4HFNA

X-ray crystal structure of a ternary complex of double bond reductase from nicotiana tabacum
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
341
structure length
331
Chain Sequence
AEEVSNKQVILKNYVTGYPKESDMEIKNVTIKLKVPEGSNDVVVKNLYLSCDPYMRSRMRESFAPGSPITGYGVAKVLESGDPKFQKGDLVWGMTGWEEYSIITPLFKIHDKDVPLSYYTGILGMPGMTAYAGFHEVCSPKKGETVFVSAASGAVGQLVGQFAKMLGCYVVGSAGSKEKVDLLKSKFGFDEAFNYKEEQDLSAALKRYFPDGIDIYFENVGGKMLDAVLVNMKLYGRIAVCGMISQYNLEQTEGVHNLFCLITKRIRMEGFLVFDYYHLYPKYLEMVIPQIKAGKVVYVEDVAHGLESAPTALVGLFSGRNIGKQVVMVSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Allyl alcohol dehydrogenase
publication title Biocatalytic Asymmetric Alkene Reduction: Crystal Structure and Characterization of a Double Bond Reductase fromNicotiana tabacum.
pubmed doi rcsb
source organism Nicotiana tabacum
molecule tags Oxidoreductase
total genus 107
structure length 331
sequence length 341
chains with identical sequence B
ec nomenclature ec 1.3.1.102: 2-alkenal reductase (NADP(+)).
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hfnA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4hfnA01
2D8AA 2YHIA 4ALIA 1FDWA 3GVHA 1VKNA 1TB4A 4OOFA 3WQQA 5LCXA 2E48A 1PJ3A 1NP3A 3VPGA 4D44A 2ZK7A 1DLIA 3ORFA 4CM6A 3QVWA 4W9NA 4OSPA 1N92A 4BQRA 3GDGA 1E5LA 2Z1NA 2QQ5A 3KOUA 4E4YA 5MDHA 2C2XA 1MC5A 3GA0A 5A9RA 4BO6A 3Q3CA 1DSSG 4NK5A 4CQLB 5A03A 4R16A 1AUPA 1U1IA 1X15A 5HTOA 3UCFA 1N5DA 1A72A 1D8AA 3K2BA 3QVOA 3KBOA 2HKIA 1LDNA 3DBLA 4BNMA 3PJEA 4YACA 3DHEA 1HF3A 4CM8B 3ZWNA 4NBUA 4DQUA 3NEPX 3Q9NA 2NVUB 1P3DA 1QG6A 4XYEA 5G0TA 5A9TA 1YO6A 5GZ1A 3ANMA 2J3JA 4XEHA 2JD0A 5EQFA 1ZSYA 1W73A 2PZLA 4ALJA 3D4PA 3GUCA 5JCXA 4PLYA 1AHIA 2CF6A 3KYDB 2VZ0A 4Y6RA 3JQAA 3ZWXA 5C7LO 2VTEA 4WCFB 4OXNA 2JFFA 1QV6A 1Y8RB 3HNPA 3MJSA 1E3LA 4UVEA 1ORRA 3LC1O 1UZLA 3JSAA 1DC3A 1RM5A 1J49A 3L6OO 4DL9A 5KTKA 3OECA 1EQ2A 1PS0A 1T2CA 3V1YA 4BGVA 3H6KA 2F00A 2RBEA 3BAZA 1EDZA 1GYQA 3ONFA 1TT5A 2J8ZA 1ISMA 3C1TA 4RV9A 3RBZA 1X7GA 1JKIA 2C82A 3ULKA 4XDYA 2Q3EA 4BIIA 3ZHZA 2X58A 2PA3A 5F5NA 1YB1A 3CUKA 3BXXA 4QFDA 4I5GA 2ILTA 2EW8A 3D7LA 1OFGA 3FNGA 4BNGA 2OMEA 1ZK4A 3VTFA 4FDAA 1EEHA 3RU9A 3JQ8A 3RFXA 1V3TA 3KLPX 1UDAA 2V65A 1JWBB 4GSKA 3PHJA 4O5OA 1GZ6A 3PYXA 4GI2A 1M76A 1OI7A 3NT2A 1E3IA 3C7DB 4FR5A 1R66A 4GGPA 2QHXA 5TT1A 2I3GA 3SC4A 4BMSA 1JKJA 2X22A 3QVTA 1HRDA 4Z0HO 2GZ3A 2NQTA 1KERA 1JLLA 4CV0A 2Y1DA 4HP8A 1GAEO 3JQFC 1LDBA 5DCUA 3LT1A 1I2BA 1LLQA 4KUHA 4TKMA 3LLSA 2HRBA 4CUJA 4EJMA 2YFQA 2YW9A 1A9ZA 3PGJA 1NBOA 3E18A 3JQEA 3H5NA 2XPCA 2CY0A 4XRRA 1U7TA 1BHSA 5L7TA 3F3SA 1WDLA 4IDBA 4A2CA 1RYEA 3HB5X 4TRJA 3AFMA 3TN7A 5KJCA 3UXYA 1E6EA 4BNXA 1DLJA 4P8RA 4PG4A 4BUCA 1Z75A 5JY1A 4J0FA 4DUPA 5LC1A 2W90A 4J2HA 4WLUA 1K5HA 7ADHA 1D4FA 1NPDA 1HE5A 1HDGO 1LSUA 3W4KA 2JJYA 4XKJA 2AXQA 3DZKA 4YA6A 3ZU3A 4BNNA 1H6AA 4QO8A 3IOYA 2VUSA 3IDSA 1ENYA 2Q2QA 4NBWA 2NU8A 2B35A 3UCEA 3UUWA 1NQTA 1PZHA 3K30A 5GMOA 4Q3AA 1ZEMA 3QWAA 3FTNA 5JMPA 4LMPA 1A27A 5JPIA 4NFYA 1X0XA 3PLRA 1ID1A 4TROA 5CG2A 3ROPA 1NFQA 4LK3A 3D3WA 2FR1A 4HWKA 1XQ1A 1P44A 1DJNA 3I5MA 4L73A 4R3WA 4YYZA 3ON5A 5BR7A 1NVGA 3ZW8A 1ADBA 3QP9A 4JCOA 4RO0A 3RCBA 2VYVA 4NIMA 1NFFA 2X9VA 4K9DA 1C0LA 4XA8A 4C4OA 4S3MA 3ZNPA 4IDCA 1RM0A 4YAEA 1VE9A 1AXEA 1YDWA 2EHDA 3Q0EA 4NDNE 1HT0A 3QWIA 1E6WA 2P4HX 2VN8A 5G4KA 3V1UA 1U8FO 2PR2A 3W8DA 2X0JA 4OGWA 1MG5A 3PEFA 4IDAA 4HFRA 4IGEA 1C1XA 3RWBA 3HWRA 1B2LA 3BHJA 1EVJA 2X5KO 1DFIA 4TSKA 3GUYA 1MG0A 4ND2A 4G2NA 5COAA 2NWQA 4YRAA 1U5CA 4L8VA 2WYWA 4FPXA 4WLVA 5G0UA 1O6ZA 3VDQA 5ITVA 5A3JA 2EW2A 4BGIA 1IOLA 1E0DA 4RF3A 3GT0A 3DZHA 1BSVA 1SCUA 2WEKA 3DBLB 3MJCA 1QLHA 3GY0A 4ALKA 1O89A 5TC4A 4TRMA 2C07A 3LK7A 4FFMA 2D5CA 5G0WA 5AXCA 2C5AA 4KMSA 1PJCA 4AG3A 4D3DA 2W2KA 4GX1A 1R4MA 2OBNA 2Z5LA 3PTZA 1P1IA 1NHWA 3UKOA 3GN2A 5DP2A 1SZJG 3DB2A 1U4SA 2J6IA 3JQAB 1HTBA 2JHFA 3H9JA 3I1JA 1GDHA 2B83A 3FD8A 1I2CA 3DC2A 1BVRA 1GUZA 2O3QA 5JDCC 3WWYA 3ZWCA 1XWFA 1ZH8A 5IG2A 5JO0A 2C59A 2NACA 3BMOA 3JQBC 1YL5A 4M49A 3V2GA 4ZQFA 4Y8VA 3DMYA 3IP3A 4RVDA 3VZSA 3INTA 1LC3A 1WNTA 4E0BA 3DFZA 1TT5B 1GZ3A 5B4TA 3PIIA 4KWHA 4DIOA 5L4SA 3U4CA 5KJ1A 3UGKA 4Z6KA 1ISGA 2QG4A 3DO5A 1J0XO 3B6ZA 2FZWA 3IC5A 3QWHA 4ONEA 4D3FA 2AEJA 2P91A 2IXAA 3JD2A 4W7HA 4BMNA 2Y93A 2FP4A 3ZU2A 1GZ4A 3JQ8B 4L4XA 1X7HA 1UP6A 3RSHA 2DUWA 1G1AA 3KYCA 3BMQA 4PZEA 5DBIA 3K96A 4YAJA 4XQ9A 1ZW1A 2DBZA 3WNQA 4OIMA 1LU9A 4E12A 1L7DA 2PGLA 2D3TA 2EG9A 3C24A 1ML3A 3WGZA 3E9MA 3TNLA 3VH3A 1U7HA 2AMFA 4QEDA 3RBXA 3GQVA 1DB3A 1SB8A 2DLDA 4L75A 3G79A 3DMTC 4R9SA 1WDKA 2IZZA 4BO3A 2DTEA 4F6LA 4DXHA 3KYBA 2C2YA 2BGKA 3F6YA 4J1QA 5CPFA 4PG8A 5ADHA 1PS9A 5T5QA 4MVJE 1SMKA 1Z7EA 4Q3NA 2Y1EA 1TA4A 2QRKA 4L4RA 4WASA 3RU7A 2OGUA 4IJVA 4UVDA 4L0QA 1I0ZA 2C20A 5GZ6A 1PGPA 3GGOA 3NGXA 3OF2A 1JKFA 4ESOA 4YBZA 5FI3A 1DOHA 2VUUA 2BI8A 4Y98A 3RQSA 5L53A 3AY6A 2VYND 3DTTA 1U28A 3NTRA 1EBFA 3SEFA 5KJFA 2R6JA 3BTSA 1ZKMA 1GPDG 2AE1A 5ILOA 3OEWA 5A06A 3E5MA 2C0CA 4EJ6A 2HMSA 3ZGYA 2GLXA 2J5QA 1HSZA 5DN9A 3OETA 4ZJUA 5JYEA 2O3SA 3WGHA 1I36A 3ETEA 1T24A 3D3WB 1C3VA 4HX5A 1JA9A 2C7GA 4YT2A 4CLRA 3MTGA 5JDCA 5IF3A 1O8CA 3DOJA 1GQ2A 1HZZA 2G76A 4NFSA 4CMJA 4XX0A 5JC8A 2Q1WA 1SEPA 3DZFA 1HDXA 3QV1A 1LTHR 3KVOA 1GU7A 1KVTA 1CQIA 2CMDA 1E7SA 1NAHA 2ZB3A 1BW9A 1LBEA 1MLDA 1E3SA 4QXMA 1LSSA 1D7OA 4TKLA 3EK2A 3WG9A 3D4NA 3F5SA 1BVUA 3AUAA 1IHXA 4PCVA 3AJRA 1C1XB 4O1MA 4KOAA 4JJFA 1E7WA 1Y81A 2JAHA 5FI5A 1ISFA 1XKQA 2HK8A 3V2HA 2O50A 4RZIA 5LDGA 4E2ZA 5L4LA 2PGDA 4MDHA 4J2OA 3LQFA 1O95A 3LU1A 1V8BA 4CLEA 1A5ZA 1BXKA 2IDZA 2NVBA 1LLDA 4LRTB 2UV8A 4MVJP 1X14A 4WLNA 4XJSA 3E6AA 3X2EA 4JBHA 1XA0A 1JVSA 5T8KA 2O2SA 2FN7A 3RC7A 4M87A 1HDRA 5JO9A 3PQEA 1EE2A 1T2DA 5KCZA 3B70A 2W2KB 4NPCA 4Z3DA 1R4MB 2EXXA 4DLBA 1NX6A 4JQCA 4YT4A 5IZ4A 1JAXA 3IKVA 2GASA 2Z95A 1PR9A 4CPDA 1NTOA 4E5PA 5JDIC 1EMDA 4B4OA 1QYXA 2O2YA 4MO2A 4E5MA 1KEUA 4M8SA 1FK8A 2PK3A 2QW8A 2NADA 4E31A 1MX3A 1TI7A 5EINA 4EI2A 3T7CA 3BMCA 4CM7A 1P1JA 1C0PA 3WGTA 2VNAA 3M1LA 4BNJA 3TF5A 5L40A 2ZB7A 3BMOB 2Q1SA 2GN8A 3FNHA 1NQAO 2HSDA 2QZ9A 1LSOA 1Z45A 4H16A 3JD0A 3U49A 4CLHA 1ZBQA 4PLGA 1EQUA 1WP4A 4RVGA 1HXHA 1YBMA 1SBYA 4CMAA 4EDFA 4B79A 2PZKA 3TWOA 1JQBA 2EWMA 1KC1A 4BNZA 1KC3A 3EUWA 3FR7A 4EITA 1H5QA 1B8VA 3R0IA 5KWEA 2HK7A 1HEUA 1T4BA 3DHYA 1ZO8A 3KYCB 3BMQB 5HWSA 2AQ8A 2W8ZA 4RQTA 3T4EA 1GCUA 5JMWA 4FFLA 1U2DA 3FPLA 1T2EA 4TRNA 3JD1A 1FDTA 1T2AA 4QECA 3A28A 4IQGA 4XQCA 5C7IO 3UAGA 4ALMA 1UP7A 4GVLA 1PSDA 1ZIDA 2BFMA 4KP7A 3ICPA 4J1SA 4WOJA 4PGFA 3GNTA 3H5RA 5B1YA 3WQRA 2C5EA 3VC7A 1NR7A 2HQ1A 5H83A 4ZN6A 4IMPA 2AQKA 3JTMA 4DBZA 4I9UA 2GD1O 2VOEA 4R68A 2D5AA 3OBBA 5KVQA 1ARZA 1N1EA 3AI2A 1ZK1A 4OQZA 1LQUA 3UVEA 4UREA 4RF2A 4WCDA 5HA5A 4J9VA 4R9RA 4QSMA 2Q49A 1S7CA 3GRPA 4Z0TA 1EFKA 2Q2WA 2YQ5A 1FXSA 3KSDO 2RAFA 5DCWA 3JYNA 4U5QA 1GQQA 4URFA 3KLMX 2QYSA 4IZIA 3NGLA 3VAZA 2BFOA 3K9QO 3PK0A 5JDIA 4EEZA 4CJXA 1YS4A 1GFSA 2Z1MA 1ONPA 2B37A 2OFPA 4PG6A 4JBGA 3DFUA 3WDSA 4OXKA 1DBVO 3ZWBA 1JW9B 1NNUA 4PLVA 1E3EA 1PZEA 3GPIA 2I67A 4IM7A 4NHEA 4CLRB 2BFAA 4IINA 4ZHSA 4BKQA 5T67A 1XHLA 3IIEA 3WFIA 4FFOA 2B36A 4XCVA 5I8ZA 3GNQA 4E21A 1R0KA 3RUIA 2WD7A 3OFSA 5KJEA 1BW9B 2VT2A 3E8XA 4BKPA 1H2HA 3OQBA 4GLLA 2WSBA 1BGVA 1BRMA 2HJRA 3S55A 4RLSA 2QRJA 4E2WA 2ZTLA 2P9GA 4PRLA 2CZCA 3DAFA 3WB9A 1T25A 1P0CA 2JHGA 5IAAA 2HAEA 4E3ZA 1XIVA 3GGGA 3O03A 1XELA 3JYLA 5IJZA 4QFCA 5BSFA 1I3NA 5CHEA 4FSHA 4K1LA 5THKA 1YQGA 3ZV6A 5BNIA 4R1TA 3OIGA 4NBVA 3CE6A 2YJZA 5EMHA 3KRTA 3RC9A 2YY7A 4AJ1A 1XCBA 2CSUA 3HFSA 3IP1A 4BO4A 3JQAD 4R69A 3BIOA 5JLAA 2IYOA 3MCVA 3ZNQA 1HDCA 4XYBA 5I7SA 3VKUA 4R4JA 4YAKA 2FOIA 3BA1A 4JJIA 3QA9A 4ND3A 1DIGA 3ZWWA 1MP0A 3R1IA 1EK6A 1ENOA 4HV4A 1UXGA 3JQ6A 3KB6A 1A4UA 5TRTA 3NAQA 1AN9A 3CSDA 2ZTUA 5JE8A 3BMCB 3RC2A 4A5OA 4K26A 3VTZA 4PG7A 4DYDA 1KY4A 4FOOA 3QWBA 4K6FA 4UEKA 4KDFA 4CR6A 2DBQA 1C1DA 2GSDA 4H7PA 5EIOA 3GVXA 4D79A 2JCYA 5DCYA 4HADA 2GPTA 5ENVA 4DRYA 4P22A 4OMUA 4CLDA 3O4RA 2ZYAA 3EZLA 5EJ2A 1YBVA 2OO5A 4IJUA 2HMVA 4J7CA 3LSYA 1SNYA 1MGOA 1NM5A 3ICCA 4GAEA 4BNKA 4D0RA 1YQXA 4FQ8A 5FFFA 4A26A 1P1FA 3A1NA 1F12A 4F45A 4MPDA 5L45A 1Y7TA 3PJGA 1PZGA 5I7VA 2R2GA 2UYYA 3FPCA 3LZ6A 4XGNA 1HE4A 3D0OA 3FWNA 1H2BA 3JQ7A 3R3JA 1P1KA 4YJFA 3JV7A 1U9JA 2HJSA 3I9JA 1O9BA 1MUUA 2HO5A 3E5RA 4QUKA 5DBFA 3K6JA 2EERA 2WDZA 4MVJH 3EAGA 2GCGA 1YE3A 3RUAA 3TRIA 2VWHA 3I6QA 4GQAA 3RAJA 3RFTA 3LVFO 4LCJA 4UEJA 1N8KA 4BHTA 2AE2A 4Q3CA 3L4SO 5JFOA 3F4LA 5I8WA 4CV2A 5C5IA 3KM0A 1ADFA 4CL3A 3IJRA 4BQPA 4BKRA 4M1QA 3TPCA 2ZTVA 3A9WA 2QX7A 4XIJA 2Y1OA 4TZKA 3ADOA 4EUHA 3FNFA 1X1TA 3KV3O 4P4NA 1W6UA 2IODA 4KWIA 4MINA 2O3TA 3P5SA 5G0VA 2NV6A 1AGNA 3MWEB 2RH4A 4B7UA 1I33A 4CV1A 4HBGA 4JP2A 3GGPA 5JBIA 3VZRA 4XZ3A 2QYTA 2DU8A 2ZB4A 4YAGA 1ZNQO 4KUGA 4Y9DA 3HHPA 3AWDA 1KETA 3NDIA 3QW2A 2Y0EA 1LNQA 2PGJA 2ZATA 2H5LA 3L6EA 1K6IA 5F5LA 2VYVD 3E03A 1DJQA 3KETA 3UN1A 3KHUA 3MJVA 3IUPA 5TSDA 2W98A 4IS2A 4OH1A 3GRKA 5EL0A 3WGYA 3CZMA 4S1VA 1LRJA 1KVRA 3ZDFA 3F4BA 4GBJA 1VJ0A 1P1RA 1EUDA 1WAMA 1ZJYA 1RJWA 2I99A 4HFMA 3ZW9A 5ICMA 2B5VA 2WD7B 3WOHA 2GZ1A 3DHNA 2G82A 4XWYA 1PGOA 4JX8A 4RVHA 5BSHA 1A9YA 3IUSA 2YV3A 2B0JA 4WLOA 3MJTA 2X0RA 4I9HA 1LLCA 2D2IA 4PVCA 4RPHA 4EW6A 5IDWA 1DXYA 5DULA 2XOXA 3OH8A 4BO1A 1IY8A 2Y68A 4O0LA 4E2YA 1NFRA 4BL5A 5J23A 1DC5A 4IMRA 2JCVA 3I52A 4HFNA 1EBUA 3VZQA 1J6UA 5CEEA 4BB5A 4CMCA 1CQJA 4PLCA 3IAHA 4G5HA 4JBIA 1B14A 3ZWVA 2OORA 5KJ6A 4IDDA 1A4IA 1LQTA 3FBGA 2F1KA 2YQ4A 4D41A 1M75A 4NI5A 4B8WA 1TVEA 7MDHA 1GYPA 3A14A 2CDBA 5F1OA 1QRRA 2X9GA 4N54A 3GK3A 4XQEA 3VVCA 1YRLA 3DBRA 2V7PA 3EVTA 1HYGA 1F14A 1YJQA 1K2WA 3WWZA 3ZV5A 3S2GA 4GGOA 4ILKA 4E5NA 1PQUA 3FI9A 2V6FA 3H9GA 1KOLA 2PH5A 3RUDA 5T57A 4F6CA 4BNVA 1C1DB 2UAGA 3WMXA 4YB8A 4Z9XA 1LSJA 4NU6A 2O3RA 1OBFO 3I4FA 3K5PA 4XYMA 2G17A 4MVJI 2RCYA 4FB5A 5JAIA 4KQWA 4I5FA 1ZVMA 2BHLA 2VWGA 3KUXA 1SOVA 3OSUA 5THQA 3CZRA 3HB4X 3W6ZA 4GKVA 2EJWA 3NT5A 1DHTA 1X0VA 4WJZA 4B8ZA 2BGLA 4WLFA 4BMVA 1BMDA 5IDQA 1PTJA 1VLLA 5JCJD 2RHCA 5TJHA 3WXBA 5TNXA 1LXCA 1L7EA 1VKOA 4RLHA 2YZ7A 3M6IA 4H15A 2D4AA 4ROSA 1ZZEA 1CYDA 1H9AA 4E32A 1Q0HA 3ZZNA 1G0NA 1UXHA 3JQ7B 5B12A 3ST7A 4YJFB 3BMNB 1IL0A 1VPDA 4WE3A 1EVIA 1NPYA 4RVFA 2GGSA 4RZHA 4UUNA 3WTBA 4MKRA 5KNLA 4GWGA 3U5TA 4ND5A 1U8XX 4FFRA 4GH5A 3PZBA 4RF4A 1E77A 1LRKA 4RF5A 1UUFA 2J5RA 2PKQP 1KY5A 1PU2A 4MP8A 1ZK3A 2AQIA 2P9CA 1Q7GA 3FN4A 3U4DA 5BQFA 1K6XA 1O0SA 3AM3A 5EN4A 4HNGA 5G0SA 3U9LA 4AJOA 2CVQA 2R00C 3EDMA 4AJ4A 4IBOA 4YWJA 1YL6A 1U3TA 4IY1A 2HK9A 4K28A 2PH3A 1LRLA 3UHAA 3ZHXA 2HU2A 4ZRMA 3OHSX 1EUCA 3H2SA 3ANNA 1XQ6A 5ES3A 2EEZA 3R3SA 4RGBA 1XU7A 2ZKLA 3LC2O 4K6CA 4DVJA 5CDUA 4BGUA 4E5YA 2GR9A 5A5FA 3TOZA 3GMDA 4D45A 2VHZA 4YT5A 3SBOA 3W8EA 1E7RA 1NWHA 2PZMA 2IE0A 3K73O 2G5CA 2X86A 3TL3A 1RPNA 2V6MA 4EUEA 4LN1A 2GRAA 4GMGA 3KXDA 1U5AA 4OOEA 1I30A 3WGGA 4BKUA 3H7AA 4QTZA 5H82A 4A73A 1VSVA 2XF8A 4AICA 1H6BA 1F17A 4NBTA 3K92A 2PY6A 1YWGO 2ZIZA 5L3ZA 2VRCA 1YJ8A 3HUDA 4ZD6A 5FEUA 2EJVA 5T8KC 2O7QA 4KQXA 4O59O 4J49A 1X7DA 4XB2A 4RPLA 1DRWA 1Q7CA 3GHHA 5JCJA 3OMLA 3L0DA 4XJTA 5CP8A 1CWUA 1TEHA 4B4VA 5CEFA 1RM3A 5TQVA 5L7YA 1X13A 3OICA 5AQ1A 4YQZA 5JYDA 1YXMA 4DTIA 4DWVA 1PGJA 3PWKA 4YRDA 1XSEA 3RROA 3OJFA 4WPGA 4A7PA 1T1RA 4TMFA 3PHGA 1DEHA 1OC4A 1GEGA 4XQGA 2FR0A 4HKTA 2DPHA 5FF9A 2G1UA 4Y67A 3U0BA 1CETA 3CIFA 4DREA 1PGNA 3JQCA 1VM6A 5DBGA 3GEDA 3U4IA 3DBRB 3WLEA 3G49A 4CM1A 1UZNA 3S1LA 1H6CA 3PQFA 3PPIA 1I24A 3PWZA 1E3WA 2GO1A 3IS3A 4JN6B 4EJ0A 3C85A 1P74A 4PLPA 4FIZA 3LYLA 1G6KA 3MZ0A 4HNHA 1GUFA 2HLPA 5CEJA 4EEXA 1PWZA 3CINA 3COSA 2BMAA 3ITKA 4R5HA 4XB1A 2QIOA 3NUGA 4D43A 4AJHA 3I9MA 3TZHA 3KEQA 4CM9A 3RUFA 2R00A 3P7MA 4NQZA 4NR0A 1V6AA 2FZEA 4BGEA 3JQGA 4CMKA 5MGBA 5DZSA 2VWQA 4MVJG 1K3TA 4GSLA 1E3JA 1Q0LA 3C1OA 1DIBA 4ITUA 2P5YA 4LW8A 4IJWA 2VT3A 1DFHA 3UH1A 4HFJA 4JLWA 1IULA 3NJ4A 1WW8A 2CUKA 3DBVO 4G65A 2RIRA 4ZQGA 1LJ8A 3HDJA 4NZ9A 1QSGA 1R6DA 4OO3A 3AU8A 3NKLA 2P5UA 1VRWA 1AXGA 3SJ7A 2POQX 4IXWA 2CVOA 4FN4A 1I5RA 4B3HA 3CKYA 3WGOA 3BTOA 1N7GA 3IKTA 3SJUA 3JCZA 2Y1GA 5KIAA 2O3JA 2Y67A 1LX6A 2JCXA 3H2ZA 1DFGA 1ONOA 4XGIA 3ZHYA 1BWSA 1LDMA 3ZWMA 4MJLA 4U6QA 1UH5A 3Q2KA 2E6UX 3TFOA 2DBRA 1VSUA 3G3EA 1FDSA 5A3VA 5A05A 3PWSA 5CPBA 4ZGWA 5IDYA 3UCXA 1I10A 3JD3A 3AI3A 4CQMA 1XGKA 3PJDA 6LDHA 2IYPA 5G4LA 1E6UA 4CR7A 2NNLD 3PQDA 4EUFA 1AHHA 5AXBA 2A4KA 4X54A 2HMUA 3G1TA 3HJAA 1E1NA 3MJEA 3HE3A 4PZDA 1E1KA 1UZMA 2HCTA 1HDZA 3DQPA 1A7KA 3Q9UA 4CMEC 4FGWA 5TS3A 3PDUA 5A5EA 4YRBA 1Y5RA 2BGMA 3BHIA 3WBFA 1F0YA 4ZU3A 4RORA 1ZK2A 2UUOA 2CD9A 3H3JA 4QO7A 2ZCVA 3P19A 3RJ9A 2GERA 4LMRA 4C7JA 3DBHA 4DQVA 2WYUA 2IRWA 2FSSA 4TZTA 4YR9A 3VH4A 4FJ2A 4TWRA 1QMGA 3DL2A 1OZAA 2FSVA 3PJFA 3Q6IA 3RKUA 3VH1A 1R4NA 2FMUA 4J6FA 3LC7O 1BXZA 3KSUA 4CM3A 4IXTA 4DMMA 3VHRA 1UXKA 4JROA 3UICA 3DOCA 1S6YA 2HMTA 4U7WA 2QRLA 3E82A 4R1UA 5K9ZA 3ZNOA 4DIFA 3GZNA 4MIEA 1QKIA 1H93A 4FJ0A 4FD3A 3HDYA 3N58A 3ZWOA 2O4CA 5A4DA 5AXDA 3FBTA 4XD2A 5AXAA 4I8XA 2DM6A 2PTGA 4OSOA 2X6TA 1YH3A 4M89A 1YGYA 1DC4A 4NNJA 4R01A 1MC4A 1U3UA 1BXGA 4J3FA 2YFHA 3QE3A 4KUEA 3BYZA 4OXYA 3MWDB 5HBRA 1YB5A 3RI3A 3HSKA 4BNHA 3ANLA 1Q7BA 1GYRA 4RPJA 3GR6A 3S8MA 2X5JO 1GUYA 1R37A 1R16A 1ZXBA 3ABIA 3AI1A 3RUEA 4OAQA 1R0SA 5ILGA 1QYDA 5K6AA 3ZI0A 1DC6A 3AK4A 1YBAA 3TSCA 3GN1A 2NU9A 3WICA 3ZCXA 4I08A 3F9IA 1JN0A 3RJ5A 3QJ5A 4FGSA 2OBYA 4ZQEA 1M6WA 2FR8A 3GDFA 4BV9A 3SX2A 1V3UA 2BFPA 1E3WB 4ID9A 3KEOA 4NU5A 2OZPA 1Y8QA 2DC1A 4YQYA 1HZJA 4UUMA 4U8GA 5BSEA 3L4BA 4LCEA 4MIOA 1FF9A 4DC1A 3WMWA 3OA0A 3NDRA 3WSWA 2UUPA 1WMBA 1K6JA 1G0OA 2X4GA 3ENKA 4I9NA 4JGBA 3DWFA 3FF4A 4DIBA 2DTXA 3W4IA 4LGVA 4MP3A 3JQGB 1PWXA 1PZFA 2DKNA 3JQ9C 2E4AA 3NT4A 3RIHA 4PRKA 3WYEA 1R0LA 4CMEA 3QQPA 1P9LA 4YJDA 6ADHA 2O4UX 2IEDA 2AHRA 3PI7A 4PZCA 3FRJA 5KVVA 4EBFA 1UR5A 3K2EA 2I65A 4U0KA 4Z3KA 4ZICA 4IQ0A 3QRWA 1YDEA 4NMHA 3PLNA 4MKXA 2NU7A 3HFGA 4OKNA 3DZIA 3ZHBA 3VH2A 4CM5A 4WKGA 5HM8A 3FSRA 1RKXA 1UP4A 3MJ4A 1R12A 2V6GA 1XEAA 2PV7A 8LDHA 2ZCUA 1WZIA 4OHUA 4OJNA 5BSGA 3AM5A 5B4UA 5GZ3A 3U09A 4BOYA 4BNFA 2HMWA 3ONEA 5HS4A 1HE3A 4N7RA 4A0SA 2AG8A 1SPXA 2EKQA 1EVYA 4BNWA 3O38A 1CIVA 5B4VA 2AEMA 4DQXA 4TRRA 3DZGA 3D3EA 3UOGA 1B15A 1DAOA 3I9OA 4EGFA 4CQMB 2UDPA 1J5PA 2O23A 4XR9A 2A92A 1VC2A 2EKLA 3AY7A 4HXYA 5KVCA 3BTVA 4E13A 3VOSA 3V1TC 1I2ZA 1B3BA 4G81A 3ZWYA 2J3IA 2IZ1A 1IUKA 5IN5A 3W8FA 1RYDA 1UDCA 3VVBA 1DIRA 4Q3DA 4KTVE 1UXJA 1CEQA 3A06A 3PZRA 4BO9A 1IB6A 1Q2XA 1J4AA 1R15A 1MFPA 2VCYA 4ND4A 4YCAA 4QQRA 4YXFA 3GEGA 3HN7A 2EP7A 1OMOA 3AUUA 4P4LA 3W4JA 2IXBA 3V5NA 3EGOA 1KBZA 4B4WA 1B16A 4AVYA 5T64A 3DBHB 4D0SA 4XRGA 2WTBA 3RFVA 1NAIA 3OA2A 3W1VA 4A27A 3HZZA 3H8VA 3JYPA 1R4NB 3B1JA 3JYOA 1PEDA 1JU9A 3H3FA 2BD0A 4O63O 2JFGA 4J0EA 3TZKA 5C7OO 1PS8A 3HQ4O 5DDIP 5DNAA 2PD3A 2UVDA 3D64A 3C3XA 3GZNB 4RJTA 5IXYA 1HWYA 1D1SA 2WYVA 4A10A 1T26A 5L95A 4FOSA 5F21A 1EZ4A 1ISHA 1HLDA 2I76A 3RBVA 4AL4A 2Y66A 3DONA 3JQ9A 2A9FA 3WR5A 1CERA 1PJSA 2D1YA 3C1AA 4R3NA 2XAAA 1I8TA 2O7SA 5TIIA 2EGGA 3F46A 1BDBA 5L51A 1HETA 3GHYA 1BXGB 2X1HA 4CMIB 2JL1A 2NVWA 1Z73A 1JVBA 1MFZA 4DGSA 1A71A 1XYGA 3GC6A 1YONA 2X23A 1E1LA 3O8QA 2A94A 1CF2O 2BKAA 3JD4A 1ISJA 4OM8A 1MV8A 3G17A 3MOIA 4XR4A 3QWFA 1DIAA 4MIYA 1MXFA 2V6BA 1U2GA 4J16A 4UVIA 3LT2A 3ETGA 1ZMOA 3AUTA 3E9NA 2DBVO 3OQ1A 4O6VA 1DRUA 1VL0A 4R1NA 4TVOA 3CTMA 1Y8QB 4L9RA 3RUHA 4F46A 1WVGA 4B4UA 2ZYDA 4W7IA 4MVJM 4U6SA 2YYYA 3PYLA 1QYWA 1HE2A 2J3HA 5CG1A 4PLWA 1K89A 1KS9A 2DVMA 1U3WA 4H3VA 3B1FA 3WYBA 3WSVA 3WIDA 3ITDA 1T2FA 4M86A 1U4OA 2WE8A 4UUPA 3DAPA 3ETDA 4Q39A 4Z0PA 5L7WA 5JS6A 4N5NA 2W2LA 4OL9A 2NTVA 3ZV3A 2E37A 2Q2VA 3O26A 1KEVA 4FC7A 3H9EO 2Y99A 1PX0A 2NLOA 2VOJA 3G1UA 1P1HA 3RVDA 1E7MA 3GFBA 1LUAA 3DZJA 2B4TO 3EC7A 2WWRA 4HY3A 4RQUA 4UULA 5TX7A 3TZQA 3VZPA 1TT7A 3HG7A 3R6DA 4IJKA 1YKFA 3GNSA 1NWCA 1SC6A 1JDJA 1PGQA 1VJ1A 1DHRA 1GEEA 4Q9NA 5COBA 1U3VA 5HS6A 4EYEA 3F1LA 2PZJA 5BNFA 3C8MA 3OJLA 5IZCC 1I3KA 3RKRA 1VJTA 2FPGA 3D5QA 4J1NA 4PFJA 1QYCA 4TQGA 5I9LA 5A02A 1KEWA 4FW8A 3T4XA 4L74A 3ADPA 4AJLA 4LVUA 1HYHA 2JD1A 5AVOA 2Q1TA 2AG5A 3BZUA 3WFJA 4B7CA 1W4ZA 4CL8A 4IS3A 4MVJD 1QV7A 2Q4BA 2E49A 3S2EA 4I5EA 4TVBA 4NG5A 2EV9A 2LDXA 2BRUA 4E6PA 1I32A 4Z9FA 2PNFA 2YDXA 3M2PA 4NBRA 4BO8A 3CH6A 5C37A 1IPEA 4LSWA 4Y6PA 3X2FA 1FJHA 4JXKA 3LF1A 1AE1A 3OJOA 1EK5A 2DFDA 3PHIA 3TDKA 1YQDA 4D3SA 1SOWA 4RPGA 5U9CA 3HADA 2I66A 1CDOA 4IDEA 2VZ9A 5DT9A 1F06A 3L9XA 1L1FA 2Y05A 2P2SA 1N9GA 4OQYA 3OJ0A 4AJPA 4D42A 4YPOA 1DPGA 2PLAA 2BLLA 1MXHA 4NK4A 1VI2A 4ZQHA 4AJ2A 4F3YA 1QORA 2EF1A 2EIHA 3C7CB 4HUJA 3GF4A 3JQDA 4DPMA 2TMGA 3H65A 1DIHA 3GVIA 2XXJA 4DLLA 1CRWG 4UEOA 2Q45A 3ZWAA 1B0AA 1UDBA 3AY3A 2VZ8A 1IHYA 3OQ6A 2X0IA 1H6DA 3DR3A 4WLEA 1IYZA 2NU6A 2VRCD 4J4HA 1NQOA 3UF0A 3ZWPA 2WE7A 2I6TA 3AM4A 4RDIA 5CFZA 3LT0A 1GD1O 5BNTA 4BO5A 3W6UA 1T1SA 1HDOA 1NR1A 1XDWA 3D1LA 1BTOA 3PFWO 4IQ8A 4CM4A 2EKPA 4WUVA 4Y6SA 5TJ9A 5HRUA 3C7AA 2BELA 3CMCO 5LDHA 4BNUA 3K8ZA 4JK3A 5F1PA 1LA2A 1ULSA 4CV3A 3I3OA 2GUGA 5FYDA 5COQA 3GG9A 4YAIA 3TZCA 4PLZA 4RVSA 1QXSA 4IUYA 2YHIB 2GN9A 5F1KA 3EMKA 4NJMA 3I83A 3GFGA 1H94A 4R54A 1YL7A 3GVCA 3WNVA 5IN4A 5DP1A 1E5QA 3EZYA 4YJGA 3A4VA 5ICSA 3O8QB 1EE9A 2NM0A 4M54A 4NJOA 1D1TA 1ADGA 1W8DA 4DA9A 2OUIA 3WJAA 4DBVO 5IZCA 9LDTA 2HDHA 4LVCA 3KTDA 1Z74A 2JD2A 3NTQA 3M1AA 3L77A 1MB4A 3U3XA 2D59A 2FY8A 4MVJA 4W4TA 3GZ4A 3QLJA 5DOZA 4MKZA 5EERA 2ZB8A 3FHLA 1UAGA 1DDOA 3FCOA 2VTDA 3GG2A 4CM9D 2DT5A 4DPLA 3UW3A 1F8GA 2H6EA 5TT0A 5EQDA 2NUAA 4CMBA 3WGIA 1GV1A 2DUUA 1W0CA 3JQFA 2DAPA 1NVMB 4R1SA 4WECA 5I7EA 3TJRA 3OIDA 3AUSA 1PJ4A 2ZJ1A 2C29D 4INAA 4PN3A 5TF4A 3HDQA 1PIWA 3VPHA 1SO8A 2Y0CA 1EVZA 3QVSA 4J9UE 3NX4A 1PQPA 3IJPA 3VKVA 1UXIA 2GDZA 2X9NA 1YB4A 3GOHA 3SXPA 2I3AA 1OAAA 3ASUA 3PIDA 2VHVA 4GWKA 1GQYA 5T6BA 1A7AA 2GN6A 2VHWA 3GMSA 4IGFA 1ONNA 4WOKA 3RD5A 1GCOA 3WGQA 1GY8A 4GVXA 4DPKA 4WGGA 2X8LA 4J4TA 3N7UA 3PP8A 1PL8A 4BV8A 4BNLA 2BF7A 4JP3A 1K0UA 2WJPA 3TL2A 1DO8A 1XR3A 1PL6A 1KVUA 4ZQBA 4DYVA 1PJQA 2EGHA 3WBBA 4LISA 5ENDA 5KOIA 2Q4EA 3H9UA 3INRA 2OP1A 4Q3BA 2CVZA 2J3KA 4RL6A 3U62A 1ZMTA 4GX5A 3QSGA 1FDUA 2ZTMA 2W4QA 3F5QA 3GEMA 3V8BA 4CQMD 4KTTE 2H63A 1E7YA 3CEAA 5ITWA 3SVTA 1KEPA 2P9EA 2OXIA 2ZYGA 4YJHA 4CMGA 2VRBA 3B20A 3I9LA 2CF5A 4L4SA 3GAZA 1P0FA 4CMHA 3I6IA 1P33A 1ZK0A 5CDGA 2AA3A 3L6DA 1FMCA 4XYGA 4U0JA 3B1KA 3LT4A 2Y1FA 3QVXA 5CAEA 1KVQA 1C0KA 3U4HA 4EZBA 1N1GA 2EP5A 4BO0A 5DOVA 2Q1UA 4FS3A 4B3IA 5A9SA 1EUZA 2J5KA 3MOGA 1B3RA 2CFCA 5ER6A 1ZFNA 2DFVA 2OOSA 1VL6A 5DF1A 1X1EA 1Y9EA 2CDCA 3ROMA 2B4QA 3WS7A 2QZZA 2GNAA 1N9GB 3EYWA 3QY9A 4DMLA 3RUCA 1ZJZA 5JSFA 1NXQA 4UVGA 4B3JA 1ISIA 3PRJA 2YDYA 3T7EA 3WX0A 2PD4A 5JAMA 4BO7A 3PGXA 2BH9A 5TLSA 1ENZA 1HL3A 1UJMA 1LI4A 4PIVA 1NYTA 4P4GA 1Y6JA 1Y9AA 1M2WA 2P4QA 4IDFA 4E2XA 4CLOA 5L4NA 1GV0A 3MEQA 5IDXA 3NV9A 3I9NA 1TXGA 3ROKA 5CDTA 1ZEJA 1GADO 4PLHA 4CM4B 3PXXA 1B7GO 1HKUA 2O3UA 2JKVA 3VPFA 3EVNA 4JJGA 1WPQA 1HLPA 3OP4A 3DEYX 4IPTA 5G2OA 1P77A 3WTCA 4BKOA 9LDBA 4WNCA 5K6AC 3WJ7A 2WD8A 3EY4A 3FNEA 3FTPA 3WQSB 3JQBA 3SLGA 1NPTO 4QX6A 4C7KA 5JY6A 1Y5MA 3BTUA 5JAZA 4NJMB 3SLKA 2A35A 5JXWA 3OM9A 4W99A 4J90A 2IZ0A 4YJGB 5I9MA 5G4KB 3IQDB 1I01A 1IZ9A 3INGA 2GF2A 2VHXA 3L4BC 3I9KA 1BDMA 1ZSVA 5JW6A 5K1SA 3CXRA 3PVZA 2P68A 2ZQZA 5U1PA 4BNTA 1H0KA 2JAPA 1PJTA 4CUZA 4UVHA 3NDJA 2AEFA 3N74A 4A03A 4P38A 4R51A 4CUKA 4J4BA 4AFNA 1PQWA 1N2SA 4RCVA 1IE3A 3PHHA 4YTEA 4WCFC 2BI7A 2IEBA 3DZBA 1F8FA 3M2TA 3NRCA 1NHGA 5U4QA 4CR8A 1PJBA 4AJJA 4J1TA 4GL4A 3STHA 4KDEA 4BVAA 4UAGA 1YOVA 3BHMA 1OOEA 1ADCA 2TMDA 3VPSA 2B4RO 3KZVA 1JAYA 2YV1A 3DMTA 1GL3A 5F3RA 1XLTA 1WXDA 1QR6A 3D5TA 1E1MA 1QYVA 3OJEA 4I5DA 3RC1A 3WIEA 3WLFA 3AFNA 1B26A 1EDOA 1JWAB 2DQ4A 4GX2A 3DAGA 2NSDA 3DTYA 4OKIA 1RM4A 4II2A 3TFQA 3KSZO 2OL4A 4WEQA 4J91A 4ALNA 4AJEA 2C7VA 5C3MA 4DLAA 2O48X 2RHRA 1Z6ZA 1QLJA 3UFXA 1Z7BA 4IIUA 4B7XA 3QIVA 5B37A 1O94A 3QHAA 3RASA 1ULUA 2PD6A 2X7HA 1C14A 2FWMX 2VYNA 3I4CA 3OEYA 1ENPA 3Q2IA 4WEOA 3TQHA 3SC6A 1PJLA 1C0IA 4E5KA 3FR8A 2PKQO 5JAQA 3NYWA 2PFGA 4UUOA 1GPJA 1E92A 1HDYA 2I5PO 1PL7A 4R5MA 2C54A 3BMNA 3PDJA 1DRVA 3P2OA 4CMIA 1P31A 2X5OA 5IXSA 2VUTA 1GTMA 5IFLA 4GX0A 1IZ0A 2JFHA 1CJCA 2GN4A 2H1SA 2HRZA 4YJHB 3GPDG 3ASVA 3Q11A 4PVDA 3H9QA 4FFNA 4JIGA 2WMDA 3E48A 1WWKA 4M55A 1MA0A 4FC6A 3ZU5A 1M67A 4I1IA 5KKCA 2FRDA 4II3A 1QP8A 1Z82A 4J43A 4R41A 4CQLA 2ZJ0A 2ZQYA 3DDNA 2AW5A 2SCUA 4QT0A 4LSMA 4XYLA 1NVTA 3AOEC 1UAYA 2YHUA 4ND1A 5A9SB 2CNBA 3ROQA 3I23A 3FWZA 2NTJA 1WLYA 4ALLA 1LDGA 4CM8A 3EHEA 4WK6A 4W6ZA 2VNSA 3GAFA 4N5MA 2NVUA 2VQ3A 4PG5A 4BNIA 1LDEA 1N7HA 5A04A 4E33A 4NH4A 2GYYA 1OC2A 3GLQA 1FDVA 3TOXA 2B69A 4AJIA 1TLTA 3IL2A 3KYDA 1GR0A 3VDRA 4W82A 4WCFA 1Y8RA 3NTOA 5I9NA 2FPPA 3D4OA 4YDRA 3VPXA 1ZSNA 1BG6A 1ZXLA 2DPGA 2XXBA 3PYMA 4PLFA 4YVFA 3EW7A 1DAPA 4CLOB 3GH3A 5L9AA 1HYEA 4GMFA 3LF2A 2Y0DA 2I9PA 1SEVA 3E1KA 1YVEI 4NFHA 1WDMA 2YUTA 1D3AA 2NTNA 1T4DA 4GLOA 4FCCA 4LRSB 4CLXA 1LDYA 1E7QA 4J7XA 3JYQA 1SB9A 4FBGA 3NJ8A 2GZ2A 2WM3A 4W9NC 4L76A 4ZRNA 1I3MA 5EPOA 1O5IA 4YEDA 4ZVVA 3TZ6A 3AU9A 2CDAA 3HN2A 1IPFA 1SAYA 1LEHA 2E82A 2B5WA 1XG5A 1ZUD1 4GKBA 4BB6A 3PHLA 4RDHA 3GVPA 4J7UA 4WNIA 1M6HA 3H4VA 1HSOA 3Q1LA 4BNYA 3F47A 1KYQA 4D7AA 4XDZA 2ET6A 4RVUA 4Z9YA 4KZPA 1LC0A 3L07A 3S2IA 4OYRA 1KIFA 2PWZA 1RWBA 3ZU4A 1NQ5A 5EESA 1VL8A 3E9QA 5FWNA 5I7FA 3IMFA 3ONDA 2Y1CA 3AOGA 1LLUA 4AJKA 1KVSA 3H5AA 1M66A 4IDGA 5H81A 3DOOA 2Q46A 8ADHA 4FFPA 5GY7A 5ER9A 5K0ZA 2NQ8A 3GDOA 3DXFA 5TGDA 3HDHA 5KKAA 3OIFA 3G0OA 3F1KA 2H9IA 2VHYA 2LDBA 3P2YA 3ZNNA 4BS9A 1V0JA 3CMMA 4YT8A 4IZHA 5JC1A 1YOVB 2PKRA 5JNLA 2G0TA 2W2LD 4CODB 1I3LA 5CDSA 3AOEA 3L9WA 1PR3A 4ZA2A 5BT9A 2D0IA 3MTJA 1JTVA 4XGKA 4BO2A 3K31A 4N18A 3LLVA 3S2FA 2RH8A 1Q1NA 5AOVA 1B8PA 4E30A 4GPD1 2FPIA 3LDHA 1Y1PA 4MP6A 3ZN2A 1P45A 2OP0A 1PJ2A 1XU9A 3ENNA 4D46A 1EFLA 2FHSA 2DTDA 4MOWA 2X0NA 1V3VA 2HUNA 1B8UA 2Q50A 3AW9A 5AYVA 4MVJF 2OHXA 4DC0A 2VWPA 4IIVA 1ZCJA 4PLTA 3WYCA 3ZH2A 5KVSA 1V35A 4RPKA 5A1TA 2AQHA 3CPSA 1V9LA 3KO8A 4XIYA 4JNKA 1H9BA 4N5LA 5CDYA 3PFFA 4Q3EA 3V2UA 4FJ1A 1NASA 1Q0QA 4AJNA 1WMAA 1WZEA 3ZV4A 2Q99A 2YV2A 3O9ZA
chains in the Genus database with same CATH superfamily
4NBSA 2PPVA 1D5CA 3BJRA 2I3ZA 4U2CA 2D8AA 2F90A 4WDQA 3TRJA 3L2OB 4OI1A 2BEVA 1RLOA 1W6RA 4OOFA 3OLXA 3F49S 4G4JA 2E48A 3RTEA 1HA3A 5DKFA 3VNSA 3D5EA 3VPGA 3K0FB 1DLIA 2DEUA 1PT7A 3USCS 4D99A 3WAGA 1DAHA 4BC0A 1Z0KA 3HKCB 4LX8A 4GPBA 3GDGA 3WKCA 1KE1A 3PPYA 4U9HS 2Z1NA 3QBJA 2CMKA 4E4YA 2C2XA 3HRKA 3DLBA 3CKMA 4NK5A 3EXIB 2V1UA 1F2UB 1WKVA 1X15A 1ZGJA 3K15A 1A72A 2YVKA 1MJNA 4JIMA 2I1VB 4OAOA 3HXPA 3DS8A 3U48A 4C0KA 4EMTA 4ZYUA 1PNRA 4IOLA 2HKIA 1LDNA 4N65A 1XVLA 1Y82A 1G8AA 2A0YA 1LV8A 2LIPA 2WSYB 3LUKA 4IYJA 2HIGA 2WP8J 3WB2A 4BNMA 4BVBA 5ITZB 2J41A 1HF3A 4C0QC 1Q3TA 3TAXA 4IFIA 2PH1A 3OE7A 1Y1TA 4Z0NA 3BWBA 3HBNA 1P3DA 2ZE7A 4U3JA 1U1FA 4UZFA 1J20A 1M34A 2EDAA 4UBMA 5AK5A 4P7BA 3ANMA 3FDJA 1Q0TA 1ETUA 3BCRA 4XEHA 4US2R 2ZITA 3AJ8A 1P7ZA 2W2QA 1W73A 1G6Q1 4I55F 1CDDA 4ZAWA 2OVBA 5GONF 4XPIA 2YCBA 2EKZA 2RC6A 2Z8XA 4JUAA 1E99A 2ZRFA 3G82C 3K7EA 4NY1A 3RU2A 5AVZA 4WCFB 1A8IA 1BROA 1Y8RB 3K0AA 4B6JA 5DTRA 2IHYA 2FPPB 3BD8A 1DC3A 3QMPA 4DL9A 3CJTA 2R68A 5TDHA 1OYVA 3UT6A 3NW9A 4BWFB 2C0PA 2P7HA 5KTKA 5AKIA 5JVDF 3A1TA 4HVTA 4C0LA 4ICIA 3TCKA 3V9AA 3MG9A 1IOWA 2XT0A 4REQB 3RHFA 3FZGA 2BGRA 2QM8A 1EDZA 1W2GA 1TT5A 1X80B 2J8ZA 4UQOA 4CVNA 1ISMA 3CF4A 3ELUA 3LA8A 1UIMA 3IO3A 3C1TA 3DE3X 2ZJBA 3PE3A 1KYYA 2K7ZA 1NL3A 2C82A 3PCXA 2Q3EA 3EIFA 3RFCA 3E9CA 3H2GA 4BIIA 3ZHZA 2X58A 3IOMA 1G38A 5CFLA 3CUKA 4HNQA 4H35A 2EW8A 2O07A 4BNGA 4QHYA 3A8TA 4DLVA 1DKLA 5CT8A 2IPOA 3LPNA 3BD6A 3WL3A 5IAOA 4P3KA 4TXLA 1RXYA 1JMYA 2WSSA 1UDAA 3SE7A 3HUTA 1RTKA 4HDSB 3PHJA 1TJPB 3PYXA 3MXOA 2B25A 1E3IA 2RE8A 1SQFA 3C7DB 1A04A 2J5XA 4F3NA 4B6OA 4RH1A 2OGZA 1JLRA 2YJGA 5F52A 3VU3A 2GN1A 2J4DA 2X22A 5DSTA 2W2VA 4BE4A 1KERA 1TO1E 2X2FA 3V34A 4CV0A 5TVKA 2Y1DA 4HP8A 5JH7A 1GAEO 1AUXA 3JQFC 5DCUA 2ZU6A 4ZEOA 3LT1A 1Q0PA 1U2RA 3ORRA 2OFFA 4EHBA 7REQA 4J07A 1UBCA 4FSXA 2QLNA 1ZMBA 1GAJA 1LK0A 3DV0B 1GCGA 5J1SB 1LBTA 1Y5LA 2Q4TA 1XEWX 3PGJA 1AK9A 3ORYA 3HUUA 1RC0A 3EZGA 4MR8A 3JQEA 3ZCQA 1RWNA 4W5OA 5F9MA 5KHLB 1NNLA 5K99A 1RQLA 4PCAA 1U7TA 1C41A 1EJ0A 1K7EB 2QVYX 1UC9A 5CIYA 4CXMA 2OZKA 1GCAA 3HB5X 4IEEA 4TRJA 3U6BA 2HFKA 2EDCA 4EPWA 3PNSA 4I1VA 1TCBA 3H6GA 5BT8A 5CFQA 3SZ3A 4BUCA 5TQ0A 821PA 3OHMA 3R0ZA 2IJGX 2OZLB 5B1IA 2IYVA 5JY1A 2F1RA 1YIOA 3KBBA 4DUPA 5C4IA 1SXJE 2VJCA 4NZZA 4J2HA 3GP8A 1KSHA 3PT9A 2VDPB 7ADHA 6NULA 3AHEA 5J43A 3DE6X 4HH4A 1ESMA 1ZW6A 3ELYA 4QGAA 1OT3A 1CY1A 2JJYA 3GFRA 4MWCA 4NXNB 3AG6A 1T6XA 5IYZF 1Z34A 3GLGB 4QO8A 3C48A 4QFBA 3PEWA 1ENYA 4RA9B 3BICA 3A6DA 4NBWA 3U3MA 2K5UA 2H7XA 2B35A 2BFNA 2INGX 5CJPA 3WJ2A 3GXBA 1PZHA 1ZINA 3K30A 4ZKDA 2Q7XA 1GA1A 1ZEMA 2R1TB 3FTNA 1F9AA 3QWAA 4KN6A 4LMPA 5DM2A 2O8DB 2B8NA 4ZVKA 2FSFA 1X0XA 3MLAA 1O03A 2V45A 1TKAA 4YAOA 3ROPA 5K0EA 3ZZTA 3D3WA 2PU5A 4CF7A 2FR1A 1RXVA 5F9FA 1XQ1A 4YYZA 1ZJWA 4F4HA 4R3WA 4B3RB 2WP0A 2DWOA 3PD7A 4WKBA 3MUOA 3U0VA 3U7RA 2MIIA 3OOSA 1F4VA 1WRBA 5JAOA 1H69A 2J32A 4FCTA 1RM0A 3HCAA 4BVKA 1MAUA 4BX3A 4ZCQA 3QWIA 1BJTA 2OV4A 2AZMA 1SC9A 4WXEA 5JQGF 4Q4HB 1T0IA 3KWLA 3W8DA 1UFVA 5A4AA 4IDAA 4R8SA 3STYA 3WGNA 2DLNA 5EXTA 3EQ7A 3LBFA 1B2LA 1KORA 4KWCA 1EVJA 3E23A 1G21A 3K9HA 5HRCA 4YRAA 4BQIA 1A2OA 3FI0A 2WT8A 1N4DA 1FNSA 1VL1A 3EDOA 3DLIA 3WLSA 3FFBA 1ZNWA 3K70C 3W5JA 2CVHA 1BFUA 2D1SA 2ZRKA 1LS6A 1T3ZA 2ZYHA 4CG1A 4F5WA 1IOLA 4KQGA 2PNJA 3O93A 2WEKA 2W22A 3MJCA 1QLHA 4P7JA 4NMWA 1O89A 3SDZA 2AKYA 4FFMA 1BFDA 2VL7A 5G0WA 1L4UA 4QGBA 5HFNA 4BX0A 4C9BA 5JPDA 4C2UA 1USGA 2I22A 4GX1A 3AVYA 1UPFA 4JR0A 2F4NA 1ZN7A 3MC1A 1JHQA 1P1IA 1Z15A 3QOXA 2GNOA 2V9ZA 4MUMA 2HHLA 2D1FA 4IOMA 4PQYA 4XIGS 4EX7A 3FOFC 3DNPA 3DP7A 3GN2A 4XWKA 4RD0A 1J1IA 2VFAA 1ZM3A 2VIIA 3ZD9A 1Z6QA 3FLAA 3CKKA 3IMCA 3OQIA 5C46F 2IVZA 5HQTA 2PKXA 3JQAB 2VDKB 2ZCJA 2YJ6A 1VPVA 3EPPA 2XMSA 1D9ZA 3W8RA 2JHFA 2V6IA 3DG9A 3H9JA 3QFRA 5SZKB 3W2IA 4Z4HA 2PX8A 1BVRA 5JDCC 3TTUA 4F2GA 4F9TA 1E5XA 2KYRA 1XWFA 5BW8A 3ZKWA 5DGDA 1GQOA 2C59A 2WUDA 3L46A 5AJVB 3H8JA 1YL5A 2A5GA 5DLPA 1YU9A 3V2GA 1UPAA 1I14A 2MCFA 4OQQA 4Y8VA 4JI1B 1PHRA 4ISBA 3V3TA 4RVDA 1U0OC 1MHPA 4MLDA 4LWQA 3B2QA 4E0BA 2X8WA 3ZTYA 3DFZA 4EB6B 2Y9PB 3QXCA 1D2EA 3RARA 5DGIA 4MPRA 1ZCFA 2P2CA 3ZVMA 1ML4A 2H4XA 5HK8A 3V00A 5L4SA 3BD9A 1Y4UA 1J06A 4ZT4A 2X2PA 5BQOA 3TX6A 4G1BA 2UUCB 2F8MA 4PPNA 1J0XO 3WLHA 1SOAA 3IC5A 2WB4A 3ZU6A 1N2OA 4TYNA 1B8OA 4W7HA 1PI3A 2P91A 5AI6A 3T3GA 4RJKA 1JILA 4BMNA 3L1KA 2VSYA 3W9BA 2NSYA 3JQ8B 2RJOA 1X7HA 3DHVA 4L4XA 4QUDA 1F0KA 2D74A 4Z4CA 4L85A 2I7DA 3ZIUA 3K96A 4YAJA 4XQ9A 1EVQA 2YMLA 4IIJF 2HBQA 5DLQC 5BQPA 2OLEA 2REOA 5A0FA 3KOZA 3U81A 1X8XA 4AX4A 3T9CA 3IQHX 1RHUA 3C24A 4N1AA 3FTFA 3UYKA 5DW3A 1JLLB 4FU0A 4Y2VA 1FYXA 1S4QA 2B4YA 1XV5A 4QEDA 4M21A 4F3RA 1M1YB 3GQVA 1DB3A 1SB8A 2DLDA 3H86A 4L75A 5JASA 1E2JA 1U2TA 3G79A 3JPYA 4MKFA 4ZAXA 2OQVA 2PL3A 4H1TA 1YR9A 3GJ6A 2KWIA 4JJ8A 4Z4EA 1ECLA 3DMTC 4L57A 5B7GA 2A9KA 1JKXA 4Y1RB 2IZZA 4OK3A 2A0KA 1TA9A 2C2YA 3F6YA 5CX4A 3K35A 1NRJB 4PG8A 4RK0A 1JLMA 2E18A 3H83A 4S05A 3OD5A 5ADHA 2X0DA 1JB9A 1Z7EA 2Q4OA 1MMFB 2XHZA 5BV8A 1VMAA 3PXGA 5JARA 4WK4B 2BGTA 1GGVA 2WAXA 1XCPA 1SQSA 2NUBA 3IKJA 1KO7A 3FUWA 2GAAA 4IEFB 3BDAA 4L0QA 3GLFA 3I62A 1EP9A 2I4IA 1PGPA 4Q4CA 3NGXA 1M2VA 2YBEA 2FKNA 1JKFA 4US1R 3D4LA 4BLPA 1R00A 3I8OA 4FZJA 3RQSA 4C4YA 1OE0A 2ON6A 3ROFA 1GNQA 3AY6A 3SEFA 3SYNA 4YV0A 4MARA 3C3DA 3CVWA 4PZZA 5CXSA 1GPDG 2AE1A 3DULA 4LSGA 3OEWA 4LWZA 5GGXA 3RWOA 4EJ6A 3BRSA 3ZQJA 3HYCA 2H31A 1ESDA 5DN9A 3DVRX 5DHQA 3T3OA 4QWMA 2O3SA 4CI0B 3OSZA 4BLSA 4YRZA 2FFRA 2VBIA 1FTSA 1ESZA 2LW7A 4FI3F 4QULA 4YT2A 2C7GA 3UTDA 5JDCA 2FRDC 1O8CA 2NXCA 4YUXA 4C5BA 5ALWA 4QWWA 5G40A 1BQ4A 2VHTA 1PFQA 5SYNA 3EOAI 4J2TA 1BVHA 1SEPA 1D2RA 1T5HX 1T9HA 2QW0X 4PBRA 1ISPA 2BSAA 1KVTA 4EBBA 2YASA 4JUBA 1SXGA 5K09A 4CF3A 3FYSA 4QXMA 4XASA 2XZLA 2BM9A 3WY9A 4TKLA 3V4ZA 3EK2A 3WG9A 3F5SA 3REQB 1W5EA 4Y0NA 5P8WA 4V39A 4PYRA 1IHXA 2J4CA 3OFKA 5SICE 3ZKAA 2JJ1A 2DQZA 4DCTA 1C1XB 4KOAA 1E69A 1E7WA 2JAHA 4G0OA 4LAFA 2HK8A 10MHA 2R65A 4JH0A 4LEIA 4RZIA 3BWDD 4RV4A 3DVSX 5LDGA 2PGDA 5L4LA 4J2OA 4PPFA 3LU1A 1V8BA 3ZBPA 1DC7A 1VCMA 2GPBA 2JARA 4DJ5X 5EJ7A 1BXKA 1T9GR 2UZAA 4G97A 4HUQA 3EVEA 1DV2A 1KS2A 4MVJP 1X14A 4L9AA 4CGZA 3D6JA 3E6AA 1YNSA 1V11A 2DFPA 1N5MA 2WR8A 1K86A 1XA0A 2QRZA 2YMPA 4U63A 4DSZA 5IBRA 4CCYB 3TBHA 1YZLA 4M87A 1HDRA 3IEVA 1H2XA 5IH7A 4U5XA 2XNHA 3PQEA 5DISB 4JP5A 1DAGA 3R3HA 3RIEA 3B70A 1H4QA 1F48A 2O14A 4EGAA 3M5PA 4NPCA 4DLBA 1NX6A 4OQXA 3HL0A 1S9DA 4GOMD 1NVKA 3MGBA 4Q4AB 1COWA 2GASA 3SSOA 4CPDA 1TECE 2DPLA 2XA1A 4RE6A 4OJKA 2CZGA 5BNZA 1YKGA 4B4OA 2X2OA 5KTRA 4MUJA 1LH0A 4ZQCB 2YN2A 1EWYA 5CA0A 1P80A 5LMCA 1R8XA 3HL4A 3T7CA 1DC8A 4YGYA 4D9FA 4CM7A 1P1JA 2WNIA 1VCNA 4ZHQB 5AJXA 3TF5A 3Q8XB 2OSVA 3BMOB 4INOA 1CZNA 1PHPA 2GN8A 2QE6A 5SZIA 4RX1A 1Z6AA 4HSEA 4MKGA 4RD2A 4W8HA 1R0WA 2IE8A 2W70A 2R6DA 4H16A 3JD0A 3NUZA 3U49A 2G88A 2QL5A 4ZRDA 5JAPA 3IMEA 5EZYF 1ZBQA 4N5DA 4PLGA 5SZHB 1YMVA 4BFCA 2DH6A 2YIDA 1WP4A 4RVGA 3O8LA 4FMCF 5ALMA 4B79A 5JJCA 1W36D 2O0KA 3QMWA 5G1PA 4LQCA 3UMJA 1N2EA 5CCEA 5BWNA 1JQBA 3BMXA 1KC1A 4CE6A 2FVXA 4GR5A 1K8XB 5DV9A 3C98A 1THZA 4NLLA 3E7WA 2E4WA 5I47A 1SCDA 4YJKA 1U6IA 3HXOA 3DHYA 3KYCB 4E09A 3NHFA 3BMQB 4RIGA 2AQ8A 5HWSA 2VHEA 4IIYA 4XWOA 2O8CB 2CVPA 3T4EA 2VP6A 2OCDA 4FUQA 5JMWA 3VAYA 1ZD2P 2OCXA 3UMMA 1C4XA 4TRNA 3JD1A 5EZ6B 1YDFA 3L5KA 4U00A 2A1UB 4QECA 4BCCA 2BEWA 2ZT7A 4G8JA 1PSWA 5EXSA 4ZCLA 4MWOA 1L1EA 2NP6A 5ECGC 3A28A 2V3VA 521PA 5K0TA 3W5DA 5EIAA 3VR0A 5I7AA 3HCNA 4YJ3F 2WA2A 4QOIA 3KKMA 4OPMA 3Q8LA 1GKKA 1J7KA 1VTKA 4X20A 4Y2QA 3TUZC 1L4LA 1AGPA 4J1SA 5EEHA 3VX3A 3RW9A 3MTBA 2HEGA 4LF9B 1Z8NA 5G3ZA 1K63A 1WQ3A 5AIBA 1NR7A 3TQSA 3I01M 3LWBA 5H83A 4KW7A 2FG7C 4HAVA 2BCEA 5E2BA 2JI9A 3R9XA 2GD1O 3CR3C 4NDAA 1FMTA 2VOEA 4R68A 4EVSA 2D5AA 5CVVA 1WCWA 3VR4H 1HUQA 5BMVA 1N1EA 4QOHA 3W0LB 2PQ6A 2I7CA 1EXDA 1O8BA 2FRVA 2R8BA 4GBED 4NCXA 5EJFA 1EZ1A 1GU1A 1LQUA 1U1EA 4GW3A 5LM3A 2FPMA 4WH0A 2A8YA 3II6X 5BQ3A 1RJGA 1FE8A 4L3VA 1P19A 3WBKA 1VE5A 1NIPA 2Q49A 1JPUA 4RMNA 2YQ5A 3TDNA 2IBTA 1U0RA 1FXSA 2MJLA 3HEBA 5AJZA 3JYNA 3WWOA 4U5QA 4GRAA 3KOYA 4HQRA 4BLWA 4IICA 3KLMX 2QYSA 4MITA 3HABA 4IZIA 4DXAA 1OX4B 2QVGA 2BFOA 2W4MA 3B3AA 3PK0A 2PYDA 4Y7CA 2Z1MA 3BEDA 2QL9A 2PPLA 1ONPA 1FSSA 4CG2A 3DFUA 3L01A 5KYWA 4NV3A 5E6RA 2WQZA 2P4UA 1HQCA 2P69A 4XOUA 1JW9B 2P1RA 4PLVA 3NVKI 1URPA 1PZEA 4AF8A 1EUYA 3K16A 1VMEA 1GPNA 1S8FA 4CLRB 4IINA 1TYCA 1QUEA 3COZA 4X97A 1P4RA 5AW2A 3ZLUA 5LQMA 1OFHA 5T67A 3RS3A 4URXR 2FW9A 1CY2A 1XHLA 3PV0A 1RQ2A 5F7XA 2AF4C 3EODA 3GELA 1KXZA 5I8ZA 1OA1A 1FP4B 4BPBA 4JV5B 4M53A 2W00A 4X1YA 5KJEA 3HV0A 1QE3A 3LPCA 5LP6F 4QLAA 1BH2A 1H8HD 1H2HA 1IIBA 1NBMD 1QZTA 2PT5A 1BZYA 2WF5A 4GLLA 4YRCA 2W48A 5BR8B 2CXHA 4G1UC 3O4JA 2XDWA 3A4NA 1WPRA 5ADUS 4ZCSA 4OHYA 1BRMA 2HJRA 1VIAA 4E2WA 5FA5A 3KVRA 3GH1A 3LQRA 3LGSA 4R7ZA 2OY0A 3DAFA 4QTUB 2FLVA 4UPVA 2RG7A 4V3CA 1P0CA 2JHGA 3NWBA 4Y6OA 5BW6B 3WK4A 3X1KA 1Z4OA 4D9GA 2XUHA 3LX6A 2A88A 3O03A 4QPJC 5DM0A 1KYWA 3TFWA 5KU1A 5FPYA 4LGYA 1KIAA 2PWPA 5AW1A 1VECA 2ZS7A 4UTVA 5DO9A 5K0BA 3P0RA 4R1TA 1NN1A 2F59A 3L3BA 5HIMA 3UBTA 3CE6A 2NGRA 3KELA 2HRCA 3QG1A 4Z51A 3JWPA 4JI4B 4H17A 1XZMA 3KRTA 2X14A 2G4LA 1Q3KA 3T4PA 4HJXA 5HE9A 5IT0A 1IMOA 4IHKA 1IN1A 2W6CX 1FX0B 3TGPA 2CSUA 4IUCS 3TLGA 1JG7A 3JQAD 3BIOA 4R69A 4YAWA 5JLAA 2FPWA 1CB0A 1YGPA 2W37A 4P93A 3E8SA 3BEOA 4DUYB 1WCXA 1U4NA 3PPVA 1SH7A 3VKUA 2BBTA 4FB4A 4YAKA 1TTPB 1KRHA 1DTEA 1DG3A 3IV9A 1U8YA 2ZZKA 3ENZA 3PNVA 3Q87B 3QA9A 4UOEA 1ENOA 4HZGA 1EJ2A 1SIBE 4RHTA 3AI7A 3KB6A 4V0LA 4YO7A 1M2OA 1QVRA 2AYXA 4UXIA 4DIMA 5LFAA 5JE8A 2Z6AA 5BSKA 3RC2A 3SR0A 2O8EB 3VTZA 1NVUQ 3IP8A 1KY4A 1PQYA 2JEZA 2PSSA 4LK2A 3QWBA 4UEKA 3IHLA 2HD4A 3ZZ0A 1BE1A 2IYLD 1NY6A 3TLEA 1LJLA 1UMBA 5H3HA 2PBFA 3GARA 4GUAA 1OH7A 3GVXA 5C4GB 3LDGA 4RYLA 5DCYA 4ENVA 2EZUA 1TUEA 2Q5OA 3BFVA 2GA8A 1W93A 4P22A 3OU7A 5DYNA 4WKPA 5C1OA 3FWKA 5FHRA 4R8KA 2EL7A 1S2NA 3FUCA 2Z2IA 1YBVA 1NKTA 1V9CA 1E2NA 3KSMA 1Z0ZA 3PQ8A 1KI9A 3Q0IA 3COWA 2SHKA 4KGZA 1MGOA 4GXTA 4LBZA 3RG8A 4CTNA 3ONWA 4GAEA 4GD3Q 3USZA 1YQXA 3P1JA 4CU5A 5FFFA 3GQBA 5HQ3A 4F45A 5L45A 5AUQA 1SZPA 1KRWA 1MC8A 1O2DA 4JB0A 1CSEE 1YR3A 2P78A 4LNUB 1K4MA 3PJGA 3RSCA 2K4MA 3UYLA 4K7JA 3QVGA 3S1SA 1W19A 3VKWA 3U4MA 2R2GA 1MD9A 2UYYA 2JJ2D 3OKCA 3IYLW 3KJIA 3PUZA 3Q1KA 3D3KA 2OC9A 4XGNA 4LWPA 2DSTA 3FWNA 1H2BA 3TVDA 3JQ7A 1P1KA 1JHUA 3QF7A 4PAGA 1U9JA 3F67A 4ZI5A 5BN1A 1NTRA 2CJPA 3PXEA 3E5RA 3NIFB 4MWEA 4QUKA 2MR5A 2Y4OA 1ESEA 3K6JA 2PRKA 3LC0A 5K8IA 3EAGA 2GCGA 1U6KA 1YE3A 3GJTA 2VI5A 3REGA 2VA9A 2I34A 2ZSBA 3AHHA 4WSOA 2ZIGA 3RAJA 1AQUA 2F3PA 3GJZA 4JXXA 2RJNA 1EBBA 5JALA 3WGMA 4RDXA 3DXYA 4EI8A 1C4WA 1FS4A 2AE2A 2Z6UA 1T6BY 4R2KA 1AUQA 3ZGXA 1QONA 2AFIB 4I14A 5CXXA 3ZCPA 2A7XA 1MTZA 3KM0A 2EYQA 2DP4E 3MLBA 1N9KA 3PUVA 5J2TF 4BQPA 4UTPA 1BD3A 4M1QA 3TPCA 1G4UR 2IYSA 2ZTVA 3OPYB 2IX3A 5FPQA 1WSWA 3JX9A 3A3YA 4ZC8A 3WO1A 1X1TA 3CZQA 2PUFA 4L5JA 3ETCA 4AY6A 1N1DA 2NSJA 3L7CA 2R4UA 3T5BA 1U0FA 3NHMA 3IBTA 3P5SA 4LJYA 2NV6A 4G63A 4C6TB 3N0TA 5CGZA 1JEYA 3PUIA 4L0CA 3GI1A 3D2AA 2AK2A 2WKSA 4HBGA 4KQIA 4ACBA 4AKSA 4JP2A 5HKKD 3IAS1 4DSOA 2M98A 1RJFA 2GWRA 5JBIA 3Q98A 3SKXA 3HCBA 4YAGA 5A5VA 2AD5A 2DG2A 4TMYA 1H65A 4RGQA 4BFWA 4NONA 2FKAA 2QRHA 4NMXB 4S2UA 3T35A 3MJFA 4HQOA 4QARA 2Y0EA 3NZEA 2WUVA 4BQSA 1XI2A 5KQRA 1IJFA 2H5LA 2PQ0A 4IG4A 1W0KD 3Q12A 2XVAA 5F5LA 2AR7A 2DSNA 3E03A 4P5DA 3KETA 4RBNA 2B92A 1LPAB 5L3QB 1VQ1A 2EJUA 2PBRA 1WUIS 2QLFA 1ZOOA 1OXBB 1ULTA 2KB0A 3FMIA 3MJVA 3OTQA 4IS2A 4OH1A 4WQMA 1UBUS 2YVAA 3HVUA 1LPMA 1WSBA 4BFXA 1C1YA 3CZMA 4S1VA 4EDHA 4EO9A 2WVJA 2AN5A 4RESA 4G0VA 3W2FA 3LT5A 1P1RA 2IYEA 3KQSA 4IRUB 4NL4H 4ZYYA 1RJWA 3ZW9A 1G18A 2WD7B 3WIVA 1U80A 2G82A 2G5TA 1U2EA 2I80A 3ZHTA 3G7NA 1R0BA 4M1OA 1A9YA 2VCEA 5DH9A 1S1CA 4OHCA 1T6NA 1SCBA 1VIYA 2H54A 4WLOA 4MMYB 1D7AA 4I9HA 1YB2A 1A0OA 1LLCA 1USVA 3AW8A 4RPHA 5HJEA 2N46A 3EA0A 1XTQA 3GGSA 1BU5A 1DXYA 4JQZA 3L7YA 4WZ6A 5GQSA 4QG3A 3QE9Y 2HLHA 4O0LA 5K0SA 2P65A 5EIHA 5DGHA 3TW8B 1KMQA 1N7IA 1RYZA 2WIDA 4IMRA 3TNJA 1ZGCA 2V9PA 5IH3A 2JCVA 2RGNA 3I52A 3K1AB 4EKYA 3UWOA 2QZSA 1MTOA 3SZGA 3P97A 2R6R1 4GPIB 1J6UA 5CEEA 1TC1A 3FCSB 1TK9A 5DBHX 3PFKA 4PLCA 1A9SA 1LTKA 1TIPA 1WD5A 3UC5A 3WJ1A 3NBMA 4BUZA 3C8ZA 1E2MA 1G8HA 2QMZA 5CK5A 1X42A 5CX1B 1NUSA 3OLWA 1BEEA 1M6VA 4OQPA 1TOAA 3EVCA 2P4SA 1M75A 4NI5A 3BSFA 4X6YA 4MH0R 1TVEA 1YFJA 1I2AA 1GYPA 2NAPA 1K8QA 4CKEB 3A14A 4BGDA 4HYEA 2CDBA 2X9GA 3VVCA 1YIDA 4MB2A 2V7PA 1I7NA 4LDAA 1HYGA 5LKRA 1QTRA 3ER9A 1F14A 2ID8A 3P26A 1YUBA 3OKAA 1K2WA 3WWZA 5KNBA 2FZVA 1Y1RA 1Y6QA 3S2GA 1AKMA 1WABA 4E5NA 1PQUA 3ZHRA 3SZMA 4A82A 1CUAA 1D0VA 2V6FA 3A04A 3FI9A 3HKBA 3BJIC 4F6CA 2D3WA 4DJJA 3QPCA 2ZM6B 2UAGA 4Z9XA 4JVSB 4NU6A 1W35A 2JIPA 3K5PA 2UU9B 1G55A 2G17A 4MVJI 2RCYA 4XYMA 2CV1A 2ZBEA 4I5FA 2BZ1A 4NDZA 4G0XA 1Y80A 5LXTF 4QDUA 4A5SA 2REQA 3HB4X 1WXGA 2WKQA 2FSIA 2AX4A 2O05A 4L2IA 2EJWA 3P9NA 1DHTA 2VCHA 1X0VA 1BWRA 2QTAA 4C0SA 2WKWA 3VGPA 3C6MA 4JB3A 1QFMA 4C76A 3PE6A 1TDJA 1BKDR 3AIOA 3H97A 2BGLA 4D4HA 2ZGVA 2GZHA 3PG5A 2VK4A 3K09C 1I0LA 3ZGLA 1VLLA 1QGDA 5KYUB 1RPTA 4G09A 1EX7A 4X84A 4CI9A 1YI0A 1J7JA 2PYZA 2GK7A 4LJAA 4JC0A 9GPBA 1M1XB 4RLHA 3UJ6A 3M6IA 1VLVA 2HIHA 2AXNA 2EJTA 2A5YB 4KWEA 1FSFA 3MYYA 1KZ7B 2BEUB 1H9AA 2GCPA 2QTHA 3Q7SA 3TH5A 2I3DA 3PTLA 5I9TA 5B12A 5DX0A 3ST7A 4KG7A 5JJLA 3NALA 3V97A 2LCIA 2DWUA 4RKWA 2CCJA 3WIOA 5JBNA 1I6MA 2QDKA 1EVIA 4QVGA 2H1WA 1ZNZA 1J33A 4RZHA 1DQPA 4FR2A 2UYQA 4N03A 3T34A 3FVQA 1MENA 2GCIA 3F6PA 3P2IA 3UWKA 1MQAA 3E3LA 2IU0A 1DZ3A 3O1HB 3C8UA 4ND5A 3TLCA 4UD6A 3VYTB 3CWQA 4EI7A 1EWQA 4FFRA 4QT4A 1EXVA 2O1SA 3RVKA 3LS2A 2X9LA 3A1UA 3NHYA 4K6MA 1TQHA 3FYCA 4YCCA 3FUTA 4RF5A 1CCWA 1ECGA 1UUFA 2PKQP 4A6EA 2YN0A 4YP7A 3EVBA 3LBIA 4YRGA 1Q0ZA 1Q7GA 1XMIA 3U4DA 3N3BC 5BQFA 1RQRA 3M6LA 1CP3A 1M1NA 1VGRA 5IAKA 3T0IA 3CLKA 3IRUA 1ZGGA 2R00C 1P1BA 5CBPB 1V96A 5T4HA 2A30A 1IB0A 5HZMA 2BDTA 3O3NB 3ZXUB 1U3TA 1QG0A 1HFKA 1UMCA 1GSOA 2H4YA 2UZ3A 2HK9A 1IBLB 2PH3A 1RZUA 3Q7EA 3UHAA 5B3JC 4HDNB 3ME5A 1HRKA 2VDWB 4KK4A 5HJ5A 1EUCA 5F7OA 1N2BA 5ES3A 3JARB 1N5LA 2FFHA 2Y4NA 2QAGB 3PRYA 1WXWA 3V80A 3VSCA 4WNYA 1JB1A 1P2TA 4M22A 3IUQA 4DJTA 4P7GA 5CDUA 4PU0A 1DTWB 3A9CA 5EIBC 4E5YA 2GR9A 1CY6A 1KJZA 2OBFA 2XZTA 5KYTA 3GMDA 4D45A 4YT5A 5HGJA 1KQOA 4R8MA 2V7GA 4R2JA 3A4MA 3R8XA 3RKSA 2IE0A 5H68A 2DUMA 4QGHA 2X86A 2VZLA 2ZPUA 1PX2A 3CBGA 4L27A 4MB0A 4O2RA 4BJ1A 3QMMA 4G25A 4MUFA 5J63A 2FYTA 4YO8A 3ZGOA 1KI1A 5FO0A 4DT1A 1UT5A 2WG1A 1CFJA 4BRUA 1OIWA 3LCCA 1PT6A 1MR3F 1W96A 2RHBA 5H82A 4M6WA 4JD5A 3SHOA 4E6EA 5JOQA 5DNYB 5K8JB 5DBEX 1N77A 1QRTA 1AKNA 3EXHB 1CS0B 5FCDA 1YKSA 3WWPA 3HA7A 3M7IA 3AEKB 1HFJA 3O2SB 2ZIZA 1YWGO 4JLOA 2O54A 4C1NA 5AJWA 1T9ZA 2COUA 2CW5A 1E2LA 1O95D 1QVZA 2VRCA 4C06A 4KQXA 4EY8A 3JZAA 4DV1B 1X7DA 1GPYA 1EEXB 1DRWA 5I9SA 1UBRS 5CA1A 1UK9A 1Q7CA 3GHHA 1P4GA 4OUKX 5JCJA 1KH2A 3KT3A 1BOFA 1TEZA 1Z0FA 4Q48A 4KSBA 3EZFA 2IDMA 2VHJA 4RIIA 5KSYA 1TEHA 4K03A 1F2VA 3FFTA 4KQ9A 3K09A 4XLLA 1XLVA 4AMUA 1SUCA 3ESQA 2H2FA 1C4KA 3A4YA 3RE1A 1E2FA 3PWKA 1QIDA 4YRDA 1CQJB 5KKNB 1AXRA 3KLBA 4G8CA 1CG6A 5D84A 1Z0AA 3OJFA 3I39X 1B6GA 2EFGA 3OLYA 4Q02A 4BASA 1T1RA 4TMFA 1DEHA 8MHTA 3BFPA 3QVMA 1GEGA 5IVIA 2G07A 2JG3A 2BMVA 5FF9A 3U0BA 4BV2A 2HK6A 2QV0A 5F78A 2OOKA 2WI8A 5KDLA 4C7XA 4DREA 1E0KA 3EW9A 4RFLA 1NLZA 3QU5A 3LHDA 1DVRA 1MO5A 3W04A 2WT4A 3K6RA 1QAMA 4QJ3A 5AESA 1R7RA 2I8LA 3TQOA 2GO1A 3FAZA 1E9RA 2Q5LA 2QBYB 4B6PA 3FTEA 1JHMA 4HNHA 4IKPA 1SBCA 3BXPA 2E0IA 3IMKA 2FE1A 4YGXB 2CV0A 4RY0A 4FB5A 3ELWA 3COSA 4I36A 3Q9LA 2PCJA 2FW0A 1JYEA 1NMSA 4EY6A 1ORDA 3KEQA 2ILVA 3IVRA 5KOYA 2R00A 4NQZA 4AP6A 3T5TA 1VZ3A 1AF7A 3A26A 4NQRA 3NIGB 2Q62A 2OZVA 2PQ2A 5DZSA 4CL0A 4OI4A 2Z9CA 2H0QA 1E3JA 1AURA 5EE3A 1XDGA 1Q0LA 5DHAA 5KBYA 2ZREA 2ZBGA 4LY0A 3UMCA 1TUGA 1DIBA 1NUTA 3TEJA 3NWOA 3TLXA 4B81A 4WIAA 5AOCA 2J5BA 1DFHA 3SMQA 3UH1A 1XVUA 4GPAA 4HNAB 5LB2A 4HQNA 4JLWA 2W2TA 4QATA 1IULA 2GCEA 4LNAA 1KJ9A 1WW8A 1XJCA 3DBVO 3TR0A 4C4ZA 4BE9A 2RIRA 3FYUC 1SC1A 3J80A 1O9GA 2J33A 1ADJA 3SYTA 1F0PA 1N33B 2FZ4A 3WKAA 3PUHA 1AMUA 1WZCA 1A2QA 3JVVA 1RBMA 3SJ7A 1G3QA 4RS3A 2Y8EA 3RB8A 5I4KA 1SU4A 1QBGA 3LUAA 1FUKA 3O3OB 2EC5A 2NUPB 3RTCA 3TUJC 3VMFA 4I50B 3UV3A 2ZUSA 4R40A 2O3JA 2Y67A 1LX6A 4C2BA 4X9XA 1DFGA 1ONOA 5CCBA 1Z5UA 1BWSA 4U2GA 5JS7A 2PBZA 4DZTA 1RQXA 2W8BB 3ZWMA 2R8YA 3CLRC 4ACAA 1BYIA 3R40A 3K32A 1GUBA 3G6WA 3M6UA 1PNOA 1VSUA 3PC6A 2ZTSA 3EBLA 5CU7A 4EQ6B 1XA3A 1FW8A 2JRCA 2R79A 2RGBA 2Z4RA 3G3EA 1USIA 4WOBA 2FMXA 3PWSA 5CPBA 2KHZA 3T3NA 1KFJB 1ZP6A 1D5WA 1EFRD 1P5FA 3LNTA 4KQEA 2UZ1A 4MQBA 5IDYA 1AGRA 3PJDA 1CZHA 1Z2PX 2CCKA 2O2JA 2QXUA 1FB5A 2XEXA 3NKVA 3ND9A 3BH6A 3RRFA 1YJ5A 3ZTTA 2R96A 4CR7A 4OX9Y 4EUFA 3AF6A 1AHHA 2O2CA 2A4KA 3HA2A 4GHWA 5AXBA 1SN7A 2ERXA 2OHVA 2ZIAA 4WBSA 3L8ZA 3G1TA 4B7ZA 4EKGA 2B78A 2QN6A 2QIPA 3CH7A 2LXNA 3MJEA 3OFND 3INYA 1J24A 1K97A 2ZVQX 3DOFA 3PA6A 4KEAA 4Z8XA 2YZMA 1YVRA 3DQPA 3V1MA 2FXIA 1XLWA 4IDPA 1YUMA 3CNLA 4CMEC 5CLIA 4HB2A 3AR2A 1LPOA 4G1EB 4TTVA 3TK1A 5JQWA 3V7UA 4LXGA 3D7KA 1W30A 1JEEA 1UPCA 3WBFA 2AWOA 2XH8A 3WK8A 2ODPA 4A6PA 3OZDA 1H2ZA 4TKVA 2ZCVA 2G25A 4JGGA 4I19A 4I0WB 1T43A 3DNFA 1Q22A 4RPCA 2RHWA 3S4YA 4TZTA 4D0GA 4D56A 4FJ2A 3STTA 1QMGA 3DL2A 4IP0A 1DDIA 2QL6A 2ZDHA 3PGLA 3QG5A 3E3NA 4JOBA 4M83A 1JZQA 3LX4A 5FBHA 1WUYA 2YYZA 3V4RA 1SXIA 3P9YA 2FMUA 3EIXA 3NHAA 5DFAA 4Z9BA 5LOVF 2OKGA 2VH2A 1L5YA 3ISJA 3W6OA 4CM3A 4EY5A 4Q03A 3UNXA 2IIBA 1UXKA 1Y1LA 1BA2A 1NW5A 2HMTA 2I29A 3LUPA 3NTXA 1TQ8A 1JIIA 1R6AA 5K9ZA 2RGWA 2P9QA 4PHFA 4JT9A 1QGYA 3OI7A 1GTZA 1QO0D 3P27A 2WM2A 3EULA 1L9XA 4GVPA 5M7EA 4FD3A 1JEQA 1R8JA 2RGCA 2O06A 5KO2A 4G9GA 4BX8A 3N58A 3UT5B 2XUIA 3HYLA 2FWJA 2O4CA 2ZR7A 1AM4D 4BLUA 5AXDA 4XD2A 1VFNA 3V1LA 1JLKA 2EGUA 5JS2A 2BMDA 3VZBA 4B84A 3SK0A 2RAVA 4M89A 4R1OA 2F62A 2IDKA 4YJ2B 4NNJA 3AQIA 4IVPA 1RHQA 2XUFA 3MT9A 4R01A 5E9JA 5BR1A 1E3MA 4EJ2A 3LIPA 1VKRA 1YZKA 4C89A 4NV1A 4OXYA 1ES9A 1YB5A 3FYUA 4MHOA 3AB3A 3RI3A 9MHTA 4J8PA 1CR0A 1HE1C 1YDGA 2SKCA 3RAGA 2FB9A 3U6KA 1K8ZB 1NMZA 1Q7BA 3LOQA 4BU1A 5EHQA 5GWXA 2RHDA 2A9RA 1GUYA 1L3BA 1R37A 1R16A 3AI1A 1D6JA 1U5BA 3GRUA 4LIPD 3ZI0A 1DC6A 3AK4A 5EYPB 5JMTA 3OZXA 1Y9DA 4FYXA 3F90A 4PCLA 2XCRB 5CAEB 4RZ3A 3ZJUA 2FUNB 3N75A 3CGGA 3QJ5A 2OBYA 1OI3A 3WNBA 2OA0A 2OHFA 3GDFA 3KYIB 5JCZA 1T3SA 4PYNA 1T6ZA 2JDID 1ND6A 2PS0A 4DMKA 3RREA 2UZ4A 3HBLA 4BZPA 4BFVA 1GFIA 1IN8A 1Y8QA 2DC1A 4WZBE 4Q9LA 4JQYA 2F43B 3IAAA 3PVSA 4X1IB 1XKXA 2PR7A 4IUBS 2P9ZA 4X60A 3L4BA 1E2BA 3LVRE 3DMNA 2Q9BA 3CNHA 4D82A 1KF0A 1WDTA 4HDOB 2HHJA 3NDRA 4IZOA 3WSWA 4DRXA 4I4TF 2Q6VA 4DHEA 3BWVA 3LY9A 5LUAA 2VO1A 4B8YA 5CBKA 1T5IA 2WWWA 3PSAA 3OZVA 4N7BA 4X7RA 3ENKA 4Y2JA 4JGBA 5A4JA 1BA3A 4D4LA 2Z2YA 4F84A 3FDZB 2DTXA 2KBEA 4U2BA 1C1HA 4NZMA 2UYCA 2QLMA 1QP0A 3E0QA 4FT2A 3EG9B 4CMEA 1BKYA 3IQXA 1UMKA 2R5FA 4L5YA 4QAQA 1GTL1 2O4UX 2Q9CA 4PZCA 3NLLA 2MYUA 3C70A 1VYVA 3K2EA 5AVRA 3A25A 3CZ4A 4U0KA 2H17A 1YS6A 5DXJA 4ZICA 2C96A 3U16A 1YDEA 4QYIB 4GKJB 3CUSA 3I9V6 5BYBA 3PLNA 5CT5A 5ETJA 2NT4A 4MKXA 2NU7A 1FFXB 4IV0A 3DZIA 3DMHA 3T3PB 1KJ8A 3FYTA 1JXQA 2IEGA 3GEPA 4URWR 1OI2A 1MH1A 4WKGA 3SR3A 5HM8A 1FW6A 4RTJA 4YP9A 1RKXA 2IUSA 2J08A 3MJ4A 5J4YA 1U02A 1EFVB 4G5OA 4KPUB 2O5EA 1PL0A 4IVQA