4WGGA

Structure of the ternary complex of a zingiber officinale double bond reductase in complex with nadp and coniferyl aldehyde
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
352
structure length
352
Chain Sequence
VVVVNKQVLLKHFIPEGAPKETDMELVTTGTIRLRVPEGSNAVLLKNLYLSCDPYMRMRMTKHEEASYVDDFVPGAPITGFGVGKVVDSSHPDFKTGDYVWGLIGWEEYSLITKPQGLFKIHHTEIPLSYYTGILGMVGLTAYVGFYDICSPKKGERVFVSAAAGAVGQIVGQFAKQFGCYVVGSAGSDEKVNLLKTKFGFDEAFNYKKEPDLTKALKRYFPEGIDIYFENVGGPMLEAVLHNMRIKGRIAACGMISQYNLEKPEGVHNLFLIVGKRIRLEGFLVFDHYGSYPEFEEKVVQLIKEEKIKYLEDIVEGLENAPAALIGLFEGRNVGKQVVVVSREKGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double Bond Reductase
publication title STRUCTURE OF ZINGIBER OFFICINALE DOUBLE BOND REDUCTASE
rcsb
source organism Zingiber officinale
molecule tags Oxidoreductase
total genus 111
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wggA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4wggA01
4CUZA 2X0JA 4JBIA 1ADGA 2O3TA 5ADHA 4Z3DA 4H16A 6ADHA 3F4BA 3QWFA 3PJFA 5A3VA 3QA9A 4E5PA 1A71A 1DOHA 4L74A 4NDNE 2EKPA 5TGDA 2NTVA 4OOEA 3WJAA 1ADFA 1E3LA 1GL3A 1Q0QA 2WE8A 2ZB4A 3CXRA 1P1HA 1WAMA 4YJGA 3GZ4A 2Q1SA 3RJ9A 3U62A 3TSCA 2J3IA 4CLRB 3CZMA 2DKNA 2ILTA 2BHLA 4D46A 4CV1A 1E92A 3LDHA 4MO2A 3OJFA 4DQVA 2UUPA 2GERA 3RJ5A 1FDWA 4MKRA 4TRNA 4G2NA 2DBVO 2RH4A 4JBGA 4CV2A 1ONNA 4WKGA 1UXGA 3VZRA 1KVRA 4HBGA 1G0OA 1E6WA 3BHJA 1A7AA 3RKRA 3KO8A 1HLDA 2XPCA 4XYBA 1R4NA 4J7XA 1XGKA 2IZ0A 3DZFA 2XXBA 4EUFA 3E9MA 3L77A 3DAFA 1B2LA 3BXXA 7MDHA 3MCVA 1FDTA 1JWAB 3LU1A 5DN9A 2PZLA 1NPTO 4E5YA 1QYVA 3AFMA 4MVJF 1H6DA 2GASA 3KHUA 3QVSA 4Q3NA 4PG7A 3WGYA 4UULA 4K28A 4WCDA 1HLPA 2CVQA 2PKRA 3PWZA 3RBVA 2NM0A 3FBGA 4MINA 2VOEA 3H2SA 5AQ1A 2ZYDA 2ZCVA 4YEDA 1Y9AA 2DPGA 3WXBA 2BFMA 1KY5A 2VUSA 4ITUA 3BHIA 2EG9A 1X13A 1JKFA 1E1KA 3PXXA 1HDGO 3ANNA 1Q1NA 2VHVA 3X2EA 5H81A 4PN3A 1YWGO 2D2IA 1V35A 4YJFB 5L7WA 3FHLA 4GLOA 3WQSB 1EZ4A 2WEKA 3IQDB 1DJNA 3EZYA 4CMGA 1ML3A 3L4BC 4OXYA 3QIVA 3RC2A 4KDFA 2VYND 3BTUA 1K6IA 3I3OA 4Y9DA 2P68A 4IS3A 1UH5A 2G17A 4BHTA 3WOHA 3E6AA 3DWFA 1VSUA 1YQXA 3PTZA 1RJWA 4CLHA 4ZHSA 1B3BA 4BO7A 4ND1A 1DO8A 1HKUA 4XJTA 5T5QA 1IHYA 1SCUA 5KKAA 3ZHBA 2C54A 2HJRA 3UN1A 2GGSA 4BKRA 3JQ7A 3I6IA 2Z1MA 2V65A 3C8MA 3TF5A 3K9QO 3DB2A 1JWBB 3T4EA 3ZWNA 3JQ6A 3V1YA 2WDZA 2X0RA 4JP3A 5A9SA 3PZRA 3TWOA 2C5AA 4J1TA 5JDIC 3CKYA 4Q3AA 2Y0CA 1NBOA 4HNHA 1EQUA 3KEOA 5ENDA 2I5PO 5ITWA 5L45A 5F3RA 1ZJZA 2POQX 3I52A 4RLSA 3F46A 5T57A 1ZH8A 3JQBC 4JROA 5CEFA 1R12A 3MJ4A 5H83A 1E5QA 1KVQA 3VDRA 1LDYA 2PGJA 2TMGA 1NQOA 2EHDA 1BMDA 3M2PA 3LK7A 3ZGYA 4I5GA 5B4UA 3PHIA 3GAZA 5L4LA 4IDAA 2A4KA 4CMKA 1ZK1A 1QMGA 5G4KA 5HBRA 2HK7A 4RVFA 1EVIA 2O4UX 3GC6A 4BKPA 4JX8A 4NBUA 4ZQHA 3MTJA 4DYDA 4DBZA 4GMGA 2PTGA 5F5LA 1MLDA 4DIBA 5JAIA 4B79A 3JTMA 4EYEA 1N5DA 3AUTA 3RBZA 3QVOA 1F14A 4J2HA 4AJHA 1Q7GA 1BSVA 4NBVA 3GGOA 3L4SO 1IPFA 3ZHZA 4CMJA 1H6BA 4B3HA 3DBHB 2OGUA 5L53A 4WCFA 1NPYA 3LSYA 4HP8A 4NI5A 4CM4A 1HE2A 2WSBA 1D1TA 3ZN2A 1KEPA 1TVEA 3SBOA 1DPGA 4F46A 3OICA 3UXYA 4ZGWA 5C37A 1M6WA 3B6ZA 1PJ4A 4DYVA 1SAYA 5KIAA 3OM9A 2Q50A 3RQSA 3BMNA 1IYZA 3OIFA 4CMEA 3RSHA 4NK4A 4HY3A 4ALKA 1AXEA 4XQCA 1QORA 4J91A 5DOZA 3OFSA 1UP7A 1FMCA 3DOJA 3E82A 4E13A 3VZSA 3ZU4A 3RUHA 5TRTA 3TFQA 1IZ9A 4CM6A 1C0PA 3SLGA 1IZ0A 1BXGA 1ZBQA 1Y8QB 3G79A 4BNJA 1ZCJA 4M54A 2NU9A 2XAAA 3E03A 3OA0A 1YGYA 1UP4A 3NDRA 4FJ1A 5HS6A 2E4AA 1KEUA 3JQ8A 4N18A 4RO0A 4CMIB 4EI2A 4HFMA 1AHIA 4R16A 4FFMA 1FK8A 5IN5A 1ZO8A 4CODB 2QRLA 1R66A 1XDWA 4YJDA 5AOVA 4R4JA 1MXFA 3PQDA 4KMSA 4NMHA 4XGNA 5ER6A 5C3MA 1EMDA 4OIMA 1QLJA 3HADA 3H3FA 3O26A 5H82A 3CH6A 4CQLA 2JD2A 3L6DA 1LC0A 3S55A 3PIIA 4YR9A 4GH5A 5T67A 4AJIA 2I66A 2HRZA 4FFNA 1W0CA 1ADBA 4XIYA 4W6ZA 3PVZA 2Q1WA 3OQ1A 4BNLA 2YZ7A 1VL6A 1YONA 2PK3A 2HDHA 4TKLA 4Q3EA 4J1QA 5TQVA 1KIFA 4QQRA 4R01A 1GEEA 1PL8A 1E7RA 2ZTLA 1PQPA 3DHYA 1E7QA 2ZB8A 1KC1A 4LCEA 4C4OA 1SBYA 3WTCA 3RD5A 4XR4A 1CQJA 2O23A 4D0RA 4IQ0A 5JBIA 5EIOA 3NEPX 3ONFA 2WTBA 1X7GA 4PG5A 4AJEA 3JQGA 2BFOA 4IZIA 1HTBA 2PZJA 1I24A 3JQAD 3GDOA 1T2FA 4AJNA 3H9JA 1PS0A 4GI2A 1GEGA 3M1LA 4ND2A 1DRWA 4WPGA 4QO8A 3PFWO 4YT8A 1V9LA 1R0KA 4BGUA 1YL5A 3K6JA 1YB5A 3K92A 4ZD6A 5LDGA 3AFNA 3L07A 3PGXA 2Z5LA 4GSLA 5KJ1A 3O8QB 4RQUA 4JLWA 3I9LA 1ZKMA 4JXKA 2W90A 4OXNA 4ALNA 5A3JA 4YQZA 3E9QA 1B3RA 2VYNA 4PRLA 4URFA 1EVJA 2VUUA 4CUKA 2X5JO 2GN4A 2J5QA 3KSUA 2AA3A 3LT4A 1TT7A 4U5QA 3AM4A 2P9CA 1Z6ZA 1ONOA 3NUGA 5JCJD 5BSEA 3IC5A 3JQFA 5TSDA 4NBRA 2NADA 3WSWA 4F45A 5JYDA 1Q7BA 3WTBA 5ICMA 5K0ZA 4K9DA 4Y8VA 4D3FA 3HQ4O 1HDYA 1QYDA 4D45A 5KVSA 5IDWA 1GY8A 4FFRA 4J9UE 4K6FA 4OHUA 1M66A 1PGNA 4FW8A 3PDUA 4BMNA 2VHXA 2IXAA 3FPLA 4I9HA 4PVDA 3VH4A 4AJ4A 4CV3A 3DMTA 3QJ5A 4WNIA 5JC1A 1V3TA 1GV1A 4D79A 1NYTA 2DVMA 3W4IA 3RUAA 3E5RA 3EVNA 2IODA 3O4RA 1H9BA 5CEEA 3HZZA 1F06A 1Z45A 2I67A 1UZMA 4IZHA 3DTTA 4JN6B 2ZIZA 3V1TC 1ORRA 2ZATA 1YRLA 5DCWA 1FDUA 2O48X 5JAQA 5KJCA 1Z7EA 3KVOA 1BGVA 3VKUA 1ZZEA 5LDHA 2I3AA 3HFGA 4XZ3A 3ZCXA 3INRA 3MJSA 4ZRMA 5EQFA 1C0LA 3F47A 1XLTA 1AN9A 3CSDA 3GUCA 1RM3A 3S2IA 1C0IA 2JL1A 2PA3A 3QLJA 4YB8A 1NQ5A 5FI5A 1DRVA 1RYDA 1XQ1A 4ZJUA 1BTOA 3BYZA 1DXYA 2X6TA 4YAJA 2HJSA 2G76A 4B3JA 3KETA 3DMYA 1NAHA 4QFDA 4E2ZA 4HNGA 2Y67A 3NGLA 3VPHA 1I8TA 1LLQA 1H0KA 1GQQA 1PU2A 3LQFA 2CUKA 2EWMA 2I99A 1JU9A 3KLPX 5ICSA 5IDQA 3QVTA 1J4AA 2G82A 3WGIA 3HN7A 2RBEA 1MG5A 4TZTA 4F3YA 1ZJYA 1KERA 1R15A 2V6GA 3VZPA 3JQ9C 2BLLA 1UDAA 4FB5A 4GKVA 3S8MA 4DBVO 4LRSB 3ZV5A 3PLNA 2AEJA 3A9WA 2EIHA 4R69A 2NU8A 3HSKA 3R3JA 4E6PA 1P0FA 2H63A 3NV9A 5EQDA 1SPXA 3GPIA 3Q2IA 4ILKA 3GVXA 1NP3A 3B1KA 4ONEA 3OIGA 5L4SA 3GVPA 2ZTVA 4RGBA 3DBLA 2O3UA 3W1VA 4II2A 1MFPA 1OI7A 2DPHA 4BNGA 4BNXA 3WIEA 1GV0A 1PJQA 5JE8A 3RUCA 1I2BA 3GK3A 4JNKA 2AG5A 1Q0HA 2RAFA 1JQBA 3GOHA 1DIRA 4Y67A 5FEUA 2CFCA 3FNHA 4GWKA 3FSRA 2FP4A 4NJOA 1LRKA 3RC7A 2X58A 3QY9A 3H2ZA 5EJ2A 2BRUA 2EJVA 1PEDA 3WGGA 4IQGA 1U3WA 4Z0HO 3U0BA 3AOEC 2HAEA 4XYLA 3UAGA 3A14A 1XU7A 3RKUA 2UAGA 3LT1A 1U3TA 3IJPA 1HWYA 4KUGA 4TRMA 2EERA 3MJVA 1Z75A 4BO1A 3ZV3A 3GLQA 4CLOB 5KJEA 4ID9A 5IFLA 4U6SA 3DXFA 4JCOA 2JCXA 3SJUA 3CTMA 4M1QA 2QZZA 2LDBA 3S2FA 3WJ7A 1E3WB 4MVJP 1P9LA 5JDCA 3HNPA 4ND5A 2YHIB 1XELA 2EP5A 4KUEA 4J7UA 4ND3A 3UCFA 4XYMA 1SOWA 4PLWA 3IDSA 3BTSA 1NFQA 1V0JA 1VL0A 1Y9EA 5I7FA 4QFCA 3D3WA 1ULUA 2AE1A 1JKIA 4PLYA 4MVJM 4E31A 3C1AA 5JC8A 4J3FA 3DAGA 4O5OA 1DDOA 5ITVA 4P4LA 2NU7A 3P5SA 1UDCA 4R9RA 3PK0A 1YJ8A 1U7HA 5K9ZA 3GAFA 4GVLA 4RORA 4LVCA 1RM5A 1YE3A 2VRCD 3UW3A 3W8DA 4CLDA 4YRBA 1UXIA 1DBVO 1K2WA 4RF4A 4CJXA 3WDSA 4RF5A 3GFBA 3MZ0A 3EYWA 1DLIA 1QYXA 2AQHA 2UV8A 2YJZA 3JQAA 1HRDA 3CZRA 4ZRNA 1BW9B 4YJHA 3DOOA 4BO6A 4BO9A 4S3MA 1I36A 3SXPA 2QX7A 3H7AA 4Q3CA 1R4NB 1E0DA 2OUIA 2VT3A 5JY1A 2O4CA 4R41A 4NHEA 3LT2A 1LDBA 2X5OA 4IJWA 4AICA 4IDBA 3IUPA 3VOSA 3RVDA 3V2GA 1HE5A 2V7PA 3DHEA 3KXDA 3RASA 4DL9A 4E32A 4JQCA 2GRAA 1X0XA 1I3NA 1TT5B 3ASVA 3QHAA 1YBMA 3Q0EA 1LJ8A 2FZEA 5L40A 4B8WA 3LC2O 1GPJA 2GD1O 2C0CA 2GZ2A 3IP3A 3VTZA 1I3KA 4AFNA 4IQ8A 5IG2A 1RKXA 2I3GA 2P91A 4RPKA 4BQPA 1GUFA 3I9OA 4BNZA 1VI2A 5IZ4A 2B4RO 5IXSA 1HDOA 1E3SA 2AQ8A 1YO6A 5JCJA 3IJRA 2PGDA 4WECA 1WDKA 5CP8A 1VE9A 1Q7CA 3AM3A 3HFSA 5ER9A 3OMLA 5B37A 1EVZA 1T26A 3OETA 3ZDFA 2VYVD 2YY7A 4NFYA 4TROA 2FSSA 3EUWA 1HSZA 4LMPA 3RCBA 4R68A 5C7OO 2A94A 1ZMOA 3FWZA 2YDYA 3KYDA 1VRWA 1IULA 4MVJG 5EESA 4FGWA 4IPTA 3NDIA 1MXHA 1ZK4A 3LLSA 4XRGA 2J5RA 4AJKA 1XA0A 2GO1A 4M86A 4ESOA 4LGVA 3U3XA 5CG1A 4CM1A 2JAPA 4DIOA 1V8BA 3C7AA 4U0KA 3LZ6A 2F1KA 4NH4A 2B35A 3ADPA 4OSPA 5EPOA 2QIOA 2B4QA 4PLZA 2E49A 3BMQB 5JFOA 4GQAA 1MC5A 3F1KA 4JIGA 2Y1DA 3KRTA 3ZWMA 5JY6A 4K1LA 3U9LA 4OQZA 2X22A 1U8XX 4TKMA 1F17A 1WMAA 3E18A 5CFZA 2PZMA 2EKQA 4NJMA 4AJLA 2BF7A 1N2SA 2BKAA 1EBFA 1K3TA 2CSUA 4FOOA 4UUPA 3H65A 3PRJA 2WE7A 1EUDA 4U7WA 5U4QA 1G0NA 1CIVA 1SNYA 1JW9B 1N9GA 3CEAA 3OHSX 4IXWA 5A1TA 3LC1O 1N1GA 4NPCA 1Z82A 4U0JA 2FRDA 1CYDA 4D3DA 2V6FA 3D5QA 3WIDA 1LSUA 1JKJA 1U2GA 5I9MA 3LC7O 1LQTA 2VHZA 3PYXA 2VWQA 2X8LA 1B8UA 2WYWA 3G1UA 1I0ZA 1OOEA 1CRWG 1E77A 2OFPA 4L4SA 2Y0DA 3V2HA 4N54A 4AJOA 2NQ8A 1PWZA 4I8XA 4PFJA 5I8ZA 1YB1A 1FJHA 3O03A 4B8ZA 3C7CB 3EZLA 3FRJA 4RCVA 3OJLA 4NU6A 4CQMD 5IXYA 1WP4A 5G4KB 1GD1O 3ICCA 2HRBA 4L4RA 4EDFA 3KYCB 2FN7A 3D4NA 5IF3A 2VCYA 4D0SA 1HZJA 4BNYA 4RF3A 2OL4A 4I1IA 3H5NA 4BKOA 4YT4A 4JP2A 3GZNB 3AU9A 4IGFA 1PGQA 5F5NA 1C1XA 3FTNA 1PL6A 4YBZA 2GN9A 1H6AA 2LDXA 1Q0LA 3AI2A 2RCYA 3VZQA 4YCAA 4XWYA 2GN6A 1NAIA 4UVEA 1C14A 2C2XA 1QP8A 2NVBA 1P1IA 3ZWVA 1YBAA 3DBRA 4E12A 3D7LA 4MKZA 2O7QA 3HB5X 1H93A 5I8WA 4WEOA 2D5CA 1NVMB 4XD2A 1IOLA 3R3SA 4BNKA 3SC6A 1KVUA 2UYYA 2FR1A 3G49A 2GYYA 3RC9A 4RJTA 4XRRA 2GCGA 3UKOA 2D0IA 2P4HX 2E82A 5HWSA 1QLHA 1UAGA 3GQVA 1N7HA 4E4YA 2W8ZA 3R1IA 1QYCA 5JYEA 1HETA 2HUNA 4O0LA 1E1LA 4RZHA 3VVBA 5DULA 4YRDA 3DAPA 1BXGB 3X2FA 4CR8A 2QZ9A 1OMOA 3QWBA 4FC6A 4DQUA 5ILGA 2DU8A 1XCBA 3DZIA 4CM3A 1EQ2A 3CMCO 4PLCA 2VWHA 3GMDA 1ISIA 5DT9A 3HDYA 3DZGA 1CDOA 2Q45A 3H9UA 4XB2A 4UAGA 2HO5A 2VRCA 4FS3A 4XIJA 1X14A 1OC4A 2CY0A 3ETGA 3DONA 3AUUA 1P3DA 5FF9A 4CQLB 1UR5A 4C7KA 5CHEA 4WLNA 1EEHA 1AUPA 1HEUA 4Y6RA 5JAZA 3D4OA 1KOLA 3E1KA 3EY4A 2PD3A 4YPOA 5CEJA 5KTKA 5IJZA 4MVJD 3H3JA 2BFPA 4AL4A 4EBFA 1PQUA 4RL6A 4OSOA 2BGMA 3ZWYA 4WCFC 2HU2A 2DTDA 4UUOA 3ADOA 4R3NA 4GGOA 2YUTA 1HDRA 1I10A 2I6TA 3W6UA 2CNBA 4D43A 4BKUA 2GDZA 1XR3A 5A5EA 3GEGA 4TRRA 4XDYA 2C7GA 1CERA 3I6QA 1P31A 5KVCA 4CMEC 3PYLA 2IYPA 4LN1A 4RVGA 1ZEJA 2PFGA 4GKBA 4J16A 4A26A 2ZJ0A 3BA1A 4L75A 4YTEA 2YDXA 4RPLA 3NAQA 2B0JA 4RPJA 3M2TA 3ITKA 4AJ1A 3PHLA 4XR9A 3TZKA 4UUMA 3ZWPA 3PQFA 2VYVA 4A2CA 4X54A 3UGKA 3V5NA 4Q3DA 2PWZA 4E5KA 5A5FA 1LDMA 3KSZO 1PL7A 1DIGA 2YFQA 3LF2A 3FTPA 3DL2A 3H6KA 4XX0A 4J49A 1V3VA 1DIAA 5JMPA 4J1NA 1Y8RA 4BNVA 3TDKA 4E2YA 4B3IA 1OAAA 3WWYA 4GL4A 4P22A 4DXHA 5FI3A 1GCOA 1TEHA 2NQTA 5BSGA 1YQGA 2OHXA 3ZU3A 4IJKA 4CLRA 1HYGA 2JCVA 4KTTE 1YL7A 1LRLA 2A92A 3HDJA 3N74A 2HMVA 3L6EA 1ONPA 1YS4A 1BDMA 3NTOA 4KOAA 1SB8A 1I5RA 3OP4A 3PI7A 4FR5A 2DTEA 2PH3A 4EJ6A 2OOSA 2W2KA 3JD1A 5DDIP 4CLXA 3C3XA 3EGOA 2GR9A 1HE3A 3H5RA 3NTQA 1HF3A 1H2BA 1KY4A 3KB6A 3JYNA 1JTVA 1KS9A 1GR0A 3AM5A 3DBVO 5MGBA 4LVUA 4PRKA 2QQ5A 4B7UA 4ROSA 2OORA 3DZHA 3HDQA 9LDBA 3OSUA 3COSA 1U7TA 2O2YA 1R4MB 4UVGA 3TL3A 4FOSA 1MGOA 3U49A 2EW8A 2Y05A 4EZBA 1VJ1A 3B70A 3K5PA 4HV4A 4Z0PA 4C7JA 4FIZA 4O63O 3LF1A 5C5IA 4E5NA 3GRPA 4TMFA 7ADHA 4II3A 2B4TO 2V6BA 3ZWAA 4DC1A 3VH1A 1GPDG 3E9NA 2IXBA 3UHAA 4ZU3A 2RIRA 3Q9NA 3AI3A 5TJ9A 3PGJA 3BHMA 1EK5A 1PJSA 5A4DA 1I3LA 4A03A 1IE3A 5KOIA 3GNQA 1K5HA 3KSDO 1Y5MA 5G4LA 3PHHA 3D4PA 4GX1A 5TX7A 1LDEA 2GZ1A 1I30A 2YW9A 4ZQBA 4BO0A 4CQMA 3N58A 2X5KO 4R3WA 1BG6A 1WNTA 2C07A 5KVVA 3PWKA 4LW8A 5CDSA 3LYLA 4J4TA 3FR8A 4ND4A 1YQDA 3ONDA 2E48A 3NJ8A 4WK6A 5B4TA 1PWXA 2C59A 4R1UA 1KVTA 3H4VA 1GYQA 1HSOA 4CM5A 4BO4A 2X1HA 1DSSG 4KQXA 4H3VA 3IMFA 4R1NA 3RUIA 5G0WA 1SMKA 3FWNA 4L0QA 2AG8A 5GY7A 3ZWOA 2B5WA 1VJ0A 4PLHA 2AQIA 4ZN6A 1M76A 3BAZA 3GVIA 1NWCA 4M8SA 4RVUA 3JQFC 3VVCA 1J5PA 1L1FA 3IP1A 5GZ1A 1H5QA 1NR1A 1SEVA 1TA4A 1LDGA 1D4FA 2IZ1A 2Q49A 3BMCB 1HT0A 3RROA 4NR0A 3EW7A 4I08A 2VT2A 2CVOA 4XGKA 4CMBA 3C1TA 1PGJA 2AEMA 3DMTC 4B7CA 5JS6A 2DBRA 4B4UA 2Y93A 3DZBA 3AUAA 2HK8A 3ZU5A 2ZTUA 3WGHA 2C82A 2C5EA 2YQ5A 3GHHA 3JD4A 1XKQA 1M6HA 1KBZA 1B7GO 3I9MA 1EE2A 1GYPA 2HLPA 2AXQA 1C1DB 3HG7A 3JCZA 3OEWA 3TZ6A 2VNAA 4BGEA 1PZGA 2DLDA 1RM0A 1PJLA 4YVFA 4ZQEA 1NHWA 3D0OA 4AJJA 5IDXA 1KC3A 4P4GA 4HFJA 1T25A 1G6KA 1VL8A 4N5LA 1QKIA 3P7MA 3ENKA 3AY6A 3ROKA 1R6DA 4MVJH 1DFGA 1XHLA 3B1FA 3WLEA 1I32A 1WDMA 2ZCUA 4GBJA 4MVJE 5COAA 5L3ZA 2GLXA 1HXHA 1Z7BA 4IIVA 4XEHA 2PH5A 1I01A 2C2YA 5CDYA 1O8CA 2P4QA 5AXBA 4UVDA 3U4IA 4M49A 2GZ3A 1ZXBA 3QE3A 1RYEA 4XQEA 4HKTA 4HWKA 1ZVMA 4KWIA 1NPDA 5IAAA 1ISFA 2D59A 3TL2A 4KTVE 4DLLA 1C0KA 3L9XA 5J23A 1T4BA 3F9IA 1YJQA 2C29D 4IMPA 1V6AA 1E3JA 3GNTA 3ROPA 4CM8B 3WFIA 4MVJA 4FJ2A 5JMWA 3Q3CA 3I9JA 4M55A 3SLKA 1WPQA 4N5NA 2G0TA 1SOVA 2PZKA 2Y1GA 3JQDA 4HUJA 4NIMA 5EL0A 2W2LD 4DMMA 2FHSA 1N1EA 1Y81A 4NG5A 4OH1A 1D1SA 3ORFA 5FFFA 3AI1A 3CPSA 3AK4A 1CF2O 1PTJA 2CF5A 2X0NA 1PS8A 1VM6A 2AEFA 4F6CA 3L0DA 4TVBA 3OJ0A 3ZNNA 5L51A 4DGSA 4MJLA 1GUZA 3VPFA 4ZA2A 1U8FO 4OGWA 1EUCA 3S2EA 2ZQZA 3CIFA 4E30A 3BMOB 4TVOA 4J7CA 5G2OA 4Z6KA 3WR5A 2Q3EA 1A27A 4E0BA 4IJVA 3HUDA 4TSKA 3P2YA 1YB4A 2ZKLA 4J43A 1IPEA 1K6JA 3V1UA 1PJBA 3DDNA 1Y8QA 1XU9A 1GYRA 1MUUA 2NNLD 1O95A 3ZNOA 2DBZA 3GG9A 4BNMA 3RWBA 2P5UA 4Z0TA 1O0SA 3E8XA 2R00A 5ES3A 2X23A 1QXSA 2Q1UA 2NLOA 2VHYA 3Q9UA 4L73A 5ENVA 3WS7A 4WOJA 5JDCC 1KETA 3A4VA 3EK2A 3B20A 4IDCA 2IYOA 1ZXLA 2BD0A 4BKQA 1UXHA 2JD0A 4BMSA 1X0VA 3KEQA 3ICPA 5DBIA 4CPDA 3OIDA 3Q11A 3U4DA 3W4JA 4OAQA 4LCJA 2VUTA 3GVCA 1PJCA 1EFLA 2DFVA 1XIVA 4GMFA 2EEZA 3NRCA 1PQWA 1ENOA 2B36A 2W4QA 2IEBA 3FI9A 3OJEA 3FCOA 5A02A 3RFXA 4YWJA 4J2OA 1NVGA 5FYDA 1VLLA 4FFOA 4A0SA 2FOIA 4YYZA 1LDNA 3K30A 3HDHA 1BRMA 1NXQA 3QV1A 2O3QA 5I7EA 1TB4A 1J49A 1T2CA 2JFFA 3F5SA 4CL3A 2QW8A 2J3KA 4M89A 2BFAA 1E6EA 1XEAA 2TMDA 4PZDA 1EUZA 2GSDA 2HKIA 5CPBA 1ENYA 2GNAA 3PHJA 3KM0A 3ZHYA 1GUYA 5KJ6A 4PGFA 2X0IA 3W4KA 1SC6A 2IRWA 4DVJA 3OQBA 1F8GA 3GMSA 3WQQA 1A7KA 3PYMA 1J6UA 1EDZA 2NU6A 4JBHA 2I9PA 4XB1A 4CMCA 1UAYA 3PDJA 4W7IA 1I33A 4PIVA 3DFZA 4FD3A 2CD9A 4H7PA 3O8QA 1JLLA 5JLAA 3GPDG 3VDQA 1DEHA 3BTVA 1U4SA 2J5KA 4EGFA 4FQ8A 2PD4A 3EDMA 4WLVA 3WWZA 4TWRA 1ZEMA 1JVBA 5GMOA 3B1JA 1BDBA 2DC1A 4RVHA 3WB9A 4YJGB 2AE2A 1WXDA 4QUKA 4O59O 5KJFA 3U4HA 1FF9A 1L7DA 1ZFNA 3OA2A 3SX2A 2VTDA 2JAHA 1M2WA 4RPHA 4DIFA 2Q2VA 2B5VA 2IZZA 3PIDA 4DPKA 4BVAA 4W7HA 3JYPA 3TPCA 3TN7A 3W8EA 4MIOA 3GEMA 3FBTA 4MP6A 2DM6A 1RM4A 2VZ8A 1HDCA 1YOVA 1DC6A 4XYEA 4MKXA 3IOYA 4D41A 1DFHA 1E1NA 1ULSA 2WM3A 3Q1LA 4PLVA 2Y1OA 5JXWA 1HYEA 5T8KA 5DP1A 4Q39A 1U1IA 1SB9A 2OO5A 2D8AA 4IS2A 5JPIA 4BNNA 1A5ZA 4BS9A 4YAGA 3OECA 1VC2A 2RHRA 4FJ0A 2P2SA 3UCXA 2HQ1A 3GDFA 5CDUA 1H94A 1LLCA 4NFSA 2Y68A 5T6BA 1W73A 3GFGA 4J4BA 4XDZA 4L76A 1O5IA 3JD2A 1YH3A 4DLBA 1P33A 1P1JA 4QSMA 4IDDA 4YAIA 3WYCA 4XA8A 2B69A 4GGPA 5DCYA 5I7SA 3WMXA 3EHEA 2OXIA 4E2XA 4BGIA 4XQ9A 1EE9A 1YL6A 5AVOA 3D5TA 2EGGA 3BIOA 1OZAA 2FR8A 4PLGA 1O94A 2Y1CA 3UF0A 3KZVA 2VZ9A 2YV1A 2EW2A 1ID1A 1YDWA 1AXGA 2OZPA 1ZSNA 4IDGA 4O1MA 3W8FA 5JNLA 4DREA 3IL2A 1NWHA 1MP0A 4NQZA 4BNHA 5TNXA 1F12A 2W2LA 1N92A 2YV2A 2JD1A 2BI7A 5F1KA 2NVUA 4W9NA 3HJAA 2R2GA 3ITDA 3OQ6A 5JO9A 5A04A 2FR0A 1XQ6A 3QSGA 1NX6A 4TQGA 4RPGA 1JDJA 1UP6A 2H9IA 4EUHA 4A10A 2ZB7A 3JSAA 2GF2A 2O7SA 4WE3A 5KCZA 2ET6A 4J1SA 3RUFA 1JAXA 5AYVA 1T1SA 2DUUA 1P1FA 1P0CA 2ZTMA 4K26A 3WX0A 1E1MA 4ZQFA 1M67A 4WEQA 4HX5A 2PKQP 5HTOA 3JQ7B 2J3JA 1Y5RA 4QECA 4TZKA 4CLEA 4N7RA 4QXMA 1GQ2A 3N7UA 2Q1TA 4MIEA 5A9SB 1ZW1A 3UUWA 2WD8A 1OFGA 1N7GA 1LSSA 4CR6A 2W98A 5BT9A 4R1SA 4PLPA 3PQEA 4OO3A 2I76A 2ZQYA 3GT0A 3UVEA 3ZWBA 5TT1A 3ST7A 2HMTA 3I5MA 3ZH2A 2E37A 2Y99A 5TF4A 2JFGA 3H8VA 4G65A 4BO8A 4MIYA 1E3WA 4W99A 1LLDA 1HDXA 2YHIA 4DRYA 2CDBA 4U8GA 1PIWA 4J6FA 3AY3A 3KTDA 4DWVA 1O89A 1S7CA 2HMSA 2V6MA 5G0VA 4D7AA 3GA0A 5THQA 4YT2A 1WDLA 5I9NA 4YRAA 2VRBA 3I83A 3DZJA 5F1OA 1K89A 1VKOA 3JV7A 1X1EA 1Y8RB 1NR7A 3MJCA 1WLYA 1M75A 3KV3O 4I9NA 4MDHA 2E6UX 1PR3A 4MVJI 3F4LA 3VH3A 2PNFA 5K1SA 4PLFA 4DQXA 1V3UA 5KNLA 3UFXA 3I4CA 2Q99A 5HA5A 2B37A 5B4VA 3AOGA 2BH9A 3AU8A 4WCFB 4FSHA 4CM4B 2QRJA 4WNCA 5A9TA 1W8DA 2W2KB 4J4HA 3UOGA 4GWGA 3OF2A 3I9KA 4E33A 3VAZA 1LX6A 3RBXA 3QQPA 2YHUA 4N5MA 3F6YA 4UEOA 1TI7A 1BW9A 1E7WA 3QP9A 3BMNB 1PSDA 1LSJA 5BSHA 3TOZA 1LTHR 3JD3A 3H9QA 2HMUA 4GVXA 5CDGA 1ENZA 1Q2XA 1T2EA 4FC7A 4PZEA 3GVHA 2PY6A 3WBFA 1QG6A 3ETDA 4A27A 1DHRA 2FMUA 3A28A 3D64A 1B16A 3G1TA 1TT5A 5KKCA 3VTFA 4EJ0A 1ARZA 1U28A 2PV7A 1DB3A 5ILOA 1H9AA 1B15A 4E21A 3SC4A 3ZWXA 1DAOA 1C3VA 3JQ8B 4BNTA 1E3IA 2ZJ1A 4FGSA 3HWRA 1XWFA 2H6EA 4FBGA 3C85A 2NTNA 2NSDA 5IDYA 4DTIA 5DOVA 4CQMB 1NVTA 5B12A 2NTJA 5DBFA 5LCXA 4AVYA 3PZBA 3MJEA 4AJPA 3A1NA 3NYWA 4DLAA 3CINA 1GTMA 4XCVA 4DPLA 4D42A 3G3EA 2VHWA 3GF4A 4AJ2A 2RHCA 1PJTA 5BQFA 3RIHA 3JQEA 3ULKA 1NNUA 3NTRA 4RLHA 2EP7A 4GLLA 1MG0A 4HFNA 5EINA 4R9SA 5L4NA 4JJIA 4NBWA 3D1LA 1PZHA 2PR2A 2GN8A 2FPPA 4TRJA 5F21A 3RFTA 3GY0A 1JA9A 2Q2WA 1E5LA 2BGKA 2X7HA 4XGIA 2EF1A 2VWPA 4OXKA 2WD7A 1EBUA 3H5AA 1WZIA 4WASA 5DZSA 2DUWA 3JQGB 3EMKA 2YV3A 3QWIA 2AHRA 3WGTA 3HE3A 1LA2A 1R0LA 3PJDA 4FFPA 3LLVA 4IY1A 1I2CA 4PCVA 3WQRA 3HN2A 2EKLA 3BMQA 3I1JA 3T7EA 3ZWWA 3O9ZA 4RZIA 3BTOA 2D1YA 3KOUA 3IS3A 2C7VA 2CDAA 3I9NA 3ROMA 1K6XA 1A72A 5C7LO 4WJZA 4R5HA 5L95A 4Z9YA 4ZVVA 4P38A 5BSFA 1IUKA 1WMBA 4IIUA 5U9CA 4L4XA 4QTZA 3DO5A 4KUHA 5JCXA 1LEHA 4BNUA 5HM8A 5TJHA 2NVWA 1JVSA 4KWHA 2Q4BA 2R6JA 3ABIA 5AXCA 4HFRA 4WLEA 3TOXA 3QVXA 4BV8A 3LT0A 1GCUA 1NTOA 3ETEA 1ZK2A 3G17A 2D4AA 3L4BA 4CL8A 4DPMA 1F0YA 1LBEA 4BO3A 2JJYA 5CDTA 4AG3A 3DEYX 4W4TA 1T24A 3DC2A 3HB4X 3VPGA 1P74A 1VSVA 3WSVA 3AWDA 3GEDA 1MA0A 4LSWA 3WFJA 8ADHA 1H6CA 1R0SA 2AW5A 1NQAO 2F00A 3KYCA 1ISHA 1KVSA 3QRWA 3K73O 2A9FA 4ALMA 1AGNA 3GZNA 2UUOA 5IN4A 3STHA 1LSOA 3MOIA 4UVIA 3Q6IA 1IL0A 2GPTA 2Q2QA 3WLFA 1U9JA 5BNFA 4BQRA 4KP7A 3O38A 2DQ4A 2YYYA 3TJRA 4ZQGA 1PR9A 1ZK3A 1K0UA 4H15A 1BVUA 4OKNA 4Y6PA 3WYBA 1S6YA 2BMAA 1T2DA 5JDIA 1EDOA 3WYEA 3ZW9A 2NUAA 4J0FA 1YXMA 4OKIA 1LNQA 2OMEA 3PJGA 4KZPA 3EC7A 3JQBA 1NFFA 1O6ZA 1GADO 3RU9A 1W4ZA 4YDRA 3QWAA 4P8RA 4Q9NA 4LSMA 1DHTA 4BGVA 2VWGA 4LMRA 1E7MA 1Y6JA 1A9YA 2J3HA 2Y0EA 2ZK7A 4WLOA 4YJFA 1WWKA 1XG5A 1YDEA 4QT0A 3QVWA 2WYVA 9LDTA 4QX6A 3S1LA 4IUYA 1IY8A 4Y6SA 3NT4A 2D3TA 2DAPA 3FNFA 4CM7A 3K31A 1PGPA 5EN4A 3I23A 2FPIA 3EVTA 4WLFA 5EERA 3OBBA 2EXXA 1U4OA 3WICA 4IBOA 2B83A 1T2AA 1PS9A 4IJUA 4GSKA 4WGGA 3K2EA 4B7XA 3NKLA 1RWBA 4BNFA 1ZMTA 1E3EA 1PJ3A 2HK9A 4NZ9A 4J0EA 2P9EA 3MWDB 1UXJA 3DBLB 4PG6A 1YBVA 2QYTA 1GFSA 4YXFA 5COQA 5G0TA 2O3RA 4HXYA 3WMWA 3PLRA 4XJSA 3UCEA 3ZNPA 1P1KA 3ZW8A 2VN8A 4B4OA 3R6DA 5GZ3A 3ON5A 3M6IA 4MP3A 1DC5A 1DAPA 2IEDA 4WOKA 4DA9A 4IGEA 1F8FA 4IDFA 4NK5A 4Y98A 5TC4A 4BUCA 3GGPA 2VZ0A 3SVTA 1B14A 2UDPA 1PX0A 1GAEO 1PZFA 3GNSA 1NM5A 2NACA 3P2OA 1GZ4A 1NHGA 3ZNQA 3IKTA 1QYWA 2DT5A 5GZ6A 2QHXA 1GQYA 4MP8A 4EW6A 2DFDA 1MX3A 3AY7A 3VPXA 5COBA 5JW6A 3C7DB 3FF4A 3V2UA 1T1RA 2XXJA 5A9RA 1IB6A 1P44A 3D3EA 3E48A 1QV7A 4A7PA 2J8ZA 3NX4A 2IE0A 4IDEA 2FSVA 2OBYA 4FN4A 5BNIA 3NGXA 4UVHA 4S1VA 1UJMA 2OP1A 2FPGA 1U5CA 3D3WB 5KWEA 1ZSVA 4LISA 2CF6A 3ZU2A 4IMRA 4DC0A 3ZZNA 2JKVA 3DQPA 2R00C 2Y66A 4KDEA 4R51A 1DIBA 3TZQA 1ZNQO 2X86A 4GX0A 3F5QA 1B26A 1MFZA 1GU7A 4EUEA 1U3VA 4XKJA 2X9NA 4D3SA 1KYQA 2OBNA 3DBHA 3GUYA 2VNSA 2HSDA 4EEZA 1LRJA 1MV8A 1AHHA 2YQ4A 4YACA 4W82A 4O6VA 2C20A 4CUJA 4GPD1 1ENPA 3BZUA 3CUKA 2G5CA 2P5YA 5DBGA 3JQAB 1CETA 3T4XA 3T7CA 3CMMA 5KVQA 2JCYA 3FNEA 1P1RA 3KYBA 4YJHB 1A9ZA 1YOVB 1H2HA 4R54A 5FWNA 3I4FA 3VPSA 4ZICA 3U4CA 5JAMA 5DCUA 5TT0A 4RV9A 2OP0A 4MPDA 1WVGA 3ZHXA 1R4MA 4P4NA 4A5OA 1ISMA 4RVDA 2QYSA 1T4DA 4I9UA 4BIIA 3JD0A 2CMDA 3FR7A 4YQYA 3AUSA 4BOYA 3P19A 4IINA 4BO5A 3F3SA 1BHSA 2O3SA 1E7YA 3GR6A 4I5DA 4CM9D 3M1AA 4XYGA 5L7TA 4FFLA 1NFRA 3TQHA 1AE1A 2NV6A 1VJTA 1A4UA 1UZLA 2QG4A 1JAYA 2X4GA 4DMLA 4CMAA 1DJQA 2VQ3A 4CMIA 1YVEI 1DRUA 1Z74A 4HADA 1ZSYA 1SO8A 1XYGA 3ENNA 3CE6A 3DR3A 2WMDA 1FDSA 3UH1A 1CWUA 3L6OO 1FXSA 3GRKA 5AXAA 3RC1A 3DFUA 4GAEA 1HYHA 4NU5A 5A05A 1YKFA 4EJMA 4EEXA 2G1UA 3RUDA 1PGOA 2PKQO 4FPXA 3UICA 2FZWA 3IKVA 1WW8A 4RDHA 2FWMX 3HHPA 4QEDA 1UZNA 4LRTB 3GH3A 3NJ4A 1PZEA 5B1YA 3PWSA 5G0UA 2Y1EA 4ALLA 1ZUD1 4UUNA 1I3MA 3QWHA 2P9GA 1G1AA 1R16A 4KQWA 1P77A 4OMUA 3VKVA 1L7EA 3KYDB 3ZV6A 4BNIA 1DFIA 1VPDA 3DTYA 3MOGA 3U5TA 4YAEA 3V8BA 5JSFA 2YFHA 4R5MA 2GUGA 2JHFA 4G81A 2NVUB 1MB4A 3S2GA 5K6AC 3NDJA 2VOJA 5U1PA 2PD6A 3GDGA 2HCTA 4I5EA 1WZEA 1A4IA 3RI3A 2Z1NA 4CMHA 1VKNA 3EAGA 3BMCA 1ADCA 4Z9FA 4CR7A 4L8VA 3AJRA 3RFVA 1OC2A 4OQYA 4RVSA 2ZYGA 3ROQA 1ISJA 3NT2A 4EITA 1LXCA 3JYQA 5T8KC 1LU9A 4K6CA 3JYLA 1DC4A 2JHGA 1Y1PA 1UXKA 4NJMB 4ALIA 1ISGA 5A06A 1TXGA 1C1DA 1LQUA 1ZIDA 1IHXA 2ZB3A 4UREA 3WNQA 4BNWA 1SEPA 2PLAA 8LDHA 3AW9A 3IUSA 1N9GB 2QRKA 3DZKA 5DP2A 1FDVA 1X7HA 3NT5A 1LLUA 4J9VA 5TS3A 2CVZA 2EJWA 2WWRA 3ANLA 5EMHA 2Q46A 5IZCC 4I5FA 4RF2A 1D7OA 1DIHA 1HL3A 5DF1A 1QRRA 1EVYA 1NASA 1UUFA 3PHGA 1W6UA 4PVCA 4YA6A 1HE4A 3JQ9A 4GX5A 1HZZA 2ZYAA 1U3UA 3ZWCA 4B4WA 4YAKA 2O50A 2H1SA 4FCCA 4NNJA 3L9WA 5K6AA 1B0AA 3IAHA 2O2SA 4JJFA 2D5AA 3PP8A 4YT5A 4Z9XA 5C7IO 3RUEA 1N8KA 1QSGA 5G0SA 4CM8A 4PG4A 4PZCA 1QV6A 4A73A 3WGQA 3H9EO 1C1XB 3KUXA 4ALJA 6LDHA 3PPIA 4PLTA 4U6QA 5DNAA 1BVRA 1KEVA 4BB6A 4GX2A 1U2DA 3G0OA 2XOXA 4JJGA 4W9NC 4BB5A 3KBOA 3INGA 4PG8A 3K2BA 2EGHA 2CDCA 3SJ7A 3DBRB 1XSEA 4Q3BA 3H9GA 4BV9A 5JO0A 4IXTA 1JN0A 1CJCA 1KEWA 5AXDA 2H5LA 3WGOA 2WJPA 3AOEA 2DBQA 3ZV4A 1BXKA 3ZI0A 5A03A 4INAA 3PJEA 4E5MA 3WNVA 1J0XO 2I65A 4R1TA 3MWEB 3K8ZA 3Q2KA 2CZCA 3E5MA 5HRUA 1E6UA 2RH8A 3C1OA 5I9LA 3BMOA 3WGZA 1GDHA 1U5AA 4L9RA 5IZCA 2Z95A 1P45A 5THKA 4LK3A 1TLTA 4BO2A 3OJOA 5L7YA 3KLMX 4BMVA 2WYUA 1O9BA 1Z73A 4M87A 4B4VA 5LC1A 3PEFA 3ONEA 5T64A 4CV0A 1HDZA 1PJ2A 2UVDA 4OYRA 3RAJA 1B8PA 4IM7A 4UEJA 1GZ3A 2J6IA 4RQTA 4XQGA 1E7SA 4OL9A 3VC7A 3MTGA 4JK3A 5BNTA 1D8AA 1Y7TA 3K96A 5CG2A 4OJNA 1ZK0A 1GZ6A 3JQCA 5I7VA 1CEQA 3GHYA 1BXZA 4FDAA 4G5HA 3OEYA 3LVFO 2AQKA 1I2ZA 3SEFA 1OBFO 4NBTA 4E3ZA 1MC4A 3U09A 4E2WA 5CAEA 4J90A 2X9VA 3VH2A 2XF8A 4Z3KA 5HS4A 1LI4A 2Q4EA 4JGBA 1DLJA 2IDZA 1SZJG 3GN1A 4NFHA 1DC3A 4WLUA 3OH8A 1NQTA 4WUVA 4F6LA 3ASUA 2JFHA 5CPFA 4RDIA 2O3JA 4UEKA 1R37A 3W6ZA 3TFOA 2PGLA 2VTEA 2AMFA 3F1LA 2A35A 3FNGA 1QR6A 3WG9A 3GG2A 2Y1FA 2NWQA 4OM8A 3TZCA 4MOWA 2X9GA 4D44A 5MDHA 3GN2A 3FD8A 4QO7A 4OOFA 2FY8A 3FN4A 1BWSA 4DUPA 5F1PA 1B8VA 5L9AA 5TIIA 2WD7B 5BR7A 1X1TA 3ANMA 4CM9A 3QW2A 2BI8A 3INTA 2HMWA 3PFFA 1UDBA 3RU7A 1EK6A 4BL5A 3DOCA 1D3AA 3GGGA 3WBBA 2SCUA 1CQIA 3IIEA 1X15A 5TLSA 3C24A 3MEQA 3VHRA 1EFKA 3JYOA 2BELA 3A06A 2DTXA 2BGLA 2EV9A 4CLOA 1LC3A 3DHNA 3FPCA 1X7DA 3TNLA 3TZHA 3TRIA 1LUAA 1RPNA 3MJTA 3R0IA
chains in the Genus database with same CATH superfamily
1PLJA 4CUZA 2X0JA 2C97A 1Z13A 4UFOA 4X1IA 2WYHA 5BRJA 2NG1A 3FJOA 3FUCA 4OJQA 4JXXA 1UMBA 5FPPA 2ZSKA 3AWIA 3CZQA 2CNKA 3K0FA 3G0GA 5ERGB 5AW9A 4GMXA 1S3SA 1JNXX 4GOLD 3PJFA 1QHHB 2UXBB 2O5EA 2YZGA 3KKQA 1TU0A 2BT4A 2VSFA 4QG3A 2QPLA 2C7QA 2DETA 3HCPA 4H7DA 1EAMA 4L74A 3TK1A 3PKJA 2QU8A 2EKPA 5EUQB 5TGDA 3UNXA 2ZBFA 1SN7A 1FFAA 3HLKA 1QP0A 1ADFA 1YJXA 2HQOA 4HNQA 4IJ6A 5TMEA 2SKCA 1EFPB 1O9HA 3GZ4A 3HB0A 3PQ4A 5K09A 2Q27A 1ZRSA 3TSCA 3UG7A 5D7NA 1L4UA 1QO0A 3EQ7A 5JEEA 1HPLA 2DKNA 1Y1LA 5FWXB 1N7JA 3HK2A 2FPOA 5DM2A 3AONB 1K88A 1UDRA 2IXDA 4MW1A 4PYJA 3G0CA 1JDSA 4EHLA 3TINA 4GM4A 1DAMA 2WRZA 4DQVA 1TTHA 4JEMA 3D59A 1RRVA 2XGOA 4TRNA 1ZOLA 2XTZA 1CUEA 1ACMA 3GLIB 4JBGA 1S8AA 4H17A 4CV2A 2JI4A 3VZRA 2QM0A 1EPUA 3BHJA 4UE6A 4YJ2A 3QKRB 2JA2A 2PMCA 2XPCA 2PYZA 4XYBA 4B17A 4CT0A 4U2DA 3NZEA 2B1JA 2ZJYA 3ZZ0A 3RS2A 5ADUS 3L77A 2QP3A 2RGRA 3DAFA 4S1WA 1B2LA 4WQMA 2HHLA 1GU1A 3O7MA 5C8VA 3K8QA 1G19A 4DBLE 2LXNA 4P36A 3C3JA 1Y3FE 2OHOA 3AFMA 3QPVA 4HGNA 1YZUA 3F3YA 1YRYE 3WWEA 4UULA 1EX1A 4K28A 4M8KA 4X7MA 1XMQB 4WCDA 3U1TA 3UT6A 3PWZA 2NXEA 1LJLA 1WL8A 2NUAB 5BUCA 2ODWA 3K1YA 3UMRA 2VP5A 5KAPA 3F78A 2QQFA 3JARA 4BV3A 2ASEA 3DGFC 1GJRA 1Y9DA 2BFMA 1T34A 3V00A 2VUSA 3UXHA 1E79A 3BHIA 3HRIA 3AUXA 3R20A 3IAS1 1CNFA 3NWOA 1E1KA 3T0FA 3PXCX 3D7NA 4H6PA 3OHPA 1BRTA 3FPJA 1L5SA 4GNKA 5CU7A 5BOVA 4GDFA 4D6YA 3LLCA 2QSUA 1I1NA 3E4CA 3KWJA 1GP2A 3WK5A 1YWGO 2D2IA 3FKSD 4IJMA 4GC5A 4L4ZA 4F3CA 1BNCA 1DG3A 3FHLA 4GLOA 5H02A 1QRTA 2WEKA 4RTSA 1DJNA 3PV0A 4HH4A 5AVSA 2OGZA 4D4IA 1RQPA 2R751 4IIJA 5EWLA 1KI1A 4CF7A 2XMDA 4OXYA 3QIVA 4H9GA 3RC2A 3KKPA 2NV2B 4DLXA 1WZUA 1U0JA 2R9VA 3ZEAA 2P6PA 4DUYB 2G8NA 1EUYA 1NYLA 5BQPA 2JFQA 4Y9DA 4IS3A 1UMDA 4BHTA 2C8KA 4XM0A 2OGTA 2OOKA 4US0R 4RY9A 2I7TA 1FFXA 3KU1A 2XXAA 1VSUA 1V9CA 2UYOA 2Q9AA 1JEYB 2C5LA 2H1LA 4MLDA 4V3CA 5BN1A 4BZZA 4ZHSA 3NHBA 4EK9A 1MIHA 3OJWA 1QHGA 1U2EA 2B6HA 3FRHA 4BMDA 4C7VA 2MOKA 3FSEA 4M1ZA 5B1IA 1RD4A 4W63A 4IL5A 4CKEA 1WU8A 4UPDA 4QGGA 3K0SA 4NV1A 2JBAB 2QTHA 3IGFA 5KKAA 2C54A 2HJRA 1OX4B 1XN4A 1N32B 1CZOA 1FTYA 3VU9B 4A5SA 4BKRA 3PLAE 1KYXA 1Z7GA 2VL7A 1UANA 4Q02A 2E21A 2JI7A 1FFDA 3NB0A 3IPCA 1CUUA 3DB2A 1JWBB 3OF5A 3JQ6A 2WK1A 2X2OA 3TYXA 2ZTSA 1JR6A 4HMQA 1P8AA 1LD3A 3I8XA 4GFDA 4RTPA 1NVEA 1JA0A 1AGYA 2C5AA 2K6GA 2UKDA 3DE0X 1Z08A 2ZRPA 4U6NA 3RFUA 4MV4A 2WQ6A 3QKWA 3UHPA 3FAZA 1Q0TA 4HNHA 1EQUA 5ITWA 1S9HA 4A0HA 4DY6A 4DV1B 2JJ1D 8ATCA 1QHNA 1C8BA 1MAAA 3NV7A 3C8DA 4LDJA 3W7VA 1AJEA 1R12A 3MJ4A 5LZ7A 1E5QA 1T29A 2QGNA 2WICA 3N87A 5DHQA 4LYDA 4PXAA 1BMDA 3I5YA 3QBDA 3HZRA 3EVFA 4YCJA 3ZGYA 3ZIUA 4OJMX 3S8EA 3HJFA 3PHIA 4JI6B 3EGCA 4HBZA 3UC5A 1GCGA 1UJ6A 4IDAA 1JFFA 2A4KA 2EZ9A 4D8WA 2R48A 4EKIA 5I5EA 5G4KA 1XZLA 4B81A 2R5NA 3OU6A 5BSRA 5LMZA 1GU0A 2X8WA 3GC6A 2AN4A 2CB9A 3FDZB 4BKPA 1A3CA 2KWIA 4W6QA 4ZQHA 4OG2A 3PVCA 4U2FA 3VC1A 4DBZA 3HJHA 2PTGA 2Y1LA 4GMGA 4L7VA 4DIBA 4B79A 4GOJA 4ZI5A 5JBQA 3BG5A 3QELB 3ETHA 1G6OA 3AUTA 1G8PA 1PV4A 1V8FA 3QVOA 4I1OA 5KYUA 4DQKA 4OTZA 4RK0A 1ICEA 1NQVA 3BIXA 3LCVB 1KMCA 3TCKA 5BSVA 1JJVA 1SUEA 2APJA 1QGUA 3WLPA 3K6SA 1E1RA 1W5AA 4PZYA 2GBGA 3TDNA 3VO9A 4WCFA 2I62A 1N2CB 2QRVB 4O3MA 3H5LA 1HE2A 1MQ8B 3D3KA 1D1TA 3QSYA 4BQQA 1DPGA 1T8TA 2VF2A 2IXGA 2VKQA 3D8TA 3K5WA 4E5VA 2ZI5A 3EMBA 5GQSA 1L5NA 3RYFA 4ZGWA 5C37A 4O8ZA 3SDSA 3B6ZA 1PJ4A 1X7XB 3HV0A 4IV8A 4ARAA 1KAEA 3M0EA 5KIAA 3PDHA 4MJ7A 2E87A 5CA0F 4FGZA 3RQSA 1A9XA 2CT8A 1XD9A 1TADA 2A67A 5EP1A 2IPNA 1ZNXA 1ODTC 1UBCA 5JMOA 3EWAA 5EHNA 3SKVA 4HY3A 2CL7X 1KH2A 3FPEA 4O4JF 4LJYA 1AXEA 1FYWA 1VXRA 1UM9B 5DOZA 1RZUA 5FBKA 1CE8A 1K5DA 1Y48E 5DU2A 1FMCA 1XROA 2PG3A 2V3WA 5E38A 4N3CA 2IV3A 4BNUA 2F48A 3TSAA 3ILVA 3RS7A 3N2ZB 2K7FA 4UM5A 2Y1XA 1YQEA 3LW7A 3PFGA 3TFQA 3TRFA 4EJFA 1BXGA 3G79A 1ZBQA 1Y8QB 4QOGA 3ZK7A 1ZCJA 4M54A 4QLBA 3E03A 2XAAA 3K09C 2BDUA 2HIHA 1UP4A 1ABBA 1OQAA 1N6OA 4KIUA 2O8EA 3NFYA 5GIOE 1YZKA 2GM3A 1TLLA 1KEUA 3JQ8A 1L6IA 4OKSA 4UAJA 4CMIB 3O9MA 1N6KA 4DMFA 1S8OA 3RU2A 2I55A 4TX1A 4FFMA 4E3WA 4REMA 5GAJA 4CEIA 2PX5A 1GPKA 1TO2E 4UU8A 3W5UA 4CODB 5K99A 2QRLA 1NVXQ 3FZYA 4YJDA 3R2JA 1JB9A 2V58A 4MVCA 4BMYA 3PQDA 4XGNA 3W5SA 1JQLB 2V0NA 1J8VA 4QPPA 5DSTA 4IQFA 4A9AA 4MR7B 2ZTHA 2VJAA 3H3FA 3O26A 4UNIA 4NBKA 4CQLA 3TSWA 4DGQA 1Z8DA 3L6DA 4JODA 4JX9A 2MYUA 3CZ9A 3NKFA 1GLGA 1ECFA 2I66A 4MULA 1D1PA 2GAOA 1QHSA 4FFNA 5KX5A 4TKZA 5CXUA 1E5XA 1P91A 4W6ZA 2FGJA 3PVZA 4JSTA 3QFCA 1MRSA 2ON6A 2YZ7A 4GI5A 1MPXA 4ZCIA 1H9CA 1ATIA 2PK3A 2CE7A 3DPSA 3FI0A 4ZOLA 4Q3EA 1JEQA 3R5KA 4C30A 3EIWA 3GV0A 4L16A 4DM7A 2ZIVB 5L3SA 1PL8A 1N2GA 4G97A 4GR5A 2ZR9A 1PQPA 5BW6B 3G7UA 4MV1A 5EQTA 5CFMA 1A0OA 4LCEA 2R8RA 3GUZA 4S2EA 5DLEA 3WTCA 3ELDA 3TLBA 4DM4A 5JQGF 1GPH1 1EFVB 1AQJA 4OK6A 1CQJA 4QARA 2VK2A 3IOEA 5JBIA 1OYVA 3DMRA 5LA6A 3BJEA 4QOJA 3NLLA 4ZMBA 5EKSA 5IKEA 1YQTA 2ZWMA 3QBVA 4YV7A 3VBCA 4F96A 5KPDA 4YXWD 3GDOA 4RMJA 4AM8A 3KQPA 4P4SA 4JJZA 3S1SA 1QIKA 1G2PA 2AXEA 3JR3A 3VC2A 2GZHA 2JDID 4F7WA 4K3UA 4RSRA 3RM3A 1I2AA 3VYSB 4YT8A 3A1CA 1F6WA 1R0KA 2UUAB 4QYIA 1YB5A 2MSEB 3ENVA 5DBEX 2GPJA 3NTXA 2M98A 3OLXA 3AC0A 3AFNA 3L07A 3WBJA 4LJ8A 3VDXA 3O8QB 4XGQA 1W29A 4O02B 3U4QA 1HBJA 1UIMA 2C95A 2NX2A 3F49S 4KKXB 1RHUA 3KUCA 4YRPA 3WHPA 3ZJ4A 5AW0A 4W9MC 3E9QA 4TWAA 4BRWA 1B3RA 1XCLA 3L49A 3LUPA 3ORRA 2IYRA 1YIOA 4URFA 2OYCA 4KFTA 4P3XA 2VUUA 1QK3A 4P5PA 5AJVB 4EA7A 2FK7A 1KSHA 3KZ1E 1G16A 2J5QA 2BKEA 3KSUA 4IP0A 3TW0A 3H86A 3S70A 1NUHA 4RL4A 1L9XA 2QORA 3M6MD 3NBFA 4I99A 4FWBA 2FUKA 2WWXA 3NUGA 4Q4DA 2QA5A 3CBGA 2EFCB 3JQFA 4YRLA 3M8KA 4JLJA 2NADA 4F45A 3Q72A 1M33A 1C80A 3O2NA 4M6WA 5HG0A 3P2EA 4O4JB 3WTBA 4Y8VA 3W6OA 2CSXA 4EF6A 2WA2A 2VLIA 1GY8A 3ZKWA 2BEWA 4LE2A 4J9UE 3TIIA 1Z5VA 5IDWA 3UMMA 1M66A 2VC2B 4ICIA 4DVGA 5LZ9A 4QU5A 1HC7A 2QE7D 3PDUA 2P40A 3N28A 3VH4A 4LDZA 5ALMA 1T6YA 4AJ4A 2ZRIA 1FQOA 3FX2A 4RZ3A 2IYTA 3FUTA 4LJ6A 1V3TA 1GV1A 3CQ9A 3D0QA 1U2PA 2FH5B 4BN0A 5EJEA 2KLBA 3EVNA 3H87A 2IODA 1REQB 3R8XA 5NULA 4LX0A 2I67A 3QKTA 5TPWA 3M81A 1MTZA 3DTTA 3EOZA 3HKCA 5TGZA 1VPWA 2ZIZA 3O47A 4Z53A 3WK9A 4IZOA 2ZATA 1NUUA 4ECEA 4AI6A 3QPBA 5DCWA 3H83A 2IYLD 2JFVA 1JIJA 2O48X 2ZIEA 3L8ZA 2Z9BA 2KPOA 1IN7A 1C81A 4YRTA 5LDHA 4TLLB 5TVGA 4WZZA 4RCYA 1S02A 5J1TB 2I8CA 5K8CA 1SU8A 2YIVX 2PZ8A 3F47A 2G6TA 1XLTA 4GSYA 5EMMA 3CSDA 3MRVA 1J8QA 4Q7LA 3S2IA 1HE8B 2JL1A 1DE0A 1I5OA 1FNDA 1RC8A 3UYKA 1U9CA 3PD1A 1OD6A 3R3XA 1W1WA 2ZEJA 4CEHB 1OH7A 1GTJ1 2JC3A 1DRVA 3EFOB 3IBGA 1BTOA 4XFKA 1DCMA 1RLTA 4FR0A 2QL5A 1T5BA 2X6TA 2AYYA 3RB8A 3ET4A 2AI2A 3KETA 2V59A 2WWYA 4JYAB 1EFCA 1IHOA 1W19A 1K97A 2Y67A 3FWKA 2RHDA 3PD7A 5JQGB 4URWR 1PU2A 5ED0A 1LVGA 1QU3A 1GT91 2V7GA 3OIYA 2OCXA 3D6MA 1J7JA 3KLPX 4G09A 2ZVPX 3D7KA 3KHKA 3PGMA 4L8WB 5IDQA 3HN7A 3THXB 4JI0B 1SKYE 1CJUC 1R15A 2W2OA 3JQ9C 2BGIA 3EULA 3O4FA 1UDAA 3GYGA 4OVKA 4DBVO 4LRSB 3L0BA 2X15A 1L4EA 1Y9ZA 4TT3A 5F7ZA 5J2UA 2Z3WA 3RS5A 5FPSA 2ZZKA 1Y80A 3DKKA 4RFVA 1CJVC 2XNKA 2Q8NA 5EQDA 3GPIA 3NWPA 2ENWA 3Q2IA 3GVXA 3KU4A 5IM4A 3QI7A 3QEOA 3O83A 8OHMA 3K70B 3LGSA 5BQ5A 3RIYA 5E6RA 1R10A 1YQUA 3BA6A 3W1VA 5K8UA 2IIBA 5AMXA 1Z37A 3GXBA 4BNGA 2BGNA 5EFZA 3EUEA 2WSSD 3SIPA 4QDOA 4HNUA 5KOHA 3FMOB 3A2MA 3H1TA 4JNKA 4V39A 4Y67A 3VYVA 3HACA 4IHJF 4ARVA 1KDOA 1USGA 5TQ2A 5BP7A 2A5DA 4GWKA 4HSGA 2OCIA 3OMWA 4NJOA 1LRKA 3RC7A 4JI1B 4QRIA 5EJ2A 1Q20A 4B5KA 2I6QA 2OEPA 1B43A 1NW6A 1O4WA 5H80A 4YUWA 2HAEA 1Q1BA 4XYLA 1DEXA 2QD2A 3QF4A 3A14A 4X7RA 2XCLA 3FSJX 4DG9A 3ZTWA 4Y1FA 1JQEA 3THYA 2FFBA 3IJPA 4KUGA 2YL2A 1OA1A 1TFUA 2P7IA 4FMDF 1CVIA 3HJCA 4CKZA 3P2IA 4F9GA 5KJEA 4ID9A 4C2BA 3C3EA 4AP9A 3ZLTA 5IFLA 4U6SA 4ZVUA 3GO4A 5J5AA 3URMA 2GT1A 5CDHA 4LHEA 3KNZA 3OZGA 3S2FA 1YVDA 2VI5A 3AZQA 4MVJP 5HP4A 5CNKA 4QGSA 1PG0A 4HVCA 3HNPA 4RS4A 2UZ4A 2YHIB 1IM5A 3AR5A 4RSMA 1N2OA 5I4CA 4NNPA 3FGNA 1SOWA 5F4ZA 4AY4A 1VL0A 4HDAA 5I7FA 5KQLA 3NP7A 3RREA 2PUVA 3TCNA 2A5YB 1ULUA 4LZPA 4UUAA 5JPDA 3TCXB 4MVJM 4ERNA 1SQ6A 3OZIA 4EO4A 4JYZA 1NXXA 4RW0A 1EVKA 3M4XA 4J3FA 3ZHRA 3KQUA 2UYGA 2AKYA 2FMIA 4GMDA 2JZCA 3ZE8A 3NHPA 4P4LA 1PW7A 1MB2A 4OEHA 3EEYA 3USCS 4KXYA 1U7HA 1Y37A 5K9ZA 1QM5A 1LKZA 2HWWA 4XUCA 3NHSA 4GZ3A 5FUXA 3UW3A 3RK4A 821PA 1USVA 2JIPA 1UXIA 1VPVA 1PNVA 2HIGA 3BCUA 1WX1A 3OE7A 4RF4A 4CJXA 3K70C 2JBHA 1XEWY 3MS4A 4L57A 3JQAA 1E1DA 3EMDA 4N3AA 3CZRA 4BO9A 4YJHA 2I2BA 3CUUA 4S3MA 1I36A 2ZS7A 3TVYA 1NNI1 3QY0A 2QX7A 2RFLA 2QNRA 3ANXA 3H7AA 1PV1A 4O2AA 3U7EB 3UMGA 1R4NB 4GMHA 1E0DA 2HADA 4P80A 3TTYA 3V7NA 3WRYA 5ITSA 5JY1A 3V4ZA 2O4CA 3FNBA 4R41A 1G3QA 1IBKB 4MEAA 1AF7A 4YFVA 4ZI7A 3A6HA 1VYUA 3V2GA 1HE5A 2GN1A 3WC4A 4E32A 2Z30A 1SA0B 4HR7A 1US8A 2GRAA 4MV6A 1W2GA 1I3NA 4TLAA 3K70D 2ABWA 3QFFA 1YBMA 5FBQB 4ZO7A 3Q0EA 3CRRA 1Q1ZA 2YV5A 1R8XA 2FZEA 5L40A 2O1XA 3GP3A 1GPJA 1XX6A 3LY5A 4Q3KA 4XIIA 3FJYA 5IMSA 3V1LA 4U7DA 2IZOA 1RKXA 1O7JA 2L82A 2QKYA 1GUFA 1ZIOA 3SC2B 3MPUA 2MSCB 5AICA 2ZJ3A 2E4WA 2YXNA 3IAM1 3C8HA 5IZ4A 1HDOA 1XDUA 1VTKA 1YO6A 3AEQA 3H9CA 5JCJA 1M2KA 4ML3A 1HT1E 1GRQA 5CP8A 6PFKA 5ER9A 4DLZA 5B37A 1EVZA 4EA8A 4DDWA 2ZYSA 2YY7A 4TROA 5F77A 4LF9B 4DLYA 2CJWB 1XZBA 3SSNA 5E1OA 4IHJB 1YRHA 1HSZA 4PE5B 1DT3A 3GW8A 3DD5A 5CR9A 3C16C 4DRXA 2GBPA 1JGTA 4R68A 1GXSA 5HDBB 5AHKA 1S2IA 3I34X 4X41A 4PXYA 4PINA 4JYCA 4XJVA 4DUGA 3U16A 4PIMA 2PX6A 2F1HA 3L7JA 4FGWA 4IPTA 5AJWA 5JS2A 4V1CB 2JFWA 2WUGA 1JZQA 4BMPB 1ZK4A 3R6GA 3ITNA 3LCJA 2G9QA 2J5RA 2JAOA 1XA0A 3AF5A 1GZ5A 1E8NA 3Q3HA 4FMDB 3EXIA 4R8LA 3CSSA 5DASA 5LZ8A 3R7DA 4ESOA 5CG1A 3G0HA 4Q9DA 2YIMA 3MS2A 1A97A 2JAPA 2WR8A 2XA2A 4PX9A 2D5LA 4U0KA 4WTOA 1IJBA 4E09A 4NH4A 1YA8A 4YH1A 3A4TA 3W8RA 5MHTA 3ZDYB 4JV5B 5CT8A 2HY7A 2CCKA 2A9RA 1V45E 1UINA 3OE1A 2QIOA 2PKCA 3T5AA 3BMQB 5ALXA 5CXSA 3EAFA 4IX1A 1PBTA 1Z29A 1MC5A 3F1KA 4MV3A 3B13B 4UNQA 1MAUA 3KRTA 1LWNA 5DGXA 5GIPE 3RAGA 3E22B 3EQ6A 3U9LA 2OV2A 4TKMA 1I7NA 1F17A 1IBSA 1WMAA 2A3RA 1T36B 1FFHA 1ZVQA 4AYXA 5CFZA 2HHHB 4B7AA 2BF7A 2BKAA 4FOOA 3CCBA 1K3TA 5KQSA 3TGLA 3PRJA 5U4QA 4P86A 3KVYA 3KQHA 3BFPA 2YJ6A 4PC6A 2NZYA 4IUYA 1VZ3A 3TAXA 3D43A 5K0NA 4RADA 2R25B 4RH1A 3OHSX 1B6SA 1IIBA 4NPCA 1Z82A 2BLNA 4JYPA 5AESA 2FWNA 1KHTA 4M9RA 3VSBA 1CYDA 2GARA 4DLVA 2CV1A 2BM0A 2WHEA 3QK7A 1TD1A 1M73E 1L8XA 1PSZA 2DCUA 1XTSA 4OD0A 5I9MA 1IJKA 3LY9A 3LC7O 4MZXA 4R7TA 4BE7B 2X8LA 3IX7A 1TZCA 4L4SA 1QKKA 2OFPA 4P31A 3V2HA 2R6GA 1B0UA 4N54A 1VFPA 4M98A 4UTOA 2F3RA 1I2DA 5CBPA 2X1LA 3CLUD 4PFJA 4BJ3A 3IDZA 1B42A 5AH0A 3ITEA 3EZLA 4RCVA 3QE2A 1T3HA 4NU6A 2AN3A 1WV1A 1GGEA 1OYWA 1TA9A 1XMVA 2VNJA 4CQMD 1RAAA 1Z2NX 5EIHA 3TLAA 1MN6A 4EDFA 2EZ4A 1VE6A 2IGTA 1M1YE 4QJBA 2VCHA 2VCYA 3T3OA 4H0CA 1N75A 1T8WA 3PCTA 3Q41A 4AO6A 3H5NA 3GXOA 3EA0A 1N5LA 1QDEA 1W2HA 4IGFA 4L95C 3D0KA 4EX6A 3RC8A 3N05A 3LPDA 4YBZA 2HHCA 3VKWA 1WXFA 3GFSA 3LECA 4IUCS 3TX6A 2QJWA 3OZXA 4LY3A 3LD9A 2OAEA 3TOVA 2GN6A 3MMXA 1NAIA 1WB9A 2CXTA 1XA3A 1GPLA 4MGHA 3KVVA 4MR8A 1E9DA 2BF4A 4B4KA 1M1YA 1YZHA 4WMLA 1BS1A 4UD6A 3JAWA 1KS2A 3EVDA 4E12A 1FS4A 3T7RA 4KYUA 4M9QA 5D5QA 3U4GA 1NF8A 3ZXSA 2LGJA 3I12A 5JRJA 2GETA 5AM2A 1X9HA 2WFLB 3GWZA 3VJLA 5IXYA 1QQ6A 5GVRA 2FPRA 4XD2A 4C0HA 5FBHA 2J9YB 4DZTA 1M5UA 4H3HB 4IG9A 4F04A 2P2YA 4PPQA 3RFFA 1FRZA 4WK2B 5BN5B 4KO8A 2RKBA 3LWZA 2C99A 4OCZA 5ESXA 4XRRA 5H9WA 2GCGA 3ZCUA 4E14A 2R85A 2P4HX 3EEOA 3MWEA 4FLMA 3GMTA 1QNFA 3M6UA 4XQ0A 1Y8ZA 1SU4A 1WU7A 2ORIA 5KC9A 4OFBA 4QVIA 2FPWA 2AN1A 4QFMA 2PRJA 4A92A 3G88A 2F3SA 3VR4H 1JEJA 1FP2A 1OXUA 4PO9A 5A4JA 1HETA 2FUEA 4P93A 1G8GA 4NEGA 1L1QA 1E1LA 2FW0A 3ABRB 5CYOA 3ROTA 3VHQA 5C7YA 5KPJA 3DAPA 3S0JA 5LMCA 4CR8A 1FZTA 2FN4A 1F2UB 5BQOA 3LA8A 4TWIA 1S2GA 1V1MB 2A1UB 4KQ2A 4FC6A 2I8LA 4HNRA 4JQYA 4PGGA 4N6OA 3SHOA 1OLUA 3UB4A 5IT0A 1GKKA 4CM3A 2IS1A 2HJWA 4MWZA 1EQ2A 1W4RA 3CMCO 2QV7A 1NTRA 2Q5IA 4PLCA 3IV6A 5GWXA 5H59A 1RZRA 3GMDA 4MCJA 3KWFA 1ISIA 1E6MA 1FE8A 3FFTA 3D3QA 2W6IA 2FPIB 1QF6A 2HI0A 1YRBA 3DZGA 3H9UA 4HAVA 4UQOA 3QBTA 2IOYA 2V4ZA 3F96A 1X14A 4GVPA 4R9NA 4XIJA 4EEKA 1M34B 1YNOA 2ISQA 2J7KA 3DONA 2BKLA 4TMYA 4AQ7A 3AUUA 1EK0A 4OHBA 1P3DA 2X8JA 4UFPA 4C7KA 4QM7A 3LX6A 3MUNA 3VMMA 4K88A 1KY3A 4PZAA 4UJ5A 5AVXA 1KI4A 3FTCA 3RK1A 1HEUA 3VRHA 2WKRA 1U6KA 1FFYA 3BB4A 1CQPA 3K4PA 2HXSA 3EY4A 4GU5A 4YPOA 1T5SA 2Q9UA 1NN0A 2UZ3A 2FPMA 2R5WA 5IJZA 1VCOA 4UHJA 3M3PA 3GLVA 4OQNA 4RL6A 5AI8A 3W3AD 4F91B 1MVOA 4AUNA 5FI1B 4IRXA 5IVDA 2HU2A 2QPAA 4FHEA 3TNFA 1HOTA 1N3BA 2FHPA 2R8BA 3KKEA 1PWEA 1G8SA 4HQNA 3V4FA 4BX8A 6ABPA 3ENQA 4R3NA 1ZNZA 1AXRA 1HDRA 4E88A 2I6TA 2FN9A 2OXRA 4K81B 2JKYA 3BD9A 2G80A 4YMSA 1HH4A 2JI9A 4TKUA 2JH9A 3AVOA 1CLEA 4TMTA 3CR7A 3I6YA 4DV3B 4XDYA 3L0YA 2HIAA 4NVRA 5FX2A 1P31A 3G02A 2YH2A 3LXRA 4DLWA 2G6BA 1UC8A 2OCPA 3PYLA 1JFRA 1J2YA 1GL6A 3M34A 3I04A 2C5SA 3B8EA 3LQ2A 4FHZA 2M2IA 2OENG 4LN1A 1UPXA 1ZY2A 5CCDA 5BMOA 2N47A 3BWCA 3GLTA 1RAIA 2ZAGA 3OFVA 3OOHA 2BHTA 4GKBA 4J16A 5CYGA 1O0CA 4YRCA 3BA1A 4L75A 2V7VA 1IVYA 2QJRA 4RPLA 2B0JA 2VDQB 4FKZA 4RPJA 2IXEA 2OB2A 3ITKA 4AJ1A 3C15C 1YTUA 1H23A 4P9NA 1SM4A 4JC4A 4A2CA 5A0VA 4Q3DA 2CBXA 4Q00A 1DBQA 4CIXA 1J1ZA 1F0PA 1M7GA 2PBLA 2QM8A 3UUEA 1LDMA 2YFQA 4QJIA 1HURA 4QATA 3OQJA 4EL5A 2R1TB 2H2DA 3B8HA 3QUAA 4CHGA 2PUFA 5JMPA 1CB7A 3BIJA 3G8YA 4J1NA 3ZY6A 1QRSA 4OHMA 4KHPB 1OAAA 3PCRB 5H3CA 5BSGA 2OHXA 4ZEXA 1OU0A 2QDXA 5HQ3A 2QZ4A 4YPVA 2RBKA 3DXZA 3UK0A 4WY5A 1B8OA 3RSZA 1YL7A 3IEMA 2KB0A 3N74A 1PUJA 1BDMA 2VHEA 1SB8A 4S2UA 3WZ2A 3ZZUA 1I5RA 4BYMA 4LF4B 2PDAA 5CK4A 4TV8F 3M6LA 2O8NA 4EJ6A 2W2KA 3EGOA 1XU4A 2EDAA 2R1VA 3RRNA 1WMDA 2W6PA 1XKLA 2ECPA 3IR5A 1FVXA 1KY4A 5GJWC 4U9HS 3MB5A 1GR0A 5K3AA 3DBVO 4IOKA 3KZNA 5EHQA 3LWNA 1ZVJA 2KJQA 2QTFA 2R65A 5LMNB 1SXJE 1GKYA 1T1EA 4ROSA 4DHWA 2OORA 3W5BA 1W1IA 2HH9A 3QXCA 2Q4TA 1IG3A 1R4MB 4L9AA 2XNJA 3DKIA 4P5EA 1WQ3A 2WYOA 4JVNA 4JEIA 5ADWA 4AUMA 3TG8A 3LK6A 4UBIA 1PYDA 1XD2B 3P4YA 2XRFA 2DQKA 3EAQA 3T54A 4Z0PA 1P60A 3EXHC 3FH0A 3SJAA 1VI5A 4YIHA 3LF1A 2WJJA 5C5IA 4H6WA 4IMJB 3KPJA 4P3KA 3IXQA 7ADHA 1YE8A 2B4TO 2RHMA 1BYIA 1NC3A 2V6BA 3LFTA 3RGWS 5LMUB 1SXJA 2FJPA 2G9UA 3SJCA 1J8FA 2VYCA 4ZU3A 1GPAA 1XLUA 1YUBA 4JJKA 3RRJA 1I3LA 1MU0A 3AESA 4A03A 1YI0A 2RI6A 3P9RA 3LFHA 2Z2JA 1O87A 4MRRA 1GQOA 1JRLA 1ZD9A 5JOQA 3C8UA 3QF7A 2DEUA 2CN1A 3GMIA 2OB1A 4ZQBA 5KINB 5AW8A 3GD5A 2BGGA 3V6MA 1I80A 5JD4A 1Z5OA 5JATA 4KE6A 3VI4B 5KHAA 1NXTA 4PGAA 2IS2A 3M89A 4D8TA 3VR3D 4HG2A 5FL7D 1DIOB 3FFAA 5MFZA 4DADA 2PUCA 3DZ8A 1OPRA 3NJ8A 4FP9A 3HVKA 1OB2A 1TJYA 3A1VA 3AEUB 3F9CA 1E69A 1KVTA 2JFXA 3SMQA 4RIGA 1TAUA 1NW7A 3LRPA 1HSOA 5AUQA 4BO4A 4KQXA 1DSSG 3V32A 4H3VA 1ESMA 4WCVA 4R1NA 5G0WA 1SMKA 2HJ9A 5G1PA 5GY7A 2AG8A 2DJIA 1CUCA 4EPXA 5FTLA 4PLHA 5K3BA 5KYYB 3BAZA 1BCSB 4ZO8A 5ISMA 2G09A 4M8SA 3B48A 1UPCA 4NRDA 1ISRA 4RVUA 1VKRA 4G8CA 4IGKA 4TYYA 3W78A 4WINA 2VDMB 2NXWA 1ECGA 1FQJA 2HRCA 1O96B 2AXNA 3EXFA 1NR1A 3FPAA 1XDZA 5LQSA 5B30A 1NOIA 4W5QA 1D4FA 1CR6A 2V45A 3BMCB 1E4EB 5D85A 4DR3B 2Q7XA 4ZVOA 3HVUA 4NR0A 2ZWVA 4H08A 1V5EA 2Z2KA 1EWYA 4EB6B 4EI7A 4N01A 1TZKA 4EY4A 2DBRA 1K9VF 4GS5A 2ZTUA 2BFEA 1JDUA 2YQ5A 1N57A 3GHHA 4PEVA 2IYUA 2CNWD 3JD4A 3PNOA 1XKQA 2QM7A 2W0MA 3AHHA 1B7GO 1ZRHA 3BWDD 3SQMA 4IRUB 1QIEA 1IQUA 1JJBA 1LZKA 2QT0A 1J2JA 3KYIB 3HNRA 4EPTA 1IXYA 1UBFA 1WTAA 1OXVA 1NHWA 4OB8A 2E9SA 5AJYA 2OV6A 3ABZA 4BP1A 4AJJA 5JRZA 2PE5A 2G5PA 2XWJI 2PQ6A 4L02A 1G6KA 1QKIA 1A5SB 2QX4A 3AT1A 4TV8B 1ZC4A 1DTEA 1R6DA 1TZ2A 1DFGA 2ETVA 2XUHA 3A58B 3HMKA 3B1FA 3SAJA 3WLEA 3W3AH 4DSTA 1HXHA 1Z7BA 2M6SA 1I3CA 2PH5A 4ZVKA 2PWPA 4DWOA 5KNBH 2XQJA 2C2YA 1V26A 2C9YA 2P4QA 3X2SA 4UVDA 4M49A 4R1QA 2DR2A 1YFKA 5CXQA 1NBHA 2COUA 4HWKA 3VO2A 4WBXC 2C2OA 2D59A 4DLLA 4GEKA 4R40A 3F9IA 2PT5A 1VA5A 2M1XA 4BMXA 3V9PA 3G2PA 3HU5A 2BGWA 2QVGA 3GLGE 1V6AA 2GUWA 3GLFB 2XX3A 1E3JA 2DLCX 3ROPA 4Q6BA 3H2IA 1VL2A 2B4AA 2PGNA 3Q3CA 1E18A 4FJ2A 2B9VA 1KE2A 1TZMA 3RRYA 3I9JA 4M55A 3SLKA 4EECA 4BFXA 1Z62A 1DAKA 3GBVA 5AFSA 2A0WA 2UYCA 1JHVA 2P78A 3ZG6A 4NIMA 4M0FA 4DSOA 4JZYA 4BE9A 1D1SA 4UHBA 3VNBA 2GLUA 1NF2A 2YNMD 4B2PA 1YR3A 3LX8A 5CX4A 4C6HA 4TS1A 5BW5A 8ABPA 5HOQA 1NBME 1ZCAA 3WWOA 3MINB 4F84A 5KEIA 2BSAA 4RD3A 2IUFA 4BY9E 1QANA 1U1EA 1VM6A 4BWVA 3P4XA 1DAIA 3OJ0A 3PDWA 3AZOA 4UCQA 3ZNNA 4DGSA 3IHLA 4EITA 4NV0A 4C2UA 2Z4TA 2QR2A 5EJMA 2EQ5A 1I0LA 2EOAA 3MNFA 2OCLA 3OO1A 1IOVA 2FDCA 4E07A 1U8FO 1VYTA 1AF4A 3S2EA 1TQ4A 3U31A 3QKSB 1BDHA 3I53A 1HQKA 3MLEA 1QE3A 3TBFA 4NZPA 4TVOA 2QS9A 5G2OA 3NVAA 2WLSA 3GDWA 3V80A 4OK3A 5DTIA 2C1ZA 3N07A 4FYXA 5FV4A 3S2YA 2BRUC 2Q21A 3HUDA 1IXRC 1NBMA 1P4JA 1E2HA 4IJVA 1MC1A 1YB4A 2HCFA 4J43A 4GPAA 4BC0A 1K6JA 1RVDA 1GRCA 2HRQA 3R44A 1PJBA 5TXGA 3ZIDA 4OI4A 1GYRA 4Q24A 3EIQA 3RRBA 2NNLD 2ATIA 3ZNOA 4B8YA 1RPAA 4YUYA 1UEIA 1CZHA 5JASA 2LPMA 3RWBA 2CHUA 3RRFA 2P5UA 4ZO9A 3W9UA 1UKEA 2XNDA 2FVXA 2R00A 1RQRA 2VEOA 3E15A 3E8XA 3NU1A 4XCXA 5BO5A 2Q1UA 1NU8A 2IZ6A 3WOVA 2JLVA 3COYA 1ZM3A 2XE4A 4L73A 1CF9A 4IV5A 3VYWA 3A4VA 3EK2A 2AD5A 3H5TA 4IDCA 3WKAA 2AFHB 2XCUA 2JD0A 2R60A 2XBUA 3NYRA 3KEQA 3HR7A 3CGWA 4LRYA 1ZUNA 1GNQA 3JVDA 4NP6A 2QTZA 5DBIA 1YAJA 1DCTA 5B6PA 1GPNA 2G07A 2JARA 3KOOA 2VJKA 2DRIA 1BWQA 2YFKA 1T5LA 1TUIA 4GZ6A 1J90A 3ROXA 1U9ZA 4V03A 3MXOA 3S5UA 3U4DA 1FEZA 3GVCA 2Q0SA 4Q7MB 3F90A 4UBOA 2ATXA 4V3BA 3U7QA 2GK6A 2Q6OA 3NRCA 4QC2A 1PQWA 3ENZA 2RHWA 2XIJA 1VQ1A 3P9XA 4EYQA 3WAKA 1MJFA 4ZIRA 4L15A 3MHTA 1KO8A 2WKPA 3OC6A 1J5XA 5FYDA 4REOA 4FFOA 1KKMA 1G3UA 5EE0A 1JSCA 2FOIA 2QRPA 4GIBA 1SOMA 3O4IA 3HDHA 2W2MA 1NXQA 4UU0A 4MAMA 5I7EA 4AXXA 1T2CA 4LJSA 2JFFA 2QVXX 3DEAA 3F5SA 4HB2A 1N6RA 2J3KA 3IDQA 3D6JA 1DRJA 4LXTA 1SIUA 4M89A 2ZM5A 2BFAA 2NAPA 2W6CX 4C06A 3N6RA 2J0VA 2TMDA 2XGJA 5AKHA 1LBQA 1ZISA 2L0XA 4UU7A 3TQRA 2RCNA 4BVGA 4DDHA 1RPTA 1U9IA 1D9XA 1UIRA 4B47A 1GUYA 5KJ6A 2FYTA 2OO5C 2ZSJA 1RWWA 4DVJA 2R8OA 1W7AA 1F8GA 4I1RA 2HA6A 1UBOS 4LYJA 3WQQA 4ENRA 3PYMA 1GTRA 1MVLA 1A8UA 1EDZA 5JZ9A 1ITZA 4JBHA 2I9PA 4CMCA 4F2PA 2YYAA 4W7IA 2RGBA 3NNDA 3DFZA 3G2QA 2CD9A 1MB0A 1Q21A 3MC1A 2QLMA 4FD3A 1G21B 5MGNA 1L7RA 4MV9A 1JLLA 2QTLA 4IVPA 4Y9UA 2DUNA 3DXYA 5ALDA 2HM7A 3UK7A 3VAYA 3CNLA 1ISSA 1MW9X 3E27A 3SZMA 2OHIA 2SNIE 2YBEA 2IBMA 1JXQA 3EDMA 4WLVA 1D6MA 1F2DA 4YLEA 1VP9A 1ZEMA 1T2VA 3TRHA 1R00A 1BDBA 4WZAA 3UWDA 2DC1A 3PGLA 5KC8A 1ODKA 1Z88A 2QLFA 2OQIA 4KIJA 4QPZA 4X93A 4YJGB 2A9JA 4QUKA 5HJ2A 3V55A 1QX3A 4PC2A 4S04A 5KJFA 2I4NA 3GIDA 5C8YA 3SX2A 5JYCA 4FNGA 2CL6X 4A2WA 1M2WA 4JWTA 4RPHA 3NVKI 1L7AA 4OYHA 4HL6A 4B83A 2OXCA 3FZEA 1O57A 3PRHA 2J9RA 1OWOA 1SIWA 3JYPA 5JARA 3TPCA 1FLVA 5INTA 2FOXA 3GEMA 1XCPA 3FBTA 3DHWC 4DE5A 4GZMA 2XNSA 2VZ8A 4K9PA 1DBRA 3CGGA 2JGFA 1UJNA 4KFSA 3AIKA 4MKXA 5KREA 4Q19A 1E1NA 1JFVA 1F8XA 3Q1LA 5K03A 3THYB 4L3WA 3T6KA 3CUVA 2G28A 1JLMA 4QHSA 5T8KA 1DV2A 1ZR2A 3HA2A 1CUFA 4RSGA 1SB9A 4Z8XA 4E6EA 3U6KA 1JHZA 3T3PB 3TPZA 4YAGA 1SKMA 1YZTA 4LGMA 1ZU4A 3E9CA 4I19A 3U3ZA 1TYEB 1NE2A 3LXUX 3OOJA 1O1YA 5FFMA 3IT1A 1P1CA 4XOUA 5CDUA 1JG3A 4FHCA 4F6RB 3SOPA 2YWCA 4G8JA 2Y68A 5T6BA 1E2MA 1O3YA 1W73A 1RJFA 3DMHA 3T3GA 4A4DA 4EG4A 3V4LA 5D01A 3OFNA 3NBMA 1E1QD 1PF7E 1O5IA 2ZUDA 3IAEA 1YH3A 3JD2A 4AG5A 2Z8XA 4EY5A 3HFJA 3NOXA 5EHGA 1I14A 4YAIA 1NNSA 1DWUA 3PEEA 1GPMA 2I29A 3PITA 1XKXA 4IH1A 4XA8A 4RULA 2P0EA 2DX7A 2VP4A 3QPUA 3T3MB 4DMKA 4QPDA 4I7EA 4X1OA 1DDGA 3EHEA 4Y2UA 1YCFA 3UHJA 4E2XA 1JG7A 4UUBA 4YASA 2HCRA 3FNRA 3D0RA 1GG9A 1CJTC 4YO7A 4HDKB 3BIOA 2MJLA