4WGGA

Structure of the ternary complex of a zingiber officinale double bond reductase in complex with nadp and coniferyl aldehyde
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
352
structure length
352
Chain Sequence
b'VVVVNKQVLLKHFIPEGAPKETDMELVTTGTIRLRVPEGSNAVLLKNLYLSCDPYMRMRMTKHEEASYVDDFVPGAPITGFGVGKVVDSSHPDFKTGDYVWGLIGWEEYSLITKPQGLFKIHHTEIPLSYYTGILGMVGLTAYVGFYDICSPKKGERVFVSAAAGAVGQIVGQFAKQFGCYVVGSAGSDEKVNLLKTKFGFDEAFNYKKEPDLTKALKRYFPEGIDIYFENVGGPMLEAVLHNMRIKGRIAACGMISQYNLEKPEGVHNLFLIVGKRIRLEGFLVFDHYGSYPEFEEKVVQLIKEEKIKYLEDIVEGLENAPAALIGLFEGRNVGKQVVVVSREKGHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double Bond Reductase
publication title STRUCTURE OF ZINGIBER OFFICINALE DOUBLE BOND REDUCTASE
rcsb
source organism Zingiber officinale
molecule tags Oxidoreductase
total genus 111
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wggA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4wggA01
4DPLA 2Q4EA 2FZEA 4KP7A 4OIMA 4A0SA 1HE3A 4NMHA 2H6EA 1U28A 4RPHA 1I24A 1E1LA 2POQX 1Y8QB 2AXQA 2Z1MA 3I4CA 2X86A 4R1NA 3C1OA 1BDMA 1QMGA 5JMWA 1NFRA 2QYTA 1OI7A 5TT1A 1PL6A 1BG6A 1RM5A 1VRWA 3PJFA 4FFMA 4DIBA 3W1VA 1FDUA 4BNIA 2DPGA 2V6FA 2VQ3A 3DBRA 3DFZA 3M2TA 2B0JA 4L76A 2AE2A 3FI9A 5H81A 5ILGA 3VVBA 7ADHA 4XD2A 3H9UA 3F6YA 4YWJA 3BMQA 3JD4A 4UUOA 1GADO 1Y5RA 3UCEA 3VZRA 3WX0A 5CG1A 3QVSA 3S55A 3UHAA 4OGWA 2VHWA 3OP4A 1LTHR 1C3VA 3LK7A 2PNFA 3INRA 4D45A 5EL0A 3VHRA 4MIYA 1HDRA 4J6FA 2E37A 2Z1NA 2CNBA 4HY3A 1A9ZA 4ZQGA 3EYWA 5TX7A 5BNIA 4F6CA 4GBJA 5HTOA 3BHIA 5B4UA 4KZPA 1PSDA 1ZBQA 3DBHA 3UCXA 4F45A 1T1SA 2YFHA 3SLGA 5IDWA 2Q45A 4OQYA 5KOIA 1E3SA 3O38A 1JN0A 3C7CB 4MPDA 4RF2A 2WJPA 4BGEA 4CV2A 1JU9A 1C0LA 3BMNB 1K2WA 4UEJA 4GL4A 3NEPX 4J90A 3H9EO 4C7JA 3OJ0A 3LSYA 2UYYA 3QVWA 5A03A 4IDBA 4BKPA 1U3TA 1B8PA 4KUEA 1EDZA 4P22A 4ONEA 4IPTA 3QWBA 5IJZA 4RVGA 1FMCA 2BELA 4AG3A 1YXMA 3DQPA 1CJCA 3KYDA 4XDZA 1E7YA 2ZATA 4XIJA 5A3VA 1I3MA 4TKLA 3C7AA 1LLUA 4PZDA 5HWSA 1ZK3A 1ZMOA 4I08A 3I9LA 4MP8A 2JD1A 3SEFA 3ENNA 3WJ7A 2EJWA 2WD8A 2CDCA 1F0YA 1CERA 4XYGA 2ZB8A 3VOSA 4DPMA 5TF4A 3LZ6A 2GCGA 5B37A 3NKLA 3WYBA 4BIIA 1Y7TA 2CD9A 5U4QA 4JP2A 2UV8A 3JQAA 2CDAA 2P2SA 2WYWA 4IXWA 2PA3A 5K0ZA 1XELA 2FZWA 3IC5A 5T5QA 4HBGA 4TMFA 1YQGA 2LDXA 5IN4A 5FF9A 1U8FO 4J2OA 3H3FA 3B6ZA 1T1RA 2J5QA 2BFAA 2V6BA 3DBHB 2JAHA 4YAEA 4MKXA 1ONPA 1DEHA 4XJTA 1HRDA 2X58A 3X2EA 4BNVA 3PLRA 4B4UA 3JYNA 2IXBA 3PQFA 3E6AA 4OM8A 3OQ1A 2QG4A 3LVFO 4Z0TA 2AEJA 1HLPA 4L8VA 4RQTA 4HFJA 1YB5A 1PJCA 3TF5A 4AJIA 3AY6A 2UUPA 4CPDA 5CFZA 2SCUA 1UP4A 1X0VA 1ZJYA 3DHEA 4KDFA 3W8FA 5FI3A 4FDAA 4J9VA 3LDHA 4OSPA 2CZCA 3DBRB 2FHSA 1TEHA 1E3IA 3UN1A 2VNSA 1N92A 1CETA 5I7EA 1X15A 3H2SA 1B16A 3AU9A 3BMQB 3HSKA 2WWRA 4N5NA 3ZV6A 1QYWA 5ICMA 4J91A 3FRJA 4AJOA 4CMIA 1IE3A 3PDUA 4OXKA 4QO7A 3CIFA 4J0EA 4MO2A 3TZKA 3JYLA 1OFGA 1ORRA 1QP8A 1LQTA 1VC2A 4ND4A 4EJMA 2WMDA 3IJRA 5IDXA 5F5NA 2IZ0A 1DC5A 4BMSA 5G0SA 4CLXA 4CMCA 1MUUA 3WGGA 4LW8A 3FSRA 1EVZA 1P45A 2OGUA 3DTTA 1H9BA 1S7CA 3CSDA 2DLDA 3DZHA 1J5PA 3ZNQA 3GMSA 3MJCA 3MJEA 3QE3A 4HNGA 1D4FA 3PYMA 3RC9A 1D7OA 4ZD6A 2YYYA 2X5OA 4FFLA 4CMBA 4HP8A 3MJ4A 4TZTA 3C1AA 2NU8A 1V3TA 2QYSA 3FBGA 4B7XA 1IY8A 1NAHA 1Y8RA 2CMDA 2QW8A 3KYDB 4RPLA 1FK8A 1OAAA 2WYUA 3NTQA 3ZWOA 5JCXA 5L4LA 1LDBA 2XAAA 4ND2A 1PJ2A 5DOZA 4LGVA 1FDTA 3SJ7A 2FR1A 4OOEA 4KWIA 4N54A 4D3DA 2Y93A 1UZLA 3SX2A 4AICA 1J49A 2B37A 4J43A 3JQEA 3GFBA 3RC1A 3JQAB 1DO8A 3PIIA 4LMPA 1B7GO 4OH1A 1WNTA 4OOFA 2I6TA 4RF3A 3RBVA 1SNYA 4GVXA 3CZRA 2HJSA 4NJOA 1NVTA 4CUZA 3RJ9A 3VH2A 2FMUA 4AJJA 2I3AA 3KTDA 1XLTA 1YO6A 1AUPA 4H7PA 4R51A 3LYLA 3JQDA 2PV7A 3U0BA 5K6AC 1FDVA 1GPJA 2R6JA 3PVZA 3NTOA 3BA1A 3AI3A 3BMOA 4Y6RA 2GZ1A 4YDRA 3R0IA 2PTGA 4WASA 3RC2A 2JCXA 1TT5A 4D46A 1MP0A 1QG6A 4JQCA 4BV9A 1EBFA 4WPGA 4CQMA 2XPCA 2VYNA 4YAKA 2A4KA 3DWFA 2W90A 3EVTA 4DBZA 4MINA 2Z5LA 3V2UA 4CQMD 1CIVA 3ON5A 4PIVA 1GAEO 1WAMA 2UDPA 4P38A 3RKUA 4TRRA 3AI1A 1NBOA 2EW8A 3P7MA 4LSWA 3L6DA 4IXTA 2WYVA 4AJPA 3WMWA 4CMIB 1YBAA 5JAMA 1ULSA 2BI8A 3CUKA 3DDNA 3RUEA 4E5KA 3PHJA 4J49A 3GZNA 2DFVA 1N5DA 3NDRA 1M76A 3U4DA 1IHXA 4LMRA 2OL4A 4Y98A 3TNLA 4CMGA 1F12A 1YKFA 3MWEB 2B35A 1XCBA 3INGA 5IXSA 2TMGA 2X0RA 2QQ5A 4S1VA 1LLCA 2YUTA 4JP3A 4TRJA 2QRJA 1E6WA 4LK3A 3Q6IA 2O3QA 5AVOA 1LDEA 4R3NA 1WDLA 1DSSG 3NUGA 3SBOA 1DIHA 1YL7A 3JD1A 4UVDA 1LSOA 1HDYA 5A05A 1B14A 3G1TA 1E1KA 2Q50A 4NFHA 5C7LO 4D42A 4KQXA 3RROA 3C3XA 3IKVA 4IQ0A 5HS6A 3R3SA 3W4KA 3GRKA 4A5OA 1Y8RB 4DQVA 2WE8A 4A73A 2R00A 3SLKA 3U4HA 4R3WA 3RFVA 5IAAA 1P9LA 5G0UA 4ZQEA 4CM7A 2BLLA 2D3TA 2JJYA 2Y0DA 3VPXA 1SBYA 5A06A 1B26A 3GZ4A 3NT5A 4CLOA 2IZZA 4DVJA 1QV6A 2X9GA 4O0LA 4JIGA 3GK3A 1QYCA 1GTMA 4YJDA 3Q2KA 1WZIA 1GPDG 4GX5A 1L7EA 5L40A 1DIRA 3C8MA 4EEZA 3GVXA 3I1JA 4I5GA 4PLWA 3ZHBA 4YR9A 3ZWVA 1OMOA 2GN8A 2JCVA 3JCZA 3KXDA 2AQKA 3D3EA 1P77A 5A9SA 3I3OA 3Q2IA 1GL3A 3JYQA 3VH4A 5JSFA 4L4RA 1E6UA 1IULA 4EYEA 4PLGA 4YACA 3BMOB 2Z95A 2VTDA 3ZGYA 4XRRA 2OBYA 3FNEA 1K6XA 3PJGA 1Y1PA 4JROA 2PH3A 1TT5B 5CEJA 2OP1A 4E2YA 4CQMB 4DIOA 1RM0A 3WGOA 2E48A 3D4OA 4EZBA 1Z7EA 3A4VA 1Y6JA 4QXMA 4BGIA 4EJ6A 4OHUA 4XIYA 4CMAA 3PIDA 1YWGO 4CR8A 3FNGA 2JD0A 4PCVA 2HJRA 2BGKA 2D8AA 3NT2A 3CINA 3WLEA 2RHCA 4O59O 2J5RA 4P4LA 1C14A 3UW3A 1F17A 2O3RA 3WWZA 1SOVA 4GKVA 4R41A 4QX6A 5ADHA 1XEAA 4MVJG 1QYXA 1F8GA 1ZSNA 4I5EA 5KVSA 1DIGA 1CWUA 3RQSA 1YDWA 5JAIA 3BTUA 1RKXA 5ICSA 4YJGA 3GZNB 3ROQA 1TT7A 2CFCA 2EHDA 2X23A 3ZWNA 4UEKA 2R00C 3GLQA 2A94A 4IS3A 2BFMA 1UZNA 4YRDA 5T57A 1JKFA 4MIEA 3AY7A 1Z75A 1OZAA 1PTJA 3PEFA 3VDRA 3DC2A 4YTEA 3FPLA 4DQXA 4K9DA 2I3GA 3GPIA 1R6DA 3RUHA 5JDCA 4CM1A 4D41A 1P1FA 4Z9XA 1PJLA 3PK0A 2JD2A 1VJ1A 2CVQA 2EERA 4UUNA 4DC0A 4IJVA 1NPDA 3JTMA 2NADA 3I4FA 1GQ2A 5L7YA 5T8KA 5I9NA 5JO0A 3FPCA 4PLFA 2FP4A 1KETA 2O2YA 1LLQA 4B7CA 4J2HA 1P33A 2PZLA 4L4SA 4YPOA 2I67A 1BGVA 2X0JA 5CHEA 3VVCA 2X0NA 4O6VA 5KVQA 3IP3A 2UVDA 1FJHA 3FWNA 4IDDA 5G0VA 4CLOB 2WM3A 5LDHA 1Q7BA 1GU7A 1G6KA 4ZRMA 5CDSA 5JCJA 3AM4A 1FF9A 3ZN2A 3DFUA 3HFSA 2Q1TA 3VTZA 2VWQA 4YRAA 1LDYA 1A4IA 1I2BA 4QTZA 3TOXA 1R0SA 1PGPA 4Z6KA 1LQUA 3U3XA 2D59A 2GASA 5JCJD 5TQVA 5A9SB 4Y6PA 4WGGA 5CEEA 3OEYA 3DMTA 3DB2A 3EDMA 4J16A 3GN1A 1LDMA 5A3JA 1DC6A 1XHLA 1IUKA 3TL3A 4DBVO 1M6HA 4XJSA 3QRWA 2VUUA 5AQ1A 2FPIA 5U1PA 4QO8A 4JGBA 1G0OA 3EW7A 2VT2A 1EQUA 2OHXA 2W2LA 2XF8A 4JJGA 4R54A 4PLZA 1QR6A 2AE1A 4BL5A 1A5ZA 4PG4A 4GX0A 3RD5A 5GY7A 1H6BA 1QKIA 3MOIA 4L9RA 5TIIA 1SEVA 1HDCA 4D3FA 4YQYA 2ZQYA 2HQ1A 2Q49A 4ZJUA 4U8GA 4D44A 1CDOA 2P9EA 3GC6A 1QYVA 2EF1A 3T7CA 1QORA 5IZCA 4DQUA 3VZSA 3ETEA 1PQPA 2JL1A 4IDFA 1NQ5A 2B4RO 2ZYAA 4NDNE 4QQRA 4IS2A 4CM6A 4FB5A 3DO5A 2NTNA 1HYEA 3C85A 1ZK0A 4MVJM 4DUPA 3DZIA 4EI2A 1U1IA 4UVIA 3OM9A 4WCFA 2FN7A 4UVHA 1V0JA 1XYGA 1B3BA 4PG7A 4YJGB 2CVOA 5EN4A 2ZJ1A 2DT5A 5HA5A 3JD2A 4RJTA 4DXHA 1DIBA 2NM0A 3VPSA 3I9NA 5B12A 5HRUA 5ER9A 4CR7A 3H6KA 4E2WA 5TT0A 3GEMA 4IDEA 1MFZA 1Y9EA 1T2CA 4FN4A 4Y6SA 3U4CA 4BKOA 1JWAB 2J5KA 4JJIA 1DJQA 2QX7A 1NVGA 4FC7A 3EVNA 2HRZA 3RUCA 2NU6A 4YQZA 3PWSA 2O3UA 5KCZA 1ZK2A 1AN9A 3ROKA 5L4NA 1Q0HA 2B69A 3ZWWA 1C1DA 2IYOA 1EK6A 1K3TA 2NV6A 2P9CA 4JLWA 4NBVA 3GA0A 4TSKA 3EMKA 1WDMA 4XRGA 1BVUA 2Q2WA 4M54A 3G17A 3BTSA 2EV9A 4RL6A 4DPKA 1NX6A 2DTXA 1QLHA 1BTOA 2VT3A 4CLDA 5IDQA 4N18A 2H5LA 5AYVA 5ITVA 2D2IA 4XDYA 2QRKA 1V8BA 5EIOA 5I7FA 3SC6A 3L77A 4NU5A 3QWHA 1LXCA 2VRCA 3PWZA 2PD3A 1HTBA 4TWRA 2O23A 3HE3A 2YW9A 3PDJA 2H1SA 3JQ7A 2DBRA 5KVCA 3GH3A 3KLMX 4GWGA 3RAJA 4YBZA 4XB1A 4TVOA 4F6LA 2O7SA 3KEQA 1DRVA 3MJSA 1R12A 4YVFA 3AOEC 2DPHA 4BNHA 4RDHA 3L9WA 2OMEA 3QV1A 4MVJA 1JDJA 3FHLA 4EJ0A 1NWHA 2NACA 1PWZA 1HDOA 1X7GA 1A4UA 4TRNA 3WWYA 3O9ZA 4IMRA 4WOKA 2NSDA 4LISA 1D1SA 3WIEA 4WCFC 4CODB 4AJ4A 4IINA 1A27A 1DHTA 2EIHA 4MVJD 3QVOA 2GZ2A 3JQBA 5IG2A 2C29D 3AFMA 4XYLA 4ZVVA 1SZJG 2DBVO 2ZB3A 2YQ5A 4OXNA 3ZWBA 2HCTA 3I6IA 3WMXA 5BNTA 2DBQA 3NGXA 4P8RA 1YL6A 1P0CA 4BO0A 3I9KA 4I5FA 3GGOA 1WPQA 1CF2O 4DL9A 2J3HA 1PS0A 4J1QA 4C4OA 3DZFA 3FTPA 2HMWA 1HDXA 3G0OA 2EKPA 2OORA 5DP1A 3K5PA 4CQLA 5L95A 4DC1A 2AG5A 3U09A 3SJUA 1AGNA 2B5WA 1ADFA 3KYCA 4DRYA 4MVJE 1Z82A 4B4OA 4GGPA 5KJCA 1HEUA 1I32A 4GWKA 3INTA 3MZ0A 4KQWA 1DAPA 3UAGA 1B3RA 2HMSA 2GR9A 1U8XX 1KIFA 3RIHA 1DB3A 4FJ0A 4ND3A 2ILTA 1YE3A 3MJVA 5IF3A 3AY3A 3W6ZA 1K0UA 3QVTA 4W99A 1HZZA 4OJNA 1HYHA 1SMKA 3CPSA 3ZU4A 4LVCA 4Q3BA 1VSVA 4FPXA 2EG9A 5EINA 1LSJA 4IDCA 4GX2A 1ID1A 4IJWA 1C1DB 4WK6A 4B4VA 4H16A 9LDBA 1DPGA 4OAQA 3TZHA 1EUCA 3HDHA 3GRPA 4U0JA 3GG2A 4JX8A 2Q1UA 5BSEA 3WGHA 1ZEMA 2GDZA 4CLRA 1QXSA 3DBLA 2P5YA 1BWSA 3RC7A 5HS4A 4PLHA 4K26A 3KUXA 4XQCA 3F4BA 2HK9A 2VWGA 3TFOA 2RH8A 3LF1A 3DR3A 4XQEA 2O4UX 1E6EA 4MP3A 2YDXA 3JQBC 3D1LA 4ESOA 1GZ3A 4Z0HO 1DRUA 1H6CA 1BXZA 4NHEA 4EGFA 3JQ7B 5G4LA 2WSBA 1WDKA 3KOUA 2NLOA 1JKJA 1R0LA 5L3ZA 3TWOA 3WS7A 1U2DA 1YS4A 1NYTA 3AFNA 4J7UA 3RU7A 4FC6A 3VPGA 3WSVA 3E9MA 4RGBA 5JNLA 1O9BA 3HZZA 3QWAA 3WXBA 3ETGA 3O8QA 2E4AA 3GEGA 4D0SA 1MC5A 3H9QA 5A02A 2VN8A 4N5LA 1NFQA 3E5RA 4HX5A 1ZCJA 2AW5A 1RPNA 2DTEA 4A10A 3E82A 2VOEA 2C7VA 3OIFA 3HN7A 1I5RA 1T26A 3E03A 3U9LA 5JFOA 2YJZA 5JXWA 4M8SA 3VPHA 2R2GA 3OJLA 5KJ1A 4PFJA 2DQ4A 3OQBA 3QW2A 1OC4A 4PRLA 3WFJA 1DXYA 2NQTA 5I9MA 1Y9AA 4FCCA 5BT9A 5LCXA 4RVFA 5GZ6A 5A5FA 1VJTA 3T4XA 1A7KA 3JQAD 1Z45A 4OYRA 4BO5A 1KERA 3E1KA 4DYVA 2Y0CA 5A4DA 2NUAA 3ONEA 1PJTA 4W82A 5F3RA 4CQLB 1U4SA 1JTVA 3GMDA 3GGPA 2CF5A 4CLHA 4CLEA 3H3JA 4Z9FA 1YH3A 3DHYA 2X6TA 5F21A 3KYCB 3PI7A 5A9TA 4GVLA 5L4SA 1I2CA 4ND1A 1VI2A 4M86A 2DAPA 3NJ4A 1T2FA 4OXYA 3I9JA 4URFA 4BOYA 3PQDA 5TGDA 1JAXA 1XKQA 2HUNA 3WOHA 3DZGA 3O03A 3WYEA 4JK3A 4IM7A 2OUIA 1H0KA 4BVAA 4K28A 4IY1A 2C0CA 3WGZA 1TXGA 5DBIA 3GUCA 3GDOA 3B1JA 5K6AA 4UULA 5THKA 4UUMA 1VE9A 4D0RA 3PP8A 3IJPA 5JAQA 1VL0A 1YB4A 2C07A 4DIFA 4WUVA 3WGTA 1HXHA 4ALMA 2WDZA 1RJWA 4P4GA 1HZJA 4CLRB 3DBLB 4U5QA 1DBVO 1JAYA 3GF4A 3U4IA 1ZSVA 4ZA2A 2YV1A 3UUWA 1UH5A 2EP7A 2OOSA 4Z9YA 4BV8A 4CJXA 4EUEA 1M66A 1O94A 4BO1A 3S2IA 2DUWA 3TPCA 3LLVA 3K2BA 3ZV4A 3CMMA 1BW9A 4II3A 5KJ6A 1LNQA 3QP9A 4E2XA 1RYDA 1UDBA 2ZTLA 3NRCA 1C0IA 4YB8A 1PZHA 1DC3A 1M67A 4FBGA 3DAFA 2NTVA 1ZEJA 1R0KA 4FQ8A 3FBTA 4DYDA 1KVTA 1HYGA 3PHGA 3A06A 5DCWA 2HSDA 3WNQA 3OEWA 3L6EA 1PS9A 3GEDA 5BSFA 1OC2A 5EQFA 1XU9A 3O8QB 1GV1A 4YEDA 2HMTA 4N7RA 4J4HA 1IB6A 3PQEA 4QT0A 5L51A 2IEDA 3PXXA 2FSSA 3ZV3A 4R01A 3L4BC 2RCYA 1T4BA 1JLLA 1R16A 2PK3A 3WG9A 1E3EA 1XWFA 2FWMX 4ID9A 3V8BA 2VNAA 2FRDA 3ZH2A 4E3ZA 4GQAA 3TDKA 4FS3A 1RYEA 2LDBA 3ITKA 2DTDA 4PLVA 2HO5A 3WTCA 3ROMA 3GFGA 3UH1A 4LN1A 2NWQA 1HWYA 3MJTA 4PG5A 3LC1O 5MGBA 3B1KA 3ZHYA 4IQ8A 3DAPA 1TA4A 2VZ9A 4W9NC 1LDGA 3OBBA 1UXHA 1DLIA 3R6DA 3C1TA 4EBFA 1DIAA 1O6ZA 4B4WA 2JFFA 4GKBA 2GPTA 3CZMA 1Q7CA 1Q7GA 3DZKA 1NWCA 5DCYA 3DOCA 2YDYA 1MA0A 1YBMA 4JNKA 1A71A 2EP5A 1ZSYA 4E21A 3GVIA 2X5KO 1SO8A 3R1IA 3JQFC 3D64A 3F9IA 4O5OA 5TS3A 1ENPA 4L0QA 3KSZO 3ZWXA 3VPFA 1MX3A 3COSA 3OJFA 2VYND 7MDHA 3GVCA 1HSZA 1X13A 4Z3DA 1E77A 1K89A 1TI7A 4G81A 4CV3A 1MV8A 4IGFA 1JA9A 3CE6A 3ZWCA 3IIEA 5I7SA 1GYRA 3KVOA 1WMAA 1I0ZA 8ADHA 4UUPA 1E7WA 5JO9A 1NQOA 5B1YA 3FWZA 1HKUA 3U49A 1E1NA 1KEVA 3PZBA 5K1SA 3E5MA 4F46A 2EW2A 4XCVA 4BGUA 4CMJA 1E5QA 3K2EA 3FNFA 4G2NA 4BKUA 4CMEC 1V3VA 4IDGA 1T2DA 4R69A 4WKGA 1CQIA 1EFLA 1XDWA 2A35A 2YV2A 1EE2A 3IUPA 4E12A 4HUJA 5JY1A 3JV7A 1BW9B 3GAFA 2XXBA 2PZJA 3D4NA 1ULUA 3H9JA 3V1TC 4RPJA 3WQSB 3M2PA 5EESA 2O3TA 3WLFA 3ITDA 2JAPA 4W6ZA 3TZ6A 3ZNOA 5C5IA 3KRTA 2GD1O 3ZNPA 4H15A 3H2ZA 3D5QA 5T64A 3ADPA 3PGJA 3GPDG 3M1AA 5T6BA 1VM6A 4I1IA 5I8WA 1ISIA 3LLSA 2YHUA 2Y1FA 2BF7A 3UCFA 2GRAA 4ALNA 1F06A 1ZH8A 4QFCA 1U9JA 1ZK1A 3MOGA 9LDTA 1T4DA 4BNLA 1AXEA 2EGHA 2V7PA 1R66A 3GUYA 1LUAA 2Q2VA 1E7RA 4FFNA 2HLPA 3GN2A 4ZQFA 3ANLA 1EVJA 2W2KA 1CRWG 4F3YA 1O5IA 1P1JA 2WD7A 1VJ0A 2ET6A 3KEOA 3HDYA 3OH8A 4U0KA 3KV3O 1GQQA 5JPIA 5KWEA 1KVSA 4AJNA 5IN5A 5C37A 4AJEA 4BB6A 3DEYX 4WCDA 3ZHXA 5DNAA 4E2ZA 3I9MA 1IZ0A 2PWZA 3ZW8A 1CEQA 3TJRA 1ML3A 3GR6A 3VDQA 2C20A 2OFPA 4E5PA 1DAOA 4MKRA 4GGOA 3KETA 3M1LA 1U3VA 3JQCA 1F14A 1BSVA 1Y5MA 2FSVA 2BRUA 4BNKA 2VUSA 2Y1GA 5A9RA 1W73A 3JYPA 3ENKA 4HXYA 1P1HA 2J3JA 4UEOA 5DT9A 5THQA 1XR3A 2X5JO 3FNHA 3V1UA 3WYCA 1PQUA 1P31A 1SB9A 4ZGWA 1PGOA 5DZSA 2VRBA 2X9VA 1LRJA 5JW6A 4DA9A 3LQFA 2EKLA 2GN9A 4Q39A 2PLAA 4R4JA 1ZK4A 3EZYA 5L9AA 2Y66A 3P2YA 3Q1LA 1ISJA 1PWXA 4WNCA 4ALKA 2JHGA 5TLSA 1MXHA 3E48A 1H9AA 1N1EA 3V1YA 2CY0A 4I5DA 3HFGA 1NFFA 4QSMA 2GERA 5JMPA 5G4KA 3KSUA 2GSDA 3EY4A 1MG5A 1ONNA 4UREA 3IOYA 1T2EA 2VYVA 1SCUA 3JD0A 2PKQP 3LT2A 1FDWA 3TFQA 5ITWA 3Q11A 3H5NA 2OO5A 3PZRA 1UDAA 2PR2A 1PX0A 4EITA 3G3EA 3OIGA 4PLPA 1K6IA 3PLNA 2CDBA 2VYVD 1WW8A 5CAEA 3EGOA 3TOZA 1ISGA 2X7HA 4CL8A 1N9GA 2F1KA 2GZ3A 1ADBA 3WGQA 4WLOA 4XQ9A 5L7TA 1ZMTA 3ZHZA 4YAIA 2AQHA 3UICA 1H2BA 3V2GA 3GNSA 4WNIA 3TN7A 3ICCA 3VZQA 2G0TA 5A5EA 1BXGA 1WXDA 4FJ1A 1K6JA 2BMAA 1W6UA 1LSUA 4G65A 3ICPA 3EHEA 3BTVA 1LRLA 1EBUA 4TQGA 2IODA 4YJHA 3WSWA 4BNYA 6LDHA 4BUCA 5DBGA 3H5RA 4JCOA 4YCAA 2W2KB 1XQ1A 4NQZA 3RBXA 1Q1NA 2QIOA 1U7HA 1UR5A 1TB4A 1ADGA 2DC1A 2WD7B 3FF4A 5KTKA 4IBOA 1UZMA 4W7HA 2ZJ0A 3WICA 2QZZA 4J3FA 1PEDA 4WLFA 3L6OO 1GYPA 1PL8A 3AK4A 1G1AA 3IAHA 4NJMA 3I9OA 1PR3A 3Q3CA 1Z74A 1K5HA 1P1KA 3HN2A 4BNWA 8LDHA 4D3SA 4TROA 5JYEA 3TQHA 4RVDA 3GDGA 1E92A 1NR1A 3ZWPA 3OETA 1QLJA 3UOGA 4B8WA 1PZEA 2QRLA 1T25A 1XG5A 3ANMA 2IDZA 3BTOA 2ZIZA 2FPGA 2W2LD 3UXYA 2IEBA 3R3JA 4Q3EA 4RF5A 1VKOA 2TMDA 3WQQA 2BHLA 3AOEA 1HE4A 2GN6A 4BNJA 3AUTA 4INAA 4DREA 2PY6A 1ZFNA 2JFGA 5C7OO 5K9ZA 1JVBA 3NJ8A 1W0CA 4HNHA 5TJ9A 2OBNA 1UXGA 3JD3A 1NTOA 4J1SA 1YQXA 4CM5A 1EMDA 1V9LA 2JHFA 4UVGA 4AL4A 1HT0A 4PLCA 4B3HA 1M2WA 4I9NA 1VL8A 3ADOA 5I9LA 3HHPA 2AHRA 3AU8A 3MEQA 3FN4A 3JQGA 4D7AA 3KBOA 3BHJA 4BO9A 3S2FA 4CM4A 2GYYA 4J4BA 4XYMA 5G4KB 4IZIA 4Q3CA 1IHYA 3FR8A 1UP6A 3GHHA 5DOVA 1X7HA 5BSHA 4TRMA 5IFLA 3IS3A 2GNAA 3D3WA 3K31A 4RVHA 3PHLA 2C5AA 1V35A 4ITUA 5BSGA 1SPXA 2EJVA 3MTJA 4K6CA 4E5YA 4YT2A 1KY5A 1MG0A 2VHZA 1HE5A 1N9GB 4GMGA 4UAGA 3AW9A 2WEKA 3JQ6A 4M49A 1CQJA 4CM9A 3WBBA 1NVMB 1MGOA 1E1MA 4YAJA 3ZZNA 4B79A 3L4SO 4MVJP 1BXGB 3DL2A 1BRMA 2ZB7A 5JC8A 5KNLA 4BNTA 2HU2A 4QECA 3CKYA 2BGLA 4QEDA 4YJHB 4O1MA 4J9UE 4ND5A 4E6PA 2PKQO 5IZ4A 2J3KA 1BDBA 2VCYA 4NI5A 4JN6B 2P5UA 2VRCD 1YRLA 1UJMA 2FPPA 1IPEA 2X0IA 3HWRA 4MOWA 3ASUA 1Q0QA 5AXCA 4NJMB 4IJUA 4BNMA 3IQDB 1UXIA 4RF4A 5DF1A 1GUYA 4HKTA 1H94A 4RLSA 1KBZA 5C7IO 1SAYA 3HADA 3NV9A 1WMBA 5G2OA 3PJEA 3AUSA 3ONFA 1P1RA 4PGFA 4JJFA 3QVXA 4BGVA 3AM3A 4BMVA 3E18A 4MKZA 2IYPA 5J23A 3RJ5A 3OIDA 4NFSA 1E7QA 4CV1A 2C2XA 4W4TA 2VZ8A 3QLJA 2J6IA 3ABIA 3KHUA 4B7UA 1NPTO 3AUAA 4FFRA 1QV7A 1VPDA 3KLPX 1Z6ZA 3F46A 3QJ5A 1N2SA 2RIRA 1I10A 2ZTMA 3LT4A 4FGWA 3N7UA 1X1EA 4GMFA 3V5NA 2F00A 4J0FA 3KSDO 1LI4A 3ZV5A 4MVJH 1IPFA 1W8DA 1PJQA 1YB1A 4L4XA 4WCFB 1WZEA 2C82A 2PKRA 3PFFA 1B8UA 4XQGA 3ZWMA 3E9NA 1RM3A 3DOJA 3AUUA 2YQ4A 1YJ8A 4DLBA 5KVVA 3JSAA 3W6UA 1GUFA 3PRJA 1T2AA 3NAQA 5KKAA 4GLLA 3JQGB 1I2ZA 3D4PA 3GDFA 1VLLA 3RI3A 3RU9A 5FWNA 4CM4B 4OL9A 4OO3A 1I33A 3WJAA 1YONA 2O3JA 1XQ6A 4AJLA 3ZNNA 4R5MA 1XSEA 4C7KA 5I7VA 5CPBA 2A9FA 2X8LA 1NQTA 4CMKA 4RZIA 5COQA 3K8ZA 2BH9A 4U6SA 1I36A 4N5MA 4A03A 3D3WB 3H9GA 3D0OA 3HB4X 1JVSA 2AEFA 1Q0LA 2UAGA 5DULA 4ALJA 5JS6A 1EVIA 1UAYA 3GAZA 4RLHA 4R1UA 3GOHA 4QUKA 2Y1OA 1BXKA 5KIAA 1GY8A 2NU7A 3M6IA 4R1TA 1I3LA 4MJLA 6ADHA 5ENVA 5JBIA 1E3LA 4Y67A 3RUFA 3TZQA 1KEUA 1KVRA 4KDEA 5JDIC 4MVJI 1N7GA 4RPKA 4MP6A 4RZHA 2DU8A 3ZI0A 3ZWAA 4E30A 4TKMA 1MXFA 3DMYA 1Q2XA 1U3WA 1Y81A 1I3KA 3AI2A 3KZVA 2RH4A 4DMLA 3LT1A 4DLLA 5F1KA 1GD1O 1TLTA 3T7EA 4Y9DA 3KM0A 1PGNA 1YJQA 3OMLA 3V2HA 4MIOA 3ASVA 1KEPA 2O4CA 3E8XA 5BR7A 2I5PO 3AOGA 3OQ6A 3GHYA 1KVUA 2H9IA 2NU9A 4RVUA 4J7CA 1EEHA 4BMNA 1PZFA 1EUZA 1ZJZA 1XA0A 2IE0A 1N8KA 2PD6A 1PJSA 3ST7A 2QZ9A 3P19A 3HDQA 2VHVA 3WQRA 2I9PA 4AJHA 3GNTA 3W8DA 4KUGA 3JQ9C 1QSGA 1P44A 3OSUA 3TL2A 3FCOA 4GX1A 1RM4A 1H2HA 3AWDA 4A2CA 1RWBA 3PGXA 3UFXA 1VKNA 4YJFA 3WB9A 1BHSA 1P74A 3WDSA 5G0WA 3H4VA 1U5AA 1HSOA 1GDHA 3NX4A 1VL6A 4KMSA 2D1YA 1H93A 2X1HA 1N1GA 2D4AA 3I6QA 4PVCA 4RO0A 3G79A 1LC0A 1AE1A 3RUAA 3VKUA 3L4BA 3DOOA 1M75A 3I52A 2Q1SA 3D7LA 3OHSX 2HDHA 4CUJA 2DM6A 1ISMA 4EW6A 4R16A 5HM8A 4A26A 2RHRA 3KO8A 4OSOA 4HFNA 1HL3A 3GG9A 5COAA 4U7WA 5CDTA 1EUDA 3JQ8A 2Y05A 3P2OA 2C7GA 1JKIA 3WBFA 2ZCUA 2CVZA 2IZ1A 4FGSA 4PN3A 2YHIA 1XIVA 1ARZA 4AJ2A 3HNPA 4PG6A 3UF0A 1SC6A 2CF6A 3STHA 4BNFA 4W9NA 2DKNA 4XWYA 1JWBB 4YYZA 1LA2A 2AQIA 4RV9A 4ZQHA 4NFYA 1SOWA 2GLXA 4TVBA 2E82A 2E49A 2Y67A 2J8ZA 3QA9A 4PZEA 4PG8A 5H82A 1A7AA 3NDJA 3SXPA 4ALLA 3A9WA 5HBRA 1PJ3A 4R1SA 3H5AA 3H8VA 4W7IA 4HV4A 1I30A 5EJ2A 4TZKA 2P4HX 1D1TA 3JQFA 4FSHA 4PLYA 4YT5A 2H63A 2ZTVA 3G49A 4JBGA 3Q9NA 3PJDA 5EPOA 4XGKA 4DLAA 5KKCA 5JE8A 3ROPA 4M55A 4IZHA 1HLDA 1NM5A 1ZUD1 5GZ3A 2OXIA 2HKIA 4P4NA 4BNNA 1TVEA 3PYXA 5ER6A 3W4JA 1I3NA 2FR8A 2Y99A 2YY7A 3N58A 4WEOA 3HUDA 2VWPA 1GZ4A 4FR5A 4J1TA 4UVEA 4E13A 1V3UA 5ENDA 4GAEA 4BQRA 3OFSA 2Q4BA 1XU7A 3U5TA 3H7AA 2X9NA 2DUUA 4XZ3A 1GYQA 2HK8A 3WGIA 3S1LA 3LT0A 4B8ZA 2Y1CA 4OMUA 3OJEA 2B4TO 1FXSA 1LX6A 4J4TA 2JFHA 4NR0A 2NVUA 4CMEA 4BHTA 4DWVA 5CP8A 5DCUA 1DLJA 1AHIA 1E7SA 4U6QA 5CDUA 5ES3A 5U9CA 3ULKA 1CYDA 4RPGA 3EAGA 1WWKA 3MTGA 1B0AA 4Z3KA 1JW9B 3VC7A 3Q9UA 4M1QA 1N7HA 3RWBA 1NASA 3X2FA 5JY6A 4QFDA 1A9YA 4MVJF 2DFDA 1IOLA 2WE7A 2EXXA 3QWFA 4YJFB 4AJ1A 4J1NA 3G1UA 2P4QA 4L75A 3EK2A 3BMCA 1IYZA 2G17A 4FFOA 1KS9A 2RAFA 1YL5A 1O89A 2VUTA 3IKTA 2OZPA 1ZVMA 1JQBA 1ENOA 5ILOA 5CPFA 4HADA 4ZICA 1Z73A 2C54A 4HFMA 4WE3A 1U7TA 3F5QA 5F5LA 5IXYA 4CR6A 2PGDA 3RVDA 2HRBA 3RFXA 1J4AA 2Q46A 2HK7A 1XGKA 2D5AA 4FOOA 4K6FA 3D5TA 2PZKA 5F1PA 3JQ8B 2CUKA 1I8TA 4CV0A 1HDZA 1PL7A 2VWHA 2W8ZA 1AHHA 4JBHA 5FI5A 4BNGA 4ZN6A 3K30A 4FD3A 2VTEA 3RKRA 1GZ6A 2YHIB 1BMDA 1EE9A 3WNVA 1PIWA 2VOJA 3GVPA 3IDSA 3GGGA 3LC2O 3A28A 4YT8A 3RCBA 3O4RA 3LU1A 1D3AA 3OA0A 2BFPA 4CM8A 1LLDA 4XYBA 4XGIA 5GMOA 4NBWA 3DXFA 3F1LA 2P91A 3GQVA 4KTTE 2I99A 2O7QA 3NGLA 1G0NA 2Q2QA 2AQ8A 4ILKA 2NTJA 3F4LA 1EFKA 4J7XA 4JBIA 4WLVA 1PGJA 4EUFA 1X7DA 4NPCA 5EMHA 4RQUA 4K1LA 4IMPA 1MC4A 4GLOA 1L7DA 1PU2A 2D0IA 1FDSA 1KVQA 3O26A 4IQGA 4PVDA 3VAZA 5KJFA 3ZU3A 2O3SA 2AEMA 4BO2A 5L45A 3H65A 2VHXA 3PPIA 1KC3A 4PRKA 1P3DA 4H3VA 4E4YA 1ADCA 2EKQA 2NVBA 5DDIP 3VZPA 5DN9A 2HMVA 3BHMA 3VKVA 4CMHA 1E3WA 5CG2A 2NVUB 1DRWA 4R9SA 3PHHA 4E5MA 5IDYA 2B83A 3VH3A 1KC1A 5B4VA 3QHAA 3FR7A 2GUGA 4XR4A 3IMFA 1ZKMA 4L74A 3F5SA 4Q9NA 2IRWA 4G5HA 2O2SA 1HETA 1NP3A 3NYWA 1U3UA 4BO3A 1EDOA 3PYLA 4M89A 4NG5A 4Y8VA 4PZCA 1KY4A 1MLDA 5BQFA 2ZYGA 2FOIA 2D5CA 2G1UA 3QQPA 3QWIA 4Q3NA 4E31A 2BFOA 1WLYA 1H5QA 3BMCB 3W4IA 2Y1DA 4IGEA 4IDAA 4HFRA 1ZZEA 5C3MA 1LC3A 3DHNA 3OICA 3QIVA 3WFIA 1X0XA 2JCYA 5FFFA 1O8CA 1GV0A 3AJRA 5B4TA 5BNFA 3ZU2A 4IIUA 3I5MA 3ZU5A 3DBVO 5L7WA 3GT0A 1E0DA 2FR0A 4BNUA 4WOJA 5T67A 3UKOA 5I8ZA 2G76A 3RFTA 3L9XA 2EGGA 1C1XA 4IIVA 3VTFA 1GEEA 5JYDA 3DZBA 1DC4A 1PGQA 2DVMA 3ZW9A 1ISFA 1GCOA 3IUSA 2G82A 4PLTA 2B4QA 5COBA 4CUKA 4XX0A 1LU9A 2UUOA 1O95A 1HE2A 1LEHA 1R15A 3OECA 4ZQBA 3WGYA 4BB5A 4CM3A 1NR7A 5KJEA 1UDCA 5AXDA 4NK5A 3WR5A 4BO8A 1KOLA 4E0BA 4CM8B 3EUWA 4DMMA 1R4MA 4EEXA 4FOSA 1EZ4A 3ONDA 4I8XA 4EDFA 3SC4A 3JYOA 4FIZA 3I23A 1J6UA 2BKAA 3BAZA 4NZ9A 4ZHSA 3PHIA 2FY8A 1WVGA 3ZWYA 1IL0A 3MCVA 1DDOA 3HDJA 5AXBA 3WIDA 1I01A 2PGJA 4ALIA 1GEGA 1ISHA 5A1TA 2GO1A 1P0FA 1O0SA 3B70A 4GSKA 4BQPA 1GCUA 3IP1A 2W4QA 4OKNA 3DZJA 4KWHA 4WJZA 1B8VA 1ZW1A 2Y1EA 3QY9A 2V6GA 1MB4A 1PQWA 1UXKA 5JC1A 1F8FA 1NHGA 3ETDA 2IXAA 1C0KA 5AOVA 1E3WB 4L73A 4M87A 4RDIA 2ZK7A 4D79A 3CXRA 3I83A 4E5NA 2C5EA 1ENZA 3PFWO 3K6JA 4HWKA 4WLNA 2EWMA 4R68A 4NNJA 4LCJA 1X1TA 4BS9A 4O63O 3CTMA 2PFGA 1R4NA 1KEWA 4I9HA 4AJKA 1ZXLA 5MDHA 1GUZA 1H6AA 1PZGA 2G5CA 1E7MA 3SVTA 3Q0EA 2O50A 3EC7A 5AXAA 1U5CA 4YT4A 3CMCO 1LJ8A 2EEZA 4BKQA 4OKIA 5JLAA 1YQDA 2O48X 4Q3AA 2YFQA 4JXKA 2X4GA 3F3SA 4FJ2A 3F1KA 4BO6A 4IUYA 2V6MA 4EUHA 2VZ0A 1C0PA 4XYEA 1SEPA 4ZU3A 2I66A 2PH5A 2VHYA 1YOVA 5EQDA 2NQ8A 3B20A 4KUHA 4FFPA 4Q3DA 2DBZA 1GFSA 4LCEA 2NVWA 2AG8A 3C7DB 1DJNA 5TSDA 2HMUA 3HJAA 1OOEA 3T4EA 1AXGA 3HG7A 1NQAO 4AVYA 1EQ2A 4WECA 1C1XB 4II2A 3RSHA 2YZ7A 2GF2A 3BZUA 4NBUA 1EK5A 3TZCA 3UVEA 2PGLA 4A7PA 3ZDFA 1UP7A 1T24A 4XEHA 5GZ1A 5L53A 3U62A 2GN4A 4GH5A 4RVSA 1P1IA 3KB6A 3S2EA 4I9UA 4NBTA 4MDHA 1MFPA 4IJKA 3MWDB 4LRTB 2XOXA 3C24A 1YDEA 4D43A 3TSCA 4ROSA 3UGKA 3CH6A 3B1FA 1R4MB 3HQ4O 5G0TA 5FEUA 4XKJA 1E5LA 4OQZA 1LSSA 2Q1WA 4KOAA 3HB5X 4YXFA 1DHRA 3PTZA 2P9GA 1LBEA 5LDGA 2JKVA 2I76A 4ZRNA 2B36A 1DFGA 2E6UX 5JDCC 2Y0EA 3GY0A 4DTIA 3LF2A 1QYDA 4DGSA 4Z0PA 5FYDA 1ZO8A 2J3IA 1UXJA 2A92A 2C59A 2X22A 4GI2A 5T8KC 1GQYA 3FTNA 4S3MA 1Y8QA 4WLUA 5CEFA 3NTRA 1EVYA 4GSLA 1LRKA 3QSGA 3W8EA 2BD0A 4BNZA 2ZYDA 1QRRA 2B5VA 1IZ9A 2PD4A 5TNXA 5CDGA 3DONA 1NXQA 4XGNA 1NNUA 4E32A 3KYBA 1UUFA 1H6DA 2Q99A 3S8MA 3RUDA 1ZNQO 4E33A 3LC7O 1LDNA 3EZLA 2YV3A 2NNLD 1J0XO 5DBFA 1DOHA 1PJ4A 5TC4A 3P5SA 4BO4A 1M6WA 1HDGO 5H83A 1YVEI 4BNXA 1R4NB 3K73O 4B3JA 3RBZA 3S2GA 4CM9D 3GNQA 1U2GA 3DMTC 1PJBA 4B3IA 1NPYA 4LSMA 4YRBA 2XXJA 1ZXBA 1YGYA 2ZQZA 1BVRA 1HF3A 1S6YA 3ANNA 5LC1A 3E9QA 4CL3A 4A27A 1B15A 1NAIA 3BYZA 1NHWA 1ZIDA 3DTYA 2AA3A 5F1OA 3WTBA 4FW8A 3K9QO 3K92A 3NDIA 2P68A 3PWKA 1R37A 5A04A 2BI7A 4WEQA 1YOVB 5TRTA 3GVHA 4NK4A 3BMNA 5DP2A 4BKRA 1PR9A 4AFNA 1SB8A 4YAGA 1OBFO 1L1FA 3VH1A 4RCVA 3A14A 3L0DA 1DFHA 4XR9A 1GR0A 5JDIA 2GGSA 3ORFA 4XA8A 5CDYA 1W4ZA 5IZCC 1WP4A 4XB2A 2CSUA 3BXXA 4WLEA 2ZTUA 2RBEA 1UAGA 4NBRA 2OP0A 3F47A 4LVUA 5JAZA 3K96A 4BO7A 1ONOA 1YBVA 2BGMA 1X14A 2I65A 2Y68A 3ZCXA 2C2YA 2ZB4A 2AMFA 4NU6A 3IL2A 3BIOA 1B2LA 3A1NA 3OA2A 4LRSB 4KTVE 1U4OA 2ZCVA 3OJOA 2QHXA 3L07A 4NIMA 5EERA 2HAEA 4YA6A 3TRIA 2PZMA 1DFIA 3N74A 1KYQA 2W98A 3FD8A 1Z7BA 1PS8A 4GPD1 2V65A 4R9RA 3DAGA 2WTBA 1A72A 3CEAA 1V6AA 2ZKLA 3RASA 1VSUA 2Q3EA 4NH4A 4RORA 5TJHA 3AM5A 3NT4A 4R5HA 3RUIA 3JQ9A 1D8AA 3OF2A 4X54A 1ENYA 1E3JA
chains in the Genus database with same CATH superfamily
5DNWA 4QBKA 4YLGA 1RI5A 3IVXA 3LY8A 5FI1B 1RLUA 3KTOA 2FA9A 2FRVA 4RPHA 2BCGY 1E1LA 1DOAA 3E9DA 1PZMA 5FXMA 2A58A 2ZUWA 4EG5A 1DWQA 4CKZA 2X86A 4R1NA 3U26A 1QMGA 1D5WA 3R2JA 3IEUA 3SAJA 5JMWA 1NFRA 1XMQB 1ID8A 2QTBA 4MPRA 1OI7A 2DFPA 1UWCA 2YXEA 3IE1A 1HOTA 4JUIA 2YY5A 4D9GA 1BG6A 4X7BA 3U4AA 3AF6A 1SXIA 1NQXA 1MKYA 4DZZA 4TYQA 4DT1A 1FDUA 1RWKA 4O4JA 4ABYA 2ZE6A 3DBRA 4EMBA 2B0JA 2V7GA 4UTXA 2NMVA 1YJ5A 4DSZA 4D0LB 4IILA 4YWJA 4AO6A 1CNFA 3BMQA 4OXXA 2YBDA 4V0QA 1PHRA 1TGYA 1Y5RA 2JK0A 3C8DA 3WX0A 4TMVA 2JLAA 4G1VA 3PITA 1L5FA 2MTBA 5SY6A 3AF3A 4JR2A 1C3VA 4MR7B 3LK7A 3JRNA 3LBAA 4G36A 4MIYA 4EW2A 3KXPA 4MUNA 2Z1NA 4FGLA 4JL6A 4EI9A 4QUJA 2PIDA 5SZKB 5HTOA 3BHIA 2BFEB 2I4OA 1PSDA 4F11A 3UCXA 5B4UA 3ZKWB 1T1SA 4F45A 2PZAA 3PCXA 4S05A 3HCWA 5IDWA 1E4YA 2L82A 1BN7A 3HJBA 3OIWA 4GXQA 3OE4A 4OHWA 2ZAOA 1Q0ZA 5FOVA 5TGTA 1UBOS 4QJBA 5AW6A 2IHKA 4F60A 4ZI5A 1L5WA 3A36A 3VR2D 4ZQIA 2HPVA 4O2RA 4JHXA 4DBLC 4W5OA 2X8WA 4OI0A 2X4DA 4PU0A 3AYXB 1FFCA 2O5RA 3ESCA 2C9OA 3KPWA 3BF8A 2FX5A 5A03A 5MHTA 5AHKA 1FVHA 3LP6A 2B4AA 2PX5A 1C7QA 3L1JA 4QUHA 2QRHA 3JZDA 1CJCA 1KDZA 2XITA 3E15A 3KYDA 3V8PA 2F1OA 2FWRA 4XDZA 2VP9A 2VCEA 5A3VA 4QREA 1AA6A 2AUNA 5ARCA 5IASA 1EUYA 2V1UA 4F7WA 3D6NB 3WGUA 5HWSA 3DLAA 3MS4A 5HKLA 3I9LA 3T35A 5JADA 3SEFA 5D7NA 3WJ7A 1M2OB 3D7MA 2CDCA 3TAXA 2BGRA 1ECJA 1DWOA 1CERA 3OQMA 3VOSA 1ODKA 5IABA 5TF4A 3AL2A 5B37A 4CFSA 1P5RA 1XVTA 2CD9A 1F8UA 3JQAA 3JATB 3GP5A 4BVLA 4S12A 1D7AA 1JP7A 1RSZA 2WYWA 1DBQA 1KZGB 1NW7A 4R9NA 3OZ7A 1P2TA 1XELA 1L1EA 1XDZA 2FZWA 3LVBA 4GYJA 4TMFA 5T5QA 4ARSA 4AS3A 1UOEA 3GB9A 3N53A 2GAIA 5FDFA 4JX9A 3LP8A 4R8SA 3VJKA 2BFAA 2CNNA 2GHQA 3KOWA 4LXTA 5F3DA 3C5CA 4AQYB 4KC0A 4BLPA 3W5JA 3NIBA 1V3QE 2IYXA 2X58A 3DV0A 5EMMA 1RACA 3K7EA 4MUBA 4BNVA 4UFPA 5EWJA 5B36A 1GQSA 2ZLBA 2VCHA 4I3HA 1BKSB 1K8YB 3WE7A 4DRZA 4D81A 2A4MA 2VJKA 3TNJA 3AEKA 5FTJA 5FHQA 4GDFA 4EJSA 2AEEA 4RQTA 3RG2A 5IKXA 2K6GA 4FHZA 2G8NA 3AY6A 1ACMA 2UUPA 3H5VA 5CVDA 1FRVA 3F5MA 4UEWA 2R1ZA 4LDAA 4MB0A 1O97D 1LW7A 1TYEB 3QPVA 1QNLA 4KDFA 3W3ZB 1P2BA 4HB0A 4J94A 3HA2A 5EEHA 2CW5A 1BX3A 1U0FA 1DVRA 2XUGA 2VA9A 5TQ2A 4E7PA 4DQLA 1THGA 2FHSA 2CBZA 5E7MA 3UN1A 4DW8A 4IO1A 3LM8A 4W5HA 4P32A 1TCCA 2IEGA 3PNLA 1RVDA 3H2SA 2GJSA 3OZXA 2WWRA 2P9BA 3E7DA 5G02A 3IBSA 1QYWA 1UKCA 2JANA 3BEOA 4IFIA 2PGNA 3FRJA 1Z6AA 4HEA6 4J91A 4JELA 4IZ6A 3T06B 1IE3A 4QO7A 1U2DC 3TZKA 1VJ5A 3CIFA 4MO2A 2ORYA 1H42A 1LQTA 5ALRA 4L6CA 2P4SA 5KNDA 3DEFA 3IJRA 4OQFA 5IDXA 4ZOBA 4J7AA 4UMFA 4NHOA 4F85A 1CVRA 5G0SA 4JOCA 4CLXA 1YC2A 4IIJF 3T9BA 4FW9A 3FSRA 2YC4C 1U8UA 3LQQA 4LC1A 2ZUTA 4PYJA 5IJ0B 1JIKA 1NMYA 1PLJA 4YI5A 1H9BA 1S7CA 2NZYA 2R62A 2IP2A 3CYFA 1ABBA 3L8GA 4EK9A 3MJCA 3G7SA 1BQEA 1E5DA 4QDTA 5C34B 2OAEA 3NI2A 2F17A 2X8JA 4P9NA 4ZAWA 3RC9A 3CVWA 2J9GA 1C9MA 2A3NA 2P6RA 5A4FS 2QLLA 4WXEA 4TWZA 3SCZA 1K75A 4CDGA 3ZTWA 1W96A 2ID8A 1LS6A 2JHAA 5HILA 1XRNA 1V3TA 2J6BA 3TI7A 3UJBA 4PHCA 3RV3A 2P2LA 3T1QA 4E94A 4PYKA 3FBGA 5LXTB 3Q9SA 1VL2A 4TMXA 1DG1G 5BN3A 2H17A 5EWMB 1GT91 2DBYA 1FFXA 3CX7A 4EO9A 4X1YA 4NX2A 3S40A 3AMVA 4HGNA 1NOKA 3NXSA 3Q41A 1T1GA 3LGSA 1QGYA 4R9VA 4RPLA 2JK1A 2CLEB 1BCSA 2AWNA 2IHTA 2WYUA 3CVOA 4PPYA 5L4LA 1AS0A 5LQMA 1R0RE 3IERA 1GTRA 4GFDA 1U7XA 1PJ2A 2H4FA 2PUWA 5DOZA 3O93A 1JQ3A 1ZYUA 1ZONA 4LGVA 4RK5A 5M7EA 1FDTA 1QHNA 2QL5A 2P77A 2A84A 3MLBA 2GETA 4D3DA 1UZLA 3UNXA 2Q1XA 1J49A 2B37A 1UMBB 4ZMRA 4Q4HB 3RRBA 4Z2AA 3MFQA 3GFBA 3M4JA 1J21A 1H0RA 2R25B 3HXTA 5K3BA 4KAFA 3PIIA 3P2EA 3LCMA 3TH5A 4NZNA 4FWTA 1B7GO 4LG1A 1WNTA 4OOFA 1F8XA 1EM6A 5E6UB 3RBVA 2VDMB 4GVXA 4L08A 1JI3A 2HJSA 4CQJA 4DA7A 1LI7A 1QCCA 3OTIA 1U2QA 4ZPJA 4R51A 2QYHA 1WUIS 3EOAI 3KOZA 3MCWA 5AIBA 3JQDA 4EG6A 3K5IA 2BMJA 1PRYA 3DMNA 4HB4A 1CIPA 4MV7A 4C76A 3MCTA 1GPJA 2R6JA 3NTOA 1G8YA 2YMMA 3AI3A 3BMOA 4IGKA 4F4IA 2GZ1A 3MAGA 5FBZA 5REQB 1H69A 2WM9B 2CMKA 3W3AD 1VPEA 2NZWA 4BIMA 1D07A 3AEUA 4XLTA 4AO7A 3UPUA 5DEIA 3RC2A 3HXMA 4LWOA 2JCXA 1TT5A 3UT5A 4JQCA 5DK4A 3RU2A 4WPGA 3UUEA 1S8FA 4CQMA 1OVMA 4B7AA 4TYNA 3HDVA 5DKFA 5KX5F 1X8LA 1GQRA 2HA5A 4IIYA 2Q0SA 4YAKA 1K5PA 3BWBA 1RYNA 2ZRGA 3DWFA 1M7BA 2KWIA 1SBZA 2VR1A 3CS3A 1WIWA 2Z5LA 3G2JA 3I6YA 3V2UA 4W8HA 4MA4A 3JAMA 3SZUA 1NTRA 3U6BA 1ZNZA 1CIVA 421PA 3I2YX 3NHLA 2VP0A 4P38A 4KHZA 4TRRA 1QU3A 3AI1A 5WRFA 5CB6A 4UMDA 2VBIA 4WGFA 1CD5A 2EW8A 1CHDA 1XLUA 4FIDA 4LSWA 1S89A 5IAEA 3ILVA 4Y0NA 1K7EB 2WYVA 5FFMA 2AJ8A 3LZDA 3WMWA 4AJPA 4CMIB 3CUKA 2JA1A 4E5KA 1CB0A 3GZNA 1TRKA 4J49A 3C43A 4RD6A 4AN0A 1N8NA 1F2UA 3AEQA 5CA1F 1F7UA 1XHFA 3G8DA 3MSCA 1W4CA 1RPZA 2Q5HA 1Y4DE 3U4DA 1IHXA 1YKFA 2GJKA 1XCBA 3KHTA 4Q7LA 4DR2B 3MMZA 4URHA 3WBJA 5HOEA 1GWNA 2X0RA 1A4XA 3KSAC 1P7YA 3QLTA 2YUTA 4R1QA 4O3FA 1RLIA 1P4RA 3KK0A 1DDGA 1TNDA 1TW2A 2CNLA 1E6WA 4LK3A 3Q6IA 2UYQA 4DPLA 2RGAA 2O3QA 1KI6B 2AOUA 2UZ3A 4HH0A 5AVOA 3T1YB 1QVRA 2O05A 1VI5A 1WU8A 2XNHA 2ZBDA 2E4ZA 3DW3X 3NUGA 3OCUA 1DIHA 2EKBA 2PQ0A 2PKWA 4MPJA 4UNIA 3O8BA 3KOYA 1NF3A 5A05A 5CCDA 3TTXA 3DNFA 3COWA 5FWYB 1EJ2A 4D42A 3T5TA 1N2HA 3W4KA 2FMHA 1U7UA 3BB3A 1QG0A 5T4EA 4DQVA 5MF6A 5BURA 4I4TA 2IU6A 4M1TA 3U4HA 3W9BA 2PO7A 1E18A 1P9LA 1YSCA 4R2MA 2VJDA 3NVDA 2D1RA 2V0NA 2DWQA 2BLLA 2Y0DA 5AT1A 2HQRA 2WUWE 3GZ4A 2XWJI 4CLOA 3B12A 1QV6A 2X9GA 3REQB 3VV3A 3DOEA 1M2FA 1Z63A 2QZ4A 1QYCA 3U3ZA 4OGGA 4ARZB 1JLHA 5L6MB 1GPDG 3CEHA 5T3YA 4CKWB 4X84A 5GAJA 2E0IA 3WHKA 4Y2GA 4EEZA 1HTTA 3GVXA 1A2OA 1VECA 4RK4A 3UWOA 4PZPA 3GP3A 3ZWVA 1X9GA 2GN8A 4KN5A 1BRTA 2LCFA 1LI5A 1RHJA 2GESA 3D3EA 3M1YA 5CYGA 2GVNA 3R9WA 3SJCA 1EXMA 1YVRA 1E6MA 4L6AA 2H65A 5A3QA 2EFEB 2I4TA 2X6QA 3AG6A 3TGLA 1YF3A 3SBDA 2XXAA 4P4UA 4ND8A 4HX9A 1E6UA 4RTPA 1N32B 4RHXA 3O3CA 1XRPA 4NS4A 2VNHA 4PLGA 1T3TA 4YACA 1OYOA 2CXTA 2QM7A 3EXIA 5CIWA 4CBVA 4CKXA 4PCLA 1T35A 4NF2A 5IM4F 3Q7EA 3UBMA 2F43B 5MN5A 3PJGA 3QKUA 4JROA 2XNDD 2MJLA 2PSDA 2Z2IA 2OP1A 3I01M 1DINA 2BDUA 1MO2A 5KPDA 2CMHA 4C3VA 4Q4DA 2YJ6A 3BJMA 4TLLB 5CA0A 4DCUA 1ZW6A 1DV2A 1KXZA 3D4OA 3NH9A 1ESEA 1IK4A 3ZDXB 4X3OA 1YNSA 5JQGA 3A4VA 1Y6JA 4WWHA 2VJNA 3VGJA 4O1HA 4OHUA 3UAYA 4BGIA 4XIYA 4CMAA 5BQOA 4HYEA 3K9WA 1E2KA 4D8UA 4PWZA 3J80A 4H35A 1R4AA 1YV9A 2BGKA 3NT2A 4DUZB 1XMVA 2RHCA 2J5RA 3NWPA 4KO2S 2O3RA 5A4MS 1Z38A 4OHCA 4LVOA 4I5EA 5E0KB 4FSXA 5F9HA 1GUDA 1LW6E 4J03A 3BTUA 3WRVA 821PA 2GJ9A 2Y71A 4GZ3A 5AKJA 5ICSA 3ZH9B 1FSPA 1NDQA 5IKPA 1P7VA 3ROQA 1TT7A 1CY6A 2CFCA 5EIHA 2UYHA 4FHCA 4RLFA 1AMNA 3OFJA 3GLQA 3TB4A 4IS3A 2JAXA 2JIQA 2VZLA 1V8DA 1EVLA 3FRIA 5T57A 4BKUA 1IDN1 4TYYA 4WUTA 1Z0UA 4MIEA 3K1AA 5FUYA 4JKIA 5F4BA 1PTJA 3L04A 3T3MB 3VGPA 4DQXA 4RXMA 3B1ZA 4XX1A 2I3GA 3FSGA 3ZOKA 1TAQA 4LBWA 3HFRA 1KDVA 2DKFA 3RUHA 4U2CA 1PT5A 5EPEA 1Z4LA 1FYDA 3BFPA 5IP5A 1P1FA 1HE8B 1PJLA 3EWNA 2QF7A 2YNMD 3DCJA 4DCJA 3CLSC 1HDEA 2B8TA 4B6GA 4IJVA 3KBBA 3LKZA 5H7XA 4BRUA 1MABA 3H4IA 1IRXA 3R7SA 3B1YA 2BFCB 1XVUA 5JO0A 2O1XA 4S0ZA 4INPA 4OQNA 3SZGA 4BFTA 3T0GA 1HNNA 1XTUA 1WY7A 1LX7A 1JALA 3FCAA 1CPYA 3CZ9A 1KETA 1NG1A 1P6XA 1JG3A 1KSFX 3CUSA 2PUBA 3CR3C 3EH1A 2I67A 3PDHA 1BGVA 1X8XA 2BEVB 4GLJA 2R6HA 4FEYA 4CE6A 3HJUA 3CNBA 2ZRJA 2X0NA 4O6VA 1AA9A 4M83A 1Z29A 4IDDA 2IIPA 3W0LB 3BF7A 4NBLA 1W9HA 3I01A 1N25A 4YDHB 1AS3A 3UENA 1Q7BA 1X8JA 4TTAA 2YJ3A 5FPTA 5CDSA 3R0QA 3AM4A 3K8OE 3NBMA 1J56A 5ICGA 4LZZA 2JKZA 3ZN2A 4C2UA 3OAAD 3SHQA 4AUMA 5KTSA 1LBTA 2FVYA 1M1YB 2YH2A 3MG9A 4MNTA 5ILQA 4DMKA 5JD5A 1I2BA 1CEEA 1R0SA 1NV9A 1XA4A 1QG2A 2OGZA 3HRKA 3O82A 4UHKA 1LQUA 5MGNA 1QIGA 1QRTA 3AHDA 4KYTA 5TQVA 1EJBA 3DT8A 1C8VB 4Y6PA 1I0LA 3BAFA 3ILHA 3TJMA 3G2IA 3DB2A 1EFVB 1YRYE 2EQBA 3RSGA 1LWOA 1DC6A 1RQNA 4ETNA 2OQRA 1M6HA 5EJ6A 2XVAA 1M34B 1YZYA 4PX3A 4KMRA 2VUUA 3EGDB 2JVKA 4TVKA 5AQ1A 4DDKA 2EL7A 4B3XA 3EW7A 2JG3A 3IILA 4JJGA 4POAA 2XYVA 4R54A 4YP1A 3IEMA 1HM5A 1QR6A 3N2LA 4KRGA 4MLCA 5DHSA 1KQNA 1ZQ9A 3TKAA 3O7WA 4JR0A 4U2FA 1RWWA 2W2MA 2ZJBA 3RD5A 5GY7A 2ZBPA 1BQ4A 1E63A 1K6MA 2FPLA 3OLXA 4OB7A 1O9HA 1SXJB 3UMFA 3P0FA 4D9NA 4EVSA 4PWYA 3PSHA 3PFCA 4ZJUA 1YRAA 4BASA 1VZ2A 2W93A 4IOJA 4M3NA 4DMUB 2P5SA 2CE7A 2XSZA 4YYEA 3U5ZB 2QJRA 2OEPA 5IZCA 2JGIA 1EFHA 3TMKA 4DMLA 1SG0A 1UBMS 4JU8A 3GIWA 3KPVA 3I73A 5FD8A 3DO5A 3RS5A 2J85A 3HACA 4RK0A 4YRNA 1ULBA 1KYZA 4DUPA 1WG8A 3DZIA 1V47A 1XI2A 1G9SA 1N33B 2WHPB 3DYVA 2C31A 3QKTA 2OY0A 3H2KA 5D5HA 3QXXA 4U9HS 5KAMA 1JQAA 2V7TA 3ILSA 3I9NA 3VPSA 5B12A 3DB1A 5TV2A 4NKRA 2A8YA 5HRUA 1J8QA 2G63A 3H6KA 3ZDCA 4NMMA 1NRJB 5TT0A 1E0KA 1LNZA 1STOA 1XEWX 3P2KA 4Y18A 4Y2PA 4CIAA 3RHTA 1MFZA 1PR5A 1T2CA 3C16C 4CZ2A 4EF4A 4YK7A 1Y3HA 3OIVA 3TFWA 3DMRA 1CRQA 2QX7A 5BMVF 1NVGA 1IM5A 4FC7A 1QYIA 3R3WA 2BYTA 1D2HA 3RS8A 1KFKB 2XHZA 1WS6A 4YQZA 3JPWA 5LQUA 3K71B 3JYHA 2HBQA 2O1WA 4EYGA 4D4LA 1Q0HA 2B69A 4P3OA 2J31A 5L4NA 1G63A 2NV6A 2P9CA 4JLWA 5H68A 3ROTA 3ABOB 3W8NA 5CB4B 4TSKA 3K0SA 1K3UB 4KRFA 1Y3IA 2EZUA 3I3SR 4RTOA 3A6LA 1FQWA 4Q1VA 3G7NA 3G17A 3BTSA 3TECE 2EV9A 4A8TA 4RL6A 4DPKA 1SD2A 2HOQA 2WICA 3D02A 5FQNA 1L5YA 2IP4A 4NPAA 1KMIY 5IDQA 2P7HA 2ZYIA 3JAWB 5AYVA 3IT3A 2D2IA 1V8BA 3I62A 1KQPA 4NENA 3SC6A 1VL1A 4NU5A 3KJXA 4D6PA 4B84A 2R2AA 5SZIA 4KREA 1DO2A 1LXCA 2VRCA 1CRLA 3NP7A 1O6CA 1E60A 4LHEA 3HE3A 1OXXK 1GPKA 2C3UA 2YW9A 1BU8A 3LXMA 4TWRA 1J06A 2H1SA 4MGIR 1Y8ZA 4BLRA 5DXFA 2C0PA 1NVUQ 2WWVD 1CF4A 1V39A 4GWGA 3FOCA 4MR9A 4NICA 1WZNA 5EOVA 5HRAA 3WB1A 5K6TA 3VYTB 4JWTA 3HJGA 2OMEA 1EVKA 3NHWA 3CLTD 2HTFA 5E9JA 4EJ0A 1VYTA 1B42A 2FZCA 1K68A 4PNEA 3WWYA 2TMKA 6PFKA 3RS9A 1VL5A 2NSDA 2P9JA 4WOKA 4BLOA 1H2WA 1OCEA 3ESAA 3G5AA 2CLIB 3GRAA 4MUXA 4CODB 2A1IA 1YZFA 2RGXA 3OPYA 4IINA 5LYJF 2EIHA 4FOPA 4MVJD 1CRPA 3KKPA 4QHSA 4PQEA 2A86A 1W85B 2FWNA 1ZGAA 1P5FA 5DXJA 2OCAA 4ZVVA 1SZJG 2DBVO 3IE2A 4N0DA 3RK1A 1QCDA 2VFAA 3V6LA 3WMXA 1FTNA 4CG2A 1L1RA 4P8RA 5BNTA 2E55A 3C87A 3E4DA 3O83A 4BO0A 5CFLA 5IPFA 4I5FA 2VRNA 3DZDA 3HC7A 4HAZA 4DL9A 2R1TB 1ZXXA 1ZJJA 2O0LA 1XPOA 4W5NA 1PS0A 2VF8A 4C4OA 1UIRA 4RK1A 4ZT7A 1YT5A 1TUBB 1QF7A 3R9KA 3NH6A 4H3SA 2CK3D 4HF7A 1GFIA 3UHFA 1JEDA 3GJYA 3T8YA 5AVKA 3RNLA 3ZE7A 2FW9A 5DP1A 1S2DA 4J3JA 2OXTA 3LDGA 1NUHA 1D6MA 2OZKA 3IO3A 4DC1A 4DEVA 4EH1A 5HYVA 1P7ZA 2IKQA 5E1BA 4C43A 4ENTA 4EY5A 1NU6A 4L3OA 1WW2A 4M8NE 5TEVA 1Q2UA 1ADFA 3W2EA 5LMZA 2IP1A 2ZVPX 5GIPE 1Z82A 3NM6B 4HR7A 4NLLA 1X7YB 4FMDB 5JMTA 5CHYA 2J45A 5KJCA 4XM0A 4EIWA 5ADWA 5JJLA 3KUCA 4CN9A 4KQWA 4HHEA 2XUAA 2J30A 1CY8A 1VG0B 2W6QA 1EXVA 2JIMA 1TGVA 2JLRA 4QJIA 1DB3A 3K0CC 3S2UA 5H9VA 2WT9A 3EW9A 1KKLA 4ND3A 1T0PA 4M99A 2ILTA 3MJVA 4WXYB 4ZTBA 5IF3A 1KZ7B 4O4HA 4DBLE 4OJNA 2FUG6 3WYDA 1I7SB 4Q3BA 1VSVA 3IAUA 4UHFA 1SUBA 4KU4A 1LSJA 3HUEA 2YRXA 4GX2A 4B4VA 3LHDA 4MI3A 1N2ZA 2R5WA 2VSNA 6REQA 2Z9BA 2DY1A 3TZHA 1EUCA 3WWOA 1YS9A 4YFVA 3GG2A 3LUAA 5T4FA 3WGHA 1SUEA 3LHIA 1M0TA 5EFZA 5F98A 1HURA 2I2WA 3MJFA 1DAKA 2G3YA 2A57A 3DBLA 5HE9A 2P5YA 3G2NA 4F1JA 4B3TB 2QJFA 4IIJB 4LXHA 4AJ9A 2WJWA 1VE6A 2V0GA 1D2GA 1G3UA 1NSYA 4XUEA 2Z56A 4RV5A 3WA6A 5DYGA 2VHTA 2REOA 3HRIA 5BV7A 3PVCA 2QMQA 3LF1A 3ZVRA 3LX6A 3STWA 2DX7A 1E6EA 4QT4A 1KNXA 4MP3A 2NN3C 3ACDA 3JQBC 1GQOA 2WSMA 3P2JA 4Z0HO 1DRUA 1OY1A 2PA0A 3AY0A 3B6MA 3KLOA 3OT5A 4NHEA 4OG2A 3EEOA 3AKEA 3TQIA 3FZQA 3KUDA 2HSGA 1V71A 1TD1A 3ENQA 4PYRA 2QBYB 3KOUA 4C29A 3ZJ4A 2BFNA 1U2DA 1YS4A 4TLAA 1O87A 3OZGA 3EMBA 2VDNB 1P3Y1 3TW8A 2PUHA 3FCSB 3WSVA 5IMBA 1JLSA 1R00A 1SM4A 4P31A 5JNLA 1TZKA 1O9BA 3D8HA 1B1CA 4GBMA 4RMHA 1TEZA 2IYQA 2G6BA 5HZGA 1XPUA 1NJ8A 1JHDA 2VF2A 1FS6A 1BH2A 1ZD9A 1GRNA 3P0RA 1M8GA 3HWX1 4Y7CA 3K1JA 4D0SA 1C81A 4UMEA 5F78A 1A9XB 4BZPA 1NFQA 4HX5A 1TADA 2XDQA 1ZCJA 2AW5A 4KJZA 4QTTB 4DJEC 4DQKA 4JQYA 3PDIB 3S2ZA 2ZUVA 3LQRA 4A10A 4WBNA 2VBGA 1OTYA 5AKGA 2AX4A 2IU3A 3CA8A 3HN7A 2H16A 3LRPA 5MN4A 1V25A 2J87A 2YJZA 3EIUA 1WA5A 5JXWA 3ER9A 3U7GA 4CTMA 4AXBA 2QB5A 3QW2A 3PLAE 1DXYA 1E58A 2FGJA 4HQFA 5EIXA 1NOJA 2DHEA 4FCCA 5GZ6A 5IC5A 2MCFA 1VJTA 4C78A 1QC5B 4N49A 3TLKA 1A7KA 1IIRA 1JDSA 3U7QA 1LY1A 2A1TS 3VNRA 4BO5A 1KERA 3E1KA 3ASYA 3L7AA 4WZBB 4H59A 1SHUX 5ECYA 4W82A 4CQLB 4LMAA 2AVDA 3QBEA 3GMDA 2Q27A 3WJ1A 4AKTA 1M0WA 4PM4A 4CLEA 1FTYA 4RQAA 3H3JA 3HCEA 3O21A 1L5LA 1YH3A 5E9AA 3M1IA 4MVYA 2X6TA 4RGYA 4NWIA 2V6IA 4UBKA 2M6LA 1IH8A 4WNYA 3KQOA 3MIIA 3V46A 2QTVA 4OXYA 5KX5B 4F4FA 5FTNA 1KWGA 2HLNA 3FYDA 4C9BA 2QQFA 4HN2A 1ZA1A 4HXGA 1H4VB 1SOUA 4JC0A 5EP1A 1Y89A 2C3PA 1U2EA 3V2IA 4JK3A 5FUWA 3WL6A 3FI0A 3EEIA 2B78A 2QM3A 3D8SA 2VP2A 5FUXA 1IJFA 1QKJA 2C0CA 3TVTA 1U1CA 3L7IA 2OV6A 3BRSA 1NQVA 2BMWA 4H0CA 4AULA 721PA 1PLLA 5DBIA 1IUPA 3LKDA 2RGNC 5SY9A 3MGCA 5THKA 2Q6TA 10MHA 4UUMA 3K70C 3IJPA 2F3SA 5JAQA 3WGMA 1VL0A 2A9PA 2C07A 2HRCA 4FHFA 4FI3F 1HXHA 3BULA 2O07A 1RJWA 1OJLA 3ROEA 1ZR4A 3R8XA 4P4GA 3HP1A 3EVAA 1C4KA 4CLRB 4U5QA 4YMUA 2AL7A 2Q5OA 1GA4A 2QV0A 1ZSVA 3C2QA 3V80A 3UUWA 4DLKA 1UH5A 4EUEA 1XMOB 5AM4A 3KIPA 2JEOA 4K6OA 1U63A 1KZ4A 4Q4CA 3ITNA 5CIYA 4B1FA 3WRYA 4U4AA 4H3HB 1W34A 2IL1A 2Z57A 3S2IA 1SQFA 2DUWA 4JLJA 3QE4A 2FFHA 2P30A 4KGZA 5KC9A 4HEQA 1O94D 1P19A 3HGTA 3Q15C 3CMMA 3ADDA 5EP3A 4DSUA 3TLMA 4P6VF 1H9CA 5JWHA 4HDNA 1E89A 1RYDA 2JC3A 3NRCA 4H18A 4MA0A 5THXA 4D4JA 3NHMA 4LHZA 3PNBA 3AESA 1DC3A 3KQWA 2P0AA 3DAFA 2AC7A 2W83A 4WMLA 2XNKA 1AKQA 5JS2A 1KVTA 2O20A 4MUKA 3PHGA 4X45A 4IMIB 4X7RA 1OZGA 3L6EA 4B7ZA 3GEDA 2G80A 3KWLA 5TS2A 3GCZA 1OC2A 3RRNA 4G0UA 1ODIA 3O8QB 1MO4A 2PNJA 2D00A 3R3VA 3IBCA 1TZCA 1E3MA 1JAHA 2HMTA 5H9WA 4INJA 3NHKA 2QPTA 5E3JA 4CKBB 4J4HA 4BQOA 3LT5A 1AO0A 3PXXA 2I33A 5FP0A 4P7JA 3L4BC 3P2MA 1QH9A 4B4DA 2RHGB 3HCDA 1N7IA 1WO8A 3FFBA 4MEBA 5LMNB 3THRA 3OO0A 1E2IA 3H83A 4PICA 4QBHA 4QBFA 3ZH2A 1P80A 1MGPA 3D4IA 5B30A 1YAHA 2LDBA 3GJ4A 2DTDA 5F2OA 1OBHA 4IX1A 4PLVA 1BOOA 2WVHA 4JVSB 3G0BA 3UK2A 3PCRB 3B3QA 3DLIA 3SM9A 3MJTA 4JUBA 4PG5A 3LC1O 4Z0NA 4PO8A 3CLVA 5B1SA 3NOVA 5AKLA 1BU5A 4GMHA 4WESA 2QP3A 5ALOA 4MS4B 2D4HA 5E6SA 1W1IA 2AHOA 1DLIA 1YS1X 3D7SA 3NUQA 3OZSA 1P8JA 3R6DA 4RKYA 4DCGA 4RZ2A 4KO8A 1SVIA 3DLTA 1CHNA 3SEQA 1UC5B 3OZFA 3WK7A 4QDUA 3ZOZA 4LJ8A 4M7PA 3W7AA 1A9PA 1FS4A 2XD4A 3N3AC 1X8KA 1SK8A 4E21A 1ZRSA 3TLGB 1G6OA 2MMCA 5DMXA 1PD0A 3JQFC 3D64A 4C5AA 3VV2A 4YPVA 4YCMA 1RYMA 2OHOA 2TSYB 2WYOA 5TS3A 1ZM7A 1QIJA 5AJZA 4OQLA 2VYQA 4JQZA 3COSA 3I72A 4HMQA 4OQDA 2VYND 4XDGA 3WIOA 3EWSA 4DM3A 1NM5C 1V1MA 2UZAA 1X13A 2ZJ6A 3HJCA 4DDWA 1R0ZA 1E77A 1TI7A 4DABA 2YC2C 3NBXX 1NMXA 3QG1A 3ZIAA 5D2CA 4IGFA 1RCTE 4CV3A 3J7AC 3LCJA 2RE8A 1YBFA 1GYRA 3D7KA 3KVOA 2ZUUA 1AT1A 3I8SA 4J1TC 3PXGA 3ZLBA 4V1CA 2A59A 3L7YA 3N0RA 2IYZA 4ESVA 3OPXA 2ZS9A 4NMXB 4J07A 4EHAA 4FWBA 2XNSA 5K8LA 3RS4A 3FNQA 4G4SP 3MWGA 2PT9A 4Z9AA 5DVZA 3W5IA 4IUCS 1J97A 1L4NA 1T9GS 1JJIA 3PGKA 1T2DA 3L7JA 1CQIA 2YYSA 1OGJA 1HEYA 1XDWA 3B3GA 2A35A 1DKPA 1L4EA 1SVSA 2YV2A 4L9WA 1NUAA 1W1UA 1X1SA 3JV7A 1ZI6A 5EXDA 1ESNA 1FSZA 2O2EA 1Y3DE 3PWTA 3H9JA 1ZQ1A 2RJNA 3QTLA 1ZD3A 4FEEA 4RPJA 1L7NA 1Z4JA 3IO5A 2PKEA 1EG2A 3GA7A 4FZRA 3ITDA 2JAPA 3F3KA 3QOYA 2VTVA 4W6ZA 1AO3A 2QVBA 4M0KA 3A4TA 4CN8A 2XRZA 1Z2PX 4YRTA 1YQEA 1JHOA 4IWXA 3ZNPA 3ZCQA 2ZI3A 3QUCA 5ALYA 3D5QA 4X1YB 5T64A 1VGRA 1NKTA 3UM9A 4BZWA 3UHPA 3GPDG 5ITZB 4YRRA 3B6EA 3VR4D 5I8WA 3LLSA 4ZQCB 1JWLA 2ODBA 3EVZA 1J2JA 1ZNWA 2B8NA 2RK3A 1F2TA 1Z8NA 3I42A 1ZH8A 4ALNA 4YJ2A 2ZWAA 4AKHA 4HEJA 1ZK1A 2DFNA 5FL3A 4IG9A 1FRFS 1AXEA 5FOUA 1ZPDA 3CRQA 1NVDA 1LUAA 5C8DA 4FFNA 2Q3HA 3GN2A 4Y9RA 1PDOA 4COKA 3ANLA 1IRIA 1G41A 4EW1A 3BK7A 3QYPA 4GICA 1QPZA 4F21A 4RW0A 4F3YA 3R5FA 1P1JA 3CX3A 1KH3A 2CFIA 2VC2B 4U0KA 5FV7A 1BDHA 4BC1A 2COUA 1KVSA 5KWEA 2PT6A 3V3TA 2A0FA 4B45A 1VHLA 2FMIA 3K6RA 2OV4A 3BXFA 4Q4AA 2XMZA 1WABA 2W58A 3NQ41 4WCDA 1RABA 4B6PA 4E2ZA 4POOA 2FMKA 2WF5A 5EIWA 5I4CA 1RMQA 221PA 4PANA 2BR4A 1HO3A 3FCUB 1CEQA 2C3YA 3SF8A 4AS1A 4WAUA 1E4VA 5KNCD 2K2WA 2E4UA 4L7VA 1JE1A 2V98A 3GR6A 4TYMA 3F2VA 1K86A 2PKCA 4MAFA 2PL3A 2J9ZB 1G3RA 4LDRA 4TL8A 3VDQA 4K6HA 4NCXA 1F0PA 4W9MC 1DAOA 2HRDA 2X2EA 5D3ZA 5GOTA 5EKDA 4C3UA 3WLIA 2EX4A 3RHZA 1Q6ZA 3W6PA 2V3CC 4ZMSA 3GLVA 3FZYA 4UNRA 3SM3A 4MWSA 4BNKA 3QKRB 3TRJA 5IT0A 2OD9A 3ENKA 4QGSA 2NO0A 4QLOA 2ZBQA 3IJ5A 3KAQA 4B32A 1DE0A 1XR3A 4L2IA 1IN4A 4LJSA 1P31A 3VHXB 4LRUA 1B76A 1I3OA 1VPVA 3PT5A 3KZ1E 2VRBA 3WLRA 4PTZA 3WWCA 1LRJA 2OD2A 5B7PA 1SHJA 4DA9A 1JEYB 3LQFA 1WV0A 1JU3A 2EKLA 2I71A 3RTAA 4R4JA 3LX5A 3QFTA 4JL5A 2EEPA 2EYQA 3HXKA 3EZYA 1COZA 5FCDA 2Y66A 1OIXA 1WKBA 2GF0A 2P8JA 1XQYA 3P2YA 5ULLA 3H2YA 1A9RA 4LXYA 4Q3OA 4GOLD 3ZK9A 1PWXA 4IVQA 2HZBA 5TLSA 1AQJA 1JR3D 1RKQA 2IU4A 4HO1X 5CT6A 2Y1XA 1JHAA 5EJMA 1N1EA 3V4OA 4EZEA 1KMMA 1A1VA 3WRXC 3GLIE 2UZ4A 4NONA 1Z62A 1J1UA 1KO7A 4XWWA 2IW1A 3ODGA 3D6AA 4MW7A 3ND8A 5CJPA 4OMCA 2DCUA 4BDTA 2GERA 4ATNA 1MRSA 1LGYA 2Z5GA 4F9GA 4TYWA 1EP9A 2ZSBA 2QX4A 5EZYA 1OREA 1Z56C 3EGVA 4B6OA 2R6ZA 3T3NA 2PVPA 1IN1A 2P35A 3WYNA 4V03A 1Q7TA 1SCUA 2D06A 3ZY4A 4EKYA 2C4VA 3HSYA 2WWXA 3KE8A 4B47A 1CUSA 2PR2A 1FP6A 1PX0A 3G3EA 2G28A 2ZIFA 3H8WA 5AWFC 2GXSA 4ZHQB 4ZIRA 2VYVD 5EKXA 1AG9A 1RXSA 3N7AA 3OPVA 3ORRA 4G63A 4BE7B 4DLRA 2CKMA 3CW2A 3L7LA 3ZQJA 1Z35A 5KHLB 3O7MA 4HVCA 1ADBA 4C7MA 4WLOA 4XQ9A 5L7TA 1WR8A 4YAIA 1CS0B 1H2BA 1GNLA 1NC3A 2Q6KA 1SBNE 2GN2A 2NXWA 3BN3A 3DH0A 2W00A 3GNSA 3KWFA 4HUQB 3HO8A 2ZIAA 3AP2A 3ZS9A 2IQ5A 2NSLA 2V7EA 4FP9A 3GLGA 1BXGA 1EK1A 5AOAA 1ADJA 4L27A 1M6VA 1GZSA 1LSUA 4HGOA 2WUDA 4OP3A 4XLLA 1RAIA 3BTVA 1LRLA 3EHEA 5LBIA 3S2YA 4M53A 4TTPA 2QUZA 3Q7IA 4CL0A 3H5RA 2GYWA 2W2KB 3OWXA 1CVIA 5DIZA 2YXLA 5J2TF 4E2FA 4YRFA 2NG1A 2AD1A 5AM1A 1G5RA 2XECA 3PQ3A 3WQHA 5IYZB 1G17A 2FSFA 2I4RA 1XP8A 3NUZA 2GEDA 3OZEA 1TPYA 3WICA 2QZZA 1QAQA 1PEDA 4J3FA 4R81A 2NO1A 3L6OO 1GYPA 3AK4A 3KPYA 2J9YB 2O8FB 4NCHA 4L50A 1ILWA 1O95C 3DDUA 3LUHA 3HN2A 1K5HA 3MRTA 4MR8B 4U6NA 3EPHA 5FJJA 2PEYA 3CTPA 1QVVA 3GDGA 4ARCA 4ZEXA 4ZC8A 3VRHA 2OK7A 1JHYA 3IDFA 4EYQA 4RTMA 3ZWPA 2Z04A 1HYQA 5ADVA 1KAHA 3B6KA 2ZULA 3NIFB 3UOGA 1PZEA 4D9FA 5BT8A 1Z5OA 4UAVA 5IVKA 1DKMA 1E2NA 1G4UR 1GUAA 2ECQA 2W2LD 2ZS7A 2CXQA 3BWVA 2W71A 4Q3EA 4RJLA 5D5PA 1JBQA 1KY3A 2JDID 2TMDA 2XT9A 3EJWA 4NDAA 3QE0A 3ZGOA 1HE4A 1UOOA 2DXIA 4BNJA 4TLBA 5FTWA 5K9ZA 2PY6A 3A6HA 1M1NA 1TCUA 4F2WA 1Q1QA 4Z4CA 3W6NA 2HNBA 4QNRA 2H8KA 3T5PA 3UK7A 1W0CA 4HNHA 1UXGA 1AKWA 4EYOA 1W7AA 1FW6A 3IT1A 2YZMA 1SKBA 1WQ1R 3A3OA 2QXTA 3BWCA 3HDGA 3OM0A 4FTWA 4B3HA 1ZCBA 3GLIA 3QXHA 4G67A 5LNK1 2ZSFA 4S24A 1J8DA 3UB2A 3HHPA 4QOFA 2YNMC 1QK3A 3VQTA 1YUNA 1LB1B 4XXHA 3TKLA 5BWNA 2FFQA 3SKYA 5J47A 2O8EB 3MEQA 2HPZA 4BMCA 3H2GA 2IWHA 3FTFA 5F35A 1TQDA 5DI3A 3S2FA 3K1ZA 4J4BA 4BKMA 4BO9A 4XYMA 5G4KB 4IZIA 4KFUA 5HMMA 3A0UA 4EGQA 4HLCA 1IHYA 1KOJA 2WKRA 5AW2A 2Z5FA 3J7TA 1IBLB 4TGLA 3PTLA 5DOVA 2W8BB 5DNYB 1N78A 4LI0A 3IS3A 4UM5A 3UBTA 2V7QD 4KVAA 3PHLA 1LK7A 2C5AA 1V35A 2O0JA 3O8NA 4QPJC 1SPXA 3KU4A 1TCBA 3MTJA 3OI7A 5FO1A 3WA7A 1QGUA 2XVMA 5CAEB 3P9RA 4EB6B 5CJJA 1H4QA 1CQZA 4FFBA 1MG0A 2VHZA 2QW1A 4K9SA 4PHTA 4V39A 4Z9BA 3GJ0A 4CI0B 4UAGA 4DE5A 5CX4A 3PNPA 1J8FA 3A6DA 2QTHA 3CVXA 1S8OA 2MSKA 4S35A 3BZBA 1YKGA 4Q82A 5JFTA 3K0CA 2HWKA 2VHCA 1M10A 2ZRLA 1K8RA 4MVJP 1BRMA 3O1HB 5KTNA 1SKUA 5KNLA 2HU2A 3QLVC 1K66A 4OHKA 2BGLA 4ZXPA 1JDPA 1ZHHA 4YJHB 3ROFA 1DS6A 1WCIA 3ZCTA 4BTLA 4E03A 1OWNA 3RYCB 2PKQO 5IZ4A 2JRCA 2J3KA 2QAGC 3N0WA 4Q4JB 4A36A 4HJXA 3DWIA 1VIDA 3WV5A 1VG9B 2IPOA 2WT4A 4WFJA 1OPXA 2FPPA 2X0IA 1L4GA 4OBEA 4DEYA 1L7BA 2D1QA 3HWRA 4TN5A 5CDHA 4EHLA 2YW2A 3WGIA 3PF9A 5AXCA