1PL8A

Human sdh/nad+ complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
356
structure length
356
Chain Sequence
AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords human sorbitol dehydrogenase
publication title X-ray crystallographic and kinetic studies of human sorbitol dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 121
structure length 356
sequence length 356
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.14: L-iditol 2-dehydrogenase.
pdb deposition date 2003-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pl8A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1pl8A01
5T8KA 4GPD1 4BNLA 2PGDA 1XEAA 3I52A 1YBMA 3F1LA 3HJAA 2Q4BA 4ZU3A 5F21A 1KYQA 1JWAB 1HDZA 2P9CA 3AU9A 5TSDA 3ETDA 3ZW9A 1EQ2A 3JQ7B 2CZCA 3ZV4A 4DRYA 4R9RA 4Q9NA 4ZJUA 2Q2QA 5DCUA 1QYXA 3Q11A 4N54A 1YL5A 2GZ1A 5AVOA 1DBVO 2J6IA 4MVJP 1JA9A 3Q2KA 5DBGA 1PQPA 3CZMA 5EESA 1DO8A 2A9FA 1QORA 1UZNA 3NV9A 3EHEA 2HMVA 3TN7A 3F5QA 1LI4A 1DHRA 4MJLA 1C14A 3JQCA 3HN7A 4ZN6A 1XCBA 5JNLA 2X4GA 4R51A 2D1YA 2PZLA 4L4SA 3AUAA 3EY4A 1ONPA 2HK9A 2IDZA 1H5QA 2YHUA 1PU2A 4OOFA 3GNQA 1VI2A 3DTYA 3B70A 4CMHA 3AJRA 1CETA 2QYTA 4K9DA 1FXSA 1ADCA 2QG4A 1YXMA 4PLTA 3TJRA 5C37A 5BSEA 1LA2A 3TRIA 5ICMA 3NDJA 3EZYA 3MJTA 4PRKA 2AQIA 4YVFA 4DGSA 1JAXA 1LDNA 1LC0A 4IIUA 2O7SA 1ID1A 1KVUA 1A72A 1OC4A 3WTBA 1GCUA 4BB6A 1IE3A 3F47A 3WLFA 3WMWA 2FWMX 1NPTO 3HSKA 3D4PA 3WIDA 4DC1A 3JQ7A 1XG5A 3H8VA 3GMSA 3E03A 2UDPA 1A71A 2BF7A 1R16A 4IS3A 1MXFA 1ZVMA 2EHDA 3KB6A 4DIOA 4R9SA 4BNWA 1X13A 3B6ZA 5JAQA 3ZU4A 2DPGA 5KVSA 5KVQA 2CDCA 3MTJA 1HXHA 2JAHA 3AY6A 4YR9A 2P9EA 1GEGA 1DFGA 4Y6PA 1R15A 2AXQA 2FPPA 1PGQA 1NBOA 4ALNA 3I9LA 1PJSA 3DZHA 4BNGA 5A3VA 5L7TA 4XEHA 4YBZA 1YOVB 5JCJA 2AMFA 3MJSA 4WCFB 4LSWA 2NU9A 3D3WB 1MFPA 1HDOA 4BNKA 3PJDA 4PLGA 3QWAA 3I4CA 1T2DA 3WYEA 1Z73A 3OBBA 3QQPA 3PWSA 4R1NA 4Q3EA 1T2CA 5ADHA 4R01A 3NT4A 5ITWA 3GQVA 4CM7A 3F1KA 3KZVA 1WMAA 2FR0A 3JD1A 4URFA 1Y7TA 4DQXA 1HSZA 1M76A 1AHHA 2VT3A 1T4DA 4E5YA 3SXPA 2ZQYA 3TQHA 4LMPA 1UXIA 1ZJYA 1GTMA 4CLRB 1NWCA 3SVTA 4G2NA 1LRLA 3E9QA 2BGLA 1FK8A 1PS0A 2WYWA 1M6HA 2BI8A 2J5KA 3GC6A 1QG6A 4Q39A 3ZNQA 2JJYA 2EXXA 4D7AA 2B37A 4D3SA 5CDTA 3ZW8A 4QT0A 1XYGA 3VVCA 3C24A 1F0YA 2PV7A 3PYMA 3R3SA 2BKAA 3ASUA 4Q3AA 4CR6A 2C82A 2PGLA 4WEOA 2Q45A 2E4AA 3R1IA 4FS3A 3UUWA 1YH3A 2GZ3A 3E5RA 3GLQA 2PGJA 3GK3A 2I5PO 2JFGA 5JXWA 5IN5A 1JKIA 3G1TA 1P44A 2BH9A 1YOVA 2NTVA 4BNXA 1Y5RA 4WCFA 5U4QA 3D3WA 3ZWOA 3DXFA 1GU7A 5IZ4A 2PZJA 1ZK3A 2EJVA 4NPCA 1DIHA 1G6KA 1LU9A 2NVBA 4TVOA 5C7IO 5CG1A 3OJEA 4B4VA 1UP6A 3GDOA 1C0LA 4MP3A 4XRRA 3GG9A 2O4UX 3RUDA 4IXTA 2GPTA 3BYZA 3GAZA 1OFGA 4OL9A 5JAIA 4NK5A 2OOSA 3LT0A 2O7QA 3HUDA 3M2PA 1C0KA 1E3IA 1QR6A 4DTIA 2EF1A 4L0QA 4BO0A 2GASA 1DIAA 3WGQA 2WDZA 1O5IA 1IUKA 1O6ZA 1U9JA 3VDRA 2B5WA 1K6IA 2CY0A 2VHZA 4XCVA 3GHHA 4FFRA 4XGIA 1BXZA 1M6WA 3ZWVA 2FHSA 1TT7A 3GN1A 1MC5A 1YBVA 5F1PA 1NR1A 1C1XB 1GD1O 4CM9A 1U1IA 3WXBA 2DQ4A 1EZ4A 3ZZNA 3WLEA 3NRCA 3GMDA 3I1JA 3K8ZA 3QWBA 4PLZA 9LDBA 2CFCA 1TI7A 3EVNA 4K6CA 3WJAA 4DBVO 3CINA 1ZEJA 3AW9A 3WNVA 2ZB8A 1PJBA 2PKQO 3S2IA 2R00A 3ZNNA 3LT4A 1ZZEA 1ZCJA 5IZCC 1BRMA 1A9ZA 3OM9A 1GZ3A 4BMNA 3MZ0A 3RWBA 1XA0A 5COBA 2HJSA 1I2CA 2AEFA 2Y1DA 3GRKA 4AJLA 1ORRA 3MCVA 5K6AC 3I9OA 1HZJA 2CDBA 4BNJA 4O0LA 5A3JA 2LDBA 3KYDA 4HNGA 2X58A 3RROA 3ZWPA 3BTOA 4L75A 5L51A 5A4DA 1NTOA 1U28A 3Q6IA 3HWRA 3VH4A 3VH1A 1PGOA 2D4AA 1DFIA 3GVCA 2NTNA 5L7WA 2H6EA 4H15A 2BFPA 1PTJA 4IJKA 2OHXA 1PL6A 3EMKA 4XQ9A 2X5JO 3DO5A 1F8GA 4QEDA 4J7CA 4DUPA 2XXJA 3WQRA 4PG4A 3RC9A 5I9LA 4XYEA 2Q1WA 4Q3DA 2DFDA 1HE4A 1A7KA 2E49A 4IMRA 1HYEA 4NJMB 1AUPA 5JY1A 4BO9A 3ORFA 2UV8A 4YJFB 1GY8A 3B1JA 1HWYA 5BSFA 2CF6A 4BGIA 3E48A 4MDHA 1QRRA 1C1XA 2Q1SA 1XIVA 2X23A 2PA3A 4FFMA 1PS8A 2J3HA 1NVGA 4GX0A 2GO1A 1WPQA 1S6YA 1VL0A 4CLXA 4MVJF 4FOOA 3QY9A 5TS3A 4W4TA 3WQQA 5IXSA 3DB2A 5F1OA 1N8KA 3BTUA 3A4VA 4OSOA 1MUUA 4F6LA 2Q1TA 4GWGA 5BNFA 2ZJ1A 2DC1A 2VHYA 3GPIA 3V2HA 1I3LA 1UP7A 4BNHA 3MOGA 4MINA 2P5YA 2Y67A 4YT2A 4RQTA 4B7CA 3W4JA 3VZRA 4CMEC 3GZNB 5CEFA 1W0CA 2TMDA 2EEZA 4FQ8A 4OM8A 4BNYA 4WJZA 4AICA 1RPNA 3SLGA 2AQHA 1NFQA 1H93A 2WE8A 4PLFA 1B0AA 4J9VA 3DHYA 4R4JA 3B1KA 1LSUA 4L4XA 1V0JA 4Z9XA 1MXHA 1NAHA 1YDEA 3IP3A 2PWZA 4BKQA 4CV1A 2RAFA 4XJSA 3P2YA 5IDQA 3TZCA 1QSGA 3WGTA 4IJWA 3SX2A 3I9NA 4XD2A 5EMHA 4L4RA 1V9LA 3E9NA 4JROA 4L74A 4ZICA 4H16A 2X86A 1R66A 1JLLA 3NTRA 4NJMA 4GLLA 4WLEA 4EEXA 3CUKA 4ONEA 2DUWA 4YJFA 3DZBA 3WMXA 2QZZA 1J49A 1LC3A 2HQ1A 5A5FA 4UUPA 4M87A 3Q9UA 2Y05A 1O8CA 3PJEA 3W1VA 1UXGA 2VRCD 3OP4A 2IXAA 2Y1GA 5HWSA 5JE8A 3KSZO 4AJJA 5IFLA 5U9CA 3UCXA 2CD9A 3VKUA 1CF2O 1ULSA 3WGOA 3AUTA 4AVYA 3QW2A 4JBGA 4O1MA 3GZNA 1I01A 1RKXA 3E5MA 4AJ2A 2DM6A 3K9QO 3HFSA 1IHYA 2ZTVA 5CPFA 2V7PA 3AI1A 1KVTA 5JO0A 4C7JA 5KOIA 1EBUA 3CTMA 4CMCA 4FCCA 3WWYA 1DC6A 4NHEA 3BTVA 4XQCA 1JDJA 4OKIA 3DZJA 4PLYA 4CL3A 3GEDA 4ND5A 4TRJA 5JYDA 2BHLA 4AJKA 1SCUA 3KTDA 1LJ8A 2YFQA 5EL0A 1FDSA 1P31A 1ISIA 1KVSA 1E6UA 3U4HA 4DIBA 2C59A 4ALMA 4AJEA 1IOLA 1NYTA 1PZHA 5DDIP 1V8BA 3UCFA 3JYQA 1TB4A 2AEJA 4K26A 3AOGA 4A2CA 5TNXA 1LQUA 3KSUA 4YDRA 2P9GA 2Q2WA 2VYVD 1U5CA 1ZSYA 1NAIA 3QSGA 1BMDA 2VHVA 4J3FA 4W7IA 3AFNA 3QHAA 3GF4A 3O03A 4HXYA 4CMAA 5CDYA 1WNTA 3Q3CA 1JVSA 5JDCC 3WGZA 1RYDA 4P8RA 1O94A 3DHNA 1WW8A 5GZ3A 4TKLA 1ENYA 1VLLA 1UJMA 2QW8A 4CLDA 1MA0A 2VYNA 1TLTA 3DOCA 3NGXA 3PIDA 3QVTA 4IDEA 4PG6A 4YJHB 3PZBA 4U8GA 2HK8A 2X1HA 3P5SA 2EGHA 2OP1A 3OQBA 1C3VA 2ZIZA 3FR8A 2HAEA 3ROKA 1SEVA 1DFHA 4MVJI 3RBZA 4CM6A 2CNBA 3PZRA 4ND4A 3MJVA 5KJ1A 3U9LA 1IL0A 3PHIA 1GUFA 1R4NA 2Q4EA 1VL8A 4DWVA 1HZZA 2IEDA 1OAAA 4JNKA 1ZXLA 2OO5A 4UVIA 1M66A 3U62A 4RF2A 1D1SA 4OAQA 3EUWA 5ICSA 1IULA 4GI2A 1IHXA 2QX7A 1EK5A 3BTSA 3OJ0A 4O63O 1GFSA 4L76A 1E1LA 2YQ4A 4RF4A 1U7TA 5BNTA 3H3FA 2PH3A 1Z7EA 3F4LA 4ALJA 4XZ3A 2A4KA 1N7HA 4WUVA 5G0TA 1KC3A 1PSDA 4DXHA 4E33A 4E5MA 4PCVA 1VRWA 5IN4A 3AM3A 4DMMA 5JAZA 2X9GA 3KO8A 1N5DA 4MP6A 2I6TA 2PTGA 1EQUA 3OH8A 4FN4A 4GWKA 4AJIA 1WLYA 2IEBA 1C0PA 2G76A 1P1IA 1UDAA 4FD3A 1KY5A 1Q2XA 4R54A 3TDKA 3V5NA 1M2WA 1U4SA 4R68A 3UGKA 4GGOA 5I7VA 1YB1A 5ILGA 4IDDA 4YA6A 4JX8A 4CM4B 3WBBA 2JD2A 1MV8A 1L7DA 1NASA 3COSA 4YJDA 1R6DA 2UUPA 1YO6A 2X8LA 3WDSA 5L95A 1PJQA 4HUJA 4MVJD 1LDGA 3JQDA 1MG5A 4J7XA 3RVDA 4YB8A 3VC7A 1D4FA 4NNJA 1GDHA 2DVMA 1E77A 3F46A 4N18A 4RORA 2AQKA 3K30A 1XELA 4CMJA 4EYEA 2GUGA 5TT1A 3LLSA 3H7AA 4M89A 3GVIA 3CZRA 2A94A 1L7EA 1LRKA 4HFRA 3VOSA 4NU5A 3GZ4A 2JFFA 4GX2A 3L07A 1O95A 2HRZA 1A9YA 1E7YA 5KKCA 2PFGA 4XDYA 3JD2A 3VHRA 3I9MA 3A14A 3ZWYA 4A26A 3G3EA 4M1QA 4GKBA 1ZK4A 5JLAA 4TSKA 3KETA 5DT9A 2XOXA 1KBZA 1U3UA 2AHRA 1YJQA 4FFLA 4I9HA 1PGNA 4IQ0A 5TRTA 3T4EA 3GVHA 2W90A 2AEMA 3ZDFA 3WFJA 2OBNA 4PZDA 2H63A 3EYWA 4B79A 1A5ZA 1FF9A 3E6AA 4E12A 1ZK1A 5AQ1A 2CVZA 1ZSNA 3ZV6A 2Q99A 1ONNA 5CG2A 5TJ9A 4MKZA 1T24A 1SOWA 5L9AA 2A35A 4TZKA 4CM4A 3C85A 1D8AA 1GPDG 3TWOA 1GAEO 2VWQA 4U7WA 1JKFA 3T4XA 4IDBA 2YV2A 4RZIA 3OQ1A 1D1TA 3W4KA 1PX0A 2WJPA 1BXKA 2C20A 4D79A 1R0KA 3M2TA 5FI3A 3RFVA 3RUCA 3QIVA 2JL1A 4BO4A 4JLWA 3AI3A 2DBQA 4I1IA 3BMQB 1KOLA 4UVEA 4E2ZA 3VTFA 5CFZA 3KLMX 1UR5A 4G81A 4R3WA 1Y8RB 4X54A 2Y1EA 1XDWA 3VVBA 2DKNA 4R16A 1ADFA 1KEPA 2GN9A 3PI7A 3PDUA 4P4NA 1HLPA 3P2OA 2Q3EA 1M75A 4C4OA 3GY0A 4NBVA 3E9MA 3KLPX 1WDKA 4U5QA 5KJCA 1RM5A 5KVVA 3ROMA 1YJ8A 3UCEA 4AJ1A 5IZCA 2J3KA 2H9IA 3PEFA 2H1SA 3QWIA 5GMOA 1DEHA 1J4AA 1OMOA 2O23A 1U8FO 4ZQBA 1EBFA 3BAZA 5K6AA 1CEQA 4HADA 1U8XX 1DLIA 4HX5A 4PVCA 4XWYA 3F5SA 3GAFA 4YAEA 4BNFA 4BV8A 4J1QA 4B8WA 4DLAA 2NM0A 2I99A 3FNEA 4RVFA 2HK7A 4DBZA 2POQX 2WEKA 1Q7GA 2O4CA 2YHIB 5I8WA 3RIHA 4ZA2A 2GLXA 4CLHA 9LDTA 1I2BA 1YDWA 3IDSA 3WNQA 5KNLA 5HS6A 5DNAA 4R3NA 3IJRA 5A1TA 3ZHXA 4PN3A 3UW3A 1ZW1A 1PJCA 2FOIA 1MC4A 3W6ZA 2IE0A 2PZKA 4DLLA 4FFNA 1ULUA 1H6AA 2DAPA 1V3TA 2HMUA 1JKJA 3GG2A 3LC7O 3Q2IA 4Z3KA 3I6QA 1T1RA 3OHSX 4TKMA 4OXYA 3HDYA 3H2SA 3H6KA 3ULKA 5BR7A 1U2GA 3ADPA 4UVDA 1VJTA 3PYLA 1DAPA 3BMQA 5G4LA 3FR7A 3NDRA 3ZH2A 4NFHA 2BFAA 3QVSA 3VAZA 1Y8RA 3KVOA 5CAEA 4J1SA 2YJZA 3Q9NA 4IY1A 3ZN2A 5A5EA 4JGBA 1PQWA 4BO1A 1HT0A 5COAA 2BELA 2NVUA 2YZ7A 4A03A 3M1LA 4CQMD 4PG8A 4EDFA 1YBAA 2G5CA 5IDWA 3RC7A 1YB5A 3PQDA 4WCDA 1RM3A 2AE2A 1NR7A 5TGDA 4J1TA 3H2ZA 5G0SA 3IP1A 3UAGA 2IODA 2JD1A 3OMLA 4D43A 4CMEA 3HHPA 4NBTA 1Z82A 1QKIA 4KQWA 1G0NA 4J4BA 1LLUA 3KSDO 1NM5A 4J2OA 4LRTB 2HKIA 2NLOA 4I5GA 2I3AA 4XX0A 4L9RA 2I3GA 4OYRA 3WR5A 3PIIA 3JYNA 1GZ6A 4BQPA 2O3TA 2YHIA 3JTMA 2ZYDA 4I5EA 4IDGA 5EJ2A 3JQBC 4NH4A 2I66A 2OMEA 3LK7A 4UUOA 1LSSA 3D64A 5KVCA 1UXJA 5ENDA 4NQZA 3H9QA 1Q0HA 4TZTA 1HDRA 1Z74A 5HBRA 1NPDA 2PR2A 4BKPA 5I9NA 3PWKA 1NQ5A 4U0KA 4D45A 3QWHA 2DTDA 2QRKA 3HNPA 2B4QA 4IGEA 2AE1A 3F9IA 2ZYAA 4GVLA 1O0SA 2G1UA 2QRJA 3H5NA 5IAAA 4WLVA 3D5TA 3B20A 5TIIA 1QLJA 1BW9A 3Q0EA 4IIVA 4BQRA 3R6DA 5G4KB 5TQVA 5EQDA 4IINA 2VNAA 4DLBA 1GV1A 3HDJA 2BRUA 1X14A 3INGA 2CF5A 1U3VA 4ITUA 4ND2A 3LT2A 3AI2A 3DBHA 4P38A 4JCOA 1QYCA 3SJUA 2Z5LA 1ZH8A 2EP7A 2W2LD 1N2SA 3JQAD 4M49A 1KEVA 3PQFA 3FTPA 1ISFA 4XA8A 4YAGA 2X0JA 1AHIA 3FN4A 3NEPX 4IS2A 3SJ7A 1BSVA 4GBJA 4R1SA 3PGXA 3N7UA 1DIRA 5H83A 5DP2A 4MPDA 2P68A 3ASVA 1LX6A 1R4MB 3DTTA 1HSOA 2VNSA 1PL7A 3OA2A 2VWHA 4EUFA 3S2EA 2BD0A 2DBZA 2CMDA 3UOGA 4YAIA 5A05A 2ZKLA 3KUXA 1E3JA 1NQAO 3GGOA 4HP8A 4UAGA 3MTGA 3VPFA 1MB4A 3I3OA 3KYDB 2XXBA 3RASA 1QYDA 3SBOA 3SEFA 1NP3A 2JD0A 2EW8A 2AG8A 5LDGA 2VZ9A 1VM6A 4FSHA 3WQSB 4TRRA 2WD7B 4YQZA 3WS7A 2FR1A 5I7FA 1P0FA 4NBUA 2GN6A 4HY3A 3DMYA 3PDJA 1PZFA 7MDHA 1NQTA 3RBVA 3UN1A 5G4KA 1I3KA 3S55A 4D44A 4LCJA 4M54A 2DTEA 1B15A 3L4SO 4U6QA 1HE2A 1H94A 5GZ1A 4YJGB 5HM8A 1F12A 4CR8A 2FZEA 3HB5X 2WMDA 3IOYA 2VWPA 4C7KA 2PNFA 2D3TA 4IMPA 3N58A 1HRDA 1Q7CA 1V6AA 3AFMA 4LK3A 4JP3A 1UUFA 4BNTA 5JDCA 3DZGA 4GLOA 4N5MA 4RL6A 4PLPA 3RUEA 4E3ZA 2DBVO 2G0TA 2X6TA 4Z9FA 3C3XA 3WTCA 1UP4A 3FD8A 4UUMA 3QA9A 1N9GB 5KJ6A 1HDYA 4Y8VA 2QHXA 3WGYA 1SC6A 2HSDA 2Q46A 1H0KA 5EQFA 1R4MA 1UAGA 3ROQA 2PY6A 4ZGWA 1DJQA 3G0OA 3WYCA 4E32A 1HEUA 1EVYA 5C5IA 3JD3A 5EERA 3DFZA 4KUGA 4LN1A 3G17A 3TL3A 5I7EA 3RUHA 1IZ9A 1HDXA 3HE3A 2DPHA 3TOZA 2NV6A 4ROSA 4JJFA 4YCAA 4YRAA 3DZIA 5THKA 5L45A 2O50A 2Y1CA 2EKQA 1I8TA 4QFDA 3ZHZA 5A9RA 1E3EA 1BVUA 2ZJ0A 1DB3A 5A9TA 5B4VA 1ZXBA 3ST7A 1JW9B 3ZWBA 2C07A 2WD7A 1XHLA 1PL8A 2X9VA 3ICPA 3HB4X 4CMGA 3GFGA 3NDIA 2VRCA 2F1KA 2W2KB 3RU7A 5F5LA 5JYEA 5EN4A 3ZWNA 4XYGA 3ANLA 4XR4A 3IQDB 1E0DA 3U4IA 4NU6A 2ZQZA 4W9NC 4AJOA 5IDXA 3RJ5A 4YJGA 1NNUA 1W73A 4KDFA 4BV9A 1LSOA 1ZEMA 2EKPA 2P4HX 3LF1A 3P7MA 1LDBA 3CEAA 2V6FA 4KTTE 4FC6A 1YQGA 4BOYA 5HS4A 1NVMB 4OJNA 3D5QA 3E8XA 2AA3A 5IJZA 1N9GA 1RJWA 2P91A 4B4WA 4J0EA 5DBIA 3GA0A 4XYLA 2NSDA 4DPMA 1N1GA 1I24A 5EIOA 2VQ3A 1LTHR 4Y67A 3WOHA 4BO2A 1JN0A 2FP4A 3V1UA 1T4BA 1EFLA 1PJTA 3O4RA 4GSLA 4BNMA 4CV2A 4DREA 5B4UA 2VHWA 2I67A 4XYMA 4BNVA 3C7DB 4CM8B 1HDCA 3P19A 1GL3A 2VYVA 1BTOA 3L0DA 5DOZA 4TMFA 1NVTA 3OFSA 3PHJA 1P9LA 5FI5A 2IXBA 2DTXA 2FY8A 1ENOA 1SAYA 3I4FA 3ICCA 2W2KA 4P4GA 1A7AA 3A9WA 1JVBA 4FFOA 2FSSA 1GYPA 4E30A 3ETEA 2G82A 3KOUA 4A73A 5BT9A 1X0XA 4YWJA 5JW6A 3CSDA 1V3VA 2GN4A 5U1PA 2HMWA 5JC1A 3UVEA 1OBFO 1IPFA 1YKFA 4E4YA 2PD4A 1ZJZA 2HDHA 2VTEA 4RF3A 4EGFA 4I9NA 4WE3A 1ZSVA 1PZGA 4FW8A 3O38A 4BKRA 1EK6A 4EJ0A 3GPDG 1M67A 5DULA 3L6EA 2PD3A 3FTNA 3V2UA 1XWFA 1PR3A 5BQFA 3PLNA 4UEKA 1ENZA 4E2YA 3S2FA 5K1SA 3FRJA 3AY7A 4IQ8A 1CIVA 2IZ0A 5H81A 4D42A 2Z1MA 5DN9A 3NTOA 1CRWG 2JHGA 3GDFA 1PJ2A 3PP8A 1OOEA 4PLWA 1TEHA 3QWFA 5EPOA 2FPIA 2X5KO 3X2FA 1DIGA 4Y6SA 3C1OA 2JAPA 4RLSA 1LSJA 3PGJA 5I9MA 2W98A 1G1AA 3BMNB 3RD5A 4B7XA 3V1TC 1HF3A 2YDXA 4FBGA 1UZLA 4WEQA 2BI7A 1O9BA 1V3UA 4O6VA 1HLDA 4R5MA 4RPKA 1J5PA 4NFSA 4OOEA 3EAGA 3GVPA 5ER6A 3TL2A 1SOVA 4KP7A 4XYBA 3IKVA 4CM8A 3H9GA 4WOKA 1LDYA 1VJ0A 3WICA 1DAOA 3FBGA 4IQGA 3L6OO 3K73O 4NJOA 1VJ1A 2HCTA 2OL4A 1R4NB 3NJ8A 5JBIA 1P1FA 1NFFA 2DBRA 1B8PA 1GQYA 3DFUA 3ZU2A 2WE7A 1TA4A 1ZK2A 4MVJG 1B14A 3GRPA 3OETA 3DAPA 3G49A 3JYLA 1ISMA 1ZMTA 1YS4A 3DBVO 4IZIA 3SC6A 3DDNA 3KM0A 2VUTA 2HU2A 3AU8A 3SLKA 4J91A 1BGVA 4DMLA 3ZWAA 1WXDA 3LYLA 1B26A 4JN6B 2J5QA 3VPXA 4D3DA 2UYYA 3GN2A 4FIZA 4PLVA 5FWNA 1MGOA 1YVEI 2HMTA 5LDHA 2B83A 1AN9A 4JK3A 4RVHA 4II2A 4WLFA 3OJOA 3FSRA 1G0OA 2B5VA 4OHUA 5IF3A 1PGPA 3TSCA 3HZZA 3GEGA 4MKRA 3KV3O 3GNSA 2NTJA 3V1YA 4BGVA 3HN2A 1I5RA 1MFZA 4G65A 4MVJA 2QQ5A 4CMKA 4PG5A 1E1KA 5DOVA 5F1KA 2IYPA 3IAHA 3O26A 4GSKA 3BMNA 4W99A 3DHEA 1Y5MA 3PHGA 3OA0A 1SO8A 1B16A 2E37A 2JCVA 3EK2A 2O3JA 5L3ZA 3ZWWA 2EW2A 3WGGA 3PYXA 3ZU3A 2CDAA 3D3EA 3ETGA 5TC4A 1W4ZA 1NHWA 2AW5A 2C29D 3KEQA 3KYBA 5T6BA 2O3SA 1KVQA 3KYCB 4KQXA 3G79A 4EW6A 5ITVA 1P1HA 1X1TA 5CPBA 1SMKA 3RUFA 2GR9A 1KETA 2JCXA 1Y8QB 3KXDA 1AXEA 2BMAA 4J49A 1VE9A 3JQ8B 1IY8A 3L6DA 2TMGA 3ON5A 3T7CA 4IJUA 3LC2O 1B7GO 2FSVA 2JKVA 1SEPA 1ENPA 4PVDA 4FGSA 4LCEA 4IDCA 2WTBA 2O2SA 3PHHA 4M55A 3IKTA 4FJ2A 1OI7A 4D0RA 2J3JA 4BS9A 3LU1A 4B7UA 4IGFA 1K2WA 4GH5A 5KIAA 5KCZA 2WYUA 3L9WA 1YL7A 3VZPA 3H9UA 1IYZA 4RPJA 4BIIA 3KRTA 5CHEA 3K96A 2HUNA 1YONA 1KVRA 2FN7A 3V8BA 1YWGO 4JP2A 4PG7A 5FFFA 2IRWA 2YY7A 3ITKA 3JQGB 4XDZA 5JAMA 2EJWA 4RPHA 1VPDA 3BIOA 3JQBA 1E3SA 4MKXA 1LXCA 5T5QA 5JDIC 1PJ4A 4Z9YA 3QVXA 1H2BA 1VL6A 2D2IA 1ZIDA 1JU9A 1UH5A 2JHFA 4RV9A 1B2LA 4XB2A 3RQSA 1Z7BA 5GZ6A 2AG5A 3OJFA 1DOHA 3PJFA 3PPIA 3IC5A 2X5OA 2A92A 3ONDA 4Z3DA 4J2HA 4UVGA 4JQCA 3CIFA 5H82A 4CQMB 2B69A 3BHJA 2GDZA 3NGLA 2Z95A 3VDQA 4E5PA 4RJTA 5B4TA 3QJ5A 1KY4A 3NKLA 5G0WA 4YEDA 5JMPA 3KYCA 3FBTA 1YRLA 2OUIA 1NX6A 3OIFA 4AJHA 4CODB 4BNUA 5ES3A 5JCXA 3QP9A 1XR3A 1GUZA 1Y8QA 4QTZA 2I76A 5L4SA 1C0IA 3DEYX 2NADA 4J90A 2X0NA 3JQ8A 4QQRA 2BLLA 4E5NA 3C8MA 2JFHA 1ZKMA 1Q0QA 3IUSA 4QXMA 5MGBA 3EZLA 1WP4A 1H2HA 4BHTA 5JY6A 1P45A 1ZMOA 4BNNA 5EINA 1VC2A 1RM0A 3CH6A 4FJ1A 3WWZA 4D3FA 4NDNE 1PWXA 4FFPA 4O59O 1Q7BA 3RFTA 1BVRA 2RHCA 4LRSB 4CJXA 1BWSA 3MWDB 1JAYA 1X7GA 3FHLA 1SZJG 4RZHA 1R0LA 4P22A 1LDEA 2W4QA 3JQGA 3ZU5A 2SCUA 2QRLA 3WB9A 1EMDA 4BB5A 2V6BA 3GOHA 1WDMA 1GV0A 3DZKA 4IDAA 6LDHA 4R1TA 5BNIA 2JCYA 5L7YA 3FF4A 4MIEA 5TF4A 3NT2A 4XIJA 4YXFA 5K9ZA 2EKLA 1L1FA 5C7LO 3U0BA 5K0ZA 3H9JA 2E82A 2OBYA 5AXDA 4GKVA 3ADOA 2EERA 1Z6ZA 4CQMA 4DYDA 4KTVE 1K0UA 4M8SA 3D0OA 3MEQA 2ZB3A 4EZBA 3UFXA 4R41A 5LCXA 3VZQA 1ONOA 3JQAB 1YQXA 3S2GA 1NHGA 3OICA 1R0SA 2NVWA 3H4VA 1CDOA 2XF8A 4RO0A 4BO3A 3L4BC 4TQGA 3O9ZA 3W8FA 1HL3A 1LQTA 3ENKA 4S3MA 1CYDA 2B35A 1U2DA 2VZ0A 3AM5A 4CLEA 4AJNA 2EIHA 2F00A 1A4UA 4ND3A 5TJHA 3H3JA 2WD8A 2RBEA 3ZV5A 1YE3A 4EI2A 5CDGA 4D0SA 1PR9A 2P4QA 1I3MA 1EE2A 3VH3A 4ZD6A 3M1AA 2NQTA 2NU8A 1Y9EA 2NVUB 4YQYA 2EWMA 5LC1A 1X7DA 4CPDA 3NTQA 2P2SA 4DPLA 3K5PA 1KIFA 4DQVA 1Y81A 1N7GA 3U3XA 3WFIA 2J8ZA 4CV0A 4K1LA 2C7VA 1U5AA 3BA1A 3JSAA 4FJ0A 2VRBA 2X22A 1OC2A 3QLJA 1Y6JA 4LGVA 3WGHA 3MJ4A 2C5AA 4IUYA 4J1NA 3OIDA 4ILKA 5J23A 3FPCA 1JQBA 3OIGA 2RHRA 4IZHA 1IPEA 4HFNA 4HNHA 4OGWA 5KWEA 5B12A 4ALKA 3PFFA 4PGFA 4NIMA 3T7EA 2W2LA 3JQAA 3QRWA 1KEWA 1E6EA 4W9NA 5DBFA 2Y0DA 1DLJA 1H6BA 4UVHA 2Q49A 2FMUA 3E18A 3JQEA 3LC1O 3L9XA 3A28A 4F3YA 3AUSA 2NUAA 2WWRA 2FRDA 1P3DA 1BW9B 1MP0A 2GZ2A 3BMOB 4CMIB 1VSUA 1PEDA 1GUYA 2OXIA 3IJPA 4YT5A 1YQDA 3KBOA 1WWKA 2EGGA 1BG6A 1ML3A 4IM7A 3ZGYA 2GYYA 2ZCVA 4HBGA 4NI5A 1PZEA 3CKYA 1XQ6A 3UF0A 3DBHB 2O3RA 1FMCA 4B3IA 5L53A 2P5UA 3KEOA 1SBYA 3UKOA 4CV3A 4TRNA 1F06A 1A27A 5DZSA 5I8ZA 1UDBA 3WGIA 4I08A 3LZ6A 2O2YA 4WNCA 2GN8A 3BXXA 5G0VA 3LQFA 4S1VA 5THQA 1PS9A 4ZQHA 3S1LA 1E1NA 3EDMA 4HKTA 1BXGA 1I2ZA 1YGYA 4EITA 3ZWMA 4EJMA 1VSVA 3QVOA 4YACA 2Y93A 3DC2A 4JIGA 4GMFA 3ZCXA 1HE3A 2I65A 1RM4A 1RWBA 1YL6A 4ALLA 4DPKA 4BMSA 2VOEA 2E6UX 4HV4A 5L4NA 3PK0A 1HDGO 3JQ9C 2ZTLA 2X0RA 2Q2VA 4LVCA 1MX3A 4Z0HO 2BFMA 4KWHA 1E92A 1WVGA 1DSSG 4XB1A 1N92A 3E1KA 3EC7A 3WX0A 4MIYA 1H9BA 3NT5A 3X2EA 2VHXA 1P33A 4J6FA 1E7SA 5FEUA 3S8MA 5JCJD 2UAGA 5ER9A 2HRBA 3TNLA 3HDHA 4RVSA 3BMOA 4IXWA 4DIFA 4FGWA 4CMIA 3DAGA 4J7UA 3JQFA 3NAQA 3OJLA 4MVJH 4AG3A 3IUPA 2YQ5A 2ZCUA 1LDMA 4A7PA 4F46A 2D5CA 2VOJA 4D41A 4PZEA 1U3WA 4LVUA 3MWEB 3MOIA 3UICA 5L40A 2GERA 2FPGA 4CMBA 4KWIA 2CUKA 3HDQA 3ONFA 1E6WA 5KKAA 3PJGA 3RI3A 3F4BA 4M86A 1F14A 1IB6A 2AQ8A 2VUUA 4YYZA 5ILOA 3W8EA 3UH1A 4RGBA 3I23A 4I5FA 5TX7A 1WZIA 5CEJA 4XKJA 4FDAA 1DC4A 8LDHA 5MDHA 2GCGA 2PLAA 2VZ8A 4FC7A 4RQUA 5BSHA 3FCOA 1E3LA 4R1UA 1HTBA 1BDMA 5COQA 3LVFO 3GNTA 3GVXA 2WSBA 2O48X 2ZATA 2Y0EA 1MG0A 1Y9AA 2Q50A 3GUYA 4JJGA 5A06A 1P0CA 1LLCA 3ZWCA 2YUTA 4J4TA 1AXGA 2BFOA 1FDWA 3ZI0A 3JD0A 4E13A 4RPGA 2H5LA 3LLVA 2C7GA 2ZTMA 1E7RA 4RLHA 1Q0LA 5JO9A 4BGUA 4Z6KA 1DXYA 2YW9A 4GX5A 4XRGA 3I9KA 4ID9A 4DA9A 1HKUA 1FDVA 1BHSA 4OIMA 4J0FA 1C1DB 1NWHA 1EDOA 4CR7A 1LEHA 2XPCA 3NJ4A 4LISA 4INAA 3TZKA 3NYWA 5JFOA 5DF1A 5CP8A 4NR0A 3D7LA 4W82A 3AOEC 3B1FA 1CQIA 2W8ZA 5AXBA 5IXYA 1T1SA 1K5HA 2C2XA 4CM3A 3RAJA 3DOJA 2VTDA 4GAEA 3RUIA 1YB4A 5A02A 5CDUA 3CPSA 1W6UA 2GGSA 3H5RA 3NUGA 1J6UA 1EUZA 3PQEA 3RUAA 1UZMA 4U0JA 3MJCA 4N5NA 5B1YA 2YV1A 3JD4A 3FPLA 4OKNA 4EEZA 1EUCA 2BGMA 3CXRA 4WPGA 4W6ZA 1GADO 3PRJA 1WDLA 1O89A 1Z45A 1CERA 3I9JA 3ZWXA 3U09A 1RYEA 3ZHYA 4MVJM 4D46A 3DAFA 4E31A 3PTZA 4JBIA 4I9UA 4TRMA 2I9PA 1DDOA 4ZRNA 3U4CA 3GEMA 4G5HA 4L73A 4LMRA 4YTEA 3ABIA 1TVEA 5HA5A 1DRWA 4CLRA 2NACA 4XR9A 1S7CA 4K6FA 4WLOA 4CL8A 1NQOA 5A03A 4DL9A 3JYPA 5T8KC 1ZBQA 4XIYA 5IDYA 4MIOA 4ZQFA 3RBXA 3VKVA 4BKUA 4CQLB 5AXCA 2D8AA 2PZMA 1SB9A 3A1NA 3INTA 2WYVA 3DONA 3N74A 4W7HA 2V6GA 4R5HA 4ZQGA 3TOXA 4EUHA 1C1DA 1WMBA 3C1AA 1I30A 4Y98A 1LRJA 2VCYA 3G1UA 1GQQA 4WKGA 4Z0TA 3HADA 5JMWA 4QX6A 4HWKA 3DMTA 4WK6A 1QYVA 1UDCA 3PLRA 4QO8A 4A10A 1ZO8A 3D1LA 3R0IA 3K2EA 5T64A 4WGGA 4BL5A 4HFJA 2WM3A 1E7QA 2DLDA 4WECA 4JJIA 3C7CB 3OSUA 4OXNA 2B4TO 3H9EO 2QIOA 3BZUA 2E48A 4JXKA 4YT4A 4F6CA 3K2BA 2R2GA 1R37A 5KJEA 1Q1NA 1D3AA 2ILTA 2IZZA 2B0JA 4Q3NA 4QECA 5JDIA 3RC1A 2NU6A 2UVDA 1I33A 1U3TA 1FJHA 4ZQEA 1E3WB 3I5MA 1K6XA 4ALIA 3FWZA 1T2AA 1KC1A 1CQJA 5AOVA 5JC8A 3WJ7A 3GGPA 2HJRA 1I10A 4AJ4A 5JPIA 2OORA 3UXYA 1ZUD1 3BMCB 3WIEA 4J4HA 2EP5A 2J3IA 3ZNPA 4B3HA 4MP8A 1EFKA 3AY3A 2Y99A 2PD6A 4ZRMA 4E5KA 5A9SB 5HRUA 1DC3A 3ENNA 4NFYA 1EUDA 3U49A 4CQLA 2VN8A 1R12A 3VH2A 2PK3A 1F8FA 3Q1LA 4E6PA 3GDGA 4B4UA 4RDIA 4F45A 2O3QA 2Y1OA 4YRBA 4NZ9A 2NWQA 4KUEA 4I8XA 3JQ6A 5ENVA 4BNIA 1CWUA 5G2OA 1GYQA 1QV6A 4WASA 4CLOB 1WZEA 2GRAA 1KS9A 1EE9A 3SC4A 1X7HA 2D59A 4IJVA 3W8DA 4CM9D 4E0BA 2YV3A 3GUCA 4PFJA 3GGGA 1W8DA 5B37A 4DC0A 4YPOA 4KZPA 2Y0CA 4TWRA 3M6IA 3JQFC 4PZCA 4E2WA 1VKNA 2GNAA 2HLPA 3FNFA 1KERA 4GX1A 1P1RA 3ROPA 3VPSA 3NX4A 3PXXA 4LSMA 4UREA 1XU7A 3H65A 1QV7A 3E82A 4HFMA 3WG9A 5CDSA 1IZ0A 3IL2A 2YFHA 1E3WA 3AUUA 2Y68A 1HYGA 2DT5A 3ANNA 5JSFA 1QXSA 4KOAA 4A0SA 1H6DA 3GR6A 1U7HA 4DQUA 5C3MA 1Y1PA 4NBRA 4YRDA 4EBFA 3VPGA 1GEEA 3VPHA 3K92A 4DVJA 5TLSA 3ITDA 1NFRA 3IMFA 4TVBA 3BMCA 2J5RA 4P4LA 4RCVA 1ZFNA 1LBEA 2DUUA 3LT1A 4B4OA 4OSPA 5A9SA 3WBFA 4BUCA 2C5EA 3L4BA 2CVOA 1DC5A 2PKRA 4OQYA 4RPLA 3I83A 4GMGA 3DBLB 1TT5B 1LUAA 3STHA 4Y9DA 1B8UA 4XJTA 3CMMA 2ZB4A 3TF5A 2D0IA 2V65A 4RDHA 4CM5A 3A06A 1U4OA 3WSWA 3BHIA 1D7OA 4II3A 3ZV3A 2Q1UA 3QV1A 1N1EA 4IBOA 3VTZA 1GQ2A 1ISGA 3EW7A 1OZAA 3WYBA 4CLOA 4OH1A 3KHUA 5BSGA 4N5LA 3L77A 3UHAA 4CM1A 4QFCA 1P1KA 3U4DA 4Y6RA 1JWBB 1DRVA 5CEEA 3TZ6A 2C0CA 3OEYA 1P77A 1PIWA 3QVWA 2FR8A 1UXKA 3DL2A 4WCFC 3RU9A 4DYVA 4OQZA 5L4LA 5TT0A 4GL4A 3ZNOA 4RVUA 3ANMA 4Z0PA 1Z75A 2HMSA 1NXQA 1P74A 3OECA 3RFXA 3LDHA 4WOJA 4BGEA 1K3TA 3OEWA 4K28A 5F5NA 5IG2A 3F6YA 3LSYA 3LF2A 3AK4A 2Y1FA 1J0XO 4FR5A 2GF2A 2VT2A 1ZNQO 3DR3A 1QYWA 4PLHA 4RVDA 2C2YA 2G17A 1DHTA 4J9UE 1HYHA 2LDXA 1E5LA 1AGNA 4L8VA 1WAMA 4YT8A 2ZTUA 3W6UA 4B3JA 2EV9A 2VUSA 4Q3CA 1DPGA 1EEHA 1DJNA 4E2XA 3DBLA 1TT5A 4FB5A 4MOWA 1HETA 3HQ4O 3PHLA 4RVGA 2YDYA 5AXAA 3INRA 4UUNA 1LLQA 1LNQA 2NQ8A 4NBWA 3IIEA 1X1EA 3C7AA 3RJ9A 1XLTA 2CSUA 3FNGA 4A5OA 4ZVVA 1BDBA 1A4IA 1T2EA 2R00C 3K31A 2OGUA 2RCYA 3H5AA 4LW8A 1E7MA 5JS6A 4A27A 3RC2A 2VWGA 3CMCO 4JBHA 2V6MA 4EUEA 1I0ZA 3JV7A 4GGPA 4IPTA 4PIVA 3F3SA 3DMTC 4MO2A 4Q3BA 1ADGA 1SB8A 2ET6A 1DIBA 1GZ4A 1K89A 1HE5A 4XQGA 1X0VA 4NMHA 1ISHA 5G0UA 1VKOA 4OMUA 2DU8A 2ZYGA 2C54A 3PWZA 2X9NA 3C1TA 3GH3A 2Z1NA 4KMSA 1ADBA 2D5AA 1I32A 3JYOA 4GQAA 2NU7A 4CUZA 3TFOA 3DZFA 2X0IA 3JQ9A 4BNZA 4ESOA 2BGKA 3DQPA 5F3RA 3FI9A 1MLDA 4KDEA 4QSMA 4PLCA 2QZ9A 1B3RA 3DWFA 1EDZA 1FDTA 1LLDA 4NG5A 1PGJA 2ZB7A 4XGKA 5AYVA 3TZHA 3RCBA 2OP0A 3D4NA 1TXGA 2XAAA 4GVXA 4KUHA 1XU9A 1K6JA 2CVQA 4U6SA 3O8QB 2X7HA 4WLNA 1EVIA 1T2FA 4UEOA 1KEUA 4N7RA 4R69A 1H6CA 2GD1O 5T57A 5DCWA 2FZWA 4YJHA 1AE1A 1X15A 3DBRB 2O3UA 3RKRA 4BO8A 1XGKA 2EG9A 2IZ1A 4WLUA 1F17A 3ZHBA 1E1MA 2IYOA 2OFPA 4BMVA 3EVTA 1QP8A 3HG7A 1E5QA 4J16A 1DRUA 4BKOA 1ISJA 1SPXA 3MJEA 4E21A 3QE3A 4AFNA 2Y66A 2YYYA 3OF2A 5DP1A 4AL4A 3CE6A 3GFBA 2NNLD 3GHYA 4BO6A 3PFWO 2PH5A 2VYND 1NPYA 5C7OO 5A04A 2QYSA 1T26A 2B4RO 3FWNA 1GCOA 4ND1A 3AM4A 1ARZA 1XQ1A 3W4IA 1I3NA 4YAJA 2RH8A 3AWDA 3TZQA 1GYRA 4BVAA 3WSVA 4MVJE 6ADHA 2UUOA 2HO5A 4I5DA 4OXKA 3K6JA 4XGNA 2GSDA 1SNYA 3VZSA 1PWZA 3O8QA 1I36A 4BO5A 3U5TA 1T25A 1V35A 1EVZA 2RIRA 3V2GA 3RSHA 4BO7A 4PRLA 1XKQA 3IS3A 4J43A 4RF5A 3AOEA 4EJ6A 1B3BA 8ADHA 3D4OA 2PKQP 3DOOA 1CJCA 1PJ3A 4QO7A 1XSEA 1P1JA 1QMGA 4B8ZA 2DFVA 3DBRA 4QUKA 1H9AA 3RKUA 4CUKA 3BHMA 3OQ6A 1PJLA 3TFQA 4FOSA 4TROA 5HTOA 5T67A 1E7WA 5FF9A 2B36A 3HFGA 7ADHA 1QLHA 4UEJA 3EGOA 4FPXA 1ZK0A 1PQUA 1B8VA 5GY7A 4ZHSA 3I6IA 1EVJA 4AJPA 3JCZA 5FYDA 5KTKA 3TPCA 1UAYA 4UULA 4YAKA 2RH4A 4H3VA 5I7SA 4CUJA 2ZK7A 1GPJA 2OZPA 4H7PA 1JTVA 3FNHA 4IDFA 1GR0A 4XQEA 1FDUA 4NK4A 5KJFA 3R3JA 1UXHA 3ONEA 3PVZA 5DCYA 1BXGB 4O5OA 2R6JA 4WNIA 3GT0A 4OO3A
chains in the Genus database with same CATH superfamily
1N7JA 5T8KA 3UHFA 5JASA 4GPD1 4NENA 1YBMA 3HJAA 4PPFA 4REMA 2Q4BA 4H7KA 4ZU3A 4CE6A 1X7ZB 1KYQA 1MRNA 3N2ZB 4LS3A 4CF3A 1AQ6A 3DZ8A 3DWEX 4EO9A 4YASA 5E7IA 4BQIA 4F6RA 2NXJA 1N2CA 4DRXA 2P27A 2C2BA 4XPZA 4Q9JA 2YR0A 3HFJA 3N0VA 2XRYA 4EB0A 4WW0A 1PW7A 1E96A 1PT6A 4B9EA 4N54A 4AN4A 3U39A 1YL5A 2AKAB 3CONA 4PO9A 4L15A 2GZ1A 4ZVOA 4CF7A 4EB6B 4W5QA 1H0SA 2J6IA 1MHPA 4LBVA 5DBGA 1AKYA 3PQ2A 1TQ4A 3CZMA 5EESA 1GL6A 2A9FA 5DBHX 4PR3A 2A5FA 3FBWA 4RHUA 2Q5LA 4ECAA 4LGMA 2VZLA 3EHEA 4F56A 3L0BA 4BBJA 1RQNA 3G0IA 4LMBA 1LI4A 3DULA 3K1YA 2FPPB 4MJLA 5BV7A 4B6FA 1EI9A 5JNLA 4Z4IA 4R51A 3FFBA 1LPAB 3D8BA 3OCWA 4XVUA 1JT2A 3GH1A 2HK9A 1DX9A 4MVYA 1H5QA 1S2NA 2YHUA 3FNRA 2ID9A 3GNQA 1RXVA 1EP2B 2IVZA 4CMHA 3QFFA 3NU1A 4A9AA 1FXSA 1SZDA 3OZFA 3BT7A 1YE8A 1SUAA 2RC6A 5HDQA 4CQNA 2YHBA 3BD8A 4Y2HA 2IBTA 4LXXA 4E07A 3G0CA 1BIFA 3R3WA 4OFXA 5F4BA 4PSVA 1Z17A 3BA6A 3I04A 3UJNA 3ENZA 4AO8A 1PRYA 4NY1A 1H4VB 2J3MA 1SKQA 3NHRA 4MJ7A 4WADA 5ADWA 3WMFA 1K5DA 1KVUA 2ADFA 4P82A 2SICE 3JWHA 1AC5A 4QJ3A 2H1RA 4X5OA 4KFCA 4LY6A 1GCUA 3BL8A 1JG2A 3AUYA 3WLFA 1CJMA 2HUPA 3D4PA 2GCIA 4F92B 1E4EB 1FFCA 5K3OA 3B60A 4F3TA 2LXNA 3H8VA 4CTNA 3S2ZA 3E03A 1ORWA 4M0FA 1R16A 1XVAA 2EHDA 3KB6A 2ETVA 1JEYB 3WL3A 3JWPA 1X80B 2D5BA 2EIXA 3OFJA 3B6ZA 4F3NA 3ZU4A 4KYTA 4DILA 1RQLA 3HDVA 1FNDA 3MPOA 5DVZA 2BEUB 1JAIA 3CJRA 4U2DA 4R2WA 1IJBA 1P72A 4BQNA 1OPXA 1HK7A 2FX2A 2JAHA 3H4IA 5J9FA 5JI3E 1FYEA 1BCRA 4PSKA 3RIGA 1GEGA 4MUNA 1DFGA 2AN1A 4L3VA 1SQGA 1CUZA 2DR3A 2Q0QA 3P9ZA 5ECDA 3QF4B 1PJSA 1Z13A 1XTQA 1YC5A 2ACKA 2KYRA 4XEHA 4YBZA 2AMFA 2HOQA 3EIWA 4CG3A 2PRZA 3D3WB 3A37A 3U2QA 4B6JA 4HUQA 2CCKA 3SJAA 3WLJA 4MKFA 1FP7A 1QZTA 2ZTHA 4M9RA 2ANBA 4PLGA 3QWAA 3BD6A 4L3WA 4ZDWA 3S2YA 4DUZB 5B3LA 4KMOA 3GAAA 3GROA 5CA0F 1KP9A 1XTUA 1T2DA 2E9SA 2B4YA 4QTXA 3WK7A 5ARDA 4R1OA 2MINA 2VAXA 5FI0B 3AESA 4IKPA 3V7UA 4TN5A 4BNDA 2WMNB 1KH3A 5ADHA 4H9GA 2KLBA 4RKRA 1PQ4A 2DRIA 2ZBFA 1DVRA 1RHUA 3F3KA 5EHXA 1XKXA 1RLUA 4UM9D 4XLTA 2FR0A 2ZP1A 4DT1A 2DR2A 5JJIA 1WB4A 1L8QA 4ZPXA 1Z0ZA 4DQXA 1HSZA 3JVEA 4CF5A 1KZ4A 1M76A 1AHHA 1YJCA 2VT3A 3N0TA 2AT1A 1TMKA 1W0KD 4M1KA 3AHEA 5KVAA 1FP4B 1UXIA 3ZVKA 5IDVA 1Q22A 1ZI6A 1BQ3A 1NT2A 1N57A 4RZ2A 3E05A 3DNMA 4QM6A 2AXPA 1GCGA 2GK6A 3NR2A 1PNTA 4I81A 4QEKA 4C5CA 1NUAA 4LF4B 3AVOA 2J5KA 2GJSA 3ROEA 3GC6A 1EFCA 1B8NA 3UJ3X 2J5BA 1G8MA 4MEBA 2O1WA 4M9UA 3WY9A 3LOPA 2QM3A 4OP3A 1B4DA 1C8KA 4D7AA 3R0JA 5CDTA 4HB3A 2OGTA 2VJPA 3WL6A 4DMGA 3QENA 2JGDB 1Z47A 3ASUA 2OAEA 2WB4A 2C82A 1U7XA 2PGLA 4WEOA 4F96A 2Q45A 2E4AA 3R1IA 3IBGA 3H2HA 1VKZA 2P8SA 3KCNA 1GCIA 2JFGA 4I4TA 1GTRA 3HWX1 1J2TA 4CKEA 5JXWA 5FL3A 1FNSA 5IN5A 3AEQA 3RSZA 1A95A 5JU6A 5I51A 3C3JA 1FFDA 3OEHD 4HDNB 4WCFA 5JUWA 3L0CA 4HMOA 4MA5A 1DINA 5HKKD 2G36A 5FOTA 4DR4B 3KPWA 2HLHA 2Y3IA 3B9PA 4NPCA 1AXRA 2FLWA 2QX8A 4QUIA 5FCDA 3KQTA 3MD9A 3FSJX 3X0DA 3HLKA 3OJEA 4B4VA 2H9YA 4ZK6A 2WWTA 4TWBA 1CZKA 4KHZA 3GJRA 1EGVB 2ZDQA 3RUDA 4IXTA 2GPTA 3GAZA 5JAIA 3GJ7A 4OL9A 4OHRA 1V95A 1YVDA 3E3OA 2O7QA 3LT0A 4C2UA 4C06A 1AV6A 1ZR4A 4C05A 1C0KA 1E3IA 2GK3A 2HBRA 3OKAA 4FXPA 1D5WA 1WD5A 3IBFA 4L0QA 5AKKA 4DTIA 3RAFC 3HJFA 1DIAA 1NVDA 1Z22A 3CEPB 1EB9A 1V7QA 4TT8A 3WGQA 3KELA 2NP7A 1UJ6A 1EX1A 1O6ZA 5ALOA 5AJHA 3CF6R 1K6IA 2CY0A 1G16A 1RRKA 3AFHA 3EODA 4G4JA 2Y2UA 5BSMA 2F1IA 3S99A 5KKNB 2GN1A 3HGTA 2OO7A 3JRXA 5GOZA 2MMGA 2FHSA 3GN1A 5LWQA 1MC5A 5F1PA 1WOMA 5M2QA 1OV4A 1UWVA 5DLYA 4NCBA 3ESBA 1U1IA 1C4XA 3WGLA 3O31A 2X0KA 2X4DA 5C18A 4QXRA 4ZOCA 2QAGB 1CEYA 9LDBA 4F4DA 1E61A 1X7YA 3WJAA 1G17A 4X7PA 2AOXA 4KXMA 5JVDB 1Q0RA 4DBVO 2ZBRA 5SY6A 4LNHA 3VZDA 3BG5A 4L2IA 1ZD2P 1N4DA 3SKVA 1ZCJA 4OHOA 1GG5A 5IZCC 2GI4A 3CQ9A 3SR0A 1GZ3A 1YZKA 2CHFA 4BMNA 3H1GA 4G9EA 4YO7A 4KQ2A 4AYWA 4AJLA 2QX6A 2BV3A 4WK0B 4P5PA 5D5PA 4CTJA 5K6AC 1H1LA 1T9BA 2CDBA 3WLTA 1O87A 2GPSA 3K20A 4O0LA 3BCUA 3GLHA 1KKUA 3OPYB 2BZGA 2BGTA 5IAEA 3ZWPA 4L75A 2BMEA 4GP7A 3EWIA 2YX1A 3HWRA 2BR5A 3TRHA 5IPFA 4HNRA 1CQZA 2ZU6A 1W96A 5E9QA 3VH4A 1OKKA 2VHCA 5K6RA 4G8BA 1PGOA 4FBLA 3I2IA 5CBPB 3QEKA 5FL7A 3W5VA 3WMRA 1XP8A 1OV6A 4PO1A 5AKXA 3WNCA 3EMKA 1EA7A 3EXFA 4QEDA 4J7CA 2UKDA 2W6OA 2JI6A 2ZR7A 3VI3B 1Y5IA 4QXQA 5TEVA 3UW1A 4OI0A 5CXSA 4B09A 2Z8YM 4GEKA 1WPGA 4P86A 4YRQA 4EHFA 2DFDA 1H5NA 2E49A 4ZAWA 4JC8A 4JQOA 3GJSA 1G7RA 3KZ1E 3ORFA 2PQ6A 1P9NA 2PUTA 4LOIA 4M38A 3WO0A 1GY8A 1Y7IA 4A1OA 2JA1A 3B1JA 4FU0A 4MMYB 4IGIA 4IH4A 4JEMA 4FFMA 1C1XA 2Q1SA 2X23A 3M4ZA 4HLUC 2R2AA 5E95A 1WPQA 2VLIA 2OHFA 4PFSA 3QY9A 3A9CA 1WM1A 3H1PA 5HJ2A 1QOPB 1X1QA 2QWXA 5IXSA 2N47A 3CLHA 2QLFA 3DB2A 1EX7A 4DF3A 5FOQA 1N8KA 1Z5ZA 5EUMA 1KAQA 5BVHA 4F6LA 1IHOA 2H1LA 2HA5A 4LX8A 1IJEA 2J9RA 1C2YA 1VCOA 3CXUA 1IHUA 4GECA 4N5DA 3UBMA 3V2HA 2YVUA 2P6OA 2O8DB 1UP7A 2C9CA 2P5YA 4Z99A 2Y67A 4LDPA 2LP4Y 3RS7A 2PWYA 4RQTA 3Q9LA 4B7CA 4YT2A 4CMEC 3BWBA 3GZNB 5JV5A 2WLSA 1E6CA 2TMDA 4KR7A 1EJ0A 1E1YA 1YRYE 2NTYC 5CFMA 2CV1A 3B53X 3OU6A 3QU4A 4N5HX 4WJZA 2WHXA 4X60A 4ZI2A 1NM5C 4FYKA 1RPNA 1XD2B 1H93A 1OT3A 4HG2A 2EP8A 2QZSA 3FETA 5HZMA 1IN4A 4G5RA 5EQTA 4B4DA 3OZCA 2PH7A 1QHHA 4J9VA 2ESRA 4L4XA 1JXMA 1V0JA 1UIRA 1X8JA 4X94A 3T99A 4GOOD 4XJSA 4B2YA 4ENTA 5LU8A 2OBFA 2JAQA 3P2YA 5IDQA 4MW1A 4UFPA 3TZCA 5H8WA 1QH1B 3QOFA 2C5SA 2R66A 1GIAA 3OPYI 3I9NA 4TUYB 5EMHA 3LRTA 4L4RA 2GD0A 1V9LA 2QZPA 3REFA 3TMAA 2AWOA 1XLVA 4JROA 5FTMA 5CK4A 3R20A 3UC5A 3L49A 4DWJA 3HKDA 1SXJE 3EFOA 3LCJA 3RYFA 2H1HA 1XZQA 4QAJA 3S3TA 1G2OA 3HU1A 4N7JA 4YJFA 3S27A 3S29A 3VX3A 1OA1A 1UMBA 2FK8A 3DZBA 3S5UA 3CVWA 3KQKA 3CSSA 3P0JA 4G5SA 5TDHA 4EI7A 1LC3A 2H11A 2HQ1A 1QVAA 4LHSA 4F8EA 1QO0A 2QN9A 4JY7A 2R65A 2ATCA 3Q9UA 4EFMA 1IBCA 2Y05A 1C1HA 4Z4HA 1YDFA 3OEEA 2JIZD 2VRCD 1RC0A 1ZUHA 4TV8B 3HEAA 5FWXB 2DE0X 2J41A 5JE8A 2A86A 5IFLA 1HMPA 1KZ1A 1UT6A 2ZYHA 1TA0A 2OCKA 3BEOA 1F51E 1G8YA 2HNAA 3HXQA 1USKA 4R1QA 3HC7A 4H0FA 3WGOA 2YUIA 4DR3B 1TZBA 3ESXA 5C5DA 2JLZA 1M5UA 5FFMA 3X1MA 1MPXA 1I01A 1RKXA 4GP9A 5C5EA 1M6YA 4AJ2A 2DM6A 1JSXA 2E55A 2QGZA 2P69A 2ZTVA 3B1ZA 4UCWA 2P4UA 4X7MA 3TLGA 2ZJFA 4C7JA 1YSCA 1FLVA 5KOIA 4QYWA 4FMDF 4EG4A 2Q3HA 2JH9A 4MSUA 3SYMA 4XQCA 1AM4D 1JDJA 4NZZA 3K0KA 4BQSA 5CK5A 3GEDA 3NPMA 1GPKA 4RMIA 3K0AB 2RJ3A 3KOOA 4QLBA 2I34A 1FZTA 3EXEB 1DX4A 1FDSA 2O2HA 5EL0A 1SBQA 4QG3A 5LQMA 1ISIA 2REXB 3GEEA 1XZGA 1DQSA 3CRQA 4JLMA 1UXOA 4PBTA 4BMOB 1N2XA 3UMBA 2V7QD 4V0OA 5F98A 2Z83A 3OZSA 3QH4A 5DDIP 4V02A 5CB0A 2AEJA 2HV8A 2IHVA 4K26A 1M2HA 1TUIA 2G7ZA 4MW5A 3AOGA 6REQB 4HNAA 4A2CA 3I1YA 5TNXA 1NBEA 1UC5B 3A4LA 4QDZA 2V9PA 1GITA 3X1XA 1UMDA 4FWBA 4GBMA 4DLZA 1JFLA 1DJOA 2Q2WA 4LC0A 3ZDEA 4EX7A 2FFRA 3MGKA 4D3ZA 3P1JA 2V9CA 4J3FA 4OUDA 4Q4LA 4UDXX 4W7IA 4GEGA 5K3FA 3GF4A 2ZRFA 3PPYA 4NYIQ 4MYCA 3L8MA 4CMAA 4MLPA 2VTBB 1L3CA 5ESXA 2FB9A 5IKXA 2GEFA 5H3HA 1JVSA 1KEZA 1DKMA 5JDCC 1JQLB 4Q4AB 4A23A 1TRHA 2BM1A 1XNGA 2PWBA 3G7SA 4I46A 4IDQA 3DHNA 4P8RA 1WW8A 5GGXA 4FILA 2ZI5A 2OK8A 2IZOA 3RARA 2QR2A 421PA 2VYNA 4DGQA 4U5XA 3PIDA 1Q7TA 4D74A 4QDOA 1G8FA 1VHDA 3PZBA 4NCIA 2X1HA 1JKMA 2F8TA 2EGHA 4BJ3A 4XXHA 1QHXA 3OQBA 3TR6A 2ZIZA 5K09A 1M2OB 1B1AA 4RK7A 4AY3A 1J7KA 3ESAA 3FDZA 4H7FA 2XUOA 2VDWB 1GKYA 2YWBA 3SXUA 1YNSA 4GI3A 4TS4A 1T9ZA 1XZLA 3PFNA 5CHYA 4B7AA 2EARA 2V6JA 2IEDA 3BC1A 4K9QA 1GPYA 4GKKB 1KR2A 1ZGCA 3D8TA 3NXKA 4YXWD 1M66A 4TXLA 2VDMB 4CL2A 3EZFA 3QLUC 4N7MA 5DRYA 3ZDDA 1D1SA 3QIAA 4LNUA 4OAQA 1EXNA 3LWZA 2A67A 4UNPA 3HRHA 5KQRA 3BGWA 1BXRB 1EK5A 1G6HA 2QA5A 3G0BA 1OLSA 3BTSA 4QQ8A 1HEYA 2V7UA 4UMDA 4XX1A 4ITRC 3PA6A 1N5IA 1R6BX 3OUUA 1WU8A 2C3OA 3BWCA 1U7TA 3EEYA 3MMNA 2QTTA 4FMCB 2HK6A 4L5YA 5KSOA 1M8GA 1N1DA 2VDRB 3F4LA 3V1NA 3X44A 4MWGA 4B9AA 3GW8A 5FX2A 2O2DA 4NDAA 4KLCA 4DDTA 3TXAA 2A4KA 4MQLA 4WUVA 2HRDA 5G0TA 3MHPA 4YCMA 3CM0A 5F2EA 4E5MA 2AHOA 1IXKA 1F2TB 3OSZA 3AM3A 4ND7A 5D01A 4DMMA 3KJNA 4DA4A 1TTHA 4QUHA 2X9GA 5JAZA 3KR2A 1V1RA 4K6GA 1NI4A 2XZDA 2H3EA 4FN4A 3VYRB 2VDQB 4DABA 1V9SA 2YCBA 2H0RA 4KGVA 5BSVA 4G5OA 1UBUS 4F91B 3UGKA 4GGOA 3H5VA 3MFQA 1SVWA 5G40A 3T7DA 4XM1A 2FSHA 1CDEA 1NJFA 2AMJA 3DL4A 5ILGA 1Z5GA 1K88A 1MV5A 4JX8A 1NXVA 5AM2A 3R24A 4QRDA 1GN9A 3NG1A 4D9CA 2G25A 4L8WB 4HHEA 1TO2E 4BRUA 5CDFE 3ECSA 1IK6A 5EE5B 3AUJB 4EY5A 1JJBA 1ND5A 1ECBA 3COSA 1U7UA 1R6DA 4ME6A 4Y2JA 5ANRB 2HQSA 2P5SA 3WDSA 2IYQA 4AKHA 3QG1A 1MG5A 2FEAA 4JLDA 3OLQA 2ZJ2A 3RVDA 5JWOA 3M6WA 2DVMA 2CE7A 4RORA 2AQKA 3RK1A 5EJ8A 1XELA 2YJ3A 5TT1A 4M89A 3VUEA 2PGOA 3ZDCA 4F85A 5E6RB 5LA6F 2A94A 1OFVA 1LRKA 2IPMA 1PEAA 4JAVC 1GSIA 1QWSA 1KH1A 1NTRA 2PLNA 4GX2A 1QZZA 2WMOB 1U0RA 3DLCA 4HXEB 2CBZA 1ZUNB 1RCTE 3OBIA 1MDFA 2Q21A 1X94A 2H5EA 4P54A 1Z25A 3HPRA 2DY0A 1NQVA 3I9MA 4F4UA 3RVPA 3VBCA 1GFZA 3G3EA 4A26A 4OMCA 4Z7JA 4F4JA 1TIPA 2HXYA 3QVJA 3ORYA 1CU1A 5JLAA 3T52A 3M7IA 4R8MA 5LPNA 3KETA 1BKSB 2XE7A 2XOXA 4MPPA 1QP7A 2QTLA 4I8DA 1YJQA 1EJBA 2QORA 3OC0A 1YU9A 2KMLA 1CS0A 1Y3DE 4BZWA 2BCGY 4YHHB 4X20A 4LZZA 1GILA 1SVUA 1CDZA 3QKSB 4OREX 5CB4A 1F1BA 3SS7X 2XZOA 2OBNA 3L7CA 4PZDA 4WXYB 4XWWA 3SFVA 1OXUA 3E6AA 3PFHA 2BL4A 3OY7A 1ZK1A 1GDDA 1W36C 2HDWA 4AY6A 4UQPA 2CVZA 3RRXA 5GIPE 4B2IA 1ONNA 1S89A 2RKBA 4FKZA 2QMHA 3LA6A 2NUPA 4A92A 4B6QA 2H9AA 4CM4A 2D1TA 2DH5A 2ERCA 1KNXA 1JA0A 1SBCA 1YZQA 3C85A 1GPDG 1Z0KA 4TS1A 5EE3A 3GFPA 3AEXA 1CUFA 1JKFA 1OYWA 3LHSA 4IDBA 4RMJA 2ADMA 2DHCA 3AL2A 1LS1A 1ODIA 3W4KA 2WJPA 3GPCA 5I9SA 1BXKA 1JKJB 2BDTA 2W6JD 4MGYR 1R0KA 1S4MA 4Q6WA 3OI7A 4RHXA 5DYTA 3QIVA 1N2JA 3D3NA 3RUCA 2E4WA 1RDFA 3NZEA 3W3AA 4K6HA 4BO4A 5KU7A 1W9HA 4NF2A 2J9GA 3RNLA 2XWSA 2OKCA 1YR7A 2AFIB 3HU2A 2QSYA 3QITA 1KQOA 4PHTA 4G0PA 3LPNA 1KHTA 4UVEA 1T5DX 1IAVA 4R3WA 4G81A 3HCRA 3BUSA 4X54A 5CAEB 5REQA 2APJA 1XDWA 4EBBA 3AVPA 3FCSB 2V4UA 4R16A 1YZGA 5KYKA 4KH0A 2GN9A 4P4NA 5BUSA 4C4OA 4NBVA 2LV8A 1TADA 2G4VA 2MDTA 1G9SA 4Z86A 1MBZA 3E9MA 1BS2A 1FE8A 4U5QA 2OSBA 3GJYA 1KZGB 5KVVA 1ORTA 4C7OB 1OZ0A 4IIDA 2O2XA 1WBDA 2BEVA 1BX0A 1M72A 2H9IA 3PGLA 3PEFA 5GMOA 2ZI7A 1J4AA 3PR2B 5H9WA 2O23A 1OLXB 1T4GA 2ODAA 4FQ7A 3AB3A 2HIHA 1V71A 3MJRA 4ZVMA 5AKJA 1UKBA 3HVJA 2CSXA 3KVYA 1U8XX 1S2GA 1C7QA 1ATIA 3K0CC 4J1QA 3L1UA 4BAGA 4ZT2A 2PU5A 2NM0A 3OE1A 3FNEA 3G5TA 1AK1A 2A59A 2PT7A 5JS2A 4GZLA 5E3IA 2YHIB 1QFXA 2I1VB 4ZA2A 4BP8A 9LDTA 1CQPA 1YDWA 2QTHA 1OROA 3IDSA 4KXLA 1DWPA 1SIWA 3FG9A 4IICA 4LBWA 1AUVA 4B6SA 2IITA 2LZ0A 3A9VA 5A1TA 4L57A 4PN3A 3GRUA 1L5FA 1ZW1A 2BTOA 2FOIA 2PYDA 1QIKA 3UW3A 2WTXA 2ECOA 5ALVA 2IOFA 3EBOA 3O4VA 4HQNA 3SLRA 1TF2A 1CUIA 2QG9A 3NWPA 4ZMRA 2UYQA 4DR1B 1GGMA 3I6QA 3TR0A 2NPIA 1YZNA 3H3XA 4FYMA 4TKMA 3H7IA 2QQGA 3HDYA 3ULKA 5BR7A 3B3AA 2IUYA 4PGGA 3V6LA 3BXHA 2MYNA 3FR7A 4M60A 1ICEA 1TC1A 2BFAA 2JLCA 3FVTA 3QVSA 4EUSA 3CRRA 3EA4A 3VAZA 1HZZC 1ND6A 1GZVA 2NN3C 3ZN2A 4BO1A 1M8PA 2Q4TA 4YJ3F 1HT0A 2QTBA 3OOJA 5COAA 3BL5A 5J5VA 4CT4B 3DOUA 5EUCA 1RHMA 4PG8A 4DV6B 2CJWB 1A2OA 2CL6X 2COKA 3U4QA 2A7XA 3W5BA 4BX9A 5I5GA 3DV0B 3OM0A 4UHCA 4EPRA 1JBEA 1P18A 2VYFA 5FP0A 3RC7A 3SM9A 1RWXA 2QGFA 2XNHA 1QIMA 3MYYA 4Q9DA 1NR7A 5DGIA 2FPOA 2H1WA 4JXXA 1BH2A 3MFYA 4YAFA 4BBAA 3NONA 5G0SA 3STWA 3GT0A 1TF7A 1QUFA 5KWSA 2QXTA 3B38A 2CXNA 1U8UA 4EECA 3LBAA 3W2EA 1V6SA 2GVNA 3EGIA 1JH9A 4MPJA 5ICFA 4UOEA 2JZNA 4MHSA 4NEHB 1J8YF 4PO3X 1WUIS 1P19A 4XX0A 1J8QA 2CDRA 3PIIA 2X2FA 1GZ6A 1OA0A 3JYNA 3O1JC 1JIUA 4UFOA 2WJJA 1T43A 2Z2KA 2D13A 4U3JA 4IDGA 4XDGA 5DTIA 5EJ2A 5BMVB 3JQBC 5AKHA 1D9ZA 3D64A 3S5JA 4RA9B 4RBNA 1G5PA 4UAVA 3W90A 1Q0HA 5JS7A 1O97C 4OX9B 1Z74A 1CR0A 1NPDA 1XQVA 1NQ5A 4U0KA 3A3PA 1KQNA 3AGQA 3BVPA 2QRKA 1UQUA 3QNUA 4EY6A 2JGLA 1L7PA 2DGDA 4YAUA 2E2WA 2VHTA 2B4QA 5JARA 1LK5A 4YRNA 3F9IA 2IYEA 4X45A 1RS0A 1Y7LA 3N2KB 3H5NA 1T6BY 1DJMA 3FF1A 3LQ2A 4IIVA 4XFJA 3V9AA 2IWRA 5G4KB 5TQVA 1GTJ1 5EQDA 3JZDA 4IINA 5HEKA 5KYVA 4EPTA 3V6MA 3CLSD 4MAAA 3OZTA 1J2RA 1BMQA 2DECA 4ZVKA 1YVPA 3INGA 5A4FS 3V8RA 5K7SA 1ISSA 3LT2A 4HQLA 4G1BA 1P81A 2QV0A 4JCOA 1AKEA 3FPAA 4HRXA 4AKTA 4DY4A 1DG1G 3JQAD 3H5LA 3BD7A 3BWEA 3FTPA 1WUYA 3TRDA 4PNEA 3JPYA 1ISFA 4XA8A 4YAGA 3JWJA 3UV7A 3C43A 4GMXA 2EQAA 3R3VA 5LZ4A 2O0LA 3RM3A 3SJ7A 1BSVA 4GBJA 4WKNA 2QD3A 4MWBA 1QB7A 1YS7A 4KSYA 4YUAA 1DIRA 4FOTA 4JLKA 1W75A 4E5VA 2IU4A 3UWOA 2CKDA 3KTFA 4R84A 4MPDA 2P68A 2FDCA 3CO0S 3I2FA 3DTTA 3NHWA 1V2HE 1HSOA 2ZE8A 1N2OA 4FE3A 2PL3A 2I7TA 1JS1X 3PL1A 2DBZA 4MCHA 1WR8A 3KFXA 1H4QA 4OI4A 3ZEIA 5EWJB 5KSPA 1VLJA 2ZKLA 3KUXA 4GBED 3CX6A 2XTAA 2YXPX 3DDZX 3HL4A 4H18A 5EIAA 3VR4A 1H9CA 1Q17A 2A30A 4QODA 1JXAA 2O8EA 1PYOA 2AOUB 1IBKB 3RASA 4B17A 1PL0A 3JVVA 3I5XA 3SBOA 4XGQA 1YQWA 1EIZA 1KAEA 2JD0A 2UXDB 2QLLA 3IDZA 5LDGA 2F1OA 3RF6A 1RQGA 3GLFA 4COKA 1U65A 2P6UA 1L5KA 2E85A 1KWGA 1U4NA 3W1EA 1J8MF 4DR2B 3VNRA 1D4OA 1P0FA 3BQMB 4NBUA 1ZUIA 2GN6A 3OT1A 3RYHB 2O52A 3DMYA 7MDHA 1NQTA 2GF9A 3HVHA 1I3KA 3EGDA 4LCJA 3FFAA 3L4SO 4NDZA 4W5OA 4BB0A 3R9WA 3GGDA 4U6QA 3G8AA 1J8DA 1RIFA 3SMQA 1E3MA 5HM8A 1C3OB 4CR8A 4OHXA 3U3KA 1I0LA 5HIMA 2PNFA 4C7KA 1YU6A 3H2BA 1U2DC 4IMPA 1QHGA 4UPDA 3TIFA 4DQKA 4JP3A 3LFHA 4HPWA 1OVMA 3A8TA 4RENA 2PVPA 3T3HA 1SXGA 3DZGA 2EF0A 1RWMA 3ED1A 4HQOA 4YJ2B 5AH0A 5KWEA 5K8CA 1EWRA 2LTAA 4HDRA 2W83A 1E4VA 3F3MA 3WTCA 3O73A 1XRMA 3C3KA 4B74A 2VQDA 1OHHD 2ZAGA 1OZFA 3B1XA 4MR8A 3C5EA 1VMKA 3ZK9A 4Q9IA 3M3DA 1NP7A 5HKLA 5K3BA 5DBEX 5K0NA 1R4MA 2FUG1 4KEAA 3VPAA 5AJYA 4E32A 1EVYA 2X0EA 1NE7A 1U80A 1AKRA 2C2KA 1V43A 3TL3A 3DDCA 5C8YB 5CLHA 3T94A 1SVNA 3EPJA 4FKMA 2ZSHA 3TOZA 2IJGX 2WAMA 4FYPA 4JJFA 2JEYA 1GG8A 3EARA 3RYTC 2UU9B 3BWYA 5SZKB 1CB7A 3D02A 2O50A 4FNAA 1WUTA 1I8TA 3SX0A 4HZUB 3E9DA 3SQDA 4ZHQB 3KYIB 1KYWA 1Z2CA 5B4VA 3ZWBA 2R1TA 4GZ3A 4O33A 2WQ6A 2V54A 1XHLA 1PL8A 3OX1A 2X9VA 3T06B 3DVAB 3HB4X 1JPJA 2XVMA 4UNQA 4CMGA 1DCMA 3HKCA 4MAFA 5EYPA 3IULA 4FI3C 3RU7A 4JEHA 5EN4A 4KMMA 2HZ7A 3T0IA 1PCXA 1VA4A 2FG6C 4Q05A 5CLLA 5BSWA 1E0DA 3U4IA 1NYQA 2GLTA 2ZQZA 3BK7A 2B7LA 3FX2A 4KITB 2X4IA 2GEJA 2DFNA 2QPOA 4YJGA 2YIJA 3NW9A 2ATVA 4FT4A 4UXHA 4A0QA 1AS3A 1RBQA 1SR8A 1Y33E 1P0PA 2ZWPA 1LDBA 2XIJA 5BV0A 5C8ZA 3QLEA 4K0KB 5ALQA 1XZIA 3UOWA 2V6FA 1GAXA 4FC6A 4V2UA 4RY8A 1RWOA 3AVUA 4CIDA 1TAUA 3K1ZA 3VNBA 4JD5A 1NVMB 1XPUA 2W6PA 3E8XA 2AA3A 6AT1A 4B3FX 3OZ7A 4MYDA 5IT5A 2QTWB 3BCSA 1FMTA 1RJWA 1QCDA 2P91A 3DT8A 1SA0B 4MQEB 2H0AA 3X3HA 4B4WA 2Z6UA 3T1NA 2F3TA 2JGEA 4C04A 3NHUA 5ELLA 1W36B 2QY9A 3NOOA 2NSDA 4DPMA 5BWCA 1NW3A 1Y7HA 3SF8B 2PLFA 4CNBA 2V55B 4ZKDA 3KKNA 4RESA 1MQ9A 4Q93A 3DCIA 2WWXA 1JG7A 3KPYA 3PF9A 3UUFA 4QL3A 3DSRA 4TWZA 4K9NA 1J07A 1JN0A 3VV2A 4DMCA 3V1UA 2YTZA 4XWKA 2ZR8A 4D25A 4WSOA 2CKMA 1DDIA 3ZIAD 5HHTA 1YZVA 2YNMC 4BNMA 3O4RA 4DREA 3GLIA 5AM3A 2VHWA 1EE1A 2I67A 3CVUA 4BNVA 1VL1A 3FIJA 3C7DB 2BBWA 4REOA 1SD5A 5JZVA 2AR7A 1GL3A 1FY2A 4CYMA 1X3SA 2GMWA 3L0DA 2C4NA 2PZ8A 3QKTA 1NVTA 3CUYA 4TMFA 2P35A 1HLGA 2F43B 1OLOA 2SHKA 2GJ9A 1SKUA 2FZKA 2RG7A 4RE6A 5PNTA 2W2KA 2ZSAA 4NKRA 1FRZA 1A7AA 1DZIA 1Y1KE 3RKSA 2FYTA 3F6RA 1NDQA 2HCRA 3KPVA 1A82A 1Q3HA 1QH8A 1GYPA 3GUUA 4UU8A 2G82A 2X1MA 4CL0A 3Q6MA 4JU9A 4H17A 4YWJA 1YVRA 1HE1C 2B99A 5JC1A 2DWQA 1LGYA 1YKFA 2CHGA 2R7LA 1ZJZA 2WKWA 4JJZA 3CPEA 4EGFA 1JAZA 1SHZA 2HZBA 3U4MA 4M0LA 1KFKB 1P62B 1E64A 1IZ8A 1T5OA 1ZSVA 2F6RA 2H1VA 2IKQA 1AV7A 2LKDA 3O38A 4FW8A 4YRCA 3NFRA 2O8BB 4PHCA 4LE0A 1Y6RA 3FTNA 2F9MA 2CLIB 3V2UA 3K6SA 3DM5A 3PLNA 3AJAA 4OD0A 1L5QA 4UEKA 1CB0A 3FRJA 5EZ5A 4IQ8A 1CIVA 3N2NA 3P0RA 5K1SA 1TVCA 4FLEA 4OATA 5H81A 4YRMA 1RI4A 2HBQA 1CRWG 5B30A 4RFSA 1K08A 3IEXA 1OOEA 3IMEA 2WWHA 3PP8A 2C8LA 4Q3KA 2OGSA 3DT9A 1YRWA 1HRKA 4C7XA 3IUMA 3WWPA 3H8SA 4IH9A 4WKCA 4D6PA 2Z9DA 2JAPA 2AFHE 2ISQA 1QPBA 2V4MA 1G1AA 1JI0A 3QEJA 3SJCA 3V1TC 4M7PA 3K9FC 3O4IA 2W2NA 2XMZA 2PKCA 3OZRA 1UZLA 1KOJA 1RD4A 2V8BA 4N8SA 2Q3CA 3TTWA 2BFBA 3AR9A 2F4VB 1HLDA 5FHRA 4NFSA 4AWAA 3SHQA 3W05A 3AZPA 4Z54A 2XNCA 1KMQA 1E9DA 3VQTA 2J9ZB 4CM8A 5F2NA 1TLLA 4P3OA 4ZJZA 4IQGA 2BGIA 4KQEA 4KE9A 4NJOA 3NJ8A 2PX0A 1R4NB 5JBIA 4OY3A 1QUEA 2VC2B 4ASUA 3U48A 1FVFA 2PE5A 1GQYA 4HGYA 3HYLA 1CE8A 2Q3JA 2WP0A 5JAHA 5IKMA 4BFUA 2WE7A 5KREA 1TA4A 4QDXA 4X3OA 4ETMA 3GRPA 1J0DA 3OETA 2YW2A 3DAPA 3EVEA 3JYLA 3CEHA 4M0UA 2C7QA 1YS4A 1LFDB 3SC6A 3DDNA 3GXBA 4MQ4A 4C4PA 3J80A 1QH9A 1S3GA 3MLEA 4UBMA 3ZZTA 2PBRA 4UBKA 1WXDA 2XT6A 1YS6A 2YXDA 5DNEA 5E1OA 2J5QA 5AHXA 1DWQA 4O29A 4LWQA 2XTMA 4II7A 4NOKA 4ML3A 4PLVA 2BSQA 1PG0A 3KAKA 3D2CA 2TMYA 2OV6A 3DE0X 4ZMBA 3QE9Y 3W5AA 4TRRA 1EGHA 2OHVA 3VR2A 3FSRA 1USWA 4RD6A 5IF3A 1LCIA 4UARA 1HG1A 3GEGA 4E7OA 3TVDA 1EXMA 2A9PA 4I9GA 2FQWA 5FUBA 4ARZB 1T6YA 4Q3OA 4IIBA 2IKSA 3V1YA 1YK0A 1I5RA 4RIGA 3BIXA 4QOJA 5J2TF 3ZE9A 2DF8A 1E1KA 5C35A 1ZD1A 4LWZA 3E27A 4MUBA 1FXWA 3BMNA 3W6NA 1SXJC 2JIBA 5M5BA 3QXXA 1YULA 3VTKA 2QXUA 2FW9A 1H1TA 5HCUA 3KKMA 2PX8A 3MNFA 2HBZA 4WKOA 1ZRMA 5IRCD 1L5OA 2I4IA 2KS6A 5EJMA 3ZD8A 4CG0A 4B2PA 2HDNB 1HT2E 1HM5A 3WGGA 4CIVA 1RAFA 4HYYA 5F77A 1Q84A 2CDAA 4V0SA 5B53A 3ZU3A 4DEYA 4F9FA 4HDMB 2ZWAA 5TC4A 3STTA 2ZE7A 1OH8A 3RVOA 2IGTA 5LZ2A 4RK0A 1XD9A 2VP2A 3NM4A 4CF4A 2AW5A 1ADJA 2C29D 3I72A 1JHAA 1VXOA 5T6BA 1KVQA 3SY8A 4KQXA 3TCKA 3UO8B 4EW6A 5AESA 4BX3A 1P1HA 1R10A 2BFFA 3UG7A 3W34A 4MHTA 1C8VB 1SMKA 4FLMA 3ZR4B 3TNDA 1XZMA 3D6UA 2JFNA 2OCDA 3UTDA 4ZYLA 1TZMA 1EZ1A 5TMPA 2CLKB 2Q7DA 3JQPA 4GICA 5C5CA 1TD9A 3FLBA 5FFNA 2VXCA 1IY8A 4EK9A 4FYIA 5FUMA 5KTOA 4JDPA 3LC2O 2XQVA 1B7GO 1PFQA 5LU9A 2JKVA 1SEPA 3T1OA 2ZUTA 4FGSA 4LCEA 3EEOA 1TUEA 4HYTA 4BX0A 1WQ3A 2NXEA 3IQIX 5BSTA 1MOQA 2P6MA 5IH7A 5IT0A 3PEYA 5BVGA 3SDSA 2JIDA 3QBEA 5LL6P 2BFCA 3A05A 4IGFA 1K2WA 3S0JA 1S0UA 1E99A 2WYUA 4RPJA 5I01A 2JBAB 1Q7RA 3O8DA 2YWDA 1KVRA 4GOMD 1YWGO 3EIXA 1XZCA 3ITKA 3JQGB 3LNTA 4XDZA 1ULHA 1REQB 5B6PA 4M53A 4XCXA 4AQYB 5FLYA 3N1UA 1Q1AA 3TO5A 1C4WA 1LXCA 2YXNA 1KSFX 2D0PB 3L6CA 2X1LA 4ARVA 1PR2A 1GGEA 1SQ5A 5JDIC 4GC9A 4D9HA 1WOYA 1MAAA 4BECA 1UH5A 1L1QA 2FPKA 3IAM1 3PPXA 4UAUA 3BILA 1Z06A 3ZDYB 2H4HA 3UK7A 3IC5A 2ASEA 2X5OA 1J99A 2BE9A 2FJPA 2HJVA 3BIJA 3ONDA 3DLPX 4TS3A 1S2MA 2VNHA 4Q1CA 5EXTA 2R6ZA 4GI1A 5B64A 3PHCA 2GDZA 5EFZA 3QJ5A 4H60A 3UFXB 5AW4A 3A1EA 2GCOA 3NKLA 3U6KA 4YEDA 1TJ4A 5JMPA 3SP1A 2O8VA 1HC7A 2YKGA 4ZO7A 1FX1A 3OIFA 1RLJA 3MCAA 4BNUA 5A2QA 2HJHA 2XUAA 2AOTA 3SCZA 1Y8QA 13PKA 2I76A 5L4SA 2P5TB 3DEYX 4RCYA 1II8B 3FW1A 2NADA 4J90A 3TH5A 1QVVA 2C8VA 3L8HA 1U99A 1QHNA 3IR6A 4QQRA 5GAJA 1XRJA 2BHNA 4QXMA 3C15C 3EZLA 3KE9A 5HR5A 5GONB 1GPLA 3IRVA 4MLZA 4KJXA 1QG0A 3KHTA 1ZMOA 1DKPA 1BMFA 5MHTA 4Q16A 5DLDA 3NTUA 1ZCFA 4FW9A 1P61B 3V1MA 1T0PA 2MSCB 2DPMA 3IQFA 3VKWA 4DCMA 1ZI8A 1QDUA 2NU8B 4D3FA 4NDNE 5J1SB 1BEUB 1PWXA 3C3CA 1F6WA 1W5EA 2MSEB 4O59O 3HA5A 3WLKX 5KPJA 2AJTA 4ZCQA 3RFTA 3HCCA 3IA7A 1O94D 1BVRA 4FDMA 4C3ZA 5EHZA 3F4KA 4LRSB 4CJXA 2CBXA 1BWSA 1UCFA 5DFAA 3HU3A 3QEMB 4YI3A 2P6NA 5ALWA 3TSAA 2NYAA 1Z12A 2IBSA 2XUHA 1EMDA 4FR2A 3C45A 3DZKA 4INOA 2ATXA 4LYGA 1DV2A 4TVSA 2OLJA 1AF7A 2DKOA 3R5XA 4XD7A 5L7YA 5TF4A 4GQBA 4C88A 4M1SA 4ZV4A 4OAPA 1H85A 4J0QA 5HSGA 4N6NA 4YUWA 1XWWA 1BFKA 4LF7B 4URVR 3WL8A 4UM9B 3UAYA 2NO6A 1JFFA 4BQQA 4EP1A 2E82A 3AETA 1T34A 3THXB 5K1ZA 3M33A 3ADOA 4ZC8A 1T4CA 4JZYA 4CQMA 3ITEA 4EYKA 1S2OA 3H04A 4GBGA 1IXSB 3IPXA 1A96A 4M8SA 3R7WB 3TUIC 3WDLA 4EZBA 2VQFB 4DKJA 3UMRA 1YQXA 1NHGA 5CIQA 4K9MA 3PUYA 3KU1A 3OICA 3V7WA 4GOLD 4BBZA 1LH0A 3H4VA 5F76A 1Z28A 2HLNA 3B36A 2IUTA 1DC7A 3AO0B 4RO0A 1IRXA 3PITA 5EZYB 3TLJA 3W8FA 2B2NA 4MO9A 4S3MA