1PL8A

Human sdh/nad+ complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
356
structure length
356
Chain Sequence
AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords human sorbitol dehydrogenase
publication title X-ray crystallographic and kinetic studies of human sorbitol dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 121
structure length 356
sequence length 356
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.14: L-iditol 2-dehydrogenase.
pdb deposition date 2003-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pl8A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1pl8A01
3ANMA 1DHTA 1PGJA 3TSCA 1EUDA 3BTOA 4CMEC 4L73A 3KTDA 1BMDA 4IDGA 1U3TA 4WECA 1RM4A 3U4HA 4DQVA 1ISFA 1YB1A 2PV7A 3DB2A 3HG7A 3QVTA 4CQMB 1PZFA 3DAPA 1BVUA 1YB4A 4CMAA 4I9UA 2QHXA 2D2IA 4WLFA 1MGOA 5U4QA 2E48A 4CLEA 4CMIB 3JYQA 4UULA 2VWGA 1PJTA 2VRBA 2NQ8A 1PS0A 1YL5A 4PIVA 3K2EA 2O48X 3VDQA 3GDOA 2YV2A 1PL7A 5G0UA 4WNIA 4C4OA 3K2BA 1LRKA 2JJYA 1AN9A 3FWZA 2WJPA 3A4VA 3I23A 3KSZO 3QWAA 2CY0A 3E18A 2FR1A 1JKIA 3AI1A 4XYGA 3GAZA 5B12A 5DP2A 1NFQA 2CF5A 3BMNB 3RFXA 3EY4A 1I3NA 2VQ3A 3H2SA 4KTTE 5LCXA 2PGJA 1AE1A 4WOKA 3TN7A 4A03A 2Y1EA 4BB6A 1DLJA 1GYQA 1NXQA 1DRVA 4I5DA 3PEFA 1VJ1A 5TLSA 1E1LA 2OORA 4LGVA 2DBVO 4HNHA 4BNJA 5G4KA 3LVFO 5ADHA 1E5LA 1PZGA 5JYEA 4MVJF 4BKUA 1ZBQA 3ROMA 3KB6A 1E7SA 2X0IA 4NFYA 4TROA 1FF9A 3ADPA 3MJCA 2G76A 4AJNA 1Y5RA 5DCYA 1Y6JA 2H6EA 3GDFA 3IJPA 3BHIA 2Y93A 1C1XA 1DDOA 1YBMA 2GASA 2X8LA 1E7QA 1K6IA 3PQFA 1GCOA 3MJTA 5I7FA 3PJEA 1LSJA 1DAPA 3JD0A 1ZCJA 1T4DA 3P2YA 4EUFA 1Q2XA 1CQIA 1P1KA 3GRPA 3ZWWA 3E6AA 2P4QA 3VKVA 2LDXA 3ASVA 3ZU4A 4Z3KA 1U3WA 3DHYA 3WX0A 1DAOA 5LDGA 1HWYA 2NVUA 3ROPA 1KEPA 3RBZA 1ID1A 5F1KA 1MC4A 3QA9A 3PHJA 1L1FA 3UXYA 4E13A 1LQUA 5DT9A 2ZYGA 5BSFA 1A27A 1HZZA 5T6BA 2R00A 4W7IA 5JW6A 3WYCA 2CDBA 4YT4A 1ZIDA 5DP1A 3S2FA 4FFRA 2EJVA 4IPTA 4KTVE 2O50A 2DT5A 4GSKA 2HK9A 2CD9A 1ZH8A 5F3RA 2OMEA 5DOVA 2E37A 3IAHA 1ZJYA 3L4SO 2OGUA 4RQTA 2WDZA 2BKAA 4ZRMA 2E49A 1ADBA 4XRGA 1QYXA 3PYXA 4D46A 1TI7A 2CDAA 2IYOA 1C1DA 3O4RA 3QV1A 4H7PA 1Q0QA 3EDMA 1MG0A 4P4NA 4PVDA 1WWKA 1X14A 1Y81A 2ZTUA 2GYYA 4XEHA 5COAA 2NSDA 2UUPA 4ZQGA 2JL1A 2Z1NA 1S6YA 3CTMA 5A9SB 3TFQA 3VTZA 4DYDA 3GLQA 2NNLD 3TQHA 5HBRA 1Z7EA 2UUOA 3GAFA 3B1KA 2X58A 4F45A 3H9GA 2Y67A 3WFIA 1SNYA 5DOZA 1NQ5A 1YBAA 1JAYA 2AA3A 5L40A 4N18A 3VZPA 2WE8A 5G0SA 5G2OA 4BNZA 4D44A 5IXYA 2X5OA 1B15A 3NDRA 2HMVA 4BO8A 3Q1LA 1IYZA 3DAFA 3PTZA 2UAGA 1N1GA 4M49A 4OKIA 4DGSA 3KXDA 3GVPA 3P2OA 2HMTA 5DN9A 1ZSNA 3G3EA 1VRWA 4U0JA 3TL3A 1QMGA 4MVJM 1ADCA 1PJ3A 1HE4A 1P77A 3JQBC 1VJTA 5F1PA 5CPFA 2GCGA 4OO3A 4BIIA 1GY8A 3DZGA 3NTQA 4MVJE 3EZYA 3VH2A 2ZTMA 3WGGA 6ADHA 1TT5B 2Y05A 3OJOA 3GN2A 4P4LA 4Z9FA 2EKPA 4J1SA 2XAAA 5EQFA 2W2LA 4AJEA 4BKPA 3GUCA 4S3MA 4BO0A 2GN6A 2VZ9A 3MOGA 4Q3AA 2X9NA 4PN3A 4I5FA 1PGOA 3SJUA 4DBZA 1I24A 4H16A 4NFSA 1ADFA 2I3AA 3H5NA 4EEZA 1M76A 3WLFA 3ZWVA 4EW6A 4EZBA 3PQDA 2O4UX 4PLCA 3JQDA 4EUHA 1A7KA 2EG9A 1R0KA 2YDXA 3H9UA 5BR7A 4NBUA 1L7EA 1HF3A 1SAYA 1WLYA 1N92A 2VCYA 4PRLA 5B1YA 1B26A 1BWSA 3PDJA 4YEDA 3ZH2A 4CLOA 4JCOA 1CYDA 1H94A 4YCAA 2DM6A 2FZWA 2RIRA 3DBLA 1J5PA 3G49A 1NPTO 1U9JA 2BGMA 4LRSB 4MOWA 3NGLA 1E3JA 3UCEA 1XYGA 1F12A 1RPNA 3IC5A 3LQFA 3K30A 5K6AC 2FOIA 4PG6A 1LJ8A 1RM0A 1RYEA 4AG3A 1V3VA 4R5MA 2GLXA 2BLLA 2DUUA 1XQ1A 4LVUA 1VSUA 1JKFA 3PFWO 2AEMA 4W6ZA 1QG6A 2QYTA 4D3SA 1IE3A 3DQPA 4ALIA 4CJXA 2C7GA 5ITVA 2VYVA 4OMUA 1HLPA 4OSPA 1GZ6A 2FY8A 3ITKA 3LC7O 3AUSA 4M86A 3JYOA 4NFHA 1IOLA 1ARZA 4KMSA 4RDHA 1ULSA 4BGIA 1WZIA 3JD3A 2Z5LA 1PQPA 3RD5A 2QRJA 2VT3A 2DAPA 2Q2WA 3BTUA 1ORRA 1P1IA 2WD7A 3H9QA 4F6LA 1ZZEA 3WDSA 4CQMA 1CDOA 5IN5A 2D3TA 4BNYA 4IDEA 1DIAA 4J91A 2PK3A 3TF5A 1V3TA 4B7XA 4IBOA 4PLPA 3H6KA 3O26A 1QYWA 4YA6A 3WNQA 2BGLA 2E82A 1K89A 1JVSA 1HEUA 4G2NA 2B4TO 1O9BA 1QLHA 4D3FA 1LC3A 2HRBA 4L74A 3W4IA 4P38A 2BD0A 3OJ0A 3GRKA 4HADA 1D7OA 2PZJA 1LDBA 2AW5A 4DXHA 2NTJA 3FF4A 3DTYA 3DZHA 4WGGA 4P22A 4YRBA 3LT4A 2EIHA 2HLPA 1LX6A 2V6BA 4CL8A 3PWKA 4PLWA 5L51A 3WQSB 2JFGA 4WCFA 4PLHA 4NBVA 4HFNA 2JD1A 3DDNA 3M2TA 1SO8A 1V8BA 3Q9UA 3L6DA 4WLNA 3UUWA 4PVCA 4MVJH 2X9VA 5BNTA 1UP7A 4RDIA 3QW2A 4K6CA 4NR0A 5EINA 1MUUA 1PJCA 1FXSA 2GZ1A 4E2ZA 4MVJI 1YO6A 3U09A 3U49A 4R1TA 3IL2A 2FZEA 1IULA 1EVZA 4DYVA 1ISIA 1E3EA 4NU5A 2I76A 4RPLA 2Z1MA 1MFZA 3D7LA 4BHTA 4ZU3A 2ZCVA 5TRTA 1X7HA 2A92A 2I67A 4KUHA 2E6UX 4TKLA 4EJMA 3UICA 5K0ZA 3ZV6A 1B2LA 1HYEA 4GL4A 4XZ3A 1BTOA 5A02A 4ZJUA 3VH1A 3GVCA 1I32A 4XQGA 3BTVA 2WE7A 1H2HA 3OQ1A 1BW9A 2DPGA 3E8XA 4J1TA 3TZHA 5CPBA 3M1AA 4G65A 1YXMA 4R16A 5KVSA 3EYWA 5AXAA 5ICSA 3ASUA 2GD1O 3UF0A 3DO5A 4RF2A 5JO0A 4UUMA 1U7TA 1IZ0A 4IMRA 4K6FA 3WNVA 1LDYA 1EK6A 1YL7A 1PS8A 3ONDA 4BNIA 3LU1A 4HKTA 3AY6A 3EC7A 1YQXA 2DU8A 3OH8A 4PLFA 3MTGA 2Y1FA 1EFKA 4XX0A 4E5MA 4TRRA 4XQCA 3PXXA 3CE6A 4DQUA 4CR8A 1EEHA 2Y68A 3RC9A 2SCUA 3WJ7A 1I3KA 5KJCA 3RU7A 1HXHA 1SMKA 4IS2A 2W2KA 3S2EA 1DIBA 1UXHA 3ICCA 3IMFA 4ALLA 3OF2A 3JTMA 3OIDA 1UJMA 5AVOA 4EUEA 1NFRA 1MC5A 1UP4A 2X0RA 4YQYA 4BNXA 1EDZA 1WVGA 4HBGA 3DMTA 3MWEB 5A9SA 4W99A 1T2AA 3NT2A 4ALMA 4GGOA 1I33A 4E5PA 4MP8A 1NFFA 4NHEA 2OO5A 3DZJA 5KKCA 2B5VA 1HKUA 2FHSA 3UN1A 2QW8A 2WTBA 4U6SA 4PG5A 5G4KB 1X0VA 4UUOA 1LBEA 4DIOA 5K9ZA 4XGIA 4BS9A 2EWMA 5TT0A 3GHYA 1EVYA 3SBOA 2ZYDA 1B14A 4B3IA 3I5MA 4BO3A 2O4CA 1N9GA 2EKQA 2DPHA 3LZ6A 2GN8A 4FGWA 3ENKA 4CM3A 1HT0A 4YTEA 1AHHA 4UAGA 3WYBA 2C7VA 3BMOA 3LC1O 3Q9NA 5A06A 2JHFA 3WSWA 2QZZA 4PZEA 5EN4A 1UDBA 3D4NA 1ZXLA 4IXTA 4YT2A 3CPSA 3VZQA 2BMAA 4IJWA 5CFZA 5IN4A 1UXGA 4FCCA 5DBGA 3TOZA 4XIJA 5FEUA 4Q3DA 1NHGA 2PTGA 1K6XA 1SEVA 4IS3A 1H9AA 5FFFA 4BNKA 3C7CB 4BNWA 2Y0CA 4XQ9A 2DKNA 1LNQA 1BG6A 2YV3A 3ABIA 3ZI0A 3AU8A 2P5YA 3GA0A 2X5KO 1DOHA 2W98A 5I9LA 4CM4A 3WBBA 3WWYA 1PJBA 2DTEA 1CWUA 1KVUA 4UREA 4GH5A 4ZQBA 3LF1A 3QLJA 4CMGA 4XGKA 3JYNA 5H83A 1BXZA 1WXDA 3U4CA 3VKUA 1T2EA 2OUIA 2WMDA 3WG9A 1EDOA 2P2SA 1JWBB 2PKQO 1UZNA 4L76A 4DTIA 1E3WB 1SB9A 3K8ZA 1KOLA 5HM8A 3I9LA 3CUKA 4LW8A 3FPLA 3GNQA 4WUVA 4XR9A 2RH8A 2Q1UA 3AU9A 3FHLA 4NZ9A 4YR9A 2I99A 1G0NA 2GERA 3H3JA 1J49A 1GD1O 1HDCA 1QYDA 1W8DA 2RHCA 1Z74A 3BA1A 3KO8A 9LDBA 3KBOA 3RUEA 1O0SA 4KUGA 2NVBA 3INTA 4DIBA 2EJWA 1DIGA 3GVIA 4MIOA 1ZW1A 1NX6A 2HO5A 3C85A 2Z95A 3U5TA 3WQQA 3NGXA 1E1MA 4Q3NA 3KHUA 4AVYA 5IDXA 3NKLA 4HXYA 1JQBA 3FN4A 1HTBA 1ZUD1 3BYZA 1ZKMA 2YHUA 3ITDA 3S2IA 2Q1TA 2RHRA 2BHLA 1SEPA 4E5KA 3OM9A 4R41A 2ZJ1A 4WLOA 2X22A 3OJFA 1I3MA 1I2CA 4BMSA 4M8SA 1XU7A 4U6QA 3TRIA 2Y99A 4WLVA 1ADGA 4FJ0A 1WW8A 2Q49A 1NHWA 4RPHA 5T8KA 3PI7A 3RFTA 3CMMA 5A9TA 1BSVA 3JV7A 3TZQA 5DZSA 1V35A 3JD2A 5IF3A 2OP1A 3I52A 4WOJA 5EPOA 1I2BA 3RFVA 1HYHA 4BO5A 4NK4A 2C2YA 2OOSA 4J49A 1FDWA 4WLUA 1XHLA 3N58A 4Q3BA 4RVFA 2I65A 3F4LA 3WIDA 1BDBA 4O59O 4CPDA 1UXJA 5IAAA 3PK0A 4IUYA 4AJPA 2DBZA 1ONOA 1V3UA 4AJ4A 1BXKA 4U7WA 5I7VA 2H63A 1GQYA 1Y1PA 3WGYA 2YY7A 1YB5A 2O2YA 3IDSA 4BOYA 4CLOB 4DLBA 1GEGA 1F8FA 3PZBA 1NR7A 3S8MA 3DBLB 5C7IO 3PYMA 4M1QA 4WCDA 3WIEA 4JLWA 1GV0A 1E5QA 4GVLA 3UVEA 2WWRA 3KOUA 4A2CA 4K28A 5CEEA 4BNFA 1U2GA 4E4YA 1Q0LA 2ZKLA 1AHIA 3K31A 3D4OA 3DHNA 4WNCA 1C0PA 1DFIA 1TXGA 1VC2A 3TL2A 4A27A 3U9LA 4W9NA 2VOJA 2OP0A 4ND3A 3L0DA 4RVHA 2B35A 3ETEA 4EBFA 4J2OA 2EW2A 1O95A 1SOVA 1U8FO 3RC7A 2GUGA 2GGSA 2V6FA 1NAHA 4O5OA 4E5YA 2A9FA 4RF3A 3DOCA 1A5ZA 2XF8A 4YRAA 4MINA 8ADHA 2D5AA 4KOAA 3DZIA 2BFOA 2W8ZA 4CUJA 1UXIA 1XEAA 4CLRB 3FCOA 4IGFA 4BNGA 3DWFA 3D5QA 2AG5A 2WD7B 2CVZA 3AY7A 3PLNA 4LVCA 2R00C 3A06A 3GN1A 1GAEO 3JQAD 2EHDA 5CDSA 2IDZA 5CDGA 3DHEA 4R54A 5JS6A 3UAGA 2POQX 2JD0A 2JFFA 4CMKA 3NT4A 5A05A 2HRZA 3GQVA 2PKQP 3DXFA 1UP6A 5JAQA 3VAZA 1YQDA 1LUAA 4YT8A 1HSOA 2JFHA 1T26A 4GI2A 1H2BA 4DBVO 5FYDA 4BO4A 4EJ0A 3MJEA 4C7JA 1GFSA 5A03A 1B3RA 5TT1A 1RJWA 5U1PA 1LC0A 1NQTA 5EIOA 3VH4A 5DCUA 3WS7A 3OHSX 4QTZA 4NBRA 5H81A 5JAZA 1GL3A 3ON5A 2Q1SA 4ZD6A 1FDVA 3RUCA 1O94A 1AXEA 3IP1A 4PLTA 1PWXA 4WJZA 3WXBA 4FD3A 3EZLA 3DFUA 3NRCA 4DLLA 2AE1A 4JN6B 3T4EA 5A3VA 1VL8A 3HN7A 4WCFB 2BI7A 4URFA 3F47A 4PZCA 4OSOA 3PP8A 2P9CA 4EDFA 3S1LA 2HK8A 5KVCA 3NEPX 1D8AA 2B4QA 1EUCA 4BO7A 2VHYA 3D1LA 3A28A 3K5PA 1SC6A 1GUZA 5AXCA 1N2SA 4D45A 3AJRA 4IDCA 5JPIA 2ZQYA 2YJZA 5F1OA 5C7LO 1VI2A 1PWZA 3L6EA 3LLVA 1X15A 3C24A 1ENOA 2VNSA 2NQTA 2ZTVA 4IIVA 3ULKA 4IINA 3WICA 3P7MA 4J4BA 5IDWA 3CZRA 4N5NA 4AJIA 1P3DA 2VYND 4HV4A 1GQ2A 4O1MA 4RVSA 4RF4A 1YH3A 1PJSA 2G0TA 3PJFA 5ES3A 1BW9B 3N7UA 1N7GA 3E1KA 3RKRA 2CF6A 1UXKA 4LK3A 4ZQHA 4D42A 4F6CA 4D41A 1RYDA 4ZHSA 1TVEA 5FI5A 3PDUA 4XKJA 2CZCA 4TRJA 4B7CA 5GZ1A 4D3DA 1JA9A 4GQAA 4ESOA 3B6ZA 4YJFB 4CM7A 3QQPA 3WFJA 4IY1A 4U0KA 4BL5A 1ZK4A 4J6FA 2FR8A 1DC4A 5KJ6A 4HFJA 4NBTA 4D79A 3ZWNA 4J7UA 2Q1WA 3GDGA 3JSAA 4JROA 1K5HA 2ZYAA 5EMHA 2Q50A 3KLMX 3ZWAA 5LC1A 3NV9A 3WGZA 1KVQA 3AM3A 3RC1A 4CMEA 3DAGA 1YJQA 2W2KB 3GPDG 2HAEA 3MOIA 5B4TA 1GUFA 1E3WA 1JDJA 1H0KA 3E9MA 1ULUA 1GEEA 1PTJA 3U4DA 4E30A 1ZMTA 3H5AA 3PHIA 2DQ4A 5L95A 1I01A 2QIOA 3ZDFA 2WEKA 2DUWA 1PZHA 3RUFA 3D0OA 3IQDB 3VH3A 1Y7TA 1R4MA 3E9QA 3WR5A 5G4LA 3GG9A 1QV6A 4O0LA 5K1SA 1QYCA 3MWDB 4E31A 2WYVA 5KIAA 1ENPA 4OQZA 1ENYA 4O63O 2J5QA 4QO8A 4DA9A 7ADHA 1B8PA 1WAMA 1HE2A 2HJSA 4JJGA 1XIVA 4NJMA 1I8TA 4CM1A 4Q3CA 3OJEA 1D4FA 5U9CA 1NVTA 1XQ6A 2GF2A 1PZEA 3QVXA 4TMFA 1N9GB 4GWGA 4I5GA 1YOVA 3BMQB 2EERA 4RCVA 1H6DA 3BMOB 1YRLA 2VTDA 4YB8A 4YRDA 1YVEI 4K26A 4CM5A 4Z0PA 4KQWA 3E03A 2CUKA 3JYPA 3FNHA 3MJVA 1CJCA 1LSSA 3C1TA 2IXAA 3SXPA 4J90A 3H65A 5COQA 2FMUA 1HYGA 2WD8A 1KEVA 2D59A 3E48A 1KEUA 2PD4A 3GEMA 3M1LA 3KYCB 1MXHA 1YQGA 1E6WA 3GZ4A 3JQ7A 5EL0A 1C3VA 3ZWBA 4CM4B 1O6ZA 1XLTA 3KRTA 4B8WA 1IUKA 1EVJA 1OFGA 4YAEA 2X9GA 1E0DA 3P19A 4RO0A 4Y6PA 4E21A 1A9YA 4XJTA 3C7AA 1B0AA 5JBIA 4L8VA 3V1YA 3HSKA 4MDHA 1ZFNA 1JAXA 2D0IA 2ZQZA 3L9WA 3OQBA 4DPKA 1PEDA 3RUIA 5L45A 1A4IA 1T4BA 3D4PA 3OEWA 4IJUA 2QYSA 9LDTA 1HDRA 2FSSA 3GG2A 2FPIA 4JXKA 5GZ3A 1GV1A 1VKOA 3OECA 1NNUA 1Q0HA 2ZB4A 1SBYA 3TJRA 4YXFA 4JNKA 1HRDA 3PVZA 1IHXA 3G1UA 5TSDA 3RUHA 2OL4A 3WGTA 2FN7A 4BNMA 5CDUA 2V6MA 4B8ZA 2C20A 3WSVA 3GGPA 2UYYA 2DLDA 4RLHA 4BV9A 1PU2A 3PWZA 5TIIA 1GPJA 3RBXA 3ZNOA 3E5MA 4JX8A 4IGEA 1T25A 4GX2A 4L4SA 4FS3A 2OBNA 4TZKA 5LDHA 3PIDA 3H9EO 4MIYA 4FJ1A 4FFPA 1DIRA 1QRRA 4J0FA 4YVFA 4OXNA 5JE8A 1EMDA 1KC3A 4FR5A 3NX4A 4I9HA 2NV6A 4H3VA 3R0IA 3UGKA 5J23A 3ETDA 2EP5A 4M87A 2HK7A 3PLRA 1T2DA 3JQAA 4QECA 1R0SA 1VM6A 3H4VA 4L0QA 4MKXA 1O89A 1QV7A 1L7DA 3NYWA 3JQ6A 5TJHA 4CLRA 4CLXA 5KVVA 1P74A 3BZUA 3D64A 1LDMA 4CUKA 1LLCA 3AM4A 1NTOA 5EERA 1A7AA 5TNXA 4FJ2A 3W1VA 3QE3A 1M66A 1P31A 2H5LA 3PGXA 1YL6A 1XA0A 4TKMA 4YYZA 2J3IA 4BGEA 5KNLA 1OZAA 1PGQA 1LQTA 3I6IA 1PQWA 1M67A 2Y1DA 3JQBA 3SLKA 2P9GA 1B8UA 4GVXA 4CL3A 5JFOA 2XXBA 4BNNA 3Q6IA 4FPXA 4YJHB 2VOEA 3TZKA 1YE3A 3KVOA 4WK6A 3VPFA 2UV8A 3UH1A 4CV0A 2EXXA 3INGA 3V2GA 4XD2A 5TC4A 5L3ZA 4BO1A 1DJNA 4RV9A 3C1AA 1I0ZA 2YQ5A 5IZCA 3B20A 3ROKA 4GX0A 1ZK1A 4DMMA 1B3BA 2O23A 1I5RA 4TVOA 5F21A 4IQGA 3WMXA 2V65A 4MVJG 2W4QA 1KS9A 1YDWA 1N8KA 4YBZA 1H9BA 1X1EA 1TEHA 3JD4A 4H15A 4L9RA 1F06A 2C5AA 5TQVA 5HTOA 3HB5X 5DF1A 4AJKA 2O3SA 3ZN2A 2NU7A 1B8VA 3T7EA 2X0NA 4W7HA 3ZNNA 3O8QB 2PZKA 2VYNA 1O8CA 5C5IA 3UFXA 1P0CA 3M6IA 1HDYA 2PGLA 4CV1A 4YAJA 1E7MA 4DRYA 4YACA 1NPYA 4U5QA 1KVTA 1EVIA 3AY3A 3F9IA 2ZIZA 3ZNPA 3I9NA 1Y9AA 5AYVA 5L7YA 3VVBA 4MVJP 3F1LA 4R1NA 4FBGA 4FFLA 2HMUA 2C29D 4Q9NA 1HZJA 2HMSA 2PH5A 4R69A 2DC1A 3G79A 3WOHA 1CEQA 2J3HA 3CMCO 1GADO 2VRCD 1FDUA 4IDAA 4AJHA 5JDCA 3RIHA 5HS4A 5L7TA 1Y8QB 2ZB8A 2ZATA 4GKVA 1Z73A 3BTSA 2RBEA 1AXGA 3V1UA 2P9EA 1UDCA 4LN1A 1UR5A 4YJFA 4J7CA 4YAKA 1SCUA 1E3SA 3LT1A 4NIMA 4BMVA 5JYDA 5HWSA 3I83A 1X0XA 4D0RA 3VVCA 2GSDA 5L9AA 2VWHA 4XYBA 3WQRA 4G5HA 1G0OA 2F00A 4RVDA 4UVDA 4DC0A 4HUJA 1IPFA 1ISMA 1KIFA 5AOVA 3D5TA 4BO6A 2B5WA 3ANLA 4UVHA 4LCJA 4BKOA 3N74A 4TSKA 1HSZA 2YYYA 1CF2O 2YFQA 1P44A 1Q7BA 4GWKA 3FI9A 2RCYA 2YHIA 3IS3A 4NJOA 1YGYA 4DC1A 1Z7BA 3AOEA 3TDKA 3HUDA 4P4GA 2BH9A 3OQ6A 4R1SA 4B79A 3T4XA 4HP8A 3SLGA 3H5RA 1T1SA 2O3RA 1EZ4A 1X7GA 4CV2A 4ITUA 4IQ8A 4J9VA 5CDYA 4NDNE 3IOYA 1R66A 3DONA 3QVWA 3L77A 5JCJD 3DBHA 2HSDA 2IEDA 2Q4BA 1TA4A 3WGQA 1TB4A 1ZSYA 2CDCA 2NWQA 1P1JA 5A5FA 2DFVA 3FNEA 2G5CA 3DFZA 3WTBA 4BKQA 3FR8A 3L4BA 3WTCA 3GOHA 4UUPA 1DC3A 3U4IA 1DFHA 3WGIA 1R6DA 3R6DA 3TPCA 4BO9A 2O7SA 4XYLA 1NYTA 3VHRA 3AFNA 3IUPA 2O3QA 2NU8A 3BMQA 3EAGA 1YS4A 3QJ5A 2ILTA 4E5NA 1RM3A 3EVTA 4RZHA 4GX5A 4GMFA 4XJSA 2AEJA 2IEBA 5COBA 2O2SA 1JKJA 3GC6A 1GPDG 4E3ZA 2OZPA 4CM8A 2YV1A 1QR6A 3DBRA 3DZBA 3PZRA 1K0UA 3KZVA 1KY4A 2EF1A 3KYCA 3LYLA 4INAA 4X54A 3STHA 5G0TA 3KM0A 2X1HA 3ZU5A 1NR1A 4IIUA 3JQFA 4BV8A 3NDIA 4NBWA 5JC1A 3KEQA 1MFPA 2IYPA 3NJ4A 3KYDA 2WM3A 1DO8A 1HE5A 1PR3A 1WDMA 4L4RA 4ILKA 1KVRA 5KJEA 5KOIA 1UAGA 1MB4A 2Q2VA 4QUKA 4IJVA 2WYUA 4KUEA 3OFSA 4OYRA 1KC1A 1KY5A 3AFMA 1FK8A 2X4GA 3R3JA 5L53A 4R68A 2GZ3A 2LDBA 3O38A 3VOSA 3ZV4A 3K73O 3DTTA 3W8DA 4LCEA 1R16A 2YDYA 5A1TA 1D3AA 1QKIA 1R4MB 4I08A 3KLPX 2NTVA 3OETA 5THKA 4BUCA 2JCVA 4PCVA 1PSDA 1CQJA 1K6JA 4AICA 5I9NA 4DL9A 4UEKA 3ZU3A 5JAMA 3AUUA 3BMCB 4GLOA 1VL6A 3H8VA 2A4KA 1LRJA 2DVMA 4NJMB 3K6JA 4W9NC 4KWIA 3DR3A 1M2WA 4RVUA 1TLTA 4GLLA 2FRDA 4B3HA 4GBJA 1WZEA 3O9ZA 3RASA 4DMLA 4AL4A 1YOVB 5DDIP 3RUAA 4WE3A 4D0SA 3C7DB 4CM6A 4UVIA 5CHEA 2X6TA 3HE3A 1W73A 3PHGA 1U7HA 4B4UA 4J4HA 4PGFA 1Z6ZA 4ZQFA 3NAQA 2FPGA 4UEJA 3SC6A 5L4NA 1ENZA 3I6QA 2J5KA 3RJ5A 5IFLA 3H3FA 2O7QA 1RWBA 4FIZA 4EJ6A 1PJ4A 3NTOA 2UVDA 3CXRA 5DBIA 3NT5A 3VZSA 4A10A 3WJAA 1BGVA 3E5RA 1KETA 4IDFA 1Y9EA 4AJ1A 2EV9A 4B7UA 2VNAA 1F8GA 3JQ7B 4XDYA 3V8BA 1QSGA 4CUZA 2J6IA 3HJAA 5CEFA 4RF5A 5F5LA 5TX7A 4EGFA 4ROSA 4YJHA 4OOEA 3HFSA 5ENDA 2AEFA 2HUNA 5IXSA 3RU9A 2JAPA 2FSVA 4R4JA 3FBTA 4OXKA 1E7RA 2O3JA 3CKYA 1LTHR 5HRUA 4DQXA 2X5JO 2QG4A 4IM7A 3Q2IA 1HL3A 3KSUA 4PG4A 3A1NA 4Z3DA 1KEWA 1AGNA 1U3UA 3DOOA 4J7XA 4LMRA 4UVGA 3RCBA 5IZ4A 2CFCA 3ZU2A 1QXSA 1Z75A 2C82A 5F5NA 3WBFA 3QWFA 4Q3EA 5GY7A 1GZ4A 2W2LD 4NH4A 4F46A 1XWFA 1ISJA 4EEXA 1JTVA 4NG5A 5BNFA 4OOFA 1NQAO 3ZWMA 3O8QA 4WKGA 5GZ6A 2NM0A 2PD6A 3HB4X 2GN9A 2B37A 1C0KA 1XCBA 4PZDA 5CP8A 4GKBA 5IDYA 5I8ZA 4B4WA 5G0WA 1ONPA 7MDHA 3JQ9A 2DTXA 3IKTA 2VRCA 3VDRA 4MJLA 3R1IA 2HJRA 1PR9A 3JQCA 4FOOA 4NI5A 2FP4A 4GX1A 3CINA 3GUYA 5JDIA 3JQAB 3F46A 4II2A 5JCXA 1DXYA 4CR6A 4JBHA 1T24A 5B4UA 2X86A 2VWPA 4FSHA 4PRKA 3GK3A 4XWYA 3X2FA 4MO2A 4GGPA 1R0LA 2JAHA 1XSEA 3WYEA 3GNTA 3U0BA 4M89A 1I2ZA 1Y8QA 1IL0A 3GT0A 1MLDA 4CQLA 2Q46A 3SJ7A 3E9NA 1XR3A 3VTFA 3AM5A 5AXBA 4A0SA 2IZ1A 2YFHA 3EVNA 3F5QA 5EESA 4A5OA 2W90A 2NTNA 5JY6A 1V0JA 4PG7A 1H6CA 4ALKA 3RUDA 3ONEA 1WDKA 3SVTA 3R3SA 2VYVD 4RPJA 2BF7A 5BNIA 2X7HA 3I4CA 4XA8A 4DWVA 4FB5A 2Q3EA 4W82A 1E1NA 1E7WA 1B16A 4FQ8A 5JCJA 4CLHA 4L75A 2YZ7A 1GU7A 4WEQA 3W6UA 1DHRA 3I3OA 2NUAA 2EW8A 4MP3A 4DPMA 2A35A 1E1KA 3QP9A 4XYEA 2C59A 4MPDA 1UZLA 2B0JA 1I10A 2VWQA 3GZNA 4JQCA 3JQGB 5THQA 4CQMD 5CAEA 1PIWA 2P68A 4J43A 1WP4A 2PWZA 4AJJA 4NNJA 3ZV3A 2O3UA 2UDPA 4FC6A 4IMPA 2AXQA 3OBBA 3GMSA 1JWAB 5DNAA 3D3WA 4PLGA 1ZNQO 4BNUA 1SPXA 3UHAA 3PQEA 2VHZA 3ONFA 1VPDA 1R12A 4AJLA 1YKFA 3PWSA 5ER9A 1T1RA 4Z0TA 4GMGA 4XYMA 3EK2A 4Z9YA 3PJGA 3RKUA 1X1TA 3ZWYA 3RBVA 4KZPA 3GFGA 1P1FA 4BO2A 4BNHA 1FMCA 4JK3A 4BNLA 4ZVVA 5DBFA 4P8RA 2XXJA 1ML3A 1SOWA 3O03A 3LT0A 1IY8A 3GH3A 2YUTA 4FDAA 4R9RA 3PHHA 4R9SA 1DJQA 1VLLA 2AQKA 3G1TA 1JW9B 3RQSA 4PFJA 1KERA 3DL2A 1DBVO 2ZB3A 4BMNA 4ND4A 3UKOA 4HNGA 4BQRA 2Q45A 4WEOA 3KV3O 1E6UA 4Z6KA 2GPTA 2VHXA 4EI2A 4CM9D 4QT0A 2BFPA 4KP7A 4Y8VA 1DIHA 1F0YA 1W0CA 4IZIA 1LEHA 4MVJD 4J1QA 5BSHA 3FTNA 3HFGA 3TZ6A 2YHIB 3GEGA 1GUYA 4RJTA 1J6UA 2WSBA 4ZICA 1GYPA 2BI8A 1M75A 3G17A 4AJ2A 3PFFA 3C8MA 1F17A 2G17A 1XKQA 3K9QO 1ZMOA 1P1HA 2Y0EA 3IUSA 3V2UA 3VPGA 1RKXA 2J8ZA 1G6KA 1P9LA 2ZTLA 5FWNA 1EQ2A 4CMCA 1NQOA 1M6WA 3GY0A 4ALNA 1EE2A 2HDHA 4QFCA 1DFGA 3FTPA 3L9XA 3JQ8A 4BNVA 3DBHB 3PHLA 4N7RA 3A9WA 3DZFA 2R2GA 1LDEA 5FI3A 1XU9A 2FWMX 1V9LA 3UCFA 4II3A 4GAEA 1PGPA 1VSVA 2FR0A 3B1JA 4UVEA 2J5RA 4NK5A 3BMCA 3I1JA 3ENNA 5JO9A 4CMHA 2JHGA 5L4LA 1ZEJA 2NACA 3ZNQA 4D7AA 1T2FA 3QIVA 1EBFA 1U1IA 1VKNA 1QYVA 3F4BA 1P0FA 1I36A 4OL9A 1LDGA 3OP4A 1Y8RA 1UUFA 2EGGA 5HS6A 5GMOA 3E82A 1SB8A 3PYLA 2C54A 4BB5A 2GZ2A 4R3WA 3L07A 3HDJA 1DSSG 3VPHA 4BQPA 4R01A 2QQ5A 4O6VA 4ND2A 4GPD1 3WGHA 1NVMB 3LC2O 4E33A 3JQEA 3GEDA 4DIFA 4KWHA 4MKRA 1N7HA 4JP2A 5B37A 1GZ3A 1BXGA 3MTJA 2B69A 4OHUA 4CM8B 2OBYA 2PLAA 1C0IA 3BXXA 3DBRB 4Y98A 1A4UA 3ZW8A 2GRAA 1PJLA 3SX2A 3RC2A 2EKLA 3EHEA 4K1LA 3DEYX 2TMGA 1E3LA 3GFBA 3GMDA 4PLZA 3W4KA 3C1OA 4E6PA 1DRWA 2Y1OA 4Y6SA 3I9OA 2AQHA 1H6BA 1V6AA 4HFMA 1IHYA 3KUXA 1WPQA 3KYDB 4TQGA 1HDGO 1PGNA 4NPCA 2P5UA 4CLDA 3EMKA 1U28A 3HNPA 1Q7GA 3D3EA 5A3JA 1BRMA 4PG8A 3L6OO 3OSUA 4ALJA 1K3TA 1T2CA 3B1FA 3QVSA 4RLSA 3LK7A 5IZCC 4YJGA 4U8GA 1P33A 2EP7A 2Y1CA 3ADOA 1HDOA 1VE9A 2OHXA 2DBRA 2JCYA 4A73A 3GGOA 5L4SA 4WCFC 1FDSA 1XG5A 3F3SA 4IJKA 2D8AA 1LSOA 3NUGA 2PH3A 1B7GO 1NVGA 1LXCA 1R4NA 1XGKA 5BSGA 1YJ8A 1F14A 2BFMA 1PJ2A 1M6HA 1LA2A 3HQ4O 3IKVA 1U5AA 1SZJG 1Z45A 3M2PA 4JJFA 4R51A 4TVBA 4OJNA 5JXWA 4QXMA 1ZXBA 5TGDA 4FOSA 3GF4A 4BGVA 3ZW9A 3F1KA 4RORA 4J3FA 3RAJA 1DC6A 1R15A 4EYEA 3IJRA 1NWHA 1OC2A 3K96A 4YDRA 3UW3A 5BT9A 5JAIA 2P91A 3NTRA 3W4JA 2VHWA 5C37A 3ZWXA 4Q39A 4XR4A 4FW8A 5TJ9A 3JD1A 4IXWA 4QSMA 1MA0A 4Z9XA 4LISA 1EUZA 2B36A 1DLIA 2AG8A 5JDCC 1I3LA 2DBQA 4YAGA 3HDYA 4CODB 1R37A 2AHRA 3QRWA 1OC4A 1LSUA 4RPGA 3W6ZA 1J0XO 3OJLA 2NU6A 1Y5MA 3G0OA 4N5MA 3TNLA 2VT2A 2CVQA 2VUSA 3QSGA 2HMWA 1GR0A 1MX3A 1JVBA 4K9DA 4XQEA 3HZZA 4G81A 3BHJA 3QVOA 4IZHA 3PJDA 3QWHA 4Y67A 1UDAA 3FNFA 5EJ2A 1JLLA 1NBOA 2C5EA 4LRTB 3W8EA 2D5CA 4XGNA 4HFRA 1S7CA 4ZRNA 3NJ8A 4YAIA 5T5QA 1ISGA 3H2ZA 3AOEC 3FSRA 1DRUA 1NAIA 4UUNA 2AQ8A 4FGSA 1E3IA 4TRMA 2EEZA 3KEOA 5KJFA 4AFNA 3ZWOA 4HY3A 1KVSA 3ZHXA 3RWBA 4CMIA 3DMTC 5CG1A 2F1KA 5TS3A 4ONEA 2GDZA 4JBGA 1HDZA 3BIOA 3JQGA 3S2GA 4FFMA 2PY6A 1C14A 2IZ0A 4PLVA 2XPCA 1JN0A 2PGDA 3AI3A 3L4BC 2XOXA 4I1IA 2HU2A 1IB6A 3B70A 1EE9A 5KKAA 4TWRA 1HDXA 1CRWG 3BMNA 1WNTA 2G1UA 2EGHA 2WYWA 3AOGA 3IIEA 3ZGYA 2Y1GA 1P45A 5A4DA 2A94A 6LDHA 2B4RO 3INRA 3VC7A 1PL8A 4KQXA 3CEAA 5BQFA 1U2DA 4XB1A 3KETA 2JCXA 1VL0A 1ZSVA 2PA3A 4ND5A 4QFDA 2P4HX 4YT5A 3ST7A 1ONNA 2CMDA 5T64A 5I8WA 4IQ0A 4JGBA 4Z0HO 4Y6RA 3U3XA 2PZMA 1GYRA 1LRLA 2YW9A 3MJSA 5K6AA 5H82A 3ROQA 2V6GA 3DMYA 4ID9A 3WMWA 2ZB7A 4CM9A 2DFDA 4NU6A 5I7EA 4CQLB 3I9MA 1CETA 5L7WA 1ZVMA 1EQUA 1GCUA 2NADA 4MVJA 3RSHA 3TZCA 3U62A 5JLAA 4J9UE 4I8XA 3GGGA 2QRLA 3JQFC 1P1RA 4NQZA 1NWCA 4ZQEA 2H1SA 1FDTA 2PR2A 1DC5A 5EQDA 5KJ1A 3ZWCA 2HCTA 3K92A 2I5PO 1CERA 3PRJA 3LDHA 4J1NA 2VZ0A 1DEHA 3GHHA 4NMHA 2PNFA 3OMLA 1XELA 2NVWA 4HWKA 4CMBA 1K2WA 5JY1A 2GN4A 3EGOA 1HLDA 5ICMA 3Q3CA 3F6YA 4MIEA 3VPSA 3OA2A 3QY9A 1JU9A 4LSWA 1OBFO 4J16A 5FF9A 3I4FA 4KDFA 2IRWA 3LF2A 4E0BA 1LI4A 1GQQA 2I66A 1D1SA 4J0EA 1Z82A 5DULA 4E2WA 2AQIA 3ICPA 5IG2A 3GZNB 4YQZA 4DVJA 2YQ4A 4YJDA 4RPKA 4RQUA 3V1TC 3JYLA 5TF4A 3AUTA 5ITWA 2NLOA 5MGBA 4EITA 4XDZA 4OQYA 1NM5A 1Q1NA 4R3NA 3D3WB 2JD2A 4QQRA 3KSDO 4XB2A 1OOEA 4A7PA 4KDEA 4YPOA 5T67A 2JKVA 1PS9A 2VZ8A 2VHVA 1Q7CA 2C2XA 2AMFA 3WLEA 5IJZA 2IODA 3LLSA 1E6EA 2B83A 3LT2A 3Q11A 4WASA 1RM5A 5A9RA 4JIGA 2OXIA 1N1EA 4TZTA 3FWNA 1ZO8A 1HE3A 3QHAA 4I9NA 2HKIA 5BSEA 4ZN6A 2IZZA 3COSA 1XDWA 1EK5A 1H93A 4OH1A 4W4TA 4OXYA 5T8KC 5CDTA 4I5EA 4OIMA 4AJOA 2O3TA 4JJIA 2ET6A 5JMWA 2BGKA 4MP6A 4JP3A 3GVHA 4CR7A 1IZ9A 1C1XB 1A72A 4E2XA 3AI2A 1E77A 4M55A 4WPGA 4ZGWA 3I9KA 4CV3A 4CMJA 4FN4A 1ISHA 1J4AA 2VUTA 3F5SA 3C3XA 3CSDA 3OEYA 4OKNA 2NVUB 1WDLA 1EBUA 3V5NA 1QORA 4DLAA 4BNTA 3OA0A 2X23A 1OMOA 1TT5A 1U8XX 1UH5A 1NP3A 4L4XA 4A26A 2VUUA 2ZCUA 2R6JA 4RVGA 3RROA 4UEOA 2VTEA 3W8FA 4WLEA 3DOJA 5T57A 3I9JA 3H9JA 5KTKA 1OAAA 3MEQA 1ZK0A 3MCVA 2AE2A 1YDEA 5ILGA 2OFPA 3UOGA 1YONA 3JQ8B 2CSUA 1N5DA 1H5QA 1ZJZA 4IDBA 2J3JA 1FJHA 3PPIA 4QEDA 2C07A 4BGUA 1C1DB 5ILOA 2D4AA 3IP3A 2PZLA 1PX0A 4MKZA 1X13A 4RL6A 3DBVO 2VN8A 5I9MA 1VJ0A 1YBVA 2D1YA 4JBIA 3OIFA 2IXBA 5CG2A 2PKRA 4RZIA 1G1AA 1ZEMA 1Y8RB 1MV8A 3QWBA 2QZ9A 2PFGA 3JQ9C 2I6TA 3A14A 1AUPA 3PIIA 2G82A 4BKRA 3TOXA 3HDHA 4D43A 4LMPA 4FC7A 3VPXA 5AQ1A 4ZA2A 5I7SA 5JDIC 4YWJA 5JSFA 5MDHA 3BAZA 1PL6A 3GPIA 3LSYA 1MXFA 2HQ1A 4FFOA 3FD8A 5A04A 2GR9A 1IPEA 2H9IA 5KVQA 1UAYA 5KWEA 4R1UA 3MJ4A 1BXGB 5B4VA 1D1TA 1BVRA 1LLQA 1WMBA 1GDHA 2DTDA 5JNLA 1W4ZA 3SC4A 4F3YA 1U4OA 2ZJ0A 3WGOA 3H7AA 3DC2A 2I9PA 4QX6A 3AK4A 5ENVA 3ZWPA 3RI3A 4ND1A 1TT7A 5DCWA 3UCXA 3ETGA 4B4OA 1UZMA 1HETA 1ZK2A 3Q2KA 4GSLA 2Q2QA 4OM8A 4J4TA 4PLYA 1EFLA 2BELA 1A71A 1PJQA 4Y9DA 3TWOA 4M54A 2RAFA 4J2HA 5ER6A 2I3GA 3X2EA 3KYBA 3TFOA 1LLDA 3EW7A 1U4SA 5JMPA 4E12A 1DB3A 2BFAA 4E2YA 3QWIA 3T7CA 4DUPA 3SEFA 1I30A 3AWDA 2RH4A 4N54A 2Q99A 3CH6A 3P5SA 4S1VA 3HHPA 5AXDA 3AW9A 3NDJA 1WMAA 2IE0A 2V7PA 3HN2A 3MZ0A 4HX5A 4YJGB 3V2HA 4B3JA 1DPGA 4LSMA 4XRRA 1NASA 3FR7A 2GNAA 3PGJA 2GO1A 5A5EA 3RVDA 3ZHBA 3GVXA 5JC8A 1MG5A 2BRUA 3VZRA 3S55A 1R4NB 4XIYA 3WB9A 4OGWA 5C3MA 1QLJA 2E4AA 3ZV5A 8LDHA 1BDMA 2CNBA 1KBZA 1LLUA 2QX7A 4R5HA 4B4VA 3ZHZA 2ZK7A 1O5IA 5IDQA 4XCVA 3ANNA 1LDNA 3WWZA 4RGBA 3AUAA 3EUWA 4E32A 1E7YA 2Y0DA 1U5CA 4IDDA 3DZKA 4QO7A 1H6AA 2Q4EA 3ORFA 5C7OO 1CIVA 1U3VA 1ZK3A 1C0LA 3FNGA 2C0CA 5CEJA 2Y66A 4DPLA 3HADA 1X7DA 3JCZA 3CZMA 3CIFA 4C7KA 1E92A 2FPPA 2J3KA 1OI7A 1A9ZA 2PD3A 2X0JA 3FRJA 3OIGA 1NPDA 5KCZA 1BHSA 3FBGA 3OICA 4TRNA 3GR6A 1QP8A 3GNSA 3HWRA 5G0VA 4OAQA 1MP0A 1GTMA 2TMDA 4N5LA 4DREA 3FPCA 1W6UA 1YWGO 2QRKA 1LU9A 2NU9A 3ZZNA 1KYQA 3HDQA 3RJ9A 1PQUA 4FFNA 5HA5A 3ZCXA 4BVAA 3BHMA 3Q0EA 2CVOA 3ZHYA
chains in the Genus database with same CATH superfamily
1JLLB 4PZYA 1DHTA 1PGJA 3UM9A 4CFYA 1TM7E 8AT1A 1ZOIA 5IAEA 4L73A 3U4GA 1Z36A 2XQJA 1UK7A 3QGMA 4KK3A 3U4HA 3O92A 5ELMA 5BUSA 1NBMD 3TG8A 2C03A 3WZMA 4CQMB 1T9AA 1G20E 1NJSA 4C3OB 4M9SA 3ZQUA 3ROFA 1OFUA 7ABPA 3COZA 1CUHA 1YS9A 4WLFA 1MGOA 1IHPA 2H07A 3RYCA 4UULA 3CUWA 3ZZUA 3RJZA 3T34A 2OAQ1 3IXMA 5A2QA 4RYDA 5CA0A 1TKRA 5BV2P 4TLEA 2A5LA 4WK0B 3VDQA 2YV2A 5JAPA 1U8TA 3C5EA 4NMMA 4WNIA 3BN3A 1R8JA 5F2NA 1TCBA 3DMDA 3OLZA 3I23A 2BDEA 2A0WA 1ULHA 3QWAA 1P8AA 1L8LA 2W2VA 1R8SA 2JBWA 2WJAA 2CY0A 1JECA 3E18A 3AI1A 2BFEB 5KYGA 3OOHA 1YTLA 5B12A 3UWMA 3MM4A 3CHYA 4LF6B 1NQUA 1Y9DA 2COUA 2ORIA 5IC6A 3BMNB 3E7WA 3RFXA 3VRHA 3KVNA 1ZDMA 3S2ZA 5ITZA 2M6KA 4KTTE 4A03A 5KMGA 2ZT5A 1I94B 3JZAA 1DLJA 3GROA 3NHBA 3FPFA 4M7OA 3PPYA 2C99A 1DRVA 4RKYA 4TMYA 1GTZA 1H5NA 1WEKA 4KN9S 4QASA 5LXTB 3D6NB 1AUVA 5JSYA 2FZ5A 2DBVO 1PZMA 5HGJA 1MB2A 4CEJB 1NURA 3LVFO 4EYKA 2J0EA 4QEKA 2JDIA 3SXJA 4NBNA 4ER6A 1S4QA 4TLLB 4RH0A 2WVGA 3PF9A 4YCDA 1FRVA 4F3TA 1SCIA 2JH3A 3PR1A 2H4XA 1DCKA 1RW4A 1YOBA 4FCTA 2VPWA 3MJCA 4O0MA 1CE8A 3KE8A 3DULA 3JTEA 3WRYC 2BCJQ 4AJNA 5DCYA 2H6EA 1Q1AA 3BHIA 1G8KA 2FKAA 3W3ZB 2Y93A 1GCAA 1MABB 1C1XA 1DDOA 1YBMA 3KKKA 3PQFA 5BORA 2AZXA 4ZT6A 4N8EA 1A8SA 2GAIA 3MJTA 5F7ZA 1DAPA 2QX9A 4YK7A 1YV9A 3CM0A 1L0BA 3JD0A 3BRSA 4RMJA 2I8LA 4WKNA 2O2EA 5AHRA 4RNCA 1TO1E 3SHOA 4HAVA 3TRDA 2ZBGA 4EUFA 5JEEA 7MHTA 2B6NA 5IBCA 1VKHA 2P4QA 3DV2A 1EP9A 3TQFA 3LBNA 4HDKA 2RMKA 1O7JA 2G5GX 3BT7A 2IITA 2IXFA 2ZYRA 4MRSA 4OKSA 2A7XA 2D5BA 1RRMA 1N36B 2LUOA 5L3VA 3CVXA 3CGGA 1A5BB 1ID1A 3JVIA 3PHJA 1LPBB 5DT9A 3IP6A 2ZYGA 1X8LA 3R24A 4MV5A 4OUDA 5BSFA 1TUIA 1TTTA 3HDVA 2G0NA 4AMBA 3GYBA 3VHXA 1ZIDA 4DLUA 1XZ8A 1K0FA 1DPFA 2H59A 2ODTX 3EUAA 4RKQA 5FTMA 1Q95A 1UKCA 1NDHA 1HI9A 1XTQA 3GCGA 4JLJA 4DADA 3L4SO 2AFHA 3IKJA 3A6FA 2WDZA 3RSZA 3HR4A 5CT5A 4Q7MB 4ZRMA 5HZHA 3L4JA 1AV7A 1FNCA 1OZHA 1ADBA 2A0YA 2ZRCA 3PA8A 5JRJA 1W36B 1ZG3A 4P3XA 4WY2A 3FXAA 2IT1A 3PYXA 3UENA 4D46A 4EJSB 2HBRA 1YA4A 1BXRA 1C1DA 3KKOA 3QV1A 2IW1A 1Q0QA 2WI8A 2MT9A 1T4CA 3BKWA 3MPUA 5CVCA 1WWKA 5D3KA 2D1FA 1UKEA 2CHFA 3AJDA 3OPMA 2ZYIA 4DA7A 1V4NA 4BLSA 2ZVPX 2H1LA 1F8UA 4RDCA 3NJRA 2UXBB 2BUBA 1X7XB 4TS1A 2EFCB 1BEZA 1O96A 5HK8A 5A9SB 3VTZA 1BEUB 4KQMA 2DR0A 3WDMA 4DYDA 2HSGA 2NNLD 3IVAA 5DFAA 5HBRA 4DABA 2OLJA 3B1KA 4F45A 4PCLA 1JQKA 1HQDA 3H9GA 3KL2A 5BN1A 3WFIA 5ALIA 1XFDA 1NQ5A 3A2NA 4J7AA 4QWWA 2Q5FA 4D2IA 3A1CA 1XHFA 1JR6A 3KTAA 3LQKA 2WUDA 3ANXA 3CZPA 4D44A 4MUXA 2WG2A 1HE8B 2F43B 1B15A 4MLDA 3NDRA 4DCGA 2FAXA 3DAFA 4M49A 3LHDA 1MO2A 5K3DA 4DGSA 1HORA 4K9RA 4DZTA 3D6UA 5HGXA 1V6SA 3T3GA 3QF7A 2G5TA 5JBNA 2XZPA 5E4JA 2QB5A 2CXQA 2ZJ2A 3G3EA 4JSRA 3WWOA 2ZRFA 3JRWA 1E2DA 2DHCA 2H8GA 3BH0A 5BN4B 4W5NA 1TYAE 4QBFA 3Q7QA 3Q3EA 4AQYB 2C5SA 1NTRA 4GOOD 2I54A 2VJQA 4MKFA 1HE4A 1P77A 1UBEA 4ZYZA 1VJTA 2HA2A 1EUYA 4XWTA 5CPFA 5FUXA 4I3GA 4B83A 2ZIXB 1TEZA 1F1BA 3YASA 3FCEA 4Q1DA 4D96A 2FVYA 3NC1C 3NTQA 4HDSB 3KJEA 4I4TB 4RK4A 1GQSA 5JH7A 4G37A 3ZQ4A 4R1PA 1EYZA 4UNSA 3IQZA 4RHEA 4EO4A 1HA3A 3NTUA 3LK6A 4H7FA 3NBMA 1WKCA 4NABA 4EA7A 3OJOA 4KGDA 5DNDA 3GN2A 1VMIA 2QR5A 1G6Q1 2W2LA 3GUCA 3WZ2A 2VZ9A 3MOGA 3LQ2A 5BWNA 3RRYA 3A1DA 2IHKA 4H6WA 1XZQA 3R6TA 2YWFA 4UHDA 4YRTA 2QL9A 3K05A 4H16A 4GBMA 5LBIA 1SOUA 1O58A 2IY8A 2QTVB 5E3IA 4IEIA 2I3AA 3RTEA 4EY8A 5KHLB 1K2VN 1TRKA 2XYGA 5T4BA 2Z4SA 1SXJC 2WIGA 4NL4H 1II8B 2C5GA 3JQDA 2XBMA 4YQEA 1O3YA 2C4TA 1RXYA 4QOFA 1KEKA 1MDBA 3H9UA 4F3KA 5BR7A 5C1BA 3I5YA 3BUSA 1K6EA 1A9TA 1L7EA 1HL7A 1WLYA 2VCYA 1EA7A 2Y2VA 4KXMA 1QE5A 4PRLA 5AMXA 2BMJA 1BCRA 1EWRA 1KFJB 4YEDA 1TL7C 4MQEB 4JCOA 3U6KA 4CU5A 1C5KA 5D85A 2RIRA 4F6RA 4A0FA 2RC5A 3VR4H 4XM1A 2E3JA 4WZBB 3L0YA 1MRNA 1EWTA 1CY4A 2H54A 3LQQA 5HJ7A 2TSYB 2XDWA 1Y1RA 4INZA 1D1PA 1YGPA 2WF9A 2WU4A 2Y6VA 2WYOA 3DBOB 3DDHA 3UCEA 3ZZTA 1J8MF 1F12A 1THZA 4IJ5A 1F6DA 2J4DA 3IC5A 4KR7A 4ZOLB 2Q9CA 1UDRA 4NEGA 2ZREA 3MYYA 4Y18A 4B2YA 3UGQA 3I0ZA 5CK5A 5D87A 5DTQA 3U2QA 4QTTB 4X64B 2Y92A 5C35A 4YREA 5LZ8A 3J81A 2JFWA 3VR4A 1T9GR 3OESA 2UU9B 1DEXA 4V0QA 4P83A 5ALPA 3K16A 4EPYA 3PFWO 1ZD5A 2KW5A 4QXQA 4FONA 4UDXX 5EQTA 5K3CA 1FTSA 4CJXA 2PT5A 1QHYA 2F3TA 2VYVA 4NMXB 4C0BA 1C7JA 3KT8A 3U3MA 3KX2A 2RGEA 4WKBA 2IYQA 5DIFA 1NMSA 7GPBA 1GZ6A 1WY7A 3T7IA 3DDWA 4OY3A 2XB6A 4EENA 1WABA 1EFUA 4HVCA 4HTFB 1OE0A 1KO4A 3AL3A 3UAWA 4NFHA 5F7OA 1WO8A 1ARZA 3RS8A 1A69A 3K9HA 4KMSA 1I6WA 4O4HB 5DM70 2VL7A 4RD4A 5HOEA 3RD5A 2RJNA 2Q2WA 3BTUA 3H9QA 1P1IA 1VGQA 3IELA 5FTKA 4LZAA 3SVLA 3TE7A 4NZOA 1EK0A 5IM4A 1IBRA 1Y6RA 3G8DA 3TLKA 4C0JA 4CKCB 1JJBA 4K9OA 4PYNA 3ZOKA 1K97A 3RFUA 2PK3A 2I34A 2XUKA 4OX9Y 4AQ7A 2QPTA 1QH1A 1JP7A 3KOWA 3O91A 1M1YB 1O97C 4FDLA 4M38A 2EDAA 4MI6A 1VCOA 3HP1A 2B94A 2BGLA 2C3OA 3BL5A 1JVSA 1HEUA 2HXYA 2JFQA 2XWBF 2PMBA 3O4VA 1FP4A 1KFBB 2PO5A 4PM4A 1ULTA 2CE2X 2B4TO 1O9BA 1WDTA 2C4VA 4I1PA 5LNK1 1QQTA 2OOKA 1E4EB 1VCHA 2PMKA 1PT6A 4L74A 3HXLA 4P4SB 2FX5A 2FETA 3VO1A 4AY5A 3OJ0A 3PC4A 3R20A 2HWYA 2QF7A 3I12A 1E62A 3LXUX 4I9GA 3IPAA 3DOFA 5CW1A 2YN2A 2AW5A 2GAAA 3AFHA 4DXHA 4A0HA 2IUFA 4MPPA 4BMXA 5ADWA 4YRBA 1QVRA 4WGGA 3FZEA 1UWLA 1CJBA 4KFSA 4E1AA 1I7LA 2HLPA 1H2RS 1LX6A 1XRQA 2P6PA 2W7TA 3L05A 2MSCB 5ALUA 4I1RA 5GAJA 3IXQA 5L51A 2JFGA 1KQGA 4LGMA 4NBVA 5BSUA 3E7DA 3CLHA 5HKAA 4A0GA 3I6ZA 3AHHA 4Q1BA 3L6DA 3R76A 2HSWA 1VL2A 4MVJH 1RBYA 2IXGA 2R60A 2IK8A 2QSZA 1H1LB 4K6CA 1UANA 3F9CA 4ZHQF 4XFDA 1MUUA 1Q6YA 1PJCA 3AUFA 2FOXA 3QTTA 1Y3CE 3ES9A 1YO6A 5EHQA 2BDTA 3GLSA 1WCXA 4JC4A 4R1TA 2FZEA 1CUAA 1IULA 1D6NA 1YU9A 3U49A 1X1RA 4YJ3F 4Q9HA 2WP8J 2DETA 1AKQA 1EKXA 2GM4A 4LGCA 2HIAA 4C5AA 3HLKA 1C2YA 1MFZA 3D7LA 2AZMA 1YR1A 5CVTA 2DP4E 2WT9A 3D81A 1X7HA 2I67A 4CZ2A 3OEHD 4F4JA 4KXVA 4EJMA 1EJ6A 1UEJA 1K98A 3ZV6A 5K0ZA 1GPUA 5A02A 1E6KA 5K1ZA 3TVTA 1N5KA 1I32A 1FSSA 1KO8A 1Z29A 1UKYA 2WM8A 3C15C 3X1JA 2CDRA 1XNHA 2H0RA 2JBHA 3KWMA 3OQ1A 4FGUA 1BW9A 1TMKA 1WPXA 2DPGA 2UYGA 3CONA 4S2UA 3TZHA 4L6AA 5H7XA 5DM4A 1E1DA 1YXMA 5IT4A 1SVWA 4HGZA 2B4YA 1TDJA 2QP9X 4H0NA 3JAWA 4R16A 5CYOA 4ZCRA 3MWLA 5HW0A 2EHJA 3EYWA 3TLGB 2A9PA 3D8BA 4B71A 2QW0X 5AXAA 5CXUA 1D6SA 1YHNA 2GD1O 3HB7A 3DO5A 4RF2A 1Q16A 4S0XA 3U80A 3UF0A 1U7TA 5AUOB 5JO0A 1IZ0A 4IMRA 1U2RA 5TGZA 3OVMA 2QU7A 1NI5A 1NI4A 3KWFA 1XZNA 4UNIA 3PRKE 1DKUA 1U6JA 1C9JA 5E4YA 4ZOQI 3RYCB 3AY6A 3EC7A 4RD1A 4WH0A 3QQ5A 3OH8A 2P11A 5B3AA 4XX0A 1JA1A 1HOTA 2QJFA 1QRSA 4I50F 1Q1BA 2X76A 5K8IA 3PXXA 1E89A 4D8WA 1EEHA 521PA 4DQUA 2Y68A 1Q0RA 4UTPA 3GLHA 3LMKA 3PDHA 1HC7A 1K9SA 3SD7A 1Z47A 3E0QA 3A6DA 3TRHA 5DGXA 3W2TA 1PD0A 2G36A 4IS2A 4EKNB 3ZHUA 2H7XA 3WXMA 2QTHA 5GONA 3S2EA 3VSEA 1Q7TA 4B4KA 2PX5A 3BMXA 4F1KA 5FWYA 3HRHA 5IFKA 2DBYA 3OIDA 5NLLA 3HYCA 3ABZA 5AVOA 2NVOA 5BSVA 4KB5A 4E7OA 2YZNA 4YQYA 4BNXA 1R64A 1T4GA 4D8XA 1GGEA 3OPQA 5KMGB 1A2BA 3DMTA 4Y2QA 1P4JA 3T61A 1MB3A 2GBIA 3KQTA 2GARA 4NCXA 4RTMA 1KDVA 4E5PA 1P5ZB 4JBLA 5KKCA 2P4UA 4FYPA 3MWDA 2W71A 3HLTA 1G3QA 3G5MA 4UCFA 2QW8A 2OO3A 2WTBA 1O94D 2IYAA 1TW2A 3FCXA 1X0VA 4UCQA 4LE0A 5D01A 5K9ZA 3QF4A 2DLCX 4D4GA 1FFXA 2WLSA 4PSUA 4K7JA 5J4HA 3HCCA 1RAIA 5TT0A 3FSEA 3HCAA 1MO6A 2ACVA 4BBZA 3TOVA 5JD5A 2ZSAA 2GCOB 3FNBA 3SNHA 4EPXA 1KRXA 1T35A 1YMVA 1GPYA 2ZJ4A 3PQ8A 4LBYA 5E95A 2RGCA 5HUQA 4RKFA 4EX7A 4FU0A 1KZ6A 4D4MA 1N6KA 2GEKA 4XLLA 1N9GA 1ZN7A 3F6EX 4AK9A 1N6LA 1DWUA 4Q03A 1MD9A 1RQRA 3LZ6A 4CM3A 4R8MA 3TBKA 2ZCJA 3WMEA 1GARA 1O9HA 2AI3A 3D54D 5DLPA 5LM3A 4IV0A 5DCLA 1U0BB 1HTTA 3SWWA 5JXHA 2W6MA 3L8EA 2HLDA 5JVDB 3CPSA 1F2DA 1TMYA 4IJWA 1ZONA 3LY9A 3GEIA 2H31A 2W0MA 1K6XA 1SEVA 3CA8A 3EQ6A 4MCJA 1X6VA 4OUDB 4B3DA 1MQ9A 3C7CB 2OFWA 2YV3A 3D1VA 5I51A 1JEOA 4H0CA 2HF8A 1CRPA 2HV9A 1XP8A 2P0YA 3ZI0A 2IH5A 4JV5B 1ORVA 3AU8A 2PYIA 3GA0A 3HPQA 4KNVA 4KRGA 4OLHA 3GUHA 4TTQA 2KBFA 3UB3A 2PRKA 1X42A 5AW6A 2IHUA 1PJBA 3GQBA 3PENA 4N40A 5K0CA 1KVUA 4UREA 1ST3A 2WKSA 4ZQBA 3LF1A 3CPEA 1XPJA 2QMOA 4D9GA 2FP3A 1LGYA 2YJ3A 3EEFA 3M9LA 4E5UA 5KC8A 5KS2A 3RVQA 3NG1A 2OUIA 2BFFA 1EDOA 1BXRB 4JVNA 4X20A 1SCKA 4Y0VA 1KSFX 4UOEA 3U1VA 2AD1A 1QBGA 2YMMA 4NECA 1KOLA 1GNSA 3K8ZA 3VX3A 1U0FA 2CB0A 4WY5A 4ZYYA 2ZWVA 5B3KA 1AH2A 1FDIA 3L7MA 3VTKA 2ZI6A 3FPLA 2PEYA 3GNQA 2H4HA 1M1UA 2Q1UA 4LNHA 4BAGA 1N8SA 3FHLA 4IIJF 4NZ9A 4YR9A 4LJYA 1PZNA 1G0NA 1O96B 3MUFA 2V58A 3OOYA 2GERA 1J49A 1AY0A 1BS2A 2JFNA 2IP2A 3HMKA 1FMLA 5AKXA 4YMWA 1RJ9A 1MB0A 4CKXA 2GN0A 4OI4A 4C4XA 2GEBA 3RVRA 2QVLA 5FRDA 5J1TB 1Z37A 5LOVA 4DIBA 1AV6A 2EQ5A 1Q15A 4JX9A 2EJWA 3GVIA 3TJMA 1YMUA 5FX2A 5B57C 3SNKA 4QVKA 3KK0A 4IOMA 4DCVA 4JI0B 1NX6A 3ZKAA 2AUMA 2X8JA 2BEJA 3AF5A 1E2EA 2P27A 3C85A 4QYIA 3O8NA 3U5TA 4Q3NA 3R9XA 1EH5A 3KHUA 2XTJA 2ZVDA 3NKLA 3O95A 4Q02A 4HXYA 3W7BA 3H4TA 3G7SA 1MQSA 2RHRA 4E5KA 3TMAA 3LS2A 3KOOA 3ZBPA 4WLOA 5A3QA 3ND6A 1WXXA 4C0WA 3BXGA 3MT8A 4E70A 1ZUWA 2BH2A 2J0UA 4KI7A 4N1AA 5TMPA 3F73A 1E2JA 2Y99A 1OI4A 2R65A 1ADGA 2AN3A 2FWRA 1QAOA 4FJ0A 4IHAA 2IELA 1XFAA 1N3BA 1NLYA 4U2KA 1FDOA 1K08A 2GFQA 4U00A 3PI7A 4N12A 2X8AA 3SIRA 3AHCA 3AW8A 2Q3JA 1WNFA 1BSVA 3JV7A 3IV6A 4F71A 5GINE 1M34E 3E61A 1SELA 4DIDA 2HQRA 4B40A 3NHSA 2VLBA 3SS8A 3K6RA 3F6SA 5EPOA 4G4JA 2XX3A 1J0AA 1TVMA 2HU8A 3HFRA 3O82A 7REQA 2QVGA 2PMFA 3AHEA 1DXOA 3AKZA 2NG1A 1I4EB 1FDWA 2OMKA 4RVFA 1TF2A 4YUYA 1TTHA 3DE7X 2VSOA 3OZTA 2PLRA 2DSNA 1QR2A 2XLBA 5AVSA 1XA3A 1KMHA 3B53X 3ACDA 3P9RA 5JD6A 2Q3LA 3JR3A 3RHSA 8MHTA 3V8VA 4IUYA 2OV4A 2E6KA 1ONOA 1V3UA 4B45A 2XRFA 4P31A 2FZVA 4AJ4A 4AECA 3PX3A 3KZOA 1R0WA 1HLGA 3WGYA 2YY7A 3RVPA 2JFOA 1WUTA 4DCTA 1WBJB 5DBOA 2O2YA 4JOSA 2QT0A 4Y2HA 4KWEA 1BCRB 1U3CA 1ZLYA 2I2CA 1FMJA 3DEKA 4LJRA 1KL7A 5IJAA 2FEAA 2XT9A 1F8FA 1SGWA 1TTQB 5LA6A 1VHWA 3S8MA 5HKKD 3P71T 2J6HA 2OORC 5D1NA 2QD1A 5C7IO 3OI7A 4NRDA 1DBWA 3R7BA 4FX2A 4TUYA 4GXNA 2AF3C 4QBHA 3OFND 1NMEA 2VJCA 3W6PA 4ODIA 3MCZA 4QTXA 1E2HA 4GVLA 4A2CA 4TWBA 3AV0B 3FUXA 2R79A 3KOUA 4K28A 4NCNA 2DULA 3AETA 5AJUA 2XUIA 4G5FA 1T2VA 3LG2A 2YH2A 4ZVMA 3AYXB 5CT4A 4E4YA 1SD1A 1Q0LA 2ZKLA 1X9GA 4M3NA 1G16A 4UKDA 5CM9C 3TL2A 2NXWA 1L4YA 3L0DA 4NAVA 5DNVA 1FXUA 2LCQA 5GVSA 2IC5A 1OH6A 2VATA 4J2OA 2OE2A 4UAVA 1A95A 2NZ2A 3A6HA 1RYHA 4MKGA 3RC7A 5DYTA 3RG8A 3IODA 3UJ7A 2GGSA 2V6FA 3B3QA 4ESHA 4GOMD 4F7WA 2A9FA 3U31A 4RF3A 2NXJA 1A5ZA 3IHLA 5FPYA 5HFJA 3CVYA 3MGKA 3M6MD 2ZQ5A 3BWMA 4JT8A 1CULC 1UXIA 3BX1A 4MJ7A 4CLRB 3OQNA 1SBHA 1UDXA 4L5BA 2ZDQA 4JI3B 4EHLA 5JU6A 5AHOA 2ERXA 2R00C 1N2XA 1PDVA 3GEPA 2I6UA 1KF0A 5DASA 3SI7A 2W42A 2P1RA 4A36A 3NNNA 4C06A 2XB2A 5EIFA 2Q8PA 5G40A 3M4NA 4CMKA 1JRLA 5A05A 3N07A 3ZXSA 4A8PA 1OBCA 1QH1B 3GQVA 2PKQP 3NEAA 3STUA 1RWXA 3OQIA 1UP6A 3B6IA 4YT8A 2JFHA 4WK4B 1Y82A 3GBSA 4DLWA 1CNFA 4EJ0A 1FP4B 3B3GA 5HJEA 4R2XA 1TMOA 2OFXA 3G2JA 4P5PA 5D5PA 4QE3A 4CDGA 5TT1A 2BCGY 2MOKA 4QC2A 2CK3D 5DCUA 1KYXA 1X38A 3OHSX 3WS7A 4NBRA 2P5SA 4B7AA 5A4IS 1FX1A 1GL3A 4FYMA 4EK9A 3UK0A 1RWNA 2QD4A 1T8SA 4Q82A 3BORA 4PLTA 2VDLB 3WXBA 1JDSA 1XYVA 3C98A 3W06A 4F93B 1U5BB 2VSQA 1LPMA 1ZNZA 2AE1A 4HDCA 3EVEA 5IASA 4PNPA 1XNJA 3HN7A 4W9RA 1J2JA 4DG8A 4LRXA 5BQ5A 3HU5A 1QLWA 3FHOA 1FNBA 4GDMA 4OSOA 4A2QA 3L6RA 3PP8A 3R23A 2JLXA 3IIKA 4LEIA 3OCYA 4BMCA 4UXHA 5K8TA 2HK8A 5KVCA 2JPDA 2FWJA 1RLMA 1Z2PX 1FRQA 1KOFA 2FUKA 2VHYA 3U9TA 2PT9A 4PBSA 2PXHA 2OXCA 1SC6A 5AXCA 3X1XA 1N2SA 4BP9A 2A3RA 5JPIA 5JZOA 3DM9B 5CB8A 1JLSA 5F77A 1G19A 5B2FA 5C7LO 1NG1A 2CL7X 4H7JA 4ZAFA 4CVNA 1NE7A 3AFGA 4KDRA 1A8HA 1B6GA 1FFAA 2NYAA 3CZ4A 3N2IA 1SQSA 4EY4A 4D99A 4GOJA 1X15A 3T0FA 1PBNA 3Q15C 3EUFA 4Y9SA 4AIIA 2ZTVA 3G1WA 3G0IA 3CZRA 4JP8A 5DXFA 3RYFA 1Q0SA 4N5NA 2UKDA 4AJIA 4OBXA 4GS5A 1NU8A 3B7WA 3O83A 3D8HA 4O1MA 2OCIA 4KLRA 4RF4A 5LQSA 3WJ1A 1PJSA 1PG2A 4S05A 3DNPA 1BW9B 2NUPB 1UAAA 3DLIA 3KHKA 3MAGA 4BC1A 1KY2A 1VSQA 4J29A 4D42A 4EKGA 3NU1A 1RYDA 2OCGA 1TVEA 4ZHSA 1XVUA 2EDCA 5E9JA 2P6RA 1GZ5A 3LGXA 2Y1WA 5IWAB 2YJTD 3UJAA 4CDRA 4ESOA 3NHWA 2VBGA 2C3UA 1BVYF 4CM7A 1Y6QA 2F55A 1SCUB 4IY1A 4MXDA 3W8RA 1ZK4A 2Y0BA 4J6FA 1QGOA 3NAMA 1NI4B 2XVXA 1DC4A 5FUVA 1KK2A 1KAMA 5KJ6A 3C3PA 4XVUA 5EEGA 821PA 4M7RA 4D79A 4BGDA 2FW9A 1G38A 4XX0B 2J3LA 3RVNA 3GDGA 4ZYVA 5DK6A 2Z0MA 4KE7A 4GBGA 3KOMA 4I55A 3AL2A 3E9EA 4NYIQ 4DNXA 4GO1A 1X2EA 3M34A 3EDYA 4LZWA 5KTRA 3QTLA 3AX6A 1L5QA 3R44A 3WHIA 2DWQA 1GXSA 2CL6X 4MICA 3KJZA 3NHPA 3GPDG 5GONB 2RHWA 1Y9ZA 4KOEC 1E3WA 4KXNA 3E9MA 3ISVA 1GEEA 4G24A 1HT1E 1UC5B 1UBMS 3U4DA 5KX5A 1ZMTA 2G04A 2QAGC 2DQ4A 5DTJA 1DTEA 3ZDFA 5J4KA 3ME5A 4IWXA 1DEOA 2QZPA 3RUFA 1IUOA 1P7PA 2G28A 1BWQA 4K1XA 1LZLA 3D0RA 1OLOA 5FFNA 1DX6A 3VH3A 4B76A 3HR7A 3E9QA 1PKXA 3OKCA 4UBNA 4X60A 1W76A 3MWDB 4HB3A 2PCLA 4BZQA 4CDNA 3TIGA 2E4ZA 4E31A 2NXNA 4G97A 4O63O 4QO8A 1IBKB 4OJKA 2QQ0A 1B8PA 4I7EA 4P0PB 1FSZA 1RWKA 4MW1A 1XIVA 4XIIA 4UPEA 4Q3CA 3HO1A 3B6KA 4KQEA 3ZLBA 5U9CA 1BWPA 2GF2A 3THSA 1PZEA 3QVXA 5F23A 4TMFA 3UY4A 1C1HA 1N9GB 2G77B 4EF6A 3H11B 1U1CA 3HVUA 4I5GA 1VE1A 1COZA 3WISA 3BMQB 1YJ5A 1JHPA 1PTKA 1H6DA 1XVLA 1Z2AA 3HABA 4KQIA 3PIRA 4MUMA 1CR6A 1LPPA 3AYZB 5AUQA 1ZHFA 1V25A 4EVQA 4YB8A 5D3ZA 2EQAA 4YRDA 4K26A 2H2AA 4GZ6A 5CYFA 3M5WA 2ZE6A 2WAAA 3E03A 4KV9A 3N8IA 1YZYA 4OHYA 2DB3A 2YX1A 2PX4A 1L4EA 4Q9LA 4TMKA 1RCUA 2Z2XA 1TO6A 2ATEA 1AHNA 2Q3BA 4V1CA 3IERA 3DLHA 1FU8A 3PQ7A 1KEUA 1H1DA 3SM9A 1G3UA 4WT7A 1W48A 2JLWA 1YF3A 3OLWA 5AWFC 3J7TA 3QKUA 1MXHA 3LWBA 4PC1A 5C0OE 4QTYA 3AMVA 3LE8A 1B0ZA 2GEFA 3CUVA 1CKEA 1E6WA 1N25A 4HJRA 2M6SA 1C3VA 4MMZB 5DHSA 1NUHA 2LKCA 2HU7A 1XLTA 3KRTA 3GQBB 5E7QA 1W9HA 1V5GA 4RJJA 3WIUA 1XN4A 4GWLA 5HQTA 5JV5A 2X9GA 4CQNA 4MEAA 1BX0A 1SU8A 2WSSD 4JKIA 1Z0JA 3JVEA 3V1YA 4HYTA 1ZFNA 3KKEA 1JAXA 2GZSA 4G1MB 4OPMA 1II9A 4IIFA 4X20B 5FWAA 4YUZA 4X6YA 4FGJA 1PEDA 3RUIA 5LP6B 1WUYA 1A4IA 1P1BA 1T4BA 2ZI3A 3OEWA 4IJUA 4PTLA 2QTZA 3GG2A 4KYTA 4QUBA 4JXKA 3OHPA 1W88A 3R9IA 5F4ZA 3OECA 1ILWA 1JDUA 1R0ZA 2IHJA 3F6RA 2RAPA 2N9UA 1E63A 3ABOB 1Z9BA 3UJ3X 1RJ9B 2GI4A 1NNSA 1IHXA 2OB2A 3EFEA 2HIGA 1JG3A 4MGYR 2FN7A 1DUSA 2O0HA 2XLCA 3K9LA 4JSYA 4OQ4A 4RGYA 3SC2A 5LOVB 3TAXA 4YUVA 4OHOA 4B8ZA 2I7TA 3WSVA 1ZM9A 1PU2A 4BZWA 5D86A 5K7SA 1GUBA 4PZPA 3ZNOA 1TYDE 1CV2A 3LBHA 2X8JB 1OAOA 4QU5A 3I72A 3QBVA 4QUDA 3F7NA 3H99A 1CZHA 1IY9A 2B1IA 2OBNA 1UADA 4PAGA 5DJ5A 3U7QA 4DQDA 3H9EO 4MIYA 3D2BA 5A2GA 4I5IA 3TQIA 3FX2A 4QNRA 1SBTA 4BNLA 2D1QA 4TT3A 3ZEAA 1Z3IX 4H3VA 3CT6A 5HE9A 4ZP1A 4M87A 1PFVA 3W6OA 1YZLA 1NN3A 1SCDA 1T2DA 4FYKA 2DR2A 3M6FA 3IQEA 2ANBA 3H4VA 3VNQA 5AW4A 2J0UB 4MKXA 1GKKA 1O89A 1VLMA 5F7XA 1L7DA 3UBTA 2CFSA 2YQZA 2AX3A 3IHKA 3IP7A 5JBQA 2H5IA 3FKSA 3FPGA 3MK31 5EERA 1SVMA 3W1VA 3QE3A 2UZ3A 3D4IA 1P31A 4QJIA 5ELLA 5GJWC 1DOAA 1TC1A 3PGXA 4JMPA 3W2GA 4F3RA 4LQCA 2QMUA 2YN0A 1YIAA 1XDUA 4TKMA 5J9FA 2ZFUA 3LGSA 3VR3A 4J0HA 4P34A 2PUHA 4BGEA 5KNLA 4R81A 3ZS9A 4HGYA 3PT9A 3S4YA 1XZMA 2MWMA 2G80A 5KNCH 3LX8A 4RZSA 4GVXA 2RGBA 5KYVA 3DDZX 3AR8A 2FN3A 2W6JA 2Z9CA 3Q6IA 1Z68A 4F85A 1YE3A 3KZXA 3PQCA 1SZPA 1TGVA 4RQBA 1CIJA 4UHBA 1QAMA 1KK1A 3Q3IA 1Y3FE 5KYNA 4OXIA 4PHGA 4YDSA 5TC4A 3GJRA 2VJPA 2Q7OE 2XYVA 4HQNA 1YJAA 4RV9A 1I1NA 3N86A 1I0ZA 1T2UA 4CEIA 2H9AA 3SBXA 3V8MA 3QOFA 2ROQA 1FFEA 4B17A 3TGPA 2IIQA 3KR9A 3B20A 5K3AA 1YQ9A 2VDWA 1EWYA 2ID4A 2KMLA 3VU8A 4BYGA 1I5RA 3LYUA 4TVOA 4W6QA 1Z88A 1E1RD 1XAIA 2W4QA 2C2BA 1KS9A 1P7VA 1MJGM 2G07A 4F1WA 3EFBA 4TUYB 1ESNA 1N8KA 2R7NA 2XV1A 4ZCMA 1F2TA 1X1EA 1VE5A 4FKMA 2DERA 4H15A 2G1JA 4RACA 3W7VA 1ULZA 1F06A 3CEPB 2C5AA 3BIJA 3AETB 4J2TA 1GGJA 4LZZA 1WE2A 3HB5X 4YRCA 4BIMA 2PYZA 4AJKA 1L7XA 2HF2A 2O3SA 5HTOA 2NU7A 3VKHA 1B8VA 1E32A 4W7HA 5MHTA 2HYDA 3LPLA 3QELA 4NYIR 2B4KA 1O8CA 2PX2A 3A9SA 3AZOA 1J0EA 3UFXA 4RTLA 1NV9A 4B3TB 1GKYA 1P4GA 3P0RA 4DA0A 1Z5OA 5A6VA 2RCNA 3B1XA 1NPYA 1BVHA 2FMXA 2PJRA 3F9IA 1J9ZA 3NOOA 1MF7A 3QU7A 4ENWA 1Y9AA 2XB9A 1G3IA 3QKIA 1YFKA 5AYVA 1M10A 1DI0A 1E4OA 3VVBA 4LJAA 4QKQA 4R1NA 4FBGA 4FFLA 2HMUA 5T4EA 1HZJA 4U2GA 1AK2A 2DX7A 2FE4A 2DY0A 3G79A 1D8TA 3VV3A 1HYBA 1YS1X 5JNUA 1T36A 4G09A 2HT1A 4IDAA 1GFIA 3RIHA 1KZHA 4ZMBA 2ZATA 4JQZA 3DXZA 3DEFA 1Z73A 3I1YA 3V1UA 1PDOA 1UR5A 3PE6A 4X85A 4BMVA 4NIMA 4LFBB 4D0RA 4DHWA 1P9RA 2GSDA 1IN4A 2VPTA 4FGLA 5L9AA 3WQRA 1IQRA 3QUQA 4G5HA 5BYBA 1G0OA 3F90A 3RJTA 4YJKA 5GM1A 2ESRA 1IPFA 1ISMA 4HUJA 4OHRA 4RLQA 3D5TA 4YMSA 3EAQA 5ALMA 2B5WA 1F9EA 3A32A 3ANLA 1JSXA 1Q14A 2E4YA 4A9AA 3VUEA 1NW6A 1W85A 3NP7A 4G1VA 3TVDA 2PH1A 3K4PA 3B6JA 1QFZA 2PUJA 3NDBB 4OHFA 1YDGA 4D9IA 3CX6A 3OBIA 1PWEA 1W0JA 3ILHA 3IS3A 4FFVA 4G8CA 4NJOA 4UHCA 3QOWA 4DUGA 2BP7A 4BO0A 3TDKA 5CFMA 3HUDA 3MMPA 3GNLA 4AZVA 1P2GA 3WDLA 2IVZA 3T4XA 5HIAA 3OQMA 1XCLA 1EZ4A 1MKYA 1YFZA 1X7GA 4MYDA 4OVKA 4CV2A 2AJTA 4IQ8A 1E5VA 1EP1B 4KLAA 3MWJA 4Q4CA 3IURA 4P3YA 1SCQA 3DONA 3KVRA 4HDMA 3TNFA 4XXHA 1QCZA 3HKCB 4HAIA 4EPVA 3K15A 1ZMRA 1M1ZA 4FM9A 3LSTA 3KQMA 2Q4BA 3QLUA 4UBLA 2CDCA 3GD7A 5G1OA 4FYWA 5LMNB 5A5FA 3V7FA 1W47A 3FNEA 2YV4A 2YS6A 1W1UA 2G83A 4UM9D 2TYSB 3FR8A 4G0NA 4JFAA 3TTUA 4BLUA 3WTCA 3GOHA 4P33A 1X1BA 2X9QA 4BV2A 1LBHA 1NXPA 2P35A 3QXSA 1HLFA 1R6DA 2FW8A 2W48A 3R6DA 1VPLA 4K6MA 3LW8A 2GPSA 5FJIA 2W43A 2VUHB 3IUPA 2O3QA 2NU8A 3C3DA 5FL3A 2YN4A 3QJ5A 4L51A 3THWA 2XITA 4BMPB 1GGMA 4E5NA 4PR0A 1VDMA 1TKAA 2XNSA 3GLUA 5K4AA 3RYFB 5MN6A 4U2FA 3DTVA 1JV2B 2R8ZA 1G64A 2LW7A 4IDOA 4PQGA 3PXDA 1CQZA 2A5DA 4HAWA 2IEBA 4BJ6A 4ETIA 2PIAA 5L3QA 3PNVA 3KAPA 4UARA 5COBA 5C1IA 4NCHA 4S04A 1E3DA 2D06A 3H1BA 4MAFA 3FUWA 4QICA 4E1VA 1XZAA 4RZUA 2BSXA 2BGGA 3BDVA 2WIBA 1MAVA 1NQWA 2V7GA 2NP6A 4OMCA 3BVPA 4TLCA 4JP5A 2QU8A 2H4YA 2GKGA 3KYCA 2EF1A 1RPJA 3LYLA 1E98A 3N1UA 4X54A 3SSAA 4RZ2A 3V8NA 4B87A 5G0TA 4RJLA 2WJJA 3ZU5A 1O5OA 4TL8A 1E2NA 4J8PA 4DDHA 4PQFA 3NDIA 3FCAA 5JC1A 1XA4A 4MUKA 2IW3A 3KEQA 3WL6A 1DAFA 1XJQA 4JGGA 4ENRA 3E7PA 2WM3A 4O8CA 1DO8A 2IY7A 1HE5A 1PR3A 1WDMA 4HVTA 4TS4A 1KVRA 4XQ0A 1FBNA 4L7QA 4RXUA 2OD7A 2AIRA 1DAHA 2WPDD 4IJVA 4HGRA 4N3NA 3FCYA 3EEQA 3FVQA 4HZIA 1BKSB 3SZMA 1U3GA 4LDNA 4WIAA 1IBSA 1KY5A 3RQIA 3C3KA 1FK8A 3O8DA 4OTZA 5E7JA 2X4GA 3R3JA 4YWHA 5DEOA 1AB6A 4R68A 4JLNA 3I8SA 2GZ3A 2LDBA 1CQWA 3O38A 3PNOA 4I99A 5EIBC 1RQXA 1L7OA 3CNQS 3OLVA 4YRPA 1KTVA 3IUMA 4A3SA 3IVGA 2GZDA 3GJ8A 4B9AA 5JZMA 4C6HA 2CLIB 2Z2JA 3N3BC 2I6QA 1U98A 3OETA 1VZ2A 2GPAA 4KI0A 3ITEA 4P92A 2QTTA 1PSDA 1IVYA 1FYWA 1GRCA 4EF4A 4MRVA 3DEAA 4TLDA 5IDVA 2VP6A 2FJUA 3ESXA 2IV7A 1JU3A 1T91A 1OLSA 3SJCA 2IBMA 4G1BA 5AUNB 3DMHA 2YR0A 4ACAA 1LRJA 2J4FA 5F98A 3K6JA 3G0HA 4KWIA 4C30A 2PXXA 1JPUA 1TLTA 4JQYA 4O2BF 2X0DA 5JISA 5EWJB 2O0LA 1O95C 5EJ7A 2ZI7A 1S2DA 3DCIA 1ZOOA 1WZEA 4PO1A 3NLLA 4GI1A 1MN6A 3DLAA 2A7QA 3WHLA 3HM9A 1Y1SA 3HKBA 3THYA 3RUAA 4D0SA 1SKYE 3C7DB 4JT2A 2Q3FA 1UIMA 2H0AA 2PSFA 3HE3A 1W73A 1H2ZA 1NATA 4JJ6A 4GSYA 4B4UA 4J4HA 3D2LA 5MF6A 5BUCA 3DE0X 4AXXA 2FPGA 1M2OA 3T1YB 1V2GA 2BN4A 2FZLA 2IEAA 5ICCA 3ITNA 1MJ5A 4K0RA 3RJ5A 1HEYA 1XJWA 5CB4A 5IFLA 1RNLA 5TQ2B 2O7QA 4F5ZA 4EJ6A 1UOQA 4RJIA 1RBQA 4W5JA 3NTOA 1K68A 2UVDA 5SICE 4V1CB 3EGXA 3NT5A 5JCOC 2G6TA 3GT4A 3ILSA 1BGVA 1G1MA 1XKTA 3OP1A 1IWPB 4NLLA 1VG8A 1Z2EA 3KJIA 1KETA 1WCYA 3SLRA 2VNAA 4XDYA 4MX8A 4JT9A 3QKWA 4JC0A 2FSFA 3NKVA 1PX2A 3CFYA 1V7QA 3FG9A 3IV7A 3P4UA 2W2PA 2ZSHA 3LO5A 3TBFA 1A9QA 3TSZA 1GTG1 1CY0A 1DG3A 1PUXA 2ZETA 3KZCA 4FIDA 4YJHA 5FLEX 3O7MA 1KGSA 1LW7A 2AEFA 4X44A 5AO9A 2HUNA 2C5LA 2G40A 4C3VA 2G8NA 3GFTA 3FJOA 3CKYA 4YCBA 1LTHR 5HRUA 2HBZA 1F2UB 5GV7A 4IHJA 5EJ9A