4WGGA

Structure of the ternary complex of a zingiber officinale double bond reductase in complex with nadp and coniferyl aldehyde
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
352
structure length
352
Chain Sequence
VVVVNKQVLLKHFIPEGAPKETDMELVTTGTIRLRVPEGSNAVLLKNLYLSCDPYMRMRMTKHEEASYVDDFVPGAPITGFGVGKVVDSSHPDFKTGDYVWGLIGWEEYSLITKPQGLFKIHHTEIPLSYYTGILGMVGLTAYVGFYDICSPKKGERVFVSAAAGAVGQIVGQFAKQFGCYVVGSAGSDEKVNLLKTKFGFDEAFNYKKEPDLTKALKRYFPEGIDIYFENVGGPMLEAVLHNMRIKGRIAACGMISQYNLEKPEGVHNLFLIVGKRIRLEGFLVFDHYGSYPEFEEKVVQLIKEEKIKYLEDIVEGLENAPAALIGLFEGRNVGKQVVVVSREKGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Double Bond Reductase
publication title STRUCTURE OF ZINGIBER OFFICINALE DOUBLE BOND REDUCTASE
rcsb
source organism Zingiber officinale
total genus 111
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wggA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4wggA01
3DDNA 3FI9A 3FNHA 1OC4A 3JQFC 4IINA 1TI7A 3RUIA 5T67A 2ILTA 3RUCA 1N9GB 1WPQA 2YDYA 3F9IA 4IUYA 4W82A 1E1KA 5L40A 4MIOA 4GBJA 4CM4B 4WLFA 5CDTA 5IAAA 1SCUA 4HBGA 3C8MA 2PA3A 1LRJA 1GPDG 1T2EA 1BMDA 1HE5A 3PZBA 4L74A 2WYUA 2IYOA 4CJXA 3PP8A 3GGPA 5ICSA 2NNLD 4MVJD 4J16A 3JQEA 3PDUA 1KEVA 4Q3EA 4LCJA 3ICCA 3UICA 2NLOA 4CR6A 2PKQO 3A4VA 3GN2A 3OEWA 3GNQA 1VSVA 1MXHA 2NQ8A 5TJ9A 4K26A 3DBRA 3VOSA 4LN1A 3WGQA 1K3TA 4DPLA 2C2YA 1IUKA 1PJQA 2GCGA 4J9VA 4CLRA 3KSZO 2QZ9A 3JQ6A 3RCBA 1GYQA 5IDYA 1H2HA 5DCYA 5I7FA 4YWJA 1WWKA 1U8XX 5T64A 4DL9A 3DONA 2IRWA 2R6JA 2G17A 4BNLA 1E3WA 1E3EA 4EUFA 3ONEA 4NNJA 3M1LA 5K0ZA 1ZJZA 3JYPA 2JKVA 1KOLA 1PL6A 4ZGWA 5FI5A 1ZMTA 4XR4A 3PWSA 1E3SA 1JVSA 1GYRA 2QRKA 4BNHA 3MJTA 3T4EA 3H5AA 2VYVD 3OJFA 5L3ZA 1M76A 2D59A 3KYDB 4GWKA 1R6DA 1AHIA 3NX4A 2OFPA 4J1TA 1EFLA 3KB6A 3F1LA 2R00C 2NVUB 4IDDA 1YJQA 3GG9A 4XYGA 1GL3A 2JFGA 1TA4A 3PGXA 2Z95A 1LRLA 4OIMA 1KERA 4LMRA 2X86A 2VHWA 2GRAA 3BMQA 4ZQFA 1GPJA 1X0XA 3PWZA 5KIAA 4GWGA 2OHXA 3EVTA 2HJRA 2VOEA 3X2EA 1TLTA 3PJEA 3JQ7B 2J3HA 3H7AA 2P9GA 3ZWVA 1P1JA 5KNLA 3RUHA 4WNIA 3ANMA 1DFIA 3CEAA 1FDSA 4ZJUA 3ZGYA 3PHIA 2YHIB 1QYXA 4M89A 2WM3A 3VC7A 4K6CA 2I66A 3O4RA 4E4YA 1C0LA 5I8WA 3F46A 4DGSA 4DQVA 4Z9FA 1HTBA 3VH2A 3VTZA 2IE0A 4PG8A 1SAYA 3R1IA 4JXKA 2AG5A 4YQYA 3NT2A 1DDOA 1P77A 4B3IA 1RM0A 3VH4A 1HDOA 3HADA 3JCZA 4UUNA 5COQA 3UFXA 1D8AA 5B37A 3BAZA 1DSSG 1C1XA 2C07A 3EZLA 2DBVO 2UYYA 2CF5A 3LYLA 4MVJM 1UZLA 1GCUA 4LW8A 1SO8A 1ZSYA 4XJSA 1BRMA 2Q2WA 4DYDA 3AI3A 1K2WA 1T26A 2W2KB 1Q0LA 3BIOA 4JN6B 4ZN6A 5CFZA 1I3NA 2POQX 3JQAA 3QP9A 1LXCA 2VNSA 5A05A 5BSGA 4J49A 3QIVA 4Z9XA 3OJEA 4FJ1A 3RJ9A 2B5VA 1T2AA 2HK7A 2PTGA 3SEFA 2NACA 2Y0CA 3JYNA 3GT0A 1BDMA 1O9BA 2JD0A 3QVOA 3RC2A 4P38A 4HFMA 2GNAA 2DUWA 5IN5A 5HTOA 1JLLA 1RJWA 3JV7A 4XR9A 5IZ4A 1IPFA 3PJDA 1LDGA 4C4OA 2OP0A 2V6FA 3JQ8A 1ADGA 1PS9A 2VZ8A 1LUAA 3DZGA 1FXSA 1UZNA 1U8FO 1IOLA 3MOGA 1M2WA 5G4KB 4BNNA 1I2BA 2IXBA 4JK3A 4BV8A 1UXIA 1FK8A 1P0CA 4AJLA 4ZVVA 1HE4A 1JVBA 3HB4X 4CR8A 4D42A 3ZWBA 2RIRA 3WNQA 2C54A 3QWAA 4AJOA 3GF4A 1X1TA 2O7SA 3RQSA 1C1DA 4E32A 3CKYA 4I9HA 1ZK3A 3WLEA 5G0TA 3S2FA 3AM5A 4DPKA 5EL0A 5IZCC 3SVTA 2EJVA 3ITKA 4K1LA 4BNYA 3AW9A 1N7GA 3KBOA 4J6FA 2X23A 5TRTA 1YJ8A 2OZPA 4Q39A 1LC0A 1NFFA 1PGQA 2HKIA 5I7VA 4RVUA 5JFOA 3CTMA 1IZ0A 1PGJA 4ALLA 1Y5RA 1L7DA 2HMSA 3BTVA 3DC2A 4GH5A 3UAGA 5C7LO 4E13A 1FJHA 3C1AA 1ZK2A 1DHRA 1PJ2A 1E7WA 2JAHA 2PH5A 2CDCA 2R00A 3HZZA 5A5FA 1Y8RB 2IXAA 1CQIA 4E5NA 3KVOA 4NG5A 4GMFA 1UXGA 2FPPA 1FMCA 1GV1A 3V8BA 5CDUA 2BGLA 3O9ZA 4KQXA 5IDQA 5ENVA 4RZIA 5COAA 1WDLA 3GUYA 4BO3A 5EQDA 4WLOA 2JHFA 5A3VA 4GLOA 4E2XA 1K6JA 4X54A 5A4DA 1DAOA 3WFJA 4B8ZA 5U4QA 3BMNB 1PSDA 1VSUA 3K2EA 4O59O 3ZHZA 2XAAA 5DN9A 2FHSA 3D3WB 3JD0A 3L4SO 4DVJA 2GO1A 2X9NA 4Z0PA 3OA0A 3UCXA 2Q1WA 2W98A 3EY4A 3NAQA 3HDQA 3ZV3A 2ET6A 4JJGA 2VHZA 3E9NA 3AUAA 3QWBA 5F5NA 3D5QA 4DC0A 4B7CA 3KTDA 2UV8A 3D64A 1NQ5A 5C7OO 3DAPA 2JCXA 3N58A 5KOIA 3ON5A 1ZSNA 3ZWYA 3TWOA 3H3JA 1V6AA 4JNKA 3DQPA 3PHGA 1B2LA 4AL4A 3TRIA 1XKQA 3PYMA 1EBFA 2PK3A 2X22A 4YJHB 5G0WA 2D0IA 4IBOA 1P31A 4GVXA 1JN0A 3ETDA 2WEKA 1V35A 4WCFC 1NPYA 4IGEA 1I10A 4AG3A 4DIOA 5JAMA 2E37A 5GZ6A 2B37A 3HN7A 3IIEA 4OH1A 4NMHA 4XQGA 3ROQA 3LLVA 1GAEO 3W6ZA 4RVDA 3HG7A 1UXJA 1EUDA 2ZYAA 1U3TA 5BT9A 3CE6A 5TSDA 4CM1A 2I67A 1Z75A 1NP3A 1ZSVA 2QYTA 3LT2A 1R0KA 4TZTA 4A27A 2VUUA 2P9CA 2BFPA 1PZGA 2X0IA 3OIFA 4XWYA 3ZWMA 1HXHA 3AU9A 1LU9A 2ZTMA 4J0EA 3RBZA 3S2IA 4CMHA 2WYWA 3ONFA 1G0NA 3FPLA 3PDJA 2EHDA 5JAQA 1J4AA 3OIGA 4BO1A 4YPOA 1OAAA 3UKOA 1SEPA 3LQFA 3VPGA 2Y05A 5MGBA 3SC6A 4J4HA 1I36A 1J6UA 4RGBA 5JY1A 4MVJP 2X6TA 1R37A 1HT0A 1E3LA 2Y0DA 3WQSB 1ADBA 4B4WA 5CPBA 4YAGA 4NI5A 3PQEA 3HSKA 1M66A 1E7RA 1QMGA 4GLLA 2A35A 4NH4A 3DBHB 1NHGA 1E5LA 1WAMA 2AW5A 1A7AA 1BXKA 3DBHA 2Y1EA 1Q7CA 4WLVA 3RFXA 3F47A 2PZMA 3NV9A 1B8UA 5F5LA 1PJ4A 2FP4A 5JMPA 2PZKA 1U9JA 3FTNA 1EQ2A 3GFBA 2HRZA 3ENNA 1ZK1A 3U9LA 4QUKA 4O1MA 3ZU5A 2AG8A 5T8KA 2TMDA 1J5PA 3AM3A 3E48A 3RFVA 3LC1O 1N8KA 1CF2O 2D5CA 1DLIA 4PLPA 4Q9NA 4WKGA 1PZHA 1TT7A 4IJVA 4WEOA 3W4IA 3ONDA 4PGFA 4J1NA 4DBZA 2DQ4A 1JAYA 1NR7A 5K1SA 4RLHA 5JMWA 4J2HA 3FF4A 4D45A 2YFHA 2RCYA 1HKUA 1NAHA 3Q1LA 5IG2A 1RPNA 2J3IA 4L9RA 1MGOA 1OBFO 3AJRA 4BQRA 1LLDA 1D7OA 5TQVA 2VHYA 3L4BA 3V2UA 1ZMOA 2VZ0A 4E3ZA 1YDWA 2QIOA 4MOWA 4PN3A 2B5WA 1BGVA 3IQDB 4GVLA 4EUEA 2VRBA 2YQ5A 3OMLA 1V3UA 4Z9YA 4MP8A 5B4VA 1T24A 2X9VA 4BO5A 3P7MA 4CQMB 5FWNA 3F6YA 2I76A 1GADO 3G17A 3GK3A 5TT0A 4DPMA 3G1UA 1ZEJA 8ADHA 4AJHA 4TROA 3OF2A 1AN9A 3GZNB 2UUOA 3S8MA 4B3HA 3ZHBA 2OL4A 4J9UE 4ZHSA 4JIGA 3KXDA 3GQVA 3PTZA 3Q9UA 3MJVA 4OKIA 4QO8A 4RPLA 5JDCC 2PNFA 2VWHA 4P4LA 3M6IA 2SCUA 3NT5A 1NYTA 1Y7TA 2WE7A 1JQBA 4ALNA 2Y93A 4D41A 2X0RA 2C7GA 2GSDA 1CYDA 2PD3A 1C0KA 3GLQA 4ND4A 3VVCA 3T7EA 3OQ1A 4WCFB 3INRA 4LRSB 4I5FA 3DFUA 4XYLA 2BFOA 2HSDA 4L73A 3HHPA 4ZICA 1J0XO 3E5MA 2PGLA 3VHRA 2H9IA 1HSZA 1E6UA 4Z0HO 1VKOA 4G65A 4FFNA 4I08A 3ZHYA 4YAKA 4N5LA 2O3RA 3HDHA 1QYWA 4HNHA 2D2IA 2HK9A 4YAJA 3NGXA 2PY6A 3CZRA 3DHNA 1X14A 3RUEA 4JQCA 5KVCA 1NVGA 1YRLA 2HRBA 3ADPA 1PTJA 4Y67A 5G2OA 3DBVO 1DJQA 1CIVA 1B15A 1ZXBA 2E4AA 4CM6A 4NDNE 1IHXA 1UAYA 2IZZA 3E03A 2HMWA 2IZ1A 3E82A 2GZ2A 2AE2A 1BXGA 2I6TA 3LVFO 4MKRA 4U0KA 3TDKA 1ENPA 5BNIA 1UP4A 3NRCA 4D0RA 4H16A 4BNKA 4FBGA 2PKQP 3I3OA 3TJRA 2QX7A 5U9CA 1ZIDA 5HS6A 3DZIA 1EE9A 4K6FA 5L45A 3BA1A 3I9NA 4CLOA 1VPDA 5COBA 3JYLA 4KUHA 4TQGA 4ZQEA 3PZRA 4QFCA 1SMKA 1UP7A 1DC4A 1MP0A 1Y9EA 1HDGO 4HFRA 4EBFA 3WJAA 4AJNA 3PLNA 3VZPA 1P9LA 3JYQA 3RKUA 3BHJA 2D4AA 3HUDA 3CMCO 1ULSA 1X15A 3GGOA 1N1GA 2P4HX 3SLKA 3CUKA 3MOIA 1I8TA 3ZW8A 2C82A 2VHXA 3NTQA 1QP8A 5ITVA 1ZEMA 4FJ2A 5F3RA 4FFMA 1GEGA 3NJ4A 4DYVA 4HNGA 5G0UA 4PZDA 3GVXA 2EEZA 3I6IA 5EN4A 1KC1A 2V6MA 2CUKA 4CUKA 1YQXA 4GAEA 3JQ9A 3MWEB 4HV4A 3ZU3A 5TIIA 2P5UA 4Q3AA 4PLHA 3U5TA 1HZZA 4L8VA 1HDCA 1DB3A 3VZSA 3GAZA 3PEFA 4FGWA 1DOHA 1QYDA 1R4MB 4JCOA 3ZNOA 1BWSA 3DMTC 4WE3A 4R1NA 3H9EO 4PG7A 4DQXA 2OMEA 1HSOA 4XYMA 4HFJA 5A06A 1Q7BA 4MKZA 3UN1A 3W4JA 3RROA 3L9WA 3ROPA 3AFNA 3PYXA 1OC2A 2DUUA 4NBUA 4D44A 2V6BA 4PIVA 4XKJA 3RU9A 4FN4A 1Z6ZA 2GN4A 3H6KA 3ITDA 3ZU4A 4BNUA 4CMAA 2BH9A 4BMVA 1NNUA 2QRLA 5ICMA 4RF3A 4RV9A 1LLCA 1FDVA 1YWGO 1NFQA 2DPGA 4IMRA 5A5EA 3SX2A 2EKQA 4J4TA 2EGHA 2HCTA 3H9JA 3AOEA 1UH5A 3ZU2A 1U3VA 2GN6A 4YJDA 1E5QA 4GX0A 5J23A 3WWYA 4B8WA 1VL0A 1A4IA 1ISIA 2YUTA 3W6UA 5KVVA 3P19A 4UUOA 4AVYA 4QX6A 5ILOA 2OGUA 4B3JA 5KVSA 1Q7GA 2NVWA 1NQOA 2ZTVA 2DU8A 4UULA 2BELA 4PZCA 1Q1NA 5KVQA 1XA0A 5G0SA 4LK3A 5JNLA 1LSUA 1EZ4A 4E33A 2QQ5A 5JXWA 4BHTA 1YE3A 4HP8A 2G1UA 2I3GA 3S2GA 3LSYA 1R15A 1QYCA 2FR0A 3GFGA 3DTYA 2C29D 2UAGA 1V3VA 2OUIA 4U7WA 3I9JA 4W9NC 1PGNA 1X7DA 3A9WA 3I23A 4IDAA 4N18A 1TT5B 1QRRA 3ZWNA 4IDFA 1NHWA 4OQZA 3T7CA 5IDXA 3VKUA 4NQZA 3AUSA 4KWIA 1U5AA 4KZPA 2BFMA 2C59A 2C2XA 4GX2A 5TC4A 3V1TC 2Y0EA 1N9GA 5L4SA 1YOVB 4CM4A 3V2GA 3QY9A 1I0ZA 5JPIA 1OOEA 1WZIA 4CV0A 1H6CA 5F1PA 1HLDA 3QVXA 4E5PA 3R3SA 5DBFA 2PV7A 3B70A 1M67A 1A9YA 4BO9A 3WIEA 2VT3A 4HX5A 4NFHA 2UUPA 2P5YA 4YRBA 1XEAA 1YXMA 5TGDA 3VDQA 3GDOA 4FR5A 1B26A 2JL1A 4PFJA 4ZQHA 1ZH8A 4D3SA 1O89A 4CMKA 4XD2A 1GR0A 3L07A 1F12A 1GFSA 1QKIA 4ZA2A 5T6BA 3D4NA 2NSDA 1X7GA 2NTVA 4J7UA 5DP2A 3IL2A 2EXXA 4U0JA 3TZCA 1NWHA 3PHLA 4CODB 2HO5A 4RQTA 4DLAA 4BKPA 4I5DA 4IJKA 3ZNPA 1GUZA 1E6EA 1O0SA 3PIDA 3GY0A 3UF0A 2DTDA 3ABIA 3O8QB 2AEJA 2WD8A 3W8EA 2P4QA 3BTSA 3NYWA 3RFTA 2HU2A 1YH3A 3FNEA 1A7KA 3FWNA 3OQBA 3SLGA 1GQYA 3LC2O 3U09A 1UDAA 3EMKA 3PFWO 2HAEA 2O7QA 4FGSA 5F21A 1DIGA 2BKAA 4NBVA 3V1UA 3S1LA 3KYDA 3OJ0A 3TSCA 5DDIP 1KYQA 1KVQA 2LDXA 2GR9A 2Q99A 2X8LA 2AEFA 4LVUA 4IGFA 5DULA 1RM3A 5DCWA 3EW7A 1T2CA 5I9NA 4XZ3A 4RPJA 1X7HA 2NVUA 1PR9A 3VAZA 1UJMA 1ENYA 1YB5A 1EUCA 3PLRA 3Q9NA 4XEHA 1UDBA 2FR8A 4N54A 5C7IO 2B35A 2ZQYA 1H9AA 3MJ4A 3AUTA 1ISGA 1MG0A 3QVTA 4BKRA 4CLEA 2ZYGA 2IDZA 1GUFA 4XQCA 1YL5A 4BKQA 5I9MA 4R16A 1N92A 3DZJA 3WGIA 4RLSA 1PGOA 4WASA 3PGJA 3I1JA 3JQ7A 5BNTA 1Q0QA 2RH4A 3KEOA 4M55A 3WBFA 3KV3O 3FBGA 5ADHA 2FRDA 1M75A 4MPDA 3ZNNA 1KC3A 2RAFA 3BMCB 3NTRA 4NR0A 4YAEA 2JFHA 4ZQGA 3VH1A 3A28A 5L9AA 2YHIA 3BMCA 4W6ZA 3L6OO 4XYBA 3AY7A 5CPFA 4UUMA 3SJ7A 4AJ1A 1VJ1A 5CEEA 1ISFA 4BQPA 4EZBA 3I9LA 5EMHA 4GSKA 5CAEA 3EUWA 2EP5A 2C0CA 1JA9A 4WLEA 3IC5A 3RU7A 4XDZA 1XG5A 4DMMA 1ZKMA 4TRJA 5F1KA 5T57A 1B16A 2VUSA 4R3WA 4HKTA 5BSFA 3WNVA 3FR7A 1O95A 2H1SA 3WSWA 4YR9A 2IODA 4PLFA 4NJOA 5IFLA 4ZRNA 4RVSA 4BMNA 1WMAA 3G49A 1ZUD1 4F46A 3R0IA 5JCJD 1LSJA 1AHHA 3DMYA 3F5SA 3NUGA 3SBOA 3GH3A 5L7YA 2W2KA 5FYDA 5JCXA 1VJ0A 1XWFA 4BO6A 3C24A 2EF1A 3JQFA 4IXTA 1BSVA 3BYZA 2AQKA 4YACA 3H4VA 3QW2A 1EDOA 4CUJA 4XRRA 3WIDA 7MDHA 4QQRA 4RZHA 1NVTA 3A14A 4JLWA 3ZH2A 3WS7A 1IY8A 1EBUA 5HBRA 1ZCJA 4ESOA 4PVDA 4C7JA 1U4SA 3RBVA 1R0SA 2PZJA 3G79A 1LA2A 1H6BA 4EDFA 3VPXA 5HM8A 4MVJH 3OIDA 3UHAA 3A06A 2X5KO 4GGOA 2OP1A 4UVDA 2Q4EA 1EVZA 5A03A 4YJGB 4RF5A 1H94A 1ARZA 1GV0A 2BFAA 3E5RA 3PYLA 4Y9DA 3OSUA 3UCEA 5FF9A 1XELA 1NTOA 1T25A 4CM9D 3DEYX 5BSHA 1CJCA 3CMMA 3WGOA 5H81A 4PZEA 3TFQA 5TT1A 4A5OA 3RC1A 1RM4A 1X0VA 1FDTA 5JE8A 1SEVA 1VJTA 5CHEA 3WMXA 2VCYA 2ZYDA 3I9KA 3IJRA 1SOVA 2RHCA 1ULUA 3OJLA 3RC7A 3CZMA 3ICPA 1NWCA 2FSVA 4PCVA 2NTJA 4BS9A 2ZCVA 1A5ZA 1F8FA 3W8DA 1BTOA 4GKVA 3NTOA 4M49A 4OSPA 4NHEA 3S2EA 4G2NA 3ZWCA 1CERA 1KBZA 4KUGA 4YB8A 1VM6A 3DFZA 1HF3A 3K8ZA 3MZ0A 4QFDA 4OOFA 1NXQA 1MC4A 1G6KA 2O3QA 4NU5A 5K6AC 5KJCA 4JP2A 3BTOA 4AJIA 1HLPA 2Q2QA 4NBTA 2HJSA 1MXFA 4FIZA 1H0KA 2YJZA 4BNIA 3D1LA 2CSUA 1Y8RA 4YVFA 2WD7B 1ZJYA 3VH3A 4A2CA 3AU8A 4I8XA 1XYGA 4B7XA 4WOJA 1P1IA 1PJ3A 2DTEA 1DPGA 5EERA 1XDWA 1MG5A 4IJWA 5B4UA 4OXYA 4J90A 2NTNA 4WGGA 3O03A 3BMNA 3U4HA 5HA5A 4G81A 4DIBA 2A94A 1E92A 3IOYA 3LT1A 4J3FA 3D3WA 3UUWA 2YV1A 1XIVA 4FFOA 1KEPA 3IUPA 3KYBA 1M6WA 3V2HA 1YBAA 1JTVA 2O3JA 1VL8A 3GPIA 1T1RA 4L0QA 1I32A 4MIYA 1P74A 2X5OA 4XX0A 2NUAA 3GHYA 1UR5A 2GUGA 1LDYA 5KJFA 4R5HA 2I65A 3GDFA 7ADHA 4DBVO 4JBHA 5THQA 3CXRA 2PGJA 3DO5A 2AQIA 3FRJA 1O8CA 3VVBA 1OFGA 1Y5MA 3Q0EA 3TFOA 4OQYA 3K30A 4CMIB 3LK7A 4IQ8A 5CDYA 5I7EA 1PL8A 3ZV4A 1I3KA 3DOOA 4ND5A 1YGYA 3FBTA 2EW8A 1H2BA 1YKFA 2BRUA 4PLCA 5DBGA 1EVJA 1LSOA 4XGKA 3ULKA 2I99A 4YJHA 1SPXA 1I3LA 2ZTLA 4RF4A 1R4NB 4UEJA 4BNWA 2W2LA 4J4BA 3E6AA 4H3VA 3ZWWA 2RHRA 2DLDA 4DRYA 1NM5A 4E6PA 1JW9B 1AGNA 4I9UA 4LGVA 5A02A 2BMAA 4CMBA 4D0SA 1C3VA 1X13A 1L1FA 3ZWAA 3GEDA 1QLJA 3ZV5A 2W90A 5HRUA 3KYCB 4Q3CA 2DBQA 3WFIA 3A1NA 1WNTA 1DIAA 1P44A 1XQ6A 2CF6A 1EVIA 4E12A 1AXGA 1H93A 1N1EA 1E7MA 1ENOA 2QRJA 1HRDA 4LSWA 3PFFA 3VZQA 1B14A 1V8BA 4A26A 4II3A 4KDFA 2O3SA 4JGBA 5ER9A 2GF2A 4EJMA 3IDSA 4CQLB 1B8VA 2RH8A 2V6GA 4U5QA 2CNBA 4XDYA 4D3FA 1M6HA 1DRWA 5G0VA 3I9OA 2QHXA 3V5NA 2YY7A 5TLSA 1DIBA 1Z7EA 1PZEA 3HFGA 4YCAA 4DMLA 2YV2A 3PPIA 4NZ9A 3WOHA 2IZ0A 4I5GA 1VLLA 2PD4A 2J3KA 2FY8A 4MDHA 4NJMB 1LNQA 2GN8A 2NV6A 3H2ZA 3QVWA 1YVEI 1P0FA 5CP8A 2EW2A 3NKLA 4WCDA 2X1HA 3I83A 2ZB4A 3KUXA 3QVSA 3RUAA 2V65A 3OECA 4JBGA 1EK6A 4JJFA 1Z73A 4I1IA 4YRDA 3K73O 4TMFA 4XB2A 5IZCA 4H15A 1RWBA 4R9RA 4UVEA 3NJ8A 5ILGA 4R4JA 2E6UX 3GVCA 5HS4A 5G4LA 1DEHA 4ZU3A 4B4OA 1Y1PA 1DC3A 3JTMA 5TS3A 4BB5A 4MVJF 5L4LA 4IQ0A 3ZW9A 4L4RA 1KVUA 4F45A 3OETA 3RC9A 1MB4A 3HJAA 1UUFA 2FPGA 4NBWA 5JY6A 3TPCA 1XU7A 4UUPA 1ONOA 3H3FA 5HWSA 2DM6A 1MX3A 2ZCUA 3ORFA 2E48A 1F0YA 4CMEC 4BUCA 2VRCA 1DBVO 3C1TA 3L6DA 2XF8A 4HUJA 5LCXA 5CEFA 1ISMA 1NFRA 4J1SA 5JO9A 3RUFA 5C5IA 4CLHA 5GY7A 1YB4A 1YBVA 1JKFA 5THKA 4BO4A 3PVZA 3DZFA 4EJ6A 2ZB3A 3SJUA 1K5HA 3OEYA 2YW9A 3DAFA 2V7PA 5GMOA 4XB1A 3IP3A 1XGKA 5IN4A 2AXQA 4B4UA 2ZKLA 1DO8A 3UH1A 3WG9A 2O2SA 3GVPA 4G5HA 2BF7A 4CQMA 1U4OA 3ST7A 4TKLA 1SB9A 2HMUA 3I4FA 3JQBC 1WW8A 4W4TA 1IB6A 2YYYA 2Y68A 3BMOB 4YRAA 3GZNA 3H8VA 3RBXA 2OBNA 5MDHA 2D8AA 2GDZA 4URFA 3K5PA 4A7PA 3F1KA 3WSVA 2F1KA 4XGIA 5AXDA 2R2GA 1W8DA 2O2YA 4FS3A 1T1SA 4IDCA 4R1UA 2JHGA 5DOVA 2CVOA 3PHHA 4CMJA 4AJKA 1DRVA 1HWYA 4WPGA 2HQ1A 4Z0TA 4AJPA 2NU7A 2FOIA 1LDBA 2DFVA 4WCFA 4E0BA 3CINA 4WLUA 4BOYA 4Z6KA 1A4UA 3PWKA 4MINA 2EV9A 3B1KA 3B20A 3GPDG 3GZ4A 1LDEA 2EKPA 1P33A 1IZ9A 2BHLA 4QECA 2X5JO 5DP1A 2HK8A 4R41A 3TZKA 1BW9B 4WUVA 5FFFA 4FQ8A 3WGZA 1PEDA 4PLGA 3KZVA 3PXXA 4RPHA 3UW3A 1F14A 2VOJA 1ID1A 3D0OA 3MTGA 4IMPA 4YQZA 2J5RA 2DAPA 2PKRA 1NBOA 3AWDA 1E6WA 4Z3DA 1PQUA 4Y8VA 2ZIZA 2YFQA 1S6YA 1HE3A 2TMGA 4ND2A 1OZAA 1IYZA 1YL6A 3GG2A 2HDHA 2X0NA 1TVEA 1KS9A 4RCVA 5L7TA 1U7HA 4FSHA 3BTUA 4HXYA 3ETGA 4FOOA 4BNJA 2GZ1A 4LISA 4O5OA 2O48X 4B7UA 5G4KA 4KTTE 3IUSA 3C7AA 4NU6A 5JO0A 5TF4A 3KLMX 4GX1A 4KTVE 2PH3A 3ZWOA 3EAGA 3PQFA 3JQGB 3WQQA 3FNFA 1AUPA 1E1NA 4J1QA 3Q11A 1KEWA 2IEDA 3D4OA 4BNVA 3WGHA 2NU9A 1YO6A 4IDGA 1C0IA 3KHUA 4DUPA 2EG9A 1QG6A 5LDGA 1ENZA 1ORRA 2FN7A 1MV8A 2Q50A 2J6IA 1HEUA 3JQAD 5CDSA 2CDAA 3FSRA 1PS8A 5GZ1A 1PGPA 4II2A 3OA2A 1I30A 1ONNA 4IQGA 4KMSA 4E21A 1PL7A 2D1YA 4JP3A 3T4XA 4BO8A 5JC8A 1P1RA 1D3AA 1P1FA 4R9SA 1WDMA 1RYEA 3JD1A 1GD1O 3JYOA 3OQ6A 4Y6PA 3PJFA 1O5IA 3F3SA 1YONA 1ZK4A 4Q3NA 2PGDA 1E1MA 2AQHA 3S55A 3GVIA 2ZB8A 1UXKA 1Y8QB 5IF3A 1I2ZA 3O38A 1B8PA 1E3IA 2VTDA 3VTFA 4LMPA 2J8ZA 2GD1O 1YL7A 2UDPA 5BQFA 5L51A 2Z1MA 3B1JA 3DBLB 4MVJG 3GN1A 5F1OA 4ALMA 4QO7A 3HDJA 5DT9A 4CM8B 2EP7A 4OHUA 1R4MA 4XIJA 2ZB7A 4J91A 5A04A 4KDEA 1OMOA 4GI2A 4JX8A 4IDEA 2LDBA 4PG6A 1BHSA 2B4QA 3ZV6A 4E31A 2EERA 3RAJA 5U1PA 1GCOA 4RDIA 1Q2XA 5C37A 1GYPA 4PVCA 1I2CA 4E2YA 3MTJA 1P1KA 1BVUA 3X2FA 3EHEA 4OMUA 1ZK0A 1EDZA 2D5AA 1ONPA 3GVHA 3RVDA 3ROKA 6LDHA 5CEJA 1Y81A 5JDCA 4YJFB 4CV3A 4GL4A 4FOSA 3PI7A 4M1QA 2H5LA 2FWMX 5DCUA 4A10A 4CL8A 1HZJA 5H83A 3LT4A 3NT4A 5B1YA 1GZ6A 1ZVMA 1W73A 4FDAA 5A9SB 1B0AA 3G3EA 3TOZA 3HFSA 2J3JA 3DB2A 4L4SA 1BDBA 3I4CA 4KWHA 1U2GA 3M2PA 4P22A 1FDWA 3TF5A 1JKJA 1SB8A 3PK0A 3WYCA 1ISJA 4S1VA 4MJLA 3QLJA 3N7UA 4BIIA 3IJPA 1A9ZA 1V0JA 4XGNA 3B1FA 1HDZA 2JJYA 2WYVA 4CLXA 2JFFA 2Q2VA 1H6DA 4RVGA 4HADA 1DXYA 5DNAA 1BXZA 5JC1A 4M54A 4OXNA 4QT0A 3UGKA 2FZEA 1KIFA 3ETEA 4M86A 4QTZA 1TT5A 1U28A 3M1AA 3I9MA 4R54A 1B7GO 1KETA 2W8ZA 3TZHA 1LQTA 3P5SA 4XCVA 2O23A 3ASUA 3OICA 1T2FA 5C3MA 1KVTA 3WMWA 2Q1TA 3WWZA 1VC2A 4FC6A 5KTKA 1YOVA 2DBZA 3PIIA 1GTMA 4P8RA 5KCZA 3EK2A 5T5QA 3WICA 2DTXA 3WJ7A 1ML3A 2GERA 5A9TA 1E3JA 4IXWA 1NQAO 1D4FA 2HMVA 4BB6A 2FPIA 3INTA 1R12A 4ITUA 5JAIA 5L95A 2X9GA 3STHA 4AJJA 2A4KA 1VE9A 1HDRA 4OAQA 2W2LD 2X0JA 4UREA 4GSLA 3QJ5A 9LDTA 1UXHA 2YDXA 1LX6A 1R0LA 2UVDA 3ZDFA 4A0SA 4MIEA 3WBBA 1H9BA 4HY3A 3HWRA 4UVIA 1F17A 4OM8A 4IY1A 2GN9A 3DBRB 3JD2A 2ZJ1A 3RI3A 4CLRB 1ZNQO 5GZ3A 3VPHA 2BI8A 2P91A 1IULA 3U0BA 2C7VA 3O8QA 5BSEA 3C7CB 4QEDA 1BVRA 2I5PO 2E49A 1A27A 5A9RA 4ZD6A 3DTTA 3U4IA 5EPOA 1E3WB 4EGFA 4MVJI 4WOKA 4BO2A 5I9LA 4K28A 4R69A 2RBEA 1LSSA 4OYRA 1VL6A 1HL3A 2O3UA 3N74A 4DLLA 3QRWA 1I24A 4JJIA 4ALKA 1RM5A 3EGOA 1U3UA 3C85A 3WR5A 3ENKA 1SBYA 2B4RO 1QV7A 3FCOA 2BD0A 3MJCA 5B4TA 2CZCA 4NPCA 4KQWA 3L6EA 3DMTA 4YA6A 1HYGA 4BO0A 4RDHA 4EITA 3W4KA 2B4TO 3RASA 4U8GA 2VWGA 3H5NA 4F6LA 2WMDA 1LDNA 3AY6A 3SXPA 4CMGA 3DZHA 4H7PA 4GGPA 1EMDA 1QV6A 3BXXA 4J2OA 3WB9A 4D46A 2GYYA 3PHJA 5A3JA 2YV3A 4IPTA 2VYNA 3BMQB 3CPSA 1PR3A 1W4ZA 4XRGA 1FF9A 4PLWA 1UZMA 3AI1A 3L0DA 4HWKA 1AXEA 4DLBA 4N7RA 4FW8A 3TL3A 4AJ2A 1LC3A 1SC6A 1LEHA 3L77A 4E30A 3NGLA 2WDZA 4NK5A 2O4CA 2VRCD 1JKIA 1QR6A 2W4QA 4CMCA 2O4UX 1PQPA 2QZZA 4NFYA 3QE3A 3RIHA 5DBIA 3JQDA 4Y6RA 5EESA 2Q1SA 3IP1A 5IJZA 8LDHA 1EFKA 4YXFA 2C5AA 3BHMA 2P9EA 3PJGA 3GRPA 1B3BA 1LDMA 4TWRA 1PWZA 4U6QA 2BGKA 1KY5A 5KJ1A 1PJSA 2X58A 1E0DA 2B69A 3IKVA 4D7AA 1PIWA 2D3TA 2IEBA 4M8SA 1NR1A 3VPFA 5JS6A 5KKCA 1C1XB 1W6UA 2Q49A 1WXDA 4TRNA 3SC4A 3UXYA 2Y66A 4CQMD 4W9NA 2EWMA 1DIHA 1Y9AA 3KETA 4FPXA 1XU9A 1MUUA 4BNTA 4E5KA 4OL9A 4EJ0A 2J5KA 1X1EA 3V1YA 3WGYA 5KKAA 4CM3A 3JQAB 4IS3A 2HUNA 4EW6A 3KO8A 5IXSA 2AA3A 1GY8A 3HDYA 5LC1A 3HB5X 1IE3A 1Z82A 4XYEA 3IMFA 3Q2KA 4F3YA 3ROMA 5JSFA 4TVBA 2QG4A 4ALJA 3PRJA 1TXGA 2GGSA 4YJGA 1E7YA 1Q0HA 5I7SA 1PQWA 3JQ8B 2OXIA 3R6DA 5AXBA 4ID9A 2BI7A 3Q6IA 3KSUA 4R51A 5AXAA 4I5EA 3AOGA 1K6IA 4C7KA 3DOCA 4K9DA 5LDHA 2AHRA 4LCEA 1YDEA 2A92A 1EVYA 4DWVA 1UDCA 2QYSA 2JCYA 3TOXA 1CWUA 2VQ3A 4RL6A 2ZJ0A 2NQTA 3HN2A 1HYEA 5H82A 2AE1A 4UEOA 4Y6SA 2NU6A 2OBYA 3FR8A 3GMSA 3C7DB 4GX5A 2C20A 1V3TA 2DC1A 2G76A 3DZKA 2PD6A 4FC7A 1C1DB 2C5EA 3P2OA 3WQRA 3L9XA 3LDHA 4TRRA 1DC5A 4YBZA 4OO3A 1PJLA 3PQDA 4R1TA 2Y1OA 5FI3A 3FPCA 3LF2A 5A1TA 4DXHA 1CQJA 3KM0A 1G0OA 1ZFNA 2AMFA 2ZK7A 3RJ5A 4FFPA 1H5QA 3LU1A 3R3JA 3DHYA 3I52A 1U1IA 2JD1A 2DT5A 2PFGA 4Y98A 1NASA 1JU9A 3ADOA 4RVFA 5T8KC 3ZZNA 4EEXA 2YZ7A 4GMGA 1U7TA 2WD7A 1DAPA 2Q1UA 3BZUA 1DJNA 4WLNA 3RSHA 5EIOA 4FB5A 5JAZA 2GASA 5I8ZA 1GEEA 2YHUA 1JAXA 4MP6A 1I5RA 3RWBA 4CM7A 2VN8A 1WLYA 5JBIA 5KJ6A 4PG5A 4TKMA 2G0TA 4YT2A 1ZW1A 3OJOA 1E1LA 3OBBA 3KRTA 5BR7A 3K96A 5B12A 2A9FA 2Y67A 4Q3DA 4MP3A 1LRKA 4OGWA 4ONEA 3WXBA 1XQ1A 3U62A 4TRMA 1EE2A 3L4BC 3LF1A 4BNFA 4Z3KA 4MVJE 4NFSA 3NDRA 5DZSA 4M87A 1YB1A 1S7CA 1O94A 3K6JA 4D43A 4ILKA 4E5MA 1C14A 3CSDA 4O0LA 3EVNA 3IS3A 4IIVA 3B6ZA 3DXFA 4RPKA 1NAIA 1GZ3A 5AYVA 4CMIA 1XHLA 3GMDA 3ANNA 1Y6JA 3AK4A 4RF2A 3NEPX 4UVHA 4I9NA 3U3XA 4GPD1 3W1VA 3AI2A 3WLFA 4XQ9A 2VNAA 3OH8A 2J5QA 3HE3A 4E2WA 4XJTA 1VI2A 4PRKA 2VWPA 1T2DA 2B0JA 4KP7A 5EINA 3WGTA 1HDXA 4CL3A 1T4BA 4YT5A 4FFLA 4TVOA 2EKLA 1R4NA 5JDIC 3BHIA 2CFCA 4D79A 3NDJA 4MVJA 3OHSX 5AOVA 4A73A 3MWDB 1GDHA 3RKRA 3AFMA 1PJCA 4OJNA 4PG4A 3WYBA 1ZBQA 4CLDA 2CDBA 1DFHA 1KVSA 2NWQA 4RPGA 1I3MA 4L4XA 4TSKA 4IZHA 5EQFA 4YAIA 1CRWG 3KYCA 3MJSA 2XOXA 3QHAA 3QQPA 2XXJA 3DOJA 4EI2A 2JCVA 4B4VA 2YQ4A 1Z7BA 1WDKA 3FNGA 1EQUA 1NPDA 4P4NA 4J43A 4KUEA 3OM9A 3QA9A 4DIFA 1NVMB 2P68A 5ES3A 4PRLA 4F6CA 4LSMA 1IPEA 1F8GA 1N7HA 2OOSA 3WX0A 4CQLA 4NK4A 4N5MA 3LLSA 5FEUA 1A72A 4L75A 1LLUA 3K9QO 5JYDA 4E2ZA 4O63O 1TEHA 3UVEA 4CPDA 4IZIA 1W0CA 3DZBA 3UCFA 4NJMA 3HNPA 1XLTA 2DVMA 2VYVA 3KSDO 4CR7A 1PWXA 4LVCA 3U4CA 1LJ8A 4ROSA 3GOHA 3NDIA 1OI7A 5IDWA 4PLVA 1A71A 4R5MA 2AQ8A 3GC6A 3D7LA 2XPCA 1R16A 1MA0A 4IM7A 4R3NA 3F5QA 4JROA 3ZWPA 2XXBA 2GZ3A 3COSA 4AJEA 1I33A 2G82A 3Q2IA 3GR6A 3I6QA 2Z1NA 4DREA 3KLPX 9LDBA 1XCBA 3IKTA 1AE1A 2F00A 1P45A 4BKOA 1N5DA 4FFRA 1VRWA 1DLJA 1WP4A 1ISHA 1Z74A 3DAGA 3K31A 5K6AA 3VZRA 1R66A 3WGGA 5ER6A 4NIMA 1PZFA 2E82A 3OP4A 3MJEA 1DRUA 2NVBA 3GA0A 3F4LA 4CV1A 2GLXA 4W7IA 3WTCA 4BO7A 5DF1A 3FHLA 2Y1GA 4FCCA 1QSGA 2FMUA 2Y99A 1QORA 4IIUA 2IYPA 3EYWA 3GGGA 3TN7A 2NM0A 4OOEA 1KY4A 1NPTO 5TNXA 1DIRA 2PR2A 3JQ9C 1TB4A 1Z45A 4TZKA 4DC1A 5JW6A 4GQAA 4IS2A 4BMSA 3FWZA 2BLLA 1PX0A 4ALIA 2Q4BA 2DFDA 3F4BA 1ADCA 3D5TA 3CH6A 4DA9A 3D3EA 1UP6A 1MFZA 3GNSA 1NQTA 2PZLA 3RD5A 1DFGA 3VKVA 2FR1A 3BMOA 4UAGA 1D1TA 2Y1CA 5DOZA 3I5MA 1D1SA 5JCJA 6ADHA 3E9QA 4YEDA 1N2SA 3TQHA 3Q3CA 2AEMA 3TL2A 1XSEA 2B83A 4PLTA 1L7EA 4O6VA 5TJHA 3QWIA 4AFNA 4A03A 1GZ4A 1GU7A 3VPSA 1IL0A 3E8XA 3QWHA 1KVRA 4BGUA 5AQ1A 2FZWA 2VTEA 2QW8A 1PS0A 4EUHA 3O26A 4J0FA 4NBRA 3AOEC 4UEKA 3RUDA 4BL5A 1E7QA 3ZWXA 3KOUA 1RYDA 4W99A 4W7HA 4OSOA 4EYEA 5JDIA 3ASVA 1XR3A 4FJ0A 1SOWA 1CEQA 2CMDA 1QYVA 2Z5LA 1SZJG 2WE8A 2WWRA 2JD2A 4Q3BA 4RO0A 2VYND 1BW9A 3GUCA 1V9LA 3IAHA 4MO2A 1YQGA 1LLQA 4YDRA 4ND3A 5KWEA 3DR3A 1E7SA 5CDGA 2PLAA 4XA8A 3LC7O 1DC6A 3D4PA 4J7XA 4CM9A 4OXKA 2VT2A 3GHHA 4XIYA 1ADFA 3QSGA 4QSMA 3ZCXA 4DTIA 5K9ZA 1RKXA 2H6EA 3WDSA 4OKNA 4FD3A 4R68A 1PU2A 3G0OA 1T4DA 3GDGA 4QXMA 5L4NA 2FSSA 3ZNQA 1B3RA 5AXCA 1GUYA 1H6AA 3CIFA 4CUZA 3M2TA 3JQGA 4WK6A 3DL2A 4GKBA 1YQDA 1C0PA 2NU8A 3ZN2A 3QV1A 1BXGB 1ZXLA 3E9MA 4HFNA 2HLPA 1P1HA 4UVGA 1GQ2A 3EC7A 2X7HA 2OORA 5KJEA 1U3WA 1E77A 2VHVA 1EK5A 2DBRA 4CV2A 3H5RA 4CM5A 3GAFA 3H65A 1YS4A 3ANLA 3WTBA 4BNGA 3OFSA 1EUZA 4LRTB 4CLOB 5JLAA 2HMTA 4R1SA 1ZO8A 1LBEA 1GQQA 3G1TA 1YBMA 2BGMA 1WVGA 2EJWA 4BGVA 4BVAA 2Q45A 5CG2A 1MFPA 3GEMA 3K92A 4BGEA 5JYEA 2G5CA 1U5CA 1FDUA 2I3AA 4WECA 1IHYA 3EDMA 2ZATA 3MCVA 2WJPA 3P2YA 3INGA 1F06A 2I9PA 3UOGA 3C3XA 1PJBA 3HQ4O 4CMEA 1P3DA 4YT4A 3JQCA 3QWFA 4B79A 3TZQA 3ZI0A 1Y8QA 1CETA 3ZHXA 4IJUA 4BKUA 5CG1A 1HYHA 4WJZA 4XQEA 5EJ2A 4BNZA 1WMBA 3FN4A 2Y1DA 1U2DA 4ZRMA 3W8FA 2H63A 1J49A 4RJTA 3JD3A 4AJ4A 4YYZA 3AM4A 3DBLA 4MKXA 1JDJA 2CD9A 2NADA 5L53A 2VUTA 3LZ6A 4CM8A 3TNLA 3GEGA 3JSAA 3E1KA 4AICA 1KEUA 3KEQA 1MC5A 4ZQBA 1JWAB 1NX6A 5ENDA 4KOAA 3WYEA 1ZZEA 3H9QA 4PLYA 3H9GA 1HE2A 3JQBA 1DHTA 1K0UA 4DQUA 1HETA 2CY0A 3E18A 4R01A 2DPHA 5IXYA 2EGGA 4PLZA 4ND1A 4RQUA 5ITWA 4U6SA 4BV9A 1SNYA 1UAGA 4L76A 3DWFA 3H9UA 4J7CA 2O50A 4WNCA 4E5YA 4YJFA 2X4GA 2VWQA 4EEZA 2CVZA 1QXSA 3U4DA 1QLHA 3TZ6A 3C1OA 1VKNA 2Q3EA 2ZTUA 2O3TA 4BGIA 3LT0A 5A9SA 1LI4A 1EEHA 1WZEA 3EZYA 5AVOA 4P4GA 1O6ZA 1HDYA 1JWBB 5L7WA 2Y1FA 3FD8A 3JD4A 4YT8A 2EIHA 1K89A 1BG6A 1CDOA 2JAPA 5BNFA 2WTBA 2VZ9A 3AY3A 4BNMA 3GRKA 3MEQA 3DHEA 5TX7A 1K6XA 3AUUA 4YTEA 1LQUA 2CVQA 4WEQA 3VDRA 3GNTA 2DKNA 2WSBA 3K2BA 4S3MA 1LTHR 3FTPA 2GPTA 2OO5A 4IDBA 4BNXA 2Q46A 4RVHA 3H2SA 4RORA 4JBIA 2P2SA 1I01A 4N5NA 4INAA 2B36A 1PJTA 1G1AA 3U49A 2ZQZA 1MLDA 4D3DA 2PWZA
chains in the Genus database with same CATH superfamily
3OTQA 2CBZA 3DDNA 4OYLA 1T9ZA 1OC4A 2B94A 1ODCA 1QDEA 4PX3A 3CW2A 4BLSA 2ILTA 1BHO1 3RUCA 4IUYA 2PVSA 1E1KA 2B8WA 4BEBA 4WLFA 2OCLA 5HIKA 3W5IA 3C8MA 1Z2PX 2H2WA 1D5CA 3FIJA 1EX7A 2E4YA 4ETWA 4Q02A 1F51E 3B5JA 1CEEA 3L2OB 3SSMA 1IU9A 5AOBA 4MVJD 1EIWA 4TZ6A 1W4LA 2XQJA 4RNCA 4PTYA 3PDUA 3G9TA 4DCOA 4PZYA 3GMTA 4Q3EA 3V7NA 2IDKA 2EW1A 1UBFA 2HTEA 2NYVA 3UICA 4CR6A 3OEWA 3PPVA 2FJPA 1AS0A 2ANCA 4OP2A 4O2AF 5FNVF 1D4OA 3T0FA 3UJ9A 3T4PA 3ZJYA 3WGQA 4EVQA 1NTRA 1MB2A 5DIZA 1E3MA 1U02A 3HY4A 2RSLA 4KREA 4QPNA 1UPUA 2G9QA 1XJ0A 3JQ6A 3RCBA 2QMEA 1JFVA 3FPEA 4US1R 1IATA 1V1JA 2E1PA 5A7HA 4BN4A 4YWJA 3TB4A 2YC4C 5JXGA 2XOKA 2MSEB 3ACBA 3DONA 2IRWA 1KPGA 3TD9A 2R6JA 1H23A 5IM4F 1YVDA 3E3LA 3MRVA 1E3WA 3TLGA 1E3EA 2FSVC 3QPWA 1VI5A 5ALFA 4JFRA 2ZI6A 2GEDA 2ZIEA 4TV9F 1N9KA 3UM9A 1KOLA 3VYSB 5FL3A 1MJGM 5JS8A 3LIIA 1GFZA 4FKBA 3FZEA 3PWSA 4DNQA 5K0NA 1KP9A 1JVSA 4JGGA 3GLRA 2WNSA 1ZVVA 4BNHA 5A4IS 2V1XA 3X2SA 2FAXA 1ADYA 2JLQA 1PJZA 2QPTA 2VYVD 1DBRA 2D59A 3ISTA 4TT3A 5AM1A 2NYUA 2JJ2A 4JVMA 3HVRA 3REFA 3SFVA 4XSGA 4YRKA 1SA0B 3H5OA 4J1TA 4DIMA 3OOYA 4BTVA 3GLFB 5HJEA 1GRVA 1XN1A 5LKRA 4EG6A 4G8DA 4MRPA 2Q1XA 2XIJA 4IDDA 1TTQB 2PZFA 1EUCB 4FOLA 2W2OA 3G02A 3BK7A 3OKPA 3PNPA 4NSNA 3EBPA 5HSGA 1QIHA 3JALB 1P7ZA 1T9CA 3KAQA 2ZUDA 1EFPB 2J09A 3F8SA 5ITZA 2CUTA 4I4TF 5DXJA 4N76A 2VHWA 2XNSA 2GRAA 3TE7A 4ZQFA 4AKHA 2FDXA 2A1TS 2PT9A 1GPJA 3NS7A 4FMDB 2Z98A 3G2LA 4GWGA 4QOEA 3T12A 4D9MA 5KIAA 1KMHB 8GPBA 1AGYA 5JCOA 3TRHA 5IJ9B 1P2GA 4J2TA 3NC1C 3KJQA 1RQLA 3Q10A 2CXRA 1DO2A 1R8QA 2PWBA 1F48A 1WCIA 3CY6A 1CVLA 3FSJX 3FZQA 2BF4A 2CLKB 1UBKS 5ANRB 1SUPA 4RHEA 2DR0A 1DFIA 4L7VA 4XPIA 5SYNA 4IMJB 3PHIA 4G0NA 5K3BA 2FW9A 1PFWA 5AIBA 2WM3A 2NPOA 3SR4A 3VC7A 1MQSA 1KI7A 2I66A 4MW6A 1Q91A 2A5FA 4YXWA 4KQ1A 4E4YA 4DQVA 4N7BA 7REQB 1HTBA 1V2GA 1EPUA 1R6XA 2WG0A 5CA1A 3COJA 4S1NA 2HA4A 4MA5A 5BYAA 4I1UA 2A86A 3CYFA 3OEEA 3R1IA 1ZUHA 1HT1E 2XCTB 3NT2A 1SC3A 1YDGA 3HNOA 2LPMA 3RAPR 1J39A 4B3IA 3VH4A 5COQA 2PKEA 5E9AA 3NIFB 4BRWA 3R9XB 1KO1A 3V46A 3FJOA 1SZCA 2PMCA 3BAZA 1C1XA 4G1BA 3WDMA 3EZLA 1DKPA 2IFTA 4MGYR 3PQCA 1RHJA 4O1IA 1LQ2A 4MUJA 1GCUA 1RLOA 2WSLA 2ORWA 4XJSA 5J2UB 3A9VA 4PYMA 4CF6A 4RV4A 3I8SA 2JB9A 4HLUC 5IJWA 5EQTA 1BDHA 4DCCA 1D7AA 1S8AA 4MRSA 3AI3A 5B57C 1SUBA 1T26A 5CFZA 2WFZA 5AVXA 1QIGA 1RWKA 1I3NA 2J1LA 2M6RA 2POQX 3EXIA 3FCCA 3FSGD 3JQAA 3KHTA 3LDGA 4QPPA 4AP9A 2C57A 2GK4A 3G0HA 1C7EA 3BDIA 1OWLA 3DTNA 4MSUA 2VNSA 3CW8X 5I47A 1M8JA 4PO9A 2QTWB 5GM2A 4ZT4A 5SV2A 1ZIPA 4ENVA 3JVIA 3OJEA 1H8EA 2FGKA 1NXWA 4YWHA 1T2AA 4FFSA 3M49A 2N46A 2ESRA 2Y0CA 4CDNA 3NNSA 1DOAA 1O9BA 2JD0A 2FF7A 3GT0A 1P73A 3TD6A 4P38A 4PZPA 5HVNA 4HFMA 2A0YA 1FC0A 1XCOA 2V7QA 3E1SA 4IOKA 4OH7A 1IPFA 3PJDA 2I1VB 3OZXA 5LBUA 1GAJA 3ANTA 4TYMA 2KLHA 1PS9A 2HWUA 2VSOA 3K6SA 1HNWB 4ZZ2A 1C9KA 1FXSA 1UZNA 3WOVA 3WNCA 3H0CA 3DO6A 4R05A 1ECGA 5E2IA 4KW7A 1M2WA 1VZ2A 4RZ3A 1UK9A 1I2BA 3G9ZA 1FK8A 5BN5B 1P0CA 3SN6A 1XAJA 3OC0A 4EYKA 4IJMA 3K20A 3OWXA 3VHLB 2C54A 2H5IA 1IRIA 1PFKA 2HF2A 3AF3A 4F4DA 1C1DA 2IEZA 3THYA 3MA0A 5DHRA 4E32A 3GW8A 3L8CA 3UHJA 2HDNB 3L7OA 2JAWA 4PFQA 4MS3A 1E2GA 4AZSA 4O2RA 1CXZA 3S2FA 4DPKA 5IZCC 2R9VA 5JT1A 4K1LA 4GKKB 4NOMA 1QHSA 4ABYA 4V1CA 2WIBA 2WA2A 2ZBPA 1N7IA 4AJ9A 3AHHA 2PGAA 1YS6A 2D3WA 2GAFA 4OUDB 4B9EA 1OT5A 2QTAA 3HXPA 3FNQA 2X23A 2A30A 3CB4A 5I7VA 3A4IA 4LDPA 4RVUA 3VVLA 4LNUA 1IZ0A 2Y4OA 5AKEA 2GM5A 5EFZA 2BSXA 3EC2A 3EIEA 4ESVA 4LQLA 1JR6A 5GPBA 1FJHA 2VS1A 1JLSA 3JVUA 3EGWA 2WF9A 5I9TA 5E6UA 2H11A 4OQNA 4QUEA 4FYPA 2P9FA 4L5CA 1E7WA 3HZZA 2G3YA 2CDCA 4LJ6A 5A5FA 5JHGB 4KMRA 3CNNA 3OEHD 1CQIA 2BYTA 1HORA 1WMSA 2KMLA 3A1CA 1LPOA 1NBWB 1UXGA 2FPPA 2F7SA 4G5OA 2ONZA 3T0IA 5LU8A 2V3CC 1GG8A 2MSKA 2EHJA 3CGGA 2ZIXA 5HPYB 5IDQA 1WDLA 5JNUA 2YN4A 2WZCA 3MVEA 4WLOA 3SM9A 1K6JA 4X54A 4QQNA 4XDHA 1FJGB 5AJVB 2Z56A 4FSDA 5U4QA 3IOCA 3H86A 1VSUA 3BH0A 5JATA 5DN9A 4DM7A 5LMNB 3IILA 1KWKA 1G21A 4D97A 5BV2P 1UJCA 2AN5A 2GO1A 2X9NA 1H8HA 2XUHA 3EGXB 1KDOA 3OA0A 1OXSC 4YMSA 4JL8A 2Q1WA 4G56A 1YQWA 1SOUA 3O93A 1CUFA 3NAQA 3N70A 3HHEA 4XX0B 1ZH6A 3S1AB 4HGOA 2VG8A 2ET6A 4WX2B 4INZA 3D4IA 5AQEA 5NULA 1E99A 2CKDA 4FYKA 4UBIA 3ZBUA 3RVOA 4OLHA 1EFVA 1TQHA 2WF5A 3S2SA 1TJYA 4QRIA 5KCMA 3KTDA 4NCJA 2RGDA 4GD3Q 3VR6D 1VJRA 3FWPA 4EG7A 5JADA 3CU5A 5C7OO 4OLAA 2I3ZA 2PAAA 2C3MA 3DD1A 3K05A 2W7TA 3UNXA 3JAKA 1UL1X 2ZUBA 2JZNA 4BP9A 4F91B 2BGGA 1V6AA 2QQFA 3GFSA 4MI3A 1RRGA 1XZQA 3NETA 3TRIA 2QV0A 1XCJA 1AB5A 2HLNA 1AG9A 1IUOA 1A77A 2GEVA 1XD9A 4G8CA 1YU6A 4CCSA 1MRNA 1OVGA 4R31A 5G0WA 2VQFB 3QXXA 4K3UA 3B38A 3BK1A 4HT3B 2VTBB 3LY7A 3ABSB 1XKLA 4RDCA 4GT1A 3MS4A 3ENZA 1I10A 1PCXA 3NOOA 2G40A 2GEFA 4C7BA 2REBA 5E1BA 4JB2A 3HB0A 5FLYA 4YUXA 3TIFA 5DM0A 1HEIA 1WZCA 5GZ6A 3PUXA 2ATVA 2RBKA 3C16C 5JG7A 1R0YA 5JZ9A 2RB4A 4XQGA 2W6IA 4KV9A 1BKYA 4GOKA 2GCEA 2QTHA 1UXJA 2P27A 3AESB 3F49S 3P4XA 3RNLA 5BT9A 1Z6YA 1Z9BA 2AZDA 1NP3A 5AW9A 1Z62A 3AO0B 2V9ZA 3L7IA 2P5TB 1UBRS 3O2SB 1NX9A 2P9CA 4DLWA 3RTAA 1OXVA 3ZXYA 3FXAA 2OZLB 2QG9A 1PLLA 3D6AA 3OIFA 3QI2A 5HRCA 1SHKA 3KSRA 4EB3A 2Z6QA 3UMGA 2VF7A 1USIA 3W6PA 4RWZA 5JH7A 3RBZA 3CLTD 3LJKA 3S2IA 1ZUNA 2XWPA 4QUIA 2BSAA 3HBFA 3UJBA 5LR6A 2XDAA 2BP7B 2ERCA 1ZR2A 2XCRB 5JAQA 3OIGA 4YPOA 4FGZA 3UKOA 5MGBA 3MINA 4O08A 4GYJA 4EJSB 1X39A 2O7RA 3ZLTA 2O0JA 4PZZA 2HQOA 1I36A 3ND7A 3RRBA 2EX4A 3PHCA 2X6TA 1R37A 4S1TA 3JASB 3ROTA 3O74A 2Y0DA 3WQSB 3WZLA 4AY4A 5C8YF 3SF8A 1XA4A 1G8FA 1UKYA 3IBGA 3HSKA 3LY5A 4G1UC 2AF4C 3OWHA 3EEIA 4NI5A 1EEXB 1V2HE 4WK0B 4CIYA 1Z7GA 4DJJA 3DBHB 2GTIA 3PNVA 5BMOA 3CLRD 1Z08A 4JUDX 4YH1A 8ATCA 5H16A 1I2MA 1PFGA 5EY5B 4BLRA 1II8A 4FNAA 3OTIA 3NPMA 2VAXA 2XLBA 4RLFA 1PK9A 2QUHA 1X94A 2OBLA 3F47A 2PZMA 3M5DA 1KK0A 1BJRE 4X8HA 1IN5A 3TTVA 2ZP1A 4D56A 3P20A 4F4HA 3A10A 2RHTA 4FZ5A 5A3SA 1KDZA 3D8HA 4JU8A 1OBVA 4EPRA 5EIXA 3N05A 4CU5A 3ENNA 1ZK1A 5LZ2A 1KZ6A 4M21A 2FW6A 3KJHA 4B09A 5JZVA 1N2JA 1Q7TA 5JBNA 5FDFA 3AM3A 1M5UA 1U0HC 5HJ7A 1PNTA 1N8KA 2ZRBA 1F6BA 3K94A 3KIPA 4OHZA 2C1EA 4Q9NA 4B46A 4IJVA 4YRNA 2LGJA 4PGFA 3WK7A 2F9FA 2DQ4A 2IIBA 4F4UA 5JMWA 2H85A 2XCOA 2YFHA 2PUAA 1OHHA 5AI9A 1HKUA 1YI0A 2AJBA 4MQFA 3NRBA 4YAUA 4U3JA 1B73A 2V7TA 4L0MA 2P8SA 3P27A 1PUXA 1QIJA 4KWCA 4H59A 3KZXA 2I4OA 4L9RA 1UFRA 2K6GA 3AJRA 3QZUA 2BHNA 1G9XA 4HLNA 3FSEA 1HY3A 2RAPA 2HRDA 1LLDA 4XASA 1D7OA 2X8JA 2VHYA 5A7GA 4E3ZA 4EENA 3ETLA 4PQEA 2GM3A 1V11B 5LB2A 4F21A 5JS2A 2VUHB 4EUEA 3PBKA 2XYPA 2FPMA 2XE6A 3HS3A 3QEKA 3ZDQA 1LH0A 3RU3A 1ZD2P 1Z15A 1V3UA 2CE7A 2FZLA 1IQ0A 3MGBA 2G09A 4BO5A 3P7MA 1TFRA 4EPTA 3RYCB 1TX4B 3D3NA 4X6UA 2SECE 2NXCA 4ZVRA 3GGCA 1ZEJA 4WINA 3I5XA 1Y98A 2BFFB 4FI3C 2JA1A 4JR0A 5E2AA 4EF6A 4M9QA 1AN9A 2OE2A 1WB4A 4B3HA 5BN3A 1JWLA 4ZHSA 1UQTA 1DUIA 3ZG6A 4JIGA 4AYWA 2XUPA 3KXDA 3W3AD 1PHPA 3VO8A 3MJVA 3IMEA 2EFCB 4RPLA 2EFHB 3JAWA 5JDCC 3UPDA 4P4LA 4F5ZA 1UKAA 3NT5A 2SCUA 4FLMA 4X93A 3W78A 4LF7B 1NYTA 3SC2B 3AG6A 1QHXA 4JLAA 4ALNA 4TZ0A 1TJ4A 1FFBA 2OWEA 2J85A 2Q2NA 3BL8A 5D5HA 4XWKA 2BZGA 2C7GA 3HKEA 3HUUA 2XEXA 1CYDA 2PD3A 1C0KA 3EASA 2CK3D 3VVCA 4MCIA 4JH0A 3U3JA 2ATXA 2QSUA 3H5WA 1CUZA 4ENUA 2JFOA 4UAUA 4CRWB 1IBCA 2C2KA 3OX3A 1JDTA 3VHRA 1G6HA 2H9IA 3G9QA 3GCDA 3K1AB 4G65A 4XFJA 5EP2A 1XTSA 4I08A 4YAKA 3MPUA 4Q3OA 2BGIA 3ECSA 4OEHA 3CT6A 3DYVA 4PHGA 4B82A 4HNHA 1XWWA 2D2IA 3KEFA 1EWTA 2GARA 1TC1A 4YAJA 4YRLA 2PY6A 4TXNA 3ROFA 1X14A 3RUEA 5F2NA 1ZKDA 5JNRA 3N86A 4L7QA 5FBWB 1U28C 1NVGA 4R98A 4BRUA 5C1DA 3ADPA 1E2UA 2A9OA 3CPJB 5KOHA 2C4MA 1G7SA 2QR3A 4RKYA 5KNDH 2W4MA 2ZREA 3G9XA 1CIVA 1QS0B 1ZXBA 3EG9A 4C3OB 4EQ6A 1SH7A 3AR3A 4NDNE 5DNAA 3EMBA 4MROA 2AE2A 2I6TA 4PPFA 1QP7A 1NULA 1KAHA 3BK2A 2UUBB 3WYNA 3QX8A 1UP4A 3EZXA 2AFIB 1QP0A 3I92A 2YMQA 4MPRA 4R2XA 2J7PA 1SXJB 1Z6XA 3M6FA 5LDDC 4JLKA 2WFMA 3K0CC 5L8VA 5HS6A 3KAPA 3DZIA 3GBSA 3SYKA 4EB6A 2ZRQA 1UEJA 5FPQA 5J58A 5L45A 2ZUUA 4OFZA 4LPKA 4TQGA 1YR9A 3RLIA 1M5RA 1NDQA 1MF7A 3L8ZA 3O8CA 2PX3A 4U7JA 3WSTA 4O2BF 1GFWA 5LXTA 3ZTTA 1S3GA 1HDGO 3JX9A 3QITA 1DRKA 5IVIA 4AJNA 3UK6A 1JDBB 3ZC3A 1UIRA 4OK3A 1G7CA 2CUNA 2BTQB 3P96A 1CK4A 3RKUA 4BFYA 3CG4A 3DLAA 2Q3DA 4OQFA 2JIMA 3CMCO 1JYFA 3ZWQA 3UK7A 4F9EA 5JJIA 4X8MA 3LLMA 3ZW8A 3CR8A 3T1NA 3QTTA 3I0NA 1XJQA 5CXSA 4L9WA 1MX5A 1QP8A 4WD3A 3DUWA 4Q4AB 4U7PB 1SUFA 4FJ2A 1NVWQ 2PUGA 4FFMA 1GEGA 2A2ZA 2X3YA 1X1CA 3NJ4A 4HNGA 1ZCFA 1HFWA 3MCAA 3ORSA 3EVZA 2GBLA 4UCWA 2GXAA 4G0PA 2EEZA 1QGAA 1II9A 4J0GA 2QD2A 1CTQA 4CUKA 3PFNA 1M34A 4AULA 5TVKA 3FZYA 1IEXA 1NP6A 3KZOA 3L1JA 3U5TA 3V48A 1J0AA 2BMDA 2BJVA 2H18A 2YZMA 1DB3A 1KJZA 4LNAA 3PEFA 3KJEA 4FGWA 1V41E 5K8IA 3CW9A 1YTUA 1E9FA 3PQ7A 4TUYF 1H9CA 1G2PA 2Q3JA 1D4ZA 3CSSA 1X74A 1JDSA 5LOVB 4RAOA 4YRZA 5LBTA 3H9EO 2B6HA 2FWPA 1JEDA 1G3IA 2PUVA 1RAEA 3CZCA 2QZSA 4PG7A 4DQXA 4XYMA 4G85A 4AUKA 4YX9A 4LQCA 1V9SA 5JMTA 3UZUA 3G2OA 1VGVA 2BONA 2O8BA 1ZZGA 3RROA 4GEGA 4JKOA 2CCKA 1NSTA 4NBUA 4PICA 3RU9A 4XKJA 1RRCA 2HJHA 5HKKA 4BBZA 3QVKA 4BMVA 5INTA 1N7JA 4RF3A 1ZL0A 2JK0A 4RV9A 4UJ3A 3VSBA 5EXTA 4S04A 2QXTA 1WQ4A 3OE1A 3LUGA 3SX2A 3M6WA 1S3IA 4O2AA 2XB8A 4LG1A 1W88B 2GCOA 4NE7A 4Q1BA 1ZC3A 1RRKA 3BXEA 4Z49A 3KCQA 2OD7A 5T4BA 1T2NA 1T5OA 2AOXA 3NYQA 4QGAA 3TXYA 4DCSA 4M1KA 1VL0A 2GLTA 3IT1A 2YUTA 3EQ2A 3I58A 4AVYA 5CXQA 2IS4A 3O4HA 1OXBB 4LC0A 3G2MA 3NC4A 4FCWA 4UULA 1TMYA 4MA4A 5REQA 2FQXA 1G41A 2BELA 4PZCA 1Q1NA 5KVQA 1FUKA 1JKJB 1XA0A 1Y3DE 3HWSA 4LJRA 1SD2A 4LJLA 2AFHB 2FFRA 5I4KA 1DKLA 1GUBA 4TV9A 1ZW6A 2FFAA 3CRMA 2BGUA 2GA9A 3DH0A 3F6RA 3MUEA 3PNMA 1GDDA 3NHJA 1ULZA 4NWIA 2HU7A 3BJEA 2FR0A 5FA5A 2Q21A 4LECA 3TIVA 3FKSA 1HQKA 5KQRA 4URXR 2OUIA 4C9BA 1G42A 4YASA 2PCJA 1YZKA 4W9NC 5FUWA 3ZX4A 3QEAZ 2B3DA 5DI3B 1R9MA 5AI0A 4ZC8A 1TT5B 3KDPA 3ZWNA 1CLUA 4F06A 4Y30A 1XZPA 4ZZIA 3R5SA 5IDXA 3DV2A 1CE8B 3ASYA 2BCEA 2YV4A 2C59A 1Z2AA 2Q0QA 2WI8A 4F38A 1L7PA 2XWQA 1FXWA 3C3BA 2QX8A 4NS4A 2M1ZA 5E1MA 1GRCA 2I2CA 1ZH0A 4Z7QB 3EBOA 3FYUC 2OFWA 3EDOA 4PSCA 4BFVA 2FPUA 3ZDAA 1E2IA 3U9SA 3ZDCA 1VKJA 4RIEA 3G2HA 1GO2A 4BV3A 2FUCA 4KGZA 4CV0A 4PY2A 4I4TA 2OGZA 5EHQA 3RVSA 2RG1A 1H6CA 5CVDA 1MTOA 1GRQA 1I6LA 1QVVA 3SVLA 1HLDA 2JNWA 1GPNA 1I2AA 4ZT6A 1S2LA 3QVXA 1COWD 4TMYA 5ALRA 2WTXA 3U7QB 3UUFA 4DDMA 4HDRB 3HCWA 4JHLA 5DHUA 4ZTBA 3SHWA 4BO9A 4JT8A 4NFHA 2P5YA 4YRBA 3P9CA 1X9IA 2ZWVA 4FR5A 1B26A 2JL1A 3HEAA 3E70C 3OZRA 1OXMA 5KYGA 5JS1A 4GKJB 1D2GA 1JRLA 5D7BA 3VKGA 3WRYA 1GR0A 2NYRA 3UW1A 4NYIQ 4WK2B 1TEVA 5D6OA 4ZA2A 4X1IB 2ZRMA 4D4HA 1X7GA 2I87A 3ZE1B 4MS1A 3I64A 4EFDA 1NWHA 2C3OA 3KR2A 1SKYB 3T15A 4JI6B 3PCXA 4HAYA 4RQTA 1V7PC 2ODBA 4IJKA 5FL7D 3I2IA 1MMFB 1DQYA 2C9YA 2G80A 4L08A 1GUZA 5KMGA 4XLTA 3R77A 1O54A 3PQ8A 4BFXA 3GY0A 2Q9BA 1HG1A 3CCBA 2P4QA 2C58A 4UNIA 2ZIGA 3LA6A 4GS5A 1C7FA 1UFKA 2WF6A 3IEKA 3MELA 3FNEA 3OQBA 3DTVB 2F3SA 1J09A 1LD3A 3D2BA 1K63A 1UDAA 4ZV7A 4DR6B 4QHYA 4FGSA 5F21A 2C88A 5A2QA 2YJTD 4YJKA 2X0DA 2BKAA 1X7ZA 1YFZA 1RW4A 3B53X 4HQNA 3S1LA 4MMYB 4RSHA 1TUBB 2Q99A 2GR9A 4OB6A 4REQB 1EK0A 4K86A 4ZWNA 4W9MC 1W48A 5FR2A 5KDOA 4BX8A 2WDPA 3B12A 4NMWA 4HRXA 5EJ9A 1RXIA 1S9HA 4RIHA 1NT2A 1AQ6A 3IV9A 2GBIA 4IAOA 3PLRA 4XEHA 2FR8A 4LXIA 1TD1A 5C7IO 1PUJA 2H4WA 4GI1A 4DF3A 3H1TA 3MJ4A 3WZ2A 1MG0A 3A3PA 4GQIA 4GRIA 3EEBA 3OX2A 4QG7A 2QRQA 5IAOA 3DDZX 4R16A 2CMGA 2COEA 4IGKA 3WGIA 3AJEA 1IQRA 3G89A 5E4FA 3SC3A 1RRMA 3PGJA 3LVRE 4FFVA 3IQHX 4KN8A 4WZBA 3RWMB 1Q0QA 1JF8A 3UH0A 1BFDA 3KEOA 2ZUEA 4AC9A 1N32B 3FYDA 3KV3O 1UINA 2PZAA 2RAFA 3BMCB 3NTRA 2A0UA 1CVRA 1ODIA 2ODPA 3M4YA 4UCFA 4RVNA 4TYNA 2W2PA 1Q0RA 1UWCA 3VH1A 3A28A 2YHIA 1Q0ZA 1MV5A 2ON6A 4RANA 1STOA 2C97A 4LC9A 5CPFA 1D1PA 4UUMA 1JAZA 4DG8A 4MLCA 4AJ1A 5BV1A 4AIIA 3MGGA 4EZBA 5EMHA 3JRXA 5B7PA 4DMMA 5AW3A 2CW5A 1N8NA 3R7NA 4QVIA 1V9CA 3IPLA 4DEXA 3Q5GA 1RZ3A 1RKVA 4DAOA 4C6RA 2PZEA 5ALWA 3TPZA 4N6NA 4MV3A 4D0LB 3PUJA 2OA0A 1J9EA 1QQTA 5KDDA 3F78A 1H5NA 1WV0A 2XECA 3KP1A 5IFLA 2ADOA 4BMNA 1JTFA 5C5CA 1LK0A 1ZUD1 4R40A 3RAGA 4F46A 4MQEA 1ORWA 1JAHA 1LSJA 2A57A 3L7NA 1AHHA 4M0FA 1EP3B 1NF3A 3T5MA 1T10A 4C05A 1RE0A 3GUZA 4ZI3A 1T35A 4JYCA 1FP1D 2W2MA 2NO4A 3QVVA 1QRUA 4BO6A 4ZJPA 3JQFA 4IXTA 1KQNA 4ZANA 4D9GA 1QGYA 1D1QA 3ZIAA 4YACA 2BW0A 3H4VA 3QW2A 4CUJA 4XRRA 3WIDA 1A2OA 4QQRA 4RZHA 1UANA 3A14A 3FYUB 1UZAA 2R4UA 5AW6A 3WS7A 1IY8A 5HBRA 4KQEA 5D2CA 2DUNA 4FZVA 3S2UA 1WOYA 1WXIA 1RKQA 3EQ8A 3RBVA 4AZ3B 3E58A 1LA2A 4EDFA 2PGXA 4MVJH 3KQMA 2RJ3A 4R84A 2WTAA 3EPJA 2HJVA 3UHAA 3U1BA 2V7EA 5IAKA 3KDAA 4JL5A 1E1RA 4UVDA 1E69A 1U11A 2Q4EA 3OKCA 1Y5IA 4YJGB 4ZVMA 4AF6A 4OQPA 4LNHA 4X24A 5CYGA 2HHAA 1E60A 4KE7A 1R6BX 1NW6A 2BFAA 3E5RA 4HQKA 3OSUA 3O1HB 3MXOA 2VF8A 3WJ2A 1MOZA 1F2TA 3HJUA 5B6JA 5BSHA 5BVHB 5BYJA 1VLQA 3K8YA 3U37A 4PZEA 4X7BA 1UMDA 4RTKA 2WJHA 4Q5IA 5E4YA 3T9FA 1JILA 1WF6A 2P2GA 1RM4A 3RC1A 2EJUA 3U7FB 2I34A 4O2LA 1JAIA 1OAOA 1FMLA 1LZKA 3D0KA 3I9KA 3IJRA 5K0TA 3VNUA 1CW2B 3OJLA 3RC7A 1IHPA 2YXDA 1Y5NA 1PT5A 4X7RA 2R79A 3ICVA 3V7UA 2PA0A 3W8DA 1CYEA 5IWAB 2ROQA 1NVBA 1UCFA 3NTOA 4M49A 1M1XB 4OHBA 4WXRA 4Q1EA 5EWMA 4AK9A 1F8YA 4G5SA 4PX9A 3L4KA 3IR6A 1VBMA 4Z7OB 5FR1A 1U0TA 3V97A 1CQJB 1S5PA 1DT5A 2FUKA 3NEYA 5EP1A 2H3EA 2JVIA 4HVCA 4B80A 3BFJA 3G6KA 4OOFA 2ADMA 2P5SA 1G6KA 4NU5A 2R8ZA 1Z4KA 4BEJA 2L42A 2PU7A 4JP2A 4ZP1A 4HDCA 3JWJA 5AKHA 2ECPA 4AJIA 5FV4A 3R8XA 1JDUA 2Q2QA 4NBTA 2HJSA 1FTSA 2J59A 3N9IA 1RDFA 3GJ5A 4Q4JA 3EARA 1OPRA 2CBXA 4OY3A 5CGZA 2YNMA 1N2CB 4QGHA 1U8AA 3PT9A 3MTAA 4FDTA 1RBMA 1T36A 4IH9A 5SZKB 3WLQA 5BPFA 4BJ6A 4I8XA 1U0LA 3T3NA 4F3RA 4B7XA 2X42A 1P1IA 1PJ3A 2ZU6A 1POWA 1X42A 3HMKA 2WUDA 1VGQA 4D9FA 5IX8A 1UOPA 2BBWA 2R5WA 2YTZA 2WJAA 2AMLA 3BMNA 1I9CA 1OAKA 1TCCA 3ONNA 1JMYA 4KXUA 4JV5B 1S8FA 2W6NA 3D3WA 3DKPA 4HYEA 4X9XA 2YV1A 1G66A 2XBUA 1MBZA 1N0UA 2CLEB 4OX9Y 1UKBA 3KYBA 5C1OA 1X8KA 5IS2A 1NUAA 1YBAA 1JTVA 2O3JA 5AKKA 3NHRA 1TM7E 2PKYX 3MAGA 1U9CA 3ESBA 2I33A 1P74A 1N33B 3GHYA 2GUGA 2V0NA 1LDYA 3DMDA 3P9SA 4GR9A 4HDKB 7ADHA 1AA6A 5GQSA 3TE6A 1YZGA 2XR1A 3A9SA 1IBMB 4UATA 4V02A 5CK4A 1N5MA 2QN6A 2WAYA 4HDNA 3ZHUA 1QIDA 1P2FA 5JFOA 1OFGA 3Q0EA 2QT9A 2YIJA 3PGA1 1WHTB 4OQYA 5C8YA 2HIAA 4CMIB 1CY4A 3LK7A 4XEUA 3NB0A 1G5IA 4RY0A 4NF2A 5CDYA 5J3JA 1I3KA 2QP3A 2WLTA 1YCHA 2FG5A 1DL5A 3DOOA 1C0EA 2EW8A 1YSCA 4FSXA 2UXDB 2FUG6 2VQSA 4IV0A 1T3TA 2EWVA 4RZXA 3TEFA 5AVJA 4XGKA 2QN1A 2IC5A 2I99A 1WHSA 1THMA 2FJUA 4IFTA 1Q16A 2Q7DA 2ZT6A 1XD2B 1KZ9A 1YVRA 3ZX5A 4P6VF 2H1VA 3ILHA 4UEJA 4HQFA 3HABA 4DRYA 3KB2A 4MWOA 3UV7A 4G89A 5KYNA 4Y0VA 3BGWA 4QJIA 1UBUS 3SZRA 1AGNA 4I9UA 4KSCA 2BMAA 4CMBA 1AIPA 1QYRA 4JB0A 4A5SA 4KXFB 5HUJA 5DBHX 1TQ8A 2NTEA 2W83A 3KOWA 1G20A 1VSBA 3ZV5A 2H1OA 2GJ4A 3Q87B 2IL1A 1E2JA 3RVNA 1P39A 3FNBA 1WNTA 4RIIA 3RRNA 3KQOA 5BR8B 1WF3A 1BKSB 2QA5A 1B0ZA 4GPAA 4DLSA 3KVRA 2P65A 4FX5A 4Y2PA 4AMZA 5JYBA 1AXGA 1W5EA 3QEJA 1E9VA 1HRDA 1CT9A 3ZE9A 3HC7A 3JATA 5KQPA 1ZGBA 1B14A 1AXRA 4ILEA 1V37A 4KPUA 3NHFA 2FPLA 1CY7A 1GPLA 4EJMA 2QSYA 4EUNA 4XDYA 2XWBF 4F2PA 1DRWA 1EZZA 1GTRA 3O94A 1E64A 1X7WB 3I9OA 3DDCA 1BCSB 4P53A 1Q0UA 2BEJA 4MCAA 3WHKA 1TM2A 2IV3A 4XUEA 2JI6A 5MGNA 1W2HA 1KSFX 3PPIA 2VP2A 3TX2A 4EI7A 2IZ0A 1A2BA 1J56A 1NW7A 2J3KA 2FY8A 1D2RA 1F5SA 1XMXA 2OORC 4Q9DA 2FUG1 5DLEA 3H2ZA 2QG6A 4BO8A 4PCUA 2I2BA 3A6EA 3DHWC 2FEPA 4I2NA 3NKLA 4YDSA 3WC4A 4C0JA 1UFOA 3I83A 2F8SA 5AM5A 2VP9A 5A71A 2Q7OE 3UMVA 1CUDA 3KBBA 4JJKA 4LY0A 4JZYA 4KRXA 5KYYA 1GAXA 3RK4A 3A6JA 3THWA 4DA8A 1E8DA 3PI6A 4TMFA 2QJFA 4YV0A 3EXHA 2RHGB 2WWWA 4MV0A 2LXNA 1RXEA 4MLDA 1CZOA 5ILGA 3NJ8A 1TC2A 1I4TD 1NJ2A 2OD2A 3FFTA 3RSGA 4JQOA 4I1VA 4UUBA 5HS4A 3LHKA 3QLUC 1Y1PA 4MVJF 2B92A 1AKMA 4P1ZA 4I1SA 5KQGA 4IQ0A 3KR1A 1SKQA 3K2IA 3NHYA 4J94A 4L4RA 4RHXA 1HURA 3OETA 1EJ6A 2ZU0C 5FD8A 1L5HA 1P2TA 3FZNA 2PCLA 1C2TA 3M3HA 5LIRA 4RVOA 3V6LA 3H0EA 1SKMA 4NBWA 1OZHA 2DSTA 1DBPA 2DQSA 1W5TA 3SNKA 4ZCRA 1DC8A 1R64A 3IQEA 4HAVA 1F0YA 4F60A 4M7WA 5AI8A 2AFVA 4N3NA 2PZBA 2IXGA 1VYVA 4JJ4A 4DFDA 3L6DA 2XF8A 3WYFA 3GDWA 2DEUA 4PXAA 5LCXA 5CM2Z 4Z1OA 3RIYA 1ISMA 1CZLA 1NFRA 2YY5A 2CJWA 1Y33E 1NU8A 5H5JA 2A9VA 4R9NA 5CNMA 4YGXB 4GZMA 3I39X 5IDVA 1GRRA 4JI3B 4EJ6A 2GPYA 2ZB3A 3TIGA 5JFTA 4REOA 3SJUA 1XTUA 4LHVA 3CVOA 5DW3A 2ZTSA 3BWEA 4QOJA 2PNJA 5KB3A 1QO9A 1RI3A 3PA6A 4XB1A 4D2IA 4D0GA 4F5DA 4ENQA 1QRSA 4QM6A 4RK4A 4ARZB 5IN4A 2DSNA 4B4UA 2Z9BA 4ZTZB 2WZDA 3E22B 2FCRA 3OZVA 1LI5A 3NGMA 4ND6A 5KTOA 5C7YA 2XVAA 3GVPA 4G5HA 4QOFA 1GCAA 2OBMA 4CQMA 1U4OA 5JCPA 2XYQA 3TYXA 1ZH4A 3EXFA 1SB9A 3I4FA 2IXEA 5IKXA 5SZHB 1QH1B 4H7IA 1A8HA 1Z18A 1N0HA 4BAZA 3VR6H 1P18A 1VJDA 1IBKB 2CV0A 1TO2E 1A1VA 4BJ1A 3RBXA 1TTHA 2OBNA 3HVHA 4AWBA 4EPYA 1FP2A 2ID7A 4LRUA 3OPNA 1R10A 2C00A 1RJ9B 3GJ6A 5CMLA 4Z86A 1R4ZA 4FS3A 2ETXA 4IDCA 4QAQA 4PR0A 3SD7A 4LF9B 1LPAB 1UK8A 2CVOA 3PHHA 4PIPA 5IH3A 3FPAA 4CMJA 3P94A 4DDKA 1X9GA 5E95A 4JP5A 4AJPA 4Z0TA 3WL8A 1W9HA 3P9PA 5TQ0B 3ZE8A 1V71A 3ZXIA 1LDBA 2WIKA 3IB3A 4E0BA 2EZTA 3DMRA 1NI5A 1XRSB 1MOSA 2AJ8A 2Q7XA 4LYGA 4QREA 1W46A 3PWKA 4MINA 2Z3VA 3H2BA 3ILSA 1QF7A 4CCWA 4EUSA 5HZMA 1JT2A 3BGIA 4K0KB 1IZ9A 2EFYA 4H1VA 4HO1X 3TZKA 1BW9B 1ZNXA 4FQ8A 1USWA 4W1PA 3WB2A 3PXXA 2EG5A 1SVIA 2VOJA 1ID1A 1Z35A 2XUQA 3MTGA 5AQ1A 3PITA 4B48A 1NBOA 4LWQA 1W5FA 3AWDA 4KGVA 2ZI7A 4MKHA 1S6YA 1HE3A 4Q1VA 5LU9A 2A1UA 2PO5A 4US0R 3F6CA 4IRXA 4ID3A 2W11A 3FDIA 4YMVA 4NY1A 2E55A 3ISJA 3S8YA 1W19A 3VOBA 4N4AA 4BBAA 5ALQA 3KB1A 4V03A 3QU4A 3GPCA 3HP7A 2VK1A 1C4WA 3ETCA 5K3SA 4BNJA 1DBIA 4MWTA 2HSJA 4PYRA 1YA4A 5CB4A 5DNUA 4A36A 5TB5A 1OLUB 3OCZA 3IUSA 4QUAA 5JWOA 1QCZA 1RYNA 3H3XA 4TUYA 4NU6A 1SUWA 2BZ1A 4XQ0A 3K0EA 3KLMX 2RGBA 4LY6A 4GM0A 3B7GA 3PQFA 3FNFA 1AUPA 1NW5A 2D5BA 3Q11A 4QOGA 1KEWA 3D4OA 1OVMA 3M4ZA 5J40A 2NU9A 5ECGC 1FIUA 4MRVA 3TSZA 1C0IA 5JQGF 2EG9A 4I4IA 5KSZA 4DSNA 1W44A 1IOVA 2GBCA 2CV2A 1J0EA 3LTEA 1ORRA 2QR2A 4WWHA 2O5VA 1FUIA 4EYOA 2QZ4A 2V0GA 4C0QC 4PYNA 4FYYA 2GK3A 4KPYA 3OZGA 2CDAA 2X2EA 2X8AA 3QKIA 5GZ1A 3FCXA 4C5CA 1PGPA 4II2A 1U9ZA 3OA2A 1ONNA 3MK31 4QU8A 2YICA 2W8BB 1KKLA 1Q84A 4IF6A 5FXMA 3A3OA 4BVKA 4FM9A 4LF5B 4ZXFA 1WDMA 2FPXA 1RYEA 2OGSA 3FMFA 4GW3A 4AUEA 1SGWA 4EKGA 4UBNA 5HR5A 3AEKA 2O2ZA 3OQ6A 2WUWE 2Q62A 4XD7D 4Y1EA 3VPCA 1O5IA 3L4JA 1L5LA 4YR7A 1ZK4A 3E35A 4GO1A 5CA0B 1ZIOA 4WV3A 4YCCA 3S55A 3W3ZB 1QFJA 3W9SA 2KBEA 3AHFA 2C99A 1CS0B 4P31A 3PDWA 2IHZA 3ICQB 2CL5A 1E3IA 3HFRA 3IRUA 3PEEA 2Q0XA 1Z8DA 2V55B 5F12A 3QKWA 5AI6A 4XLLA 3U1TA 4R1LA 4I0WB 1YL7A 2ZB2A 3QKSA 3P52A 4AYXA 4DLRA 5BQFA 3PE4A 4X1YA 2O8DA 1MH9A 4JHXA 3CRQA 3EFHA 5F1OA 4ALMA 2ASEA 4NATA 1SHUX 3D6VA 4KVAA 2JFVA 3JTEA 2R25B 3IAXA 3NANA 4JBYA 1HM5A 3BFXA 3C39A 4MQ5A 1EBBA 3O4IA 1OWNA 1DWPA 4LYEA 4EK9A 3I2JA 5SY4A 2VDLB 2LDBA 3BJIC 4KO3S 5J2TB 1Z26A 2JFNA 1FNBA 1MENA 4IIGA 1C7ZA 3C8HA 4ETMA 4M99A 5KZMB 2B21A 5C37A 4MITA 1GYPA 5CB0A 2ZWIA 4PVCA 3NOVA 2FXVA 2QWXA 2AUMA 2EYUA 1P1KA 3IH5A 4JCCA 4WADA 1BVUA 3X2FA 2ZRKA 4OMUA 3NH6A 5AVKA 4BB9A 4IMIB 4C6TB 2RI1A 1EDZA 5JCOC 3CWZA 3GVHA 3ML1A 3RVDA 3A3YA 3W3AH 1OBCA 3NPAA 6LDHA 4W7SA 5E0KB 3T1YB 3FUWA 4YJFB 5G40A 3UBMA 4OBBA 3UC5A 2BFBB 1AKNA 1QQ7A 1XL1A 4L27A 3U7JA 5DCUA 1Q95A 2H5LA 2FWMX 3TINA 4IL5A 1ZVMA 2H1WA 4RKEA 4X1KA 3V00A 3NCHA 3VBCA 2ERXA 4FDAA 4BC0A 4UTVA 1B0AA 3G3EA 3RRFA 3TOZA 4N0DA 3G9UA 3DB2A 1X1AA 5B3LA 4DG9A 1FTYA 3COYA 4EY5A 2OCPA 1E8MA 1YOBA 1FDWA 4Q9KA 2Q9UA 5KNBD 3TF5A 1SWVA 4M36A 1T9BA 2J6CA 2UYQA 3QLJA 4IF4A<