4HFNA

X-ray crystal structure of a ternary complex of double bond reductase from nicotiana tabacum
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
341
structure length
331
Chain Sequence
AEEVSNKQVILKNYVTGYPKESDMEIKNVTIKLKVPEGSNDVVVKNLYLSCDPYMRSRMRESFAPGSPITGYGVAKVLESGDPKFQKGDLVWGMTGWEEYSIITPLFKIHDKDVPLSYYTGILGMPGMTAYAGFHEVCSPKKGETVFVSAASGAVGQLVGQFAKMLGCYVVGSAGSKEKVDLLKSKFGFDEAFNYKEEQDLSAALKRYFPDGIDIYFENVGGKMLDAVLVNMKLYGRIAVCGMISQYNLEQTEGVHNLFCLITKRIRMEGFLVFDYYHLYPKYLEMVIPQIKAGKVVYVEDVAHGLESAPTALVGLFSGRNIGKQVVMVSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biocatalytic Asymmetric Alkene Reduction: Crystal Structure and Characterization of a Double Bond Reductase fromNicotiana tabacum.
pubmed doi rcsb
source organism Nicotiana tabacum
molecule tags Oxidoreductase
molecule keywords Allyl alcohol dehydrogenase
total genus 107
structure length 331
sequence length 341
chains with identical sequence B
ec nomenclature ec 1.3.1.102: 2-alkenal reductase (NADP(+)).
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hfnA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4hfnA01
4DIOA 4EI2A 3JYLA 3W8DA 2LDBA 1GUYA 4ALJA 1QYWA 3V1UA 2ZIZA 1U3WA 3WMXA 5COBA 2DQ4A 3DBHB 4XRRA 3RUDA 2A35A 4A0SA 1U9JA 3L4BC 4R5HA 4CMGA 5CFZA 1F14A 1GYRA 3IJPA 3AJRA 2NSDA 4PVDA 4XB1A 4LVUA 4MP8A 1UXIA 1YJ8A 4M54A 3KTDA 1DB3A 3PLRA 2J5KA 4GGOA 2X5JO 4I1IA 4O0LA 4ZQBA 1JAYA 1OMOA 1VJ1A 1QYDA 3UCFA 1KYQA 3PI7A 4FFLA 2Z5LA 1MXFA 1R4NB 2FSVA 3H6KA 4LMPA 3SBOA 3OJOA 1T2CA 4DYDA 5I9LA 2Q1SA 1YS4A 4XYGA 1XU9A 2X7HA 3AUTA 3C3XA 1EVIA 5AXAA 4NJMB 5KIAA 2CF5A 1DHTA 2Y05A 2QZZA 4RF3A 5JXWA 3QSGA 2XXJA 4D42A 1X13A 5A3VA 4DBZA 5GZ6A 4BKQA 1C0PA 4FPXA 3QQPA 4E5NA 1E1NA 1B7GO 5T8KC 3T4EA 5G2OA 4BKPA 1BDMA 2C07A 3H9EO 3DHEA 1RM3A 4OKIA 3TZCA 3VH1A 4MP3A 1GR0A 4OL9A 1LDNA 2Q1WA 2DBQA 3G17A 2YHIA 3AU8A 4XJSA 4W9NC 1O89A 3L07A 3QE3A 4RPHA 4DGSA 5K6AA 1OBFO 3IIEA 2LDXA 4JN6B 4LN1A 2C82A 2GR9A 2CNBA 2O3TA 1ORRA 3A28A 3AOEC 1SEVA 5H82A 4QFDA 5GMOA 1JW9B 1GD1O 1T2AA 3M2TA 5DBGA 5EJ2A 5KJEA 3TFQA 3VPHA 3WYBA 5BQFA 4E13A 2ZJ1A 1QYCA 5IXSA 1ADGA 1Q2XA 3VAZA 4NFSA 2HK7A 3DZGA 3SJUA 2FPPA 3DOJA 3O4RA 4MIOA 4RQUA 5GZ3A 2D0IA 3WYEA 4CM1A 3ZV3A 4EEZA 3DBHA 3JQAA 4NBUA 1B15A 1HDXA 1U1IA 1MLDA 1YOVA 4J0FA 2X23A 1A9YA 4N5NA 4XYLA 4W99A 3QIVA 1Y8RB 1UDCA 5ICMA 4XDZA 1LSJA 3I9MA 4BQPA 3LF1A 3R3SA 5DP2A 1KOLA 2FZWA 3KYDB 2NWQA 2CD9A 1KC3A 1QYVA 1RYDA 4X54A 3PJFA 1E3EA 1UAGA 3RC2A 2CVZA 1EMDA 3H3JA 2X0RA 3GG9A 3E5RA 3HJAA 2F1KA 1NASA 3RIHA 3RUAA 3BTOA 4UULA 1H0KA 1MUUA 2EERA 1O0SA 3WFJA 2O48X 3JQGA 4WASA 4GPD1 4UVGA 5IDQA 2RHCA 2EG9A 1S6YA 1P33A 5B1YA 1MGOA 2HO5A 1LTHR 1I10A 1NR1A 2WMDA 1NVTA 3B1FA 3NT5A 4E4YA 3HB4X 1LU9A 4CM8B 4YAKA 4B3HA 2NTJA 1H5QA 3EW7A 2YUTA 4PLPA 4NU6A 3JYQA 4BL5A 1NR7A 5C7IO 4MVJG 3ZWNA 3MZ0A 3JQDA 2VRCD 4CMJA 2ZJ0A 4BNMA 3RI3A 1J4AA 4R1NA 3JQ8A 5A9SA 4Z9XA 3BMQB 4I5FA 1LLCA 4DQVA 3BMOB 4CQMD 1NAHA 4ND4A 2H1SA 2DT5A 1ZK4A 1U3VA 1KETA 3BMNB 5C7LO 2AMFA 3CINA 3UF0A 1TI7A 3RROA 4AJKA 2V6MA 5LDHA 4CLRB 1UJMA 3KSUA 1PJBA 3OMLA 4ITUA 1AXGA 1SB8A 5GZ1A 1BGVA 4DYVA 4WLEA 5LDGA 2PZMA 4DC1A 4L76A 2VT2A 4QFCA 4YT4A 4BO7A 1E7YA 3SLGA 4AVYA 5LC1A 3WGGA 1LC0A 3WJAA 3AM3A 1FMCA 4DBVO 5EIOA 4IXWA 2WWRA 3HFSA 3LDHA 2PZJA 2O23A 1LC3A 3VPGA 4FJ0A 2D1YA 5FI5A 5JS6A 4N5LA 4MDHA 3LVFO 5F1KA 3P2YA 1A7AA 1KY5A 4B79A 1OI7A 3AY7A 1GPDG 5FF9A 1MC5A 3U4CA 1AHIA 3W1VA 1HETA 3UHAA 4PLGA 1IZ0A 4DQUA 2AQIA 3OQ1A 1OC4A 4UUPA 2VYVD 4RO0A 1VSUA 3TPCA 2X9GA 2O3QA 3O26A 4JBIA 1DFHA 1XWFA 4R4JA 4CM8A 4NI5A 1U4SA 3Q3CA 1GEEA 3JQFC 4PLCA 1FDTA 1DDOA 3V5NA 4EJ6A 1KEPA 4RZIA 5JYEA 4MVJD 1I2CA 1WZEA 1XKQA 1EEHA 4DA9A 1WDMA 1AE1A 4ND3A 3A9WA 3GR6A 4AICA 3BXXA 4CLOA 1LLDA 2UV8A 3RU9A 3ICCA 4L74A 3GEGA 4EJ0A 3BTSA 2RAFA 2HDHA 2TMDA 2Y0CA 3FWNA 2JCVA 1SO8A 2YFHA 3BMOA 3I6QA 2X5OA 1ONOA 3KEQA 3HDJA 4YJFA 5I8ZA 1W4ZA 3TJRA 4E30A 4BNXA 2B4RO 3ZHBA 4RPJA 3FCOA 2OFPA 3GVXA 1NBOA 2UDPA 4E21A 3GGGA 2PWZA 1BSVA 3RU7A 1G6KA 3JQ8B 3ZZNA 4AJJA 5A9SB 3KETA 1DEHA 1CJCA 4BGEA 1VKOA 2P91A 3CMCO 4JJIA 4E2YA 2YHUA 4ZQHA 4GVLA 3RBXA 4RVHA 4XIYA 4K26A 1T1RA 2OL4A 1Z7EA 2OP1A 4IDCA 1ZIDA 2IZZA 1GFSA 3DONA 4BB6A 4EJMA 3GOHA 5JLAA 3K2BA 2W2LD 3FNFA 2NACA 2E6UX 3BZUA 5JSFA 4PRLA 4DLLA 2AQKA 1VL0A 3I9LA 3QWFA 2GN9A 4GL4A 2E49A 2PKRA 1K6XA 2BKAA 3WG9A 5ER9A 4RLSA 1YDWA 5CDYA 4CR6A 4CUJA 5K1SA 4UAGA 3OIFA 5IZCA 1Y6JA 2BFOA 3L6DA 3C7DB 1O5IA 1B2LA 1HE4A 2YJZA 4CV3A 2Y0EA 3E9MA 4URFA 3VTFA 2Q99A 3AI1A 1DAPA 1E5LA 1DPGA 5F21A 1VL6A 4OOFA 3GFBA 3ZN2A 3KUXA 3HDHA 3DFZA 4G65A 4XWYA 4DPLA 1X0XA 1EZ4A 2FRDA 5JAQA 1XGKA 4B7CA 1H9BA 2BGMA 2X22A 3EY4A 3E18A 5B4UA 1U8FO 1R16A 4BGUA 2FR1A 4XYMA 3QVXA 4TWRA 5HWSA 3A1NA 1T4BA 1WMBA 3AWDA 1B0AA 3RJ5A 3TL2A 3K31A 2AA3A 4ZVVA 5ENDA 1LRJA 4CMAA 3E9QA 4HX5A 1WPQA 1EVYA 2Q3EA 3Q11A 5CP8A 3VDQA 1UAYA 5IG2A 4MKXA 5HBRA 4XIJA 1KVQA 2DPGA 3F3SA 3PPIA 2X4GA 2NU9A 1N5DA 1SPXA 5DCYA 5I7EA 1E3LA 3IDSA 3KB6A 3F4LA 2BH9A 5A04A 2WYWA 2BF7A 4PIVA 4G2NA 3OJ0A 3KYCA 2CDCA 5JFOA 1YRLA 1GUZA 5L45A 2O3JA 3R1IA 1QR6A 2B5VA 4WCFA 3SVTA 3TZ6A 1YVEI 1YWGO 4YJDA 1P3DA 4E5PA 3VC7A 4U6QA 3NT2A 2AEFA 4MVJI 4NHEA 3NKLA 1RWBA 2V7PA 3WQSB 3PGXA 5G0WA 3O9ZA 1EK6A 2W2LA 2FR0A 4J1TA 4GMGA 1CDOA 1PR3A 2QW8A 4J16A 4OM8A 1LSUA 4I9NA 3F4BA 3PIDA 3A4VA 2HMSA 3JQBA 3NEPX 5DF1A 1BW9B 1NNUA 3NX4A 4J7CA 4PZEA 4BNUA 3TQHA 3LC1O 4DL9A 1BDBA 1I5RA 2OGUA 4GWKA 1E0DA 2IEBA 4XGNA 3GA0A 4WKGA 4P4LA 4GBJA 4CLEA 2Q2WA 5K6AC 4WEQA 3DBRB 1UZNA 2FPIA 2I6TA 5KCZA 4EEXA 4E6PA 3JQ9A 4JP2A 1QV7A 1XELA 3NJ8A 1EVJA 1ZZEA 4WGGA 4IY1A 3GGOA 3RVDA 3JYNA 5THKA 1F0YA 2NV6A 4CMCA 3MWDB 3OF2A 5DBFA 4B4VA 4CMKA 4B7XA 3E03A 1PGNA 2AW5A 4HWKA 4W4TA 3ZWCA 4Y8VA 1IY8A 2GSDA 3ZWBA 7ADHA 2H63A 4GX0A 4WLVA 3UVEA 4Q3CA 1I8TA 2GF2A 5CEFA 3ZCXA 4NG5A 2C7VA 1JAXA 4UVEA 4BQRA 3GZ4A 3O38A 4XQEA 2JCXA 3G0OA 1YL5A 3C8MA 3R6DA 4FQ8A 3LK7A 1TEHA 4II2A 4PGFA 1MB4A 2PD6A 3MJCA 5F1OA 4QO7A 1PGJA 1ARZA 2IYOA 2C0CA 9LDBA 3ONFA 4JCOA 2PZKA 4NK5A 4YR9A 3GDGA 3LU1A 5KKAA 2EV9A 4RDIA 2O2SA 3WR5A 3F9IA 4NDNE 4LCEA 2B37A 1HZJA 5DN9A 4BMNA 4YXFA 3GF4A 3H65A 4HBGA 2RIRA 4ND5A 3H9JA 3UGKA 5BSGA 3RC1A 4IJUA 3PFWO 1PZGA 4Y98A 3PQDA 1GQ2A 1A71A 3S2GA 4FIZA 2J3JA 4WUVA 4NU5A 3L4SO 4W82A 4W6ZA 4AJOA 2W90A 1W73A 4TKMA 1D7OA 3U0BA 1LQTA 3JD0A 1WAMA 2NNLD 3U3XA 1Y7TA 2AQHA 3DBLA 4OHUA 3IL2A 5DOVA 2GCGA 3TZKA 2A4KA 4AJ2A 4BNVA 3WICA 1XG5A 3GZNA 2I5PO 2I3GA 3D4NA 4E3ZA 5COAA 1OAAA 3ROKA 4TQGA 4I08A 3GUYA 4OYRA 1JKJA 5T64A 4FOSA 4QO8A 4E0BA 1ENYA 3GG2A 4PG5A 2BGKA 5AXBA 2R00A 3KYCB 5JO9A 1QMGA 1PSDA 1IPFA 5BNTA 1P0CA 3OP4A 5GY7A 1A72A 1ADBA 3GRPA 5IAAA 1Q0LA 3EGOA 4FR5A 2QQ5A 3FNHA 1M76A 1N92A 4N54A 1BXGA 1C0LA 2GDZA 2W2KA 3I9KA 3EYWA 4BB5A 4HUJA 1VSVA 4KTTE 1M2WA 3SC4A 2VNAA 1TT5B 4A73A 3LLVA 3C7CB 3PWZA 5C3MA 1HT0A 3IQDB 2GZ2A 4WEOA 3PRJA 4CUZA 4L9RA 1QSGA 2X86A 1DFIA 4YJHA 1RM0A 3U5TA 2WM3A 3ICPA 4JP3A 3W4KA 4YBZA 4L0QA 3D3WB 2QYTA 2D5AA 5L4SA 4E2WA 1X0VA 3ROPA 3AU9A 3KSZO 3DBRA 4XA8A 2NUAA 1YJQA 4R1UA 1Q7BA 4AL4A 1WNTA 3WNQA 3ASVA 4YQYA 4YA6A 5AOVA 1YB4A 2PFGA 1I2BA 4IUYA 3E48A 5H81A 3JD3A 1DRUA 3U4HA 3N74A 4YQZA 2JD0A 3VZQA 2GERA 2ZTLA 4D46A 4L4SA 4Q3EA 1SB9A 4CMEA 2VZ9A 1RJWA 1NYTA 5KVSA 4KZPA 4Y6SA 5TQVA 2Z1NA 1E7QA 1V0JA 4CM3A 4Y67A 1O94A 2XF8A 3VPXA 3U62A 3GVPA 4WNCA 4FC7A 3DMYA 4FJ2A 4E2ZA 1D4FA 3CIFA 5TT0A 5CHEA 3RKRA 3WSWA 5U9CA 2PD3A 4ZN6A 3DR3A 4FBGA 3ETGA 1ZFNA 4OXNA 2VQ3A 4J49A 5JCXA 4D3SA 1JWAB 3P5SA 3RUFA 3FN4A 3I4CA 3TWOA 1Z75A 1JKFA 2WD7B 1H9AA 3TZHA 3AFNA 2VWPA 1PJ2A 1HLDA 1P9LA 2I65A 4LW8A 1R0KA 4FD3A 3MJTA 3OA2A 3IKVA 1LDMA 3NJ4A 2DFVA 4JLWA 4DWVA 4CM9D 1M75A 1E7MA 1VJ0A 1KS9A 4ALMA 3CPSA 1ID1A 5EN4A 4U0JA 5EPOA 1DO8A 4AJ1A 1DHRA 1O95A 2JCYA 4BUCA 4E5YA 4PLWA 1TB4A 3BHJA 3PZBA 3TZQA 5IDYA 4LCJA 3M1AA 3PVZA 4FSHA 3TL3A 1D3AA 1I3MA 1PU2A 2TMGA 2Q46A 3UKOA 5JNLA 3KBOA 3L4BA 5L9AA 4R9RA 5L4LA 1U2GA 3MTJA 4UVIA 3GPIA 2XXBA 1SAYA 2B4QA 4KQWA 1R0LA 1QLHA 1Y81A 1YBMA 1ZJZA 3KLMX 3ZU3A 5IFLA 4F6CA 5FEUA 1UH5A 3RBZA 4FFOA 1GUFA 2O4UX 4EBFA 1T24A 1KVTA 2C2YA 2PGLA 5TC4A 3DFUA 2AXQA 1KVSA 2VOJA 3JQ7A 6LDHA 4MKZA 5JMPA 1ZK0A 3GN1A 3KLPX 1KY4A 4YCAA 2HRZA 2QHXA 5TX7A 4XGIA 2UAGA 5T6BA 5L4NA 3GK3A 5G4KB 3UCEA 3WGOA 3AUSA 4MVJF 2BFAA 2EEZA 4QT0A 1K6IA 1N7HA 3WWZA 5BR7A 3F46A 2PZLA 1HF3A 4DVJA 3H8VA 4INAA 3RAJA 4B4UA 1NFFA 4GVXA 1TT5A 1A27A 2GGSA 3BAZA 5TNXA 1NP3A 4NK4A 4H15A 2EJVA 3U9LA 3VKUA 4R3NA 4B8WA 3GH3A 5U1PA 2OORA 3WS7A 5EL0A 5TJ9A 1S7CA 1U28A 4IBOA 3JQAD 1GV1A 3NRCA 3ORFA 2G0TA 4WECA 2D4AA 1C1XA 1HYHA 4AJIA 1P1JA 1MFZA 1B8VA 4BNGA 4E32A 4RL6A 4CMHA 4JIGA 1ONNA 1NVMB 5BNIA 1GDHA 4HNHA 3DZBA 2X1HA 1J5PA 3E9NA 3JD1A 3D7LA 3OJLA 2EJWA 2D2IA 2ZYDA 3FBGA 1R37A 3PHLA 4PLVA 4YAJA 2EIHA 3NT4A 1XEAA 1YBVA 4J90A 4J2OA 3GVCA 4CMIB 4ZGWA 3F5SA 2NVBA 5JMWA 3C85A 4RCVA 1F8GA 4OSPA 2NVUB 3DZHA 5IN4A 4HADA 3QRWA 3HSKA 1Z45A 2NU7A 3OM9A 3ZU4A 1PQPA 1I3NA 2PNFA 2QYSA 3K8ZA 4RF2A 4E12A 1AHHA 1DJNA 3PEFA 4A5OA 3OA0A 4ZJUA 2Y68A 4BO0A 1PS9A 3DBVO 4KQXA 4PRKA 2VZ8A 3A14A 2G5CA 4ZRMA 3RUIA 5A03A 4MVJH 1E3WA 4J91A 4Z3DA 3RQSA 3RC7A 4H3VA 1WDLA 1NQTA 2JJYA 1T1SA 3OEWA 4O1MA 1UP7A 5K0ZA 3WGIA 5KWEA 1LXCA 2A94A 5BNFA 4IPTA 1LNQA 3BHMA 3OHSX 3PJEA 3FWZA 5I7VA 4BNTA 3WMWA 1Y8RA 3PIIA 3ZDFA 2Q2VA 1HE5A 1HSZA 2G1UA 4R5MA 4YDRA 3PJGA 3IJRA 4K9DA 4CR7A 4R9SA 2ZYAA 1SEPA 2I66A 2EKLA 1ISJA 1H94A 3GLQA 4GMFA 3D5QA 4YJHB 4MP6A 3DZFA 3EK2A 1E7RA 2NM0A 1YDEA 1N1GA 4MJLA 1HLPA 1UP4A 1ZEJA 4HKTA 5JAMA 4LRSB 3OETA 4OXYA 4ZRNA 4BVAA 3NDRA 2YFQA 1Z73A 2NTNA 5JDIA 4Z0HO 4U6SA 3C7AA 4ZQFA 1D8AA 1ULUA 2O7QA 4J4TA 3ROMA 2H6EA 2ET6A 2DUWA 3QJ5A 2VHXA 1XLTA 4IGFA 2JFGA 3WJ7A 4K1LA 4FOOA 4K6CA 3KYDA 1GZ6A 4BKUA 5L53A 2G17A 4NQZA 1UXGA 4LSMA 2DBRA 5TT1A 4BOYA 3GVIA 2AQ8A 2DTEA 4PCVA 1PR9A 2W4QA 4RORA 2CVOA 3DDNA 3OICA 4FW8A 3LLSA 5DZSA 3L77A 2UVDA 2DVMA 1PJSA 4BNJA 1JDJA 1ZJYA 3HWRA 4UEKA 4XR4A 3GZNB 2VRCA 2HJSA 5DOZA 2PD4A 2YV3A 4XX0A 2O3RA 2J3HA 5HM8A 2XAAA 2C7GA 1BWSA 5EQDA 3INGA 4ZA2A 4EDFA 4W7IA 5IZ4A 1CETA 1UR5A 4CLRA 4UVHA 3S2IA 1R4MB 3I9NA 3X2FA 5IJZA 4PN3A 4KDEA 2GZ3A 1QG6A 1PQUA 1HDCA 3K6JA 4IDFA 1ZKMA 4MINA 1LSOA 4LVCA 3DAPA 4CMEC 2B36A 3AK4A 1PL8A 3WGTA 3W4IA 4XRGA 2DC1A 4G5HA 3I52A 1D1TA 3CZRA 4R16A 4IXTA 2BI7A 2D3TA 3LC7O 3G1UA 4NIMA 3GHYA 3ADPA 1YH3A 5T57A 1LDEA 4TVOA 1UZMA 3WLEA 4GH5A 1VLLA 1DRVA 4OH1A 2EGGA 3OQ6A 4M1QA 1KVUA 3I3OA 1FXSA 5KOIA 3I83A 3ZWAA 5TIIA 3PQFA 1LDYA 3FNGA 3AUUA 1I3LA 3JSAA 1EUDA 4YACA 5KJCA 2CY0A 3ZHZA 4BNKA 1PJ3A 3GAFA 1DC4A 1T4DA 5AVOA 4ZICA 1R4MA 5F3RA 4PLYA 3ZW8A 1T25A 2YY7A 5I9NA 3WGHA 4O6VA 1JVBA 2DAPA 5IDXA 4RVDA 4UVDA 3E6AA 5G4LA 2EF1A 5A06A 4CLOB 8LDHA 2X0NA 5KJ6A 1DLIA 2ZTVA 5KTKA 4XCVA 4TRMA 1GU7A 1EDZA 3GNSA 3IP3A 1ADFA 4ESOA 4D7AA 3L0DA 5FFFA 4I5GA 5KJ1A 1ZEMA 2GN6A 4JROA 5T8KA 3VZPA 5TS3A 2C59A 1ZNQO 4Z0PA 4XDYA 2C2XA 2BLLA 1ISMA 3F6YA 4A03A 1TVEA 5TJHA 3OFSA 4P38A 3UUWA 4Q3DA 2GN8A 3E8XA 2Y1DA 2VRBA 4IJWA 2O4CA 3FHLA 1TXGA 3LT2A 1DXYA 5JPIA 4FFRA 3HNPA 2POQX 4AG3A 4C7JA 1L7EA 2VCYA 4KTVE 2IODA 3LT4A 1JLLA 3IS3A 4JNKA 3ZNNA 2J3IA 3ZV5A 1YQXA 3S2FA 4ALNA 3D4OA 5F1PA 5ER6A 1XHLA 1PQWA 2BRUA 2ZCUA 3TOXA 1GAEO 2H5LA 1CF2O 4UEOA 5MDHA 1I0ZA 1SOVA 4EGFA 2VWGA 5JY1A 2HLPA 3MOIA 4NFYA 4E5KA 3WTCA 3GMSA 3JCZA 1UDAA 3BHIA 2B35A 2NLOA 4BGVA 1R4NA 3H5AA 3GMDA 5G4KA 2JKVA 4U0KA 2WE8A 3IMFA 2Y93A 4LK3A 1OC2A 4GSKA 4BO9A 3CSDA 2O2YA 4O59O 4CM6A 3D5TA 1I3KA 4IJVA 4OKNA 3DAGA 3HZZA 3QWAA 4QECA 1NAIA 2WSBA 1U5CA 2O3SA 5JE8A 5KKCA 5A5FA 1ENOA 3PZRA 4NR0A 2AHRA 1G0NA 4CM4A 1BHSA 3MTGA 2RH4A 3ZWWA 5HTOA 4Z9YA 3O8QA 4C4OA 2X6TA 3H2SA 4N18A 2CUKA 4NBTA 4B4OA 2EP7A 4DXHA 2EXXA 5KJFA 4M55A 5BSEA 4PG7A 4TRNA 3N58A 5A3JA 2P68A 3ANLA 5EERA 2OP0A 1L1FA 4QEDA 4KDFA 2ZKLA 1H6CA 1DFGA 5T5QA 5JAIA 2V6FA 3M2PA 4YRBA 1R15A 1Z7BA 1ZK1A 1BTOA 4GKBA 2EW8A 2R2GA 4S3MA 2FR8A 3I4FA 2GRAA 5CDGA 4WCFB 2C5AA 1C1DB 2OBNA 4J9VA 2JHGA 4Q9NA 3JQBC 4HFJA 3PXXA 1EQ2A 4DIFA 1P1HA 3EVNA 5AQ1A 1IE3A 1P31A 1ZSNA 3V2UA 5L95A 2AG8A 3HN7A 2O7SA 5I7SA 4DC0A 3DZIA 3RBVA 1WW8A 5TLSA 2PV7A 5A1TA 1I30A 1ML3A 4BO5A 4CLDA 5DDIP 3BTUA 1GEGA 5COQA 3E1KA 1MG5A 3TDKA 2F00A 5B37A 3LZ6A 3WIEA 1PS0A 2J3KA 1K5HA 1ZMOA 1F12A 2DUUA 2ZQZA 5G0TA 2HMVA 2ZB4A 2ZATA 2UUOA 2V65A 1EK5A 3TFOA 2PGDA 3DZJA 4L4RA 3UN1A 1T2DA 4BV8A 4CL8A 3RJ9A 3ZWYA 3K5PA 1BVUA 1ENPA 1JQBA 5G0VA 2EP5A 4AJLA 1YL7A 1WLYA 1LI4A 2ZTUA 3H9QA 1UDBA 2E4AA 3I1JA 5HS4A 3LT1A 4MVJP 1BMDA 3M1LA 5MGBA 4M87A 2GYYA 4GX1A 4MOWA 1VRWA 4IQ8A 3ABIA 4EUFA 5HRUA 1FF9A 2Y0DA 3HN2A 3TSCA 2HAEA 4Q39A 2Z95A 4B3JA 1JVSA 3NTOA 1KC1A 1UP6A 3CZMA 1WWKA 3GEDA 3T7EA 1A9ZA 1PEDA 1IHYA 1GQYA 2FHSA 2GLXA 2AEMA 2IZ0A 2J5RA 4IQGA 3BIOA 4NBWA 5JC1A 4IDDA 4ROSA 3VOSA 3S55A 2D59A 2VYVA 3PYLA 4YJGA 2JAPA 3C1AA 3PDJA 5IZCC 4NJOA 3VZRA 4YRAA 4Q3BA 5AXDA 5KNLA 1E5QA 4CR8A 3E82A 4JGBA 3PLNA 3UICA 4DTIA 7MDHA 1E1LA 4I5EA 2RBEA 2NTVA 4DPMA 2YHIB 3UAGA 3ENNA 2Q1UA 1E77A 5JCJA 3GNTA 5L40A 4BS9A 1YGYA 1DIGA 4IINA 4OXKA 3VZSA 3WX0A 5IXYA 2PKQP 3DBLB 1XDWA 3FTNA 4YPOA 1X7GA 4XR9A 3OIGA 5JBIA 2Q4BA 3RUHA 1V6AA 4YRDA 5ILOA 3WGQA 1ZSVA 4CM7A 4PZCA 2XPCA 4EITA 5ICSA 1HTBA 3DMTA 2HK8A 3JTMA 2P2SA 3PHGA 1JA9A 1E7SA 1EVZA 3QVOA 4PVCA 3WBFA 2ZB7A 3PYXA 1EUZA 2FY8A 2QRLA 1P44A 1HYEA 1HDGO 1X1EA 5A9RA 1CQIA 1Z82A 4CLHA 4OJNA 3GT0A 3KO8A 3JQ6A 5LCXA 1BG6A 1FDVA 1HEUA 2A9FA 2ZK7A 4QUKA 5FYDA 3P19A 1ZK3A 2EKQA 3HB5X 3K30A 3F1KA 1EFKA 4ZQEA 1N9GA 5A4DA 3GDFA 2BMAA 1YOVB 1YO6A 1E3IA 3ZV4A 1Y9AA 3ZU2A 3JQFA 1MA0A 2PK3A 4CV2A 4IDBA 4DPKA 4Z3KA 1ZBQA 1I33A 2PLAA 3ULKA 1VE9A 5JDIC 4GX2A 4XB2A 4NBRA 1LRLA 4IQ0A 1ENZA 3JQ9C 3QHAA 3DHNA 4IS3A 3PJDA 2IDZA 2OOSA 1J49A 4TZTA 3PK0A 1HL3A 1KBZA 3GFGA 3AUAA 3ASUA 5IN5A 2NU8A 3PHIA 3BMNA 4CJXA 2JL1A 4BNNA 2X58A 2G76A 2ZCVA 1NWHA 1OOEA 1H2HA 4IMRA 3NTQA 2FZEA 4UUOA 1AGNA 5CAEA 4JBHA 4J7UA 2DM6A 1NFQA 4IS2A 3PTZA 2W98A 2OO5A 5J23A 3O8QB 5I7FA 1C0IA 1NFRA 4BO1A 4DRYA 2PA3A 4KUHA 3TOZA 9LDTA 3QWHA 3D3WA 3PWKA 4Y6RA 4YVFA 1DIRA 1N9GB 3HDQA 2JHFA 1VI2A 1EE2A 4YEDA 1DOHA 4ALIA 4FDAA 4J1SA 3Q1LA 4CLXA 5EESA 4A7PA 4FFMA 1B8PA 4E2XA 3ETDA 1MFPA 1W0CA 1NXQA 1X14A 1FJHA 4H16A 4TZKA 1N2SA 1YE3A 3WFIA 4L8VA 4WE3A 2HSDA 4OQZA 2CSUA 4LISA 4FFPA 4BO4A 1RKXA 3HUDA 2BFPA 4BNHA 1K3TA 4FC6A 3D3EA 4IGEA 5B4TA 2C29D 1XU7A 2Y1FA 3SC6A 3ZH2A 4U5QA 1JKIA 1PJCA 2VUTA 1ZO8A 4GI2A 4I8XA 4R68A 3OECA 3S8MA 1XSEA 3WTBA 1NQ5A 4CMBA 5ENVA 1B3BA 1RPNA 1WDKA 1X7DA 3PP8A 5ADHA 4WCDA 5DNAA 1MX3A 1HXHA 1K2WA 1HRDA 1E1MA 2HK9A 2PH3A 3K92A 4MO2A 3STHA 3UXYA 4BO2A 3D4PA 1HE2A 3MOGA 1Y1PA 2IRWA 4FGSA 5TSDA 4KUGA 2PR2A 2Q4EA 1R66A 4TRJA 4J9UE 2EGHA 1H93A 3DTYA 2DPHA 2DLDA 3QV1A 3R0IA 4Z6KA 1JTVA 1B16A 4WLUA 4J1QA 3PGJA 4JBGA 4D43A 2RCYA 4F6LA 3ZI0A 2Y1EA 2IE0A 4PLFA 1QV6A 3B1JA 1FDSA 4CPDA 1ZCJA 2VYNA 1XQ6A 3EUWA 3FR7A 4L75A 3TN7A 3Q9NA 3W8FA 4DMLA 1MC4A 2GPTA 3LF2A 1Q1NA 4P8RA 2PTGA 3HFGA 3P7MA 4UUMA 4YT2A 3MJVA 1CRWG 4MVJA 4R01A 2GASA 1FDUA 1PJLA 5ILGA 1NWCA 1DAOA 1C1DA 3IOYA 3U4DA 3ZW9A 2CMDA 5DBIA 5H83A 3QVTA 3B70A 4R41A 1E3JA 1OZAA 1UZLA 3QWBA 4KWHA 2FOIA 4RDHA 1H6AA 3AI2A 3KEOA 4ALKA 5ES3A 1CWUA 1RYEA 3X2EA 2CFCA 2ZQYA 2VT3A 1MXHA 1V9LA 2VWQA 2A92A 4YTEA 1KEUA 1PL6A 1SCUA 3WQQA 1U4OA 3HQ4O 4TMFA 2FP4A 4PG6A 2E37A 2NQTA 4Q3NA 4GAEA 3QP9A 3WXBA 5L7TA 1HE3A 1C3VA 2VHWA 4OO3A 4XZ3A 1UUFA 2I76A 1QYXA 3RFXA 4D41A 4MPDA 4J4BA 3PHJA 3N7UA 1YKFA 3ANNA 4FB5A 3ZHXA 4YT5A 3V1TC 3U49A 3FTPA 1E92A 1T2FA 2NVWA 3Q9UA 4LRTB 5B12A 4MVJE 3EVTA 5C7OO 1HWYA 4AJPA 5KVVA 3OIDA 4TVBA 3IUPA 3VPSA 3JYOA 1V35A 2VOEA 4N7RA 3WLFA 3VPFA 4BNLA 4BHTA 3F47A 5F5LA 1GQQA 1NHWA 2P5YA 1AN9A 3W6ZA 2X9NA 1M66A 1MV8A 4PZDA 1ISFA 3W8EA 1U3TA 1PWXA 3EC7A 1X15A 4R3WA 1RM4A 2H9IA 2Q45A 3DO5A 4KMSA 5L3ZA 3BMQA 3V2HA 4IDEA 4LMRA 4D3DA 2Q1TA 4KP7A 1JN0A 1R0SA 3FI9A 5AXCA 3ZWMA 5THQA 3S2EA 3JV7A 1GY8A 4IIVA 4CM5A 3HDYA 1LBEA 1YXMA 1E6UA 3H5RA 1PZFA 3P2OA 4L4XA 4D45A 1ZMTA 3RUCA 4CV0A 1NQAO 3VH3A 3HE3A 3ETEA 1N7GA 4XGKA 1P1RA 3I6IA 3DC2A 4XQCA 1BXKA 2VUSA 3JQAB 1P1IA 1PGOA 4Y9DA 4BO6A 3FPLA 4A27A 4UREA 1BXZA 2W8ZA 4J4HA 1Y8QB 4RV9A 4RLHA 4ND1A 1A4IA 2DTDA 3KSDO 4QTZA 1F06A 4GQAA 5CDSA 1A7KA 1YB5A 2Y66A 3K2EA 4W7HA 3PHHA 2C5EA 2W2KB 4J43A 1H6BA 3EAGA 1QP8A 1LDBA 1BW9A 5JO0A 5JW6A 4H7PA 1KEVA 3L9XA 2RH8A 4OOEA 1GCOA 5EMHA 5A9TA 3ROQA 3NGXA 3EZYA 3GUCA 2FWMX 2EWMA 4KUEA 2HMWA 2VZ0A 1PJ4A 4BMSA 3ONEA 4C7KA 1SC6A 2P4QA 3MCVA 1GZ4A 4JJFA 5T67A 3UFXA 1PZEA 3KOUA 3CXRA 3WGZA 1KVRA 2BELA 4E33A 4QQRA 2P9GA 3C1OA 3JQGB 5F5NA 3QA9A 3TNLA 2IZ1A 1ADCA 2HUNA 2DKNA 3OQBA 4P22A 2VHYA 3QY9A 4EYEA 5JYDA 3H5NA 1HYGA 2DBVO 3L9WA 4P4NA 4WOKA 4XEHA 1PGQA 3G1TA 4CV1A 4RJTA 3OSUA 3EMKA 2C54A 2OUIA 3KXDA 3AFMA 3NTRA 1Y8QA 2Q50A 4DREA 3LC2O 1GPJA 3AOGA 3DOCA 5JC8A 5L7WA 3AM5A 3I23A 1WZIA 3M6IA 3T4XA 5JAZA 2D5CA 1LDGA 1Y5RA 4GWGA 2VN8A 1XIVA 3PWSA 2QG4A 2ZYGA 4DUPA 4B8ZA 2X0IA 1W8DA 4D0RA 3ITDA 3NYWA 3QWIA 4IM7A 4RVGA 4RVFA 4F46A 5CDTA 3L6OO 3RWBA 1FK8A 3ZWPA 4RPLA 3BYZA 4PG8A 2ILTA 2E48A 4ALLA 1HDYA 1MP0A 1EDOA 4RGBA 4BO8A 2WD8A 2YW9A 3NAQA 3ZNQA 4S1VA 4Q3AA 2CF6A 1T2EA 4M8SA 3SX2A 2NQ8A 5JCJD 1ULSA 3H2ZA 1NX6A 2X0JA 2YYYA 1HKUA 2CDAA 1GTMA 4XQGA 3BMCA 3IP1A 5EINA 4BMVA 4DLBA 3TF5A 2PKQO 2Y67A 3MEQA 3PYMA 4BNYA 1LLQA 1CQJA 1GZ3A 4FGWA 5L7YA 1M6WA 5TRTA 3GEMA 2X5KO 2YDYA 3Q2KA 1SZJG 3VVBA 3H7AA 3WIDA 2HMTA 2P4HX 3C1TA 5A02A 4CM9A 2BI8A 4BKOA 3GPDG 1I32A 1XCBA 2EHDA 5TGDA 2UYYA 1TT7A 2B83A 4LGVA 4ZQGA 4AJEA 4NFHA 3GC6A 3VH4A 1C14A 4D0SA 3OEYA 1HDRA 1NM5A 4RPKA 1VL8A 1P45A 4YAEA 3WDSA 1U5AA 4EZBA 2B5WA 2WYVA 2ZB3A 1C1XB 3MJ4A 4QSMA 1ISHA 4JK3A 1DLJA 4D3FA 4D79A 3IKTA 2WD7A 1X1TA 2IXAA 6ADHA 4CUKA 3H9GA 3UW3A 1ONPA 4XYBA 1DJQA 1IYZA 2YDXA 3W4JA 2HMUA 1Q7GA 2QRKA 4PG4A 2BHLA 4Z0TA 3FR8A 4NZ9A 3OJEA 3RASA 2WEKA 1LRKA 4OMUA 1PIWA 1EQUA 1ZH8A 1Z6ZA 4HFMA 4PLZA 4WLFA 1BXGB 5I9MA 4U8GA 5I8WA 2NU6A 2PGJA 1R6DA 2Y1CA 3HG7A 1YONA 4D44A 4HY3A 1U8XX 4ZHSA 1D1SA 3V2GA 2DBZA 1TLTA 4I9HA 1WP4A 4IJKA 2B69A 3V1YA 1CYDA 3V8BA 4B3IA 5DT9A 4PLHA 1NHGA 4MKRA 1QKIA 4O5OA 3GNQA 3ADOA 1DRWA 1Q0QA 5CEEA 1I36A 2WJPA 1G0OA 1XR3A 2YQ4A 3VKVA 4NNJA 2BFMA 1E6WA 3EDMA 1L7DA 4JQCA 3FPCA 3CTMA 1KIFA 4XYEA 3JQ7B 3E5MA 3JD2A 4R51A 3CEAA 4PFJA 4YJGB 4BKRA 4ONEA 1O9BA 4AJ4A 3LQFA 4CMIA 3IC5A 1WVGA 4NMHA 5KVCA 1NPYA 2YZ7A 4U7WA 1R12A 3QLJA 4MIEA 5KVQA 4HV4A 1WXDA 2WE7A 1DIBA 4IMPA 1Q7CA 4F3YA 3DZKA 1F8FA 3GHHA 4AFNA 1Y9EA 1PWZA 4II3A 1O6ZA 4WCFC 3WBBA 1HDZA 2WDZA 1ZK2A 2YV2A 1AXEA 3Q2IA 4XQ9A 4J2HA 2VWHA 1IB6A 1K6JA 3DL2A 3ZU5A 3LYLA 1DSSG 4WLOA 4P4GA 3UH1A 1LSSA 5CG2A 2OZPA 1YQGA 5CPBA 2OBYA 3ZWOA 3IUSA 1J6UA 2WTBA 1QORA 1BRMA 3FF4A 4LSWA 3RC9A 3VDRA 1EE9A 2I3AA 2VNSA 1W6UA 1F17A 4WOJA 5IDWA 1LUAA 4HP8A 4DLAA 8ADHA 4JJGA 3D64A 4MIYA 5G0SA 4DIBA 2AE2A 4HXYA 4E5MA 1T26A 3PDUA 1RM5A 2ZB8A 3PQEA 1N8KA 3WOHA 2X8LA 1GV0A 4HFNA 4BO3A 3Q6IA 5B4VA 4IIUA 3O03A 3K73O 1A4UA 1M6HA 2VYND 4GKVA 3NDJA 3B20A 2HQ1A 3FNEA 1U7TA 3RFTA 1P1KA 5U4QA 5DULA 4TRRA 2I67A 2V6BA 4XD2A 4N5MA 4IZHA 3UCXA 3NV9A 3GGPA 4CM4B 4RVUA 3DQPA 4RZHA 4Z9FA 4TROA 4WK6A 1XA0A 2FN7A 5CDUA 1HZZA 3K9QO 4FJ1A 4HFRA 1JWBB 5FWNA 1UXKA 2PH5A 1U2DA 3JYPA 3KM0A 5JDCA 3WNVA 3U09A 1PX0A 2FMUA 3INTA 3JD4A 3ANMA 4GGPA 4J6FA 1NPTO 4JXKA 3ZNPA 1SBYA 5BT9A 4ZU3A 2JD2A 5CPFA 5ITWA 1V3VA 3ST7A 2Y1GA 4L73A 5DCUA 1CERA 3SJ7A 2QX7A 1O8CA 3B1KA 4TKLA 1G1AA 1YQDA 2I99A 5HA5A 3CUKA 1YB1A 1EBUA 2GD1O 3G49A 3DWFA 1VC2A 3W6UA 2E82A 5DCWA 1P74A 1AUPA 3KVOA 4NH4A 4B7UA 4ND2A 1WMAA 4RVSA 3C24A 4KWIA 3ZV6A 1I24A 2EKPA 3Q0EA 1IL0A 3LT0A 3DB2A 2GNAA 1B14A 3KHUA 1ZVMA 4GSLA 1NTOA 3K96A 3AI3A 2I9PA 3CH6A 3WB9A 1PTJA 3BA1A 4O63O 3GQVA 4PLTA 4OIMA 3SXPA 3L6EA 2GN4A 3CKYA 3TRIA 3VH2A 3NGLA 2R6JA 4E31A 3S1LA 3IAHA 2JD1A 3LSYA 2QRJA 4BGIA 1KEWA 1FDWA 2IXBA 2PY6A 4YJFB 2QIOA 4I5DA 5G0UA 2SCUA 4ILKA 3ZGYA 1Q0HA 1ZUD1 1YBAA 3OJFA 4MVJM 2HKIA 1IOLA 4XKJA 5JY6A 2DU8A 1IUKA 1PGPA 2P9CA 1M67A 3AY3A 1Z74A 5DP1A 2OMEA 3F1LA 3ZWXA 4CODB 2IEDA 5FI3A 1H6DA 4RQTA 3UOGA 4R69A 4YB8A 1SOWA 3GDOA 4WLNA 4K28A 3A06A 4NJMA 4UUNA 2HRBA 5IF3A 2X9VA 3DMTC 3GVHA 4ZD6A 1K0UA 3GAZA 1E3WB 1ISGA 3I9JA 3HADA 4FS3A 4CQLA 1P77A 4GLOA 2HU2A 1B26A 4OGWA 2DTXA 1DC5A 2JFFA 1GL3A 4K6FA 1E3SA 3KRTA 2CDBA 4FFNA 2QZ9A 1V3TA 1VPDA 2B0JA 3DOOA 1GYQA 2ZTMA 3DTTA 2NVUA 2P9EA 1E1KA 4IDAA 1NQOA 1GADO 1UXHA 4Y6PA 3BMCB 2CVQA 1DIAA 3QW2A 4QX6A 2O3UA 5A05A 5CEJA 2GO1A 1DC3A 3DAFA 2DFDA 4R1SA 2BGLA 3G3EA 3ITKA 3FBTA 4BNFA 3VVCA 1NVGA 1ZW1A 1B8UA 1PZHA 3AY6A 3R3JA 1EBFA 2HJRA 5L51A 2FSSA 1SMKA 2OXIA 1DC6A 4NBVA 3VHRA 4M89A 2O50A 3EHEA 4IZIA 4CQMB 3FD8A 3QVSA 5ITVA 4OSOA 1DIHA 4EW6A 3RD5A 3GY0A 1Y5MA 1EFLA 1EUCA 1PJTA 1HSOA 2AG5A 3ON5A 1LEHA 1QRRA 3FRJA 1XQ1A 2VUUA 4DQXA 1K89A 4TSKA 2V6GA 3OH8A 3ONDA 4M86A 3CE6A 3WQRA 1I2ZA 3RFVA 3KZVA 2AE1A 5EQFA 3ZNOA 4EUHA 2P5UA 3H4VA 5C37A 1VJTA 3T7CA 1P1FA 1VKNA 2YV1A 4IDGA 3NUGA 4F45A 3ZHYA 4BNWA 1LX6A 3VTZA 4YWJA 1N1EA 4J0EA 4AJNA 2Y1OA 5TF4A 1ZXBA 1CIVA 4BNZA 3WYCA 5BSFA 5K9ZA 2Q2QA 3RCBA 2GZ1A 3D0OA 3PFFA 1QLJA 3RUEA 2J5QA 1H2BA 3MJSA 4RF5A 1OFGA 3CMMA 1I01A 1U3UA 4ID9A 1XYGA 1SNYA 1IULA 2Z1MA 3ENKA 3I5MA 4J1NA 1E6EA 3FSRA 4RF4A 3WGYA 2Y99A 5BSHA 4GLLA 2IYPA 3G79A 1P0FA 5CG1A 4B4WA 2YQ5A 5JDCC 3KV3O 2UUPA 4GX5A 3NDIA 1LQUA 1GYPA 3GN2A 4J3FA 1NPDA 4A2CA 1JU9A 4BV9A 1IPEA 3H9UA 2RHRA 2XOXA 1A5ZA 4RPGA 4AJHA 2D8AA 2CZCA 2C20A 3DHYA 1J0XO 1ZSYA 2Q49A 3COSA 2G82A 2J8ZA 2HCTA 3OBBA 1HDOA 3JQCA 4YYZA 1PJQA 3EZLA 4M49A 4WJZA 5C5IA 1C0KA 1E7WA 4QXMA 1YL6A 2BD0A 2VHZA 4YAGA 1TA4A 2OHXA 4FCCA 1VM6A 3U4IA 1CEQA 3B6ZA 4YAIA 3AOEA 4EUEA 1LJ8A 4OAQA 4WNIA 5AYVA 4CQLB 3DXFA 4BNIA 2JFHA 4W9NA 4FN4A 2VTEA 1PS8A 3RSHA 3KYBA 1IZ9A 3WSVA 2NADA 3MWEB 4HNGA 1MG0A 2FPGA 2J6IA 2JAHA 4UEJA 3AM4A 1ZXLA 3GRKA 3QVWA 3ZWVA 4A10A 3SEFA 5A5EA 3HHPA 3DEYX 5HS6A 3D1LA 4JX8A 1PL7A 4A26A 1X7HA 2EW2A 2WYUA 2VTDA 3I9OA 4BIIA 4OQYA 4KOAA 1UXJA 3F5QA 4YT8A 1GCUA 1IHXA 3INRA 2B4TO 4R1TA 2VHVA 1V8BA 1KERA 2GUGA 3H3FA 4NPCA 3MJEA 4WPGA 3RKUA 4DMMA 4G81A 4R54A 2AEJA 1QXSA 3BTVA 1DBVO 1BVRA 1LA2A 1V3UA 3JQEA 3SLKA 4CQMA 4I9UA 2R00C 1U7HA 4J7XA 3WWYA 4CL3A 3AW9A 1LLUA 1ISIA 1B3RA 4XJTA
chains in the Genus database with same CATH superfamily
5IH3A 4ARUA 3JYLA 4X85A 4DIOA 2QT9A 3T3NA 2ZWPA 3A6GA 3W8DA 1RWWA 3QE4A 1GUYA 3H18A 3MJDA 1NNSA 5J1SB 2ZIZA 2P3QA 3QX3A 1RYYA 3L4BC 4TWAA 1F14A 3AJRA 2VLBA 4DA6A 2C8VA 1YJ8A 4M54A 1U8EA 4LDQA 5ISMA 1B6GA 4PZLA 4V02A 3PLRA 1RQPA 2IEYA 4GGOA 3AR2A 1XLWA 1JTFA 2JGDA 1QYRA 3T52A 2R5WA 5JAOA 2P1ZA 2I54A 1QYDA 3WLNA 2A9JA 3PI7A 2ZUVA 4FFLA 4L6IA 3E15A 3QK7A 1EG7A 1U81A 3OJOA 1KJJA 4HI0E 2ZUEA 3N05A 1SY7A 1XU9A 2G4CA 2QOEA 1JQJC 4AG5A 1WE2A 5E0KB 5KIAA 4LJ9A 1DHTA 2Y05A 4D82A 5JXWA 4QDTA 5L6LB 3QSGA 2XXJA 3AF6A 2FFHA 1X13A 4PC1A 5AI5A 4GDFA 3N39C 2JS7A 2OD7A 3CRMA 3RODA 1EFAA 4F2HA 3ESRA 4MRMA 4TT8A 3AJ9A 3M0EA 4HQ0A 4KQ1A 4G07A 1E1NA 2I8CA 4NMXB 1NW7A 5T8KC 3T4EA 3UJAA 1RRMA 2OVFA 1GKKA 4BKPA 1G6Q1 2LWIA 1DQZA 3KJIA 4HHEA 4K6HA 2VQEB 2P9QA 1RM3A 2WWWA 1V45E 4KAFA 5K45A 3IIMA 1GR0A 3NIFB 2GZSA 4OL9A 4YJ3F 1U0GA 2W6JD 1RLJA 3KSBC 2YHIA 3AU8A 5IKMA 3CX7A 3O2SB 4B7ZA 4GVPA 3QFFA 4PR3A 4DGSA 4KACA 2XVZA 1OBFO 2XYRA 2V5AA 1MT0A 4ZO6A 3X43A 2CNBA 4CU5A 2LKCA 1ORRA 2B1JA 2H7CA 3AOEC 3IUQA 1SEVA 1N5OX 3A25A 4QFDA 5KJEA 5DBGA 5TMDA 3VPHA 1B0PA 2ST1A 1Q1EA 1PYDA 2YWDA 3MMZA 1QYCA 4N7MA 1R18A 4QJIA 2ZWVA 3HXLA 1FNMA 4D4JA 3VAZA 1REQB 2H11A 2HK7A 3DZGA 3RSQA 3L43A 1K8ZB 5LP6C 1PFYA 1S5PA 3DOJA 4ZJYA 1MA3A 1V2GA 1XZAA 2QTZA 2D2FA 5GZ3A 4DV6B 1HI9A 2D0IA 1HT1E 2C42A 4FZ3A 4S0XA 5BPHA 5CFPA 4CM1A 4XW2A 4N4AA 1X2EA 1ZOSA 1SU6A 2C9YA 4D4GA 2WKPA 3JQAA 4WESB 1UMBB 3TEMA 2AKEA 1NY5A 2DOKA 2QRVA 5AO9A 3V4VB 3GLIA 4F3TA 2XDAA 4L0CA 3B1YA 3O8BA 3Q7EA 3KOYA 4PTYA 4L72A 3EFHA 3R3HA 1USIA 1Y8RB 4W99A 3V1NA 4H59A 1QANA 1F7VA 1F48A 1LSJA 1JA1A 1A9RA 1YKGA 2CJWA 3ZJTA 4EEKA 3N2GB 2FZWA 1JQ3A 4FDUA 4YGXB 5JTUA 3N0VA 2CLFB 1O6BA 1QYVA 3I6ZA 1RYDA 4X54A 5C8VA 2ZIWB 1ADYA 1L8AA 3IPXA 3NLLA 1PP4A 3H3JA 4M2LA 1K2VN 4MK4A 1IWPB 4UUQA 3TLAA 4BLRA 4AY6A 3SCZA 1C80A 3PXUA 3TW4A 2Z8YA 4RENA 2V98A 1MPTA 3BTOA 4JB8A 3DGFC 2EBWA 3TTSA 1L1EA 3W05A 3EODA 4MR8A 4GPD1 1OKKA 2ARKA 1J2TA 2RHCA 2COUA 2YMPA 5CA0A 1P33A 1LBIA 4P5DA 1VLZA 1LTHR 2FQQA 2PHZA 4TYPA 2WMDA 3UAOA 3M4YA 4GIBA 1NW3A 4LOAA 3NT5A 1ICEA 3EJ6A 4W5HA 1KP9A 5JT1A 2FN4A 4CM8B 4YAKA 6CHYA 1MOQA 3RV4A 4GM4A 4QRIA 5AJVB 2Q5JA 3DCIA 3VNBA 1D4OA 4URZR 3HBFA 1WV0A 5CLHA 2O8FA 5EMNA 1RMQA 1V25A 5B2ZA 1DXOA 4MVJG 3GCDA 1KJIA 1SCIA 4X1KA 4YP1A 2VTBA 3EMVA 2VRCD 5AW4A 2GBPA 2ZJ0A 4B6RA 4BNMA 3RI3A 2RGWA 4CF5A 2C4MA 5JXJA 2R6CA 4MV4A 4WJKB 4YCDA 5ALXA 4R1NA 3TGWA 5JCOA 2BR5A 1A0OA 5AUNB 1LLCA 4MZXA 4O0MA 3O8RA 1N2JA 2A9QA 3VNSA 4JI5B 3RVMA 5D5PA 1MH1A 1KETA 2XT0A 3BMNB 1FRZA 2AMFA 3CINA 3D2BA 3IEXA 3UF0A 5C7LO 3B1WA 3RAEC 3EPRA 1DCTA 2QD1A 2CXUA 2VXYA 4HGOA 3RROA 3UKDA 1H8EA 2QL9A 3CYFA 4AJKA 1X7WB 4MHSA 5E3HA 1UMKA 4WBNB 1Z47A 2DWOA 4ZGBA 4PNHA 4WA8A 5GZ1A 5J2UF 4DLYA 4DJAA 3KVYA 2PXCA 3ZKAA 4NCAA 4KHZA 2ZUTA 3A05A 5JWHA 5BVHA 3C2QA 2XTMA 2R6DA 1RPZA 4BO7A 1ZS9A 4QNNA 2OHGA 2Q5FA 3LZCA 2GHQA 1I0LA 2G9RA 1HFEL 4AVYA 5J4HA 3QI2A 2B82A 5LC1A 2GEJA 2EFEB 1ZN7A 1B8OA 1FFXB 1CZKA 2FSGA 2VP3A 4ZZ3A 4HN2A 3W8RA 3VPGA 4G4SO 1PRYA 1JHUA 1LC3A 1TPZA 2IXTA 4LHSA 2AOVA 2I80A 4D0SA 1VCOA 1OW3B 1XCLA 2BP7A 2JLQA 3KQYA 4MR7B 5IC4A 1FUUA 4KWTA 3M8KA 3SI7A 2FZKA 4CGZA 5D3QA 5IT0A 3G8CA 4GBMA 4CT4B 2UZ1B 4EY5A 4R0VA 2I1WA 2EJBA 3AY7A 1GPDG 5FF9A 3D54D 3KDPA 3W1VA 4PLGA 4LOHA 1IZ0A 2AXNA 5F64A 4IHJF 3VR4A 1IIRA 3LOQA 1OC4A 1Y9DA 4UUPA 4RO0A 3SKYA 1AMOA 3TPCA 5B53A 1TTTA 1F38A 5CXQA 2MU1A 1QGDA 3QMMA 4MEAA 5CW2A 3O26A 4JBIA 2Q27A 1DFHA 1U1CA 4H4DA 1E62A 3LE8A 2VJKA 1U4SA 3ZG6A 1JHAA 1GEEA 1GGJA 2ZXFA 3JQFC 4PLCA 4NBNA 1FDTA 1DDOA 1PT5A 2QS9A 3V5NA 4DJDC 4EJ6A 4OX9B 1MQ8B 4EVSA 1QF6A 1EM8A 4LNHA 1Z0IA 4DA9A 1EFPA 1WDMA 1AE1A 4ND3A 3EXFA 3A9WA 1GPLA 2HJHA 2OESA 1Z4OA 3BXXA 5KC8A 1KPGA 1W5TA 5HIJA 4ZKDA 4I5IA 2AF4C 4RD4A 4MWTA 2ZR8A 2EJTA 2AL7A 5DGXA 2RAFA 1ICIA 2HDHA 1YJXA 2Y0CA 2CHQA 3PVSA 2EIXA 1LK5A 1ND5A 4DC9A 1UWLA 2ZJZA 2H0QA 3BMOA 3CC8A 2HCRA 3I6QA 5EZYA 4ZMBA 2HNBA 1RLIA 2C77A 3MXOA 2HO4A 4GP6A 2I8AA 4E30A 2JFYA 4H6VA 1J2YA 5AM3A 3BK2A 2OFPA 2ORYA 1DEXA 1CZUA 1VMAA 1B74A 1NL3A 4R2KA 4C03A 2BGNA 4EIWA 4OLAA 1RTTA 2FW9A 1G6KA 3LHFA 3SBXA 5ICFA 3ZZNA 3H84A 3KETA 1WEHA 1ZN8A 3CMCO 1FVXA 4JGGA 3FPJA 4RVHA 4J16C 1F7UA 1T1RA 2OM2A 1IJFA 4MQUA 3B5EA 1ZIDA 4DCCA 1BO6A 1NV9A 4EYSA 4NEHB 2YXPX 3SFTA 3S99A 3DONA 4BB6A 2W2MA 2XSZA 1PR2A 2WW8A 2O0HA 3K2BA 3PHBE 4G86A 2XDQA 1OFUX 3MWLA 1KRXA 2Q2NA 1XMPA 2XYHA 3O3NB 5ALUA 5K5EA 1FNNA 5L3QA 1SBZA 2AS0A 3GFRA 3E53A 3Q8KA 1GJRA 3TINA 4K6KA 4IJ6A 4N0DA 2P69A 1ZBDA 2PKRA 4GL4A 4ZI5A 3UK1A 2CLIB 2VPZA 3QMVA 4RSGA 1Q84A 1J99A 5ER9A 4RLSA 4YRLA 4F86A 2W00A 3QFCA 1CF9A 3PC8C 1W87A 1BDHA 5DM1A 5K1SA 4II7A 4YJ2F 5A5GA 2O9JA 2KX7A 5IZCA 4RM2A 4POAA 1GZUA 2BFOA 2QD5A 1FOEB 5IW8A 1B2LA 4CV3A 3H9BA 1WOMA 2Y0EA 1ZD9A 6AT1A 3E9MA 1ISRA 3UANA 1DPGA 2O19A 2GS9A 5T41A 4MMXB 4OOFA 4R1QA 1PD0A 3HYSA 3ZHRA 3O95A 5HMLA 2ECFA 1DQYA 4G65A 4WAUA 1DAFA 3N2NA 3A6PC 2ZBVA 3ZHVA 3HV2A 1Q1BA 1EZ4A 2FRDA 1KFCB 3BRWD 1IXSB 3T3IA 3T5AA 5IUNC 2J9FA 1BGXT 4C4RA 3E18A 2B9VA 1R16A 2FR1A 2PNJA 3EMBA 5KNDH 5BVGA 3JVVA 5HWSA 1WMSA 1HOTA 2ZRCA 3AWDA 3RJ5A 1E2QA 3TD6A 1EXVA 2R7MA 2REBA 3A3OA 1E2NA 2D8MA 4HZUA 4GEKA 2WLSA 4MXDA 1G60A 2WF6A 1SUFA 1DEOA 3S29A 4CMAA 2E4VA 3AUYA 1FRVA 2O2GA 1QE0A 3E9QA 4RZ3A 2PA0A 1EVYA 2WU1A 3DGEC 3Q11A 4G6ZA 4HPXB 3QENA 3ETNA 4JH0A 4L6AA 4MV1A 1UAYA 3JAWB 3BRQA 2UYOA 2IYWA 1E66A 5IG2A 1T8TA 2G77B 3ZGLA 1D6SA 4X7MA 3D3KA 4FR2A 2DPGA 3ZZMA 4D4LA 4IKEA 3TMKA 4BY9E 2QTVA 3PQ7A 2X4GA 2NU9A 1SPXA 1ZJ6A 2AI3A 3IUYA 3KB6A 4WGFA 2PRJA 2BH9A 3URMA 1QGUA 4DVGA 5AKIA 5A04A 3BDVA 3QELB 2DKFA 2BF7A 1AKQA 3G8YA 2PS9A 3Q1KA 5F4BA 3B60A 3C3AA 5JOQA 4ZYLA 1Q74A 2VJBA 1XVIA 1BOFA 3KYCA 1BVYF 3Q7QA 4IRUB 1C9NA 3S70A 3NWEA 3P9IA 3A6DA 2PMDA 4G1EB 4RHFA 3EEBA 2FSHA 3PICA 1W85A 3A3NA 1CEYA 2PRZA 3VYSB 1QOPB 3P0FA 4F1KA 2A5FA 1KP3A 2AMLA 4LK2A 3DXYA 4NHEA 1KS2A 2ZSEA 1EK6A 2OZVA 1FFGA 2W2LA 4J1TA 1Z13A 4FYKA 1CDOA 1PR3A 2BGIA 2QW8A 4NHOA 3SR0A 4OM8A 1J70A 1UBEA 4D9FA 1LSUA 4I9NA 2Q9UA 2JHPA 3GI1A 4IL5A 3PIDA 4QGHA 3CLRD 4G4IA 4FKBA 4ZODA 4A0QA 4E03A 5DHQA 1WXXA 2HMSA 3GIWA 1A1VA 2CHEA 4KLZA 4D80A 3EUEA 2JGMA 1J0EA 4CYMA 2EKBA 3FMIA 1NNUA 3HJTA 4WESA 2IU0A 3C43A 3PEEA 4J7CA 5GQSA 1GL6A 4PZEA 4BMXA 2Z9DA 3CF4G 4GWKA 3DD5A 3GLIE 5BXYA 1DTWA 5CVEA 3ZTWA 1BH2A 4TMKA 1BE8A 4XGNA 3F9RA 2D6FA 2EX0A 4CLEA 3QF4B 3A31A 1OYWA 1PTJC 3OEHA 2HK6A 3DBRB 1UZNA 4LVOA 1R5JA 3EEQA 3K0FA 3QLTA 4WEQA 2I6TA 5FBHA 1SVWA 1POWA 2OHIA 1LW6E 5BPFA 5DX1A 1ZZEA 3KQKA 3AEUB 1R8XA 1JGTA 1W52X 2N47A 3I6BA 4GWLA 4MROA 4MGHA 2WF8A 4Z8YA 3DDWA 1EB8A 3CURA 4EDHA 4DR3B 1TZBA 1V5GA 3R4VA 1LPBB 3EBOA 4ZQIA 3OF2A 3PUZA 3QU4A 5AHWA 4CMCA 4CMKA 4MJXA 4DEYA 3E03A 4Q5IA 1V16B 3B6KA 4CDGA 4Y8VA 3NEYA 4M0CA 3ZWBA 7ADHA 3ZI7A 4PXYA 1ODTC 4UATA 5DE3A 1OQAA 1L4FA 2HB6A 2P2LA 2XVXA 3HA7A 2XUOA 1JSRA 3UK7A 2VVTA 2DPMA 3K4PA 4NSNA 3W7BA 2C9OA 5CA0B 5JWRA 1UPXA 1I8TA 2YHSA 3GBVA 4JA0A 3ZCXA 2MSWA 3ZY3A 5CEFA 2N46A 2C7VA 1JAXA 4NY1A 4LOJA 4BQRA 3FZNA 4NNOA 2BDEA 1OWPA 4TXHA 1ZAKA 4XQEA 3X1WA 4FDMA 3VV2A 4AROA 4BJ1A 5HUHA 2LV8A 1T0PA 1N5IA 1GT6A 3R6DA 2NPOA 4FQ8A 4II2A 1THTA 4OHVA 2CEKA 5JNTA 1YU6A 4CG3A 1ARZA 1QNFA 2W2NA 3SHVA 9LDBA 3IELA 1JYSA 1XF9A 4FHZA 4G26A 4HBZA 3AF0A 1C9YA 3ONFA 2PZKA 2HPHA 2OECA 4N0MA 4L78A 4BMCA 4ES6A 4RTQA 3LU1A 1E3DA 1QZZA 1EIWA 2EV9A 4BAUA 4OFXA 3OPYB 1Z5WA 3D6UA 4Q1FA 1HZJA 3RSSA 4YXFA 4NX2A 2P2ZA 1X1CA 4HBGA 2RIRA 3I04A 3LUAA 2HHCA 3H9JA 4JA2A 1QG4A 4O29A 4P3KA 5BSGA 4IJUA 2NZ2A 1DQNA 1F8XA 1J23A 2JI7A 1TCAA 3IQFA 4I4TF 4E4RA 1FZQA 4QNMA 1ZGHA 2O57A 4OM7A 1Q91A 5T6MA 4W6ZA 2W90A 3CTPA 1VP9A 2P78A 4MGEA 1MC8A 3JD0A 3O4FA 4N3NA 1R27A 2HDWA 2NNLD 1Y7TA 4P2GA 1M6VA 4HNAA 4BNVA 2A4KA 2HSEA 3GZNA 3K7EA 2QQEA 4FSXA 1GSAA 1X8KA 3ZDRA 3BFKA 5HOQA 2YWJA 3D4NA 4IH4A 1Y4ZA 2ZSBA 1OAAA 1O0CA 4JQYA 5KDLA 3OZVA 3P2KA 4YRQA 2RGNC 4MGYR 1BCRB 3GUYA 1KJWA 1Z2EA 4OYRA 3RW9A 1KORA 2CUNA 2PANA 5T64A 4OP3A 1ANKA 3QKUA 4QUHA 1LGYA 3ZUPA 2BGKA 2JLAA 1SKYB 1EVQA 3KEFA 2A8YA 1DU4A 3KKPA 3QKSA 2WJ6A 3UMRA 3HI6A 2AD5A 2EDCA 1A72A 3R7NA 1AURA 3GRPA 1EUCB 4DOMA 5K05A 4YH1A 2FSFA 3JWPA 5AI9A 2QQ5A 2QR5A 4EG4A 1N92A 2AOXA 5M29A 4PN7A 1AX9A 1BXGA 3LXRA 2P5SA 4MICA 2Y4NA 4LZZA 5EKDA 4HUJA 2H1CA 3TLGA 2A1IA 3DFIA 4DMHA 4REMA 3LLVA 3PWZA 4YAUA 4J6EA 2IU3A 1FMLA 2I7VA 2JGAA 1WA5A 3BIFA 5BWNA 5ICCA 3GEBA 3TFWA 2QX9A 4K9PA 3PRJA 3KQNA 3V7YA 2X86A 1Q3TA 1DFIA 4YJHA 2OYCA 1VCMA 2AGVA 2P27A 2GA9A 2WM3A 3U5TA 3W4KA 2V03A 1KAHA 4ZV9A 2QL7A 1W59A 2QYTA 2VP6A 3OE7A 1RAHA 1ISSA 4K9QA 4M38A 5JNWA 4C88A 3L79A 3GGJA 4GRIA 2ENUA 4FYJA 5FNZA 5IPFA 7YASA 2VAPA 4NECA 4NNPA 4R1UA 3QJGA 3G2PA 1QFXA 4OQQA 1U2QA 4YA6A 3IR5A 2PUAA 1VB5A 3PPYA 4LY9A 5FQNA 1MIOA 4E22A 1LVHA 3IDZA 5FO1A 1F9AA 1TIKA 3JD3A 1T0UA 1ZJJA 3N74A 1BMFD 1XTKA 3NIBA 4YQZA 2LIVA 2JCBA 2GEDA 2JGNA 2XNKA 4TQ9A 1UBRS 1T1JA 2YVAA 1P1CA 2J0QA 1NYTA 4YMTA 2DR2A 1YRAA 2AMYA 3SP1A 4Z7NB 4Y6SA 3NBXX 4RHCA 4PX9A 1YB6A 3OTHA 4NOKA 2GPJA 4ZEMA 4CM3A 3J80A 3ODGA 2P2NA 2XF8A 3IAM1 2GAAA 1U65A 2FMXA 1A9TA 2J41A 4E2ZA 3RYCB 1AK9A 1D4FA 3R6TA 1QF9A 4QUJA 3K4QA 2Z2IA 4UTOA 5TT0A 2JJ2A 3L7NA 3RRMA 3VUFA 4BAZA 4JEIA 3BDAA 3PRYA 3T3GA 1G5RA 2QB5A 2C1ZA 2FF7A 2OV2A 4KFUA 5TB5A 1XZBA 5B6JA 2IHTA 1CUSA 2R84A 3IP7A 3LUHA 2CMHA 1H22A 1WD5A 2W2TA 2AEEA 3BF8A 4M8KA 4E07A 3FN4A 2PBRA 2IYSA 1Q12A 2GZHA 1OXUA 4KRGA 3LBYA 3ODPA 4UZSA 4CIBA 3A6FA 5AW6A 4BLOA 1H9AA 1XJ0A 1YUNA 3VKGA 2BFFB 3G0DA 3I5UA 5CGZA 4K9NA 1C3XA 4ILEA 4DDKA 5CM2Z 2NYUA 1YHZA 1TGYA 2A14A 3OA2A 3U80A 1LDMA 5AM1A 2P9HA 3O1HB 2Y92A 3UNXA 1FNDA 2P0AA 5AKEA 1M8FA 5FHRA 4CF4A 1A9QA 2EP8A 2PS0A 4DWVA 1AKUA 1KS9A 4A6XA 1OE0A 4RTOA 1GCAA 1MEOA 5K8UA 1CUDA 2A86A 1ID1A 3CPSA 3D6JA 3K09A 1SHTX 1VLHA 4RZXA 4U0JA 4Q01A 3SF8A 4AJ1A 3IPCA 3WLAA 1SHZA 4ZGGA 1TB4A 3TZQA 4LXYA 4LCJA 3PVZA 4FSHA 2ETXA 3TL3A 5JAPA 9LDTA 1I3MA 2W58A 2Z6AA 4ASUA 1Q22A 4PFSA 2ZIAA 3L1HA 3WZ2A 2WNSA 1KJNA 2N0SA 3BK1A 2M9MA 2Y27A 2QA5A 1G8JA 3G9XA 1U2GA 2QUKA 2V9CA 5E2IA 3BCUA 3GW8A 5K0NA 4BVGA 4DLXA 4FFBA 1P2BA 4K0RA 3ECCA 4QHYA 1R0LA 3WA6A 1XTQA 1QK4A 1WB5A 1YBMA 5D85A 1AIPA 3EGIA 3BSFA 4OQXA 3NYRA 4EYOA 1CJKC 4UTRA 4KGXA 2EARA 3N2KB 4AY4A 3PC2A 1JLKA 1WR8A 1GUFA 1EFVA 3BGSA 1XRRA 4AAYA 1R5BA 1MW9X 1GNSA 1UPFA 1RJ9B 4X7RA 4OL0A 2VOJA 4M8NE 2Z8YM 5FBZA 3DLCA 3FKSD 3PL1A 2W6CX 4MKZA 4OXQA 4Q1DA 4TV9F 3SR4A 2QHXA 1E1RA 5F73A 1AKRA 1CQPA 3OPNA 3X1ZA 1M0EA 1KMCA 5CHYA 4OUDA 4KXFB 3VNRA 5G4KB 4K9KA 2WK1A 5D86A 2QTTA 1D03A 1KMQA 5E7JA 4ZU6X 3M49A 1SG6A 3BC1A 4INAA 1EPUA 3N70A 3O73A 5JSZB 1TT5A 1N1DA 2CFIA 3MQ2A 4HYTA 5CMLA 4H15A 1R7RA 2EJVA 4QGSA 4R3NA 4JLPA 5M7EA 4XX0B 3RTBA 1W49A 4MUEA 3WS7A 2YCLA 3ZGZA 1XZFA 1S7CA 1G5HA 2B30A 3OJWA 5ALGA 1A97A 3T61A 1FUIA 3BJEA 4D0LB 2VYCA 1Z2PX 1GU0A 1Z6YA 2BKEA 1C1XA 1F60A 2EHJA 2D4AA 2J59A 2ZKIA 3HLTA 3BJIC 4X94A 1ETHA 4MS3A 1JFRA 1EU1A 1ZOPA 1B8VA 3N87A 4YIKA 2DSTA 3CWZA 2XE4A 4OYLA 5AIBA 1ZNWA 4AKSA 5EXXA 3ELWA 1NVMB 3ETLA 4BQIA 1XZIA 4HAYA 2WFLA 5SYAA 4GD3Q 2B8EA 2X1HA 4HN4B 5G53C 2B8JA 3SDSA 3TG8A 4LJ8A 2PBFA 4URWR 4WFIA 2YL2A 3FBGA 3KKMA 1Z4QA 2V74B 3IQGX 1R37A 1JQ5A 2XYVA 1CNMA 4AKGA 1JDTA 3WIOA 4KQ6A 1YR1A 4K2HA 4DNFA 1YBVA 2VJNA 4J2OA 2ODPA 2ZRBA 1D1QA 2BIFA 3DF9A 1FU8A 1UMCB 3L4KA 3WNDA 1F8GA 2GBGA 1UJ5A 5FP0A 2BMEA 3C3WA 3K0CC 4KMRA 3I2JA 3HS3A 4Z4EA 3HEBA 3HSKA 4Q1EA 5EP3A 3PGLA 2VF2A 2ZSKA 3OF3A 1MNAA 4WXYB 2HSZA 2JARA 4RL4A 3PEFA 3REFA 4JI2B 2XCQA 4OX9Y 1G41A 4BO0A 5CJ2A 1CY2A 1TW3A 1VECA 1W2GA 1ZVQA 1XL0A 4CFSA 3L46A 3ZQUA 2XMZA 4UUAA 2WUWE 4C4ZA 4Y6GB 4BE4A 2H4HA 1E3WA 3BKWA 1AKYA 4W8HA 1UBUS 3RQSA 5DW0A 3QSYA 3ENZA 3HYCA 3RC7A 5IKEA 1NSFA 1GFWA 3DW3X 4HGQA 1WDLA 4AG3A 3O1LA 4TWZA 4WKPA 4NARA 1UP7A 3WGIA 4OLHA 3W2TA 3DKKA 4QU8A 2A94A 4OXRA 1LVUA 4ZP1A 3MIZA 4REOA 1JXMA 2GJSA 4ZVKA 5F3WB 1BH6A 1JIQA 2HWWA 3UFXB 4RJLA 3AR5A 4UFOA 1UBCA 3STYA 4BQSA 2KMLA 1I1OA 1ZCZA 1T10A 4H7DA 2QMEA 3PIIA 4QBIA 4FFVA 4ZVRA 2Q2VA 5BQ5A 3ZDFA 3CVOA 4NOMA 4R5MA 4B17A 1QWOA 4KSYA 4OHOA 1FJ2A 5E1BA 3IJRA 2QTCA 2ZBFA 4HS4A 4WK2B 2ZYAA 3AR9A 3A7DA 2OBBA 4A0HA 2W9XA 1EXWA 2JRLA 3FMPB 2HIGA 3D5QA 4QEKA 5JV5A 4MP6A 3D0KA 3JVUA 4NE7A 4HQLA 3IJEB 3O4GA 4U63A 4B47A 4E7PA 4MJLA 4EVRA 2V7QD 4EGJA 5LU8A 2CNWD 3NVDA 3PUWA 1YZ3A 1GRNA 3B7WA 3Q3IA 3SOZA 3JWGA 5JAMA 2UUCB 3HXOA 2QVXX 3BD8A 4JUDX 4INPA 4QIHA 3VTKA 2Y2VA 1X42A 4JU8A 4ZRNA 2AV6A 2V1XA 1V4VA 2X42A 1GG2A 3NDRA 3OCCA 4HWTA 4X20B 2YFQA 1Z73A 5DNDA 4ZHQA 3TR0A 3S6JA 1ULUA 2H8GA 1OFUA 1ZQ9A 2A0YA 2H6EA 3MBOA 4FOLA 3ROMA 2ET6A 3QJ5A 3PG5A 2MIIA 3V4ZA 1NKTA 1B2RA 1XF1A 4PBTA 4K1LA 2BGUA 4US2R 4FOOA 3KYDA 1C3OA 2WFLB 1QP7A 2XGOA 5L53A 1V5FA 1KO8A 1G9XA 2XNDA 3W7VA 2VSQA 2ZRFA 3ND9A 3D7MA 4KIFA 5A2GA 3V8NA 1TAUA 5FBRB 1CUVA 1MW8X 1NVFA 2RONA 2ZWOA 4FHGA 5HKBA 2CVOA 4FW8A 2YVUA 3LLSA 2B61A 1MAHA 4XQ0A 5DZSA 5AJXA 3TZLA 4EA9A 4UM7A 5KDOA 4FGUA 2UVDA 2XMDA 1PJSA 2DPXA 2AKYA 4BNJA 2GHTA 2HF9A 3KALA 3KVRA 1PR1A 2E87A 4XEUA 3LKVA 2H51A 1OXKB 1Y8CA 1K7FB 2WM9B 3WK7A 4YJ3A 4HGRA 6GPBA 5HM8A 5JBNA 3E84A 4QU5A 1BWSA 3MUEA 5EQDA 3INGA 5DLDA 2V5VA 3HL4A 2E0IA 3LDAA 3PRHA 4JL6A 1SFRA 1UR5A 4BYMA 5IZ4A 3WA7A 4CLRA 3MINB 4UVHA 2IVFA 4TXNA 3WWPA 3DMFA 1PQUA 1X1AA 5E4JA 2ZYTX 3E2IA 1GZDA 2NAFA 3CW9A 1IRIA 5DU2A 3W5SA 3HYLA 1ZKMA 4WH0A 2IT1A 4F7WA 4C43A 4MW5A 4G36A 3ZWKA 1R0BA 2NYAA 3DAPA 2B36A 3HU1A 4P4UA 1JLHA 3JWJA 4G5HA 1IJKA 1GM5A 1UWKA 1XJ5A 3U1BA 1K7YA 4DV0B 1RXUA 4D6YA 3AF4A 3DBIA 3F6SA 3FROA 1WY7A 5K03A 2H92A 2GJ8A 1GZ5A 5FO0A 4B4KA 4MLPA 3CW8X 4C3OB 2JJQA 3H2YA 3AGPA 3KOZA 3FRHA 3NIWA 1WW2A 3ADPA 1YH3A 4Z1MD 4TVOA 3SM3A 4INJA 1SVMA 3S28A 3CVUA 2ZAOA 3GBPA 2FUNB 5DLPA 5B3JA 4AKHA 4JI3B 1W5SA 4XAQA 1FXSA 1FLNA 4MQMA 1UWVA 4PAQA 3I83A 4RIGA 3PQFA 5IUKC 3W6PA 5EOVA 5EE1A 2J07A 2R97A 4W1RA 2O2EA 5F5XA 5KJCA 1YR9A 3ZZTA 4MR8B 1PJ3A 2OAQ1 5H80A 1T4DA 5AVOA 621PA 2F8MA 3KHSA 3DUFA 5F3RA 2RCNA 3V32A 4D56A 5BORA 3AVOA 2QSYA 4M1TA 3VV3A 1JVBA 1Q1QA 2DAPA 4BFYA 5IDXA 2BCEA 2YXDA 4N9WA 3ND5A 2DETA 4RZ2A 3V4LA 3G6KA 3YASA 5G4LA 2EF1A 1RI5A 5A06A 2DUMA 3VUEA 3C6MA 5KTKA 1VSBA 1G17A 3HM2A 3KVNA 5JARA 3B2EA 1EDZA 1ADFA 2OG2A 4TKUA 2JG3A 4COOA 2O1WA 5AVKA 5KTRA 2O0MA 2XCLA 2YJ6A 4ESOA 2ZJ7A 5LD2C 3N5KA 5EUMA 1NUPA 2GKSA 4AXBA 1TK3A 1ZHFA 4CCYA 2ZBPA 1ZEMA 3L3BA 4JROA 3AJ8A 2C8LA 1VE3A 2HREA 3L7DA 3MSXA 5TS3A 1DCKA 1T4MA 4RY0A 1ZNQO 2VPXA 4DCPA 2Q6OA 2WJ4A 2XDWA 2CL5A 2C2XA 3RE1A 2Q41A 4GXQA 5DFAA 3F6YA 1OCEA 3MLBA 3UUWA 3DO6A 3VZBA 3TXAA 2RK6A 1F8UA 3HLKA 2FPSA 4YJ3B 4JIMA 5KYVA 2VRBA 2O4CA 4ANFA 3LO8A 1TXGA 2H2DA 4FFRA 1XTPA 1V9CA 2ZGVA 5ES4B 1OFVA 1E6MA 1CQXA 2POQX 4KSBA 5ALFA 2PMWB 2VCYA 3A3PA 2OCIA 2W4IA 4KTVE 3LT4A 1JLLA 4M1MA 3AHHA 1CY4A 5K3EA 3IQIX 3T1QA 3ZV5A 4ALNA 3S2FA 4PQYA 2VP9A 2HF7A 4I99A 3WADA 5I4CA 5JRZA 1T6XA 1XHLA 3FLAA 3N0WA 4OU5A 3HO6A 1TO2E 1VI6A 5CYGA 2JGJA 4KGDA 4OGKA 3U7QB 2I3DA 4D4KA 3DE5X 3EW9A 4UEOA 5TQ0A 1NIPA 1T9ZA 3D8HA 4RA9B 4TTQA 2VWGA 4EGFA 4ZK6A 1A88A 3I53A 1KFJB 4NFYA 3LPCA 3WTCA 2HN9A 3WI7A 1UDAA 3L0ZA 2F48A 2NLOA 3QUCA 4AY2A 2C7RA 4AN4A 4OUDB 4ZOEA 5G4KA 5EIBD 2OMKA 4N12A 2PMEA 9ABPA 2WE8A 3GEHA 3IMFA 4M7OA 4R98A 4FQ7A 4LK3A 4FOTA 3E9RA 1U8TA 1JUDA 3C0KA 4MHTA 2CHUA 4CM6A 2LCQA 1VKZA 3TQRA 2ZM5A 5M2QA 2VXCA 1Q7RA 1OH8A 4HAOA 4PAGA 2YC2C 5HKKD 3QPDA 2WSBA 1KFKB 1U5CA 1WHTA 1O95C 3MRXA 1CHNA 1DQSA 3PZRA 4MWSA 3MD9A 3MCTA 5JQWA 2OQIA 3LCVB 3V6MA 4UD2A 4EW2A 2IYTA 2AHRA 2G5PA 3GQBA 4RD2A 3S27A 1BHSA 3MN1A 1R5OA 1W8IA 3BZBA 4QQKA 3ZWWA 5FLXA 1NT4A 2X14A 1KAEA 4Q1BA 5H5JA 4RX1A 3QFHA 3H2SA 4NBTA 4DXHA 1R9JA 3LOUA 4RIHA 4ER5A 3TX6A 3EVGA 1SUWA 2AZ4A 3Q98A 4TRNA 2PYZA 1HG0A 3FW1A 3NHZA 3P94A 2P68A 1EP9A 2VK8A 1QVWA 4IIYA 3SQOA 4OY3A 4QEDA 1Y4AE 2IX3A 4QJBA 3AF1A 3BA6A 4GOXA 5JVDF 1U2RA 5IM5A 2FX3A 4K0KB 1VHJA 2I33A 4Q7QA 4S2UA 4CKZA 1H6CA 3O8OB 2BGRA 4QYMA 4HWSA 5DASA 4KZKA 1WV1A 4LF9B 5CFQA 2YX1A 1BKDR 3BGVA 1DWQA 1NA5A 3FTQA 3DR5A 3GFOA 4JR1A 1DX4A 1DQRA 4HATA 1N6HA 3I4FA 4OHXA 2GRAA 3R7AA 3BICA 4K6MA 4ZCSA 3Q2OA 5IVKA 3B6EA 4I0WB 4ZVQA 2DJ5A 4WDRA 3T0IA 3DVAA 3MILA 2J5XA 4QDXA 4FEAA 5AQ1A 1ZSNA 2EJUA 2XDQB 5L95A 1QBKC 2AG8A 3HN7A 1CNEA 2COEA 2O7SA 3RYTC 5CBPA 1DKRA 3DZIA 1WW8A 2XBUA 4I6EA 1YFKA 3DLPX 1NGSA 1SD2A 4Q1AA 5A4AA 3K6SB 3UAWA 2PSFA 5DDIP 5E4FA 4H7HA 1L9KA 2NZVG 4XLLA 3T1YB 1ZU4A 3L92A 1SUIA 4OK3A 3E1KA 3TDKA 1X8LA 3EUFA 3UFBA 1NUSA 1L4EA 1TOAA 2OHOA 3I34X 2F43B 3B3AA 3MWEA 4WN3A 1KQNA 3WDLA 5E7IA 1K5PA 1RYMA 1SC4A 2GT1A 4Q3LA 1MB0A 3TIFA 1KGDA 5AVJA 5HJ7A 4I81A 1E61A 1K5HA 3P2MA 1WOYA 2Z83A 3ZGXA 1KQOA 2GPAA 2O14A 1VA5A 1X6VA 1QH1B 4UHEA 5LZ7A 3HDVA 4AZVA 4PINA 1XZ8A 4L4RA 2FX2A 3H2JA 4FCWA 3UN1A 1T2DA 2YN2A 5I9BA 4ASUD 4BRZA 1Y8AA 1KWKA 1R88A 1KK0A 3DA8A 3RNOA 1A1SA 4DQDA 3EULA 1W9MA 2ZRDA 3D6HA 1T8YA 2GWRA 4RJ2A 2RGCA 4ODIA 1BKSB 2IIVA 2ZRMA 3AKCA 4RFSB 2X0EA 1N0IA 2ESRA 1WLYA 4OXIA 2QL6A 4HVCA 1N2OA 2EF0A 4LYDA 5EZYF 3TD2A 5HS4A 3LT1A 1BMDA 4IF4A 4MA0A 4TLAA 5C4MA 5MGBA 1M8KA 4GX1A 1VRWA 5KQLA 3QYFA 5DGIA 2C1XA 2WHRA 2HAEA 1ADJA 4MRVA 4JJ6A 3OFJA 521PA 1ISPA 4GOKA 1PSWA 1MGPA 2ODWA 5HFAA 3RJZA 1SN7A 1P7PA 4GM0A 4NCIA 1KZYC 2WUDA 2XBMA 4JQZA 1J90A 3T9CA 1HC7A 4Q4AA 2I4NA 2VC2B 4RK0A 3T7EA 4Q16A 3TTVA 1WXFA 3BIOA 4BFLA 3DKIA 5TS2A 4I46A 5JC1A 3ORRA 4IDDA 4OHFA 3U19A 3L6UA 4JENA 2D00A 4N3GA 3R7BA 2W93A 3UMFA 3PYLA 3T35A 1JJVA 3V80A 1VE6A 3ZCRA 3C1AA 3EXEB 3PDJA 4PM4A 4DJTA 1NF2A 3UGTA 2R1VB 4HAZA 1RTKA 4M9XA 1Z0SA 2C5LA 4Q3BA 2PSEA 2HGZA 4FINA 2QJFA 1ZM7A 2ZUDA 4JGBA 5JZ9A 1D4AA 1WUJS 2OD9A 3JPYA 3RR2A 7MDHA 1U8UA 2NUTB 2CNNA 3E1SA 2REQA 5F12A 3S5UA 4CKBA 4X60A 2A5DA 2VT7A 2CZQA 2XD4A 3DULA 3ENNA 5FI0B 5CBPB 2LE0A 4HMOA 4RA6A 4BYGA 1PLLA 5J4LA 2E3JA 2ZIGA 3OM1A 2FDXA 3KQPA 4WOPA 3LXXA 3OZDA 2NUBA 3WBFA 1J9GA 3NQ41 4Y2SA 3IT3A 3TPZA 2YY5A 2ZSUA 2Y76A 4WOCA 1GUDA 1XD9A 1Q11A 1QS0B 1U0OC 1YUMA 3O0TA 1FTYA 2Q4BA 1UFKA 1JPJA 4YRDA 1I13A 4UHJA 4EPVA 4IICA 5FHQA 4TTSA 5ANRB 3GT3A 1LTQA 3EC2A 3KIPA 1GARA 3N8IA 5BN1A 2YWEA 1JHOA 2ID8A 2NZJA 4EI8A 2NAPA 3LCMA 5ICSA 1A3CA 2Q5HA 2FZ5A 1E7SA 1RPTA 2GPWA 3QVOA 4PVCA 2HL6A 2ZB7A 2I78A 2IOQA 1IN4A 2PN1A 3PYXA 2FB9A 2FLVA 1Q0RA 2FY8A 2Q29A 2QRLA 1GTL1 1P44A 1PG2A 1HDGO 2ODAA 2P9FA 2X4DA 3OY7A 4K5QA 5A9RA 5LR6A 4Y3UA 2EL9A 2MOKA 3KO8A 3JQ6A 4N48A 1BG6A 4F3RA 4YN3A 2CB0A 1HTTA 1DOAA 4K9SA 4DSZA 3P19A 1ZK3A 3HB5X 3ZBQA 1PLKA 3U48A 5KB3A 1NURA 1ACLA 3F1KA 3LQ4A 3KZNA 4ZQEA 2GK6A 3TLCA 3FWYA 2AFHA 4HQ6A 1EAYA 4U2BA 4PE5B 1FLAA 1UBMS 1U9IC 3IHTA 2WPDA 3KSRA 5P8WA 1N5JA 1YR6A 4LXUA 3K05A 4OGGA 1YMVA 2B7CA 1DKLA 1O77A 1QLWA 2PLAA 4NJEA 3P96A 3CVWA 1RCTE 4HRXA 2WMOB 1GR1A 3OO1A 4GX2A 4EB0A 1PSZA 3QHAA 3DHNA 1OLSB 3PDWA 3PXEA 1MO2A 1N9KA 1GAJA 2BFNA 4QYWA 1ZNZA 1JHQA 4LYGA 4WZBE 2FUKA 4X65B 4I3HA 1DT3A 1GVNB 3PC7A 3PK0A 4CEIB 1HL3A 4POOA 3GFGA 1GXSB 3ASUA 1YTLA 5IN5A 1XPOA 4B76A 3E8SA 1GGVA 3BMNA 2BTOA 4U2EA 5TDHA 5IWCA 5EKUA 2JL1A 3FJOA 3VBEA 4WZZA 3W77A 3RYHA 2G76A 3OE1A 4L9AA 3PCRB 4Y7DA 1MQAA 1FQJA 2JI4A 1Z2DA 2QAGA 1H2HA 2R1ZA 3M83A 4PW0A 2AT1A 3NTQA 2FZEA 2C5FA 4BPBA 1O3YA 3VOAA 5CFMA 4L85A 4K3UA 4HDCA 1RAGA 4IS2A 3CZ5A 3PTZA 4BVLA 3RF7A 4J1TC 5LJLA 4LJKA 4WINA 1RJDA 1Q15A 2OV1A 4KUHA 3D3WA 3PWKA 1DIRA 3FKJA 4Z4IA 4OHKA 5KNDD 5JNRA 1XQWA 2K5UA 4O4LF 1DOHA 4NOJA 4F1WA 4BU1A 1UBSB 3Q1LA 4OLJA 3MLAA 2BFDB 3PNQA 4CLXA 1P5JA 2EFDB 4LECA 2GD6A 4NENB 4LHYA