4WGGA

Structure of the ternary complex of a zingiber officinale double bond reductase in complex with nadp and coniferyl aldehyde
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
352
structure length
352
Chain Sequence
VVVVNKQVLLKHFIPEGAPKETDMELVTTGTIRLRVPEGSNAVLLKNLYLSCDPYMRMRMTKHEEASYVDDFVPGAPITGFGVGKVVDSSHPDFKTGDYVWGLIGWEEYSLITKPQGLFKIHHTEIPLSYYTGILGMVGLTAYVGFYDICSPKKGERVFVSAAAGAVGQIVGQFAKQFGCYVVGSAGSDEKVNLLKTKFGFDEAFNYKKEPDLTKALKRYFPEGIDIYFENVGGPMLEAVLHNMRIKGRIAACGMISQYNLEKPEGVHNLFLIVGKRIRLEGFLVFDHYGSYPEFEEKVVQLIKEEKIKYLEDIVEGLENAPAALIGLFEGRNVGKQVVVVSREKGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURE OF ZINGIBER OFFICINALE DOUBLE BOND REDUCTASE
rcsb
source organism Zingiber officinale
molecule tags Oxidoreductase
molecule keywords Double Bond Reductase
total genus 111
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wggA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4wggA01
1IUKA 1D1SA 2O3TA 4NU6A 5I7FA 1EVIA 2PR2A 3ROPA 5DULA 2GD1O 4HFRA 4IDCA 2CZCA 3GNSA 2C0CA 2Z95A 3NT4A 4PRKA 1B16A 5BSGA 4ONEA 4KTVE 5KKAA 5BNTA 4AJNA 5L51A 1MUUA 2LDBA 4PLFA 3CZMA 4KOAA 1LBEA 4O6VA 1Q1NA 3JYQA 1UP4A 5C7LO 4N54A 1DBVO 5KJEA 2O4UX 2HUNA 4D3FA 1LEHA 2VWHA 3CTMA 3PGJA 1N9GB 1KEUA 2P9GA 2PA3A 1WMAA 2YHUA 3RJ9A 3BHIA 2X58A 2EEZA 3OHSX 1WWKA 4ZVVA 1BW9B 3IJRA 4D43A 3QV1A 3RUDA 7MDHA 1ZIDA 5JO0A 1DIAA 3GH3A 4ND2A 1WAMA 1N2SA 2IYOA 2X4GA 2CSUA 4PN3A 5B12A 5BR7A 4YAIA 4WEQA 3QVSA 1DC3A 3KLPX 3LK7A 3FNEA 1GTMA 1I2BA 2DBQA 5FEUA 1KVQA 2D3TA 3WICA 1JKFA 4L0QA 3L6EA 1E7WA 2X5KO 3VKUA 3PK0A 3KO8A 3GMDA 1I3MA 4DIFA 5KJCA 3MTJA 4U0KA 1R0LA 2PWZA 1YOVA 3TOZA 2DFVA 4NMHA 3T4EA 5IXYA 2O2SA 2BD0A 3FPLA 2BGKA 2VT2A 3NKLA 4FOSA 4CMHA 4YAGA 3I83A 1FDVA 3AI3A 4RCVA 5AYVA 3VZQA 2ZTMA 4RQTA 5ILGA 2GSDA 4DC0A 4IS3A 1VC2A 5JCJA 3PYLA 1UP7A 2X1HA 2V6BA 2TMGA 2YHIA 1X15A 1QYWA 4BO2A 2HMTA 2VWPA 4CQMB 1QXSA 2OL4A 3PI7A 4TKLA 3ZU5A 1JVSA 1RM3A 5JAQA 2OORA 1ARZA 3ZU2A 4ZRNA 1WDLA 1NAHA 2FY8A 1KC1A 2PTGA 4UEJA 3IDSA 5TNXA 5B1YA 1OMOA 1UDBA 3IKVA 5T67A 1E3SA 2VYVA 4CMEC 3E6AA 3PRJA 4A10A 1EK6A 5JCXA 2YDXA 1XELA 4L4RA 3V5NA 2X9NA 3AU8A 3JYPA 4CM8A 1F17A 2Y0CA 3UN1A 4FFMA 3AM4A 3GLQA 4PG8A 1DB3A 1Y1PA 3OEYA 4QSMA 5CPBA 3INGA 1YXMA 4TZKA 1JLLA 2BFMA 4I08A 4XGKA 1W4ZA 2CVQA 3ZV6A 2VNAA 3FTNA 1NBOA 2YHIB 3DZFA 2W2KA 3E18A 3PHGA 3FSRA 3UAGA 3GAFA 2R6JA 4IDGA 1E0DA 1G0OA 3WQSB 2HK7A 4A0SA 2UAGA 4Y6SA 1LU9A 4BNZA 4RV9A 4Z3KA 1YJ8A 1E7MA 4PLGA 1I24A 4EDFA 4LMPA 1MGOA 1NXQA 3ADOA 4D3SA 5G0UA 3H9UA 4D45A 5J23A 3L9WA 6LDHA 3W8EA 4LW8A 1E6EA 1GEGA 2NTVA 2Q1TA 3ANNA 2YUTA 3PJFA 3SVTA 1B7GO 3ZWXA 4QFDA 1HL3A 1QYCA 2Y67A 3G1TA 1QR6A 2C20A 3JD1A 5JSFA 1ZO8A 2WM3A 5LCXA 2Y68A 1DRUA 3ITDA 3P7MA 4AJ2A 4B4UA 1X13A 4GMFA 3QWFA 4OL9A 1UXJA 4G65A 4Z9FA 4IZIA 4CMBA 3GFBA 1JU9A 3A06A 3ZV3A 1EE9A 3DMYA 5G0WA 1NQTA 3PHHA 3GC6A 1AHHA 5DBFA 1L1FA 3M2TA 1T4BA 2X9VA 1PR9A 2FSVA 1E7SA 1JAXA 1E7QA 1NTOA 2NWQA 1H2BA 1R15A 2X5OA 2ZB4A 3CE6A 3OSUA 4AL4A 5CEJA 3I23A 1ZK1A 4CV2A 3S2GA 1E3LA 2YW9A 5F5NA 1ADGA 4BMSA 3JD0A 3OICA 2UYYA 1DLIA 2DBVO 2V6GA 4E5NA 2DUWA 3HNPA 3M2PA 4CM4A 2E82A 1A9YA 4FC7A 3ONDA 2CDBA 1KVTA 2ZYAA 1YBMA 4UUNA 2PLAA 4WLOA 2VTEA 4KMSA 4BKOA 2NADA 3AU9A 3RBZA 3R6DA 2O4CA 3DB2A 3NJ8A 1EMDA 4LCEA 1R6DA 3ZNPA 2P9CA 4DXHA 3S55A 2NM0A 4W7HA 2NUAA 1YRLA 3HHPA 4AJHA 3S2EA 2IRWA 4CQLA 4M8SA 1LDMA 1KYQA 2Y93A 3C3XA 3GR6A 4XRRA 4D44A 2EKPA 2I6TA 3GNQA 4M54A 1NHGA 3RROA 2P4QA 5G0SA 2NTNA 2VHWA 1UXKA 1VL0A 4R41A 3K9QO 4LK3A 3WGIA 2ZQYA 3PYXA 3MJCA 1C1DB 1VE9A 3QWAA 4TROA 2G0TA 1LSJA 2C82A 2E48A 3AY3A 4MVJF 3E5MA 2YZ7A 3RUAA 1MX3A 1ML3A 5KCZA 3L0DA 4E5KA 5DN9A 4GKVA 5IZCA 5A9RA 2AEMA 1H6DA 3V2HA 3VPSA 4OYRA 4GBJA 1GFSA 1XG5A 1IYZA 4XIJA 3VAZA 2JFHA 4PZCA 1YB5A 1MLDA 1E1NA 1PL8A 3PIDA 1IY8A 4J1TA 4LSMA 2P91A 2WE7A 5COQA 1NPYA 2ZB8A 1MV8A 3INRA 3O8QA 4JCOA 4XEHA 3FN4A 4BIIA 1VJ1A 5F1PA 2J5KA 2Y1DA 5JAIA 3V1YA 2IEDA 1X0XA 4RVSA 4ALIA 4PVDA 5EL0A 4J4HA 1HYEA 5C7OO 5CEEA 1PGNA 3CH6A 1F06A 3BAZA 1UDCA 4O1MA 1E5LA 3KZVA 4WLUA 4E6PA 3DOJA 2Q2WA 1Q7BA 3JQGA 2HRZA 2ZK7A 4EUHA 1CYDA 3IKTA 5H82A 2WYVA 1YQDA 2NU7A 5A02A 2GLXA 4IXTA 4ND3A 4I1IA 2UUPA 3W8FA 1V3VA 2V6FA 1WMBA 3GQVA 2Y1EA 3W1VA 4II3A 4HWKA 4Z3DA 3SLKA 3VDRA 1K6XA 9LDBA 2CY0A 2C7VA 1U2DA 1UH5A 2VQ3A 4XWYA 1B3BA 3GN1A 3KVOA 1GV1A 1Y9AA 2Z1NA 5EN4A 3OJ0A 4DYVA 5T8KC 2DVMA 1M76A 4MP6A 1I2CA 3BHMA 3DZKA 5DZSA 2D8AA 2FMUA 3TZHA 2X7HA 4XYGA 1N9GA 2GERA 4JJFA 3JD4A 4N5LA 3TRIA 4D79A 3WIEA 5IN5A 1YJQA 3CPSA 1RWBA 1R4NA 1KY5A 4B7CA 3S2FA 4CLOB 3EUWA 5JC8A 5EERA 4D46A 4PLCA 1K6IA 1X7HA 2Y0DA 2BI8A 4FOOA 3E9QA 3P2OA 3QHAA 6ADHA 1N7GA 4TRMA 4CM9D 4R1NA 3WYEA 5G0VA 4GKBA 3I52A 5EMHA 4I5GA 2O3RA 3W8DA 3AFNA 2YFQA 4WCFA 2RH8A 3F1KA 3RWBA 4F6LA 5C37A 4GX2A 4MDHA 2B5VA 4BNKA 1G1AA 5KWEA 5T5QA 3SJ7A 3GF4A 4D3DA 2JCVA 3DFUA 2I5PO 2OO5A 1VSUA 4WOKA 3GRKA 4NBVA 4RVDA 4CLOA 2EF1A 2ET6A 1ISHA 5FI3A 1P0CA 4WLEA 4B3HA 5L53A 4HFNA 2VT3A 1U3VA 4W82A 3U5TA 4E0BA 1QP8A 1WW8A 5HS4A 5CHEA 3UHAA 1U7HA 3KYCA 1ORRA 1WZIA 3LT2A 1NFRA 2JHGA 1HDYA 1C0IA 2I9PA 2OFPA 4YCAA 3KRTA 5CPFA 2HRBA 1GYPA 1MA0A 3QWIA 3RFXA 1VL8A 5KIAA 1E92A 1HYHA 1AN9A 2FWMX 2HO5A 3NJ4A 2GZ3A 1PL7A 4IMPA 4EZBA 2UVDA 3SBOA 1XIVA 3K6JA 2G82A 4TZTA 1PGQA 4OOEA 1LI4A 5KVQA 3WJ7A 3EHEA 3NT5A 3MJEA 1DIHA 3NTOA 1NPDA 2EJWA 1YL7A 4ZHSA 3QVWA 4UEOA 1VKNA 3F46A 3MJTA 4A27A 1XKQA 3GEGA 3QE3A 3L9XA 4PLTA 2GR9A 1O6ZA 3C8MA 5K6AA 3ABIA 4RLHA 4UEKA 1ISFA 1Y8QA 5H81A 4NNJA 3JQ9C 2Q4BA 1FDWA 2RIRA 3RJ5A 3ZNNA 4A73A 3WOHA 4GQAA 3DBRA 3H3FA 2VRBA 4P38A 4OO3A 1Q2XA 4ESOA 4XQ9A 4OKIA 5C3MA 3ZWYA 1T1RA 1X1EA 2NVUB 2RHRA 4N7RA 3PXXA 1AXGA 3WR5A 3FWZA 1HZJA 4EW6A 4QO8A 3ETDA 4BO6A 1XA0A 4WOJA 5T64A 3NUGA 4MINA 4CLDA 4DPMA 1BWSA 3WLFA 2YYYA 2P5YA 1HSZA 2C54A 4J9VA 4Q3BA 3VVCA 3CMMA 5IAAA 5DCUA 3LT0A 2JCXA 1PJTA 3LF1A 3FR7A 1ZFNA 3P2YA 4ALKA 4OM8A 1IPFA 3HFSA 5L95A 1CRWG 1P33A 3TZQA 4WUVA 3F5SA 4QX6A 4OQYA 4OXYA 3TNLA 4QQRA 4ZA2A 3ZDFA 1KEPA 1XSEA 2W2LD 1ZMTA 4G2NA 4RGBA 4YB8A 3GOHA 2WE8A 4CLRA 4WK6A 4UVIA 3H5RA 2GO1A 1MXHA 2D1YA 3ST7A 2DT5A 4WCDA 4UVDA 4B79A 4L73A 4RVHA 1GYQA 2E4AA 1O95A 1GCOA 2W2LA 3OQ1A 4IGEA 1DFGA 3NEPX 4IQ0A 5TX7A 4BMNA 3O38A 1OAAA 3F47A 1PX0A 5A3VA 1DPGA 5KJ1A 1LRLA 4UUOA 3JTMA 1LC3A 4IUYA 3H9QA 4NDNE 4QO7A 2JD1A 5HS6A 4RORA 3TFOA 3AJRA 4J9UE 4LGVA 2Z5LA 4IDBA 2B36A 4DBZA 1IZ0A 1PS8A 3KBOA 1VKOA 4NQZA 3SLGA 3I6QA 1EUDA 5G2OA 2QX7A 2Y66A 2XXJA 4OSPA 4FFLA 3ZWOA 4K6CA 2ILTA 4R3WA 4HFJA 2D5CA 5CFZA 4R5MA 5L9AA 2IZZA 5JE8A 2B69A 3BTOA 3LZ6A 1U9JA 1XGKA 2NSDA 1LQTA 2Q1UA 2W2KB 4TMFA 4BO7A 1D4FA 5IDQA 1ZZEA 2QQ5A 4NK4A 3VZRA 1OOEA 1C0KA 3DWFA 2GF2A 1DAOA 4DIBA 4JXKA 3TQHA 4DLLA 4J90A 1SPXA 2HSDA 1MFPA 2D59A 3FI9A 3ZGYA 1Z74A 2O3QA 3F4LA 2CVZA 1K5HA 1NQ5A 1WVGA 5KVVA 3KSDO 1N5DA 3O03A 4U6QA 4YRDA 2JKVA 3QSGA 4OMUA 5TT0A 4XQEA 5A05A 4BNGA 5BQFA 4NBWA 4FD3A 3I4FA 2VZ0A 4RQUA 3DO5A 4MIEA 4YBZA 4KWIA 3PYMA 1BG6A 1PQWA 1HTBA 5F5LA 2ZCVA 3ZWBA 2NU8A 2I76A 3ZZNA 3DHEA 3X2FA 1ADCA 1SCUA 3GZNA 3KTDA 1E3WB 3NTRA 2HMVA 3GY0A 5JDIC 5L4LA 3EZLA 4MVJI 4UAGA 1CQJA 3BYZA 2GZ1A 2D2IA 5AVOA 3T4XA 3DZGA 4M1QA 1NWCA 2I99A 3I1JA 4CLEA 4MVJD 3NRCA 1XEAA 5TJ9A 3WMWA 1GPDG 3KXDA 4ALJA 4TVOA 3RVDA 1RJWA 4Z0PA 5ENVA 5GMOA 3S2IA 3PJDA 4NPCA 4I8XA 5G0TA 4L9RA 2OUIA 4PLWA 5JO9A 1QMGA 2I3GA 4O63O 1VRWA 2IODA 2FPPA 3K31A 2JAPA 4PGFA 1HDXA 1U2GA 2R2GA 4UREA 3WXBA 4J91A 4XIYA 5B4VA 3MJ4A 4JX8A 2DC1A 1AHIA 4R01A 4JJGA 3L4SO 4XYLA 1GDHA 2BH9A 5CEFA 5ITVA 4RL6A 1R4MA 3PHIA 4HUJA 2P2SA 3MEQA 3IP3A 2DPHA 3BMQA 2VZ8A 4W9NC 1YBVA 3CSDA 1WPQA 1T2CA 4LRSB 2LDXA 3F3SA 2J3IA 2AG8A 1HXHA 1PJLA 1GYRA 3KEOA 1V6AA 5FI5A 1D7OA 1D8AA 4FW8A 2J5RA 4YT2A 2C07A 3CINA 4XYEA 3ZW8A 3D3EA 3WGQA 3H9EO 1H6BA 4YAKA 3E48A 5IDYA 3IJPA 3ITKA 4DTIA 1R37A 1BVRA 2BLLA 4OKNA 4OOFA 3AOGA 1V3TA 1B8PA 1Q0LA 4GLOA 5F21A 1EQUA 4MVJG 2WYUA 4CMEA 4JROA 5AQ1A 1UZMA 4KDFA 4A7PA 4YT4A 1M67A 4R16A 2PD4A 2JJYA 3DC2A 3NDRA 5JDCA 5DOVA 3DR3A 1SOWA 2CDAA 4GH5A 4PG4A 4NK5A 3GGGA 1O8CA 1Y81A 2EXXA 1NWHA 1ULSA 2HAEA 5THQA 4BO3A 4E3ZA 1YH3A 3JSAA 4ALLA 3Q2KA 5FYDA 3A1NA 3OIFA 2DU8A 3DBLA 3M1LA 5JS6A 3LVFO 4R4JA 4DREA 1K6JA 2EJVA 2X23A 2V7PA 1GUZA 1GZ3A 3NT2A 4OQZA 2AEFA 4XKJA 5BSHA 3ZV5A 3GVXA 3WTBA 1TB4A 2X22A 4Y8VA 4RPJA 1ZEJA 1J5PA 1W73A 1ENPA 1ZMOA 5AXCA 3WYBA 1N7HA 4EJ6A 1IPEA 3RCBA 3H5NA 2DFDA 3JD2A 2H5LA 3RI3A 5I7EA 3VTFA 3I5MA 1DO8A 3I9JA 4AJEA 3B20A 4WNCA 5DDIP 1KVRA 4RJTA 1PZFA 4FS3A 3G1UA 3LDHA 1NVGA 3QJ5A 5L4NA 3OMLA 1QKIA 2E49A 3Q9UA 4RDIA 2FZEA 1K89A 4IBOA 3W4IA 1ID1A 2FR8A 4JP2A 2ZIZA 4LSWA 4UULA 3VH4A 5C7IO 4EUFA 4R1UA 4DLBA 4CM5A 2HK9A 2FSSA 2Q2VA 1R0SA 4WGGA 3RC2A 4Y6PA 1VJTA 1FDUA 1KOLA 3DTYA 3OQ6A 2CF5A 3CXRA 1BVUA 5ILOA 5FFFA 3JQEA 4ILKA 1VJ0A 3NAQA 1OZAA 4TVBA 1EE2A 1I8TA 2W98A 1A71A 5TC4A 5TF4A 2Q4EA 1LUAA 1OC2A 3TZ6A 4E32A 1TT7A 3D1LA 4CMIA 3B70A 4TQGA 4XDZA 3E82A 1UZLA 3WSWA 2JD0A 2XXBA 3L6OO 4TRJA 2X0NA 5JY6A 2O3JA 1I3LA 1EVYA 2GCGA 1MB4A 2HK8A 3ZN2A 5I7VA 3KETA 2BI7A 4YJHA 3DMTC 1BSVA 4FDAA 3E5RA 3BTUA 5T57A 5BNFA 5JAZA 3U4HA 1RPNA 3ZNQA 1H0KA 3WFJA 3JQBC 1MFZA 5L4SA 3HWRA 1ZKMA 4FR5A 1D3AA 2GASA 3RBVA 3ENKA 3WWZA 2VYNA 4EGFA 1GQQA 3GDGA 2NV6A 1JKIA 4YXFA 3UUWA 4E30A 4J16A 4CJXA 1T25A 4PZEA 4ALMA 4BNLA 2ZATA 4ZQBA 4JQCA 4CMIB 2I66A 1ZVMA 4ZQGA 5EJ2A 5ER6A 1F8GA 1R0KA 2Q49A 4FBGA 4FFOA 2EHDA 4J1NA 1B8VA 1VI2A 4GWKA 4KQWA 4MOWA 4RF5A 3UH1A 4CM1A 3UFXA 4QTZA 5L45A 4I9HA 2VYND 3NDJA 1KIFA 4QT0A 4XZ3A 1MXFA 3KHUA 4YAEA 4JNKA 2VHXA 2HCTA 2Y1FA 5ITWA 2O7SA 3AUTA 5B37A 3AK4A 2WEKA 4EEZA 4BO9A 9LDTA 1YS4A 1HRDA 3OH8A 2P4HX 5ICMA 4Y9DA 3I6IA 3IQDB 4RPKA 1N1EA 2WD7B 1C1DA 4OHUA 2BGLA 3JV7A 4EI2A 2VUTA 3DBHA 3TDKA 2IXBA 3JQ8B 4RVFA 2PFGA 3IS3A 4DRYA 3TL3A 4PZDA 2AQHA 4A26A 4GVLA 2A35A 1EFLA 1GY8A 3VH1A 1BXGA 1XYGA 2QYTA 3LYLA 4ND4A 1UXIA 3A9WA 4RPLA 4ALNA 4Q3CA 1ZW1A 4M86A 4Q39A 3EC7A 4J2HA 1G0NA 3VPGA 4GMGA 3ETGA 1Y6JA 2W4QA 2V65A 4ZQFA 2ZJ0A 3TL2A 3DBRB 2PKQO 3OETA 1PGPA 3O26A 4B3JA 2ZKLA 1MC5A 4I5FA 2R00C 3EYWA 4CM9A 4KQXA 3EVNA 3QIVA 5HA5A 2DM6A 4XJSA 5TJHA 3AY7A 3PHJA 2WJPA 3DAGA 1EUCA 3PPIA 5A9SB 4EUEA 1DHRA 2X0RA 1YO6A 2HJSA 4LISA 4PLZA 4BUCA 2EKQA 3GEDA 2EWMA 4FFPA 1SEVA 2AE1A 4FJ1A 1SOVA 1YB1A 1MC4A 3RU9A 1ZUD1 4OJNA 4ROSA 1PIWA 2EIHA 2JL1A 2YV3A 4DIOA 3FRJA 2Z1MA 1B8UA 4GPD1 4J1SA 4E5MA 4KDEA 3VH3A 2X0IA 2EERA 1O9BA 2Y05A 2OGUA 3JYOA 4FQ8A 4LN1A 2PH3A 4NG5A 1QLHA 4CV1A 1N92A 3W6UA 2FPIA 4PIVA 1NM5A 4MVJE 1CQIA 3HG7A 1I0ZA 5A03A 2WWRA 3OIGA 5L3ZA 3D0OA 4IJVA 4QECA 1Y8QB 3FR8A 3E8XA 3A14A 2RHCA 4MVJP 4WCFC 3RC9A 3KM0A 3W4JA 3ZW9A 3U4CA 2OXIA 3A4VA 2GDZA 1BXZA 5THKA 1HDCA 1V35A 4Q3AA 4L75A 1LX6A 1Y7TA 3PDJA 2FHSA 4ZN6A 2X9GA 4PG6A 1O94A 2C2YA 5F1KA 1EBFA 4W6ZA 3UGKA 2B83A 3W6ZA 3TF5A 2SCUA 3DEYX 3IMFA 1DRVA 3ONFA 4GX5A 3WX0A 2ZTUA 1EZ4A 1NVTA 3KSZO 4RLSA 1SC6A 4UVGA 3RUCA 1P44A 1GQYA 4ZGWA 3MCVA 3X2EA 1OFGA 1GEEA 4JBHA 4WASA 4BGIA 3PJEA 5JCJD 1CWUA 3H4VA 3HN2A 1ADFA 2BHLA 2DAPA 2GUGA 2BFOA 3H2SA 4BNYA 3GG9A 4RPGA 1J49A 3GRPA 4OH1A 3KEQA 3RUIA 5TGDA 1PJBA 1T2FA 1J4AA 1CETA 2NVWA 3HDHA 2NU9A 2A9FA 1M6WA 5TQVA 2NQ8A 3KSUA 3OJLA 4K9DA 1JTVA 2ZTVA 3OBBA 4CUKA 1WNTA 4WJZA 2RBEA 1T2EA 1LSSA 1LDEA 1I3KA 2CNBA 2P5UA 3GUYA 3U4IA 4J7CA 5JC1A 5CG1A 2A92A 4J43A 3IUPA 2AE2A 4PLHA 3FHLA 2OP0A 5U1PA 4CL3A 5G4KB 5CG2A 1IHYA 1TI7A 4BS9A 3PFWO 5HBRA 3Q1LA 4NIMA 1H9BA 1EBUA 5DCYA 1U5CA 3RD5A 4CV0A 1V3UA 3JQBA 2HMSA 3CKYA 2AW5A 3JQ9A 1M75A 4HP8A 2DTDA 1A5ZA 4J6FA 5JNLA 3DOOA 4PLYA 1QORA 1YOVB 3EVTA 1H2HA 1XQ6A 1PTJA 2VRCD 1Y9EA 4MIOA 1LRJA 3ZHYA 4ID9A 1JAYA 2GN4A 4A2CA 5JFOA 3LU1A 1SNYA 3GVIA 3ZU3A 1TVEA 4D41A 4DWVA 5IXSA 5G4LA 1RM4A 7ADHA 1Q7GA 1I5RA 3PLRA 4PG5A 4MP3A 5AXBA 4J49A 1DIGA 2QHXA 2PNFA 1B0AA 4XQGA 5LDGA 5ADHA 1ONPA 1PJQA 4D0RA 1K2WA 3BHJA 1UUFA 3JQAD 3QLJA 1Y8RA 4E21A 4YRBA 2OP1A 4FC6A 3FNGA 1ZXBA 4HFMA 4JBIA 1PS9A 4Q9NA 2VYVD 3DFZA 2GPTA 3CMCO 4AJ4A 3AI1A 1N1GA 4IIVA 3H6KA 3HADA 4X54A 1I33A 3NTQA 2PGDA 3P19A 4E2ZA 3UW3A 5GZ1A 3HDYA 3PQEA 5CDSA 2DTXA 4BNTA 1JWBB 3ETEA 3Q3CA 4BO0A 3B1JA 2OZPA 3I9LA 4CL8A 1HETA 1ZSNA 5DOZA 1EFKA 3GAZA 2AQIA 3GMSA 4CUJA 3FNFA 2EW2A 4HNGA 1IE3A 3JQAB 2B37A 4CQMD 1ADBA 4HXYA 3UCXA 5IG2A 1R4NB 1KETA 5ENDA 4AFNA 3WSVA 1E1LA 2EGHA 2NACA 4YVFA 1LLQA 4H16A 4BNUA 1RYEA 3L4BA 1NNUA 4L74A 1HE2A 1DDOA 1WP4A 1KBZA 3G49A 3ON5A 1GZ4A 2VUSA 3I9OA 1RM0A 1NR1A 3HFGA 5DBGA 4GSLA 3TZKA 1DAPA 3OA0A 3QWBA 3KYDB 4ND1A 1WLYA 4AJLA 2IE0A 4YJDA 1L7EA 1O5IA 1S6YA 3S1LA 3TSCA 4R1SA 4WEOA 2VWGA 4S1VA 4F45A 1Q7CA 4CMGA 1I01A 1P1RA 1U1IA 4J4TA 1XDWA 5JXWA 1GU7A 5DP1A 5K6AC 2Y99A 3FCOA 4E31A 1B2LA 1ZNQO 4BKUA 4YQZA 4EJ0A 1E5QA 3AY6A 4NFYA 5COAA 4F46A 2PZLA 4XDYA 4C7JA 3U0BA 3LC2O 4MJLA 1UJMA 4JP3A 1V9LA 2EGGA 4YTEA 4GWGA 5KVCA 3F6YA 3AOEC 1YGYA 1M6HA 5H83A 1TXGA 3KYDA 2Y1GA 4P22A 4B8WA 1U4SA 2GGSA 4OAQA 5U9CA 4IJKA 2EW8A 3K96A 2A4KA 3SEFA 1IULA 2EKLA 4L8VA 1LJ8A 2AMFA 3JQFC 1H5QA 4GLLA 2YDYA 4QFCA 5BT9A 1Z7BA 4XCVA 3D5TA 4YA6A 4WLNA 4AVYA 3COSA 3LT1A 3Q11A 1ZXLA 3GVHA 4IJUA 3WGHA 3GHHA 4IGFA 2B0JA 2BELA 3OJOA 1BW9A 1AGNA 3QY9A 3TJRA 1U8FO 1YB4A 3V1UA 1ZCJA 4KTTE 5GY7A 3UVEA 2DLDA 1IB6A 4YJFB 3Q6IA 3R3SA 1E6WA 4E33A 3L4BC 2JAHA 2UUOA 4AJKA 4YJGB 1PJ2A 5HM8A 1PJ3A 4AJIA 1MG5A 3FTPA 4IJWA 1J0XO 3TPCA 4WE3A 1VL6A 5JDIA 4M89A 5I9NA 5B4UA 3D3WB 3UCFA 4BKPA 4DC1A 4DPKA 4CM8B 1Y8RB 5A9SA 5CDTA 1U3TA 3PDUA 1Q0QA 5COBA 3STHA 5JAMA 3LC1O 2VHVA 1F14A 3K92A 3KUXA 4URFA 3PZRA 4WPGA 3GT0A 4NFHA 4Z9YA 3ZWCA 1NVMB 3HB4X 4IDFA 4E13A 5TRTA 4EEXA 4YT8A 3BA1A 4UVHA 1ZSYA 1JA9A 4HKTA 4BO5A 4DUPA 1Y5MA 4MVJA 4CM3A 3RQSA 2FOIA 5TIIA 3RU7A 3C1TA 1TT5A 1E6UA 1DRWA 3UOGA 1W6UA 3L6DA 3ZHXA 2P9EA 2BRUA 4TRNA 4BHTA 1PWZA 1P1KA 2YV2A 5IF3A 3PEFA 5BSEA 3PTZA 4K28A 3W4KA 4C7KA 3ZCXA 1KEVA 1MG0A 1B3RA 4DQVA 3RFVA 5F3RA 3WGOA 3WB9A 3U4DA 2O3UA 5DF1A 2Q1SA 5A5EA 1C3VA 1U3UA 1GCUA 1WZEA 3T7CA 3ZH2A 1UXHA 1P77A 1YWGO 2G5CA 3BMCB 2OMEA 1ZSVA 3WTCA 2XF8A 2D5AA 1GADO 1F0YA 2O3SA 4XGNA 3C7DB 1GD1O 3DZJA 1HZZA 5LC1A 5KOIA 4CMJA 1DEHA 2Q3EA 3HSKA 3PZBA 5JPIA 2JHFA 4M55A 3LF2A 3JQFA 4Q3DA 1DC6A 2NLOA 5T6BA 1NYTA 4W9NA 1T1SA 2CDCA 5JLAA 4WLVA 1PGJA 3MOGA 4IM7A 1J6UA 1LC0A 1ZH8A 3SC6A 4GX1A 4EBFA 3TFQA 3JCZA 4YWJA 3RSHA 4E4YA 3AFMA 3FWNA 3ONEA 3SC4A 2ZYDA 4Y98A 2VZ9A 4XR9A 1GQ2A 3BXXA 2UV8A 5I8WA 3MJSA 4I9UA 1BTOA 3BZUA 2J6IA 4DA9A 4J0EA 3LC7O 3LSYA 2VRCA 4U0JA 4E5PA 2B4RO 4RVGA 4XA8A 1QSGA 1UR5A 2BGMA 3QW2A 4B8ZA 3N7UA 1LA2A 4BNNA 3B1KA 3DOCA 1VM6A 2RAFA 4B4WA 3VPHA 1K3TA 2GNAA 1NFQA 1P3DA 3ENNA 3EDMA 2O7QA 2WDZA 4CODB 3L07A 4XGIA 2HMWA 3HZZA 4FN4A 4QUKA 4HADA 1A4IA 1KERA 5DP2A 3K5PA 5IDXA 4F3YA 3GGOA 2PD3A 2CD9A 3DZHA 2PZKA 2G17A 4JGBA 4BVAA 4FFRA 2FR0A 4YRAA 2QRLA 2WD8A 3HN7A 2PGJA 2VOEA 1QYVA 3GNTA 5EQFA 1DSSG 4NZ9A 3DONA 5U4QA 3ZNOA 2ZYGA 4DVJA 2C5EA 2RCYA 4AG3A 5CAEA 1EDZA 4R54A 4Z0TA 4BNWA 5MGBA 2HLPA 3ZV4A 1U4OA 4IPTA 3BTSA 5G4KA 3K30A 1DLJA 2J3HA 4NU5A 3T7EA 1JDJA 1ISIA 1JN0A 2TMDA 3JD3A 3SX2A 3JQ8A 1U7TA 3RUHA 1Y5RA 3F5QA 3ZWAA 3GHYA 3QVXA 3GA0A 3PP8A 4JBGA 1M2WA 4RF4A 1YKFA 4D42A 1YONA 1Z45A 4G5HA 1C0LA 4GX0A 5HTOA 3AUAA 5BSFA 2ZB3A 2QZ9A 1KVUA 1NAIA 1B14A 4GI2A 5EQDA 2PZJA 2VHZA 1RYDA 2P68A 1CEQA 1H94A 3C1AA 4N18A 4CPDA 1LDBA 3EAGA 1BXKA 2DQ4A 3JYLA 2Q99A 3PFFA 4YACA 3H9GA 2XAAA 3GG2A 1C14A 3I4CA 1TT5B 3L77A 1HDGO 1LLCA 4R1TA 1U8XX 2NNLD 1P0FA 2DTEA 4CMAA 3S8MA 2GYYA 4DPLA 1KC3A 3ANLA 3QWHA 4RO0A 4U6SA 4XYBA 5IDWA 1YQXA 4DYDA 5K1SA 4DMLA 1NQAO 2BMAA 4FPXA 3ROQA 3TWOA 1SBYA 2O50A 3CEAA 3B1FA 4TSKA 2ZJ1A 3SJUA 4BV8A 2YFHA 1DXYA 1CIVA 1CJCA 2NU6A 8ADHA 2J8ZA 1ZK4A 1QRRA 2I65A 4RF3A 4Z0HO 2Y0EA 2EP5A 2Q50A 5L40A 2QRKA 2PZMA 4H15A 4ZRMA 1H6CA 2O48X 1I36A 3KLMX 4GVXA 3F1LA 2NQTA 4NR0A 1RKXA 4BB6A 3MOIA 3OQBA 4R51A 3V2UA 3ZHBA 3WQQA 4DLAA 2CF6A 4YT5A 1F8FA 4E2YA 2FZWA 4AJJA 1NX6A 3G17A 4BNJA 3JYNA 1JW9B 1GPJA 4K26A 4BNMA 4CLHA 1ENYA 4R68A 1GL3A 1LDNA 1HSOA 1ZEMA 3PJGA 1EDOA 3DBVO 3A28A 3EGOA 4BGVA 5JY1A 4ZICA 2F00A 4J2OA 2GN9A 4BGUA 1PEDA 3QVTA 2J3JA 1T2DA 2H63A 3MWEB 2BF7A 2ZQZA 3GEMA 2DKNA 4FGWA 4W99A 4Y6RA 3VPFA 2IDZA 2DBZA 2B5WA 1NP3A 3C7AA 4TKMA 3OFSA 2FR1A 4N5MA 1EVJA 1KY4A 3AW9A 5A4DA 4JIGA 1YBAA 3Q2IA 4BKRA 1HLPA 3H2ZA 5EPOA 1PJSA 5T8KA 3GGPA 4YAJA 4PLPA 1PZGA 3DMTA 4XRGA 2VHYA 3D7LA 4OIMA 4XQCA 3O4RA 3RAJA 3VZPA 5I7SA 1LLDA 3U62A 4ZJUA 5I9LA 2H6EA 1DOHA 1HT0A 4P4NA 1ENZA 3D64A 3ULKA 3DAFA 3K73O 4O59O 4AJ1A 3UF0A 4J3FA 1FF9A 1XWFA 1WXDA 3I9NA 1A4UA 3BTVA 1IL0A 3D5QA 4FGSA 1YE3A 3ROKA 1HDZA 3GZNB 5A3JA 3NX4A 1DFIA 1T24A 3AUUA 3OM9A 4Y67A 3K2BA 4IQGA 4B7XA 2E37A 5LDHA 3AI2A 2WSBA 3WG9A 5K0ZA 1E7RA 4GSKA 2ZCUA 4LVUA 4NHEA 3JQ7A 2CVOA 4CV3A 4FSHA 3PHLA 4RZHA 2VUUA 1UP6A 2D4AA 3MZ0A 2YV1A 5EIOA 3E9MA 4XR4A 3DZIA 4YJFA 3U09A 3FD8A 3M1AA 2FRDA 4Z9XA 3ZU4A 4BNXA 3WWYA 4II2A 1X0VA 4CMKA 4O5OA 3JQCA 1KEWA 1ISGA 4QXMA 1I3NA 1N8KA 1FXSA 2OBNA 4PG7A 1P9LA 1NQOA 1DHTA 1P1HA 1NR7A 3PWZA 5CDYA 2QIOA 1AUPA 4PVCA 4HBGA 3SXPA 1P1IA 5BNIA 4TWRA 2IEBA 4YYZA 2PH5A 1B26A 1H6AA 3TZCA 3O9ZA 1QG6A 2OOSA 1GUYA 2YQ4A 4NH4A 3FBTA 1E7YA 3F4BA 4B4OA 3ICPA 4AJOA 4BNFA 4P8RA 1I10A 4BMVA 3H5AA 4GL4A 4N5NA 1LSOA 2HMUA 3RC7A 3VH2A 3LQFA 1CDOA 1HEUA 5JDCC 1LSUA 1SAYA 1X7GA 1EK5A 1NASA 5ES3A 1GZ6A 3WNVA 2IXAA 3H8VA 4NJMB 3MTGA 4R69A 2X8LA 3LLSA 4UUPA 1E3EA 1L7DA 4CR6A 5KNLA 3AUSA 2WMDA 2CFCA 2XPCA 4MVJM 1PSDA 4INAA 1RM5A 4OXKA 3PWSA 4BKQA 4J4BA 4JK3A 4TRRA 4KUGA 4BV9A 3HDQA 1SMKA 2PD6A 1XCBA 4DGSA 4NBTA 4EJMA 5TLSA 1NFFA 2DPGA 4IINA 3LLVA 3NYWA 4ZQEA 1UXGA 2O2YA 3ZWMA 5JYDA 1HLDA 2OHXA 2C59A 4LMRA 3BMCA 3N74A 3GUCA 2AQKA 3RIHA 3FBGA 5IZ4A 4PCVA 4F6CA 3OIDA 4L4XA 5I8ZA 1W0CA 1JQBA 4P4LA 4L4SA 1PU2A 2X6TA 1BMDA 2ZB7A 1BXGB 2EP7A 1IZ9A 5IN4A 3GZ4A 1LQUA 4M49A 4U5QA 3RUEA 3V2GA 3AM5A 3DHYA 3WMXA 1O0SA 4HX5A 1YQGA 3U3XA 1DC5A 4Q3NA 4FIZA 1V0JA 3R0IA 1QV7A 4K6FA 2FN7A 2J5QA 1Z73A 2WYWA 2X5JO 1P74A 4XB1A 1G6KA 1E3IA 4KZPA 4ITUA 5AXDA 1Z82A 3EZYA 2QRJA 4NFSA 2DUUA 1EUZA 3VPXA 4BNIA 3OA2A 3PIIA 1ZK2A 4MP8A 1EEHA 1ZK3A 4S3MA 2DBRA 4OXNA 1HYGA 3BMNB 4XB2A 2BFAA 4IXWA 3EMKA 2J3KA 3ANMA 3CUKA 4Q3EA 1VSVA 2NVBA 3IC5A 3OJEA 4ZU3A 1GR0A 5L7YA 2GN6A 4B4VA 3GPDG 4O0LA 4P4GA 4FB5A 1A27A 4XD2A 4CR8A 2E6UX 1VLLA 5CP8A 2AA3A 1B15A 3OP4A 1D1TA 4A03A 1U28A 4WNIA 4RF2A 5A06A 1BHSA 1S7CA 3Q9NA 1SEPA 3WJAA 4B7UA 3QP9A 3VKVA 4CUZA 4MO2A 1AE1A 1FMCA 1ZJYA 5C5IA 1XHLA 5IZCC 4W4TA 2GRAA 3M6IA 2H9IA 1X7DA 1MP0A 1CF2O 1HWYA 1U3WA 3WYCA 4YJHB 3BIOA 1E1KA 2Q2QA 4AICA 3IUSA 5TT1A 3WBBA 4G81A 4BL5A 1Z75A 2VN8A 1TLTA 5JBIA 1LNQA 3OF2A 3QA9A 2IYPA 5A5FA 4BQPA 4IDDA 4CMCA 3INTA 2BKAA 1SZJG 1ONOA 4H3VA 5DT9A 4IMRA 5KTKA 1E1MA 1P1FA 3ASVA 2VNSA 2YQ5A 3EW7A 1ZJZA 3JQGB 3WGGA 4WLFA 5L7WA 2FP4A 3RKUA 3I3OA 4RZIA 3C24A 2CMDA 1U5AA 3AM3A 3FF4A 4CLRB 3KOUA 4E2WA 2G76A 5I9MA 1I32A 1SO8A 5IFLA 4ND5A 2HQ1A 4J7XA 1V8BA 3IOYA 3ADPA 4KWHA 3PQDA 4BO8A 2QW8A 1DC4A 4MKRA 2Q1WA 5FWNA 1CERA 3WBFA 5KVSA 3G0OA 3ICCA 5L7TA 3OJFA 1FDTA 3NGXA 4L76A 1QV6A 2AEJA 1R4MB 4IZHA 5CDGA 4NBUA 4FJ0A 2VWQA 4GGOA 4PFJA 4LCJA 3RKRA 1E3JA 2NVUA 3BMOA 3HE3A 2RH4A 1JVBA 2WD7A 4XX0A 4CQLB 5HRUA 1SB9A 1DIRA 3VHRA 4IIUA 1YDEA 4MKZA 1EVZA 5GZ6A 4A5OA 3I9KA 3RASA 4NI5A 4JLWA 4NBRA 2V6MA 5ER9A 1Z7EA 5JMWA 2VCYA 4J7UA 1P1JA 1A9ZA 1FJHA 4MPDA 4WECA 3VVBA 3E9NA 3HJAA 1XU9A 3C85A 3WFIA 3FPCA 1DJQA 4R9SA 3PVZA 5F1OA 3U49A 4E2XA 3IL2A 3CZRA 1PJ4A 4JN6B 3U9LA 3NGLA 1KVSA 2PGLA 3RC1A 3WIDA 1HE5A 4UVEA 1GV0A 3VOSA 3WLEA 4OGWA 1BDMA 1PQPA 2EV9A 4XYMA 3V8BA 3CIFA 3DQPA 2IZ0A 1I2ZA 3BMOB 2Q45A 3OEWA 3HDJA 4I9NA 5AXAA 4LVCA 3BMQB 1PS0A 1TA4A 3WDSA 2PY6A 3R3JA 4BO1A 1QLJA 4YQYA 3NDIA 5A1TA 1X14A 3ZWPA 4BNVA 4CM4B 1JWAB 4E12A 3PQFA 4U7WA 1ISMA 3JQ6A 1LRKA 1R12A 5EINA 3RUFA 4BNHA 5JW6A 1X1TA 3G3EA 1OC4A 1GAEO 1HKUA 2C7GA 3JQDA 3KYCB 4YPOA 3DDNA 4MVJH 4YJGA 3EK2A 4OSOA 3UICA 1C1XB 4W7IA 3VC7A 3E03A 1Z6ZA 4U8GA 3ZWVA 4EYEA 4YR9A 2QG4A 1NPTO 3PWKA 1GUFA 3EY4A 1F12A 4RVUA 1A72A 3N58A 2IZ1A 4MKXA 3AOEA 2D0IA 4IDAA 1E77A 3WNQA 1ONNA 3LT4A 3E1KA 4D7AA 3UKOA 3VZSA 3D3WA 5KJFA 5GZ3A 1ULUA 3H7AA 4BB5A 3GVCA 3R1IA 4FFNA 1HE4A 4IQ8A 3QQPA 8LDHA 3ZI0A 5K9ZA 2QZZA 4IY1A 3GVPA 4EITA 3DXFA 3DHNA 3GFGA 1H9AA 3MJVA 3GN2A 2HDHA 4H7PA 1NHWA 2FPGA 2AXQA 1ISJA 3Q0EA 2BFPA 2WTBA 3KB6A 3H9JA 1O89A 2GZ2A 1LTHR 1PZHA 1FK8A 5A9TA 4HV4A 1T26A 3K8ZA 1Q0HA 2JD2A 2CUKA 3HUDA 3VDQA 1IOLA 1YL5A 3WQRA 2X86A 2JFGA 4DBVO 4RDHA 3WGZA 1ZBQA 2EG9A 1K0UA 3WGYA 3H65A 2GN8A 3G79A 1PQUA 1R66A 3RBXA 5HWSA 1XU7A 3DL2A 5TSDA 1T4DA 1TEHA 2NTJA 3NV9A 2JCYA 3RFTA 1XR3A 2QYSA 1DJNA 1LDGA 1BDBA 2PK3A 4DQXA 1A7AA 3ZWNA 3MWDB 3KYBA 1PL6A 4PRLA 3HQ4O 2AHRA 3D4OA 1BGVA 4KP7A 2W8ZA 3ZHZA 5A04A 1W8DA 3VTZA 1LLUA 3JQAA 1PZEA 4IDEA 5FF9A 5DNAA 4KUEA 4Z6KA 5JMPA 1PJCA 2G1UA 2PKQP 1E3WA 5JYEA 1T2AA 2C2XA 2HKIA 3V1TC 4K1LA 3C1OA 1QYDA 4M87A 4E5YA 1HDRA 1YVEI 5AOVA 2W90A 4JJIA 4D0SA 2JFFA 2I67A 2YJZA 3UCEA 4I5DA 2XOXA 4YDRA 4CR7A 4DL9A 3OECA 5TS3A 4BOYA 3IIEA 4DMMA 2Q46A 2VTDA 3DZBA 3HB5X 1UAYA 2POQX 4IS2A 1HE3A 3TOXA 3QVOA 2B35A 2H1SA 1SB8A 4NJMA 1PWXA 4GGPA 4WKGA 1PGOA 5KJ6A 1UAGA 4MIYA 1FDSA 3DBLB 3ASUA 2AQ8A 3DTTA 5DCWA 2I3AA 4I5EA 2VOJA 2UDPA 2HU2A 3DAPA 4BQRA 4BGEA 1C0PA 4KUHA 1HDOA 2C29D 2OBYA 4R3NA 2ZTLA 3D4NA 3GDOA 3C7CB 3IP1A 5MDHA 1P45A 1XLTA 4BO4A 3GDFA 3JQ7B 3BMNA 3K2EA 4J1QA 3WGTA 3D4PA 1DIBA 1VPDA 1YL6A 4XJTA 5DBIA 3H3JA 1ZK0A 1R16A 4CLXA 4WCFB 2X0JA 4J0FA 4UUMA 1LXCA 4C4OA 5EESA 1H93A 1BRMA 2A94A 2AG5A 1A7KA 1JKJA 2R00A 4CQMA 2HJRA 1AXEA 1C1XA 3PLNA 5B4TA 1YDWA 4NJOA 4ZD6A 2F1KA 4YEDA 3TN7A 1ENOA 4CM6A 4CM7A 4DQUA 1OI7A 3GK3A 3GPIA 2Y1OA 1WDKA 1XQ1A 2YY7A 5IJZA 3ORFA 3O8QB 4GAEA 4HY3A 4QEDA 5CDUA 1WDMA 4LRTB 4R9RA 4B3IA 1DFHA 1QYXA 3FNHA 3IAHA 4AJPA 1HF3A 3DBHB 3QRWA 1IHXA 3AWDA 1UDAA 4FJ2A 1PR3A 4PLVA 1UZNA 3P5SA 1M66A 3F9IA 4RPHA 1LDYA 1KS9A 1EQ2A 5ICSA 3PGXA 4FCCA 3UXYA 3B6ZA 3KV3O 2B4TO 5KKCA 4HNHA 1OBFO 2PKRA 3ZWWA 3ROMA 4ZQHA 3I9MA 1P31A 2Y1CA 4R5HA 2PV7A 3WS7A 2C5AA 2B4QA 2O23A 1I30A
chains in the Genus database with same CATH superfamily
1YCDA 2FN4A 2YFKA 1IUKA 1AS0A 4MR8B 4UXIA 2QTGA 2O3TA 2L69A 3PR1A 3VBCA 5I7FA 2O5EA 1CJSA 1EVIA 3ROPA 4KRFA 1U11A 3KSBC 1WUHS 1J33A 3EGCA 3MUNA 3ZBQA 3PNQA 1B16A 1VLQA 2R751 1YOBA 2FX3A 3NALA 4JUCA 4KTVE 2XCIA 2W2PA 4ONEA 4P3XA 4RIIA 4RBNA 4X1KB 5KKAA 3ADKA 1MUUA 1Z4KA 5KNCD 2YVQA 4MS1B 4OHFA 4QVKA 3CZMA 4KOAA 1LBEA 4MS4A 4O6VA 3S99A 1EXNA 2JH3A 2QQ0A 1X7WA 4B76A 2FLVA 4XLZA 1E1RD 1IEQA 2O1EA 3B8EA 3AR6A 3MOSA 3A1DA 5CXSA 5D1NA 3TXXA 3V4ZA 4A2PA 4ZTUB 5KJEA 2C83A 2HUNA 2XGOA 2CFOA 3PSAA 4MUXA 4Q6BA 4B6QA 1EXMA 1LEHA 2VWHA 4IGAA 3ZX5A 5KNDH 4R2WA 3VQTA 3MUFA 1KEUA 2P9GA 1XF1A 3UMBA 2YHUA 1WMAA 4OFXA 3BHIA 1Q74A 5E9AA 4QOGA 2R8XA 4I6EA 4ZGBA 1OGJA 2O8FB 1NW6A 2EEZA 3C6YA 4Z4EA 4YHBA 3C74A 1LZKA 2IP1A 2G8NA 4D43A 3BRWA 3QE2A 2O54A 3AF4A 1ZIDA 4N3BA 1JG3A 5JSKA 3EYAA 1K6MA 3ZGOA 5BQ3A 1KJJA 1N2SA 2NYRA 1AKUA 2IYOA 2WLTA 2X4GA 1KH1A 4DQKA 1NC3A 3G89A 4GI5A 3R4VA 4KK4A 5C34B 3K9FC 4YAIA 1RRCA 1T35A 2HHJA 2XTJA 3FPAA 1GU0A 4WEQA 4QPDA 3UK6A 2RGUA 3ZHUA 3NHJA 3CJTA 1RQ7A 2XNDA 1CDDA 4D81A 2ZRDA 2H00A 1G7RA 3AF6A 1SN7A 3Q7SA 1YACA 3SPXA 3WICA 3OI7A 1HQCA 2DY1A 1SR8A 3L6EA 3OKPA 5BY2A 3OPNA 4BWVA 3CPHA 3UJBA 3PK0A 4DRZA 3K05A 4G8JA 1FFSA 5CCDA 5EHGA 2AZTA 4HDSA 3GW8A 4BXOA 2WIJA 5G1PA 3H9CA 4V1CB 1HNNA 1YOVA 3TOZA 4Q16A 3PENA 3UHFA 3VUFA 1GFIA 5CVDA 3UMRA 3FPLA 2BGKA 3NKLA 1SD5A 4J1TC 3L8GA 2I3BA 1FDVA 1WVMA 2H18A 2VT7A 4MEJA 2PN1A 3F7MA 1OZGA 3JWPA 2ZTMA 1A5BB 1J1IA 4RQTA 3UXMA 3WA6A 1MAAA 4DC0A 5JCJA 3VISA 3RF7A 3AYXB 2ZQ5A 3L4EA 2B4YA 3LUBA 4F4FA 1DJOA 2OM2A 2TMGA 1TJPB 1XZCA 4IOLA 1C81A 2YHIA 2CLKB 3X44A 4K05A 2HMTA 5HUJA 4LDJA 1QXSA 2WWFA 2BTQA 3PC2A 4DCNA 1JLSA 1U3FA 1FRQA 3SF0A 2P9JA 3C7KA 1G8SA 1FTWA 2VFAA 1LS1A 2ODAA 3YASA 1SUIA 2Q3MA 3NNDA 4G56A 2ZJ6A 1RPZA 1XZIA 3D43A 4EHLA 3IT2A 2R9VA 4H1VA 2W8BA 1EFHA 3VYWA 1U0FA 4BFUA 3IDSA 1DXOA 5TNXA 1PBTA 3IKVA 4NL4H 1WHSA 3BE6A 1EK6A 3VA7A 5AJYA 2IEIA 1RPAA 2M1XA 4L4RA 4R31A 4RGVA 3TOSA 4B83A 4ZZ3A 3AU8A 4YUWA 4JA2A 4FFMA 2DLCX 1FZQA 5EP2A 1YFJA 2QTZA 5E3IA 4DS3A 1DB3A 2R7AA 2IBMA 5DNCA 1AZLA 3RRJA 4CDNA 1KR5A 5LQSA 1XOIA 3M4NA 4JCCA 1YXMA 3HZOA 1IOZA 4TZKA 2BFFA 2BR5A 4JYMA 3WC4A 721PA 1KYXA 2CVQA 2VNAA 3IVCA 4BE7B 4YRFA 4XVHA 4OEHA 1BKDR 3C6ZA 1ADYA 3E18A 1OF1A 3PHGA 1WSAA 2ZR9A 3FSRA 4HDMB 2HF2A 3GAFA 3KQLA 1EXDA 3HJFA 3WRYA 1ZI9A 5K8TA 5ECDA 2W6OA 1YS7A 1LPMA 4ZYUA 3I4LA 3UUEA 3CR7A 3A31A 3A6EA 2ZRIA 4IW3B 4DMCA 1I24A 4B1FA 2PSDA 2QLLA 4LMPA 4RD0A 3LUGA 5CT4A 1CRZA 5FA8A 4I66A 2Y3IA 2RI1A 1V9CA 5CIYA 1U0JA 2QE7D 2WKPA 3PDIA 4R1OA 3I9V1 1QRUA 2WIDA 3L9WA 2RGNA 3ZHSA 6LDHA 1XPJA 3V1LA 2H17A 4MCHA 3W8EA 2X3YA 5ULLA 3ZX4A 1L4BA 4B87A 4DLSA 3G2IA 4EKIA 13PKA 4ID3A 3SVTA 3TLKA 4PCLA 1DEKA 1PR1A 1A8QA 4ZAVA 4QFDA 1QYCA 5JSFA 4Z1MD 1FPQA 4NABA 4ZV7A 4OATA 1DNPA 2WM3A 2QUIA 1N2ZA 3P7MA 3A0UA 2SNIE 5IBPA 4GMFA 1TIKA 1DKNA 1UXJA 2CJXA 4IZIA 4Z9FA 3OC0A 5GVRA 5B2ZA 3U3DA 5C4MA 1CJMA 1E6MA 3DE5X 1LPOA 4YS6A 1EE9A 2ODBA 4R0NA 2RGEA 1NQTA 2YWCA 4JLSA 1NZJA 3ZW7A 2Q9CA 5DBFA 3UBTA 4C7BA 1K66A 4HDKB 1JDNA 2C03A 1SCUB 1X8LA 5FPKA 2FSVA 3EGWA 1II0A 1NTOA 1E7QA 4UATA 2NWQA 1H2BA 3CE6A 3FVQA 5AK0A 1QH8A 2B82A 2VJYA 4NCKA 4BEBA 1U1FA 2YW9A 1KAGA 3KOWA 4U00A 4Q7LA 4BMSA 1BCSA 4NQRA 3ROXA 1KS2A 4RE5A 5EIFA 1E6LA 2OVFA 3R23A 4IO0A 5JQGF 3JX9A 1WXGA 4G0OA 4RY9A 1Y42X 3ENZA 1M6EX 5KOHA 4C4SA 3RS3A 3B1YA 3EVGA 1A9YA 1KDTA 2CDBA 4NONA 5DHAA 5FWDA 2YN2A 1HM5A 3DQZA 3KFXA 4QTXA 4WLOA 1KE2A 4F9TA 4KMSA 4BKOA 3AU9A 1ZBDA 4NBSA 5DLQC 1G2QA 3GCWA 5CNJA 3WLQA 1T8YA 2O4CA 3KHKA 1SVNA 1EMDA 4WJKB 4MZDA 2YXNA 2F1RA 4W7HA 2UVPA 2R6FA 2CEAA 3K9GA 2HY7A 4P58A 3IERA 1L4UA 1Z7GA 4FXOA 3OWXA 3O8DA 4YWHA 3RSQA 4OPMA 4CQLA 4OGLA 3O1LA 4JLBA 1L7VC 1M1YE 2Y93A 1GITA 4D44A 1E9DA 3GNQA 2FG6C 3EXHB 2QG6A 3HYSA 5K4GA 4EIWA 4QBFA 3HVKA 2P4QA 1Z2DA 2Y9PB 3H6GA 2CW5A 5TS2A 1AU9A 1VL0A 2P9YA 3WGIA 1MOSA 5FAKA 3N2EA 5CA1F 4A15A 4KGDA 4FX5A 2YHBA 3KCNA 3NBAA 4L22A 4TROA 4YYEA 4DMKA 5DTRA 1YZHA 2GEVA 3P20A 3E5MA 2Q5JA 3EZ7A 3F6SA 1MTZA 4FINA 3AHJA 2KLHA 5EC8A 4E5KA 4CTKA 5DN9A 5C52B 4GKVA 3LHIA 1KDPA 4NLLA 3V2HA 4OYRA 3RTEA 1JBQA 3UJDA 4AZVA 1T15A 2AW3A 1DXHA 4LFCB 1NE7A 3S0JA 2AIRA 4MMZB 1QIKA 2YTZA 4WKPA 1G20B 2JFHA 1I7QB 1Z0ZA 3VPBA 1IRIA 1OD6A 3H1BA 4V0RA 3EXEB 5FJJA 4HNSA 1TOAA 4JLMA 1C9NA 2YYSA 1I4OA 1PL8A 1IY8A 2Z9CA 3PIDA 2OO3A 3SFTA 2P91A 4AS2A 4BJ6A 2GWRA 5IK2A 4CEIA 3CKLA 5DYNA 2FK7A 1NPYA 1CNFA 3GEPA 1RYMA 3MF4A 4LHWA 3WI7A 5CB6A 3INRA 2IPXA 3O8QA 1FRZA 3TLBA 4WY5A 4XEHA 1GGJA 4FP9A 4BIIA 4XUCA 5HKKD 4X20B 4F2HA 4FYIA 1REQA 2ZJ5A 1XN1A 2R79A 4UEQA 2J5KA 5KYWA 1OBVA 4EVQA 5ANRB 4AZ3A 1AMOA 1SBZA 3P9ZA 2O5CA 1C9JA 1E2FA 2KLBA 3IDZA 3M6WA 4XASA 4RVSA 4ALIA 4EB6A 3TIFA 2VDPB 9ABPA 1HYEA 4P7FA 5LLTA 1T9BA 2HHCA 4WKCA 3M6LA 4PYOA 4DSUA 2X40A 3A11A 4O1MA 3TEJA 4YQFA 1GWNA 1XAGA 2DQZA 4J0KA 1ETHA 2Q2WA 1M54A 1Q7BA 2R8YA 1VZ2A 5DYYA 1K7EB 3RARA 2HRZA 4EUHA 1SELA 4KFRA 3SJBA 2ZBQA 4KLAA 2WYVA 3CA8A 2NU7A 4HVCA 1QE3A 2FN8A 4IXDA 2FOLA 2Y1EA 5LB4A 3W1VA 4ZHQA 3ZBUA 2FJPA 5AM5A 4Z3DA 1ZR4A 2WJ6A 1F0PA 1ZH4A 1K6XA 9LDBA 1ZM4A 3E9YA 3MWGA 3LPNA 2C7VA 1AQJA 3CURA 1J00A 1QVWA 4K9NA 1T3LA 5EKDA 5ALUA 2E6KA 3VU0A 4U9IS 1GV1A 5K2MA 3O4HA 1XNRB 5EN4A 2E89A 2W6JD 4F5YA 1VA4A 3MERA 10MHA 1JHRA 2FWJA 3R3YA 2EQ5A 3FSGD 3IEPA 4NX2A 1RQLA 1M76A 4MP6A 4E15A 1LGYA 4ETWA 3DZKA 1UJ4A 4EM6A 4P0QB 4X90A 7REQB 4DG8A 1JXAA 2FMUA 3TZHA 4MWBA 4XYGA 2WSYB 1A5TA 2GERA 4DLKA 4LJYA 3D6MA 2R44A 2VZEA 3EXIA 1VJCA 5L3QB 2PAAA 5ICFA 4CL2A 1MHTA 4ZAYA 2OXRA 4AP5A 4CLOB 2C9BA 3CV3A 1H4SA 1C2YA 2H1FA 4UM7A 1Z5PA 3HFJA 1ZM3A 3OKCA 4PLCA 5A0FA 3WKBA 1KGSA 3LHDA 2BI8A 2ZUDA 2ZBGA 3CX6A 3P2OA 3QHAA 2YX1A 3R0JA 4REQB 4TRMA 1FNSA 3ZJ4A 4FMBB 2QM3A 2IS1A 2J9FA 1G5HA 1GTVA 4CKBB 4CF5A 3R7NA 3W8DA 4CETA 1RS0A 2YFQA 3AFNA 4WCFA 1NV9A 3ROZA 2AMLA 4G97A 4PONA 2JFWA 3F1KA 3ZDZB 4F6LA 1JNXX 2QRGA 3D1VA 3L7KA 2AXPA 4KLZA 5GONB 5GJVC 5KWEA 3Q15C 1PFVA 1M1NA 3SJ7A 1SXHA 1B0ZA 1DBWA 4HGQA 1UL1X 3FMVA 4P4SA 3DFUA 2I5PO 2OO5A 5D86A 2H7CA 1KFKB 1WCIA 4ZOAA 4NBVA 1TRKA 3KWMA 2OBLA 2Q9BA 4AZ0B 2ISQA 4UKDA 1DT5A 1RCFA 2AMJA 3K2IA 3EXHA 4WLEA 2OY0A 3SQOA 2VXOA 2QR3A 2VT3A 1U3VA 1NNLA 1IU9A 4LY0A 4W6QA 3TNFA 1A88A 4B47A 1QP8A 4EL5A 3REOA 5LD2C 2XH8A 2OZKA 2WAXA 5CHEA 2BZ1A 4L4ZA 4B3SB 1U7HA 3KYCA 4ZEVA 1UBOS 1THTA 3RIXA 4BNDB 3ZKWB 3WY9A 2JJQA 2JHGA 4IFBA 4M0UA 4MI6A 2QPLA 2OAGA 1VL2A 2WWYA 2B21A 4MR7B 1VL8A 1AUXA 2WTMA 4MITA 4M9CA 4QOHA 4O4HA 2UVDA 1LK7A 1RYBA 1XIVA 2ENWA 2O0MA 3FHCB 2GPNA 3GDHA 2ZSEA 1F6BA 3I0NA 3NUZA 1PGQA 4G5YA 3N8GA 4OOEA 1LI4A 1RQRA 2VO1A 5KVQA 4U7JA 3WJ7A 4ZHQF 4IDNA 1YU6A 2Z6AA 1M8PA 5FCDA 1H2AS 4FOTA 1SKBA 3SC2A 4CFZA 2PHZA 2F3TA 5K3DA 5ELLA 5BSMA 3GEGA 1XI2A 2FTKE 2JIOA 3QE3A 5AUNB 2V5UA 3EZFA 4FGJA 1KU6A 1TZKA 4GL2A 2L17A 1Y9JA 2GTIA 1ZQ9A 3O94A 1P4SA 4X1KA 1FDWA 1N2CA 3BE4A 3AB7A 1T29A 3ZNNA 5EYPA 4MS4B 3DE1X 4PO1A 3MCUA 4UW9A 4A73A 2N1BA 3I32A 3N3AC 1QNFA 5F33A 3QVJA 5BWNA 1XQVA 2BCGY 3VR3A 1LCIA 2NU8B 4BFXA 1XDDA 2K2WA 2NP6A 1QTIA 4R8RA 4ESOA 3T1HB 1I7DA 5H3LA 5C3MA 5FUWA 2MDTA 3Q8MA 4CU2A 4OFBA 1X1EA 1CE8A 1V45E 3PUHA 1NF2A 3PXXA 3W3AA 3FOFC 1O97C 5FBQB 2UZ0A 3BVPA 4I2NA 2FRVA 3BXFA 5JARA 3KUCA 1NN5A 4WXHA 2Q7OE 1OE0A 4X94A 4EYGA 4RAOA 4O4IB 1YRAA 2JGIA 4RESA 1MVLA 2QU8A 3ZCUA 3ETDA 1FP7A 2OFWA 3CNEA 3EPKA 4LDRA 1U2TA 3WGLA 3NUGA 3W5UA 3ER8A 4LTNA 3VI3B 4UFNA 1PX2A 4IWXA 3AJAA 1TNDA 5KYVA 4AX8A 5HX7A 3D6JA 3JW8A 2P5YA 1JAHA 3N2ZB 4L6CA 3M5WA 4XPIA 5BP7A 5JZMA 1NLZA 1PG0A 2LIVA 4Q3BA 3F6EX 1JFFA 4XCXA 1TMKA 1E3DA 5ALQA 3J7AC 5DCUA 3LT0A 2W0SA 5IHPA 1F4VA 1KFJB 2JIZA 3FR7A 2ECKA 4FCTA 2XCUA 4OM8A 4M9QA 1P33A 2Q3BA 5ALLA 3F8TA 3MT9A 4OQYA 2C4KA 1XMQB 3W7BA 5HILA 3M4YA 4EYSA 4Q3KA 1JLKA 2VF4X 3EXIB 3RJZA 1XSEA 2B98A 4DWJA 3QFHA 4DCJA 4MUHA 2WLSA 2VP5A 4ML3A 2VAPA 3OOEA 1APBA 1BA3A 3CZPA 4LF4B 3O4VA 3AHHA 4JLAA 4YB8A 1Z7WA 3WLRA 3QI2A 5AKEA 4O4JB 3UK0A 3UJAA 3SDZA 4LNAA 5FOSA 3AR3A 1GQFA 2AHOA 3VI4B 3ST7A 1FZTA 1NLFA 1MJ5A 2DT5A 3U81A 621PA 1L5VA 4UM8B 1JR6A 2QW0X 1IQ0A 1FS4A 4XXHA 4RVHA 4AN0A 3TIXB 3P94A 1GYQA 4KQJA 2E4AA 2UUAB 5PGMA 1O95A 4BLWA 2W2LA 2PAFA 3RQIA 2ZXFA 5C1BA 4IQ0A 4JNCA 1DFGA 1L1RA 4LJ8A 3H04A 2L2QA 3O38A 1Y9ZA 2HRDA 3GFOA 3BDIA 3Q0TA 1EGAA 3RT1A 1PX0A 2VH2A 3GEEA 3KXPA 4KEAA 4BFWA 4TV8F 421PA 1KRWA 3D4LA 4P4UA 3ISJA 1QP0A 4JJEA 1N7IA 1NRXA 3ROGA 3BCRA 3U3ZA 1UOQA 2ILVA 3G0DA 3NHBA 1BO6A 1DWPA 1JDBB 3AJRA 4G24A 3TD9A 1KJ8A 2JK1A 4TMTA 1F5SA 5EIHA 5F12A 2YIMA 4I2VA 1K7CA 3WQBA 4IDBA 3QW4B 3ZQUA 4G5RA 3KBOA 3C3KA 2PSEA 4NQZA 2OB1A 2BW0A 1XP8A 3QHPA 1RTTA 1ODIA 2XXJA 3K7EA 3GU3A 1J22A 4FFLA 4K1XA 4OSPA 1C3EA 2RHOA 4HDAA 4R3WA 3UT0A 1PN3A 1DV2A 4MQFA 2ADOA 3OQNA 1ND5A 1E9CA 4FN5A 3IQXA 4G09A 2IZZA 3DNMA 3V46A 1MNAA 1KO7A 1UK6A 1P2UA 1CIPA 1YMVA 3BTOA 3QFRA 1I6LA 1KPIA 1JR2A 1U9JA 3OLQA 3GJZA 1RSZA 3FY4A 2GEFA 5J2TA 3F6BX 1JECA 2PWBA 1DKQA 1GGKA 3A27A 4JSRA 2YCLA 4PZUA 4TL8A 1OOEA 1NXXA 1L4HA 4NZOA 1LF5A 3DO8A 4WSOA 4Q19A 1UZAA 5CU7A 3WIVA 5H4HA 4RY8A 3ENQA 1ZP6A 3RIEA 3CNBA 3FI9A 4E07A 1CVRA 2O3QA 3DKPA 3F4LA 3IBGA 3WADA 3VYRB 1E1QD 1BJTA 3AP1A 1T36A 1IEXA 2ZT6A 3OCWA 3PUWA 5IBRA 3RVPA 4H0FA 4OMUA 4YASA 2I55A 5TT0A 4EG8A 1POWA 2XE6A 3T5CA 3FLEA 4BNGA 2HBQA 5BQFA 4KN8A 4MKFA 1VIVA 2EJUA 4R0VA 5A4KA 2DFPA 1NLYA 2QJFA 4PO8A 4PSDA 3WYAA 2OC4A 4D9KA 2J41A 3EC2A 1TKBA 3BJZA 4YAOA 4KQEA 3ZWBA 1S8FA 4ZQIA 1ORTA 2NU8A 4B75A 4P36A 3HMKA 2PUWA 3MXOA 4JT8A 1H8HA 3FVWA 3M33A 3NTRA 4L27A 3WYFA 2VG8A 5IMBA 4BBZA 1II8A 2G6TA 4MVJI 3WMGA 4DCMA 1CS0A 4UAGA 4OU5A 1Y6FA 1CQJA 1V5WA 1QUFA 2EL7A 2R25B 2GZ1A 2D2IA 2GB4A 3GJXC 3T4XA 2GXUA 3DZGA 4M1QA 2I99A 2JGMA 3I1JA 1R0CA 1W5FA 2B20A 2YUIA 4KAFA 4BLUA 4CLEA 2QM0A 2YL2A 3WMWA 4DVGA 3RC8A 3QX8A 3X0DA 5ENVA 1ECFA 2NO4A 1R9NA 1O1YA 3COZA 3PJDA 5GMOA 3S44A 3CVUA 2RSLA 5EJ4A 2ZB2A 4O63O 2AN4A 4C4OA 3DEKA 4PGFA 2XNCA 3OQIB 1Q5PA 4RMNA 3Q12A 5HEKA 1P2FA 3KQYA 1LPPA 4EY7A 5KQPA 1R3DA 3TB4A 1VFPA 1SCDA 1MD9A 2QZJA 3PGKA 3OZFA 1WJGA 5EJ8A 2EEPA 3W79A 3VAAA 2BH9A 4OXRA 5JJCA 4RL6A 4KE7A 4C22A 4WY8A 4BY9E 2ADMA 4LY6A 1QFMA 1R5NA 1R4MA 3H8WA 3O84A 4OHKA 5IW8A 3WGNA 2BEWB 2YZKA 4ZCLA 2A5FA 1C3JA 1Y98A 5DE3A 5FI0B 4Z3OA 3ZLTA 1VE1A 3BD6A 9GPBA 3AXSA 1MB0A 2JVJA 2WWGA 2X42A 5JT1A 1ESNA 2MSLA 3FPKA 2QROA 4PE5B 2W6JA 5ALEA 2ID7A 4AF8A 4FFVA 1HXHA 2YHSA 2I7VA 2NU6B 3DE3X 1GYRA 3KEOA 3QFCA 3H2KA 1KO1A 4OU4A 2CXXA 3CONA 3FWYA 5FI5A 4DA0A 2RGGA 4G4SP 3C0KA 2J5RA 2JAWA 4ZVPA 2GO7A 4B35A 4YT2A 4ZXFA 2C42A 2C4TA 3LUPA 5IDYA 1OASA 1E2BA 1R37A 2XUDA 2NV0A 5DGIA 3AOGA 4GLOA 4W1QA 4UHHA 2NUBA 3ZZ1A 1EQUA 1XLVA 1UMCB 1RC0A 3AJEA 4NCXA 1O4VA 4LNHA 4IJMA 1T9ZA 3ABSB 3BPSA 2WYUA 3OG9A 1G4AE 1IG3A 3HI6A 3O1IC 3HBMA 4CMEA 6PFKA 3WAJA 1IMJA 2VS1A 3R9WA 2YWRA 4DSAA 3W5JA 3UMFA 5A62A 1CJKC 2G4CA 1G20A 4R16A 2PD4A 5ALFA 2JJYA 3DC2A 1NXTA 1Z16A 5JDCA 2XCRB 1Y82A 1N6IA 4FSDA 1PF7E 2V5VA 2XT6A 1NUHA 4L5YA 2CDAA 1RBZA 3KOZA 2J0QA 2A0FA 1Z0JA 3FFXA 1E2GA 1QF6A 1OLSB 4G8CA 2R65A 4C7XA 2PCJA 1NWHA 1ULSA 3AGPA 4E3ZA 3ZZMA 5EXDA 5K99A 3D0KA 4REQA 1XZFA 3JSAA 1NKVA 1U31A 5AKGA 3T5PA 4REMA 2IW1A 4ALLA 4UPEA 5F7ZA 1CY1A 6GPBA 2COKA 3MC1A 2ZRNA 3DBLA 3KU4A 5JS6A 2J07A 4H7HA 2REBA 3SFVA 4BJ5A 3V34A 4UTOA 5BSHA 3TQSA 2WSSD 4UMDA 4J16C 3IVMA 3L41A 3H5TA 1BE6A 5HTKA 1TC1A 4KO4S 2X22A 4ASUA 1TUBA 4I1RA 1ZEJA 4UTXA 1ZMOA 4BATA 4QXPA 1C0EA 3OY7A 4MJ7A 1IPEA 4E5DA 5IVHA 1O6GA 3HCBA 1SULA 3CN9A 2WB4A 4HAVA 4TLMB 5EZQA 3W77A 5G53C 1E59A 1VP9A 3B20A 4WNCA 1KVRA 1UCFA 1YS2X 1NVGA 3WKDA 4YV1A 3G13A 3QJ5A 3T8YA 4LYEA 3OMLA 1MOZA 3ME5A 3VC3A 1ZD3A 4HWSA 2E49A 4RDIA 5F23A 1CP2A 2FZEA 2P69A 1GNPA 2HCBA 1ID1A 4IBOA 4LXUA 3W4IA 3KC2A 4B48A 1DI0A 3VH4A 5C7IO 1Z5VA 4ZYTA 1Z5WA 1F0KA 4PXAA 1QHHB 4QUBA 3W5AA 4WGGA 3RC2A 3EG9A 2WFMA 3P4UA 3SYTA 3NOQA 4ZEOA 2XW6A 3I05A 3OLWA 5TPZA 4RYDA 2PDAA 5FLYA 1I9GA 4E5SA 4G23A 5B1EA 4P6VF 2CNLA 1V2GA 3AFIA 3R40A 5DX1A 4ZMSA 2GCPA 5EJFA 1OZAA 1V16B 1XYVA 4FYVA 2ZYWX 4MA5A 4TVBA 4EMSA 5AQEA 1I8TA 2W98A 1IN7A 1LBHA 4E32A 1TT7A 3D1LA 4RS3A 1UZLA 4X9XA 3CXUA 1XD2B 2CNDA 1DC7A 1S2LA 1NYRA 5ED4A 1H2WA 5JY6A 2QE7A 1I3LA 1EVYA 1DKPA 3ZN2A 3HPQA 1KL7A 4CT5A 2LNDA 4PO9A 3KETA 3PIRA 2OXCA 4FDAA 4RWEA 1GL9B 1PD0A 4DKJA 4MQ4A 3IUMA 4RGQA 4DV5B 3U4HA 3ZNQA 3UTDA 4YCSA 1JQ5A 3IQHX 4BVEA 1KA9H 1XVUA 1Y6QA 3HWRA 4LF7B 8ABPA 1UFOA 4FR5A 5KUTA 1CR1A 2DFLA 1AKYA 1DBPA 4X0EA 2EG5A 3SN6A 2C7PA 1M34E 2EFDB 4EG7A 2FQ1A 3A05A 3A1WA 3IP8A 4H7FA 1TVMA 1EFTA 4YV0A 1FYVA 5DB4A 3AX6A 3UUWA 4YXFA 4RTLA 5EHQA 4CJXA 4D5GA 3WDKA 3ZJUA 1Y7IA 5AUQA 2QT1A 2EKZA 1FJ2A 5IKOA 3HU2A 4YCMA 1UMBA 1ZXXA 2ZATA 3QX7A 3QXHA 4K6OA 2WD9A 5KCMA 2PJDA 1ZVMA 3HXLA 4LZOA 4EZIA 3MWYW 3A4NA 4LBYA 1DZ3A 1K7XB 1O54A 2Q49A 2Z3ZA 4FBGA 3ED5A 4L4YA 4C14A 2YJ5A 4KQWA 4GWKA 4N3NA 4CM1A 1FMTA 1T5IA 1TQ8A 2WFAA 3MJDA 1O0BA 3K09A 3T7DA 4Q7QA 1F20A 1ST2A 3IE1A 4XZ3A 2FMTA 1NUSA 4HPXB 3NHSA 3CM0A 3HJHA 1VL5A 2HCTA 3IEKA 2CC2A 2Y1FA 3D6TB 5ITWA 1AJEA 1P39A 3REQA 4LXGA 3LWBA 3B52X 3FYTA 1C4WA 1HRDA 3U80A 1NMQA 2CXTA 4GDFA 1JHYA 3F6PA 5ICMA 1DAFA 1A8PA 5JRJA 1PHPA 4Y9DA 1DBSA 4H08A 2OV1A 4UBLA 2WD7B 4UQLA 1M0TA 1SC4A 2X8WA 3R5KA 5P8WA 2F7SA 2HJVA 2O8EA 4GXNA 2XI4A 2JGFA 3EVEA 2IXBA 3LBAA 2PL5A 1TCBA 1JDTA 4LOHA 3IS3A 1OFHA 3RKSA 4DRYA 4HS4A 1U2DC 2ZSBA 3LUFA 4LRWA 2J0UA 1E94E 2ZIUB 3T3IA 1EWRA 3GLVA 3NM6B 2VJOA 3RPEA 3KQOA 1O6BA 4RSMA 3KFVA 3SHVA 4XIGS 1WMDA 4C7MA 5JPCA 3H3XA 1BD4A 4M0FA 1ZW1A 4ZK2A 5ALTA 5FD8A 3EEIA 1LPNA 2PUEA 1R8SA 2J3EA 3NM5A 2HJGA 2PO5A 5EE9A 4IF6A 1Y6JA 2GHRA 2ZJ0A 4IIDA 4QXRA 2OZVA 3DBRB 2FRDC 4PV7A 4IVQA 1UJ6A 1UBNA 1MRSA 2WIGA 3HY6A 1OXKB 3IJEB 4MQ6A 5IP5A 3RGGA 5F2EA 3SOPA 1XRQA 4CFSA 1Z35A 1T4MA 1IN5A 4O4HF 5JHHB 4CM9A 1MB9A 1A2KC 4CEHB 1SQ6A 1OXMA 4QU0A 1M5TA 2G70A 4XJSA 5TJHA 3WL5A 3C70A 3CNQS 3I9FA 5FWAA 3VPAA 3DAGA 3PPIA 1EUCA 3K0AB 4BN0A 5LXTB 1A82A 1DHRA 2X0RA 2HJSA 3TLJA 4LISA 4EFLA 1FJXA 1GGHA 3K32A 5KOJB 1CY8A 2ZTHA 2EWMA 3GEDA 1SEVA 2AE1A 4B6OA 4ZOLA 1Q0SA 3FCYA 4J29A 1YIDA 1Z29A 3ACBA 1UKZA 2XVYA 2ZRCA 4WZ6A 1XJ0A 1USUA 2EATA 1Z4QA 1W7AA 2EIHA 3CUUA 3KT3A 3IOCA 4RJIA 4KIJA 4BAZA 3GGCA 3FRJA 3SQWA 1B8UA 1OIVA 2XUZA 4HX2A 4KDEA 4S35A 2YWJA 3F98A 2EERA 1OPRA 1ODTC 1RLUA 2Y05A 2OGUA 1JHXA 4HB0A 3VX4A 5EJ9A 4HTFA 2PH3A 4YGXB 3TSAA 4MUJA 4NE9A 3R3HA 5AHRA 4CV1A 4L4UA 3W6UA 4M0CA 3VYVA 4U2GA 2O2DA 3NZEA 1CQIA 3T7JA 4MCJA 2OVBA 2BFFB 4HWGA 1TVKA 4Q1BA 3T1NA 4UHFA 4MVJP 2AD1A 2ZWMA 3K16A 3NPAA 3KX2A 4TS9A 5LQKA 1CYEA 4FZ3A 1XD2A 1JJBA 1G2IA 3A4VA 1BXZA 1QLWA 5TY0A 1V35A 3EIXA 2PBRA 4Q3AA 4L75A 3VR5A 1Y7TA 4GBGA 2X9GA 4L16A 3CNHA 3CWQA 4DHEA 3BWCA 5F1KA 4KXQA 3PEWA 5JMTA 4QLAA 2BZSA 3TIVA 2G72A 3AEKA 4ZIRB 4NC9A 3TW8A 3H0KA 3K15A 1DRVA 4OQDA 3BSWA 2NUAB 5A4JA 2O2JA 4KC0A 5JG7A 4I55B 5H59A 3CT6A 1NVTA 4RLSA 1SC6A 4CW7A 1AG9A 2XQGA 3L8EA 3RUCA 3C5HA 4P33A 1GQYA 1W1IA 2B2CA 1N5OX 4EY8A 3A4IA 3N7AA 4U8GA 4WASA 3SKXA 3PJEA 4MNTA 3AFOA 1BWQA 2ZE6A 2BHLA 2GUGA 3I1IA 1XNHA 4G9EA 4WOBA 2JLSA 4OH1A 5H0IA 3UFXB 4S1PA 5TGDA 2IYNA 4DADA 3P0IA 4GSYA 1T2FA 2NSJA 1J4AA 2YXPX 4AY2A 2AZXA 1CETA 1JDZA 1OHHA 5LNK1 1KI2A 3HDHA 5AW1A 3WGVA 1Y1LA 1JTFA 3QEMB 2NQ8A 3OQIA 1C3XA 1AX9A 2GN0A 2ZTVA 3N0XA 5F35A 3LZCA 4CUKA 1QDEA 4WJZA 5HGJA 1F6DA 2CNBA 1LDEA 3PQ3A 4J7CA 1COWA 5B1DA 5JC1A 1DPFA 2CK3A 2WICA 1W49A 4ZZ2A 5CG1A 2AE2A 4LV8B 2I8CA 2PRKA 4Q21A 4X1YB 3FFBA 3BDVA 2OP0A 3FHLA 4PLHA 2EIXA 1YS9A 3PFWO 4BS9A 5KHLB 4H1HA 2Z2YA 1U5CA 5H9VA 2AYYA 1V3UA 3MLAA 5DYTA 2XQJA 3EQ7A 2FLWA 3ZGNA 1AS3A 3NXSA 3JQ9A 1CJVC 1M75A 1OZFA 2B8EA 2DTDA 1A5ZA 4J6FA 2JGJA 4XLLA 5ALHA 5GV8A 5J5CA 2QAGA 4LC1A 4PLYA 1L9KA 1YOVB 4QFBA 2W71A 1JB1A 4KQFA 4OUKX 4AUKA 2QVGA 1X7ZA 3JZIA 2ZR8A 3QLVC 1TA9A 3L7MA 2O6HA 4HDCA 5AUOB 1LRJA 4YROA 5AO9A 4MS3B 3ZUGA 2CDRA 3B13B 4JQYA 4HEA1 3ZU3A 4L72A 4D41A 3G23A 2BM8A 2HH9A 3P2MA 5HF8A 5GINE 2RARA 2HWWA 2Z58A 2I4LA 1I5RA 5IKXA 2BDTA 4MP3A 1GNRA 4PG5A 2KJQA 4R2HA 5JV5A 3EDQA 5IAOA 5JSZB 5EVCA 2QHXA 1ZGZA 4MYRA 4N7BA 3P9IA 2Q29A 3W34A 1P60A 5HBGA 5HE9A 3BERA 4XQGA 2QJWA 3QXGA 4D0RA 2HSEA 1MTOA 3MBOA 1K2WA 3PT9A 4NP6A 1Q16A 1UBUS 1VIYA 1UUFA 1PVVA 4HBZA 1T3GA 1YFZA 3FNGA 3N2GB 1X1AA 1PS9A 4ND8B 4LX8A 5HNKA 2BZGA 4KACA 3VAYA 5DTIA 2Y77A 1L5QA 3MTIA 3DFZA 3JYHA 1SUEA 1VCNA 4HI0E 2V9ZA 4MQFB 4ZDWA 3CMCO 4AJ4A 3AI1A 1BX0A 2CLMB 2ZVJA 4X54A 1Q22A 2HUPA 2BTEA 3BKXA 1FFCA 1AKWA 1RXUA 3P19A 4E2ZA 3OJWA 4YAWA 5GVSA 2DKFA 3J81k 2H0QA 3PQEA 1J0DA 2DTXA 2JAXA 4P0PB 3ELUA 5EIAA 1VE3A 5F52A 5CB4A 3Q3CA 5I9SA 3TQRA 4BO0A 3OZDA 2FWPA 3B1JA 2FW8A 5FV4A 2JF0A 1KGDA 4PEVA 1KOFA 1AM4D 4GOLD 3LI2A 2QGZA 1FFGA 1IATA 2AR7A 2OZPA 2RJNA 2E21A 2ZI4A 4L0MA 2A0XA 3I9LA 4RW0A 5IJ9A 4YONB 1ZSNA 3GAZA 2MOKA 2BHRA 2ZBPA 1IBKB 3L0ZA 3I2YX 2B37A 2H1CA 4HXYA 3UCXA 4KBFA 4YI3A 4DA6A 1DARA 1KETA 3WSVA 2XX3A 2NACA 2Z1DA 3PGMA 4O29A 1L7NA 1LLQA 3EE6A 4BNUA 3QEKA 2IV7A 1EFAA 3FM9A 4LZJA 4PAOA 2FPRA 4RHXA 4EGQA 4EABA 1RCUA 1RT9A 1UBLS 2NTYC 4WI1A 1KBZA 3MGKA 4NSNA 2IKSA 3UUFA 4G0UA 2NP7A 1EEXB 3V32A 4WRRA 1E69A 2FB9A 1AK9A 2HYIC 4BX8A 2XMCA 3A3OA 3FDXA 3IAUA 1B6RA 4TKVB 3VR5H 2G67A 3W5SA 2P40A 1BOFA 4WNAA 3TZKA 2FXIA 1OX6A 1A7JA 2O9JA 4JSTA 1WLYA 2ZRMA 4JFRA 5JROA 4TKZA 2I62A 3N05A 4D4JA 2WJ3A 4PYKA 4TMWA 1PR2A 2ZIXB 4DRXB 1I01A 1P1RA 1RE0A 3E2MA 3NBFA 3PFGA 4KO3S 4OB6A 5GJWC 3S1AB 3UK2A 3L8DA 3IV9A 4EX6A 2EBUA 4IIYA 3PPYA 4W5HA 2QKYA 5HQ3A 2R1TB 1U5BB 1O2DA 4BE4A 1B2LA 2W37A 4DR3B 4QICA 3ZHTA 1QQ5A 5FB3A 4YQZA 4CCWA 1MJHA 3AY6A 2IGTA 3P0RA 2R87A 3ESBA 1ACMA 1CB7A 1D5CA 4IRUB 5C0OE 4NF2A 4YMTA 5KMGA 1WSBA 4NV1A 4GU5A 4TYQA 4GRIA 1N4DA 2GK7A 2FFJA 3FB1A 4H6VA 2X1LA 1PFWA 1TL7C 1C7FA 1Z39A 5KOHB 2VNJA 4BLRA 4GWGA 2ECOA 1T3TA 1KZ6A 3F6YA 4MCIA 2P1ZA 3QEBZ 1M6HA 3GFPA 1UWKA 5JH7B 4EFMA 1LPSA 1U4SA 3IHKA 5U9CA 1O9HA 5BORA 3SEFA 1TIPA 4BZQA 1E1CB 1T9AA 2QMQA 3CRQA 3JQFC 4PSCA 1CLUA 1RHQA 1VOTA 2YDYA 4QFCA 1Z7BA 3LDGA 3BWDD 1FE8A 1XZEA 4YA6A 3NASA 3RAFC 2HR1A 1NW5A 2QRQA 4V1CA 2JLRA 4UJ5A 4QPZA 3COSA 4IJUA 4Z8YA 5EWMA 1OX4B 4X85A 3T7IA 3WGHA 1E99A 3QGMA 4PC1A 4BVJA 4YRZA 2F43A 2BELA 2ENUA 3H1GA 4NU0A 3U7FB 3TJRA 1CVIA 5KHAA 3I2KA 3Q3JB 4PYLA 1ZJ6A 1UBKS 3V1UA 2D7DA 4KTTE 3I5XA 1GLVA 4PINA 1H2YA 5LLDA 1MW8X 2Z2IA 1KO8A 1L8OA 3U1BA 1E6WA 1O03A 2EFYA 4KE6A 1YFKA 4PNPA 5DCLA 3I34X 3LLCA 4AJIA 3QUSA 1T6ZA 1VL6A 2BJHA 5ADUS 1IM8A 4O3FA 2GQ0A 4FFWA 5I9NA 5CCXA 2GM4A 4WTOA 1T2UA 3D3WB 1YV9A 3UCFA 1E2MA 5DM0A 1QHFA 4FQ7A 4JQSA 1CCWA 4DPKA 4YCJA 2XQVA 2VHCA 1OX5A 5B36A 2AB0A 4HD8A 4CEIB 1UF9A 1ODJA 4ZYYA 1K3FA 5CMLA 5A9SA 1U3TA 1SCIA 3PDUA 1LBIA 5EHXA 3DBIA 3FI0A 1F3OA 2IZ7A 3LC1O 1Z37A 1F14A 2VHVA 5AW9A 5B30A 1KNQA 1M7HA 2QRZA 3PZRA 3EBOA 4NFHA 2BVNA 3DV0B 4OLBA 1Y3CE 4YH1A 1WR8A 1AF7A 5FP0A 2FK8A 2RGBA 1Y5MA 4MVJA 1QGUB 3RQSA 2A4MA 2OAP1 4A8JC 4TZ6A 1WL8A 1ZITA 4NEHB 1RHRA 1JFFB 2FGKA 3L6DA 3EXFA 3FYHA 2BRUA 4GI1A 4QU9A 4I14A 1R5BA 1SU4A 1J0CA 1GZ7A 2CNOA 4EI8A 5JWOA 2VT6A 4QM7A 1HO3A 4BE9A 3HA2A 3OEHD 5IF3A 2PS3A 1P1BA 4K28A 4P54A 3FWPA 3VDXA 4EJFA 3ZLJA 4BECA 3G5MA 2CSXA 1L6RA 4I9FA 4PBRA 3G6KA 2IY9A 1G8GA 1PL0A 2Q28A 3BF7A 3ESXA 3RS2A 5KYXB 5J3JA 3BSFA 3U4DA 3PUZA 2Q1SA 4Q05A 3B3GA 3S7TA 1ZCAA 3MJHA 3KXLA 3LLMA 3TRKA 1U3UA 4HEA6 3T9AA 4ZI7A 4WBNA 3WOVA 1ODSA 2OK8A 3ZH2A 3U7JA 1P77A 4LOLA 3AT1A 2OMEA 4Z99A 3LXXA 5HOQA 2FPKA 2ZFUA 4INZA 5J1TB 4ZGGA 2O3SA 5FBVB 2FGJA 3DT8A 4Q9HA 2ZPUA 5CR9A 2KW5A 2R6R1 1E3TA 1HZZA