4WGGA

Structure of the ternary complex of a zingiber officinale double bond reductase in complex with nadp and coniferyl aldehyde
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
352
structure length
352
Chain Sequence
VVVVNKQVLLKHFIPEGAPKETDMELVTTGTIRLRVPEGSNAVLLKNLYLSCDPYMRMRMTKHEEASYVDDFVPGAPITGFGVGKVVDSSHPDFKTGDYVWGLIGWEEYSLITKPQGLFKIHHTEIPLSYYTGILGMVGLTAYVGFYDICSPKKGERVFVSAAAGAVGQIVGQFAKQFGCYVVGSAGSDEKVNLLKTKFGFDEAFNYKKEPDLTKALKRYFPEGIDIYFENVGGPMLEAVLHNMRIKGRIAACGMISQYNLEKPEGVHNLFLIVGKRIRLEGFLVFDHYGSYPEFEEKVVQLIKEEKIKYLEDIVEGLENAPAALIGLFEGRNVGKQVVVVSREKGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURE OF ZINGIBER OFFICINALE DOUBLE BOND REDUCTASE
rcsb
source organism Zingiber officinale
molecule tags Oxidoreductase
molecule keywords Double Bond Reductase
total genus 111
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wggA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4wggA01
5F1OA 2I3AA 3E6AA 3W8DA 1XQ6A 3OA0A 1WAMA 4OQZA 2IYPA 1P31A 2Y1GA 3A14A 3ICCA 5ITVA 3HQ4O 3RC2A 2QQ5A 3WFJA 5MDHA 1P0CA 3E9MA 4NBWA 3IS3A 1MC5A 1VSUA 1HE3A 1I3MA 4QXMA 1LSOA 2NVUB 1EVIA 3L6EA 2BGMA 1KOLA 1F14A 4JJIA 3EY4A 1L1FA 3ZU5A 3GOHA 3OHSX 3FNEA 1N2SA 1ZEMA 5JO0A 2VYVA 1WMAA 4IMRA 3LC1O 3VC7A 1EBUA 3LF1A 1GPJA 3JQCA 3UAGA 4ZICA 2DFDA 2B4RO 4R1UA 2W8ZA 3CEAA 5BNTA 2GZ2A 3A28A 1EBFA 1QYCA 1QG6A 1HLDA 2CSUA 2Y68A 3OIFA 2HMSA 2V6BA 3N7UA 1TLTA 2C29D 1U3VA 3D4PA 4RDIA 4RJTA 3ZWXA 2X9NA 3WIEA 4CODB 3OSUA 2Q1UA 5DN9A 3RCBA 2CDAA 4ZA2A 4A0SA 4E6PA 1R15A 3MJTA 4Y9DA 4KQXA 4DQVA 5JS6A 2VQ3A 3STHA 3ZZNA 3EGOA 4GSKA 4BKQA 4NG5A 5MGBA 4I1IA 2WMDA 4I8XA 1I10A 4BO1A 1P3DA 3IIEA 2X5OA 4ZU3A 1C14A 4ILKA 3U3XA 1YBMA 1QSGA 1ZZEA 2VZ8A 3CSDA 3W6ZA 3TF5A 1U3UA 1W0CA 4MJLA 4B4WA 3ZNQA 1SNYA 3TJRA 4HFJA 4D44A 2DBZA 5G2OA 2E82A 3I5MA 4YJDA 1SCUA 4Q3DA 1B15A 2GCGA 3PWSA 3E8XA 5K0ZA 4ZQBA 1D1TA 3PJGA 1IULA 2FHSA 3R3SA 1NYTA 2X5JO 4MKXA 2G82A 2P4QA 1Z75A 2V7PA 4YXFA 4J1QA 1GZ3A 2JAHA 2Q49A 4B4UA 4OAQA 5B4UA 3NYWA 4F6CA 4YJFB 5DZSA 5U1PA 5DDIP 3AFNA 1N1EA 4PG4A 1AN9A 3B70A 3KLPX 4RORA 4FQ8A 3HB5X 2VRCD 3GR6A 4Z9XA 3GEDA 3WLFA 2W2LD 3K2EA 3D3WB 1OC4A 1RM3A 4IDDA 4B4VA 1BDMA 1C3VA 4R9RA 1RYDA 4CL3A 4UVIA 1Y8RA 2I9PA 4QO8A 4R9SA 3KEOA 2QZ9A 2Y1DA 4CMIB 3ONEA 4BNGA 4LRSB 1DSSG 4BIIA 2D3TA 4G2NA 2DVMA 5L51A 4EZBA 3H5AA 4O0LA 4F6LA 3WIDA 4FIZA 3ON5A 1VL0A 4WLEA 5JO9A 3WGYA 1DDOA 4BO2A 4BNTA 1PJ2A 5L4SA 1A9ZA 3PPIA 2POQX 2WEKA 1HWYA 3DFUA 4HNGA 1ZIDA 1VLLA 4JLWA 3PI7A 3V5NA 1Y8QA 1QLHA 2HMVA 3IQDB 4XCVA 3RUAA 4A03A 3UUWA 3GVXA 3ROPA 1Z73A 2CUKA 3PTZA 1L7EA 3OJFA 5DBGA 4LMRA 4ALKA 4FGWA 4BOYA 4K9DA 4OO3A 3ZNPA 3KYCA 4TZTA 3TWOA 3AY3A 3IOYA 4N5LA 4O6VA 4IDCA 1GTMA 1MFZA 1A7KA 2DLDA 2VHXA 1OBFO 1PJ4A 1W4ZA 2P5UA 2Q4BA 2UDPA 1ZJYA 1R16A 2R6JA 5ER6A 1AXEA 2X8LA 3F6YA 4PG6A 3WGGA 1GY8A 3VH2A 5IF3A 4CR6A 5BR7A 4OL9A 1I5RA 3BMCB 4DYDA 3JQ6A 4XIJA 4TVBA 3CH6A 1HXHA 3R1IA 4KWIA 2EW8A 4MKZA 4BGIA 4E0BA 3G1TA 3ZWMA 5CFZA 4WJZA 5IN4A 2NU9A 4PLGA 4YR9A 3JQ9C 4O1MA 4WNCA 1HF3A 3M1AA 3S2IA 2DTEA 3ZNNA 4L75A 1YS4A 4KTVE 3FWZA 3QVTA 3RWBA 5DBFA 3JQDA 1VJTA 5COQA 4PLTA 1B7GO 1HKUA 3HZZA 4OJNA 4OOFA 4UUPA 3U4HA 1NWCA 1GQ2A 4GLLA 3U4CA 3JQFA 3MZ0A 3ZGYA 4G65A 3BTVA 3GNSA 1QYWA 3DAPA 2AQKA 1HL3A 3ANLA 1XG5A 2VYVD 2AQHA 2VYNA 1YH3A 1N92A 1PJLA 1N7GA 4CMEA 1VPDA 1ADGA 4PZEA 4WOKA 5BSGA 5COAA 4IJUA 3HNPA 2A92A 3RVDA 2NQ8A 1Z82A 4R69A 3G17A 3SLKA 4E12A 2IZ1A 2B36A 2GYYA 1FDVA 2QYTA 2Y1EA 4BUCA 1HSZA 4N5NA 3K6JA 5H83A 1EQ2A 3OICA 4HX5A 4U0JA 5KNLA 4OSPA 1YONA 2NADA 5KKAA 4DTIA 1UP7A 1H93A 3WNQA 4CM1A 2GNAA 3IDSA 4RVHA 1ZK3A 3HUDA 3ZCXA 4AJOA 1C0KA 1M76A 4BO5A 2BLLA 2GO1A 3WR5A 2QX7A 4W9NA 3L0DA 2JJYA 2BGLA 3PWKA 1PGPA 1O95A 2AQ8A 4AVYA 1P9LA 1T24A 4CUJA 5KJEA 2JHFA 2FY8A 5IZ4A 2Y93A 3NT4A 1PQWA 1HZJA 5GZ6A 3OEYA 3BHMA 1PIWA 4DIBA 3UH1A 3PQEA 2I3GA 4ZJUA 3RC9A 2J5KA 5L7TA 3FI9A 3ITDA 1T25A 3AW9A 4JN6B 4L76A 5JW6A 4RF5A 4GQAA 1LSUA 2Y05A 3UCFA 4LCEA 2WDZA 4H16A 3VZSA 1B8VA 4XIYA 5HM8A 3AU9A 5BSFA 4E4YA 4L74A 1PZHA 2H6EA 2VZ9A 3PHIA 4L8VA 1DO8A 3GHHA 3NJ4A 4GGPA 1LLCA 2RHRA 3L07A 2E48A 3GRKA 4GGOA 5F1KA 4CLDA 3AFMA 1XWFA 1JKIA 2J6IA 2G1UA 3G49A 4FGSA 4NDNE 2W4QA 5EMHA 5IFLA 1G0OA 4LCJA 3INRA 3KETA 1A71A 2ZTLA 1JU9A 3UGKA 4J90A 1YVEI 1SC6A 5CG1A 2DUUA 1NAIA 3FNHA 4FC7A 5IDYA 3DR3A 5KTKA 1CDOA 3FBTA 1Y6JA 1UDCA 3VKUA 1E3EA 4FFLA 4HNHA 3U62A 1KVRA 3ZWPA 4GAEA 5TJ9A 2GLXA 2X6TA 5THKA 1MUUA 2E49A 5FFFA 3FPCA 1ID1A 1CEQA 3GA0A 4CUKA 1LLDA 4D0SA 2HUNA 1VKOA 3CZMA 1EQUA 1Z7BA 1DEHA 1DHTA 2PK3A 1E1KA 1LRJA 4CV1A 1H5QA 4YVFA 3D3EA 3SVTA 2JHGA 3CIFA 4BO9A 1X7GA 5ES3A 4I9NA 4R5HA 1B0AA 3E9NA 3VVCA 4J3FA 4NU5A 4J4TA 4P4GA 1B16A 2AEJA 1KIFA 1ULUA 3QV1A 2IZZA 1AHHA 1U28A 3ST7A 5T67A 1XYGA 1K6IA 4CMIA 3QSGA 1SOWA 3F47A 3CTMA 4D7AA 3O8QB 2XXBA 3FNGA 2WE7A 1Q2XA 3FTNA 2VHYA 1QR6A 2EXXA 4WKGA 4TQGA 1SB9A 3ZHYA 1LTHR 4DBVO 4AFNA 4XQCA 5FF9A 2J3HA 3V2UA 3PP8A 5BT9A 1U8FO 2YDYA 3IUSA 5A9TA 1XEAA 5CDTA 4BO6A 3HN7A 4KUHA 3HHPA 2YFHA 6LDHA 1NHWA 3P19A 3UW3A 4MPDA 1MGOA 3ZWYA 5JMWA 3RBXA 3ZWVA 1TVEA 1Y8RB 1IHXA 4FFPA 5IZCA 3IKTA 3JQAB 3AOEC 3RUCA 4JBIA 4RPGA 2E4AA 4NJMA 4K1LA 3WOHA 2OFPA 4HUJA 4IGEA 4XQ9A 3DOCA 4EEXA 3ETDA 3K30A 4Q3AA 1MC4A 1SPXA 2D8AA 2D2IA 4E33A 1SMKA 2O3QA 3WGZA 1JN0A 3PGJA 1KS9A 4J7CA 4EI2A 3F1KA 1PJ3A 3NDRA 4OH1A 3AOGA 5AXCA 4J1TA 1NXQA 4RVFA 3IC5A 3H9QA 3WB9A 3KZVA 4MINA 2DAPA 4J9VA 3I6QA 5KOIA 1P45A 1VKNA 2BELA 1K89A 1NAHA 3ZW9A 4KUGA 1CRWG 3JQ9A 4R5MA 4PLPA 4I5FA 2FOIA 3ADOA 3MTGA 1ZSYA 4P22A 1DIRA 1DOHA 1EE9A 2BFOA 2QHXA 4MVJI 5LCXA 2D5CA 4A7PA 2HKIA 4YB8A 1T2EA 1HLPA 1GCOA 3DDNA 3JQBC 2GN9A 3GGGA 4BNIA 5JNLA 2PGJA 3FBGA 4Y6PA 1PJQA 3QWFA 3ZWWA 1I8TA 1BXKA 2OBYA 4Y98A 4FC6A 4E5YA 2GDZA 3DEYX 3BMOA 3V8BA 2UUPA 4E5KA 1EVYA 3FHLA 1BW9B 3AI2A 4YDRA 3Q3CA 2CMDA 1RM5A 4IXTA 4FB5A 2VCYA 1I0ZA 3O38A 4WLVA 4X54A 1CQJA 3JYNA 1ORRA 5AXBA 1KY5A 2YDXA 1UXHA 3DMYA 3NUGA 1JW9B 3UF0A 4DIFA 1OZAA 4TVOA 1VE9A 4NZ9A 1PU2A 1KC1A 5GY7A 2AE1A 3BTSA 3G1UA 4PLZA 5CP8A 4PG8A 3ANNA 3UCXA 3PQFA 1X0XA 4GI2A 2WWRA 4DQXA 3FR7A 4NJMB 1Z7EA 3DTTA 4IS3A 4YQYA 4YACA 1UUFA 3ZN2A 3JQAA 5J23A 3GG2A 3U0BA 1AE1A 3KXDA 4QO7A 4C4OA 4XRRA 1MFPA 1Y7TA 1E3JA 2FN7A 4ALNA 3ROQA 3IMFA 3JQ7B 3RJ9A 2ZKLA 1PEDA 2E6UX 1U5CA 3VKVA 5CDGA 5JDCA 1E3WA 1LLUA 4XB2A 4FFOA 9LDTA 4ITUA 5DCUA 5T6BA 2OZPA 3JD3A 4YRDA 1DFGA 3GGPA 2OORA 1PQUA 3GLQA 2IYOA 1XIVA 1DIGA 5H81A 4HXYA 3TZCA 2Y67A 4EITA 3DMTC 3ZWNA 4URFA 3QP9A 3TL3A 2F00A 4P8RA 2P91A 1DPGA 4XYMA 3DBHB 4Z3DA 3ANMA 3VH4A 2VNSA 4IGFA 2NV6A 3V1TC 2AA3A 4BGVA 4IDEA 3TOZA 1J6UA 4AL4A 4E32A 1CJCA 4M54A 2X9VA 2A9FA 2X0RA 1HDCA 4CLOB 1HDXA 3OH8A 4ZQGA 3AM3A 2RBEA 2QG4A 2PA3A 5AXDA 2B4QA 3DXFA 1I2CA 4C7JA 4CM4A 1TT5B 3F5SA 5CPFA 4IQ0A 3PDJA 1BVRA 4AJ2A 4CLHA 1E6EA 5IDQA 3CPSA 1BXGA 4K26A 3WICA 2D59A 2Q1TA 1U7TA 3DONA 4G5HA 4MKRA 3FPLA 3ZWOA 2HJRA 2HRBA 3O4RA 4MIEA 1NX6A 4E30A 1WPQA 5HS6A 3WLEA 3QVXA 4FSHA 1R4MA 2ZB8A 4HFNA 1YDEA 4QEDA 3DB2A 3NEPX 1NPYA 3JTMA 3PIIA 1SBYA 4NQZA 2Y99A 1MLDA 5DULA 1T4BA 5DBIA 1E3LA 1P1IA 3U5TA 1U4SA 2ZB7A 4W99A 1PWZA 4I5GA 5B12A 3BMNA 1KC3A 3HSKA 1ZSNA 3JYQA 3NT5A 3ZV4A 4RZIA 1NVGA 3B1FA 4RF2A 2C2YA 4I08A 3WGTA 4E2XA 3DMTA 3BA1A 1RM0A 2X0JA 9LDBA 2BFMA 4JBGA 1I01A 2WTBA 5I8ZA 1JAXA 3QW2A 3B6ZA 1D8AA 3EZLA 5L4LA 4GH5A 4DLBA 2JD0A 3GZNA 1A4IA 5JY1A 1KYQA 2YHIA 1ISFA 5F3RA 1YB1A 1P44A 4M87A 3KSDO 4D46A 1YQGA 1E92A 3D4NA 4WCFB 4YAJA 1PS0A 2EERA 3K5PA 2ZTMA 4DLLA 1KVTA 1YQXA 1FXSA 2A4KA 3OIGA 3H7AA 3PRJA 2W2LA 4A27A 2IODA 4J7XA 1E7WA 1BXZA 5JCXA 5TT0A 1SEVA 1CYDA 4BNNA 1GEGA 1OFGA 2X58A 4BS9A 3OQ6A 3GY0A 3ETEA 3MJCA 3ONFA 3LLSA 4ND2A 4EGFA 3DL2A 3RASA 3WYEA 2E37A 4ZN6A 2X7HA 3NJ8A 4R68A 3H9EO 1W8DA 1V0JA 2IXAA 1QYDA 1DXYA 3E5RA 1K5HA 2C07A 5ILOA 3F4LA 2PD4A 4D3FA 4CMAA 5GZ3A 1DFIA 4IJKA 4MVJD 3DQPA 5H82A 1VC2A 3ZU2A 1V3TA 5KWEA 1DC6A 4PIVA 1LDEA 1UDBA 3NTOA 4O59O 3RAJA 4E2ZA 2ZCVA 4IUYA 4PFJA 5JLAA 3W4JA 1YJQA 4RPLA 1E0DA 2EF1A 3NT2A 3M1LA 1ISMA 1ML3A 4BNZA 1TA4A 3QQPA 1E6WA 4MIOA 4YJGB 1IUKA 4I9HA 4BNYA 2PD6A 3TQHA 4BNMA 2VWGA 2AE2A 2RIRA 3L4BA 1HYGA 1YL5A 2Z95A 1NWHA 1GZ6A 3KB6A 3IAHA 1Y81A 3BHJA 3EMKA 3A1NA 3KO8A 4Z3KA 4LRTB 4Z9YA 1V3UA 4LVUA 1WXDA 2I76A 4DPKA 1RKXA 3T7CA 2X9GA 2YZ7A 4CMKA 2XAAA 4E5PA 3PJDA 3WG9A 4CM4B 1UXKA 4O5OA 1EUDA 2ZATA 1MV8A 3WQRA 3BHIA 3S55A 4S1VA 4ZQEA 1EK5A 7MDHA 3QVSA 5HRUA 4RCVA 4OXKA 3F9IA 3K96A 4HY3A 4DYVA 4R1NA 1T26A 1IZ9A 3VPHA 1LXCA 3VPFA 1UJMA 1F17A 3Q2KA 4J7UA 1PGQA 3D64A 2R2GA 3GAFA 2PZLA 3GZNB 4MVJM 3AWDA 4DPLA 4CLOA 1LSJA 1Q0LA 3CUKA 2O3UA 2X86A 2PKQO 3MEQA 4EUHA 5ICMA 4BNFA 2Q2VA 3M2PA 4OXNA 2B69A 3GPIA 1Q7BA 3OJOA 4QTZA 1EDZA 3GNQA 4N7RA 1GV1A 5U9CA 3L77A 2ZB4A 2WM3A 4J1NA 4BNKA 4XB1A 4BHTA 2EKPA 3U49A 1GAEO 5JSFA 1LDGA 1LDNA 4N5MA 2Q4EA 3MJVA 3AM4A 3QLJA 3TZKA 4TKMA 4FFMA 3WX0A 4E5NA 4Q3BA 1GYRA 2WSBA 3JQ8A 5A05A 3VHRA 3OF2A 3EZYA 5JYEA 1SEPA 4FOSA 4Y67A 2FR8A 2V6FA 3QRWA 5EQFA 2X5KO 3QA9A 1NFQA 4U7WA 1HTBA 5ENDA 2HQ1A 1Q7CA 1M6HA 3L6OO 3EC7A 4L4XA 4DRYA 3CKYA 3DAGA 4PLHA 3BMCA 3VPGA 5F1PA 4U0KA 1JWBB 3X2EA 1FDTA 3CXRA 2C59A 5TF4A 1E7RA 3GDGA 4WEQA 3ZH2A 3E1KA 3GC6A 1WWKA 1EEHA 3SJUA 4XD2A 1R0LA 2GZ1A 1JKJA 5T64A 3E9QA 1X7DA 2BF7A 4IM7A 2Q2QA 2HMWA 1YQDA 2HRZA 2DU8A 3WYBA 2QRLA 1GL3A 3I52A 2X0IA 2EWMA 2CY0A 2GR9A 4RPKA 4DGSA 4M55A 5KVSA 4YT8A 1E3IA 1GUYA 1ULSA 4Z9FA 3ROMA 3DZIA 3P2YA 3PJFA 5TC4A 4CM8A 4HV4A 4YRAA 4JP2A 2J3JA 4K28A 3TN7A 1U4OA 3IP3A 3Q2IA 4R41A 5BNIA 1RWBA 1PJCA 4WGGA 3WSWA 3WGOA 1NPTO 1R4NB 2FPPA 2PY6A 4DVJA 3GN1A 2NNLD 4GVXA 2O3RA 3INGA 3GDOA 3I4CA 2JCXA 2CVZA 3GMDA 3DOOA 2GF2A 5C37A 1B8PA 1BW9A 1X0VA 3L4BC 4BO4A 4CR8A 1PR9A 2B0JA 2VUTA 1E3WB 2QIOA 1O5IA 5TIIA 3QWIA 4R3NA 1LDMA 3DZJA 1YJ8A 4ROSA 3WTCA 5F5LA 4D3DA 4INAA 1ADBA 2FZEA 3M6IA 1Z6ZA 5ILGA 5B4TA 4S3MA 3MJSA 3B1JA 2LDXA 2NU6A 2C2XA 1AXGA 1TT7A 1WDMA 2BMAA 2GGSA 3DBLB 4BGUA 4BO3A 2FR0A 3C85A 5JMPA 2I99A 4J2OA 3RUFA 3VH1A 2ZJ1A 3FNFA 4BNWA 1M6WA 3DZFA 2C54A 3DBRB 4EEZA 2TMDA 3KHUA 2FRDA 2YQ4A 3C7AA 4H15A 4IQGA 4PCVA 1GUZA 3RBZA 1QRRA 1VSVA 1QYXA 4BV9A 4ZRNA 5T8KA 1A5ZA 3MWEB 3BXXA 4IIUA 3A9WA 4WNIA 4R1TA 2JKVA 4I5DA 2Q3EA 5EINA 1V6AA 1DAOA 4XDZA 4Y6RA 2H1SA 2XXJA 2W90A 4G81A 4RLSA 2H5LA 4J9UE 3TSCA 1DRUA 4DXHA 5I7SA 2QYSA 2Q45A 3RBVA 1ARZA 5TT1A 3M2TA 3H3JA 3SXPA 1X1EA 4OM8A 4TKLA 4U5QA 5G0WA 2Q1SA 3TL2A 4CMHA 5DP2A 2YV1A 4PLCA 1NQTA 3GVCA 3DHNA 5BSHA 4XZ3A 5A5FA 3H9GA 1DIBA 3I9LA 5EIOA 1N5DA 1J49A 2XOXA 1BRMA 2ILTA 5C5IA 3MWDB 3O8QA 1SB8A 3W4IA 4M1QA 5CEJA 4MVJH 5JPIA 3DOJA 3GQVA 4NH4A 3H3FA 4YBZA 2ZTUA 5C3MA 1WVGA 3JQFC 2Y1FA 4CM5A 4D42A 5I9MA 4Q9NA 1C1DB 3ZHBA 5TSDA 1CF2O 2BD0A 1VI2A 1PZFA 3MJEA 3RUHA 2UVDA 1NASA 4GX2A 4LK3A 3F46A 2PZKA 2GSDA 4EUFA 1PS8A 2D1YA 2HK7A 1UXIA 2B5VA 3RU7A 1LQUA 3WS7A 2Z5LA 5L95A 3QVOA 1JVSA 4HBGA 1K6JA 3EK2A 5TLSA 2C5EA 3QHAA 1U8XX 1PGNA 1GYPA 3LC7O 4QFCA 1IY8A 5EESA 1GUFA 3HN2A 1O0SA 4UUOA 1X7HA 1NR1A 3RIHA 2GRAA 4GWKA 4RL6A 5I9LA 3QY9A 3RFXA 4R3WA 2JCVA 1ZSVA 3I3OA 2AW5A 3S8MA 1ZK1A 4IS2A 5B37A 3NDIA 4RPHA 2F1KA 2NVBA 4NK4A 4BV8A 4IJVA 1TB4A 3U4DA 4LW8A 4EJ0A 1NR7A 3OJEA 2PGLA 1HDRA 2EP5A 5U4QA 3GUCA 2ZTVA 4L0QA 1D7OA 1NTOA 7ADHA 1Y1PA 1H9AA 2J5RA 2JD1A 4UEOA 4UEJA 4ZRMA 1F0YA 3I9KA 5K9ZA 3F5QA 4MVJA 3SLGA 2ZJ0A 1PSDA 2GASA 3RJ5A 4XR9A 4UAGA 4TRJA 5EPOA 1YL6A 4DC0A 3RKUA 3I6IA 4ND1A 1UZLA 2X23A 4R1SA 4OXYA 4MO2A 1E7YA 1RPNA 4B7XA 1R37A 2QZZA 1HDZA 1A9YA 2G5CA 3KSZO 4ND4A 1O6ZA 3HDYA 2O3JA 4XWYA 2VUSA 5KCZA 4MIYA 4JROA 3PZBA 3AM5A 1M66A 2R00A 2VOJA 2Z1NA 3H2ZA 3AI1A 4J49A 1HE4A 1NQ5A 2J5QA 5T57A 4OIMA 1BDBA 3JQEA 3C1TA 1KEUA 3LSYA 1LDYA 4ZQHA 2PZJA 3WGIA 1PL8A 2Y0DA 3LQFA 3LT2A 3W8EA 3ZWAA 4DA9A 4QUKA 3W4KA 4E2YA 3K31A 5FEUA 4D0RA 2CVOA 2AEFA 2VWQA 2UV8A 4RV9A 2DTXA 4NFSA 2J3IA 1EVJA 4CLEA 2JFFA 4OYRA 4II3A 3DZKA 4JJFA 3VH3A 4DL9A 4F3YA 4CV3A 2DUWA 4PVDA 4IPTA 1DJNA 2RAFA 1NM5A 3U09A 2O23A 4CR7A 5IXSA 1XELA 4W82A 4IQ8A 3TNLA 1MX3A 2WYUA 3C7DB 4BNLA 3AY7A 4WOJA 2VWPA 3RI3A 5EN4A 2FPIA 3WDSA 3HG7A 5L53A 2VZ0A 4NFHA 1ENZA 2P9GA 3LDHA 4PRLA 2OGUA 1ISIA 3AJRA 2DBRA 3ZWBA 3C7CB 3FR8A 4F45A 3PGXA 4RVDA 2B37A 5KJCA 2I5PO 2NM0A 1V8BA 1Z74A 1JVBA 2ZIZA 1N9GA 1YRLA 3AY6A 4CQLA 3AU8A 5HTOA 1I2BA 1ZK2A 3ABIA 3WFIA 2VT2A 3CMCO 3TZ6A 3VVBA 1D3AA 1ZVMA 1MG5A 1K0UA 1WNTA 3P2OA 1BXGB 1T2FA 3FTPA 1F8GA 4AJEA 3WJ7A 1YXMA 2Q2WA 5KVVA 3HDJA 1P1HA 4JXKA 2YHIB 4NBRA 3JV7A 4TROA 4BKPA 3S2GA 1SZJG 4XGKA 4B7CA 3EHEA 4YPOA 2NTNA 5HBRA 4LMPA 5AVOA 1TXGA 3OM9A 3WQSB 1DHRA 2FSVA 4CM9D 2GN4A 4BNHA 4BO0A 1I24A 3H5RA 4CQMD 3L6DA 5A04A 3BMNB 3ZW8A 5DF1A 5IDWA 3UVEA 2UYYA 2CDCA 2AHRA 2WYWA 4CM9A 5JAIA 4KOAA 3K9QO 5TNXA 2YV2A 5AOVA 1M2WA 4UUMA 3OETA 5T8KC 3DC2A 3N74A 3R3JA 1IE3A 4MP3A 2OXIA 3KTDA 1YWGO 3GVIA 4GKVA 4ZQFA 2PKQP 5IJZA 1TEHA 4IZIA 1ISJA 1GEEA 1EUCA 4BQRA 4UVHA 4D43A 2ZYDA 2EHDA 2HO5A 2NU7A 3JQGB 2IDZA 4LVCA 5ER9A 5C7OO 4CM7A 4RLHA 5L4NA 4NHEA 2NQTA 3TFQA 4YAIA 1B26A 3UHAA 3IL2A 4ZVVA 4DIOA 5A06A 2LDBA 4EJ6A 3D7LA 4P4LA 3HADA 3KOUA 1K6XA 1R4MB 4AJHA 5JDIC 2BGKA 2CD9A 2EJVA 3ETGA 4RVSA 1X13A 1P77A 1UP4A 4CJXA 2CZCA 3CZRA 2FMUA 2Y1OA 4W7HA 5KVQA 3PFFA 1QKIA 3ZDFA 2C7VA 4ALIA 2OP1A 1GFSA 3DBRA 3VZQA 4JK3A 3UKOA 3VDRA 3LK7A 2H63A 4M49A 5L7WA 1UZNA 3PYLA 4RQUA 4YYZA 3WWYA 4J6FA 1DJQA 1A7AA 4AJ1A 3H9UA 3AUAA 1SO8A 3NTQA 1IYZA 4NNJA 3RQSA 4YEDA 1YL7A 1I3KA 3GVPA 5G4KB 3RFTA 2FR1A 3WWZA 3ZV5A 3PIDA 4DBZA 3Q6IA 4I5EA 4YJHA 2ET6A 4J0FA 1C1DA 1KBZA 1ONOA 3PZRA 5GMOA 4QECA 4DWVA 1LQTA 3H6KA 2D4AA 4NK5A 4CV0A 4K6CA 1G6KA 3EVTA 2FSSA 4AJ4A 4AJKA 3DBHA 3GEMA 3C1OA 3DZHA 4YT5A 1HZZA 3HJAA 3WGHA 1EK6A 3HE3A 3VZRA 2PV7A 3BZUA 5JDIA 1RJWA 1IPFA 1JLLA 1NVTA 1QLJA 1LSSA 4L4SA 1DLJA 2C82A 4EW6A 4CL8A 5K6AC 3OMLA 4R51A 2GPTA 3JD4A 1A4UA 1HT0A 3IP1A 3R6DA 3GMSA 4WASA 1MXFA 4PG5A 2NTJA 2IXBA 3T7EA 8LDHA 1T1RA 1T2AA 2Q1WA 4GWGA 4NFYA 3E82A 3ZWCA 3TDKA 4CLXA 1BWSA 5G0UA 2VHVA 4RF4A 4YTEA 2DPHA 3K92A 3PHJA 2NVWA 1ZNQO 1NPDA 2CDBA 1ONPA 1U3WA 3FWNA 5A3JA 4BKRA 3K8ZA 3V2GA 1EZ4A 1IL0A 5IN5A 4A2CA 4FCCA 3D3WA 4UVDA 4WK6A 4NBVA 3AI3A 4A10A 1YOVA 4FOOA 3KBOA 4Q3EA 2RHCA 4UVGA 5L45A 5KKCA 1RYEA 1G1AA 4AICA 2YQ5A 1UR5A 1AGNA 2WD7B 4E13A 1P0FA 3D4OA 3LT1A 5IG2A 5I7FA 1UP6A 2ZQYA 2JFGA 4FJ2A 4CMBA 2P9EA 2GN8A 2Q99A 3WBBA 1M75A 1B3RA 4JBHA 1ZK4A 4YCAA 1E7MA 5T5QA 4OKNA 3JQ8B 5THQA 3JSAA 4UVEA 1CWUA 2Q50A 3QE3A 4MVJP 4LN1A 2EGGA 3G79A 3RSHA 2WE8A 5JAQA 5IAAA 1CQIA 4NBTA 5EQDA 3PVZA 1UXJA 3GRPA 1E77A 1FF9A 3Q0EA 3GEGA 2B4TO 2HDHA 4YJHB 1LLQA 5JC8A 1C0LA 1XLTA 2PFGA 1JA9A 3UICA 5L3ZA 4K6FA 3GNTA 2X1HA 1H9BA 3ASVA 3O9ZA 4IY1A 1PGJA 2RCYA 4TWRA 3TFOA 1P33A 1QYVA 4BQPA 1I2ZA 2D0IA 3ASUA 3N58A 2BH9A 4N54A 4BB6A 2HLPA 2HJSA 1LC0A 2G76A 3TZHA 3WQQA 1GPDG 2EJWA 1H2BA 4GLOA 3JD0A 1W6UA 2FPGA 2UAGA 2VYND 3X2FA 3DAFA 1BVUA 1VRWA 4MP6A 5A02A 5JCJA 1ZO8A 1R4NA 1DB3A 3V1YA 1JQBA 3SX2A 4M8SA 4B3JA 1BSVA 3K73O 3T4XA 1XU9A 3PLRA 1X15A 1Y9AA 1WDKA 1DC4A 3PYMA 3GUYA 3ROKA 3WBFA 4BKUA 3DO5A 4R4JA 1NNUA 1ZK0A 1MXHA 4KUEA 1C0IA 4J4HA 1E1LA 4AJJA 2I65A 3SC6A 4CMCA 1E7SA 4YQZA 3NDJA 2GN6A 2NWQA 1XQ1A 4BKOA 1R66A 3PDUA 5LC1A 2CNBA 1LX6A 2GERA 1EVZA 2JAPA 4CUZA 4NPCA 1V9LA 3LLVA 4BL5A 4XYLA 5BNFA 2O3SA 1ZBQA 3TRIA 1L7DA 1Q1NA 2CF5A 2R00C 4CQMB 1DRVA 5A9RA 4W4TA 3WMXA 4PRKA 1GCUA 1ZFNA 3D1LA 4R01A 1YGYA 2W2KB 3UXYA 1Y5RA 4J16A 3FD8A 2ZYAA 1C1XB 3QJ5A 4XDYA 1UXGA 3LVFO 3VDQA 3I23A 4Y8VA 3RUDA 3UCEA 2ZYGA 4R16A 2O4CA 5A3VA 1M67A 1XDWA 2AG5A 4ZD6A 1DAPA 1JWAB 4EBFA 4NJOA 3QWHA 1GZ4A 1EDOA 3G0OA 4WUVA 1NFFA 3OECA 4DPMA 4BMNA 2Y0EA 1XGKA 1XSEA 3KUXA 2NSDA 5C7LO 5I7EA 3RUIA 1X14A 3VTZA 4FD3A 2VN8A 3KYDB 1ENPA 1PR3A 4QFDA 4JGBA 3SEFA 4B8ZA 1T2DA 1I32A 4GBJA 5K6AA 3FRJA 2SCUA 3IJRA 4XRGA 1AUPA 1LRLA 5TX7A 3OEWA 1WZEA 4IDFA 5TQVA 2JCYA 4FFRA 3JYLA 2AQIA 4JIGA 2BFPA 4PN3A 4FR5A 4O63O 2JFHA 3E18A 3NGLA 2W98A 2AMFA 4XR4A 4JNKA 2X0NA 3EW7A 1H0KA 1U3TA 4FN4A 3S2FA 1FMCA 1GR0A 4GVLA 3VPXA 4MVJE 4XQGA 1K3TA 4XKJA 3RKRA 3FN4A 1HDYA 4BNJA 1LI4A 1VL8A 3OP4A 4TZKA 4Z0TA 1ZKMA 3GF4A 3LT0A 4CLRB 2IZ0A 3JQGA 2O4UX 3CMMA 1VM6A 1SOVA 3DWFA 4GL4A 5EL0A 4B79A 4OHUA 4GMFA 4GX5A 4YAEA 2AG8A 2PNFA 4WEOA 1T1SA 1HEUA 2V6MA 4NR0A 2VNAA 1IZ0A 4H7PA 4BNUA 2AXQA 2FWMX 1ZCJA 2CFCA 2GZ3A 2PKRA 1U2DA 3S1LA 3ULKA 2JL1A 2AEMA 3GFBA 4CMJA 1E1NA 1T2CA 3D0OA 4FFNA 4W6ZA 1PJSA 4AJNA 1QP8A 3GPDG 5DCWA 1BMDA 1H94A 2BI7A 5CPBA 2A94A 4PLVA 5TJHA 2VHZA 1EMDA 4WLFA 4YWJA 1MP0A 3WXBA 1QXSA 4CV2A 5EJ2A 4ALMA 3ZU3A 3NKLA 1DRWA 2DM6A 1XA0A 4E3ZA 5KIAA 5A5EA 1VJ1A 1E6UA 2EP7A 5ENVA 3VPSA 3HDQA 4NMHA 1O9BA 2YUTA 3ZU4A 5KVCA 1PTJA 1A27A 2DQ4A 4HFRA 1HSOA 3GT0A 3RUEA 2EG9A 4KDFA 2NU8A 5EERA 1XR3A 2V65A 3AUUA 1XU7A 4DMMA 3ADPA 3JCZA 2WYVA 3Q11A 3FF4A 5GZ1A 4JQCA 3LC2O 4U8GA 3UFXA 1J0XO 5I7VA 1Q7GA 3JYPA 4KQWA 4PG7A 4OMUA 4JCOA 4EUEA 4P38A 3CINA 3DFZA 4BGEA 4J4BA 3UN1A 4IDAA 3R0IA 4M86A 4DLAA 2ZB3A 4ZHSA 3IUPA 4CPDA 3B20A 3RFVA 2VT3A 5ICSA 5JCJD 1MB4A 1FK8A 3ITKA 2DBQA 5G0TA 3HB4X 3D5TA 4XYEA 3EAGA 4BB5A 1G0NA 1HDOA 1H6CA 4FJ0A 4RZHA 3COSA 3LF2A 5DCYA 4C7KA 4HADA 2NLOA 2A35A 3HFSA 4WCFC 4ESOA 2X22A 1PX0A 3I83A 2Q46A 4L4RA 1ISHA 1WW8A 1MA0A 3TOXA 1I3NA 1HETA 4HWKA 5IXYA 1DC5A 4NBUA 3GK3A 2O2YA 3KV3O 5FWNA 1Z45A 4TRRA 3BMQA 2ZQZA 4F46A 1QV7A 3PLNA 4PLYA 1V35A 3W8FA 3JD2A 1F12A 2DC1A 4E31A 4EDFA 5B1YA 4Z0HO 3MTJA 2D5AA 2RH8A 2WJPA 4TRNA 3VAZA 1IOLA 1B3BA 1KEVA 1A72A 2DT5A 3DBVO 3ZV6A 3T4EA 4D79A 5A9SB 3I9MA 1DLIA 1YDWA 3JQBA 2J3KA 5I8WA 1KEPA 1DFHA 3PFWO 2PD3A 4H3VA 4IBOA 4YJFA 1B14A 1LEHA 4J2HA 1KETA 5DP1A 5JAZA 3NTRA 2YY7A 2NTVA 1P1FA 2DPGA 2OMEA 4FPXA 2WD8A 1PZEA 4PLFA 5CEFA 4RVGA 4KP7A 1ZH8A 3I1JA 4TSKA 3EVNA 2PGDA 3DTYA 3AK4A 4WCDA 4A26A 1KVUA 4TMFA 2UUOA 2G17A 1PWXA 2BRUA 2H9IA 4IXWA 2PH5A 3DZBA 1OMOA 1HE5A 2CF6A 1HYEA 1R6DA 3ENKA 5JE8A 1GDHA 2PWZA 4R54A 3O03A 3G3EA 3WJAA 5KJ1A 2PR2A 4UUNA 2YV3A 4DREA 4XEHA 3ZHXA 3OJ0A 4UREA 4Z0PA 3PHHA 4OOEA 4D41A 2VUUA 2W2KA 4QX6A 5DOVA 2EIHA 3P7MA 1OAAA 1LBEA 4XJTA 4BNXA 5TGDA 4I9UA 4AJLA 4WLNA 4BO7A 5F21A 3D5QA 5JC1A 3SJ7A 5HWSA 1PQPA 5DNAA 2PZMA 4QSMA 1U5AA 2EGHA 4BMVA 3DZGA 2YJZA 1NP3A 3NV9A 3KEQA 4J0EA 4YRBA 4YT4A 1E7QA 3AOEA 1JDJA 2C7GA 2OUIA 3E5MA 4II2A 3OIDA 3TPCA 4DUPA 5IZCC 2O50A 3Q9UA 4BO8A 1ZW1A 4RPJA 4IJWA 2OHXA 2VTDA 4OSOA 3RC1A 4AG3A 3W6UA 2I6TA 4AJIA 4EJMA 1YB5A 2C20A 3I9JA 1QORA 1NBOA 3O26A 3QWAA 3EYWA 3BTOA 4B7UA 1UZMA 4Y6SA 3ORFA 4AJPA 3HDHA 4GKBA 3C3XA 3QWBA 1I3LA 1BHSA 3JQ7A 4BVAA 1I36A 1GV0A 4RF3A 1LJ8A 3WSVA 1PL6A 1PGOA 3SC4A 1Q0HA 1OOEA 3JD1A 1H2HA 4MDHA 3BIOA 3DBLA 4XX0A 4IDGA 3WTBA 4GX0A 5K1SA 2P68A 1FDUA 1QV6A 3B1KA 3KYBA 2YYYA 2WD7A 2NVUA 1EUZA 4QQRA 1K2WA 2HU2A 2VTEA 5TS3A 1P1JA 5JBIA 1KVSA 2IEBA 3RC7A 3ENNA 3Q9NA 4WE3A 3H5NA 1YOVB 3ZI0A 2G0TA 5AXAA 1LC3A 1AHIA 3V2HA 1DC3A 5DOZA 1GU7A 2O7SA 1WDLA 4L9RA 3H4VA 4Z6KA 3MOGA 4WPGA 2ZK7A 4TRMA 5TRTA 3BMOB 1ENYA 1DIAA 5A1TA 1N7HA 4CM8B 3KVOA 1GQYA 1PJTA 4CMGA 3OQBA 1S7CA 1JTVA 3H65A 3KRTA 2I67A 2IRWA 2QRKA 3PHGA 3SBOA 4ALLA 2O7QA 3F1LA 1U2GA 1WP4A 1N8KA 5G4KA 1O94A 1CERA 1ZMOA 1E5LA 5A03A 2OL4A 4LSWA 4HKTA 1IB6A 1Y5MA 4L73A 4U6QA 1ONNA 5KJFA 2O3TA 4J1SA 2FZWA 4DC1A 2YHUA 4E5MA 3PQDA 1O89A 4CM6A 5BSEA 4MVJF 2Y1CA 2BFAA 3MJ4A 1I30A 1WZIA 2NACA 3A06A 3HWRA 4DMLA 3MCVA 2PTGA 5JFOA 1FJHA 3BMQB 3NGXA 2V6GA 2P2SA 4Q3CA 3GFGA 1ADFA 1ZXBA 5FI3A 4LISA 1BTOA 5FYDA 5JY6A 2HK9A 4KTTE 3PWZA 5A9SA 1FDSA 3S2EA 3PHLA 4ND3A 1YBVA 5CDSA 1WLYA 4FW8A 4IZHA 2CVQA 5JDCC 3ZV3A 1E3SA 4RVUA 3EUWA 3FSRA 4W9NC 1XCBA 5LDGA 2OP0A 3W1VA 1R0KA 4FBGA 3Q1LA 3RD5A 1NQOA 1V3VA 3L9WA 4BMSA 8ADHA 3E03A 4BNVA 3U9LA 2HAEA 3QVWA 3BAZA 5ADHA 4GX1A 4KWHA 4M89A 2GUGA 2EV9A 2B35A 3GZ4A 4PZCA 3ICPA 3P5SA 4RO0A 1X1TA 1J5PA 4NU6A 2ZCUA 1NHGA 2IE0A 4UEKA 4IDBA 4XGNA 4HFMA 2NUAA 4UULA 3LT4A 3IKVA 1MG0A 2Z1MA 1ADCA 2IEDA 1FDWA 4CMEC 3AUSA 4PVCA 3RROA 3H8VA 2Y0CA 4GMGA 4ZGWA 3ONDA 4WECA 3OFSA 3GDFA 3F4BA 1LDBA 3GH3A 1NFRA 1PL7A 4W7IA 3JQAD 3GGOA 2J8ZA 2O48X 1ZUD1 4YA6A 4GSLA 1Q0QA 3HFGA 4KDEA 1KY4A 5KJ6A 3WNVA 1PS9A 4NI5A 4Q39A 4B3HA 1KEWA 3K2BA 2JD2A 1N1GA 2DKNA 3CE6A 3ZHZA 2BI8A 5CDUA 5L9AA 1U9JA 5CAEA 1LUAA 1H6DA 5I9NA 1P1KA 4FDAA 3EDMA 1IPEA 2QRJA 1W73A 3OJLA 1S6YA 2C0CA 4GPD1 2DTDA 4YAGA 4CLRA 1HDGO 1GD1O 4CQLB 2HSDA 1EFLA 3MOIA 1E5QA 1UDAA 3NAQA 2OO5A 4ND5A 5HS4A 5L7YA 4E21A 3A4VA 2P4HX 3IJPA 3GG9A 1HYHA 1GADO 1IHYA 1EE2A 4Q3NA 4IINA 1ZMTA 4XJSA 3RU9A 4A5OA 4KZPA 5IDXA 4IMPA 3WGQA 4U6SA 1LA2A 4CM3A 4RGBA 3TZQA 3VOSA 5JXWA 4J43A 2X4GA 1D1SA 2HMTA 1LU9A 5B4VA 1R12A 3PJEA 1D4FA 2P9CA 2YFQA 1B8UA 4JP3A 1SAYA 1YB4A 1R0SA 3KYCB 4JX8A 1F06A 3FCOA 5AQ1A 4B3IA 3PK0A 2DBVO 1E1MA 4ALJA 4E2WA 2Y66A 1RM4A 4IIVA 2EKQA 5G0SA 2C5AA 3KM0A 5DT9A 3BTUA 2VRBA 1UAGA 4KMSA 1OC2A 4D3SA 2B5WA 3U4IA 1CIVA 1U1IA 1Y8QB 2HCTA 3OBBA 4ONEA 4WLUA 4WLOA 1QMGA 5CHEA 5COBA 5CEEA 1NQAO 1P74A 1VJ0A 2EKLA 5LDHA 1N9GB 3LU1A 1GQQA 4QT0A 3OQ1A 2GD1O 3VTFA 1H6BA 1ISGA 4OGWA 5BQFA 2RH4A 1ZXLA 4HP8A 5CDYA 2HK8A 1YKFA 1WMBA 3AUTA 1UAYA 5F5NA 1VL6A 1CETA 2QW8A 5G4LA 1HE2A 1DIHA 2EW2A 2OBNA 3C1AA 3VZPA 1T4DA 4XGIA 5G0VA 2VHWA 4YAKA 4PGFA 1J4AA 4PZDA 3JYOA 1DBVO 1KVQA 1I33A 1YBAA 3GAZA 2TMGA 4XQEA 3ZNOA 1HRDA 3GN2A 3UOGA 1O8CA 1YO6A 2PLAA 3OA2A 4FS3A 4RDHA 4XYBA 4B4OA 3KLMX 3I4FA 1PZGA 3C24A 4NIMA 4CQMA 4DQUA 4YT2A 3BYZA 4EYEA 4YJGA 2BHLA 2DFVA 3DHEA 4FJ1A 2VRCA 1H6AA 4ID9A 2B83A 4OKIA 2O2SA 1YE3A 1NVMB 1ZEJA 1UH5A 3DHYA 4PLWA 3H9JA 5C7IO 3I9OA 3KYDA 2PH3A 1ENOA 5JAMA 1TI7A 1LRKA 1JAYA 3E48A 4MP8A 1F8FA 3L9XA 4MVJG 2FP4A 3H2SA 2HMUA 3WMWA 4RQTA 1BGVA 3L4SO 3NX4A 1P1RA 2I66A 4B8WA 3WYCA 4D45A 1BG6A 3PEFA 4LSMA 3INTA 1TT5A 4LGVA 2XF8A 5CG2A 1EFKA 4OQYA 4XYGA 3NRCA 2EEZA 3I9NA 3PXXA 4XA8A 3C8MA 5JYDA 1U7HA 5A4DA 6ADHA 4J91A 3QIVA 1C0PA 4MOWA 4N18A 1JKFA 3PYXA 5L40A 1OI7A 1ZJZA 1XKQA 4A73A 5HA5A 1GYQA 3V1UA 4P4NA 4WCFA 1B2LA 3LYLA 2VWHA 5FI5A 2OOSA 1Y9EA 3GVHA 2P5YA 2VOEA 1PJBA 1KERA 3LZ6A 3KSUA 5AYVA 4JJGA 2BKAA 2XPCA 1C1XA 5ITWA 3F3SA 3GHYA 2YW9A 1XHLA 1LNQA
chains in the Genus database with same CATH superfamily
5F1OA 2I3AA 1TYEB 2GM5A 5JZVA 2F9LA 2OTCA 3N7TA 3OA0A 1WAMA 3OY2A 3B6KA 1LH0A 4JOQA 2PUWA 1CPYA 1KR5A 1C0EA 3P9CA 4HB4A 2Y1GA 4FHGA 2XZPA 4JBWA 3O1IC 2H4ZA 5ITVA 2MR6A 5FLEX 4M1WA 4POAA 5I7HA 3IEMA 1BVHA 3OKPA 3V7UA 4NCBA 2Q3LA 1Y1KE 3M9LA 4HAVA 5MN5A 4UBOA 4BJ3A 2XKAA 1IBSA 3E9MA 1VE7A 2DWPA 3SFVA 1A5BB 3UXHA 1J2YA 5LIPA 4DCGA 3ACDA 3MTIA 1F14A 3BX1A 2W58A 3H6HA 2HXGA 4QVGA 1RRFA 4G5OA 3ZCTA 4DWOA 3U0VA 5ICCA 2C4TA 3MA0A 3WK9A 4BUJA 4BQEA 5EMLA 3QTLA 5JO0A 3WL7A 1WMAA 4KR0A 3SIXA 3LUHA 3HBLA 4IMRA 4GRDA 1BFDA 4F6RB 1PR6A 4GYYA 4KQ6A 4MA0A 4LVNA 3GFVA 4YO8A 2DR2A 1ZGCA 1G60A 1TK2A 4F4HA 4H35A 5SZKB 4U7GA 2GZ2A 3A28A 2XE8A 3AVVA 1QGYA 3NLLA 4DCSA 1Q3TA 3G8DA 4ES6A 1G4HA 4RDIA 4RIEA 4JI0B 5D86A 1SHJA 5C35A 1JKXA 2V96A 3BVPA 4ZU1X 5ALTA 3RC3A 1KOGA 3QU4A 3VUEA 2CDAA 3I42A 3CQ9A 5DW3A 5CFRA 4E6PA 1K7CA 4ND8B 4YPFA 2HQOA 2R1VB 2JW5A 2H0RA 4Y9DA 4BZPA 3AESB 3MTEA 4OUDA 1RZUA 2GETA 5JS6A 2VZLA 4GSKA 4BKQA 5EPEA 2R1VA 2RGNA 3QELA 4JLVA 2PLNA 3P2MA 5HCNA 5AK5A 1YBFA 4MKGA 3QLUC 3IIEA 5DXAA 4FYYA 3HCEA 3K8QA 4JSRA 2HIHA 4KX3A 3UYKA 1C14A 3NC1C 1X7YB 1QSGA 1O2DA 1RXEA 2EDAA 3EEYA 2GHIA 1YFZA 2B0CA 4L57A 1U3UA 4X1YA 2ODBA 1RWQA 3ZNQA 4DR3B 1UBLS 1SNYA 1Q1GA 4Q1FA 4TS9A 2QB5A 1KKUA 5EQJB 4D44A 3RVRA 4KITB 4OK3A 1M0WA 1H4VB 3C3PA 3I5MA 2I87A 2A5FA 2LXNA 2XNCA 4F85A 2NSHA 3IQZA 3GGCA 2XTZA 1KO4A 2GCGA 3KFLA 4GVPA 4MXDA 1BS2A 2GEJA 4L08A 3EBPA 1D1TA 4BCDA 4EX6A 5EC8A 4NCJA 1NYTA 3U7RA 2HL6A 4Q4JA 1G1MA 3F8WA 1V25A 3W2GA 4EGSA 1IRXA 1GZ3A 2FPPB 5E4TA 2JAHA 3RSGA 4LJRA 3JY6A 4ZODA 3RVNA 2DETA 3EPJA 1REQB 2AD1A 4L51A 1IXRC 4P81A 3I92A 5EP1A 4Z7OB 1V5FA 1EHCA 1HK7A 5EEGA 3TB4A 2E5FA 2GI4A 4F6CA 4PHHA 2AX4A 2H2GA 2C03A 3GPCA 3OFND 4RFSA 1QG4A 5DZSA 2VBIA 5H68A 5IUKC 5DDIP 3F9CA 4CKYA 4RORA 1AN9A 4MEAA 4DZRA 1O08A 3Q87B 3SFZA 1A8QA 5ANRB 4UM9B 2Q4OA 2CMHA 3OE7A 1ZOOA 1HTWA 3GEDA 5AVJA 3SG0A 1JHZA 3NBAA 4OV6B 4A15A 4C0QC 3OQHA 1BROA 1Z63A 3PV0A 3C5WP 1D6SA 5BUCA 3M34A 4KDRA 1Z34A 3O93A 2I3BA 5FUXA 1JPUA 1RM3A 2BR4A 3JX9A 4IDDA 4MIKA 2CXXA 1SVLA 3PUWA 1NW9B 4WERA 4WBSA 1II8B 1YUMA 3G2NA 4R9RA 2A59A 4L5CA 1RC8A 1K66A 2PYDA 3IELA 1OJ7A 3N6XA 4EHBA 2P6OA 2QZ9A 3LYHA 3O8DA 4WADA 4HGOA 2IEIA 3AKYA 2Y1DA 3EE6A 3NAZA 4CMIB 2PMWB 3RLIA 3M4ZA 3EXG1 3ZWQA 1PR5A 3R76A 3M7IA 1A96A 1FQWA 1XTQA 2ZXEA 3GRAA 2PSEA 1OTYA 2A9PA 1EA5A 1N25A 1R2QA 2WF9A 3PU6A 4FIZA 4YC7A 5AI8A 5GONB 1U6IA 4ZDWA 3WGYA 4BO2A 2FMHA 2B6HA 4ZXPA 3HZOA 1NIPA 1Z2CA 2J5BA 4YYEA 3QFCA 3ZHOA 2FK8A 4Y30A 5IULC 2POQX 1HWYA 1L5MA 2F8MA 3RHSA 5AI9A 5I7AA 3PI7A 5KYYA 2FMIA 2Y1KA 1QLHA 2HMVA 1ST2A 1TM2A 3IXLA 3LP6A 5KNCA 2JLRA 3FVVA 5I3CA 4N76A 4BX9A 3NDPA 3GCGA 3NNNA 3OJFA 3NVAA 2IVFA 4LMRA 5DBGA 4ENTA 5FWYA 4KMRA 3E3NA 3A6FA 1IY9A 1GAJA 5EXPA 2F64A 4C1BA 3OM8A 3TW8B 2XBMA 4K9DA 4BBPA 1O94C 2XDYA 1TU0A 3AO0B 3BGSA 3QMPA 1FNBA 2W0SA 1GTVA 1SD2A 3TWOA 3THRA 4O6VA 4IDCA 4YB8A 1OLUB 1A7KA 1PG5A 1SPBS 2P5UA 3D31A 4K46A 4QJBA 4CDNA 4HNVA 1ZJYA 2DHQA 4U63A 1PT9A 2QYHA 1AXEA 3EH1A 5ER6A 1Q11A 2QG9A 5IF3A 1NSYA 2H18A 2O07A 3JATA 5C53B 3ABSB 3BMCB 3UJ9A 4TVBA 3NC4A 2Y1WA 3H1PA 4B4DA 3SMQA 3VSEA 2EW8A 4G23A 1VJGA 1G3IA 2ZVQX 3G1TA 3L41A 4BGIA 4WJZA 4E0BA 2AJCA 4PLGA 4IOKA 3WP1B 4BC0A 4O1MA 3UFBA 1HF3A 1XL1A 3ESZA 3GEEA 1FNNA 2NPFA 4L75A 4KTVE 4TTSA 1DXOA 3QVTA 5B6IA 3RWBA 1YACA 5LU9A 2XLCA 1EPUA 1OV4A 4IO0A 4QHSA 4MGZR 1OA1A 2ODQA 3ZGLA 4PLTA 4ECAA 5C5DA 1P39A 4OOFA 2HWKA 1RE0A 1LW7A 4GLLA 2PG3A 2GXSA 3NHFA 3U4HA 4I66A 3LRTA 2JDID 1VLHA 5DK6A 4MDEA 4B81A 4G65A 4X3OA 2EBFX 2XVXA 1ZINA 1HL3A 3ANLA 2VJMA 4QVKA 4LDNA 5CLHA 4OI1A 2R1ZA 3A4IA 3ASYA 1N7GA 4CMEA 4Z4GA 4PZEA 5FA8A 4XPZA 1BEEA 4LY9A 4OMCA 3K53A 1FUUA 3DLBA 5T4EA 5ALJA 2NQ8A 3WISA 4QBFA 1E2HA 1L8LA 1W87A 1QDUA 2CB9A 2BDTA 2IZ1A 2ZDHA 4QD3A 4I1UA 2XEXA 2QYTA 3IB6A 2QLFA 3K6JA 2PAAA 3L0CA 3QHPA 1O0BA 4X8HA 4U0JA 3G9XA 2NADA 4MAFA 4DJ5X 2WWVD 1DTSA 3WNQA 1UM9A 4MLPA 1ZGJA 1BCRA 4NU8X 2WJ3A 3MUOA 1H3FA 3I1IA 3HUDA 4FIDA 4FMDB 5IJ0B 1BWPA 2H59A 3RUPA 1M76A 2L19A 4DMHA 1Z0IA 3KDAA 3L82B 4H1HA 2QX7A 4W9NA 4DOMA 3KYJB 2HN9A 1VRVA 1PGPA 3OEEA 2VPQA 2JGJA 5AJHA 5D5QA 4CUJA 3KTAA 2I4LA 4WFQA 5KJEA 1KARA 2Z30A 2Y93A 1Q0RA 1PQWA 1H2FA 3PFKA 5T6MA 1HFJA 3FGOA 3C48A 4JQSA 4TLAA 4HMPA 5B58C 4CF7A 4B3SB 2H4JA 1PK8A 2I3GA 1EZ1A 1R6VA 2IJGX 3FI9A 1SCQA 2GD2A 3A6LA 3DH0A 2N1BA 1WMDA 2WWIA 5JW6A 1IFXA 4YS6A 4YUXA 2INGX 2ETXA 2QE6A 3PFBA 2XVZA 4RGVA 4MRVA 3TUJC 3NEJA 2W2PA 3ZE9A 4H16A 4OIFA 3KKLA 5BN3A 4JOBA 4BEVA 1NOKA 1SWVA 5HM8A 5BSFA 4MR7A 1PUIA 2QMOA 4AF8A 1PZHA 2H6EA 3PHIA 2WM8A 1DGQA 4AI6A 3IQIX 3KEMA 1SCNE 1B74A 5HRAA 5LP1A 3KQUA 3SEQA 1QB8A 5JS1A 2ZEJA 5F1KA 5FHRA 5HZMA 4PQEA 1V1RA 4CLDA 4FE4A 3O3OB 4M7RA 4Q1VA 3UQZA 4XM0A 3QYAA 4HBZA 2J6IA 3OZRA 2G1UA 4QTTB 1UJ6A 5ERGB 1Y4DE 2GF9A 2PTHA 4I4LA 4FGSA 3VR1A 3WE7A 1FYXA 2R25B 2P9ZA 4JZYA 4DSTA 1A71A 2ZTLA 4OHWA 3OJWA 5CG1A 2UXDB 5D6OA 3FNHA 4LGCA 2RI1A 3EIXA 4KWCA 3FCAA 2RGBA 1CUDA 4FFLA 5JJBA 2JFPA 3KBBA 3KPVA 3U62A 3MSCA 2YICA 2LE0A 5DT2A 3E4CA 2J0SA 5TJ9A 2X6TA 3T3GA 2NO7A 5FFFA 2GPJA 4RA6B 4HVLA 3Q3IA 1CEQA 5KQRA 1LLDA 2LP4Y 4L95C 3UGQA 1QWOA 3K0FB 5LLTA 1XYVA 1Z7BA 2UVPA 2J7KA 3PQ3A 2JHGA 3CIFA 1P81A 1X7GA 5JRZA 4I9NA 1L4YA 3WYNA 1O0CA 5LA6A 4DQDA 1O9GA 1H2YA 2ATVA 3E9NA 4HSEA 3VVCA 3O8RA 4WIAA 3BK1A 4J4TA 4K8OA 5E95A 4I4TA 5ALQA 2Q21A 3DFIA 1YRBA 3UG6A 2IZZA 2RHJA 3TZLA 4WFIA 3T3PB 5T67A 1RQXA 2DFNA 2A9VA 1G3QA 1XYGA 3BULA 3FAZA 4CMIA 2C4HA 1JQKA 1II0A 3F47A 3EIHA 4JUIA 6GPBA 4YDQA 4A2QA 3F97A 4WKGA 4E5NA 3QU2A 4B3GA 5E8RA 4PQYA 3PFNA 3FMPB 4LF8B 1W88A 1JI0A 1YVPA 2ZJ5A 1XXHE 4PWZA 1P2UA 3MOSA 2GTPA 3OZGA 4OFXA 1ZONA 3UV6A 1FXWA 1P75A 4KUHA 2YFHA 1NHWA 3UW3A 4JLOA 1MGOA 4F2WA 4GFDA 2JB9A 3H2IA 2JFBA 2EFYA 3V1LA 2WPDD 3FTCA 3PD7A 1RAGA 4A1FA 4ZPXA 1JECA 2VJNA 3FH0A 2SHKA 5CFLA 5AVXA 3ZKWB 1HMYA 4M0MA 3IULA 4O0MA 3UAZA 3H4MA 5MFZA 3C3JA 2XUPA 1RWWA 3IV6A 4M1EA 1UF9A 4YP0A 1P61B 4C5BA 2OFPA 2BN4A 2VA9A 1EFRD 2QM3A 2QAGC 1JGTA 3DOCA 3C98A 4EEXA 3K30A 5EP4A 1JEOA 4LMBA 1MC4A 4OMDA 4TYNA 2DHRA 2Q3MA 3EVEA 1AURA 3EULA 2F1IA 5C18A 5ALNA 4A6XA 2L69A 1HFEL 5TARA 3ORSA 2ZUUA 3JVEA 1SIOA 4OATA 4AB1A 3BB1A 3HWSA 3PGJA 1MB9A 1W581 2WNIA 2JGRA 5GINE 3CS3A 2A1TR 2FCRA 1ZRMA 1ZNYA 1ATZA 3G9QA 3U39A 4DA4A 3DFMA 2FW0A 1JE0A 3K71B 3F90A 1ETHA 2C00A 1I6MA 2EBUA 3I58A 4RTNA 1YR8A 4RVFA 4NMWA 5BSUA 5CA0A 4AY5A 2DAPA 1E9FA 4J9VA 5KOIA 3L1IA 3G8CA 5CB6A 4LRQA 1X7XA 3PKZA 4W1QA 2OAGA 3H2GA 2ZUTA 3QBVA 4WKPA 3JQ9A 1XNHA 4PLPA 3NKVA 4M0CA 4I5FA 1WZCA 4NNOA 5HGJA 2DEUA 1XMSA 1AZLA 1PWYE 1OLOA 3UB4A 4IIJB 3EXEB 3MTGA 3IUEA 1Q12A 3QNWA 1WXWA 4OM7A 3T0FA 1CJUC 2BFOA 2IYVA 1Y5IA 2QHXA 1E9BA 2D5CA 1SUWA 2REXB 3AR4A 4KO1S 1KGSA 4XX1A 5LCXA 5TPZA 1DADA 3EFHA 1HLPA 2F3SA 1GPNA 5TPZD 4LHXA 3KKZA 2C2BA 3QVGA 4BNIA 1JDZA 2HTEA 1PJ8A 2VDRB 2CXHA 3JQPA 2O2DA 3RHZA 4PN3A 3AI7A 4OI4A 4Y6PA 1PJQA 1FTQA 2FN3A 1P91A 1I8TA 4C0AC 3WYAA 2QSZA 2XHZA 2IKQA 5CT8A 2ES4A 4F56A 1QAQA 2UYHA 3ZU6A 2ONYA 5CVCA 4CL2A 4BXOA 1SKAA 2VH2A 3IGFA 4HN4B 5JQGB 4RH0A 3RTGA 1EVYA 1M8GA 4JEIA 3V6LA 3MIIA 2HBYA 1RQNA 3SBEA 2CMDA 4ITRC 1N2CA 5KYNA 4RTOA 4HDRA 1X1DA 2VCYA 3O38A 3ZLVA 3PQ2A 2PU7A 3JYNA 4HAWA 2CXQA 5AXBA 1KY5A 2AG6A 5LNK6 2ACKA 3DMYA 3UF0A 3G82C 2HI0A 4UJ3A 5AKJA 1OZAA 1SQ5A 5GY7A 1JYFA 3F6RA 3FY4A 1AKQA 3HGQA 3SP1A 1HQKA 3B5IA 4Y6OA 5CT4A 1FMJA 2D54A 4PLZA 4KXYA 1MO2A 1Z06A 4U7PB 4PG8A 4PQFA 3LUFA 3LUBA 3SZLA 2XJ9A 2XQKA 5EWJA 1OA0A 4DQXA 3FR7A 5DYWA 3VDXA 2IITA 1TZMA 2V7EA 5HKKD 3TM4A 4CI9A 4IS3A 3QFHA 4HDRB 3S8YA 2MU1A 1F9EA 4ZO6A 4N7MA 3KWFA 3R09A 5ALUA 4A36A 2JVIA 4DGQA 2IS1A 4AXXA 2QTGA 3NPAA 5EHNA 4OX9B 1HLFA 2JVJA 3OHPA 2AFIA 1K08A 1XHFA 4E1VA 1LLUA 5ALZA 3MWGA 9LDTA 4RZUA 2R6HA 1M2VB 3EXG2 4WFKA 3IXQA 4GE0A 3HKEA 1F5NA 3NS7A 4YRDA 1DFGA 3PR1A 2JH8A 2PX4A 1SQSA 2Q3HA 3PEUA 4PGHA 4ENWA 2OG1A 1PQUA 4J03A 4BTEA 2FFHA 3PC3A 1DIGA 4CI0B 2B4YA 3WRVA 2Y67A 3ELWA 3BT7A 3TX2A 1S5PA 2ICAA 5DGDA 4URFA 3NIDB 3TL3A 4P8RA 2P91A 1H9CA 1M8FA 1T0BA 4C4PA 4IHKA 4E11A 3GFFA 1VP9A 4G1BA 3DBHB 2DQKA 1NRJB 3IUYA 4CF5A 3MGKA 4CTOA 5HIAA 3QX3A 2VNSA 1G5PA 3PG5A 2NV6A 1GN9A 1Z4NA 1TTQB 3GJ5A 1ZD9A 2HFKA 4NCKA 2FJPA 2WTNA 4IDEA 5K0NA 4AJ9A 3DF9A 5H4HA 3NYQA 4M54A 4B6FA 5GPBA 1JAHA 2X9VA 4MWCA 5LVAA 4EQZA 4XVHA 1SZDA 1M1UA 4DSOA 1U2QA 3A6GA 3QFFA 1T6YA 3V1KA 2ZM5A 1JT9A 1P5RA 3A1UA 2BTOA 4RJKA 2QG4A 4DR6B 4II7A 3MGAA 1OCEA 3AM1A 3DXFA 3L7LA 3IUJA 4OA8A 3M8KA 3OOHA 3OJXA 2YHSA 1JG1A 4Q1EA 1CUIA 1FFHA 5FFNA 1ZMRA 5FL7A 2GVNA 1U63A 1BXGA 4I4TB 3WICA 2BPOA 2FGKA 3U7QA 1U7TA 1Y7PA 3Q4GA 3ZWOA 4JI8B 4F1JA 3AIMA 4DCPA 2HJRA 1IDN1 4FX2A 1XJCA 2IYWA 4A8JC 2JF0A 4FSHA 4UE6A 1Q16A 1OYWA 3UJ8A 4ZI7F 2ZT7A 3CVYA 4QE3A 4KSYA 1E9CA 2X2OA 2LNDA 5J1TB 4QEDA 1SKUA 3I2FA 3JRXA 3R0VA 4EY8A 4NBLA 2WIDA 3OLQA 2VAVA 2GVZC 1SBYA 1VTKA 4CVNA 5L6MB 1MLDA 5DULA 1T4BA 5HGXA 1XRJA 1U4SA 2PWPA 1PK7A 3A3NA 3MWJA 1A50B 4XD7A 1VYVA 4MQFA 4I5GA 5B12A 4LI0A 1KC3A 1ZSNA 3E1GA 2OZKA 1E5DA 3ZYCA 1GT6A 1QP0A 1F8XA 2CDNA 3E22B 5DGHA 1XZQA 5C5CA 3SDZA 5JVDB 2C2YA 3CRZA 3WGTA 4CFSA 3ROEA 3ZJTA 1RM0A 2X0JA 3Q41A 4YUWA 3MT9A 1Q50A 1I01A 4N3BA 4ZO7A 5I8ZA 4I36A 2BUCA 2Q27A 2PZFA 3EZLA 1OPXA 3BQMB 3WHKA 5L4LA 3SNKA 2JD0A 3W5AA 1R74A 2Y27A 1M5TA 1AUOA 3HYLA 3KSDO 5HDQA 1YQGA 2C3UA 4I6EA 2BBSA 4O02B 3FVTA 4WCFB 4RLQA 5JIBA 1PS0A 2EERA 1RZ3A 3K5PA 4DLWA 2ZTMA 5BN1A 2PLWA 3YASA 3OIGA 1OFVA 3H7AA 3D6NB 4TKUB 1DV2A 1PDWA 5LA6B 2XYGA 1Y48E 4OBBA 3VNVA 1VLMA 5FD8A 1F0NA 2AW3A 1BXZA 1EU1A 1MABB 3N8GA 4L0CA 4Z2AA 5CBPA 4MI9A 1DAMA 1JB1A 1G8GA 4C7MA 3U4AA 1PFGA 2OVFA 3GY0A 3ETEA 3MJCA 3ONFA 5F1YA 3PUHA 4EFMA 1A8SA 3WYEA 4RHYA 2YQZA 3PRKE 4BKMA 2E37A 4FVTA 4RS4A 3NJ8A 2QUHA 4CKBA 4R68A 1V0JA 1XCPA 3ZJVA 4ZO8A 4YMTA 1AK2A 1OI4A 2NGRA 2YZGA 5ILOA 1MNAA 2JJ1A 1U9IA 1T9HA 3LBIA 4PYMA 1OAOA 1U7ZA 5JUWA 4HS9A 2AT1A 2XRZA 3R0JA 3DTVD 1AMUA 1JQEA 3DQPA 5H82A 5LP6F 1NT2A 3DB1A 5IUJC 5KWEA 3SNHA 5NLLA 1BN7A 1LDEA 4TLLB 1Z0SA 3B53X 1E60A 1FQKA 3ZI4A 2E5LB 1NQUA 3JZFA 4IUYA 5JLAA 2Q7OE 4LF9B 1YJQA 4L72A 2EF1A 4FZVA 4RPLA 4EA7A 5J2TA 1ISMA 2G7ZA 3HK2A 2A0FA 4GR4A 2UUAB 1TYAE 1E6WA 1XNJA 3O4GA 1YFKA 3VU9A 2A58A 2WWHA 5TQJA 5EJ9A 3W5BA 1J00A 5H3HA 2AS0A 2DY0A 5BWOA 2XUAA 4BNMA 4MPTA 7ABPA 5AW4A 1JYSA 3AEQB 1T8TA 4ZYLA 4D25A 2QN2A 1BKSB 1YL5A 3WWOA 1WL8A 1XAGA 3IAHA 4OH7A 1GL7A 4PZYA 3H9BA 4C5CA 1Y7LA 3M4JA 1A5SB 4HB2A 2J48A 2H2AA 3SKXA 3EF0A 5CB4B 3CVXA 5LZ2A 4FINA 3AEYA 3FVRA 1KFBB 1S2NA 3CSSA 1G64A 4AZ0A 4LRTB 1V3UA 4LXQA 1WXDA 2WK1A 3MJRA 4UHCA 3RJZA 2BMDA 2QXYA 2VS1A 4DV5B 1AK1A 3UGJA 4BQFA 1PYDA 1VKHA 5FBVB 1RKUA 2EFJA 2XAAA 4QGGA 5CAEB 3VSAA 3WG9A 1N6IA 1PFKA 2BE9A 1MV8A 1KDOA 3TLCA 1ZI6A 4KSCA 5BY2A 4FWTA 2ENUA 4QU8A 7MDHA 3DZCA 2WZCA 4TKUA 1KXJA 5EUQB 4HY3A 1SUDA 4Q18A 2X4IA 4R1NA 1RC1A 2MT9A 2NUAB 5JEDA 1KJZA 5CB8A 1QQTA 1X19A 5K3CA 4P58A 2JFXA 3E9DA 3VPFA 2WIGA 5JATA 5HOQA 2ASEA 1T1IA 2CLKB 3GAFA 3NHLA 2DR3A 2ZE7A 4FB4A 1H2ZA 4MVJM 2IUFA 4QDOA 4RMJA 3KV1A 3AWDA 4MA4A 4DNOA 3L1KA 3R7WB 1SHZA 1XRPA 3VPDA 3U31A 3D3QA 1RDFA 4PCUA 1NN5A 2O8VA 4EQ6B 1Z7GA 2VCEA 1OVMA 3LP8A 4V38A 2FMFA 5FBZA 3RJMA 4DV1B 4K2HA 3S2UA 4BNFA 4XVRA 5ICMA 2Q2VA 5AJZA 5HK9A 3OJOA 1QRTA 4ZREA 4IH1A 5CYOA 3TXYA 2ZB4A 4BNKA 1KO8A 1VB5A 4L5IA 1ZM2A 1EVEA 2P69A 4M3NA 5K0TA 5JXHA 4DR1B 1GAEO 1A9SA 1YTUA 1MW9X 2O0JA 1LDNA 1QF9A 3WX0A 3H5LA 3MJVA 5BW5A 4FFMA 3ELYA 5E3JA 1M34E 4Q3BA 3JQ8A 1NL3A 2GZAA 5GVRA 5A05A 1VPWA 4HT3B 5JARA 1II9A 4V0ME 4CN9A 5JYEA 1GA1A 3DF7A 3R20A 1SEPA 4G01B 2GCNA 3CF4A 4DA0A 4LJ7A 5ARBA 2BGWA 1SH7A 2FV8A 4BMZA 2X5KO 1FRQA 1SVNA 3FGZA 3UMJA 3ZYZA 1MJ5A 1GGEA 4RK7A 2R6CA 5BUSA 4NCHA 3CKYA 4LFCB 3C6BA 3LTEA 3ISJA 4PSCA 4UU1A 1YFJA 4PLHA 5I9TA 3AVYA 3DTVB 4JQYA 3Q7SA 1E20A 4R8LA 3I5AA 3RRYA 3X2EA 3ZD8A 4DM7A 4ESVA 2QLJA 2R5FA 4WEQA 3EBOA 3GC6A 2H1IA 3HVJA 3ZIUA 1EEHA 2IA5A 1PFUA 3ND6A 4U6NA 3PR2B 4IIDA 4BRUA 2H4FA 1DJPA 1KP3A 4DEYA 2Q2QA 5FQOA 2A84A 1EXMA 4PAOA 5C1OA 2NP6A 2DU8A 2QRLA 2C3PA 1GL3A 3I52A 5E9QA 4M7PA 4IV0A 2QRMA 4RXUA 5KVSA 4YT8A 1GUYA 3KR1A 1NXWA 3ROMA 3TIXB 3TQRA 2NP7A 1OTXA 1VI6A 1Z8DA 2QVBA 4WXPA 5TC4A 2NQ2C 4JJZA 3AHFA 4ACBA 5MN6A 5JTTA 4RSRA 3C43A 3TN7A 2J3JA 5IRCD 1Q0SA 1GGKA 2OV1A 3Q2IA 5HFJA 3T12A 3TQCA 2RG7A 5IKXA 1RWBA 4OG2A 3UB2A 3C4JA 3G2KA 3HY6A 3K3PA 2GJ8A 4GEKA 2PY6A 3ABRB 4MUGA 4TYPA 2XT9A 4JMPA 4DDWA 2RAUA 1XLWA 3EY9A 2BKEA 4RJIA 5ALFA 2CNNA 1U3DA 1IC6A 3TQFA 1TJYA 3I4CA 4MI6A 5JXJA 2QZPA 3GMDA 1C7IA 3REQA 4OGLA 4B82A 2G06A 2JLQA 2BMEA 3TNJA 1HO3A 5FP0A 2V7QD 3EIEA 2IYUA 1RT9A 1HGXA 1VE6A 2AKAB 4M21A 1RNLA 1O5IA 3IR5A 3W5JA 2AC2A 1U6JA 5GJBA 1TAHA 3ETNA 3QWIA 1U2TA 4HLUC 4R3NA 4LS3A 4WT7A 4RTQA 4D3DA 4INAA 2HSJA 4JR2A 2GSWA 4FUQA 4NAVA 3W3AH 2PKXA 3M6IA 1Z6ZA 4LXIA 2YX1A 1ML4A 1TMGE 3B1JA 4NU0A 1BXRB 4JH0A 4I46A 4BO3A 2JATA 3V8VA 1MORA 4ROTA 4KPGA 3C85A 3ZZ0A 5JMPA 5HFNA 1LKZA 4YUVA 1SCJA 3ETHA 2GKGA 4IFTA 4BNWA 4EZIA 4R2LA 2C54A 1E6KA 4V0MA 3THXA 1G8FA 1KH3A 2NTEA 2FRDA 2H2WA 2ZYTX 3KHUA 4H15A 5CJPA 1CLUA 4C2UA 3IALA 4KI0A 1O57A 4HMQA 4BV9A 1P80A 1Q6YA 2C8JA 3GDWA 4ZIRB 3C8ZA 5I6DA 1Y4AE 5T8KA 1A5ZA 2FAXA 5JYBA 4JBNA 3BXXA 1WHSB 1K92A 2OESA 3T7IA 1E69A 3L7DA 4R1TA 2JKVA 3DDZX 1LBHA 1V6AA 2DGDA 1QOZA 1ZA1A 3OOEA 5FLKA 3SHTA 3TJRA 3GLIE 2BM0A 3IO3A 2YIMA 1AKYA 2YNMD 1DKLA 5HFAA 3MAAC 2QYSA 1RXCA 4MLDA 1DWUA 4LOKA 3SOZA 1GIAA 3CH4B 3SFTA 1URPA 4KAXA 2JANA 2QSJA 5AJUA 3TL2A 1NVKA 1K5GA 2JEOA 1GZHB 4OHFA 5IFKA 3SHOA 2H16A 3GVCA 3HNOA 4OQPA 2G80A 4J76A 1F2DA 3IVCA 3RQIA 1YCHA 3PXBA 1P8JA 2GZDA 4DUGA 3T9BA 1MBZA 1J49A 3B1VA 5DHAA 3H2BA 4F97A 3AR2A 4NF2A 5AKXA 5F73A 2R6AA 3W4IA 3IPCA 4JASB 1K9VF 3OY7A 5JPIA 4KX5A 1B23P 3GQVA 2Q9BA 4HGRA 4P33A 3QBDA 4WFJA 5FOXA 1ZCBA 2OAQ1 2ZTUA 4DG5A 2FI1A 3QUBA 3S5UA 2Y1FA 3BH7A 2Q6VA 4IEFB 3ZXSA 4BFXA 5I51A 1VCIA 3NORA 2QVYX 2IKSA 1QHXA 3K6RA 4UCXA 1ZL0A 2YW2A 3MJEA 3SKVA 2DE0X 5IBRA 3RRNA 1TK3A 3F46A 3UKJA 3VU1A 1T3TA 4R9UC 1A7UA 3E7DA 4KH0A 4G0ZA 1U31A 2X8AA 1CFJA 3QFTA 1UXIA 2B5VA 2DCUA 2VJPA 2XUZA 3VNSA 1U0BB 2Q0SA 4A0RA 2ZZMA 2HB6A 4JA0A 4GBED 3WS7A 3KXPA 2FLVA 3PNOA 1VA4A 2ZSHA 3KPWA 5B30A 4HOYA 1CQPA 2C5EA 3QHAA 4JC4A 2IYQA 4ARZB 4QFCA 2ABWA 3FZYA 1HT3A 1V3QE 4R1LA 1W2GA 4UUOA 1X7HA 3A7DA 4KQ1A 3WO0A 1NR1A 2VNKA 3IP6A 2R87A 3AKZA 1ZGBA 5JSZA 1XQYA 1UOPA 3L0BA 4LSZA 1TCVA 3RFXA 2D5BA 4E94A 3EVGA 3SPXA 4K86A 1ZK1A 3RE1A 4FMCB 5IT9A 5BN4A 1U2RA 4IS2A 2F90A 2Z43A 2ZGVA 5SZHB 4LWQA 1QE0A 5B55A 1W36D 3TLXA 4IJVA 3ZJYA 2AFHA 1OBVA 3U4DA 2ECKA 3I2YX 4EI7A 4GM1A 3W2TA 1ISSA 4KGVA 2EP5A 2IHYA 2C9BA 3EASA 4X6YA 4B31A 4DNPA 1F4VA 1WOMA 3FKSA 4Z4QA 4QBGB 1V41E 2ZRKA 3VHXB 1I7NA 4IILA 1WQ3A 4ZV4A 1AUXA 4M46A 4UEOA 4UEJA 2VSXA 4QULA 3S99A 1K6EA 1GRRA 3DEIA 3RK0A 3F5QA 1NOJA 2J6HA 2QU7A 2VJCA 4IZOA 1VL1A 4UAGA 4ENUA 3OUUA 1FLAA 3BXFA 3NIWA 2V5UA 1ZUIA 3RKUA 2GCOB 3B78A 3E61A 3GYBA 4GPTA 4ND1A 4QFBA 1PR0A 4OXYA 2AJBA 1E7YA 4X94A 5TPWA 3VYVA 2CFOA 3AERB 2V58A 1N0IA 1OX6A 1HDZA 1A9YA 5FJJA 4B44A 1W5TA 3MUEA 2G5CA 4ND4A 4NCAA 1WF3A 2O3JA 4Y9RA 1RR6A 1QGUB 1RWOA 2NZ2A 4K88A 5T4BA 2R7LA 1QQBA 3DDWA 1UC5B 3COYA 1LBSA 4E07A 5BMVB 8OHMA 4D9MA 3TUZC 4DC9A 2YVLA 2O8CB 3H11B 4J49A 1Q1AA 1HE4A 3TRFA 5K0FA 1L4BA 1EWVA 3VU0A 2EGUA 2R47A 1ADYA 2ZRGA 4OIMA 3EXHB 1KEUA 2R79A 3LSYA 1ZXXA 4N65A 2XDWA 1ILEA 1QIJA 1P4SA 4ZWNA 3QXGA 2CXTA 2Y0DA 5D7NA 3H5TA 1T8PA 1P2BA 5LOVF 3W4KA 1G7TA 2JLXA 3SCZA 4TL7A 3HU5A 4ZOLA 2CVOA 5TR9A 4D0RA 3ZWDA 3RSZA 3G5TA 1MQ9A 3A31A 5FUBA 2DTXA 2G0NA 1DUIA 2QEQA 3NHAA 4NFSA 4CLEA 2Q5QA 5EEHA 3T5BA 5DVZA 2PQ0A 3VH3A 1WF6A 5CW1A 4F3YA 2CLHB 4ZK6A 1SUPA 1G8MA 2V4UA 5BQOA 5K3AA 4QOFA 3FPJA 3WQBA 2A1TS 2RAFA 4R2MA 4FBLA 2O23A 2MIIA 3VVLA 4N5IX 4D9EA 4US0R 2PJUA 4D9IA 2C9ZA 4W82A 2YXNA 3T15A 1CRQA 2BOVA 3MCUA 1NVBA 2WYUA 3HA2A 4P54A 1A5AB 1E59A 2JBWA 3AY7A 3N9IA 4WOJA 1QIGA 1Y98A 2VWPA 4OHPA 4D9KA 1T2VA 3JR3A 5EN4A 3WDSA 1CKEA 4JGIA 4M1OA 1IJEA 3DXYA 1WTAA 5A4AA 2DQSA 5L53A 2RIPA 1IMJA 1BFKA 4JBYA 4ENSA 1F4LA 3GLUA 4OB7A 1BDJA 5MGNA 3P0RA 2UZ4A 2RHMA 2AUNA 3MB5A 2QUAA 4M7WA 2PJDA 3OKFA 1GZ5A 1G17A 3P20A 3VU8A 2JBAB 2X2EA 3AJRA 2YY6A 3I6ZA 4FHEA 3FR8A 1BE1A 4LZLA 3RDPA 3ZWBA 2JLZA 4DR4B 4P2BA 3EDYA 3PGXA 4RVDA 1UBKS 2C2MA 3AH8A 3F49S 4Y2PA 5KJCA 1ZM9A 1M5RA 4AU1A 1CP3A 1RVDA 1TMKA 1W36C 2IC5A 2KWIA 3IHTA 4MB6A 1P9NA 1PX2A 2IXFA 1JVBA 2QI9F 2AZXA 2UZ0A 1N9GA 1IDOA 4CQLA 3MVEA 5ARCA 3IAAA 5G1NA 1CY8A 3ABIA 3FRIA 5C4IA 3PS9A 3ITNA 3VVBA 1D3AA 1MEEA 1MG5A 3K9BA 1WNTA 4RK1A 4GPIB 3ZHQA 1GM5A 2XV1A 2ZI9A 1A88A 2QN8A 2ZRPA 1TZ2A 2IL1A 1YXMA 3MGGA 4C6RA 5JJIA 1P1HA 4JB2A 1N2BA 3O74A 4COOA 3W04A 4TROA 4BFUA 2JIZD 2VP5A 4XGKA 4B7CA 5SY6A 1UEJA 2OFWA 2XNSA 2NTNA 1IU9A 4QIHA 1M1NA 1X39A 4NARA 1TXGA 1ZUHA 3OM9A 3PPWA 2FSVA 4MUMA 3WQSB 4CM9D 5JJKA 1QK4A 4Z7JA 3KXIA 4ZEOA 3KFVA 4PAWA 3Q6MA 1G291 1GZDA 4MR8A 5D1HA 3ZE1B 4DT1B 3LTNC 2WQ7A 1FW6A 4KR3A 5A04A 2VQDA 3TAUA 5IJ9B 3UVEA 3QOWA 3CZ9A 2AHRA 2WYWA 4B3XA 4DXAA 4H7EA 1DL5A 4KOAA 3K9QO 2J41A 1ZRNA 5TNXA 3EG9A 3HKBB 1OXVA 1P7VA 2XYQA 3OM1A 4ZTBA 3ZE8A 1TLFA 3R3JA 2VF8A 4UAUA 2DUMA 1CUZA 4MP3A 3SC2B 3VUFA 3KTDA 2KBEA 4B2YA 1IH8A 4MDYA 1E66A 1YWGO 3WHIA 3NBKA 5IJZA 2GO7A 2PKQP 1TEHA 4M9UA 3KELA 3QE4A 2NO0A 4F2HA 3K9HA 3R7SA 3KKPA 4F71A 5GJVC 1SVKA 5JISA 4UVHA 4D43A 3HCNA 1O6BA 2RG1A 3HKEB 2EHDA 2P1RA 1VCHA 3NAGA 4WV3A 4X91A 4E5SA 4UPEA 3FX2A 1P7ZA 2ZSUA 1FPMA 2FETA 3E3OA 3M6MD 3P9NA 4N12A 1EGMB 4ZZ2A 3WKEA 2IOFK 3ND5A 4B35A 5C8VA 3TGPA 2ZYUX 4NHEA 2NQTA 3G5MA 3ZD9A 1W2WB 1AGPA 3NGMA 1ZHHA 1J09A 5FWDA 1DX9A 1M73E 4P4LA 3LS2A 1C3EA 3QY0A 1XTUA 2FPRA 4MLCA 4OJMX 3UIEA 3D6HA 4AJHA 1WHSA 3GD7A 1W4RA 2P67A 4HL6A 3PRHA 3NIFB 4FSXA 3ETGA 3DDHA 1X13A 4JMLA 5LD2B 2CZCA 5EKUA 3CZRA 2ID9A 3KUCA 4P2GA 3EODA 1GR1A 5CVEA 1QH8A 2CBGA 2C7VA 2JEYA 1SCUB 2IHTA 2ZPUA 2NXNA 3P52A 3CPJB 3HYSA 3VZQA 3ESYA 4JK3A 4LEIA 2QQFA 1PRYA 2H63A 3ETJA 3H6GA 3LK7A 5TE9A 2XSZD 5FFMA 2LV8A 3W2FA 4J6FA 3WWYA 4ARUA 1L1QA 4NOMA 1KF0A 3JRWA 3K20A 1NI5A 4FYMA 1IYZA 3RQSA 4YEDA 3GVPA 1Z5PA 5G4KB 3L8EA 2FR1A 1GLNA 2YIDA 3PIDA 1P2VA 3ZE2B 3ZV5A 4EYSA 3G13A 5CDFE 1CY0A 2FKNA 4I5EA 3WRYC 1GO2A 3AVXA 2IYZA 1U0TA 2ILVA 4UNPA 1C1DA 2G8LA 3R40A 4RQBA 2JKZA 3E05A 5BQ3A 1B93A 1LQTA 2R84A 3H6KA 2D4AA 3TCXB 4CV0A 1PQ4A 2K6GA 3FCEA 4WUTA 5HIJA 4LNAA 5JQGA 1JDBC 3FOEC 1SA0B 3ESQA 2OB2A 3DZHA 2QZSA 2V5VA 2JFVA 4YT5A 3WGHA 3HE3A 4Q9KA 1IXSB 3KQMA 2PV7A 3BZUA 5ITZA 2FPUA 5JDIA 3WLMA 3BEDA 3U19A 1VLJA 3FETA 3BE6A 5B2FA 3GLKA 3LWBA 1X9GA 3OMLA 3X2SA 1RCTE 1U7PA 2GPTA 3JD4A 3ZX4A 1HT0A 1N75A 2HNBA 1JSZA 3R6DA 4KKVA 3HO6A 1MXFA 4GKAA 5JQWA 2B7CA 2VXCA 3M6AA 3EXFB 4I8DA 1T2AA 1M2OB 5BW6B 1MDFA 3B89A 3FMOB 3E82A 3NBUA 5B7NA 1D0IA 2P9YA 2DWUA 3GUVA 2MSLA 2HW8A 1MO6A 5G0UA 1ZIPA 4REQA 3H05A 2FR8C 2GZMA 2DPHA 2VVTA 4KBGA 3K92A 4OPMA 4Z54A 3PHJA 5FKJA 3TVTA 1IHUA 3NM6B 3DYIA 3TH5A 3EVDA 4KXQA 3HSSA 3II6X 2PM8A 4AKSA 4BKRA 3X1DA 5IN5A 2HGSA 1AKEA 2XTMA 1EA7A 1UOOA 4QHYA 4B79A 2VSFA 5AMXA 3AI3A 2PH7A 4FOOA 2Z9BA 3CH7A 3KBOA 4Y6QA 3AF5A 1GCIA 4UVGA 3K0KA 2P7IA 1MVNA 1KIAA 5L45A 3E0XA 3HJNA 4KO3S 4C29A 2FEOA 3FGPA 5I7UA 1UR5A 2OQRA 4D4GA 2WD7B 1V11B 3AHGA 2NYVA 3DC7A 1XROA 3V7WA 2D2VA 5IG2A 2V7TA 1KMNA 5GADl 1G20B 3CN9A 2KE5A 3SZMA 2JFGA 4AZ3A 4KQEA 4H08A 1CQJB 4GI5A 4O1IA 3WBBA 1M75A 4JBHA 1ZK4A 2H0QA 4YCAA 4U7FA 3OCWA 5CXQA 4OXIA 4RJLA 5B53A 5T5QA 2HHHB 3ILHA 3JQ8B 4FW9A 4KRXA 3U81A 4UU0A