVMA 3FNHA 1IB6A 4AJOA 4P8RA 5JAQA 3ZZNA 1YE3A 5JMPA 1D7OA 3L4BC 3KVOA 3M6IA 1LQTA 4QFCA 3OQBA 2JAHA 3RD5A 4FSHA 3WJ7A 3HN7A 2JD1A 2BH9A 3QV1A 3TZQA 2FWMX 4ZHSA 3X2EA 3RI3A 2W8ZA 1VC2A 4XR4A 5TSDA 1SC6A 1H6CA 1E3IA 1MG5A 1GYPA 4OQZA 2YQ4A 3AW9A 1N9GB 1LI4A 3HSKA 2IZZA 4L0QA 5CP8A 3HB5X 3HDYA 2P9CA 1V35A 3E9MA 2Z5LA 1ULUA 3SEFA 3JYQA 4UVGA 3QVSA 4IDGA 3COSA 1J4AA 1BG6A 3HHPA 1HZJA 1NFFA 2ZCVA 3AUAA 3LC1O 4NNJA 3VZSA 4DIOA 3I9NA 3FPLA 2BELA 4K6FA 4RVUA 1GV0A 3AU9A 4DLLA 3I23A 1ZFNA 1HE4A 5A05A 5A9TA 4ALKA 5JCJA 3GAZA 1ADCA 2NNLD 2GN8A 5KIAA 2I67A 4YJDA 1WWKA 1J6UA 2Q46A 4DVJA 3PRJA 4DLAA 4GSLA 1BWSA 5TLSA 5G0UA 3ETEA 2ZQZA 5C3MA 1J5PA 1H6BA 4CQMD 3PPIA 3JD0A 3TN7A 3A28A 3P19A 4ROSA 3VKUA 4ALNA 1QYVA 4IJUA 1LLCA 2JFGA 2CSUA 4XQCA 3WTCA 4E31A 3GRPA 1IOLA 4IPTA 2JJYA 4QO7A 4XA8A 4BNJA 1NXQA 1K0UA 3C24A 3JQ9C 5DDIP 5CPFA 2F1KA 4PVCA 3OECA 2HKIA 3GDOA 3TJRA 3PJEA 3MJVA 2BF7A 3A1NA 4FD3A 3OQ1A 1BTOA 2OORA 4OL9A 5KNLA 5G0VA 4YT8A 1ZEMA 1YO6A 3D1LA 1GUFA 5THQA 3U4DA 4PLYA 3JQEA 2TMDA 2BRUA 4U0KA 3JQBC 2PH3A 3GDFA 4XYMA 1YXMA 5EQFA 4YAIA 5K1SA 4JNKA 3DBLB 1O94A 3DL2A 4U7WA 1HSZA 3SJUA 3FBTA 3WR5A 4CUJA 2Y1EA 3OP4A 3W6UA 3ASVA 4ID9A 1AE1A 3K2BA 2Q50A 4NDNE 3CPSA 4EEXA 4XGNA 3RKRA 4LK3A 4LSMA 4CV3A 4N5LA 1JVSA 2P91A 3OJEA 4WASA 3QQPA 1KC3A 2YZ7A 4GQAA 1SOVA 3HG7A 2E37A 2UUPA 2FRDA 3JQGA 1T2CA 3E5RA 1HE3A 4A26A 4XIJA 3ZU3A 2NVUA 4YT4A 3VVBA 5GZ6A 5HM8A 2J3JA 5G0TA 4G2NA 3I6QA 5HS4A 1WP4A 3MZ0A 3MWEB 4XB2A 3SVTA 1DLJA 5HS6A 1EE2A 3T7CA 1KEUA 4A10A 1Q0QA 1XIVA 4XWYA 2P2SA 5EQDA 2J5RA 2ZCUA 1QYXA 5F3RA 4P38A 1NR7A 2VRCD 3OIDA 4TWRA 4F3YA 3RC2A 2O23A 1Y5MA 1PX0A 3H9GA 4GVXA 5CEFA 3HN2A 1E5LA 1R37A 3H6KA 3JV7A 4LN1A 1BXGB 1WXDA 3ZW9A 4E2YA 5A9SA 4JJGA 2IODA 3DFZA 5I7SA 5DOZA 2VCYA 2HJRA 1T4DA 3QWFA 1E7SA 2IXBA 5JO0A 4OMUA 1UXJA 1XSEA 3DO5A 2WYWA 3WYEA 4C4OA 1PL8A 2OBNA 4XRGA 1ZMOA 1Q7CA 1MFZA 1QV7A 4MIOA 3RVDA 3TOXA 1QSGA 2NVWA 1E1MA 3JQFA 3IIEA 2GUGA 4NJOA 4DGSA 3GVXA 2W98A 3NDJA 4B7UA 3WB9A 1Y1PA 3M2PA 3E6AA 3IMFA 1P0FA 3WGTA 2GASA 4W9NA 3TNLA 2FPPA 2IYPA 2OO5A 2AQ8A 2VWPA 1NPDA 2EKPA 4GKBA 1KVSA 4PVDA 4R68A 3VTFA 2B69A 4NBWA 3RUAA 1PS8A 2C54A 2J5QA 3VZRA 2BFMA 3D5QA 4KUGA 4P4NA 5AXDA 5I7FA 4U6QA 3WXBA 8ADHA 1T24A 1BDMA 3OSUA 4H15A 4A0SA 5ICMA 1I10A 4ZU3A 2DC1A 1Z6ZA 4FB5A 1WZIA 2Y66A 4WCFA 1PJTA 1GEEA 2HMVA 4DMLA 5DP2A 9LDTA 4U6SA 2G0TA 3IUSA 5IN4A 4IBOA 5HRUA 1VJTA 1YBMA 2H6EA 2E49A 3LT4A 2J5KA 2H9IA 4BUCA 1QYCA 2HCTA 2XXBA 2HUNA 4HKTA 3VPSA 3BAZA 3GT0A 5KWEA 2O3JA 2J3KA 2GO1A 2FPGA 1LDBA 3RAJA 4RPJA 4YACA 4XYGA 3K8ZA 4MVJH 4UUOA 1QR6A 1L7EA 1E7QA 5C7IO 1GY8A 1F17A 3L6DA 3ADPA 5IZCA 2JCVA 4ILKA 4ND2A 1OOEA 4WE3A 5ICSA 1B8VA 4QXMA 2ZIZA 1PU2A 1B3BA 3V5NA 3AWDA 2V6FA 4BO1A 4PLCA 3A06A 3FF4A 4EZBA 4J49A 3FN4A 4NFYA 4OSPA 3STHA 2DFDA 2Z1NA 4CM6A 4OHUA 5DBGA 1JN0A 2BD0A 1VKNA 3NJ8A 1QORA 1VSVA 5IG2A 4TVBA 3HWRA 5B12A 4E21A 4QFDA 5EERA 1NHGA 3GNTA 1BW9B 3AUUA 1DAOA 1RYDA 2HK9A 1UP7A 2PKQO 2JD2A 3IP1A 4TRNA 3W8FA 3DHYA 2QRKA
chains in the Genus database with same CATH superfamily
1YKGA 2A1TR 1SUCA 3EDMA 3Q15C 5FOSA 3LCMA 3Q2KA 4PYNA 5CT5A 4EPTA 1PGPA 5HHTA 4IGKA 4QUGA 1WVGA 3T9BA 3CEJA 3VOSA 5LQCA 7REQB 1WKVA 4J91A 1Q0RA 4OHFA 1TU4A 4JYZA 2J87A 3HKBB 2FZ5A 2VG8A 1YONA 2E4YA 4NK4A 5M34A 3H5TA 3I0ZA 1UBGA 3QMVA 3VR6H 3D6JA 1CF4A 1FQKA 2JF0A 4AMGA 3INNA 4ZCRA 2POCA 4YN3A 4D4HA 2FDRA 1S96A 3NGMA 9GPBA 1C9KA 5KTNA 3WGHA 3GH1A 5KYYA 1GITA 1UPBA 4C6RA 1EP9A 3DT8A 4WOKA 4DAEA 2G72A 1KQOA 3T4EA 4KR3A 3EXEA 1YHYA 3LRXA 1L5HB 5AW7A 2JIQA 2ZWMA 3DMTC 2NSHA 5BSFA 2YHIA 4XLLA 1E66A 1QDLB 1LDGA 2Z3VA 3QKRB 4L8VA 3H2GA 4EENA 2WJPA 3A6FA 3ROKA 3VYTB 3RHFA 4BVBA 4YRGA 4PAOA 4OYLA 1GGJA 2IHUA 5LUAA 2Q6IA 2Q6OA 3WL5A 2GPBA 2H4ZA 1A9XA 3MSCA 5F52A 4ZYXA 4GI7A 4WBNF 4WADA 1A98A 3FWZA 3IPYA 5U4QA 1ML3A 1YR7A 1JWBB 4MI6A 1MDBA 1VB5A 1VKJA 3ZI0A 3ZY2A 1ZGHA 3DUWA 4ZAYA 1U8UA 1V5GA 1RWNA 1T8UA 2G5CA 3OETA 4IUCS 3R09A 3D3EA 2VHWA 3PVZA 1NP3A 4NG5A 5F7OA 2RI1A 1HT3A 1X1BA 3L46A 2Y99A 1ETHA 2COUA 2AMFA 1SKQA 2Q27A 3FKQA 4HTAA 3RT1A 3VR4H 2D5LA 2NLOA 2HMWA 2PFSA 3RYIB 3WWOA 5FBWB 3ZX5A 3AV0B 2I8AA 4IDNA 2DRIA 2HWWA 2QRMA 1Z4PX 1ZQ1A 3IFSA 3OJFA 3QWHA 4LYHA 4R7ZA 4WDRA 2ZYRA 2YWCA 2HD4A 3UT0A 4BMYA 4YCAA 3H84A 3FYTA 2I91A 3ABQB 3LLSA 4DLXA 4RMNA 5E3JA 1GRCA 3EZXA 1SA0B 3DVRX 2CDBA 1D6NA 3FX2A 3DP9A 4GKVA 2VUSA 1JIJA 2QD3A 3OG9A 5C5IA 2BV3A 2PG3A 2DYKA 3H2SA 2XD9A 1FSZA 3MB8A 4E2WA 3QOXA 1L5LA 2ODWA 1LX6A 2Q3EA 4XYBA 5LQRA 3GMIA 4WFJA 2WU1A 2W83A 4ZVSA 2ZANA 3LT2A 4LDAA 5LU8A 4CFZA 1G5PA 1V7PC 3ZWDA 5IJWA 4Q02A 1PSZA 1DCFA 5AVRA 2DY0A 5JS7A 1EX9A 3BTSA 4QG7A 3M5WA 2FH5B 1WSAA 4MVYA 4DHWA 5FLKA 1DJNA 3V8EA 1IY2A 5DTRA 2QW8A 1Z7WA 4F5EA 2OHOA 2EGUA 1WUJS 4RM2A 2AE2A 4K8OA 4FDAA 4INPA 2FR8A 3SC2A 1Q7RA 2XE8A 3CNBA 3P9IA 1UWVA 2JGFA 4R2JA 1RWPA 2ZM6B 4B3SB 4UOZA 4UZSA 3RJ9A 1P5HA 3T9CA 2IUFA 1XDBA 1CIPA 2ZI5A 1MKYA 5IF9A 3NV7A 1RJ9B 1L3BA 1DEHA 2H2DA 1A1VA 4BBAA 1H4VB 4U9UA 5AUQA 2CVPA 5E6UA 2DFNA 3CVXA 1UBJS 2YMQA 4K88A 3SYNA 4GWGA 2IUTA 4IOKA 2PX3A 4GE3A 2CMFA 5EXSA 4CMAA 4MA4A 5A62A 3O1IC 2XAAA 2ZT8A 4ZI7F 3DWGA 2WIDA 4PE5B 4CL8A 3R4CA 1ADFA 3TQCA 1EGVB 5DFAA 2ORVA 1OILA 2IHYA 5LDGA 2JLUA 4BQRA 4JXXA 2VJOA 3OFNA 4H6PA 1ECGA 1P5RA 1OLSB 3C85A 3LFHA 1GWNA 1ULAA 3Q88A 3WGGA 1X77A 1U3DA 4L1KA 4TPKA 1WPXA 4HQRA 2EDAA 3GOHA 1LC0A 3V4FA 2HNBA 1RKXA 3BG5A 1E2KA 4EHIA 1QAQA 1URPA 4UBOA 2O14A 5ALUA 3SM9A 2BOVA 4HSGA 4IRXA 1NAHA 2IVFA 1WXIA 2HQ1A 4FXOA 2JLSA 1ACLA 2CL0X 3EQ9A 4I5GA 1TF7A 3F8WA 4H4DA 4L5YA 1YCFA 1ZXLA 4GM0A 5ERGB 4ZT5A 3ZN2A 1QPBA 3K6JA 5A5GA 3JZMA 4CKZA 2CHVA 2RONA 3PPXA 3DXYA 5D5QA 4JAVC 5KSOA 2AB0A 4INZA 3OLVA 2GMWA 2Q1WA 2VTDA 4Y9SA 4LFBB 1WMEA 2VH5R 2WUGA 4RZ3A 5DSZA 4Z7OB 3CR3C 1ISJA 2WFZA 2XE4A 4J0KA 3KVYA 1CUEA 2Q45A 3NQ41 5C3UA 5DNWA 2R7NA 3QU7A 1DAFA 1FDSA 3SXUB 1QK5A 1C0PA 4NHEA 1TIKA 4FEGA 1JWLA 4BX9A 2FPMA 2QLFA 4N49A 4MR7A 3W5BA 5JROA 2BBSA 3TNJA 1QIJA 4CDGA 4N0MA 1XXHE 4ER5A 3IXMA 4GC5A 4Q7QA 2FW9A 2FLVA 3NH6A 1LRKA 3WBFA 2VF7A 1AZWA 4QDKA 3OQ6A 5CLQA 4HT3B 4NCBA 5ESWA 3THYA 3HJAA 1LVGA 2RGNC 1N1DA 4MKRA 4BU0A 1GLNA 3RC8A 3AY0A 3NHAA 2X5NA 3OQVA 8ATCA 2VN8A 3KELA 4GNRA 1QQTA 1YASA 1J1IA 2N1BA 5L7WA 1NIJA 1T0IA 3GN1A 3KNZA 2W7TA 2FHPA 5HEKA 1WZ2A 4MI3A 1JAZA 1N3LA 1BJRE 2P9JA 5T64A 3K96A 5GM1A 1OAOA 5IC6A 1CQXA 4AKTA 1JG3A 1G8GA 1M2OA 2NACA 3JQDA 1FQWA 5B4TA 3TGLA 1LLFA 2ZDGA 1A7JA 1QRSA 4Q4JB 1PWHA 1TVMA 1ZAKA 2AOWA 5HSGA 2VZ9A 2FPPB 4K2AA 4IMIB 2HSZA 5F35A 4X62B 4BXOB 4ARIA 1XELA 1XA3A 3ORFA 3W9YA 5JSHA 2RDMA 3AFMA 3ZV4A 1UM8A 3I1FA 4MH0R 4OHWA 2C3YA 1JIIA 2IYSA 3M5DA 2CDNA 1OXMA 2BM0A 4AECA 1H1DA 3THXB 5JTTA 1GVHA 3EA4A 1B8NA 3KXPA 3OKFA 4OAOA 3U0BA 2VYCA 3SC6A 3GVPA 2NZYA 4RY2A 2D4HA 1V7QA 1A50B 4YRNA 4X20B 1U7HA 2Z4TA 10MHA 4QYSA 3W6ZA 2QX7A 2H2GA 4ZCMA 3KU4A 2OVFA 4D82A 2FOLA 3FLBA 1D2NA 1CR6A 4GZLA 2XT9A 1BDIA 4BY9E 1GL9B 1DHRA 1JBEA 1RRKA 3ADOA 3UJDA 1KOGA 1Z47A 3VR4D 2CW5A 2D1QA 3U3OA 4ZALA 4FHCA 1UADA 1ESMA 1XZFA 2W6NA 3ZHBA 4KYVA 1M34E 2R6CA 1GPJA 1T3HA 3RFTA 5B7NA 3ZVMA 3BK7A 5IAKA 1TUBB 3K9CA 3HDHA 4NBTA 1WZNA 4PHCA 1ZU4A 2P79A 3GCGA 1VPDA 2EFHB 2Y67A 1J0CA 3B53X 4WKCA 1GKUB 3IQDB 5EUMA 1GCUA 2WJWA 1UFOA 1H94A 3LXRA 5CVCA 2V9ZA 5LQDA 2EC5A 4Q37A 2MYUA 2VP9A 3CLUD 3TINA 5K09A 5ADWA 2A8YA 4R9RA 3GHYA 2NG1A 1E92A 2CXQA 2OP1A 2GILA 4HOYA 4C06A 1PV4A 3KQMA 3ZHVA 5CVJA 1FFDA 1XMPA 1YAHA 2HZBA 4L4UA 4URFA 2XNDA 3DYIA 4MQLA 1SEPA 2GT1A 3DEKA 3FTDA 3WHIA 4PYOA 3D6TB 3WLMA 2H63A 2WF9A 4MW1A 4ESVA 1L4UA 3NGXA 2FMHA 1MFPA 3OEYA 4HQ6A 3NVKI 1W93A 3MXTA 3TPZA 3KLPX 4JL5A 2HM7A 4BKRA 5BXYA 3FD8A 2IWRA 1WA5A 2PS9A 3CJRA 2BFCA 2IOYA 5FF9A 5BN5B 2YHSA 4RGBA 3B9PA 3EY4A 1GL6A 1NXOA 1A69A 1EA7A 2FE4A 2XOXA 2QMHA 2XHEA 4DBLC 1W5BA 1H93A 4M46A 4NEGA 5EP1A 4KC0A 4ME6A 2VAPA 1ZVKA 3ZK9A 3THWA 2D3TA 5FA5A 2ZQYA 3E4CA 1Z75A 2C2HA 2J07A 2Y8EA 4JLMA 4V02A 3VC1A 4HLCA 2R79A 2NU6A 2DLNA 5EESA 3U7QB 1FDRA 1YV9A 1UKEA 4G2TA 3GD5A 3AVQA 3ACCA 1BCRA 3NV9A 3P45A 3GDGA 1AJEA 1YK0A 4FK8A 4K9OA 1JW9B 1PLJA 1XMSA 4MRVA 2OQRA 2YV5A 3HO1A 1XRJA 2DJ5A 3ADBA 3B48A 2ZPAA 4KAFA 2PBRA 5IP5A 2XCLA 3BMNA 2V0CA 4UAGA 1FFSA 1V41E 4MPPA 4PAGA 4RJJA 5AK0A 1O7JA 5C31A 4DJJA 2UDPA 1QP0A 4HN9A 4OHRA 3BWVA 2ZCJA 1TVKB 2R6HA 1XZIA 2B0CA 4TV8A 4UE6A 4XCXA 5SYMA 2HSJA 5THXA 3CBQA 3NXSA 1BVRA 3ZDCA 1V3QE 3W79A 1R9NA 5LLTA 1K86A 3OBIA 4TSFA 4BUZA 4RTQA 3VR2A 3N2EA 4L3WA 1O9BA 4LBVA 4AG6A 2KE5A 1A77A 3CUVA 4CDRA 2YXNA 1D9ZA 1SXJD 3ZWVA 2QVCA 2L82A 3ZG6A 3U9TA 1R0WA 4F4JA 1ISPA 4RCYA 1OD6A 1YR9A 3WJ1A 4BV2A 1BRMA 2VDRB 4FP9A 5LKAA 1BFDA 1FJGB 1A71A 3K0SA 4JL8A 2OV8A 2X0FA 2WD9A 4QU0A 1DJLA 2QQFA 3DOIA 3W05A 2YVUA 3L41A 2BKAA 3CKMA 1PK8A 3AZPA 3WRYC 5J43A 3FOCA 2ZJ8A 4X1IA 1MIHA 4DPMA 5DCWA 2ZSDA 3RFUA 421PA 4E5KA 4HRVA 3E48A 2YNMC 5A3RA 1M2GA 2H07A 3I5MA 4Y6LA 4EARA 3CNOA 3GYBA 3HFJA 1CUUA 4G5QA 1NQAO 3MW8A 1VXRA 4XCQA 4IO1A 3SG0A 5IZCC 1EB8A 3ZVKA 5K3FB 1T1JA 5CA1A 5KJ1A 3DOHA 1K7XB 1JQBA 1RFGE 3OPXA 3C98A 1A9SA 4MSUA 1B8OA 4PZUA 2XQVA 3UQZA 5I9NA 1PR6A 2JGDB 3U13A 3X1KA 1PQPA 4XD7A 1VLLA 3S5UA 4BOYA 4E94A 2A9VA 2AF4C 4KG7A 5LP6F 2PGNA 1G20E 2PU7A 3T9AA 4MGIR 5GMOA 4EJMA 1QIEA 1QWOA 4TWIA 3WV5A 3EEOA 1X74A 1G6HA 5DT2A 4WK0B 3HE3A 3R3SA 2F55A 3IP3A 3IUNA 4FKMA 1P2TA 3R0ZA 4QT0A 4YI3A 5LR6A 4YLGA 1X8XA 4JJFA 4O4LF 1EWVA 2QL5A 4WWHA 2I65A 3DTTA 2I3ZA 3TQQA 2F4NA 3FHCB 1QANA 3OFVA 4LV6A 1DGQA 4TTIA 4UM7A 1MX1A 5KTPA 4CR8A 5K3EA 1UBMS 4EK9A 2JK0A 1HX7A 1SK9A 2WP8J 1OBHA 1S8AA 2ZU0C 5EJMA 4WBNB 5B4VA 2CJFA 3I12A 3KQQA 5KJ6A 1PHPA 4AQDA 4Y2VA 1H9CA 2FEPA 5FOQA 1BGVA 1FY2A 3HUDA 3D7SA 4DTIA 1RVDA 4UCFA 2NUTA 4A2QA 1YS9A 3QTLA 3EE6A 3N5KA 5ITZA 3MWJA 1R6UA 1K6JA 2ID7A 2RGWA 2IH5A 3N8HA 4RGVA 1C7RA 4YJFA 2AWNA 1WEKA 1YS7A 4JI0B 1XVAA 5A04A 2PK3A 3RVQA 3V1MA 2WTXA 3IKLA 2V7UA 4OQFA 1FFYA 4DREA 3TOCA 1FP6A 3SGLA 4MYRA 1I2BA 2PGJA 5JI2E 5DOVA 3P96A 2BHTA 4UE3S 2IYNA 1GHTA 3KTAB 4CCAA 1RE1A 3WA7A 2HXSA 2C7PA 4EBFA 3F1LA 2BFDA 3LYHA 2CYBA 3ZJYA 4Y0NA 1K5PA 3CT6A 3OP1A 4QBTA 4CV2A 1GNPA 1RDFA 4KXMA 3KZNA 4UBLA 5F1YA 2O52A 4REQB 2XUPA 1XMOB 2OZLA 1P31A 1YIDA 2OB1A 1TAQA 1WDTA 4RK4A 5ED4A 2W2QA 2BSQA 3C7CB 1E9DA 1Q6YA 2IXFA 4X0EA 4HL6A 2V0GA 3TQSA 3LCRA 4H7JA 5MDHA 5T8KA 5CR9A 3JU3A 4U7HA 1E7YA 5IXYA 4BP8A 1FSSA 1TJPB 1NSYA 1PUXA 1GA1A 4WSOA 5CH8A 3THOA 3ZZTA 4NBUA 1JG1A 2VH1A 2X0KA 4IIXA 1DTWB 4P7FA 2J0VA 2DP4E 3CTPA 3HJCA 4BVEA 1D04A 1QOQB 1IPEA 2PYZA 4DBVO 4BFSA 1VHQA 1VPWA 4W5OA 5HKOA 5IZ4A 1WU7A 3TW8A 2XECA 1EUYA 1WETA 1UKVY 4CG0A 3DD1A 1GNSA 4TWBA 5AO9A 1FYVA 4ZT6A 4MS3A 3WGZA 4AF7A 2H7CA 3DAYA 1ES9A 3IR5A 5BYBA 3KLBA 3EC7A 3G9XA 4IILA 4DDWA 1OXUA 1GU7A 1NQXA 4Q47A 3WB2A 4DMCA 2CXOA 1XAHA 1YDMA 3Q9UA 1RHQA 1YUBA 3SX4A 1AK9A 1MB9A 1T5BA 1TTPB 2OWEA 3G5TA 2XZDA 4M22A 5KPJA 3UJ7A 5KNBH 2V3CC 3DC7A 3AINA 1WLYA 3IEUA 4H6WA 4LQ4A 4ZI7B 2XJ9A 1DC4A 1AV7A 2E85A 1EUZA 5HCNA 1LDNA 3T94A 4BJHB 2P5TB 4NY1A 3W5UA 1UMCA 3G79A 2Y6VA 1G1MA 3L0OA 3QVGB 4JVMA 5AVVA 5ISMA 3HBAA 1CR4A 1V16B 3NRJA 4MJ7A 3DM5A 1YK1A 3VUEA 3PC6A 1EFRD 4AURA 4PCLA 1R6DA 2W6ZA 4UDXX 1GUDA 4Q05A 4KZPA 2XXAA 1UBTS 3PVCA 2X1VA 3NJ4A 4H7PA 2WY2D 4FZJA 4BEVA 4C3OB 3I52A 1R0KA 1KP3A 1ONBA 3ECSA 4JQZA 4CIVA 3AY6A 3FE2A 1MEOA 1O94D 4KNWA 2ZJ4A 4ZDKA 3O2QB 1I94B 1FBTA 3M3HA 5JI3E 4I4NA 3NIFB 1Y89A 4KR7A 1QRRA 1M2NA 1U2RA 3TXAA 4TSRA 4ZO4A 4FSDA 4HUQA 4QOHA 1V5WA 5GPBA 4M1TA 4B5KA 3C3YA 1I1HA 3MUOA 1L8XA 3ELDA 3PXEA 3RM3A 3OQOA 1V5EA 4KV9A 1E9BA 1T4BA 4XZ3A 1EI9A 1L7OA 2VBFA 2F3UA 1ECBA 3GFOA 2CZGA 3UB2A 4MKFA 3QVJA 1GXSB 1NONA 1CQIA 1QAMA 2HU2A 3L01A 4NECA 1ZG3A 1ZNZA 3PCXA 3PE3A 3WO0A 3I6IA 5BSVA 2H7YA 1XZGA 5CT6A 1L3IA 2L69A 2ZJ0A 2DAPA 3IVAA 3PTZA 3TW0A 1OI2A 1XZBA 4RTMA 2ZJBA 3ZBPA 2Q0QA 2AR0A 2YKGA 1QC5B 1E0DA 1E6KA 4E6EA 4D79A 2JLYA 4OHVA 4ZRDA 3HB1A 2UV8A 3R0JA 2IYFA 4MS4B 4JVNA 5KCZA 3K4QA 5FHQA 1WKBA 4OQEA 5CEJA 3V4RA 3FPFA 5JQGF 3QPUA 3DXZA 4Z9YA 4AY6A 1WCIA 1HZZC 2DQ4A 4TXNA 4KFCA 3HUTA 5GADl 1RACA 3AFNA 3P9YA 4HMQA 1AC5A 2O3UA 2GXQA 3D2BA 1TM3E 3BF8A 221PA 2YWHA 3C3WA 2FEWB 3KYDB 1XTIA 5TPZD 2NM0A 1V2HE 3UTCA 1XD9A 1ZHHA 1O96A 3PR3A 3R6LA 2WF8A 4ZCIA 4BGDA 1P2SA 1WCXA 1EFVB 1EFLA 2EBWA 2VJDA 4FJ2A 2ZR9A 1O97C 4C7OB 5BN4B 1UK8A 1OWPA 2OHXA 3AR7A 1D2EA 3ET5A 1N9KA 5BNWA 1Z0UA 5CB4F 1ZGAA 1MO5A 3OO0A 2G7MC 2GCIA 1ZD1A 1S8NA 1LX7A 4L85A 2ONJA 3WK5A 2XRYA 4YAGA 5KOJA 4I5EA 4B75A 4ZREA 3PUJA 1A3CA 3UANA 3ZXSA 4DR7B 2OPHA 3JQ7A 3TMAA 2P9GA 4D74A 1IEXA 2OAEA 3D31A 4TSKA 5FOXA 1A76A 4J3FA 2RE8A 2I66A 1G9SA 1OREA 4LOJA 4YT2A 3EDCA 1C7FA 3GEHA 3FFAA 3R5KA 4BV3A 1WR8A 2OHIA 3FVQA 1FLDA 4EKEA 1XQ9A 2KX7A 2Q9AA 3LFUA 3KZ1E 1B42A 4E03A 3FJYA 4IJVA 3UMRA 3IMKA 1KVTA 2O8VA 1I1QB 3P20A 4G3XA 5AOBA 2C00A 3RV3A 1EVLA 1G5QA 1JWAB 1DE0A 3WTBA 1DDOA 2V5UA 3NVAA 3EZLA 4OU5A 5MN5A 3H17A 3HR8A 2GYYA 5TQ2B 3U37A 3IODA 2C4TA 4DMRA 3FCAA 4M1SA 3D4NA 5E1DA 3DF9A 4OGGA 4RZHA 1VG0B 3TBHA 4DJEC 2NO0A 1UOPA 4LRTB 3KAPA 5IVHA 3DV2A 4UW9A 4K9MA 5FBLB 3IKTA 1VOTA 1GAXA 2R5FA 4QGAA 4KGZA 4B17A 4A2CA 3G49A 4DV3B 2P27A 1L7MA 3BXEA 4YRIA 5FLYA 1Z0ZA 4ML3A 1DSSG 1JR3D 1USVA 2PRZA 2A5JA 4HAIA 1TZCA 4Y2GA 4G26A 2NX2A 3A4LA 4QUIA 3PQDA 1PFWA 2KYRA 4IOLA 3U3XA 1THTA 3RIXA 3TL3A 5BQ3A 2O8FB 2XWPA 1TF2A 1C7EA 3NANA 1U3VA 1XD2B 4IHJA 2ZOSA 1NW6A 4G56A 1UM9A 4TTRA 4J1TC 3TM4A 2JGNA 4HGRA 3PQ5A 3ZI4A 4ARBA 4E51A 4P0QB 2H1VA 1L5MA 4WXEA 3IQGX 3VNQA 1FNMA 4I2NA 1KR5A 5EE3A 4EJ0A 1KGDA 1WAMA 2QSZA 3D6AA 3EVCA 1TPYA 3T41A 3EFEA 3IDFA 4JYPA 2QPAA 1EX6A 2OG2A 2XRZA 1J42A 1W76A 2AFIB 3STXA 5BW8A 1DAEA 1HQDA 1SCUA 3GEIA 4MPRA 4RV4A 4XQEA 5KAMA 4H08A 4M1WA 4RLFA 4F8JA 1ZKDA 1T25A 3DDWA 4IINA 1LPSA 3R8XA 5KNBD 1SCKA 3C3XA 4V0KA 5EMMA 1U0GA 1XL1A 1P7VA 4GSKA 4EY4A 4TUYB 1J1UA 1U28A 4ZODA 1HV8A 4YDHB 3NXKA 1Y82A 1NF8A 3L1VA 5CYPA 5AVUA 1YI0A 4CIYA 1CPYA 3LLVA 2WVHA 1K06A 1N3BA 4EPVA 3C3DA 3OTQA 2Q3LA 4P54A 2ZYWX 3LP6A 2NZUG 3BDIA 3SC4A 3FM9A 5HIJA 2BFPA 3ACDA 2YH2A 3VPBA 4N3NA 4OHMA 5CM9C 2HLNA 4B82A 1IJBA 1O4WA 3K1ZA 2H00A 3VKFA 3RBAA 3IPAA 1H0SA 4OHOA 4DR3B 2J6CA 1SOUA 2VHZA 4KX3A 4YCMA 1L4NA 2MINA 1J00A 2PXHA 3DULA 2PUEA 2H4JA 2QM8A 1KBOA 4JHLA 4V0QA 1WBJB 5DGDA 2WAAA 3HSYA 2C2WA 4O8ZA 3K0KA 2FCRA 3PITA 4NAHA 1W0JA 3JS5A 3SXPA 5D6NA 5K4AA 4BQOA 2W2OA 2GD1O 2Q1SA 5KJEA 3UCXA 1NU8A 1XR3A 1YMQA 4EHNA 2RGGA 5AJUA 1IHUA 2R4UA 3L84A 2HRBA 1YQGA 3GW8A 3QLUC 2R87A 4BECA 3KQPA 2B4RO 3HKCB 4H3KB 1ZCAA 3UUGA 5J2UA 4UTNA 3GD7A 2B7BA 3BBLA 1GADO 2QE7A 3QBTA 3GPBA 1R0ZA 4X8HA 1V8ZA 2ORED 4AKHA 3L6EA 4NJEB 1B41A 4C3UA 1VE9A 1JLLA 1SQSA 4HV4A 2AOXA 2C20A 1E1LA 1JFTA 4M1MA 3G5UA 3C7KA 4E5VA 3AF5A 1L7BA 2GM5A 4X6YA 1ODSA 2A94A 3CF2A 3JD3A 2CE7A 3UW3A 1YB4A 3JAWB 1QFSA 3KIPA 3UOGA 2VPWA 2QNRA 4G86A 4P3NA 3C4JA 3RVNA 1LY1A 5DTQA 3LV8A 1TO2E 1AZSC 1U2EA 5HF6A 1T5DX 3KYCA 4X60A 5E1BA 5IYZF 1OTHA 3OFJA 2EZUA 2OKCA 4YRDA 1JLSA 1M6HA 2VP5A 2ODBA 3P0EA 3AB7A 3ZE0B 2JIMA 3D4BA 4BNMA 4PX9A 1XVUA 1JDVA 1AKRA 3IPRA 4BRZA 4FDUA 3TEJA 1YOVA 1ZIPA 3AK4A 4I1RA 4O4LB 3ZWPA 4EELA 3KD3A 1RHUA 2W5UA 4BMCA 4OUDA 1G6OA 1PT7A 1BDBA 1IZ0A 1XRQA 2CHGA 1QV9A 1YVEI 1YIOA 4YROA 2ZETA 2ZYAA 1DVRA 2YDXA 1TW3A 3BILA 1BRTA 1P61B 3KSDO 3M4YA 4FKZA 4GXNA 2BISA 3WIEA 3PXGA 3WMWA 3F98A 3GMTA 3I32A 4EVQA 4AWXA 5LQKA 3EQ8A 3C3CA 4A6EA 4YREA 3OWXA 4BLSA 1A9OA 4DLZA 4P86A 3D59A 5E7MA 4MQEA 1ECJA 1LBQA 1KXJA 1LU9A 2DHRA 2JCBA 3TLGA 3MTAA 3L7JA 3UGQA 5CRIA 4YFVA 1FK8A 3K94A 3SNKA 5C2JB 3CF4G 3E2MA 2ZRBA 2IYZA 1SN7A 1IEQA 3B52X 4HPJB 4Z53A 1FW8A 3VZCA 2AYZA 4KW7A 4D5EA 4U63A 3U7HB 3ANLA 2VAWA 4BGIA 4OKNA 1FFGA 1YCHA 1L5SA 3VV2A 5I6DA 3DR3A 1KSJA 4X1YA 4QUJA 5IM5A 1SIWA 1JR2A 1N5MA 1PJLA 2GA9A 2KBFA 3LW7A 4OI0A 1KDTA 4Y2JA 3F5QA 3IT1A 1HZZA 5EGSA 3OEWA 3OPYB 3I62A 1Z2NX 5F4BA 5LFAA 2QZ4A 2WU4A 2C7RA 1Z82A 1JB1A 3GRYA 4YJHA 5DYNA 2X0RA 1CIVA 3MJ4A 1XDSA 3BCHA 2XZOA 1M0SA 3ZXUB 5I9TA 1X2EA 3ZXXA 4YMLA 1X2BA 1JE1A 3JRWA 1EQ2A 1EE9A 1V8FA 3BIOA 3GVCA 1O0SA 2R68A 3MWDB 4IOMA 5CK5A 3PX2A 5PNTA 2PUWA 5TV2A 4C78A 4YFYA 1BCSA 4DN6A 3U4IA 4EO9A 1NDQA 3JSAA 3HACA 4B1FA 1YC5A 4RNDB 2GNAA 2W43A 1G3UA 3HJHA 4J16C 1GQYA 2IZOA 3J7TA 4X90A 4JP2A 4EAQA 1NHWA 2F8SA 3W8EA 2CFTA 4HN2A 4BMVA 2JJ1A 2GD2A 4MCIA 4CGYA 1H3EA 3DTVA 2O2EA 2IZ0A 3GCXA 2OHHA 3CH5A 3KDPA 1HWYA 3DXXA 5J9FA 4A0FA 5BT8A 8OHMA 3ZD8A 4XJSA 3G59A 3KO8A 3UUEA 2XTNA 3NDBB 3R9XA 1MVOA 2C88A 2KWIA 4MZXA 2QTRA 4DSAA 3DGFC 3RGWS 1SXHA 1N2JA 2WZBA 1SVWA 2CXXA 1T2NA 4L5JA 2BVNA 2VH2A 3OF2A 3QZUA 4BBPA 3W8DA 1A5BB 3FOZA 3GJTA 4CXMA 1DBVO 1KFEB 2DUUA 1FOEB 2WJAA 4GMKA 4LOLA 4BO0A 1KZYC 3EDOA 2PL9A 3ZBTA 2OR3A 3K6SA 1IY1A 3IKJA 2VXOA 4K86A 4DKJA 4PG5A 1AGXA 5ALPA 3VOTA 4EGAA 4CI9A 2PRSA 4ILEA 3ZHOA 3CONA 5LBIA 1HT1E 2QUKA 3WMGA 4FDTA 2IC5A 3DOFA 3KX2A 2IYLD 1IE3A 4F5ZA 3OE7D 4UNSA 5HCIA 1MENA 3M6LA 5KDOA 1OIVA 3ZIUA 1OE0A 4D3XA 2G8NA 2YV4A 3ZJ5A 2RAVA 1N5KA 1SU4A 4TL9A 3CO0S 2ABWA 2FWAA 2I3GA 4XJTA 3U56A 4Z0PA 1XPUA 2NV6A 4MVJI 2AZXA 1CEXA 1IATA 2PKRA 4P80A 4BQIA 3FZQA 4MGYR 4LZNA 4MUJA 1OX6A 4QUKA 1M5TA 1ORWA 2NVOA 1YOBA 5REQA 1P1CA 3QG1A 1QDUA 1KZHA 1QYDA 5AHKA 4US0R 2H1SA 2CUZA 1D2HA 2IPMA 4L4SA 4WJZA 3VOBA 1E96A 2NUPB 2EYUA 1E4YA 1P4RA 1J56A 4M9ZA 2VDWA 3HNPA 5EJ7A 3WKCA 1SB9A 4LJ6A 5TMEA 3JATB 2VJNA 5C8YA 2WUFA 3WGJA 3QXHA 5JSKA 4UPVA 1JKXA 4V0OA 5K6AC 4D8TA 2UUOA 4MWEA 3QFHA 3ZDAA 1AHHA 2HXYA 5KVQA 4WN9A 3QU9A 3UJ6A 3A3PA 3WOHA 1IAQA 4V3BA 4RXUA 1WBBA 2RG7A 4HJRA 3ZQ6A 3DW1X 5CW1A 1MGOA 1P91A 2BTQB 3OZVA 5IAGA 4X5OA 5JQGB 2AW3A 4Y67A 1LCIA 4O2AF 2ISQA 1VJCA 1VE3A 1BOOA 1MAUA 3SBDA 4A2PA 3REOA 1PDOA 4U1RA 4RTNA 4UZFA 5H7XA 4F86A 1YGPA 3KALA 3UXHA 3KHTA 3WXMA 4BCBA 1R4NB 1F4LA 1U6JA 4E07A 2Y9PB 3D1JA 5TARA 1CDDA 3TNDA 4X8LA 4AXBA 2VT2A 2B94A 1YTUA 4QXQA 4EJ2A 3EXHB 2A1UB 1NFQA 2RI6A 3B5JA 3QEMB 5LB4A 1JALA 3GJYA 3TAXA 5J5AA 4WK2B 3VTAA 4MW5A 3QBEA 4AICA 4C20A 2WSMA 1R0RE 2EJVA 3RS4A 4RZSA 3U5TA 2OAP1 4RSRA 4KACA 3NHKA 1Z18A 5IPFA 4KUEA 5CB4B 3WGKA 1S6YA 2YMPA 5K8LA 3RWBA 2IZ1A 3I09A 5ALXA 2MR6A 2VP4A 3EGXB 4B0PA 1DCKA 3UAYA 1EFDN 5DX1A 1QE0A 4RHXA 5IWAB 4MDEA 1KQ3A 4OI1A 1FL9A 1NI4A 3NHJA 5BVHB 4HY3A 4NBVA 4EO7A 2H5IA 4FWBA 1Z0DA 2C2XA 1EP3B 1XG5A 5HNKA 5JCXA 2XF2A 1Y8CA 4FBMA 2F67A 3O91A 3OTGA 3DDUA 1JGTA 4LQDA 2D2IA 5DJ5A 1N57A 4HGNA 1M5UA 2R0QC 1ZH6A 1EUCB 3MUEA 2EKLA 4PICA 5JWRA 5KNDH 2AT1A 5EXTA 4B6GA 1F48A 4J7XA 4N41A 2LW7A 2FUG6 2H4YA 4IYRA 1GTMA 4G5HA 5DNDA 1OWMA 1RQXA 1RW4A 2HLDD 5B1YA 2WYIA 3PPYA 4TT8A 1U99A 4W5JA 3FWNA 4YUYA 1P80A 5EHIA 3RBZA 3VO8A 5LD2C 3IUBA 3AO0B 1C7IA 2P4SA 1N6NA 4LJ9A 5F77A 5LBTA 3AZOA 3QBJA 4NU0A 5JS2A 1E0AA 5ILOA 5DRTA 3K0CC 3UAZA 1K8RA 3RRMA 3W2EA 3PJFA 3O9ZA 4CIBA 1UJBA 3G68A 2G0AA 3OZFA 5EEHA 1M83A 2B2XA 3GBPA 3A6DA 3FOEC 1J8VA 2W11A 3VSCA 1TMYA 1K89A 1U2ZA 2HIHA 2HMYB 2ZIVB 3KFLA 1A2BA 1V9SA 1T9CA 1Z12A 3OFSA 2QP9X 2QUAA 4PV7A 2ECQA 1UT8A 3O7WA 2YIVX 1JAXA 1AUQA 2HSGA 3T9EA 5TRTA 1NRJB 1F8UA 1I0ZA 4TMZA 5H59A 3IP7A 3PEVA 2QR5A 1FUKA 1TADA 2NQ8A 2PD4A 2ZJAA 1VTKA 4HADA 3U26A 3NPAA 3I5XA 4MQFB 4UOQA 2VDMB 1R1DA 1KI8A 5A3SA 4BNKA 3VKGA 4WZBA 3CRW1 4Z0HO 2GZRA 2PMWB 3K20A 1QGUB 4HDSA 4KLAA 4X3CA 2YXDA 5AVTA 4F2HA 3KT6A 4JKOA 1EKXA 3BWEA 1U8CB 2J3HA 1NR1A 2QRVA 2EAUA 2PKEA 4WKGA 3PGMA 2EX4A 1AIPA 3K7EA 3O4GA 1VA4A 1JU4A 3O84A 4LRSB 5GGYA 4DJTA 2V1UA 1N5DA 1Z26A 3OC6A 4H6VA 3ZWXA 1YQDA 1RJWA 1DINA 1T36B 2NT4A 3AUSA 3WLAA 4L7VA 7REQA 3L4SO 4RKFA 4TLMB 1E6CA 1M74A 3WG9A 4JN6B 3TFWA 3JARA 1NQVA 4L5IA 3T7DA 2XAUA 3G1WA 1XCJA 3B1JA 3N58A 2AG5A 2B2CA 4FFNA 1USWA 4OIFA 4X54A 3W77A 5DMXA 3ZS8A 1NTRA 4W5NA 4QO8A 1KY3A 2EJWA 1OI3A 4OQLA 3T5AA 5FTWA 3OT1A 1FLNA 4G0PA 3P8ZA 5I3CA 1WUHS 4GP9A 1XJCA 3WC4A 5L4NA 3ZIAD 3QLVA 2ZI4A 3O3OB 1M8KA 1T2UA 4L3VA 1YJAA 4GDFA 3QKRA 5FWYA 4Q03A 4RF5A 3I5UA 3V1TC 1JZTA 1N7IA 1VCHA 3CUEF 3PYLA 4ZHQF 1NVXQ 3CC8A 4HAXA 4JSRA 3PTAA 2DSTA 3QX9A 1P72A 1XVTA 4J0FA 4NS1A 1G6Q1 3DKKA 4U2KA 3SFZA 1EVJA 1CP2A 1ORVA 1QGDA 3P0JA 5IDYA 3U4AA 1JYSA 4BZZA 1F4VA 2QMQA 4J0JA 1JG4A 5CLIA 1KDZA 4AO7A 2VUIB 1UC5B 4HP8A 5CIQA 2X5OA 1PL6A 2IYQA 4HEQA 4MQBA 4DXHA 3V32A 4HO1X 3S8EA 3GJ5A 1JEJA 3HWWA 1C9MA 1BKSB 3H9JA 2AUNA 3B6KA 3HJUA 4TMYA 4L8LA 1DG1G 5CITA 3KYBA 2V3VA 2B36A 2ZYIA 2AXQA 3PKZA 4JROA 4YCCA 2UYGA 3GO4A 4IDPA 1WX1A 1XNHA 5BW6B 3BFKA 4DM3A 1E62A 4JZKA 1POWA 3OJLA 1KO4A 1EG7A 4M83A 1ULBA 1Z62A 3K4HA 3NHRA 4RA9B 1ISSA 1SCDA 1E5XA 4I4IA 3VH1A 1UAGA 4XSGA 2ZIFA 4B2YA 2EP7A 3TLJA 1I2ZA 1U02A 5IYZB 1HK7A 3BGSA 2IS1A 1V0JA 1F8YA 2DVMA 1OTYA 3VYSB 4MVJM 1V1MA 5IJAA 1XTVA 3GZNB 3IV9A 1TIBA 3UICA 1R10A 2PMCA 2JLZA 3BQ9A 5TF4A 4M7PA 3KQWA 2CWDA 3AERB 5FWDA 1E0SA 3LIIA 3ZWCA 1WDLA 2ZS8A 3EMVA 4R1PA 5IT5A 2FSPA 4F6LA 4R3NA 2RK6A 2QTVB 3HWX1 3QYJA 3RTGA 4YS6A 2P8JA 2IYWA 3DZJA 3O83A 3RRZA 1P0QA 1DI0A 1L3CA 1CD5A 3RWOA 2RKOA 4MUIA 2H2HA 2ZATA 1AY0A 5F78A 1ESEA 3E1SA 1JIKA 1X38A 1SVSA 2P2NA 5CU7A 1OZAA 5CXQA 5KNDD 1WG8A 1HLGA 1C0LA 1IQRA 2C9DA 2P90A 3KD2A 5F1PA 2ERCA 3HP7A 1N9ZA 4ZYYA 4EPWA 3RUHA 1DEAA 1J8MF 3G5LA 1JVBA 5EOVA 2IU3A 4H1VA 4MPTA 1II9A 5KWJA 1AA6A 4Q4HB 5DSTA 3UW1A 3NDIA 4D4KA 2ZTLA 3K0FB 2QUIA 4HCJA 3V3TA 4W8HA 7ABPA 4TZKA 4OP3A 4R2XA 4AW9A 3H7IA 3BK1A 1DC5A 3OQHA 1ZN9A 4R8LA 3PHIA 5C51B 4FB4A 1TA0A 4JLBA 1Z35A 3QPCA 4IDBA 4NCNA 4NPHA 3QEKA 4DBLE 4PX2A 5KJFA 1G21E 3ZPXA 2BFNA 3HVKA 3EEBA 4FFLA 1C0IA 4ACAA 5FOUA 4K0RA 5T4FA 5T3UA 5FUMA 2Y4NA 1YD7A 1WV0A 5CYGA 1W0KA 3ICVA 1SC9A 2JAUA 2X2OA 4O4IF 4ZWNA 2I9KA 2Q5QA 5FWXA 5FOTA 3H8JA 1YZQA 4KWEA 4GWLA 1E1YA 3O8QB 4L50A 2EWMA 2HK7A 3O03A 2O1SA 1UKYA 3AG5A 4BFVA 1FFXB 3E61A 2I3DA 2XCTB 2QZJA 2TMGA 3TWOA 1H6DA 1JQ5A 3IIMA 4RK5A 1G59A 3TTTA 2RG1A 5AVWA 1W9MA 2OBFA 1Y4AE 3NI2A 4B09A 4D3SA 3F78A 4U4AA 2XYQA 4BC1A 3FXAA 4X65B 4OXXA 4HDAA 4G85A 1IPFA 4JSYA 2BGTA 1EFCA 2AOTA 2IRWA 3B9BA 1TTQB 1NC3A 2AOUA 2WFMA 4RZQA 1F3OA 4IDFA 1M6NA 1X7WA 1QBGA 3KUKA 3L7DA 4PQEA 4CM7A 2ZUCA 3A11A 3DFKA 3KXIA 3Q9NA 4KGDA 1T5OA 4LJLA 1CKEA 4QODA 1W4BA 5AK6A 1O03A 4RGQA 1JFFB 1FQJA 3TECE 4CG1A 3CVYA 3A6JA 1UAYA 1XNRB 3MVEA 3FCXA 1G17A 1PW5A 5CA0A 3NIDB 3FUWA 3IEKA 1KGSA 1NM5C 3OCWA 2AEMA 1BWPA 3CUSA 1LGYA 3QMWA 3FZEA 3B7PA 1E8MA 5B7QA 2OP0A 3HXPA 4H0FA 5F73A 1QRUA 3ULKA 3Q6IA 1HYEA 2ID8A 2Y3IA 3TQIA 3VKHA 2AK3A 2PN1A 3BIFA 4M4SA 4A82A 1M3SA 1RP7A 1C4OA 2Y27A 3GQBA 4Q4JA 3DDOA 3K9HA 1DWOA 2XLCA 3CN9A 1UJ5A 1X80B 1MAAA 3BUSA 2Z9CA 1A8IA 1JT9A 1M8JA 6PFKA 2A1IA 3G17A 4RK7A 5DHSA 5DZSA 2P6UA 1QR2A 3DCYA 2QR2A 4LCJA 1KDPA 1PFKA 4XGKA 2AKEA