4HFNA

X-ray crystal structure of a ternary complex of double bond reductase from nicotiana tabacum
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
341
structure length
331
Chain Sequence
AEEVSNKQVILKNYVTGYPKESDMEIKNVTIKLKVPEGSNDVVVKNLYLSCDPYMRSRMRESFAPGSPITGYGVAKVLESGDPKFQKGDLVWGMTGWEEYSIITPLFKIHDKDVPLSYYTGILGMPGMTAYAGFHEVCSPKKGETVFVSAASGAVGQLVGQFAKMLGCYVVGSAGSKEKVDLLKSKFGFDEAFNYKEEQDLSAALKRYFPDGIDIYFENVGGKMLDAVLVNMKLYGRIAVCGMISQYNLEQTEGVHNLFCLITKRIRMEGFLVFDYYHLYPKYLEMVIPQIKAGKVVYVEDVAHGLESAPTALVGLFSGRNIGKQVVMVSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Allyl alcohol dehydrogenase
publication title Biocatalytic Asymmetric Alkene Reduction: Crystal Structure and Characterization of a Double Bond Reductase fromNicotiana tabacum.
pubmed doi rcsb
source organism Nicotiana tabacum
total genus 107
structure length 331
sequence length 341
chains with identical sequence B
ec nomenclature ec 1.3.1.102: 2-alkenal reductase (NADP(+)).
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hfnA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4hfnA01
5L9AA 3LDHA 4XZ3A 4LN1A 1JKFA 1GDHA 1B16A 3FNEA 4DQUA 1XWFA 3D64A 1PL8A 4CMHA 4FFOA 2AG8A 2O50A 4YBZA 1D4FA 2G1UA 3JQCA 4RF2A 1GADO 1LTHR 2X86A 5KWEA 4XIJA 1MP0A 1L7DA 3FSRA 4YVFA 3WGTA 2SCUA 1HDGO 3LZ6A 4OSPA 1DJQA 4CLXA 1PX0A 4OXNA 1Y6JA 3OHSX 3O9ZA 4L74A 1MGOA 1W4ZA 2OXIA 4Z0HO 3RFTA 4ZU3A 1F8FA 4PZDA 5L4LA 2OHXA 1CWUA 4AJ4A 2CF6A 3MTGA 4LMRA 2HJSA 4Z9YA 5A3JA 2IE0A 2D2IA 3AI2A 1UZNA 3AUAA 3ENNA 5BT9A 4CMIA 5EQFA 4Y8VA 2DTEA 4MKXA 5T5QA 2VNAA 3AW9A 5JMWA 4J1SA 1YB1A 1GPDG 4H15A 3WGZA 3C24A 2UUOA 4CJXA 3KXDA 1LC3A 3F9IA 5KCZA 1GUFA 1UP4A 4YJGA 4DLBA 3F3SA 4DC1A 1KC3A 2O2YA 2VN8A 5FWNA 4PLPA 4D45A 1X1EA 2NU7A 2GN4A 2ZKLA 3K2EA 1GYQA 3PK0A 5F3RA 4BO5A 4DUPA 3WFIA 3PFFA 2QG4A 4I1IA 4AJEA 4HADA 2VHXA 3I6QA 2AEMA 1G0NA 2ZTLA 4AVYA 4NFHA 1BVRA 2HSDA 1I24A 4ZQGA 1U8FO 4LISA 3C1OA 1Q0HA 3BMNB 3DBRA 2XF8A 3FR7A 2NM0A 2WD7B 5KJCA 1VE9A 4D7AA 3KSUA 1V8BA 3U9LA 4ALNA 1YL6A 5IN5A 4BNHA 3GVCA 2H6EA 3DQPA 2J5QA 4CODB 1A7KA 3CH6A 1EVJA 5F5NA 1F06A 5JMPA 5G0TA 4CM9D 3G1TA 3DEYX 1QYVA 5TC4A 3GT0A 1M6HA 1NTOA 2NUAA 3Q9NA 5TF4A 4BQRA 4A10A 3P19A 4F3YA 3TZ6A 4GSLA 2XAAA 1SZJG 3WGHA 2I3AA 4U8GA 3RASA 2FWMX 3F1LA 3W6ZA 4ND3A 1T4DA 2QHXA 3JD2A 2GGSA 4L73A 4B79A 4MIYA 4EZBA 2JFFA 4RVFA 1M6WA 2HU2A 3GUCA 5TNXA 1EZ4A 3SLKA 4QSMA 4R9SA 4GLLA 3IAHA 4E2YA 1HLDA 4OM8A 4ZQFA 4J4BA 1HWYA 4EUFA 1J6UA 5EIOA 4JCOA 1ZEJA 1O89A 1IOLA 1KEVA 3B1KA 2AE1A 3ZHZA 1ZXLA 2QIOA 2ZTMA 1DFHA 2FPIA 2IODA 1LSJA 3BTOA 4DPLA 4GX5A 3D1LA 4HWKA 3HN2A 5ENVA 3GRPA 3DBVO 4U7WA 2QX7A 3EDMA 3GQVA 4E3ZA 3V8BA 1IPFA 1LI4A 1H6BA 1MXFA 4Z9XA 3ZV3A 3DWFA 4IINA 2VRCD 2EXXA 2A4KA 4ND5A 1YDWA 5ENDA 3SLGA 2YV1A 3A9WA 4PCVA 3TJRA 1HF3A 4WCFC 4E5NA 1O95A 1T25A 3JD1A 5L7TA 3NTOA 2WYVA 3GGOA 4DBVO 4J1NA 4YJDA 2A92A 2Z95A 3AJRA 1ZNQO 3UAGA 4DLLA 1HZZA 3L4BA 1GYPA 3ANLA 3OMLA 1UUFA 4Z9FA 2J3IA 4BGVA 1GCUA 2G82A 4HBGA 1SAYA 4TVOA 1OBFO 3PZRA 2FP4A 3ZWVA 2I99A 4WCFB 3TDKA 4ND1A 1J0XO 2CD9A 1NFRA 1P44A 2W4QA 3GN1A 4ALJA 2CF5A 5JDCC 3ZV6A 4W9NC 1LSUA 3ZWXA 3ZHBA 3AU8A 4CM8B 1NBOA 4NQZA 4W7HA 4YAGA 4YAKA 4CUJA 3GLQA 4A26A 1AUPA 3L4SO 4M49A 3LU1A 2OO5A 5JPIA 1P1HA 2C29D 4DPKA 3ZWOA 4PRKA 3PYLA 2X23A 3QSGA 4O63O 3RU7A 3V2GA 4DA9A 5ADHA 1L7EA 3FTNA 4CMKA 3LF2A 3BMQA 3KV3O 4II3A 1EQUA 4BO4A 2WDZA 1E7QA 3ZWNA 4AJPA 4E2XA 2Y1CA 3PEFA 5JDIA 2V7PA 2WE7A 3D7LA 1E7WA 4GKBA 4O59O 4UREA 1WLYA 2X0IA 3SVTA 4YB8A 2YV3A 1DB3A 4U6QA 4OO3A 2WEKA 1P77A 4J7UA 5JY6A 3WX0A 5IZCC 2DKNA 5JBIA 4BNGA 1Z6ZA 4BKRA 5DN9A 4YR9A 5J23A 1DO8A 1XEAA 3W6UA 3QY9A 1DIBA 1SPXA 2VUSA 3C8MA 4AJ2A 4F6LA 4L75A 2EJWA 4ZA2A 4HNHA 2E49A 3AOGA 1Z7EA 3OICA 3JCZA 1UZLA 2Y1EA 1G0OA 4UVGA 4XR9A 4BMSA 4LVCA 4DMLA 1ZFNA 4D3SA 1E3LA 1FF9A 3AM4A 4XGKA 5JCXA 1TT7A 3ZNPA 2JJYA 1HT0A 1M2WA 1B8UA 1EDZA 1LDGA 4CMEC 4BO7A 3CIFA 1JVSA 2Q1WA 4HP8A 4KUHA 3VH3A 4XGNA 3WTCA 1K0UA 2BKAA 2CY0A 2PNFA 1ENYA 1P1KA 4NHEA 2Z1MA 4BNMA 2P2SA 4BO8A 2B0JA 4JLWA 3DZFA 1O5IA 5L51A 5HA5A 5IAAA 3IUPA 2VUUA 1N7HA 4U0JA 3V1YA 1PS9A 2AQ8A 2HMSA 3BA1A 3WYBA 1M67A 4RV9A 1ARZA 2EW2A 1WNTA 3AUSA 2IDZA 4ROSA 5BSGA 2D1YA 3GDGA 1HDXA 1H9BA 1W8DA 4UUPA 4JJFA 3Q2IA 4CMAA 2NU9A 1R0KA 1VRWA 4ITUA 3RIHA 4PVCA 4ND2A 4PLHA 2W90A 4BB5A 2VNSA 1XSEA 4QT0A 2CVQA 2W98A 3NT4A 1E1NA 4BV8A 3GZNB 2CDCA 3Q3CA 2ZQZA 3RUDA 4AJJA 5HS6A 3UF0A 4R9RA 2Q99A 1V3UA 2ZIZA 4JP3A 4FC6A 1GD1O 5FEUA 4QQRA 1LDEA 3G49A 5I7FA 3VKUA 4BNLA 3MTJA 1DSSG 3JYQA 4BNTA 4M89A 4FW8A 1QYDA 4WLUA 3IDSA 1WVGA 3U3XA 3WJ7A 4ALKA 5IXYA 1X7HA 5BSFA 2P9EA 3GFGA 1IE3A 3PIIA 4U5QA 3KEOA 1DHRA 4BNFA 1EK5A 1BGVA 1HL3A 2EP5A 3NDRA 4DC0A 4JJGA 3CE6A 2WJPA 5L95A 2ZCUA 2X9GA 2ZB4A 4YT8A 3WGYA 1C1XB 1Q7GA 1IULA 2Q45A 4XQ9A 1P0CA 1PJCA 1U4SA 4CR6A 5B37A 2PD3A 5A5EA 1A9YA 3NYWA 1MV8A 2X22A 4CQMB 1E7SA 4MVJP 3EAGA 1KEWA 3GRKA 4NJMA 3U09A 1X7GA 1E3IA 5TT0A 4K9DA 3K8ZA 4IXTA 1RM3A 2C54A 3WXBA 4E30A 1RKXA 1OMOA 3CINA 2DT5A 1DOHA 3QP9A 4B3HA 1PGOA 3DOOA 2Q3EA 3JD0A 1DIRA 2I6TA 4FD3A 4WE3A 1CDOA 2RAFA 3ZH2A 4CUZA 1VJ0A 1YL5A 1K6IA 1YXMA 2Z5LA 4YACA 4QEDA 2O2SA 3OA0A 3W8FA 3JQ9A 1ENZA 1ML3A 1X15A 1IUKA 1C0IA 3H6KA 2Q1SA 2I76A 3NT5A 3TZHA 2C0CA 3GZ4A 3PJDA 2ZB3A 3BMCB 4MVJG 4PLZA 4NU5A 2WYWA 4IUYA 3RUCA 5EMHA 1ISHA 4CM6A 3SJ7A 1XGKA 3GEMA 3DAPA 1ZMTA 3JQ8B 4RZIA 3WNVA 1C0KA 2FR0A 5LDHA 1Y8RB 4G65A 5G2OA 4BB6A 3E6AA 3G3EA 3GPDG 1QLHA 3D3WA 4PVDA 3SEFA 3STHA 3TNLA 3I4CA 1ZBQA 4Q3EA 4M54A 3JQEA 5JC8A 1EK6A 3HHPA 2O3UA 3ICCA 5T64A 3GDFA 2CDBA 1RM4A 3PWSA 5CHEA 3WGQA 2EGGA 1NFFA 1P1IA 1GV1A 3WMXA 1NWHA 3QWHA 1UXGA 1WMBA 3OEWA 1JAXA 3RUHA 1JU9A 1YL7A 5IZ4A 1CERA 3LC2O 1LSOA 3HJAA 5CEJA 1D1TA 1U8XX 2YHIB 2J3JA 1CIVA 1I3LA 1X0XA 3KZVA 5CP8A 2PGDA 3S2GA 4D3FA 1V9LA 1I0ZA 1YOVB 5EQDA 3RWBA 2E37A 3I83A 3DFUA 4LW8A 1GZ6A 5CPBA 4RDIA 1O0SA 2GCGA 4FN4A 3ZU3A 3GVIA 2P91A 5BNIA 4UULA 2P5YA 4H7PA 2W2KA 1N9GA 3G17A 3NUGA 1PZFA 4E2WA 3ZNQA 4TKLA 1ZSNA 4UAGA 4TSKA 1JTVA 3EMKA 3WSVA 5KJ1A 4MPDA 2O7QA 4UEJA 1VL6A 1DRUA 4IGEA 4BIIA 4R4JA 1U1IA 5K9ZA 1G1AA 3DONA 3HQ4O 1A7AA 4D0RA 1MC4A 2C2YA 2FPGA 3D4OA 3TQHA 4XYGA 1P1RA 5AOVA 3V2UA 4DIFA 5C37A 3U62A 4R1NA 4I5FA 5DBGA 2Y1GA 2HLPA 1U3VA 1PWZA 4WCDA 2QYTA 3UCFA 5G0SA 3BHJA 1IYZA 2BLLA 1NQAO 3CZRA 1Y9AA 1PQPA 2CVZA 1DJNA 4EW6A 3E5MA 1E3EA 3GEGA 3OQBA 1GCOA 1KYQA 3WOHA 2IZ1A 1P33A 2Y99A 3L9XA 2OL4A 2RH4A 4B7UA 1QXSA 1HEUA 4Q3NA 2B4TO 4DYDA 4NIMA 1NWCA 4MVJM 1IZ9A 1U7TA 2V6GA 3QVTA 2Q49A 3AUUA 1D1SA 3E1KA 3ZWBA 4I9UA 4CQMD 3PRJA 1PGJA 2DFVA 2POQX 5TIIA 1QV6A 2UUPA 1KVRA 4TZTA 4BKQA 2DTDA 3A4VA 4IMRA 4IDGA 4IPTA 2C20A 1J49A 4IJVA 2DAPA 5IDXA 3RBVA 1F14A 1UXJA 3TL3A 4U0KA 3ETEA 1J4AA 1E6UA 4YDRA 4EBFA 1ISJA 3ULKA 1YQXA 1JLLA 1PS8A 1KEUA 2Y0CA 4B8WA 4BGIA 4CM3A 4IS2A 3OETA 1GQQA 2EF1A 3A06A 3ROMA 4DIOA 1F12A 1GUZA 1TLTA 3KYCA 3QWBA 3U4IA 4Q3CA 3QIVA 3TZQA 5MDHA 3OIDA 4CMJA 3ZU5A 4AG3A 1R12A 3CKYA 2UDPA 1X0VA 1W73A 1ZK1A 5K6AC 4DMMA 1XYGA 3OSUA 4LCJA 4JNKA 3GNSA 4MO2A 2DPGA 1HSZA 3JQAB 1NYTA 3N7UA 3PGJA 2PD4A 2VHZA 5ILOA 4XDYA 1S6YA 4B4VA 1YRLA 3GUYA 3X2FA 1ZMOA 2C07A 5DBFA 3IL2A 1C1DA 2Q2VA 4CR7A 2O3RA 3ETGA 3DMYA 1F8GA 4MP8A 4CM4A 1DEHA 3ANMA 2GSDA 2PR2A 1KERA 2HK7A 2NTNA 3H5RA 4AFNA 3NEPX 3SC6A 3U4CA 1XDWA 4DQXA 4I8XA 4E6PA 3RVDA 4J9UE 3SXPA 3I9NA 4J1QA 4F46A 4CM1A 3E48A 1T2EA 3JQDA 4PLYA 3GNTA 3EYWA 3KB6A 1DPGA 4L4XA 5CAEA 1H5QA 1BMDA 3KTDA 4FSHA 1HDYA 3GC6A 2VZ9A 1PR9A 3ZWAA 4HV4A 3KYDA 5FI5A 1PJSA 2NQ8A 3RU9A 2D59A 3WYCA 5COBA 3VKVA 4ZHSA 2B5WA 1VM6A 1YGYA 3O8QB 2D0IA 3DHYA 5DBIA 3IJPA 4YT2A 2D5AA 2QRKA 1EE2A 7MDHA 4PZEA 4RLSA 4OKIA 4BGUA 3OM9A 3AI1A 1I5RA 3AUTA 4JBHA 1U28A 3RUFA 3ZDFA 4GI2A 1LRJA 2OBNA 2O23A 4RPJA 3WJAA 4R5MA 2H63A 4JBGA 1DFGA 4ALLA 1Y8QB 2DBQA 5U1PA 4OJNA 2IXBA 3I23A 3SJUA 1KVUA 2NLOA 1AXGA 4CLOA 5B4VA 3UGKA 4CPDA 2P9CA 2GZ1A 3RAJA 3DBLB 4QFCA 3GA0A 1O8CA 4N18A 4LGVA 4R01A 4UUOA 4XX0A 3UVEA 3KO8A 2D8AA 4CLRA 1MUUA 1YQGA 4FCCA 4W82A 3IS3A 1MLDA 5T8KC 1LA2A 1E3WB 5DOVA 4BGEA 1SCUA 4AJOA 3JQFA 4CQLA 2AQKA 6ADHA 2JCVA 1U3TA 3JQBC 4FOSA 4ILKA 3GGPA 2GRAA 3AK4A 5L3ZA 1LXCA 3S2EA 3GNQA 2Q46A 4NDNE 4J90A 3MCVA 4IDEA 4RF5A 4ZQHA 4NZ9A 4YJFB 5JYEA 2R00C 4D79A 1U3WA 5AXBA 1R4MA 4MVJD 5COAA 1NVGA 4FB5A 5EJ2A 3V1TC 1WZEA 4EEXA 3HNPA 3H5NA 1NQ5A 1HDRA 1Y5RA 2PH3A 3OA2A 3ZGYA 2OFPA 3K6JA 1LUAA 2DQ4A 4XYMA 1Y5MA 4LSMA 1FDUA 3GEDA 1DHTA 2HJRA 1TVEA 2AG5A 3ONFA 3OECA 4OOEA 4R68A 5G4KA 4E13A 3WS7A 1DLIA 2VYNA 3QVSA 3V1UA 3ZI0A 3PYMA 4GQAA 5JCJD 1OC2A 1ADBA 1GZ4A 3C3XA 1R6DA 1YBMA 2PH5A 3JQAD 3TF5A 4OYRA 5DNAA 2W2LA 2VCYA 4DREA 1R16A 1AGNA 1MXHA 1WWKA 3R3SA 4NU6A 5EESA 1F0YA 3ZWCA 2VTDA 2CUKA 5A9SA 4E5KA 1ID1A 1CF2O 1I2ZA 1ZH8A 5JXWA 1JQBA 1KC1A 1FDWA 3I9MA 1I36A 1TT5B 2F00A 4PG6A 3BXXA 4XCVA 1B7GO 4Z3KA 3NJ4A 2B4RO 2OUIA 4IZIA 3U5TA 4RPHA 1WDKA 4WLNA 3I9OA 4ZVVA 3RD5A 1CYDA 1MFPA 4YEDA 1NHGA 2QQ5A 3H9JA 5JE8A 3BTUA 3I9LA 3NJ8A 1GUYA 1KS9A 5CDUA 5GY7A 3TWOA 4KTVE 3VH1A 2YJZA 3HDYA 1XU9A 4J91A 4URFA 1HETA 3WGIA 2QZZA 1HE4A 3PJEA 3QVOA 2JL1A 4OL9A 4XJTA 1GQYA 4ONEA 4X54A 4GLOA 3OQ1A 2BGMA 3BMOB 2H9IA 4QUKA 2BGKA 4LRSB 1MA0A 3ANNA 4CL3A 3EZLA 3FBGA 1HXHA 3WSWA 1EUDA 3I9KA 3FR8A 5A9TA 2B35A 2RIRA 4B4WA 1N8KA 3NTRA 4CV3A 5GZ1A 3ON5A 1ZIDA 4EUHA 3K73O 1H6AA 5B12A 2IEDA 4XRRA 2GNAA 4J0FA 4XD2A 5U4QA 3ZHXA 4A5OA 1PIWA 3R3JA 4NBVA 4YA6A 4IDAA 1DLJA 3WBBA 3RBZA 2AEJA 2NADA 2QZ9A 4UVDA 2JAHA 2AW5A 3DZKA 2VYVD 3BZUA 4E2ZA 1NNUA 3JQGA 1XR3A 5I7VA 4CMIB 2JD1A 1O6ZA 1T2AA 1UDCA 4BL5A 5COQA 2O48X 1SEPA 3I6IA 5ER6A 1LDNA 3U4DA 2YW9A 4LRTB 1HKUA 3C85A 2ZATA 4WJZA 1ISMA 4M8SA 1KIFA 3UOGA 3V2HA 5L45A 1L1FA 1E6WA 5TT1A 3RCBA 2C7GA 2OOSA 4YJGB 2BGLA 1H0KA 1DAOA 2B37A 5EN4A 4WLVA 5ITWA 3UICA 2YDXA 3AI3A 3ADPA 1NVTA 4CR8A 5JYDA 1PGQA 1BRMA 2UYYA 3I5MA 1N7GA 1HYGA 2HK9A 3DL2A 1H93A 3KSZO 1EVZA 2ZQYA 4RL6A 3DBRB 4PLVA 1ISGA 4JIGA 3LLSA 1V3VA 1ZCJA 4GL4A 1Z82A 3IUSA 1BG6A 1JDJA 3WICA 1KY4A 1KVQA 1VLLA 2CMDA 3CUKA 5ILGA 4BV9A 1YO6A 3PDUA 3ZWMA 1XQ6A 4IXWA 8ADHA 1ZK0A 2IRWA 1BXZA 1VL8A 2TMDA 2DFDA 3PHGA 4BNXA 1P3DA 1MX3A 4WNIA 3TFOA 3DZGA 1I3NA 4RVGA 3INGA 4FDAA 4RLHA 3DBHA 1ISIA 1UJMA 4WGGA 3RKUA 1NPDA 5TSDA 2E48A 2AHRA 4HFMA 4RCVA 5A5FA 2Q1TA 3DXFA 4YQYA 1A71A 3INTA 3WIEA 2EKQA 3EW7A 3CMMA 3IQDB 4Y6PA 4RJTA 2EHDA 3JQ6A 1J5PA 1SB9A 1U5AA 3DZHA 4H16A 1CQIA 1SOWA 4MDHA 4QTZA 2HQ1A 4GMFA 4DRYA 5L40A 4ALMA 1OOEA 5A4DA 1VI2A 4A2CA 4HXYA 3Q6IA 1LLQA 4FFPA 4R5HA 4IDCA 3T4EA 4E21A 1PZHA 2HCTA 3GOHA 3ONDA 2HO5A 5AYVA 4PIVA 5DF1A 3PWKA 2V6MA 3NX4A 4WK6A 1YQDA 2WWRA 3DHEA 1W6UA 3FNHA 4A73A 5KKCA 2PKQO 4OKNA 2C59A 3S55A 3L6OO 3H3FA 4KWHA 2VHYA 2BD0A 1I32A 3L4BC 2HMWA 1VC2A 2JFGA 3H2SA 2Y1FA 2HMVA 1EEHA 2NSDA 2OBYA 2YV2A 4AJNA 4BNKA 4YRBA 3BHMA 1AHIA 3GFBA 3EUWA 1TXGA 1KOLA 4TRRA 1DFIA 3GHYA 2AE2A 2VTEA 4HFJA 3RUAA 2Q2QA 4DGSA 4JJIA 3F5QA 4JROA 4TVBA 1C0LA 2GN6A 3KETA 3C7CB 4WLEA 2GPTA 3NDIA 4GGPA 3ETDA 3CXRA 4QX6A 5AXDA 2O3TA 3OJOA 5JO9A 3P2YA 3RQSA 3FNGA 4YWJA 4E5MA 2ZYGA 4XWYA 5ES3A 3WG9A 5L7WA 1DDOA 1AXEA 3FWZA 2QW8A 3ORFA 1DIHA 1I2CA 2IXAA 1VJTA 3WQQA 1FK8A 1ZW1A 3UFXA 3W4JA 2FPPA 3W1VA 1LJ8A 4XDZA 5JDIC 2W8ZA 1GZ3A 4ZQEA 3RJ9A 3HG7A 3RKRA 1V3TA 1FXSA 5BQFA 1R4NA 5I9NA 4PFJA 4RVUA 2GZ3A 1D3AA 3TOZA 2NU6A 4N5MA 5A9RA 3A28A 2FZWA 3PTZA 1T26A 1PJBA 2G17A 4NBWA 4R54A 3PDJA 4W7IA 3SX2A 3PHLA 3BMQB 4OIMA 4R1UA 3C7AA 2Z1NA 3B70A 5G0VA 3GY0A 4GX2A 3WWYA 1EE9A 3ZU2A 1HYEA 4BO9A 3F46A 4HKTA 1ZVMA 1QLJA 2WD8A 3ROQA 3INRA 2QRJA 1QKIA 3FPLA 2VT2A 3ITDA 1LU9A 2X0JA 4D41A 4E12A 1YVEI 4YRAA 3D3EA 4BNWA 2GYYA 3H4VA 4D0SA 1PGNA 3DMTA 1Y9EA 4LVUA 4PZCA 2NVUA 5AXAA 3C1AA 2I67A 4MOWA 4EGFA 4EJ6A 3VPFA 3WR5A 4DIBA 5ITVA 1E7MA 4OGWA 4CMBA 1DAPA 4WUVA 1IZ0A 4E4YA 2PV7A 3KSDO 3HADA 1P74A 3VPHA 3ZCXA 4HFNA 3DHNA 1E7YA 4O0LA 1OZAA 5KOIA 3AY7A 4YJHA 5IDQA 1A4UA 1KEPA 1YJ8A 2FY8A 4EITA 1Y7TA 3D5QA 5BNTA 2X58A 3EHEA 1VSUA 3JD3A 1GR0A 2QYSA 1GU7A 1PQWA 3TSCA 5U9CA 2FZEA 4D46A 2FSSA 4GVLA 2GR9A 3K96A 1UAGA 3DR3A 4J7CA 2B5VA 1BXGA 1U5CA 4FR5A 4A0SA 1ZO8A 2Y05A 1PEDA 3R6DA 2NNLD 3OJEA 4RVSA 4Q3DA 3WMWA 2X1HA 3S2IA 1LNQA 4O5OA 1A9ZA 3WYEA 2C5AA 1BW9A 1GEEA 4J3FA 4XKJA 4CLHA 4BNVA 4IY1A 5CDGA 1ZK4A 1N92A 1BVUA 2EEZA 1DRVA 1QSGA 3CMCO 2IZZA 1ONPA 4IDFA 3HFGA 1PJ4A 1IY8A 1FDTA 3OH8A 1PSDA 4JGBA 3MJSA 4UEKA 1T1SA 2CDAA 5TQVA 1JVBA 2Q1UA 2E82A 3L07A 4IQ0A 3HWRA 4YTEA 1GEGA 1XIVA 3LT1A 4G5HA 4RVHA 4NJOA 4U6SA 3B20A 1E6EA 1PL7A 4B7XA 4JK3A 1UZMA 4PLGA 3O38A 4PLCA 2ZK7A 3AOEA 4FPXA 1NQTA 3MOGA 1U2GA 5CDTA 3EVTA 1HRDA 5L7YA 3NDJA 2QRLA 5T6BA 2YFHA 2EW8A 2NTVA 1I10A 1X7DA 1P31A 2VWGA 1KVSA 3H9UA 3C1TA 4C7KA 1EBUA 3FF4A 2I66A 4KUGA 5DP2A 5FFFA 4W6ZA 3PJGA 1H6DA 2O4CA 3DZJA 5THQA 4YAEA 5H83A 3DC2A 1IB6A 1RM0A 4K26A 3VZPA 3LT2A 2ZJ1A 3VAZA 1JWBB 7ADHA 1YB4A 3PYXA 2GD1O 4L4RA 5JW6A 3AU9A 3LQFA 3G0OA 2GUGA 3I4FA 5H82A 4OOFA 4J7XA 1SNYA 4WOKA 2GN9A 1WMAA 4A03A 3WIDA 2VWPA 5IF3A 5BSEA 3ZZNA 5C5IA 5EERA 2EP7A 5K6AA 2GLXA 3N74A 3PQEA 1N1EA 3JQ9C 3TFQA 4EJ0A 4I08A 4PG8A 4NPCA 4NFSA 1LC0A 1I01A 3EY4A 4IIVA 3P5SA 4CUKA 4N54A 4YT4A 5I7SA 5I9MA 4IJWA 4NJMB 3JD4A 2YDYA 1MG5A 3WQSB 4YAIA 2YHUA 1EUCA 1QP8A 4MKZA 1P45A 2RHCA 3SBOA 1LLDA 1HDZA 2FN7A 4QFDA 1SO8A 3TZCA 5GZ6A 1Q2XA 2FOIA 4CM9A 3DAFA 1EVYA 5CEFA 2A9FA 3WLFA 2UVDA 3U49A 3FI9A 2X4GA 1E3SA 3WLEA 1VL0A 4BNZA 3QJ5A 3DAGA 4NBTA 4CLEA 4KP7A 3JTMA 4TRMA 6LDHA 1AHHA 5IG2A 1WW8A 4J4TA 1P1JA 1U4OA 1OFGA 4NG5A 2DTXA 4J43A 3OF2A 4BNIA 4GWGA 4ESOA 4O1MA 5I8ZA 4JBIA 4CLDA 3BTSA 3KLMX 4WLFA 2IZ0A 3ASUA 3D3WB 2VWHA 4FFMA 1WZIA 4MVJE 3V5NA 3ZWPA 1ADFA 4UVEA 2HRBA 2PK3A 4RDHA 1TB4A 4W4TA 2D4AA 4YT5A 5A04A 1QG6A 1E92A 1NR1A 4BO6A 1HTBA 4HFRA 1B0AA 2EV9A 5L4NA 2HMTA 4LSWA 1BDMA 5G0UA 3CZMA 4J1TA 2O3QA 1E7RA 4Y6RA 2G76A 4Y67A 4NK5A 5C7OO 2OORA 2BRUA 3EVNA 2P5UA 3GMDA 1ULUA 3GVXA 4P38A 5C7IO 4Z0TA 2VRCA 1QMGA 3Q2KA 3PLRA 3MEQA 2WTBA 4W99A 1WP4A 3HDHA 5KJ6A 1LDMA 3U0BA 2YQ5A 2G5CA 4D44A 1V0JA 1K89A 5A02A 5B1YA 4FFNA 4MKRA 2NVWA 2AXQA 4EI2A 2W2KB 1PJLA 5G4LA 1N9GB 5AQ1A 4XR4A 4S3MA 1ZEMA 1FDSA 1XELA 5MGBA 2DPHA 3UH1A 1JAYA 5FF9A 3Q1LA 1RPNA 4F45A 5F1KA 1NXQA 2ZB8A 1W0CA 1PJ2A 4AJ1A 1Z73A 5F1OA 3KUXA 1YONA 2JAPA 2VUTA 3Q9UA 3X2EA 3FNFA 4YQZA 3GG2A 3DZIA 4WASA 2HK8A 4N5LA 3QLJA 2JCXA 4ID9A 4KMSA 3F5SA 4PG7A 3UCXA 4BS9A 5EINA 4C4OA 3ZV5A 4NFYA 4E5PA 4UUMA 4RF3A 4B4UA 2WM3A 2ET6A 5F5LA 2BI8A 4DVJA 4NI5A 4M1QA 1EVIA 5TRTA 4TKMA 1HE5A 3F47A 1CETA 4BNUA 1SBYA 3E9QA 2IYPA 1MB4A 1YB5A 4MINA 4RORA 2V6FA 3BMNA 5A05A 3VPXA 4LCEA 4GSKA 2WD7A 5DP1A 3ZU4A 3IC5A 3ST7A 1HDOA 1U3UA 3IKVA 1E0DA 4ZGWA 1C0PA 3R0IA 1PJTA 1E1LA 4B4OA 1HYHA 3H8VA 2JHFA 4B8ZA 2GN8A 4MJLA 3OFSA 2ILTA 4BOYA 4JXKA 3L77A 3MJEA 1RJWA 5JNLA 1B26A 1RYDA 4TRNA 4DTIA 3S2FA 2FSVA 4AJIA 5IXSA 3GG9A 1U2DA 2ZJ0A 1DIAA 3JYNA 4HY3A 1VSVA 4BNJA 4XEHA 4BQPA 3OJ0A 2WMDA 3E03A 4OSOA 2C5EA 5T57A 4G81A 4DPMA 5CDYA 1LLCA 2Y66A 2NACA 3DB2A 4IQ8A 1CEQA 2OMEA 1XQ1A 2WYUA 3KYCB 4Z3DA 2LDXA 2X8LA 3EGOA 3DFZA 3F4BA 2VQ3A 5AXCA 2J8ZA 4RPGA 1B3RA 2X9NA 1BXKA 1UP6A 1P0FA 2VHVA 1GTMA 3HZZA 4JQCA 3HN7A 4ZJUA 3H5AA 4L76A 3PHIA 2CNBA 4AJKA 1E1KA 4GBJA 1JKIA 2FRDA 4OAQA 1WXDA 2EG9A 2JCYA 3OBBA 4K6FA 4XJSA 5I7EA 1C1DB 3PWZA 2EKPA 4CM4B 3DO5A 3F1KA 3K2BA 4YPOA 3MJVA 5ER9A 3JYLA 1YBAA 5JAQA 4INAA 5JSFA 1C3VA 1CRWG 2JKVA 2RBEA 2X5KO 1SB8A 2UV8A 2DBZA 3LT0A 5CG1A 4NBRA 3GN2A 3W4KA 3D5TA 5HTOA 3PQFA 4JX8A 3ZHYA 4P4NA 3D0OA 1CJCA 4BNYA 2TMGA 2Y93A 2J3KA 2X9VA 4NK4A 3ZWWA 1AN9A 1TI7A 1QV7A 4UVHA 1ADCA 3KYDB 3WTBA 2A94A 5F1PA 3ZW9A 3ASVA 4QO7A 1VKOA 2OGUA 1EMDA 1E77A 1T1RA 3U4HA 5I9LA 4P4GA 4KWIA 2Y68A 2BH9A 2G0TA 3UN1A 1KY5A 2DU8A 3AM5A 4QXMA 4FS3A 5CG2A 2I65A 3T4XA 4IDDA 4TZKA 3WGGA 5BR7A 3AWDA 4PN3A 2GO1A 1LSSA 4WCFA 3FD8A 5C7LO 3L6EA 3GMSA 1N5DA 4XQEA 4D3DA 3JQFC 4WEOA 2ZYAA 2PFGA 3MWDB 4CLOB 1PU2A 1XA0A 3O03A 4JP2A 4FBGA 3KYBA 4KDFA 2ZTUA 1DBVO 4CM8A 4GX0A 4MVJI 4KOAA 4L8VA 1Z75A 2PZMA 1UXKA 1MC5A 3GR6A 5FYDA 1OC4A 4CLRB 5JAIA 3DOCA 1ENOA 1PWXA 3WWZA 4RQTA 5B4UA 1F17A 3BYZA 2VZ0A 4N5NA 3P2OA 1H2BA 1H6CA 5A3VA 2CFCA 4CQLB 4ND4A 2X5OA 2X6TA 4GWKA 3IP1A 3FTPA 1R15A 1Z45A 2R6JA 3MJ4A 4MVJH 2X7HA 5JC1A 3O26A 3ENKA 3DZBA 1SC6A 3VPGA 5JDCA 1UH5A 2NWQA 1FJHA 4W9NA 3ZNOA 1NAIA 3UHAA 4MP6A 3MJCA 4D43A 4Y98A 3FPCA 4Z6KA 5IFLA 1X14A 4TRJA 3AFNA 1QRRA 1LBEA 5H81A 1A72A 3LSYA 5JY1A 3NTQA 2HMUA 2YUTA 4UUNA 1A27A 1R4MB 1ZSVA 2RHRA 1BSVA 5CEEA 3LT4A 1ISFA 1N1GA 4IDBA 3VZQA 1YH3A 5BSHA 4R3NA 3DOJA 3RC9A 4BMNA 4MIEA 2NVBA 2XPCA 1MFZA 4BHTA 1NR7A 3PHHA 3E82A 1ORRA 1JW9B 4PLWA 3JSAA 3PXXA 2UAGA 2J3HA 4FJ2A 3JQ7A 2Y67A 2E4AA 3NKLA 5K1SA 3H65A 5G4KB 5K0ZA 2VOJA 3SC4A 1LQTA 3OIGA 4PLTA 3UCEA 4B3JA 3LC1O 5IZCA 5DZSA 4UEOA 4FGWA 1PL6A 2Q2WA 2DC1A 3G1UA 4BKPA 2HRZA 5B4TA 4MP3A 1M75A 1Q0QA 2JD2A 4ZD6A 1HDCA 3WB9A 4HUJA 1VPDA 1UAYA 4GPD1 3M6IA 4OXYA 5DT9A 2OZPA 3RSHA 1XU7A 1YE3A 2P4QA 5A9SB 2C2XA 2HDHA 1BTOA 2IYOA 4DWVA 4OHUA 4OXKA 1X13A 3RJ5A 1EDOA 1O9BA 4M87A 2DUWA 4P4LA 3K9QO 4YXFA 1LQUA 5A06A 3DTYA 3PIDA 2Y1OA 4R16A 1Z74A 3BTVA 1ZKMA 1A5ZA 1HE3A 1ZK3A 4YCAA 4CMEA 4E0BA 4Q39A 3HB5X 1ULSA 2X5JO 4XB2A 1WAMA 1QORA 3I3OA 5KJFA 2XOXA 3QVWA 5KJEA 4CV1A 1U9JA 3HDJA 2BFMA 2ZCVA 5LDGA 4J2HA 2PGJA 2Q50A 4L0QA 3B1JA 5TJ9A 3CSDA 1PS0A 2C7VA 5KVQA 1HE2A 1RWBA 4GH5A 4EDFA 3GZNA 4Q3AA 5IDYA 8LDHA 5KVVA 4GMGA 2NV6A 5LC1A 2O3SA 1GAEO 4FJ1A 3ZWYA 4AJLA 1ADGA 4J6FA 5KVCA 5EL0A 4BKUA 3Q11A 4K28A 4LK3A 4ZRNA 3W8EA 1A4IA 4AL4A 3HE3A 4ZQBA 1YBVA 3ZW8A 1Q1NA 3GAFA 1SEVA 4IBOA 2DM6A 4XYBA 3WBFA 5CDSA 5IDWA 2AMFA 3EK2A 1EBFA 5DDIP 4ZN6A 5TLSA 3H9GA 1RM5A 1Y81A 1ZJZA 2PGLA 3L6DA 3RUIA 5JO0A 3GVHA 3CEAA 1NM5A 1BWSA 1NPTO 4DLAA 1E3JA 3JQGB 3G79A 1C1XA 4R69A 2PZKA 4GGOA 3JV7A 1LX6A 3HFSA 2LDBA 3ADOA 2GF2A 4RF4A 4CQMA 4QO8A 1QR6A 3JQ7B 4RZHA 1Z7BA 3LF1A 3PFWO 2A35A 2B69A 1M66A 3QVXA 4FIZA 3ROPA 1C14A 2AQIA 4IM7A 5F21A 2PTGA 3KM0A 4P22A 4PLFA 4E5YA 5AVOA 1VJ1A 2JHGA 4TQGA 4J16A 4C7JA 1G6KA 2NQTA 2OP1A 4CMCA 3TL2A 1I3MA 4CL8A 2B36A 5HBRA 2BMAA 3BAZA 2D3TA 1B8VA 3BMCA 4TMFA 3ITKA 2VYND 4D42A 1E1MA 4Q9NA 2VOEA 2WE8A 1UXHA 3T7EA 3JQ8A 4R3WA 5TGDA 2W2LD 2NU8A 3GH3A 2PY6A 4WKGA 3UUWA 2VRBA 4Y9DA 1Y8RA 1XKQA 1GQ2A 2YQ4A 3KOUA 3OQ6A 4B3IA 5JAZA 4WPGA 2FHSA 3QQPA 4WLOA 2EJVA 4PGFA 3TRIA 4BUCA 2PKRA 3PP8A 5KKAA 1QYXA 1T4BA 3H7AA 3ZNNA 4KDEA 4DYVA 3RC1A 2YHIA 4BO0A 2EIHA 3N58A 4XQGA 3KEQA 4H3VA 1YOVA 3VDRA 3DBHB 1IHYA 5DCUA 2B4QA 5IJZA 4S1VA 2Y1DA 1B3BA 2AQHA 4NNJA 1GYRA 1P9LA 4R41A 2DBRA 1E5LA 4FQ8A 2PA3A 2JD0A 3PGXA 4RPKA 2PWZA 3CPSA 3DDNA 1DC3A 1ZUD1 2EERA 2V6BA 4N7RA 1V6AA 2WSBA 2VWQA 1Q7CA 2JFHA 3GK3A 2DVMA 5TX7A 5DULA 1JA9A 2R2GA 2Q4BA 1AE1A 2B83A 4OMUA 4CV2A 1NP3A 2BF7A 2H5LA 2HAEA 3K31A 4I5GA 3P7MA 1DIGA 2D5CA 4BKOA 3LVFO 1UR5A 3QWIA 4IGFA 1OI7A 1YJQA 3B1FA 4AICA 4MIOA 3VOSA 2O7SA 3VH4A 3VVCA 5HWSA 4KQWA 2PLAA 1DC6A 5BNFA 3NRCA 3EC7A 1ZJYA 1HLPA 3PI7A 3OIFA 5G0WA 1PGPA 3H9QA 1T24A 1H9AA 3WQRA 5A03A 1PTJA 3QWAA 5GZ3A 1B2LA 2PKQP 5JFOA 4JN6B 4XRGA 3KRTA 4GVXA 3E9MA 1KBZA 1RYEA 4IMPA 1XCBA 1GY8A 2E6UX 4XIYA 1NQOA 1UDBA 4KUEA 3NGXA 4QECA 2VZ8A 4F6CA 3HUDA 1I8TA 2OP0A 2GDZA 4KQXA 4J4HA 3WDSA 3QWFA 4BO2A 2I3GA 3ICPA 1GL3A 4PRLA 3AY3A 3TPCA 3KBOA 2BELA 1SOVA 2BHLA 2DBVO 1D7OA 4A27A 1I30A 3B6ZA 3MJTA 1M76A 1X1TA 4Y6SA 4FC7A 9LDTA 2AEFA 3NAQA 5KNLA 1S7CA 3QE3A 1YWGO 3FWNA 2J5RA 2I5PO 3K5PA 4MVJA 1R0SA 2YY7A 3PVZA 2EWMA 1N2SA 4YYZA 1R4NB 2DLDA 2P4HX 4OQZA 3JYOA 3L9WA 3VPSA 3DMTC 3M2TA 5JAMA 3FHLA 4J49A 1TEHA 4TWRA 1Y1PA 2XXBA 3MOIA 4O6VA 4WNCA 1JN0A 1PZGA 2O3JA 2GERA 3F4LA 3LK7A 4CV0A 2C82A 1NVMB 1KVTA 1T2CA 1K3TA 3ZN2A 4XGIA 5DOZA 3UKOA 2Y0DA 1PQUA 3OJLA 3QW2A 5JCJA 1BHSA 3GDOA 4NMHA 4UVIA 1B8PA 3VDQA 4DBZA 3JQAA 3Q0EA 3GGGA 4LMPA 2ZTVA 4TROA 1U7HA 1OAAA 2BFOA 5L4SA 1GFSA 1EUZA 3H3JA 3AY6A 2NVUB 3KVOA 2DUUA 4R1TA 3D4NA 2Q4EA 5CFZA 3IOYA 4NR0A 4FFLA 3VTFA 2XXJA 4KTTE 1NX6A 3VZSA 1I3KA 1DRWA 4RQUA 1H2HA 1WPQA 3LYLA 2FR1A 1DC4A 5TS3A 1E5QA 4R1SA 9LDBA 3QA9A 3UXYA 1K5HA 1B15A 3WNQA 1DC5A 4DQVA 3VH2A 2FMUA 4IZHA 1WDMA 4WECA 1LDYA 3M1AA 3MZ0A 4I5DA 4YJHB 3E8XA 4XYLA 1LDBA 3M2PA 3HSKA 5HRUA 1PZEA 2RH8A 4E32A 1K2WA 1UXIA 3ABIA 3QHAA 1I2BA 3KHUA 4IQGA 4ZICA 3QV1A 5C3MA 4YRDA 1HZJA 1NAHA 4BMVA 4J9VA 5THKA 2BI7A 4P8RA 5ICSA 1CQJA 3EZYA 4K6CA 1WDLA 2Y0EA 1GPJA 3KLPX 3O8QA 3TZKA 1NASA 4J2OA 3RFVA 4B7CA 1BXGB 1NHWA 2H1SA 4J0EA 3RFXA 3VTZA 1Q7BA 3S8MA 3PPIA 5IN4A 3VZRA 2AA3A 1Y8QA 5EPOA 3E18A 3GHHA 4I9HA 3FCOA 1NFQA 3CTMA 4XA8A 2J6IA 3M1LA 3E5RA 4FGSA 1BW9B 1ZSYA 3I9JA 3IKTA 1ZXBA 4YAJA 4K1LA 5A1TA 3E9NA 5JLAA 1ENPA 5LCXA 2GASA 4M55A 3DBLA 4OQYA 4AJHA 4CM7A 2X0NA 1XLTA 4EYEA 4R51A 1EQ2A 3A1NA 5DCYA 2EGHA 1PR3A 4L9RA 4RVDA 3AOEC 5JS6A 1XG5A 1MG0A 2BFPA 2NTJA 1EFLA 4I9NA 2EKLA 2CZCA 2ZYDA 3GAZA 1E3WA 1XHLA 2J5KA 3PQDA 3MWEB 4G2NA 1NPYA 1TA4A 4BVAA 1YDEA 3AM3A 1HSOA 1ZK2A 1DXYA 1SMKA 2RCYA 2HUNA 1LRLA 3O4RA 3RROA 5T67A 2V65A 3NT2A 3A14A 1YKFA 3VHRA 2VYVA 5TJHA 4EUEA 4FFRA 3FBTA 1T2FA 3I1JA 2FR8A 2YZ7A 4DL9A 2ZB7A 3IJRA 4GX1A 2X0RA 4RO0A 1R37A 2O4UX 3LLVA 4YJFA 5T8KA 3VC7A 3IMFA 5HS4A 2I9PA 1K6JA 3OP4A 3I52A 4L4SA 4DXHA 3COSA 4KZPA 3NGLA 3FRJA 1V35A 4PG4A 1R66A 1ZZEA 3IP3A 2PZLA 3W4IA 5CPFA 3BIOA 3PLNA 4E33A 3K92A 3AFMA 1PJ3A 3JQBA 1P1FA 4EEZA 2P68A 4M86A 3GPIA 1JKJA 4HX5A 3IIEA 4ALIA 2F1KA 4XB1A 4WEQA 4E31A 1K6XA 5KVSA 1FDVA 1LRKA 4RGBA 2YYYA 4WOJA 4BO3A 1BDBA 3F6YA 3H9EO 3HDQA 1JWAB 3BHIA 4XQCA 4GAEA 2R00A 1QYCA 1IHXA 3H2ZA 1EFKA 1FMCA 2IEBA 1PJQA 2YFQA 2P9GA 3PZBA 1LEHA 5GMOA 4NH4A 3UW3A 3GF4A 2HKIA 3RBXA 1QYWA 3D4PA 3W8DA 2GZ2A 4PG5A 3TN7A 2VT3A 4IIUA 3T7CA 3PJFA 2PZJA 2CVOA 4EJMA 1R0LA 1TT5A 2VHWA 1ONOA 3GVPA 3QRWA 2CSUA 4IS3A 3RI3A 3HB4X 3C7DB 3LC7O 3R1IA 3ZV4A 3ONEA 5I8WA 3OEYA 4MVJF 3WGOA 3NV9A 4OH1A 4CMGA 3FN4A 4RPLA 1IPEA 1KETA 2BFAA 3VVBA 3RC2A 3S1LA 4II2A 3ROKA 3PHJA 4NBUA 4IJUA 4ZRMA 4FJ0A 4BO1A 5L53A 1Q0LA 1UDAA 1YS4A 4A7PA 4HNGA 3JYPA 1T2DA 4CM5A 4Z0PA 4IJKA 1I33A 3L0DA 5KIAA 3RC7A 1ONNA 1D8AA 1UP7A 4Q3BA 5KTKA 4GKVA 1GV0A 3RUEA 1VKNA 3OJFA 5DCWA 3K30A 3BMOA 3DTTA 1LLUA 1O94A 4FOOA 2PD6A 1IL0A 1B14A 1H94A 4XYEA 3TOXA 3WFJA 4BNNA 5FI3A 4I5EA 5ICMA 5HM8A
chains in the Genus database with same CATH superfamily
5L9AA 1S2LA 2WTNA 1RKUA 1ZOOA 3IVGA 2AK2A 2YWXA 2QUBA 4X1KA 1VQ1A 5AICA 4DCOA 2ACWA 1JMKC 1XWFA 4YCMA 1PL8A 5SICE 2DWCA 2PPVA 2W6ZA 3C3EA 3G0BA 1D4FA 4YBZA 4AM8A 2I1WA 4KWCA 4TMXA 4F2WA 2X86A 1Q0PA 3DJYA 4YVFA 1KYIA 1HDGO 3EIUA 3HCDA 3C48A 1P61B 3W1EA 1URPA 4OHXA 3EPKA 1I9CA 3N05A 3R5JA 3NUZA 2GILA 4OXNA 4CLXA 3QKTA 4S0ZA 1OXMA 3O9ZA 2WWTA 3BRWA 2O8BA 2X1MA 4QYIA 1R0BA 3RFTA 4ZU3A 4BX8A 1F8FA 2YY5A 4MLPA 5BQOA 3FCSB 2JI4A 4FWIB 3PUWA 4KITB 1SG0A 3FYCA 4AJ4A 4UUAA 4LMRA 4ZU1X 4IXDA 3P9NA 4MUNA 4Y30A 1MEOA 2IOFK 2NZ2A 3ZZ0A 3ENNA 3AI2A 1DAKA 4N65A 3R74A 2BMJA 5EQFA 1BD3A 2A5DA 4FWBA 4H7HA 1JFRA 2IZ6A 1YHNA 3LQ2A 5T5QA 3V9AA 4AY4A 1DO0A 1FP6A 3GP5A 4MS4A 4KAFA 3P97A 1XK6A 1CBUA 4J1SA 4KX3A 3SQLA 3N53A 2OILA 2XJ9A 3WGZA 3TVYA 3VR1A 2J67A 3TLYA 1P2TA 4CJXA 1L5RA 4C76A 4YV0A 1U63A 1TO6A 1F0KA 4X3PA 1TRHA 1UP4A 1CY0A 4YJGA 3F3SA 4DC1A 4DLBA 2O2YA 2GO7A 2Z9DA 3QLUA 2EC5A 4OHOA 2NU7A 2ZKLA 5DBOA 2EJCA 2PAAA 2QAGC 3K2EA 4MICA 4BASA 2PCLA 3I5AA 3JZAA 4BO5A 4B44A 1F0PA 3I8SA 5C18A 4BLSA 3ZI4A 3F6EX 1XFDA 1AV6A 2Q21A 3G8CA 1K8XB 3GYGA 5HCNA 3JAMA 1T3TA 1YDMA 2G5GX 3E3OA 4R8SA 4LISA 2Q8QA 2ZIVB 4KLZA 2XF8A 4WRRA 4CGYA 3C6KA 3Q2OA 1GKIA 2WD7B 1Q3TA 1QP4A 1Q6ZA 5FQNA 2FWBA 2FF7A 4KXWA 1JHOA 4M8IA 3NWPA 2VP4A 3L7YA 2PMCA 1IFXA 3GVCA 2PLNA 4PHTA 5KTSA 1CK4A 1MAAA 3SIWA 3UHFA 3KLOA 1E1CB 1FA9A 1SKBA 1CUJA 3NHSA 4F06A 1NSTA 3A9SA 1XROA 4B4KA 1E1DA 2YMQA 2X8JB 1F06A 4PF1A 5F5NA 3WRYC 1OD6A 2CBXA 2I62A 4ARBA 4CM9D 2EQBA 1H3NA 3UJCA 2AJTA 3KT6A 5TC4A 3DB1A 3B6KA 3ER6A 4YN3A 2VJYA 1SQGA 3E27A 3LUFA 4F3YA 1JJIA 3M9LA 3TZ6A 1W1UA 5KOJA 2FFQA 4LBWA 2CXQA 4HDSA 4U8GA 3RASA 2XRZA 3F1LA 3W6ZA 1GSHA 2DYKA 1T4DA 4ND3A 1J9EA 3MRVA 3ZX4A 2CLOB 5F2KA 3JD2A 1UIMA 4RHTA 3C39A 1PFVA 4MIYA 4I1UA 4IIYA 4RVFA 2ATVA 2VZEA 2CEKA 4YQFA 1CIJA 3PJRA 3HUTA 1LFAA 4UMVA 4FBMA 3LW7A 4R9SA 4E2YA 4E5UA 3OD1A 3SEAA 3SXUA 2XSZA 5F2OA 1SUWA 2OZVA 2ZJ7A 3IIKA 1VHLA 2VHUA 1IOLA 1KEVA 4G86A 1OIWA 5CTJA 4BLPA 3W5HA 1OY1A 4TVSA 4JNCA 1CUYA 1CY8A 3DGFC 1DFHA 1Q16A 2XV1A 2Z2XA 1NY5A 5FAXA 4GX5A 3D1LA 4KQIA 4PQYA 5FAKA 3F98A 2ZWVA 1MIOA 1NN3A 1YNSA 1XD9A 4U7WA 1PT9A 1VJ5A 5EJIA 3WB0A 4E3ZA 1ZAKA 4ZCQA 1LI4A 521PA 3K16A 1H6BA 1MXFA 2IDKA 3S5JA 2QP4A 5FPPA 4ZCLA 2UVPA 4AUEA 2ZRMA 3FFXA 3IBGA 1Y5LA 4EENA 1Y8AA 2MYNA 4PGAA 4R9NA 1VYUA 3SLGA 4R84A 1U04A 3RAGA 4K9MA 2ZITA 4PPYA 3ENQA 3TSYA 4ERXA 4PCVA 1NMSA 1HF3A 5NLLA 4BZXA 1RTTA 1NLMA 2LGJA 2WV9A 3R40A 1C9MA 2DH5A 2P6PA 2Y1XA 5CNMA 3ZZ1A 2YS6A 3A6FA 1V1MA 4B34A 2D2VA 5LP6A 3FZNA 4YJDA 2G09A 1O6BA 4ON9A 1RRFA 5SV2A 1OUMA 3S27A 2Z95A 3HDGA 3LUAA 3D31A 2IYXA 4Z86A 4AUNA 4DLLA 1SXJB 2F62A 1HZZA 3C45A 3L4BA 1GYPA 4C0QC 1L5FA 2JLBA 1M1ZA 1LKZA 2CD7A 1CUSA 2OCDA 1GCUA 2PH1A 3I1FA 4AO7A 1LGYA 1YZ3A 1M8KA 4XWTA 4ARZA 2A8YA 1E89A 2CEAA 2OCPA 1WMDA 2E1RA 4F8JA 1NUUA 1UOQA 2XNDA 3F8WA 3FPBA 3PNKA 3WLLA 1ZN9A 3NHPA 3ZLUA 5LL6P 4JLAA 4JI7B 1TO2E 2LCQA 5LQUA 1Y4SA 2Q9BA 2YXBA 8ATCA 2CD9A 2GLTA 3HDVA 5CNIA 1PX2A 3M33A 2H4ZA 5E9JA 3T3EA 4M0EA 1E4OA 4YIKA 3ZWXA 4ZTUB 4P7JA 4AIIA 3L18A 3LUDA 1XTUA 5AVVA 1YR9A 1PUXA 2Y2VA 3BDIA 4F1KA 2J7KA 1Z2PX 2VJNA 1BHQ1 4YAKA 4AJ9A 3P2IA 2XUIA 2JI7A 4A26A 3PNBA 4I6GA 4JWTA 3LPAA 4KXLA 4BMSA 1AUPA 2H0QA 2E87A 1PT8A 5TEVA 4TLLB 3EF1A 2X23A 4GWLA 3ZY3A 1RWVA 3ND9A 5ADHA 2J4CA 1T5BA 1JLMA 5IJ9B 3THWA 3OT4A 1L8AA 3LF2A 2FUEA 3ES9A 4KQEA 1VLHA 2LNDA 4QGFA 1JS1X 3UJ7A 5D86A 4KBYA 2F3TA 1E7QA 3ZWNA 3EC2A 4E2XA 3KCQA 4MA0A 4AZVA 5JQWA 4UUBA 4MUIA 1P2VA 2B94A 5KO2A 4UREA 4URVR 1C8LA 1W5EA 1H3EA 1EFVB 4MO9A 4JXZA 2LKDA 1T10A 3RRZA 4U6QA 4ZK6A 4J0JA 1E9DA 4MGZR 2WEKA 4FCTA 1ACJA 2C99A 4X63A 1H4SA 2JEYA 4IH1A 4Q3KA 4H7KA 2ZIXA 5IZCC 4UE3S 1DMSA 1ULAA 1Z6ZA 3EDOA 2QAIA 3H42B 4HGZA 1XEAA 2HJWA 4RA9A 2C4NA 1PLKA 3WYDA 5IMBA 3W6UA 1Q1BA 1KKUA 1CR0A 3QY9A 1XAHA 3BD8A 4O2BB 5D6OA 1T9DA 1BMFD 2XB4A 4L4UA 3IDQA 2XB2A 2VDMB 4L75A 2RB5A 2HCBA 4R1MA 2AF3C 3AOGA 3STXA 3OICA 2HT1A 4CKCA 2D1FA 4IWYA 1V4VA 4UM7A 2OECA 2Y1EA 3Q8KA 3ZYCA 2HLDD 2JI9A 1G20A 3HY4A 4FR0A 4LVCA 3NAGA 3B9BA 3N0WA 5D5QA 1ZFNA 1R9NA 3K9HA 4G56A 1FF9A 4HDCA 2ZAIA 3AM4A 4NOJA 2ODWA 4XGKA 3V4FA 3UTCA 3ZTYA 1BX3A 3TUJC 5JXGA 1JX6A 3ORQA 4OHWA 2GCOB 5HIIA 1LDGA 2P0AA 1P5FA 2ATCA 3FETA 5DWDA 4H59A 3THSA 2AXEA 4ISBA 2I2CA 2VFAA 4QU8A 5CCEA 4KG7A 4Q3OA 1V1MB 4G1BA 4TKVB 4BFZA 3LXXA 3FWYA 3L0SA 1ENYA 1PUJA 4WNAB 3RNLA 4ZYZA 3CVOA 5JAOA 2Z1MA 3R0JA 5ECWA 4CIXA 3DT6A 5LYJB 5JI3E 1F2DA 1EM6A 2P2SA 4JLWA 3HKCA 3NH6A 1C3JA 5L51A 1ZMXA 4ZO9A 2MT9A 3QMMA 2O0MA 1N7HA 5KOYA 4LXTA 5AJVB 5LWQA 4LTDA 1PS9A 2GQ0A 1GN8A 2V3CC 1PWEA 2HMSA 3HO8A 2NXCA 1Z15A 5E6UA 2HY7A 1WHTA 4RV9A 1ARZA 1UT8A 2F8MA 4HAUA 4QBTA 3ZDXB 1SA0B 1VKZA 1WNTA 3AUSA 1SXJD 4DPKA 4PY2A 4E46A 5BSGA 2D1YA 1ABFA 1PT5A 3K8YA 3CC8A 4EGCB 4F2GA 3Q2IA 1VBMA 1WMFA 2IYWA 2NU9A 1E32A 4ITUA 3EPRA 5JEDA 3HK2A 3MGCA 2IHVA 4RY9A 1VGRA 3U17A 2V8BA 3LGSA 3QEAZ 4PLHA 3I05A 4BB5A 2WHEA 2CLCX 2V5VA 4QT0A 2P2LA 5K8JB 2ZPTX 3KE9A 3NT4A 1E1NA 4O2BF 5ALHA 1VZ2A 1YZVA 3GZNB 1W44A 3CF4A 4TXMA 3Q3CA 4IDNA 1QGOA 3ANYB 3AFGA 1AKRA 2W6JA 3IX7A 3F96A 3WL4A 3UF0A 1TPZA 1U3DA 4KEAA 1FU7A 2REQA 1C8BA 2Q99A 4KPFC 2ZIZA 1NM5C 4JP3A 3B48A 3LCJA 1GD1O 5HJ2A 5A4MS 5AW6A 1X1CA 2P1DA 3TD9A 2FZVA 4TS1A 4YJ2B 5ALEA 4ZV7A 2YRXA 5IBQA 5TVKA 1I4OA 1QYDA 3F5FA 3IDSA 3U3XA 1YMVA 3H13A 2DSTA 3WJ7A 1I6WA 2WVHA 4HNQA 3W5IA 4ALKA 4B8YA 5BSFA 1D4OA 4C0XA 1T5LA 3SF0A 3FRHA 5EQTA 1J8DA 3KEOA 3WA6A 4A6XA 1DHRA 4INZA 1BGVA 2EP5A 3USES 2FSHA 2XTAA 4J16C 4LHXA 3UAZA 4EW1A 1Y5IA 1DT5A 3QVUA 2WIAA 1KHTA 4HN9A 4JZYA 2C03A 1VE3A 3G2IA 3OZGA 1SVMA 2PLRA 4G24A 4D57A 1K9VF 1ZMBA 2HUPA 2HB6A 2WWWA 3BIJA 3QELB 4M0LA 4RLQA 4TTQA 4CDRA 4N9QA 5LYJF 5EUCA 1IULA 3ND5A 3HCAA 5ELMA 4OUDB 1P0CA 4L5CA 1LVGA 1U4SA 4KYTA 4XQ9A 1FFDA 4IDHA 4OQEA 2PD3A 4UDYX 5FUWA 5B37A 1MV8A 3PVSA 4ENSA 5A5EA 4BXOA 1QM5A 1L3BA 5HIAA 5ARDA 3U48A 3QI2A 1E3IA 8ABPA 1KJZA 4CCYB 4LK2A 4K9DA 3K8ZA 3V3KA 4DM4A 4ZMSA 2C7QA 5ALWA 2AMVA 2V7GA 4B3HA 2CKMA 1DIRA 2HA7A 4WE3A 3MSCA 3VUEA 2PQ2A 4YACA 5WRFA 1W36C 4QEDA 3NBZC 3V7WA 4R1PA 2AZ4A 3W8FA 3KKZA 1XMIA 1N5RA 2F43B 4IX9A 2OMKA 1L5OA 4MVJG 4NU5A 1S9DA 1TQ6A 5MHTA 5TR9A 1ES9A 3C3AA 4GPAA 3P71T 3GLFE 2GMWA 2QUZA 3LKBA 1AKYA 1BWRA 2B3DA 4BLVA 5BW5A 2J33A 2XDQB 2AR9A 3IP7A 4GYYA 4N7MA 2G83A 1WHSA 1UJ4A 2FR0A 1WV1A 2D0DA 5G2OA 3SKYA 4HAOA 5J59A 2B0CA 3G3EA 1MEJA 3GPDG 1QLHA 4HRVA 2YASA 1R64A 1XO1A 1ZBQA 4HB2A 4Q3EA 5JC8A 1NV8A 1G38A 3EGXB 4KHZA 3HHPA 4M0FA 5IAEA 5ALFA 3GLRA 3UMSA 1RLOA 1WO8A 2Q5HA 3ZK7A 4YJ2F 1K5PA 5B2EA 4KAAA 1RM4A 1RJDA 1UK9A 3G5MA 3K09A 3PWSA 2EGGA 1CX9B 5CHEA 4S2EA 3WGQA 3OEWA 2HXSA 3CJQA 5AK0A 5AFSA 1CERA 4PX2A 5FJIA 5DXJA 4HL6A 5FTNA 5DHFA 3L8YA 2YHIB 2BEWB 4WDQA 2AG6A 5I9BA 3S2GA 5B7PA 3PNPA 4U2FA 5KZMB 4GXRA 4EO4A 1QYIA 2VSNA 1N2ZA 3I83A 1AQIA 1YS9A 3I2GA 2YJGA 3OIUA 4ZAFA 5CPBA 4RDIA 3REFA 3FFWA 1T4GA 2DFTA 4FN4A 5DM70 3MTQA 3W06A 3ZU3A 1FNDA 2CYBA 2P91A 2VBGA 4B35A 1XU4A 3I9V1 2P5YA 3S29A 1ZJ4A 1MRSA 3ASZA 1NN0A 2GWRA 1U8CB 1L7RA 3CG4A 4DV1B 5I4CA 5KJFA 1JTVA 2RGCA 1VDMA 3BX1A 3EMKA 3WSVA 1CJMA 1MJHA 1VB3A 3JWGA 3RSSA 4FZ3A 4LHSA 3CUYA 2R68A 4I7EA 3O1JC 4R4JA 5K9ZA 1J42A 4D1YA 1Z8NA 1G3RA 4LZAA 5DISB 3OQMA 4A15A 1G64A 3N8NA 5GJWC 3PXAA 3GJSA 2C2YA 3G9ZA 3D4OA 4R7TA 1LPSA 2WIKA 1P1RA 4DG8A 1NUHA 4DIFA 4R1LA 2O7NA 4HUQB 3U62A 4E70A 1WSDA 3HB7A 3T3GA 2PUTA 3H5WA 2OGTA 3P9PA 5IH7A 4G23A 3S40A 4WKCA 3D0RA 2HLPA 4W1QA 3SU8A 4DMFA 5JU6A 3UJ3X 2C7BA 3WGJA 4Y2UA 2VXCA 4KPEC 3CNEA 5A4DA 5G0SA 3BHJA 4O4IB 1FVOA 2XYVA 3T3PB 1Y9AA 1HYBA 5EKXA 2WSYB 1EB9A 1QGYA 4DHEA 4RIEA 1CU1A 1U0HC 2A3NA 3H6GA 3M9WA 1WPGA 3PTAA 3K15A 3NM6B 1S01A 2Y99A 3P9YA 1U9IC 4JR0A 5CIQA 4B7UA 1I1HA 1Z6YA 1R74A 2FEWB 4RTSA 2HJHA 3L6UA 3LUBA 2ODAA 5AHKA 2PYIA 2IPMA 2FCRA 2V6GA 2Y4OA 3NXSA 1IY2A 3QVTA 4R40A 3DMPA 1CFZA 2XR1A 5LU8A 4CXMA 1G8GA 2B8NA 3N2IA 4MWTA 1FFEA 1MW9X 3CH7A 1Z3IX 2P2DA 3G23A 3KOMA 4DMHA 5A6VA 1KVRA 1R9MA 3Q98A 2AFHE 3A4VA 2HI0A 3ODGA 1N5MA 4TS3A 1ZD1A 2DAPA 3U3RA 7GPBA 5IDXA 1F14A 3W77A 4YCLA 2C4MA 2ZWOA 3URKA 5I01A 3ETEA 3RYTC 2ASEA 2AOWA 5FR2A 4EBFA 2WJVA 1YQXA 3KVYA 13PKA 4L8YA 1RDFA 2OAQ1 4JV5B 2XITA 2OV2A 1R6VA 1JXAA 2ZIAA 1CUBA 2BBOA 3AP1A 3ECAA 3FZEA 4QODA 3S2SA 4IS2A 3GDHA 2B98A 4E5DA 1TW2A 1XTZA 4JDUA 4P83A 4UMEA 5F52A 4DIOA 1TLTA 2FJPA 3KYCA 5CB4B 4Z1MA 1QJCA 4XFKA 2VPWA 4IOMA 4IG9A 3TZQA 2H51A 4W8HA 3LJKA 4KJZA 3ZU5A 3CKYA 4EY4A 2ZE8A 1A9QA 3KEMA 4ZHQB 3U7FB 4EB6B 2ZRJA 1I2DA 3MTIA 1WKVA 4DMMA 3IAUA 3PQCA 4EI8A 2DJIA 1Z2NX 3GNSA 1U2TA 4WX2B 2B6NA 4TMWA 5FBLB 5B6JA 4RZ2A 2VDRB 3KQNA 2VJBA 5JCOC 2BI4A 2PD4A 5AK3A 1XNHA 1V1JA 1AK2A 3V7YA 5KBYA 5ILOA 1P1CA 2Y77A 1V11A 1S6YA 2CLMB 3BQ9A 3ZCRA 4O4IF 3SS8A 1JG3A 1H5UA 3DAHA 3FIJA 3I04A 5CTAA 1XD2A 1V8FA 1TM1E 2C07A 2E4ZA 2OC4A 5DBFA 5ECYA 5LBUA 3DMYA 1F8GA 3JALB 3OURA 3TSWA 4CM4A 2GSDA 2NTYC 3D3JA 3EEQA 2OHFA 3H83A 3NEPX 1XDWA 4O1IA 2FZCA 2JCGA 1RZUA 3U7EB 1AHNA 3D3QA 4E6PA 2N1MA 4J9UE 4PCUA 3SXPA 1D09A 3E48A 2OPHA 1T2EA 1XZMA 3JQDA 3MQ2A 2XUDA 3GNTA 3K9NA 3KB6A 1Q3KA 4MR9A 5CAEA 4KSBA 1JTFA 1SC9A 3HFRA 1H5QA 1XZPA 3HGMA 4DKXA 1HDYA 3GC6A 3JZDA 2DY0A 1W0JD 5EKUA 5DB4A 2BCJQ 1XB2A 1ZOPA 2AMYA 3E0XA 3AG6A 2UYOA 3DQZA 1I4DD 1TCUA 3QYPA 5CW1A 4EG3A 1O5OA 1NVXQ 1PJSA 1BCSB 1QKJA 1VCIA 5FI5A 2V5UA 2D59A 1CQWA 4FHGA 5DTIA 3ZLBA 4PPFA 4ZHSA 2Z6AA 2O6HA 2PSJA 4JBYA 3NR2A 3B6JA 3O8QB 2D0IA 4TWIA 5DBIA 4YT2A 1Q0TA 3ZY4A 7MDHA 1X1SA 4KYIB 3PQ4A 4BGUA 4XWGA 2JHCA 3OM9A 4K6MA 4NZZA 5EJEA 2CWDA 3AUTA 1GTJ1 2VK4A 5FBKA 4GI2A 2I1QA 3IP8A 4MMYB 2DWPA 3N2KB 3WV5A 4R5MA 1DFGA 1W34A 1Y8QB 4HLUA 5ARBA 4E03A 2J6CA 5U1PA 1Z39A 3GRRA 4M7WA 4EF5A 1USWA 2I03A 2IXBA 3I23A 2JIMA 3EQ6A 4ZYUA 4FIDA 2GN2A 4PR3A 4CLOA 5B4VA 3UGKA 1W35A 5P21A 1FSGA 3VU9A 2UKDA 4X1YB 4EHNA 2GZ1A 1Z83A 3CJRA 4G1MB 4ZHQF 1CEXA 2ZU6A 3BFJA 3R7FA 1VTKA 2C31A 4OYYA 4BV3A 2QR2A 4UUOA 4BLOA 5B57C 1NW5A 2DHDA 1HNNA 3T7KA 2HF7A 3EZNA 4N7BA 4CLRA 1SKQA 5E7JA 1MRZA 5GIOE 1VIVA 1DBQA 1OIVA 1E3WB 4AIRA 5CB0A 2QENA 4BGEA 2PXAA 3J80A 1EJ0A 5IBPA 1QGDA 2XUJA 1RXCA 2JCVA 3EXIB 2IHUA 4NXNB 1U3TA 4F2DA 1Y1KE 3JQBC 1B4DA 1S8AA 2ETXA 3GGPA 5ERXA 1B42A 1L4KA 1G5TA 3AK4A 3EVEA 5L3ZA 1ZICA 1LXCA 2ZVQX 1E3MA 2IE8A 1GTVA 1QS0B 2OD7A 2QM0A 3CX8A 2D13A 2FK7A 3HM9A 2C98A 4LGYA 3L8DA 4FX5A 1KPHA 3UJAA 3SVLA 4ZQHA 4WJKB 4NZ9A 3S3TA 1FMTA 4UOEA 5LLDA 5EC8A 5AXBA 2WC1A 4MVJD 2VG8A 3WIOA 2B5OA 2JLAA 3ICVA 1WZEA 4XW2A 4EEXA 4XWWA 3JQQA 3WL7A 2AXNA 4JQZA 4X45A 2XUQA 1KP2A 3QXXA 3PD7A 3LCCA 3P9RA 1SVKA 3DE4X 1XJWA 4CL0A 1ZNZA 1BIFA 3MUNA 3TR6A 1SCAA 1E9EA 1L4BA 1CUHA 3HBMA 4XIGS 2AG5A 3ONFA 1EINA 1JP7A 2ZUWA 2QD1A 3HI4A 3LP6A 4IIXA 4XARA 5HGJA 3W9UA 3ZDYB 3O4IA 3KKMA 1OPRA 2HIHA 4ZOEA 2VYNA 2ST1A 5E95A 3T7RA 2B7CA 2SBTA 2XUPA 4C05A 1XZIA 1R6DA 4Y2PA 1C2YA 2PXCA 4NNOA 1K8ZB 1P29A 1EFAA 4CFZA 2HHJA 2VT6A 4AZSA 5HKKA 4KWEA 1QIDA 3EMVA 5KNCD 2PXHA 5KQGA 2YXLA 4RGQA 4XWOA 1F0YA 3F4KA 3ZWCA 2LIVA 4EKIA 3TZEA 1DUIA 1YUNA 1ZIOA 5EWJA 1UPCA 4QDJA 2XXAB 4MX8A 5B36A 1ID1A 4LY3A 1JQBA 5ALZA 3HWSA 2I3DA 1FDWA 2IU0A 3W3ZB 5EAIA 1E2EA 1QGUA 1I36A 1TPYA 1TT5B 2G3YA 4PG6A 2DOKA 1B7GO 3KWMA 3NJ4A 1GL6A 3U7IA 2NX2A 4JBLA 4DCMA 3OFJA 2VDNB 4MGKR 1PG5A 2QJRA 1W1IA 3O7MA 3QENA 1C1YA 5DSZA 4OLJA 3VDXA 3VGJA 3VPDA 2EDCA 4LGMA 2GYVA 1MFPA 3BILA 4L7VA 4B2PA 1A5BB 1NHGA 5LP1A 5JE8A 2N42A 1M1NB 3UKDA 5CLJA 4GUDA 3NIWA 5CGQB 5ADWA 1UMBB 4TL6A 3IUJA 1Z5ZA 1GUYA 4UTRA 1MDBA 4AYXA 4L9WA 3OJWA 5IK2A 5KWJA 3EE6A 2J3QA 3HDYA 1XU9A 2VJMA 1N4AA 1HETA 4BPRA 5KMGA 4L9SA 4MR7B 3WGIA 3PJEA 3QVOA 2W6MA 1NBEA 1M8FA 2IGTA 4HH4A 1VPTA 3DV9A 1KHHA 1XTKA 3T7AA 1EM8A 1G5PA 5JFGA 1N2IA 2H54A 2Z6QA 4YMLA 1OFVA 5AI6A 2E5LB 4MRMB 3BMOB 2DETA 2IY7A 3A6JA 2Q7DA 5B1SA 2JEZA 2YUIA 1HGXA 4H31A 3HCBA 1E3DA 5I9IA 3EZLA 1RIFA 4YAUA 1GZVA 1ETUA 3VU3A 4J3JA 4JXJA 2ZBQA 4N0QA 4ZDWA 5A9TA 2B2NA 2RIRA 4B4WA 3UHPA 1DKRA 2FKAA 4GLBA 2I0FA 3OZCA 1NSYA 2Z2JA 4B6QA 2CCJA 1A2BA 3NG1A 4CV3A 2IX3A 5GZ1A 4WL0A 2HBRA 2BC9A 3ON5A 2GEFA 4V2IA 1E5DA 2SCUB 4M1ZA 5LA6A 4EUHA 3GDWA 3K70C 2RE8A 1H6AA 4O33A 5B12A 1BYUA 1Z37A 2GNAA 2HK6A 2W8BA 3CJTA 1NMZA 4M99A 4XD2A 1TKAA 5U4QA 5B2ZA 3WBBA 2O1EA 1MENA 2AEJA 4YALA 4HGYA 2JG3A 4Q12A 3WKBA 1RFLA 2X13A 2OCKA 2FZGA 2VYVD 5DX0A 3U26A 3BZUA 2WQ6A 2FX3A 2WWXA 4PZLA 4Q7JB 2JD1A 1O6ZA 5CVTA 4MDEA 4Y2TA 1AK9A 4NCJA 3RYFA 1K06A 4UASA 4P86A 2E85A 2OHGA 5E2AA 4DV3B 1F5SA 1JQ5A 1LDNA 2Q0QA 4H7EA 1KPIA 3BIWA 3CZ4A 1KI9A 2G6TA 5H80A 3OOEA 1H0RA 1HKUA 3N0VA 3OLZA 5DM0A 1M7BA 3U9SA 2PQ6A 1GT91 1KO5A 4EI7A 3VNAA 5HZMA 2HT6A 2C1ZA 3I5XA 2EZUA 1CG6A 2I29A 1L1FA 1CUDA 3UWMA 1DZIA 1JU3A 1AG9A 2YJ3A 2QTVA 3RS8A 3RNOA 1TCCA 2HGSA 4G63A 5F5XA 1X6VA 1UK8A 4CTMA 1W85B 1H2WA 1XZEA 1TL7C 2GARA 2YJNA 3NCHA 4OQFA 4U7TB 1I4EB 3QUBA 4AWXA 2W70A 1QVZA 3HXTA 1MABB 1PVOA 1SVLA 2WJ3A 2YDXA 4IJMA 2CLHB 1A2QA 3HVIA 3M7IA 1XQVA 3ADPA 3NUQA 5BW6B 3RGWS 1PGQA 1E2NA 4MCAA 3I5MA 3KZCA 3O8DA 1HYGA 4D9NA 3DL2A 4EOGA 1HTWA 3RU3A 1H93A 4PZ0A 1VMIA 2JLCA 1A5SB 1G5RA 2IVFA 2ZQYA 2PX5A 4S2UA 3MAJA 3NU1A 3DBRB 1ISGA 1NMXA 1QCCA 2PX8A 2MR5A 3EZ2A 1A0OA 4MEJA 4JBWA 1KAOA 4X9XA 5CX1A 3BULA 2ZVDA 3FPAA 1JDJA 4MW4A 4TTPA 1D0IA 5EWMA 2CBZA 4UDNA 3L8MA 2JJ8A 2X1VA 1H42A 3PDIA 4Q1AA 5AKZA 5DV9A 3RLFA 1NBAA 4BFWA 3HV0A 3SE7A 3HZRA 3MIZA 8ADHA 2D1RA 4C1NA 1GA6A 3QJYA 3V8QA 1GG9A 1SBNE 1GVNB 1ICEA 4YY3B 1AKTA 1YVDA 4G1UC 3TFOA 2WJWA 3R7NA 2R5WA 1TU4A 3IHTA 2EAUA 3DZGA 1R0XA 5LR6A 1WL8A 3C3JA 4IF6A 4IFTA 1Z47A 4BBPA 1KWGA 4W9MC 2OHJA 1PNTA 5JJBA 4PSVA 1RWWA 2AC4A 1L7PA 3DBHA 3HR4A 4LGCA 4Z7JA 4P0PB 1ISIA 1UJMA 1JR4A 4IOKA 2QROA 4HNAB 1NPDA 4ZQIA 2FFAA 1ORTA 1IZZA 1H2AS 2WAAA 1Y1LA 4YQYA 4WGFA 5AJWA 4AF7A 3D7MA 3MBOA 1MVLA 1QBGA 3AFHA 3EW7A 3WIEA 4N40A 4EBBA 2ADFA 3DKIA 1SB9A 1U5AA 3DZHA 4H16A 2O1XA 3RSOA 4ZGGA 1AOXA 1D04A 1KYVA 4UDOA 3OE7D 1NJSA 4FZ5A 3CWQA 2EFGA 4H9GA 3JWIA 4U2GA 1XVIA 2O5RA 1GAWA 2WICA 1P4JA 2XBLA 5AHOA 1JDUA 2Q5IA 1ODKA 3GD7A 4EY8A 2VCHA 4S35A 5EMNA 1XTRA 4E21A 2FDXA 4TLAA 3L04A 4MPTA 4ZCMA 1WCV1 4PIVA 1CTQA 3KJEA 3NX4A 4WK6A 2FPIB 2FPXA 2G4LA 3EQ7A 4ILEA 5FPQA 3EARA 4M9CA 3AB7A 3D7KA 4OKNA 3T9FA 2C59A 5BO5A 3PQ6A 2AJDA 2QN6A 2VHYA 4OI4A 4UFPA 1QGAA 1RXVA 4EHAA 5L6MB 2UXBB 2Y1FA 2HMVA 4AJNA 3U6BA 2XGMA 3PFNA 2YIDA 4BNKA 4YRBA 1AHIA 4DNQA 4CU2A 1KOLA 1DFIA 3GHYA 3KFLA 1EX9A 5FI1B 1E66A 4HFJA 3HVHA 1AUOA 3R5TA 1N2CB 2QTHA 4EPRA 1OAOA 2PBZA 4JROA 5DK6A 1GTG1 2FN8A 1TFRA 4QYTA 3BGDA 4PANA 3KETA 4WLEA 2GPTA 3NDIA 4GGPA 5AXDA 3AY0A 4K9OA 4PBSA 5LN1A 3G9TA 3H18A 4N5IX 2O3TA 4AO8A 3ZXSA 1RJ9B 5I7UA 5CA0B 5IM4A 4L8LA 4MV3A 4AXBA 2G88A 3RQSA 2G04A 1P5JA 3KDAA 4GOOD 4E5MA 2G80A 3A9RA 5EP3A 2FP4B 1AVTA 1K4KA 2OO5C 5AKEA 5KTPA 2F55A 2WIGA 3FWZA 1JSZA 5IUNC 5ERGB 2IXAA 1USVA 1F2VA 5CIWA 1J20A 1G5HA 2PBFA 3STVA 2VEOA 4FYVA 3WQQA 4BC1A 1P17A 1SU7A 3ZHOA 3UUEA 3W4JA 2OR3A 4R8LA 1VSQA 1CUXA 5C1IA 1LJ8A 3VAYA 5HGXA 2AZXA 1DVRA 5LM3A 2W0MA 1GZ3A 3C5CA 4HGNA 2QMQA 3NZEA 5KYYB 1XTTA 3RKRA 3KKNA 1V3TA 1L1RA 3AF5A 2Z6VA 1ECFA 2IA5A 3T5BA 4CEIA 2GBIA 2WUFA 3A1WA 4WVFA 2IV3A 1VMEA 1D3AA 3F0TA 3NQ41 1P0QA 4NHOA 1G5IA 1V1RA 2NZJA 4N5MA 5A9RA 1E0SA 5C4MA 4MQ6A 4KXNA 4IJQA 3OQHA 1GGHA 5FHRA 3BMQB 3BZWA 2Z1NA 2KHZA 2QM7A 2ONCA 5TVGA 5HQTA 3WWYA 1NF8A 1Q7RA 3HXKA 1QLJA 5F12A 4ZVNA 3OZBA 2QRJA 2OV4A 3DDWA 3FPLA 2ONJA 5LD2C 4QYMA 1A96A 1LU9A 1XRPA 3LZCA 2X0JA 2FUKA 3OQNA 2H1OA 1WB4A 4PNHA 3U0VA 1KAGA 4E08A 1SC3A 2LTAA 3EFOB 3GFRA 5LQSA 1XN4A 4YRAA 3H4VA 5BV8A 1TQ8A 2I4IA 3HU5A 4X97A 2ATXA 1I6MA 4EJ6A 5DHRA 3VPFA 1QH8A 3K6KA 3WR5A 2C2HA 3H5IA 4PHFA 3X1DA 4QUEA 4BNDA 1SJ9A 2MJLA 4K2AA 5FNZA 4YJ3B 3HBLA 1DAPA 3F74A 4WUVA 2MSEB 2EL7A 1ZI6A 4KXFB 1VLQA 4TTRA 4AS3A 3CVYA 4AMGA 1B00A 5DPMA 3N6RA 1Z07A 4QULA 2QT0A 1B41A 2RAVA 1P74A 2JFXA 2V7QD 4MLDA 1JHYA 4V0QA 3FPSA 1SFRA 3ZCXA 1MO3A 1IN7A 1ZISA 1E7YA 1T8TA 3BC1A 2I8CA 3KK0A 1OZAA 2QG6A 4RIIA 5I5GA 5CA0F 4RSRA 5IAKA 5IDQA 2HF2A 5KOIA 1YJ8A 1A4UA 1G41A 4TYYA 4EITA 1Y7TA 2Q3MA 3P9KA 4CDGA 4B40A 3FBWA 5JS7A 2H17A 1YJXA 2OCIA 4URZR 1BGXT 1VSUA 2HA4A 1UANA 2JFWA 3H75A 1W4CA 5JXJA 5DRYA 4ZOLB 3TSCA 3LUGA 4BVEA 1KJYA 1YFZA 3SCZA 1XRQA 1K68A 4J6EA 4GVLA 5GONA 4D56A 3NDBB 1Y6RA 2AK3A 3NNNA 3WOVA 3H2BA 2VP2A 3K96A 4L85A 4MXDA 5B3LA 2BTEA 1HOXA 3O8OB 1QFZA 2GKGA 1V25A 4J7CA 5EE0A 1BXGA 3LDUA 4U2KA 4M1KA 1ZNXA 2BUBA 2Y05A 1HE1C 4JUDX 3R9KA 1PJ8A 2QRMA 3L7CA 1QHHA 3ROGA 1O5TA 2NNLD 4RQBA 5JSYA 4DRXA 3GT3A 4QM6A 3WMWA 1PUIA 3UXEA 2Z8YA 4UTVA 1LNQA 5CNKA 4AY2A 1ZCFA 4CLHA 1BW9A 1GEEA 4J3FA 4IY1A 3H0KA 4ZO4A 1K63A 4PWZA 5JARA 4WN3A 1N92A 2RC5A 1BVUA 3D6TB 1B93A 1DRVA 3DP7A 3FDIA 3KB8A 1VLZA 3CLUC 1C4XA 1QSGA 3CMCO 3IVRA 3LHDA 3EPPA 3R5FA 4JL6A 5HDQA 3S7ZA 3OH8A 1PJ4A 3V8VA 1FDTA 5B3AA 5CXQA 3L4JA 3B8EA 4D9BA 2OXCA 4PZUA 4JGBA 4K2HA 1O4WA 3FCEA 1JH9A 1OTYA 1Z2EA 3EFEA 1QWOA 2WKPA 1MO6A 5GWXA 1OI4A 2FW6A 3QOWA 3FVQA 4PS1A 4IQ0A 3TVDA 2OD9A 3FTFA 4MGEA 4GXTA 3AO0B 4OBBA 3TRHA 2O06A 2QSZA 5I45A 1RCFA 2PZBA 4FK8A 4JOSA 3UENA 4YJ3F 5JD4A 2V7WA 1E6EA 4DDVA 3Q8XB 1IAQA 3LWDA 4Y2VA 5K05A 3ISJA 2J9FB 3WNCA 5IKOA 4Q18A 2XWQA 3NEYA 3VA7A 2H2DA 1SQSA 3D4LA 1IK6A 4N4AA 3NDJA 1IIBA 3DVRX 1WBJB 3STTA 5BNTA 2HIGA 2R7NA 3PA8A 1TECE 4M1TA 4EMBA 1XL0A 2VI5A 5DGIA 1NQWA 3LDGA 3T9CA 4C7KA 5DP2A 2QP9X 1SG6A 2WPDA 4CIWA 3WFZA 3PJGA 1R10A 2IUTA 2WRZA 4J0GA 2I7VA 3DZJA 5J43A 4ZOLF 3HL0A 3CIOA 3TMKA 1T0HB 4KMRA 3Q3EA 1KY3A 1UEJA 1JWBB 2GD1O 2W2QA 4CKEB 1E9AA 2GUGA 1DBRA 2AOUA 3H2HA 4OOFA 3FW1A 4RABA 2Q6LA 1WMAA 3KOYA 1E2FA 4A03A 2TECE 1QX4A 5TDHA 4E14A 2W4IA 1UKYA 3O92A 4IWXA 2VRWA 5EPUA 5C5IA 5KYWB 4HBZA 4C2TA 1R5BA 3FMFA 3ND8A 3FMIA 4I36A 4GOXA 1T43A 1JSLA 3PQEA 4JI3B 2IHBA 5EQJB 3TFQA 1T0IA 3KZKA 3LRTA 4I08A 4IQFA 1X7XA 1VA4A 4DXAA 3SM3A 3STYA 4EJ0A 4NFSA 1LC0A 1I01A 1IY9A 3RREA 2I4RA 1GKLA 3IBCA 4IJWA 1A97A 5SY9A 5TPWB 3KSRA 2M6SA 3GCDA 3U9TA 1T9BA 2K2QB 3C3WA 3CLKA 3G8YA 3PEEA 2RB4A 4MITA 1TJ4A 4WAUA 5HOEA 1GT6A 2GX6A 2ORYA 3QVJA 4PX5A 1MTZA 3QNWA 1G6OA 2Q8NA 5LB4A 1JQDA 2IYYA 1SZPA 2DRIA 4MWZA 4QFDA 1Q2XA 2H1LA 1FFHA 4GDFA 2XT6A 4WZAE 3OKCA 1KSGA 4C4YA 5IC4A 5CEFA 3HY3A 5HFAA 4PTLA 1SXQA 4GP7A 4HQNA 2XVYA 2PX4A 2QI9F 1UOPA 4M0KA 3FI9A 2GPSA 3QBEA 1QNLA 3KOXA 2J32A 4FHCA 3WLEA 2B20A 3QJ5A 1HNWB 3RC8A 1L7XA 3BD6A 4HQLA 4EZEA 4D9MA 2H06A 3AETA 4HYTA 1BA3A 6REQB 2ZYHA 3OOHA 2E21A 1X8XA 5AUNB 2FMXA 5IG2A 4OHVA 3DSRA 1T6YA 4NG5A 3DFIA 3CTPA 4BNIA 4S12A 4U39A 2YS7A 4HVTA 1DEXA 4E6EA 4ESOA 3U4QA 4JBIA 5HHTA 4A5SA 2YJ6A 3ZLTA 3BTSA 3KLMX 4WLFA 5TQ2A 5IASA 3AKYA 3ASUA 2P6UA 3QFSA 1RKVA 4H60A 4HWGA 3ZWPA 4D5EA 4ZIRB 1ADFA 2NN3C 3CLTC 2AFHB 4RDHA 5JBQA 3CNHA 4WACA 1EHCA 4AN1A 1B0AA 2H5IA 4LSWA 1DKNA 4GEKA 5CB8A 2IXGA 3CZMA 2QVLA 3T7JA 4ZCIA 2JGIA 1JEQB 3BGWA 2F17A 4G0ZA 4M6WB 1TYAE 4B6PA 3GGCA 4L15A 1RRCA 2OORA 3EVNA 5LDDC 1ULUA 3PFKA 3E53A 3DAYA 4Z0TA 5JQGB 1TVMA 3Q2KA 4OREX 2RCNA 1Z4PX 4ZTBA 4X41A 4W99A 1UC5B 3LZDA 4CKWB 3UB3A 1WOYA 4M7PA 3WC4A 5JJLA 1LDMA 1N6LA 4D44A 1UINA 3FYUC 3R9IA 1A77A 1MN6A 4BMXA 1IZ7A 2AXQA 2B25A 3HP7A 1NW3A 2W2KB 1GRNA 1PJLA 1R0WA 3PV0A 4QNMA 5G4LA 3E9CA 5IUKC 3R77A 2ZJ5A 3PUJA 5ILQA 1U8TA 2XMRA 4CT4B 1PFGA 1KNXA 1AGPA 1Z7WA 1RPNA 2HQOA 3Q1LA 2EKZA 2MYUA 3MINB 2Q6VA 4F45A 1W0CA 4MTCA 5BN3B 4AJ1A 1UPTA 1YONA 2VUTA 5A62A 1J0EA 3E7XA 2FG5A 3I6MA 2W4MA 4KQCA 1JIVA 4OHBA 1GQOA 4YQZA 1MGPA 5FBHA 1D8TA 4LYHA 4EY5A